1GI8B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi8B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi8B01
4MNYA 2Y5GA 1YKTA 5LH8A 1N8OB 3NK8A 3ZVEA 2QC2A 4I8JA 2P8OB 2QAAA 2B9LA 3URDA 3RXQA 1UTLM 2PW8H 3DUXH 1PJPA 2OC0A 3KHVA 5FPYA 1RIWC 1TQ0B 3SUEA 3V12A 2AGGX 1OWHA 2PFEA 2Y5FA 3DA9B 2GD4B 5HXFA 5EU8A 1BHXF 1AVWA 1O3NA 3D49H 1GBIA 3QLPH 3EAJA 2RG3A 2PSYA 5FXLA 3SO3A 3VGCB 2BDCA 1O2OA 4AB8A 1QRXA 1PQ7A 1Y3XA 1ELTA 1TGSZ 1ARCA 1YCPK 1MCTA 1ARBA 3KEEA 3SJIA 3H7OA 1G37A 2H1UA 4ABEA 1OSSA 3G01A 1W12U 2FOCA 1DFPA 1E34B 1YM0A 3C1KA 1W2KH 4MQAA 5C5NA 3TK6A 2FS8A 4CBOA 1MAXA 2V3HH 2QY0B 3PTBA 2H5CA 6LPRA 4BTTB 2HVXA 7KMEH 1O33A 1W13U 4YESB 4B2CA 2FOAA 4I8LA 1W8BH 3I77A 1C5XB 5LPEA 1F0UA 3FAOA 2JKHA 1SGDE 2G52A 4JCNA 1NN6A 2TGPZ 2CF8H 2ZKSA 3BN9A 4JYUH 4AOQA 4ZKNU 2UUFB 2BZ6H 1GBAA 4FUCA 2K1QA 3T25A 4X8UH 5EQQA 1MBMA 1O3CA 1ESBA 1YPMH 2FXRA 1V2TT 1OWJA 1D9IA 2NU3E 4JYVH 5AFZH 1OWIA 1GWAA 3PTNA 1MTNC 1O3IA 2CMYA 4AG2A 2PTCE 1LO6A 2BYAX 3GCHC 3SJ9A 3T26A 4NG9H 4ISOA 1TMTH 1LHDH 2XBWA 1O3KA 2ZHDA 1O36A 3EQ0H 3SU5A 2ZTZA 2BB4A 1AO5A 4KP0A 1OP8A 5JBAS 1GGDC 1WU1A 2J34A 4OS7A 4NWKA 3SOSA 1UTMA 1UMAH 3OTJE 3A7TA 2BD8A 4Y0YE 4ABDA 1ANEA 2XNIA 4TPIZ 3GDUA 2QXGA 1FN8A 2FOMB 4X8TH 1N6YA 3MH7A 1TE0A 3GY5A 1YLDA 1HV7A 1V2LT 3OX7U 3GCOA 1A0JA 1A2CH 4XOJA 2BD3A 3TGKE 1DSTA 4IW4E 1LVBA 5PTPA 2THFB 5EOKA 1EAUA 2FYQA 3Q3KA 3GDVA 4HTCH 5C1YA 1DWCH 2B0FA 1H9IE 3FP7E 2ANYA 4X1SU 2WPKS 3BTGE 1GJ5H 3MU1A 4I7YH 1O5AB 1GBFA 1J9CH 1KXFA 1Y5AT 2Z9GA 4E7RG 2BDIA 1SR5C 1C2MA 1RTLA 1H9HE 2ZCHP 2A2XH 1GMHG 3GCTF 1AN1E 1UVUH 2FIRH 4K60A 4NA7A 1F92A 5ABWA 5GPIB 2VIVA 2ANMH 3VXEH 2OC7A 1WQVH 4UE7H 1TPOA 5JYIA 2Z3CA 4J1YA 1PYTC 3SJ8A 1G36A 3P6ZB 5F6MA 3NPSA 3GDSA 1WCZA 2C8YB 5E0JA 4UEHH 4B74A 2FODA 1QGFA 4GCHG 1DM4B 4GHQA 6CHAB 5E2OA 4TYDA 1ZRBA 3LDXH 2FOFA 3BF6H 4NSYA 5T3HA 1E35B 1IHSH 1QJ1B 4DJZB 4ZKSU 1JWTA 1WOFA 2EI8A 3AASA 1P05A 4K3JA 2PR3A 1LPKB 1SL3A 1DLKB 1QBNA 1CE5A 1UTNA 1MBQA 1Y3YA 1HNEE 4DT7B 5K7RA 2ZIQH 1P01A 1ELGA 2H2ZA 3RXMA 1J16A 1ETRH 3FVFB 3RXIA 1J17T 3A7WA 2ZTXA 3OYPA 2NU1E 2RA3A 4A5TS 2R2MB 2VGCB 2ZU1A 3EA7A 1SVPA 4MVNA 1W11U 1HJ8A 5C5OA 1O2IA 3RXBA 3HGPA 1B0EA 1KYNA 1MUEB 1SBWA 1YPHE 3RXFA 3QN7A 3TH4H 3PO1C 1O5FH 1DY8A 1QL8A 3NXPA 3RMOH 2A45B 1DXPA 4BXWA 1QY6A 1EAXA 1KXBA 1OKXA 1SOZA 1N1LA 1GDNA 1OP0A 1XUFA 1A4WH 4JZ1A 3MU4A 1TOMH 4ABBA 4DOQA 1WTHD 2GP9B 4BAOB 2ZHEH 1JIRA 2BQ7B 1CQQA 3N7OA 1TMBH 1T4UH 1U6QA 4NWLA 1K1PA 1UVPA 4JMYA 1NU7B 3T5FH 3NKKA 1O3AA 3PLKA 4WMDA 3VB3A 1V2PT 1CO7E 1PPGE 2ZEBA 2ZGBH 2ZPQA 1O2XA 1XKAC 2PUQH 5E0HA 3MU5A 2Y82A 3MNBA 4U2WA 5GDSH 1DXWA 1WQSA 1C5WB 1GI5A 5C1UA 1YPHC 3K6ZA 2A4RA 1O5CB 3P70B 3MNSA 3UQOA 2AMDA 3AVZA 1BMMH 3R3GB 1C2EA 2OUAA 1OPHB 3PYHA 1HJAB 2ZHQH 1O2KA 5EXLA 3IG6B 3LJOA 3F9FA 1TPPA 1IQKA 2XBYA 1C5NH 1FUJA 1E0FD 3ZVCA 1L0ZA 1JMOH 1O30A 2RDLA 3RC4A 3M61U 1JIMA 1GJAB 1XUGA 3ZV9A 1TA2A 1GG6B 2KAIB 2A31A 3A87A 3RU4T 2O8TA 2VH0A 2O9QA 3C27B 5EXMA 1ANDA 1GBJA 1V6DA 3H7TA 2BDAA 5FX6A 1SC8U 1HIAB 1RRKA 1AFQB 3M7TA 4E06H 1TRYA 4YOIA 4X0WU 1F5RA 1S83A 1C2JA 4CRFA 4INHA 5EGMA 3LGYA 1NU9A 1OXGA 2ANKH 1ANCA 2J2UA 4DIHH 1GHWH 1GMDF 1MKWH 2GT8A 4FU9A 3O8BA 4OS5A 1NFXA 3KQBA 1DE7H 1UCYE 1EUFA 3A88A 2G5VA 4X1RU 5GIBA 3RMNH 5CHAB 3ZZ9A 2D26C 2BOKA 4ABFA 1W0ZU 4AFSA 2CHAC 3A80A 3PLPA 1TGCA 3KQEA 2G81E 1UO6A 2ZHWH 1HAZB 4CRCA 2Z9LA 3NCLA 1A0HB 1Z1IA 3V13A 2ZFPH 5LPRA 1Y5UT 4JYTA 3SU2A 3OY6U 1C1UH 2SGFE 4MPXA 3A8AA 3UIRA 1XMNB 1HBTH 4ZHAA 5JB8S 1PQAA 3A89A 2ODQA 4IGDA 4QT8C 4WWYA 4NZQA 1SGPE 1C2KA 3LGWA 4X6NA 2FESH 1O2MA 4WH6A 5JBTA 1AVXA 1Y3WA 1BRAA 1EJMA 2ZGCA 3FANA 2FTMA 4O03A 4DVAU 4GSOA 1CGHA 1O3OA 1QURH 2ZNKH 4WMFA 2BD9A 3M35A 2C8XB 2AMPA 1ZSLA 1GBTA 2GDEH 3DD2H 4KTCA 1LVOA 4MPVA 2CXVA 2Z9IA 1Y8TA 3VPKA 4MDSA 1MU6B 1ZHRA 4CRAA 3MU8A 2BVSH 2ZG0H 1FV9A 1SGFG 2W7SA 1W0YH 3RXCA 5E8EH 3LH3A 5J4SA 1NC6A 2FM2A 1UVSH 4B1TA 1VZQH 2V6NA 4FU8A 1AQ7A 3U98H 1XUIA 2HWLB 2TGDA 3RXTA 2QF0A 4OGXA 1MTNB 1FI8A 1GJ4H 1G3CA 3KL6A 3GCHB 1W7GH 1ESAA 1T32A 2TGAA 1TBZH 1P12E 1AWFH 4AFUA 2KAIA 1ELDE 2Z6BD 1BTYA 4JZIA 2EEKA 1P03A 2ZGXH 4GHTA 2F9PA 3LGTA 1NROH 2QGRA 2ZGHA 2B7DH 3TGIE 1P2IA 1ZMJA 5A0BA 1QR3E 5DK1A 4B2AA 3OY5U 1KXDA 3LGUA 2PKSC 1H4WA 1Z1JA 1D3PB 3F9HA 3M5OA 3SNBA 1GI1A 2P3UB 4Y10E 3BTHE 2VJ1A 1AIXH 1O3BA 2VIOA 1SLXB 1FPCH 3GYLB 5H4IB 3BTWE 1TNLA 4NFFA 2ZFQH 1EPTA 1M9UA 3UNQA 3UY9A 2PTNA 3RXDA 1UTKA 3QUMP 1RTFB 1EOJA 1C5MD 1HCGA 3CP7A 3A84A 1S0QA 5HYOA 1E38B 1CGIE 1C1VH 5TJXA 1ZSKA 3GYMA 1C5ZB 1VCWA 1AUTC 3A82A 1C1MA 2AIPA 2OBQA 2CGAA 1WSSH 4UFFH 3SV6A 1B5GH 5JPMH 1LPGB 4WJG2 2BM2A 1DWEH 1P0SH 2RCEA 1CBWC 1O3DA 2BVXH 2BXTH 1AU8A 4UD9H 4JZFH 3GICB 2IJOB 5F03A 2FWWA 3P17H 3HATH 3TVJB 1MQ5A 2JH6D 3MU0A 1XUHA 3STJA 1ZPBA 2BQWB 3P8GA 2OLGA 3GCNA 2SNWA 1W3CA 4R8TB 1EOLA 4ZXYH 1Z8GA 2Q6GA 2BLQA 4R0IA 1MQ6A 2WYGA 4O9VA 4YOJA 2DE8A 2XC0A 3NZIA 4CBNA 1K9OE 3DFJA 3I29A 2XW9A 1CHOF 5EPNA 2BDGA 1YLCA 1FXYA 1H8IH 1GI7B 1CT2E 3KN2A 2B5TB 3V0XA 5B6OA 1PPEE 2ZWLH 1YPJH 1CHGA 1J14A 2FOEA 1A46H 2WYJA 1C5UA 2QCYA 1AY6H 4NA9H 1GJ9B 2HOBA 5E0GA 3SV8A 4K8YA 4PROA 1EZSC 3HK3B 4MNXA 2VINA 1GL1A 1Z7KA 3U8OH 1YP9A 2ZF0H 2PKAB 1ZSJA 2OBOA 5HM9A 1QBOA 1AVGH 4Q7ZA 1PQ5A 1BDAA 2VH6A 3FZZA 4ZHLU 1SFQB 2OQUA 1VR1H 1PFXC 1RFNA 1LQDB 2AMQA 1HYLA 4OS1A 1O0DH 1YCPH 3BG4C 1V2WT 4X2WA 1O3LA 4Y6DA 5T6DA 4ZUHA 1T8NA 1L4DA 1P2OA 3SU4A 1HAOH 2BHGA 2IN2A 2ZC9H 2W7UA 5JDUB 2ESTE 2BZAA 2F91A 4XSKU 3O8RA 4KTSA 1W10U 5AFYH 3ZZ8A 1FY8E 3RXEA 1ABJH 1ACBE 1IQEA 1NRQH 3BG8A 1IQMA 1LHCH 2F9VA 5JBCS 1O2PA 1BQYA 2R0LA 1BTWA 1CGJE 2A5AA 4B76A 1TPSA 4GLYA 5TCCA 1P3CA 5FBIA 3RLWH 1ZTJA 1AGJA 1GI0A 3E6PH 1ZYOA 2C90B 2OCVB 2TIOA 3QTOH 4YT6H 2YNBA 1AFEH 1NESE 3ODFA 2A4QA 2AH4X 2STBE 2QYIA 3UR9A 3ZZ4A 3M5MA 1FJSA 2G51A 1SSXA 1E37B 2D1JA 2BY8X 1A61H 1XUKA 1TNKA 1FPHH 2LPRA 1ZHMA 1ID5H 3E91A 1GVKB 4MLFB 5ESTE 3TU7H 2TPIZ 1BRUP 3F1SB 1DDJA 1EB2A 1WYKA 4MPUA 1O3JA 3RMLH 2P59A 1JRSA 1F0RA 5IYTA 1Y5BT 2VVUA 3TJOA 3SBKA 3TPIZ 2NU4E 3BEUA 2Y81A 1L1JA 4Y11E 3ZZDA 2XWBI 2G00A 1EZUC 4HGCA 5GJ4B 1HFDA 3ZVAA 1YCPM 2OTVA 2A0QB 4X6MA 5CMXH 3ODDA 1P10A 5FBEA 5C1XA 1C2HA 2O8WA 2A4GA 3VB7A 2WPIS 3A7XA 1Y3VA 2PV9B 2Q1JA 1NT1A 1ESTA 1EXFA 1G3BA 1Y59T 2HLCA 1LHFH 4MNWA 3TK9A 1SLUB 3PM3A 1Y3UA 2VVVA 3RXHA 4BOHA 3EYDA 1KLJH 3LH1A 3TGJE 3RP2A 3S9BA 1GPZA 3VXFH 5K0HA 4I32A 1FLEE 2W3IA 1P09A 2PKAA 6ESTA 2UWOA 4BAQB 1AMHA 3UWIA 1BBRK 4B2BA 3M3SA 5C20A 4CHAC 1O37A 5DP7A 1GBMA 4X6PA 1LVMA 1O39A 2AEIH 1EZQA 2P93A 1K28D 4NIYA 1K21H 3HKIB 1V3XA 1K1MA 2UUKB 1YPGH 2BX4A 2GMTC 1ZJDA 4DW2U 1GDUA 1TWXB 1AB9B 1NFYA 2GZ7A 1GBBA 1KIGH 1L1NA 1V2UT 2W3KA 3LU9B 2SGQE 3RM2H 1AZ8A 1F0TA 5F8XA 5DGJA 3RXVA 4F4OC 3ZVDA 4NSVA 5ETXA 3GOVB 1HB0B 1GI4A 4LOYH 2P95A 1VCPA 1ZPCA 1C9TA 1YYY1 1BCUH 1C1TA 4ZROA 3TLOA 1C5OH 3PLBA 1VGCC 4SGBE 3CS7A 3V3MA 2J95A 4WY3A 4YLQH 1Q31A 3Q00A 1W7XH 3SUFA 4HFPB 1VITG 1ZMNA 3LGIA 4ISIH 4IN1A 4UONA 3LT3A 4ZKRU 1OYQA 4M7GA 1GJDB 3QGNB 4KELA 5JB9S 4ABIA 3LC3A 4FUJA 1C2DA 7GCHG 1A5HA 1FY3A 3DHKH 1T31A 4TY6A 1C5PA 3T2NA 4Y71A 1V2RT 2FTLE 1A5GH 1NFUA 3Q3XA 1GBDA 2NWNA 1PPBH 5A8ZA 3P8FA 4Q80A 1O5GH 1XKBC 2PKSB 3B8JA 4ISNA 1KLIH 1EKBB 3RXAA 3TH2H 1HJ9A 3ZZCA 5C3NA 2BY7X 5EQSA 2HPQH 3VB4A 1KY9A 4XBBA 1SGFA 5A0CA 4AB9A 1JOUB 3M3TA 3ZVGA 1HGTH 4B71A 4D76A 1P2NA 4YT7H 5F8TA 1EP6A 1P3EA 1T8OA 3U8TH 4JZEH 1HXEH 1VJAU 4DIIH 2GV6A 3TJNA 1P2MA 4Y8XA 2H6MA 1DLEA 4IMQA 4A7IB 1ZHPA 3QTVH 4JZDH 3E16B 2C8ZB 3QZRA 1ELFA 3VB6A 1P2JA 1Z8IB 1L4ZA 1GBEA 1V2VT 1GCTC 4AG1A 1O3MA 1TPAE 1C5RA 4YTAA 1UJ1A 2VWMA 4NCYA 1C5TA 1FAKH 3FP6E 2NU2E 2SGPE 1MD7A 2PWXA 2G5NA 5FX5A 3LGVA 4GUXA 3MFJA 2QA9E 2Y6TA 1HAHH 2P8OC 2ZU5A 2G4UA 3OSYA 2J4IA 1PPZA 3GY4A 3LONA 4X2YA 2GDDA 4Y8YA 1L2EA 1GHXH 1MKXK 2BOHB 5DP6A 2CV3A 4MNVA 5BPEA 3W95A 1PPCE 4AGKA 3U9AH 1GHVH 2FI3E 1A0LA 3BTFE 1BMAA 4SGAE 3ESTA 3RUOA 3TNSA 2PSXA 1GMHF 3Q77A 1WAYB 4I8HA 1GDQA 4LZ4B 1MAYA 5L2YH 2BLVA 4ISLA 1QCPA 2W5EA 1EX3A 4Y76A 4Y0ZE 4AN7A 1GI9B 1MMJN 1Z8JB 2ULLA 1BRCE 3SQEE 2WPMS 1KDQB 1LQEA 1LHGH 1ZR0A 3A85A 3AAVA 1HUTH 1H1BA 4X8SH 1C1WH 3O8DA 1HPGA 1EB1H 2GCTB 4O97A 2BDHA 4GCHF 3W94A 1YPKH 1EJNA 2QXJA 4U30A 1O2ZA 1QIXB 8KME2 4Q7YA 5FPSA 2SGAA 2Z9KA 1MH0A 2A1DB 4YM9A 2Z3EA 1C5LH 2XC4A 3VEQB 2ZCKP 1S6HA 1CVWH 2ILNA 3SI3H 3T27A 4AFZA 4AYYB 1RIWB 5EPYA 2AERH 1AI8H 1NRRH 1C1PA 1F5LA 3EA8A 3VB5A 1DS2E 3RXOA 1SQAA 1TMUH 2UUYA 2V3OH 3SV7A 4Y8ZA 3F6UH 2GZ9A 2V0BA 5HGGA 3A81A 4B73A 1A1RA 1CT0E 1UK3A 4ZAEA 3S69A 1G3DA 2BD5A 3SUDA 1O5BB 3TNTA 1F5KU 2FLRH 4FUBA 1L1GA 1EAWA 2SGEE 4XDEA 1O3PB 2GZ8A 3LJJA 1D6RA 4RKJB 3TH3H 2J94A 1E36B 1YC0A 1G30B 2Q6FA 1XVOA 4X1PU 3B23B 1MD8A 2P16A 1A7SA 2FPZA 4FUIA 3MMGA 1MKWK 7LPRA 3BSQA 2C8WB 3A7VA 2OC8A 2ZGJA 1GHBG 1KXAA 1TONA 1DITH 2OD3B 4U32A 1KXEA 1UTPA 2FOGA 4WXVA 3ZVFA 1O31A 1W14U 1DANH 1AUJA 1PQ8A 3MH5A 3PB1E 4NIWA 3U69H 1CSOE 1NPMA 1AE5A 2XCFA 1JRTA 5E2PA 1O2QA 1FIWA 1ZJKA 1QRWA 1IQFA 2FEQH 5F8ZA 1FY4A 1GJ6A 4HI3A 2BY6X 4THNH 2A7CA 2BLOA 1SGTA 5AHGH 1QJ6B 1TYNA 1NY22 1P8VC 2A5IA 1O2GH 1QA0A 3F9EA 1HAIH 3SNDA 1T8LA 2DE9A 5EODA 3RMMH 3MYWA 9ESTA 1AZZA 3ZV8A 1GHZA 1BUIA 1YPLH 3PV4A 4KKDA 2XRCA 5JBBS 2Q6DA 1HAGE 2F3CE 2GGVB 1GGDB 1C9PA 1P9SA 2GCHG 1C2IA 1TLDA 3QK1A 4A1XA 1P57B 1TAWA 3QO6A 2TRMA 1TNIA 1C4U2 1HIAA 2ZDNA 3MNXA 2BVRH 3GY6A 3E1XB 1TIOA 1HAYB 2O8MA 3ZYDA 4UFEH 6CHAC 3BTQE 3F68H 1O2HA 1UHBB 1GBLA 2SGDE 3RM0H 1NZQH 1IHTH 4AFQA 4INLA 1TABE 1K1LA 4WH8A 6GCHG 3A86A 1SGQE 3FZDA 4I8GA 4GAWA 2R9PA 3QGJA 1G3EA 2UWLA 4VGCC 1TQ7B 1AE8H 1BJUA 1NTPA 1UCYK 5DP4A 1FY5A 4CR9A 1QQUA 1P9UA 1T4VH 2ZFRH 4F49A 5BRRE 3FP8E 5EG4A 4H42U 3U8RH 1SFIA 5I25A 3TJVA 1TX6A 1GHAG 2QF3A 1GL0E 2VGCC 1TGNA 3AAUA 1FONA 1O38A 3SU6A 1DWDH 1J15A 4KGAA 2XTTB 4O3UA 2A4OA 1VJ9U 2JETC 4A1TA 2H5DA 4BNRA 1BT7A 1YGCH 3ENSB 1HDTH 1RGQA 1DSUA 4LZ1H 2VIPA 4MPWA 4OS2A 5C67A 4NIXA 3F9GA 1GHBF 2WV4A 3I78A 3ATIA 1NS3A 1ZRKA 3DT0H 1BA8B 1XUJA 2BD7A 3TJUA 3MOCA 4ZXXH 8ESTE 3LIWA 2FMJA 3KNXA 3ZYEA 1DOJA 1OWKA 1WBGB 2QXIA 4WMEA 2OP9A 4DY7B 3M36A 1HAPH 5A09A 3TIUA 4XBDA 1DUEA 5EXNA 5GWZA 3S7KB 4CH8B 4E7NA 1K2I1 2ODPA 5A8YA 2UUJB 1HJAC 2WPJS 3R0FA 3UPEA 1EZXC 1TBRH 3EA9A 3L33A 2HGTH 4ABHA 3UFAA 1Z71A 1LKAA 3SUGA 1EQ9A 1HAXB 1ZOMA 2BDYA 4IC6A 2BD4A 1SQTA 3S9CA 1D3QB 5EW2H 1ETTH 2HNTF 4H6SB 1MTUA 4X2VA 2G4TA 1GG6C 2CJIA 2G55A 1D3TB 3FFGA 1QNJA 2VWLA 3PO1B 4YZUA 1HAVB 1TRNA 2TGTA 3EGKH 4LK4A 4FUFA 2WUCA 1AFQC 1HXFH 1BBRE 1SLWB 5DO4H 3BTME 1G2LA 4UFGH 4Z6AH 2ZQ1A 1H9LB 3Q76A 3QDZB 4BTUB 4ASHA 2M5TA 4IC5A 2V35A 3MI4A 3M7QA 4CREA 5J4QA 6GCHF 1MTWA 4YO9A 1S85A 7ESTE 2I6SA 1EPTC 1ZMLA 3M5NA 1ZZZA 1GI2A 5A2MH 5CHAC 1GBHA 2P3FH 4DCDA 3ZZ6A 5DJ7A 2QV1A 1IQHA 3UR6A 1MZDA 3P92A 2A7JA 3KF2A 2W26A 3T29A 1IQNA 5CE1A 4ZHMU 3MHWU 3D23A 2H9HA 4XFQA 4K1TA 8LPRA 5DP9A 2HALA 3SNAA 1GHAF 1THSH 4AX9H 1BIOA 1O2SA 1GHYH 4TWWA 3U1JB 3EDXB 1C4V2 3D65E 1O2RA 1XVMA 3UREA 2ODYB 1OX1A 1AWHB 2F9OA 3GCTG 5DP3A 4DGJA 1C5SA 2XYAA 2ZTYA 3URCA 2BLWA 1QB6A 1GI3A 1P2KA 4B75A 1BTPA 3BEIB 4D7FA 1O5DH 2IPHA 2AYWA 2ZQ2A 3JZ1B 2BY9X 1QFKH 1TALA 1RD3B 2ZPSA 3ATLA 3OU0A 3KCGH 4UFDH 3ATMA 2A2QH 1C5YB 3MWIU 1IQLA 1IQGA 1O2VA 3A7YA 1K22H 5SGAE 2ZFTA 3E90B 2I6QA 2J9NA 1FZZA 4NFEA 2BY5X 3HKJB 1BBRH 1B0FA 5FHTA 1O32A 4BXSA 1LCYA 3PROA 3SJKA 3H5CB 1WTGH 2CHAB 2ZU3A 3SHCH 4ABAA 2JH5D 1SHHB 1GBCA 1OP2A 2VB0A 2BX3A 2WINI 2ZDVH 3SU1A 4AORA 1O3GA 1QQ4A 1GBKA 1A3BH 1V2ST 2H9TH 3E8LA 4CR5A 3MO3A 2C4FH 3RXKA 3DFLA 3M37A 1Z6EA 1ZGVA 1BB0B 4IN2A 1XM1A 2Y5HA 3SN8A 4ZKOU 1FAXA 4JK6A 1ETSH 1DUAA 3RLYH 3U1IB 3JZ2B 1HAVA 9LPRA 1DPOA 2PGBB 1V2QT 2R3YA 2VWNA 5I46H 3O8CA 4BAKB 1AKSB 3PMJA 4K2YA 1NRNH 1ZGIA 2R2WU 1MZAA 3MO6A 3MH6A 2ZU4A 1RJXB 1SGRE 1SHYA 4ZMAH 2LNCA 5GCHG 2ALVA 4GVUA 3S9AA 1GJ8B 1UVTH 2D2DA 1RS0A 3BTTE 2H9EH 5EW1H 5C2ZA 3KGPA 1S0RA 1O5EH 1S84A 2ZCLP 3A8DA 4X1NU 3B9FH 4U01A 3STIA 1D4PB 1BHXB 2FP7B 1THRH 5L30H 4Y7BA 3GY8A 4H4FA 1C1OA 2EA3A 5DPAA 1DT2A 1MU8B 4WF8A 2FZZA 1VITH 3UQVA 2J38A 1GVLA 4BAHB 3RU4E 5GXPA 1KTSB 3BTEE 4NA8A 1HRTH 4YOGA 1UK4A 1T8MA 5HMAA 3ZZAA 2AGIX 4I31A 1GCDA 2ZZUH 4INKA 2GV7A 4X8VH 3SGBE 2WUBA 2BXUH 3CS0A 3LPRA 3UNRA 4AGJA 2OC1A 2Z9JA 1BTXA 1O2UA 2GVFA 3BIVH 2O8UA 1G9IE 2B8OH 1FY1A 2AIQA 3L6PA 3E0PB 4WXIA 3SI4H 3A8CA 3T62A 1K1NA 4FUEA 4X1QU 3K65B 4XE4A 1UTOA 1C4Y2 3ZZ3A 1ZLRA 4O3TA 1GMDG 1GJCB 4ESTE 1V2OT 2F9UA 1QTFA 1CA0C 2XWAA 4VGCB 4CRBA 1RTKA 1SMFE 1G2MA 1AHTH 2FYRA 1S82A 2R0KA 5A8XA 1GI6A 2P3TB 1P2QA 2ZA5A 3PMHB 3SGAE 4WVPE 3M3VA 1K1IA 1MKXH 1A3EH 1LMWB 1CBWB 3TITA 4ABGA 2ZU2A 1K1JA 3HK6B 2EI7A 1DVAH 4IS5A 1IOEA 3UOUA 1RXPA 1TNHA 2JETB 5L6NH 3BV9B 4K69A 4AZ2B 3SNCA 2SFAA 1TFXA 5DP8A 3KIDU 1N8OC 3SNEA 1SGIB 3TK5A 3A7ZA 3ZVBA 4CRDA 1NFWA 1C1SA 2YNAA 3M5LA 1AKSA 2TBSA 1TNGA 2PUXB 1F7ZA 1S6FA 1SGCA 1MTVA 1CT4E 4KTUA 1ZTKA 3RXRA 3K6YA 1LTOA 3M7UA 1TOCB 4K1EA 2C93B 3UTUH 1C1NA 1ABIH 5GCHF 2Z94A 2BD2A 4JK5A 2Z7FE 5G4BA 1BTUA 4CH2B 2JH0D 2AGEX 3CENA 3RXPA 4GPGA 2Y7XA 3QX5H 3VGCC 1CA8B 4FXGH 2ALPA 1ELBA 2EC9H 2ZO3H 1TNJA 2F9NA 1O2WA 1UVOA 2BTCE 3GY2A 3SGQE 2VIWA 4A92A 1CU1A 1SGYE 2XC5A 1YBWA 2FS9A 4FVBA 4OS6A 1SQOA 1VITF 2VIQA 1XXFA 1TGTA 4D8NA 2HPPH 1X7AC 3LC5A 3P8NA 1QJ7B 1TBQH 1XX9A 2NU0E 3PWCA 3D62A 3ATWA 4TPYA 3KQDA 1N6XA 1O2LA 3NWUA 7GCHF 2FDAA 1O2TA 3RC5A 1BITA 1TX7A 2VWOA 2DUCA 5LPFA 1GVZA 4ABJA 1H8DH 4LXBH 1BRBE 1SGNE 8GCHG 1FQ3A 1O3FA 3BG4B 4FUGA 3QWCH 2ZI2H 1SG8B 1NRSH 2ZP0H 1MTSA 2XXLA 3GISB 4HZHA 1IAUA 1S81A 1ZPZA 2ZECA 2ZDMA 1ELAA 2HNTE 1O2NA 1KTTB 4FU7A 4K1SA 2WPLS 1FIZA 1S5SA 4TY7A 4FVDA 5FAHA 3GY7A 1BMLA 3ITIA 1DWBH 1QHRB 2XBVA 1QA7A 1G32B 1Q3XA 2PLXA 1EPTB 2SNVA 1YPEH 4E05H 1YF4A 5T6FA 2VIDA 3AW1A 2ZFSA 1BMNH 2Z3DA 2QIQA 2HRVA 4NIVA 2VNTA 1LPZB 5DKMA 3UWJH 1ZTLA 2FI4E 3ZZ7A 2Y80A 1EAIA 1FNIA 1MCVA 3RXLA 2FO9A 2FLBH 3RXUA 4D9QA 2YOLA 1TX8A 1A5IA 5FCRA 1SI5H 2HNTC 2STAE 1BOQA 5A0AE 3SHAH 4A6LA 3BTKE 2XBXA 3LOXA 4FUHA 1WV7H 2PHBA 1EATA 5LGOA 4TWYA 2A32A 1TB6H 3UNSA 1BZXE 2RA0A 2VVCA 5FPTA 1F2SE 1P02A 1C2GA 4RSPA 2BMGB 3MNCA 1SGEE 3MO9A 1AB9C 1Z6JH 1V2MT 1UK2A 3RDZA 1V2KT 1OS8A 4K8BA 1O35A 4NZLA 2VU8E 1SPJA 1P11E 1VCQA 3WY8A 1O3HA 4Q2KA 3LKWA 3PWBA 1CHOG 3S0NA 4BANB 2UWPA 1PPHE 1C1QA 1XXDA 1UTQA 1P04A 2GTBA 3MH4A 5HM2A 5T6GA 4YLUA 1Q2WA 2OQ5A 1GMCG 1C2LA 1C5VA 1LDTT 5TCAA 1TGBA 1KSNA 3SQHE 1BTHH 1NO9H 2A5KA 2GX4A 2QN5T 2FOBA 1KDQA 3MTYA 2FOHA 5DP5A 4DG4A 1UCYH 1QBVH 3UUZA 4MG3A 4Q7XA 3ELAH 4IBLH 3QZQA 3IWMA 4RN6A 3NUMA 1Z8RA 3KQCA 4CHAB 1UTJA 2BQ6B 1P06A 3SW2B 8GCHF 2AS9A 2IOTA 4X2XA 1OOKB 2ZDLA 1SLVB 1FDPA 5AF9H 1INCA 2AFQB 1OWEA 3T28A 4UDWH 2GMTB 2ZHFH 1T7CA 4D9RA 3SV2H 3SU0A 1QB9A 2XCNA 1C5QA 2WV5A 3P8OA 3ZZBA 1JXPA 2O8LA 2Y7ZA 1EASA 1WUNH 2ASUB 2CN0H 4BAMB 3ATKA 3AW0A 3K2UA 2FX6A 3E0NB 1O3EA 1OYTH 1QRZA 3VFEA 3RXJA 1NM6A 2WPHS 1IQJA 3GY3A 1K1OA 4ISHH 4Z0KA 1O34A 2QXHA 1VGCB 1DX5M 1AD8H 3BEFB 1LVYA 3P95A 3V7TA 3ZZ5A 3SV9A 3L3TA 4K5ZA 1QL7A 2J92A 1FN6A 2FX4A 2F9BH 5L2ZH 1F0SA 2GKVE 1KLTA 3SJOA 3RC6A 1J8AA 1THPB 4RKOB 4ZH8A 3SORA 1ANBA 1FMGA 1KXCA 1JBUH 1SOTA 1BTZA 1O2YA 5FCKA 2R3UA 3HGNA 5DG6A 3A8BA 5EQRA 1C1RA 1SB1H 3PMAB 1C2FA 4I33A 1NRPH 4AYVB 1ELVA 3RXGA 2A7HA 1TA6A 2ZDAH 2ZDKA 3Q3YA 1TRMA 4XBCA 3A83A 1PPFE 1ELCA 3IITA 1ELEE 1DY9A 2FI5E 4NGAH 1EJAA 2ZFFH 1LHEH 2C3SA 2OINA 4D7GA 4Y7AA 4Y79A 1O2JA 3SZNA 4J2YB 2PGQB 4FUDA 1PYTD 1QL9A 1QB1A 2GT7A 2ZPRA 3E3TA 4X6OA 3SU3A 3BTDE 1CA0B 2CF9H 1V2JT 3EE0B 4I8KA 5IDKA 1GJ7B 1ORFA 1D3DB 2D8WA 3UOPA 4H6TA 3K9XB 4IMZA 1GJBB 1GMCF 1OWDA 2GCHF 1BJVA 1GI8B 1V2NT 4DURA 1B7XB 1DICA 2G8TA 3PMBB 2OXSA 1LKBA 3RU4D 3BIUH 4MTBA 2P94A 1HLTH 2EI6A 5ESBA 3RXSA 2BDBA 1D6WA 3HPTB 1GCTB 2ANWA 2F83A 2GCTC 4A1VA 5AVDA 4BTIB 1EP5A 1IQIA 4CRGA 3S7HB 4OGYA 1UHBA 4OS4A
chains in the Genus database with same CATH superfamily
4MNYA 1K0HA 2Y5GA 1YKTA 5LH8A 1N8OB 3NK8A 3ZVEA 2QC2A 4I8JA 2P8OB 2QAAA 2B9LA 3URDA 3RXQA 1UTLM 2PW8H 3DUXH 1PJPA 2OC0A 3KHVA 5FPYA 1RIWC 1TQ0B 3SUEA 3V12A 2AGGX 1OWHA 2PFEA 2Y5FA 3DA9B 2GD4B 3F3BA 5HXFA 5EU8A 1BHXF 1AVWA 1O3NA 3PRBA 3D49H 1GBIA 3QLPH 3EAJA 5HIYA 2RG3A 2PSYA 5FXLA 2W6JD 3SO3A 3VGCB 2BDCA 1O2OA 4AB8A 1QRXA 1PQ7A 1Y3XA 1ELTA 1TGSZ 1ARCA 1YCPK 1MCTA 1ARBA 3KEEA 3SJIA 3H7OA 1G37A 2H1UA 4ABEA 1OSSA 3G01A 1W12U 2FOCA 1DFPA 1E34B 1YM0A 3C1KA 1W2KH 4MQAA 5C5NA 3TK6A 2FS8A 4CBOA 3H09A 1MAXA 2V3HH 2QY0B 3PTBA 2H5CA 6LPRA 4RT1A 4BTTB 2HVXA 7KMEH 1O33A 1W13U 4YESB 3FN8A 4B2CA 2FOAA 4I8LA 1W8BH 3I77A 1C5XB 5LPEA 1F0UA 3FAOA 2JKHA 1SGDE 2G52A 4JCNA 1NN6A 2TGPZ 2CF8H 2ZKSA 3BN9A 4JYUH 4AOQA 4ZKNU 2UUFB 2BZ6H 1GBAA 4FUCA 2K1QA 4P00A 3T25A 4X8UH 5EQQA 1MBMA 1O3CA 1ESBA 4Z1MD 1YPMH 2FXRA 1V2TT 1OWJA 5T1VA 2V7QD 1D9IA 2NU3E 4JYVH 5AFZH 1OWIA 1GWAA 3PTNA 1MTNC 1O3IA 2CMYA 4AG2A 2PTCE 1LO6A 2BYAX 3GCHC 3SJ9A 3T26A 4NG9H 4ISOA 1TMTH 1LHDH 2XBWA 1O3KA 2ZHDA 1O36A 3EQ0H 3SU5A 2ZTZA 3DCLA 2BB4A 1AO5A 4KP0A 1OP8A 2HVYB 5JBAS 1GGDC 1WU1A 2J34A 4OS7A 4NWKA 3SOSA 1UTMA 1UMAH 3OTJE 3A7TA 2BD8A 4Y0YE 4ABDA 1ANEA 2XNIA 4TPIZ 3GDUA 2QXGA 1FN8A 2FOMB 4X8TH 4FOUC 1N6YA 3MH7A 1SQRA 1WXRA 1TE0A 3GY5A 1YLDA 1HV7A 1V2LT 1YWUA 3OX7U 3GCOA 1A0JA 1A2CH 2L6OA 4XOJA 2BD3A 3TGKE 1DSTA 4IW4E 1LVBA 5PTPA 2THFB 5EOKA 1EAUA 2FYQA 3Q3KA 3GDVA 4HTCH 5C1YA 1DWCH 2B0FA 1H9IE 3FP7E 2ANYA 4X1SU 2WPKS 3BTGE 1GJ5H 3MU1A 5EJZA 4I7YH 1O5AB 1GBFA 1J9CH 1KMHB 1KXFA 1Y5AT 2Z9GA 4E7RG 2BDIA 1SR5C 1C2MA 1RTLA 1H9HE 2ZCHP 2A2XH 1GMHG 3GCTF 1AN1E 1UVUH 2FIRH 4K60A 4NA7A 1F92A 5ABWA 5GPIB 2VIVA 2ANMH 1UW7A 3VXEH 2OC7A 1WQVH 4UE7H 1TPOA 5JYIA 2Z3CA 4J1YA 1PYTC 3SJ8A 1G36A 3P6ZB 5F6MA 3NPSA 3GDSA 1WCZA 2C8YB 5E0JA 4UEHH 3WWBA 2FODA 4B74A 1QGFA 4GCHG 1DM4B 4GHQA 6CHAB 5E2OA 4TYDA 1ZRBA 3LDXH 2FOFA 3BF6H 4NSYA 5T3HA 1E35B 1IHSH 1QJ1B 5HKKD 4DJZB 4ZKSU 1JWTA 1WOFA 2EI8A 3AASA 1P05A 4K3JA 2PR3A 1LPKB 1SL3A 1DLKB 1QBNA 1CE5A 1UTNA 1MBQA 1Y3YA 2M2AA 1HNEE 4DT7B 5K7RA 2ZIQH 1P01A 1ELGA 2H2ZA 3RXMA 1J16A 1ETRH 3FVFB 1E1RD 1J17T 3A7WA 3RXIA 2ZTXA 3OYPA 2NU1E 2RA3A 4A5TS 2R2MB 2VGCB 2ZU1A 3EA7A 1SVPA 4MVNA 1W11U 1HJ8A 5C5OA 1O2IA 3RXBA 3HGPA 4XD7D 1B0EA 1KYNA 1MUEB 1SBWA 1YPHE 3RXFA 3QN7A 3TH4H 3PO1C 1O5FH 1DY8A 4F48B 1QL8A 3NXPA 3RMOH 2A45B 1DXPA 4BXWA 1QY6A 1EAXA 1KXBA 1OKXA 1SOZA 1N1LA 1GDNA 1OP0A 1XUFA 1A4WH 4JZ1A 3MU4A 1TOMH 4ABBA 4DOQA 1WTHD 2GP9B 4BAOB 2ZHEH 2V3MA 2XNDD 1JIRA 2BQ7B 1CQQA 3N7OA 1TMBH 1T4UH 1U6QA 5EIYA 4NWLA 1K1PA 1UVPA 4JMYA 1NU7B 3T5FH 3NKKA 1O3AA 3PLKA 4WMDA 3VB3A 1V2PT 1CO7E 1PPGE 2ZEBA 2ZGBH 2ZPQA 1O2XA 4Q4LA 1XKAC 2JIZD 2PUQH 5E0HA 3MU5A 2Y82A 3MNBA 4U2WA 5GDSH 3AK5A 1DXWA 1WQSA 1C5WB 1GI5A 5C1UA 1YPHC 3K6ZA 2A4RA 1O5CB 3P70B 3MNSA 2WSSD 3UQOA 2AMDA 3AVZA 1BMMH 3R3GB 1C2EA 2OUAA 1OPHB 1YLNA 3PYHA 1HJAB 2ZHQH 1O2KA 5EXLA 3IG6B 3LJOA 3F9FA 1TPPA 1IQKA 2XBYA 1C5NH 1FUJA 1E0FD 3ZVCA 1L0ZA 1JMOH 1O30A 5KEDA 1SKYE 2RDLA 3M61U 1JIMA 3RC4A 2KZ4A 1GJAB 1XUGA 3ZV9A 1BMFD 1TA2A 1GG6B 2KAIB 2A31A 3A87A 3RU4T 2IPQX 2O8TA 2VH0A 2O9QA 3C27B 5EXMA 1ANDA 1GBJA 1V6DA 2KCAA 3H7TA 2BDAA 5FX6A 1SC8U 5C0TA 1HIAB 1RRKA 1AFQB 3M7TA 4E06H 1TRYA 4YOIA 4X0WU 1F5RA 1S83A 1C2JA 4CRFA 4INHA 5EGMA 3LGYA 1NU9A 1OXGA 2ANKH 1ANCA 2J2UA 4DIHH 1GHWH 1GMDF 1MKWH 2GT8A 4FU9A 3O8BA 4OS5A 1NFXA 3KQBA 1DE7H 1UCYE 1EUFA 3A88A 2G5VA 4X1RU 5GIBA 3RMNH 5CHAB 3ZZ9A 2D26C 3PV5A 2BOKA 4ABFA 1W0ZU 4AFSA 2CHAC 3A80A 3PLPA 1TGCA 3KQEA 2G81E 1UO6A 2ZHWH 1HAZB 4CRCA 2Z9LA 3NCLA 1A0HB 1Z1IA 3V13A 2ZFPH 5LPRA 1Y5UT 4JYTA 3SU2A 3OY6U 1C1UH 2F4LA 2SGFE 4MPXA 3A8AA 3UIRA 5B6LA 1XMNB 1HBTH 4ZHAA 5JB8S 1PQAA 3A89A 2ODQA 4IGDA 4QT8C 4WWYA 3MQKC 4NZQA 1SGPE 1C2KA 3LGWA 4X6NA 2FESH 1O2MA 4WH6A 5JBTA 1AVXA 1Y3WA 1BRAA 1EJMA 2ZGCA 3FANA 2FTMA 4O03A 4DVAU 4GSOA 1CGHA 1O3OA 1QURH 2ZNKH 4WMFA 2BD9A 3M35A 5CHBA 2C8XB 2AMPA 1ZSLA 1GBTA 2GDEH 3DD2H 4KTCA 1LVOA 4MPVA 2CXVA 2Z9IA 1Y8TA 3VPKA 4MDSA 1MU6B 1ZHRA 4CRAA 3MU8A 2BVSH 2J5UA 4I86A 2ZG0H 1FV9A 1SGFG 2W7SA 1W0YH 3RXCA 2QF4A 5E8EH 3LH3A 5J4SA 1NC6A 5C17A 2FM2A 1UVSH 4B1TA 1VZQH 2V6NA 4FU8A 1AQ7A 3U98H 1XUIA 2HWLB 2TGDA 3RXTA 2QF0A 4OGXA 4DT4A 1MTNB 1FI8A 1GJ4H 1G3CA 3KL6A 3GCHB 1W7GH 1ESAA 1T32A 2TGAA 1TBZH 1P12E 1AWFH 4AFUA 2KAIA 1ELDE 2Z6BD 1BTYA 4JZIA 2EEKA 1P03A 2ZGXH 4GHTA 3DSPA 2F9PA 3LGTA 1NROH 2QGRA 2ZGHA 2B7DH 3TGIE 1P2IA 1ZMJA 4HG6A 5A0BA 1QR3E 5DK1A 4B2AA 3OY5U 1KXDA 3LGUA 2PKSC 2LP6A 1H4WA 1Z1JA 1D3PB 3F9HA 3M5OA 3SNBA 1GI1A 2P3UB 4Y10E 3BTHE 2VJ1A 1AIXH 1O3BA 2VIOA 1SLXB 1FPCH 3GYLB 5H4IB 3BTWE 1TNLA 4NFFA 2ZFQH 1EPTA 1M9UA 3UNQA 5EJLA 3UY9A 2PTNA 3RXDA 1UTKA 3QUMP 1RTFB 1EOJA 1C5MD 1HCGA 3CP7A 3A84A 1S0QA 5HYOA 1E38B 1CGIE 1C1VH 5TJXA 1ZSKA 3GYMA 1C5ZB 1VCWA 1AUTC 3A82A 1C1MA 2AIPA 2OBQA 2CGAA 1WSSH 4UFFH 3SV6A 1B5GH 5JPMH 1LPGB 4WJG2 2BM2A 1DWEH 1OHHD 1P0SH 2RCEA 1CBWC 1O3DA 2BVXH 2BXTH 1AU8A 4UD9H 4JZFH 3GICB 2IJOB 5F03A 2FWWA 3P17H 3HATH 3TVJB 1MQ5A 2JH6D 3MU0A 1XUHA 3STJA 1ZPBA 2BQWB 3P8GA 2K0QA 2OLGA 3GCNA 2SNWA 1W3CA 4R8TB 1EOLA 4ZXYH 1Z8GA 2Q6GA 1VKYA 2BLQA 4R0IA 1MQ6A 2WYGA 4O9VA 2KCOA 4YOJA 2DE8A 2XC0A 3NZIA 4CBNA 1K9OE 3DFJA 3I29A 2XW9A 1CHOF 5EPNA 2BDGA 1YLCA 1FXYA 1H8IH 1GI7B 1CT2E 3KN2A 2B5TB 3V0XA 5B6OA 1PPEE 2ZWLH 1YPJH 3OFND 1CHGA 1J14A 2FOEA 1A46H 2WYJA 1C5UA 2QCYA 1AY6H 4NA9H 1GJ9B 2HOBA 5E0GA 3SV8A 4K8YA 4PROA 1EZSC 3HK3B 4MNXA 2VINA 1GL1A 1Z7KA 3U8OH 1YP9A 2ZF0H 3F0OA 2PKAB 1ZSJA 2OBOA 5HM9A 1QBOA 1AVGH 4Q7ZA 1PQ5A 1BDAA 2VH6A 3FZZA 4ZHLU 1SFQB 2OQUA 1VR1H 1PFXC 1RFNA 1LQDB 2AMQA 1HYLA 4OS1A 1O0DH 1YCPH 3BG4C 1V2WT 4X2WA 1O3LA 4Y6DA 5T6DA 4ZUHA 1T8NA 1L4DA 1P2OA 3SU4A 1HAOH 2BHGA 2IN2A 2ZC9H 2W7UA 5JDUB 2ESTE 2BZAA 2F91A 4XSKU 3O8RA 4KTSA 1W10U 5AFYH 3ZZ8A 1FY8E 3RXEA 1ABJH 1ACBE 1IQEA 1NRQH 3BG8A 1IQMA 1LHCH 2F9VA 5JBCS 1O2PA 1BQYA 2R0LA 4TT3D 1BTWA 1CGJE 3WW7A 2A5AA 4B76A 1TPSA 4GLYA 5TCCA 1P3CA 5FBIA 3RLWH 3FKSD 1ZTJA 1AGJA 4FETA 2JJ2D 1GI0A 3E6PH 1ZYOA 2C90B 2OCVB 2TIOA 3WWFA 3QTOH 4YT6H 2YNBA 1AFEH 1NESE 4RI0A 3ODFA 2A4QA 2AH4X 2STBE 2XOKD 2QYIA 3UR9A 3ZZ4A 3M5MA 3N7EA 1FJSA 2G51A 1SSXA 1E37B 2D1JA 2BY8X 1A61H 1XUKA 1TNKA 1FPHH 2LPRA 1ZHMA 1ID5H 3E91A 1GVKB 4MLFB 5ESTE 3TU7H 2TPIZ 3F2GA 1BRUP 3F1SB 1DDJA 1EB2A 1WYKA 4MPUA 1O3JA 3RMLH 2P59A 1JRSA 1F0RA 5IYTA 1Y5BT 2VVUA 3TJOA 3SBKA 3TPIZ 2NU4E 3BEUA 2Y81A 1L1JA 4Y11E 3ZZDA 2XWBI 2G00A 1EZUC 4HGCA 5GJ4B 1HFDA 3ZVAA 1YCPM 2OTVA 2A0QB 4X6MA 5CMXH 3ODDA 1P10A 5FBEA 5C1XA 3OAAD 1C2HA 2O8WA 2A4GA 3VB7A 2WPIS 3A7XA 1Y3VA 2PV9B 2Q1JA 1NT1A 1ESTA 1EXFA 1G3BA 1Y59T 2HLCA 1LHFH 4YXWD 4MNWA 3TK9A 1SLUB 3PM3A 1Y3UA 2VVVA 3RXHA 4BOHA 3EYDA 1KLJH 3LH1A 3TGJE 3RP2A 3S9BA 1GPZA 4TSFD 3VXFH 5K0HA 4I32A 1FLEE 2W3IA 1P09A 2PKAA 6ESTA 2UWOA 4BAQB 1AMHA 3UWIA 1BBRK 4B2BA 3M3SA 5C20A 1MABB 4CHAC 1O37A 5DP7A 1GBMA 4X6PA 1LVMA 1O39A 2AEIH 1EZQA 2P93A 1K28D 4NIYA 1K21H 3HKIB 1V3XA 1K1MA 2UUKB 1YPGH 2BX4A 2GMTC 1ZJDA 4DW2U 1GDUA 1TWXB 1AB9B 1NFYA 2GZ7A 1GBBA 1KIGH 1L1NA 1V2UT 2W3KA 3LU9B 2SGQE 3RM2H 1AZ8A 1F0TA 5F8XA 5DGJA 3RXVA 4F4OC 3ZVDA 4NSVA 5ETXA 3GOVB 3ZIAD 1HB0B 1GI4A 4LOYH 2P95A 1VCPA 1ZPCA 1C9TA 1YYY1 1BCUH 1C1TA 4ZROA 3TLOA 1C5OH 3PLBA 1VGCC 4SGBE 3CS7A 3V3MA 2J95A 4WY3A 4YLQH 1Q31A 3Q00A 1W7XH 3SUFA 4HFPB 1VITG 2JJ1D 1ZMNA 3LGIA 4ISIH 2KCPA 4IN1A 4UONA 3LT3A 4ZKRU 1OYQA 4M7GA 1GJDB 3QGNB 4KELA 5JB9S 4ABIA 3LC3A 4FUJA 1C2DA 7GCHG 1A5HA 1FY3A 3DHKH 1T31A 4TY6A 1C5PA 3T2NA 1E1QD 4Y71A 1V2RT 2FTLE 1A5GH 1NFUA 3Q3XA 1GBDA 2NWNA 4RT0A 1PPBH 5A8ZA 3P8FA 4Q80A 1O5GH 1XKBC 2PKSB 3B8JA 4ISNA 1KLIH 1EKBB 3RXAA 3TH2H 1HJ9A 3ZZCA 5C3NA 2BY7X 5EQSA 2HPQH 3VB4A 1KY9A 4XBBA 1WDIA 1SGFA 5A0CA 4AB9A 1JOUB 3M3TA 3ZVGA 1HGTH 2PP6A 3SZEA 4B71A 4D76A 1P2NA 4YT7H 2HLDD 5F8TA 1EP6A 1P3EA 1T8OA 3U8TH 4JZEH 3SYJA 1HXEH 1VJAU 4DIIH 2GV6A 3TJNA 1P2MA 4Y8XA 2H6MA 1DLEA 4IMQA 4A7IB 3CNRA 1ZHPA 2YMSB 3QTVH 4JZDH 3E16B 2C8ZB 3QZRA 1ELFA 5C0UA 3VB6A 1P2JA 1Z8IB 3F0PA 5C94A 1L4ZA 1GBEA 1V2VT 1GCTC 4AG1A 1O3MA 1TPAE 1C5RA 4YTAA 1UJ1A 2VWMA 4NCYA 1C5TA 1FAKH 3FP6E 2NU2E 2SGPE 1MD7A 2PWXA 2G5NA 5FX5A 3LGVA 4GUXA 3GS9A 3MFJA 2QA9E 2Y6TA 1HAHH 2P8OC 2ZU5A 2G4UA 3OSYA 2J4IA 1PPZA 3GY4A 3LONA 4X2YA 2GDDA 4Y8YA 1L2EA 1GHXH 1MKXK 2BOHB 5DP6A 2CV3A 2J97A 4MNVA 5BPEA 3W95A 1PPCE 4AGKA 3U9AH 1GHVH 2FI3E 1A0LA 3BTFE 1BMAA 4SGAE 3ESTA 3RUOA 3TNSA 2PSXA 1GMHF 3Q77A 1WAYB 4I8HA 2CK3D 1GDQA 4LZ4B 1MAYA 5L2YH 2BLVA 4ISLA 1QCPA 2W5EA 1EX3A 4Y76A 4Y0ZE 4AN7A 1GI9B 1MMJN 1Z8JB 2ULLA 1BRCE 3SQEE 2WPMS 1KDQB 1LQEA 1LHGH 1ZR0A 3A85A 3AAVA 1HUTH 1H1BA 4X8SH 1C1WH 3O8DA 1HPGA 1EB1H 2GCTB 4O97A 2BDHA 4GCHF 3W94A 1YPKH 1EJNA 2QXJA 4U30A 1O2ZA 1QIXB 5EJ1A 8KME2 4Q7YA 5FPSA 2SGAA 2Z9KA 1MH0A 2A1DB 4YM9A 2Z3EA 1C5LH 2XC4A 3VEQB 2ZCKP 1S6HA 1CVWH 2ILNA 3SI3H 3T27A 4AFZA 4AYYB 1RIWB 5EPYA 2AERH 1AI8H 1NRRH 1C1PA 1F5LA 3EA8A 3VB5A 1DS2E 3RXOA 1SQAA 1TMUH 2UUYA 2V3OH 3SV7A 4Y8ZA 3F6UH 2GZ9A 2V0BA 5HGGA 3A81A 4B73A 1A1RA 1CT0E 1QZ8A 1UK3A 4ZAEA 3S69A 1G3DA 2BD5A 3SUDA 1O5BB 3TNTA 1F5KU 2FLRH 4FUBA 1L1GA 1EAWA 2SGEE 5HIZA 4XDEA 1O3PB 2GZ8A 3LJJA 1D6RA 4RKJB 3TH3H 2J94A 3U28C 1E36B 1YC0A 1G30B 2Q6FA 1XVOA 4X1PU 3B23B 1MD8A 2P16A 1A7SA 2FPZA 4FUIA 3MMGA 1MKWK 7LPRA 3BSQA 2C8WB 3A7VA 2OC8A 2ZGJA 1GHBG 1KXAA 1TONA 3F2FA 1DITH 2OD3B 4U32A 1KXEA 1UTPA 2FOGA 4WXVA 3ZVFA 1O31A 1W14U 1DANH 1AUJA 1PQ8A 3MH5A 3PB1E 4NIWA 3U69H 1CSOE 1NPMA 4AC9A 1AE5A 2XCFA 1JRTA 5E2PA 3OEHD 1O2QA 1FIWA 1ZJKA 1QRWA 1IQFA 2FEQH 5F8ZA 1FY4A 1GJ6A 4HI3A 2BY6X 4THNH 2A7CA 2BLOA 1SGTA 5AHGH 1QJ6B 1TYNA 1NY22 1P8VC 2A5IA 1O2GH 1QA0A 3F9EA 1HAIH 3SNDA 1T8LA 2DE9A 5EODA 3EE7A 3MYWA 3RMMH 9ESTA 1AZZA 3ZV8A 1GHZA 1BUIA 1YPLH 3PV4A 4KKDA 2XRCA 5JBBS 2Q6DA 1HAGE 2F3CE 2GGVB 1GGDB 1C9PA 1P9SA 2GCHG 1C2IA 1TLDA 3QK1A 4A1XA 1P57B 1TAWA 3QO6A 2TRMA 1TNIA 1C4U2 1HIAA 2ZDNA 3MNXA 2BVRH 3GY6A 4P02A 3E1XB 1TIOA 1HAYB 2O8MA 3ZYDA 4UFEH 6CHAC 3BTQE 3F68H 1O2HA 1UHBB 1GBLA 2SGDE 3RM0H 1NZQH 1IHTH 4AFQA 4INLA 1TABE 1K1LA 4WH8A 6GCHG 3A86A 1SGQE 3FZDA 4I8GA 2WZQA 4GAWA 2R9PA 3QGJA 1G3EA 2UWLA 4VGCC 1TQ7B 1W0KD 1AE8H 1BJUA 1NTPA 1UCYK 5DP4A 1FY5A 4CR9A 1QQUA 1P9UA 1T4VH 2ZFRH 4F49A 5BRRE 3FP8E 2KR7A 5EG4A 4H42U 3U8RH 3PRDA 1SFIA 5I25A 3TJVA 1TX6A 1GHAG 2QF3A 1GL0E 2VGCC 1TGNA 3AAUA 3PV2A 1FONA 1O38A 3SU6A 1DWDH 1J15A 4KGAA 2XTTB 4O3UA 2A4OA 1VJ9U 2JETC 4A1TA 2H5DA 4BNRA 1BT7A 1YGCH 2VBCA 3ENSB 1HDTH 1RGQA 1DSUA 4LZ1H 2VIPA 4MPWA 4OS2A 5C67A 4NIXA 2WHXA 3F9GA 1GHBF 2WV4A 3OEED 5CDFE 3I78A 3ATIA 1NS3A 1ZRKA 3DT0H 1BA8B 1XUJA 2BD7A 3TJUA 3MOCA 4ZXXH 8ESTE 3LIWA 2FMJA 3KNXA 3ZYEA 1DOJA 1OWKA 1WBGB 4OM9A 2QXIA 4WMEA 2OP9A 4DY7B 3M36A 1HAPH 5A09A 3OTPA 3TIUA 4XBDA 1DUEA 5EXNA 5GWZA 3S7KB 4CH8B 4E7NA 1K2I1 2ODPA 5A8YA 2UUJB 1HJAC 2WPJS 3R0FA 3UPEA 1EZXC 1TBRH 3EA9A 3L33A 2HGTH 4ABHA 3UFAA 1Z71A 1LKAA 3SUGA 1EQ9A 1HAXB 1ZOMA 2BDYA 4IC6A 2BD4A 1SQTA 3S9CA 1D3QB 5EW2H 1ETTH 2HNTF 4H6SB 1MTUA 4X2VA 2G4TA 1GG6C 2CJIA 2G55A 1D3TB 3FFGA 1QNJA 2VWLA 3PO1B 4YZUA 3UB0A 1HAVB 1TRNA 2TGTA 3EGKH 4LK4A 4FUFA 2WUCA 1AFQC 1HXFH 1BBRE 1SLWB 5DO4H 3BTME 1G2LA 4UFGH 4Z6AH 2ZQ1A 1H9LB 3Q76A 3QDZB 4BTUB 4ASHA 2M5TA 4IC5A 2V35A 3MI4A 5GNDA 3M7QA 4CREA 5J4QA 6GCHF 1MTWA 4YO9A 1S85A 7ESTE 2I6SA 1EPTC 1ZMLA 3M5NA 1ZZZA 1GI2A 5A2MH 2KCYA 5CHAC 1GBHA 2P3FH 4DCDA 3ZZ6A 5DJ7A 2QV1A 1IQHA 3UR6A 1MZDA 3P92A 2A7JA 2QF5A 3KF2A 2W26A 3T29A 1IQNA 5CE1A 4ZHMU 3MHWU 3D23A 2H9HA 4XFQA 4K1TA 8LPRA 5DP9A 2HALA 3SNAA 1GHAF 1THSH 4AX9H 2WV9A 1BIOA 1O2SA 1GHYH 4TWWA 3U1JB 3EDXB 3UAIC 1C4V2 3D65E 1O2RA 1XVMA 3UREA 2ODYB 1OX1A 1AWHB 2F9OA 3GCTG 5DP3A 4DGJA 1C5SA 2XYAA 2ZTYA 3URCA 2BLWA 2AHME 1QB6A 1GI3A 1P2KA 4B75A 1BTPA 3BEIB 4D7FA 5DN6D 1O5DH 2IPHA 2AYWA 2ZQ2A 3JZ1B 2IJD1 2BY9X 1QFKH 1TALA 1RD3B 2ZPSA 1FX0B 3ATLA 3KCGH 3OU0A 4UFDH 3ATMA 2KFWA 2A2QH 1C5YB 3MWIU 1IQLA 1IQGA 1O2VA 3A7YA 1K22H 5SGAE 2ZFTA 3E90B 2I6QA 2J9NA 4B6EA 1FZZA 4NFEA 2BY5X 3HKJB 1BBRH 1B0FA 5FHTA 1O32A 4BXSA 1LCYA 3PROA 3SJKA 3H5CB 1WTGH 2CHAB 2ZU3A 3SHCH 2JDID 4ABAA 2JH5D 1SHHB 1GBCA 1OP2A 2VB0A 2BX3A 2J98B 2WINI 2ZDVH 1H8ED 3SU1A 4AORA 1O3GA 1QQ4A 1GBKA 1A3BH 1V2ST 2H9TH 3E8LA 3N99A 4CR5A 3MO3A 2C4FH 3RXKA 3DFLA 3M37A 1Z6EA 1ZGVA 1BB0B 4IN2A 5KGOA 1XM1A 2Y5HA 3SN8A 4ZKOU 1FAXA 3N7DA 4JK6A 1ETSH 1DUAA 3RLYH 2OK5A 3U1IB 3JZ2B 1HAVA 9LPRA 1DPOA 2PGBB 1V2QT 2R3YA 2VWNA 5I46H 3O8CA 4BAKB 1AKSB 3PMJA 2WPDD 4K2YA 5FL7D 1NRNH 1ZGIA 2R2WU 1MZAA 3MO6A 3MH6A 2ZU4A 1RJXB 1SGRE 1SHYA 4ZMAH 1EFRD 2LNCA 5GCHG 2ALVA 4GVUA 3S9AA 1GJ8B 1UVTH 2D2DA 1RS0A 3BTTE 2H9EH 5EW1H 5C2ZA 3KGPA 1S0RA 1O5EH 1S84A 2ZCLP 3A8DA 4X1NU 3B9FH 4U01A 3STIA 1D4PB 1S6LA 1BHXB 2FP7B 1THRH 5L30H 4Y7BA 3GY8A 4H4FA 1C1OA 2EA3A 5DPAA 1DT2A 1MU8B 4WF8A 2FZZA 1VITH 3UQVA 2J38A 1GVLA 4BAHB 3RU4E 5GXPA 1KTSB 3BTEE 4NA8A 1HRTH 1COWD 4YOGA 1UK4A 1T8MA 5HMAA 3ZZAA 2AGIX 4I31A 1GCDA 4ZCNA 2ZZUH 4INKA 2GV7A 4X8VH 3SGBE 2WUBA 2BXUH 3CS0A 3LPRA 3UNRA 4AGJA 2OC1A 2Z9JA 1BTXA 1O2UA 2GVFA 3BIVH 2QE7D 2O8UA 1G9IE 2B8OH 1FY1A 2AIQA 3L6PA 2RFKC 3E0PB 4WXIA 3SI4H 3A8CA 3T62A 1K1NA 4FUEA 4X1QU 3K65B 4XE4A 1UTOA 1YY3A 1C4Y2 3ZZ3A 1ZLRA 4O3TA 3KYFA 1GMDG 1GJCB 4ESTE 1V2OT 2F9UA 1QTFA 1CA0C 2XWAA 4VGCB 3DSOA 2J98A 1RTKA 1SMFE 4CRBA 1G2MA 4F55A 1AHTH 2FYRA 1S82A 2R0KA 5A8XA 1GI6A 2P3TB 1P2QA 2ZA5A 3PMHB 3SGAE 4WVPE 3M3VA 1K1IA 1MKXH 1A3EH 1LMWB 2L74A 1CBWB 3TITA 4ABGA 2ZU2A 1K1JA 3HK6B 2EI7A 1DVAH 4IS5A 1IOEA 3UOUA 1RXPA 1TNHA 2JETB 5L6NH 3BV9B 4K69A 4AZ2B 3SNCA 2SFAA 1TFXA 5DP8A 3KIDU 4ACBA 1N8OC 3SNEA 1SGIB 3TK5A 3A7ZA 3ZVBA 4CRDA 1NFWA 1C1SA 2YNAA 3M5LA 1AKSA 2TBSA 1TNGA 2PUXB 1F7ZA 2RDEA 1S6FA 1SGCA 1MTVA 1CT4E 4KTUA 1ZTKA 3RXRA 4B6FA 3K6YA 1LTOA 3M7UA 1TOCB 4K1EA 2C93B 3UTUH 1C1NA 1ABIH 5GCHF 2Z94A 2BD2A 4JK5A 2Z7FE 5G4BA 1BTUA 4CH2B 2YMSD 2JH0D 2AGEX 3CENA 3RXPA 4GPGA 2Y7XA 3QX5H 3VGCC 1CA8B 4FXGH 2ALPA 1ELBA 2EC9H 2ZO3H 1TNJA 2F9NA 1O2WA 1UVOA 2BTCE 3GY2A 3SGQE 2VIWA 4A92A 1CU1A 1SGYE 2XC5A 1YBWA 2FS9A 4FVBA 4OS6A 1SQOA 1VITF 2VIQA 1XXFA 1TGTA 4D8NA 2HPPH 1X7AC 3LC5A 3P8NA 1QJ7B 1TBQH 1XX9A 2NU0E 3PWCA 4XRNA 3D62A 3ATWA 4TPYA 3KQDA 1N6XA 1O2LA 3NWUA 7GCHF 2FDAA 1O2TA 3FOAA 3RC5A 1BITA 1TX7A 2VWOA 2DUCA 5LPFA 1GVZA 4ABJA 1H8DH 4LXBH 1BRBE 1SGNE 8GCHG 1FQ3A 2EY4C 1O3FA 3BG4B 4FUGA 3QWCH 2ZI2H 1SG8B 1NRSH 2ZP0H 1MTSA 2XXLA 3GISB 1NBMD 4HZHA 1IAUA 1S81A 1ZPZA 2ZECA 2ZDMA 1ELAA 2HNTE 1O2NA 1KTTB 4FU7A 4K1SA 2WPLS 1FIZA 1S5SA 4TY7A 4FVDA 5FAHA 3GY7A 1BMLA 3ITIA 1DWBH 1QHRB 2XBVA 1QA7A 1G32B 1Q3XA 2PLXA 1EPTB 2SNVA 1YPEH 4E05H 1YF4A 5T6FA 2VIDA 3AW1A 2ZFSA 1BMNH 2Z3DA 2QIQA 2HRVA 4NIVA 2VNTA 1LPZB 5DKMA 4ASUD 3FO8D 3UWJH 2LELA 1ZTLA 2FI4E 3ZZ7A 2Y80A 1EAIA 1FNIA 1MCVA 3RXLA 2FO9A 3KQ5A 2FLBH 3RXUA 4D9QA 2YOLA 1TX8A 1A5IA 5FCRA 1SI5H 2F43B 5IK2D 5KECA 3OE7D 2HNTC 2STAE 1BOQA 4Q63A 5A0AE 3SHAH 3VG8A 4A6LA 3BTKE 2XBXA 3LOXA 4FUHA 1WV7H 2PHBA 1EATA 3DSGA 5LGOA 4TWYA 2A32A 4M9FA 1TB6H 3UNSA 3NRLA 1BZXE 2RA0A 2VVCA 5FPTA 1F2SE 1P02A 1C2GA 4RSPA 2BMGB 3MNCA 1SGEE 3MO9A 1AB9C 1Z6JH 1V2MT 1UK2A 3RDZA 1V2KT 1OS8A 4K8BA 2KM0A 1O35A 4NZLA 2VU8E 1SPJA 1P11E 1VCQA 3WY8A 1O3HA 4Q2KA 3LKWA 3PWBA 1CHOG 3S0NA 4BANB 2UWPA 1PPHE 1C1QA 1XXDA 1UTQA 1P04A 2GTBA 3MH4A 3W1EA 3KYGA 5HM2A 5T6GA 4YLUA 1Q2WA 2OQ5A 1GMCG 1C2LA 1C5VA 1LDTT 5F53A 5TCAA 1TGBA 1KSNA 3SQHE 1BTHH 1NO9H 2A5KA 2GX4A 2QN5T 2FOBA 1KDQA 3MTYA 2FOHA 5DP5A 4DG4A 1UCYH 1QBVH 3UUZA 4MG3A 4Q7XA 3ELAH 4IBLH 3QZQA 3IWMA 4RN6A 3NUMA 1Z8RA 3KQCA 4CHAB 1UTJA 2BQ6B 1P06A 3SW2B 8GCHF 2AS9A 2IOTA 4X2XA 1OOKB 2ZDLA 1SLVB 1FDPA 5AF9H 1INCA 2AFQB 1OWEA 3T28A 4UDWH 2GMTB 2ZHFH 1T7CA 4D9RA 3SV2H 3SU0A 1QB9A 2XCNA 1C5QA 2WV5A 3P8OA 3ZZBA 1JXPA 2O8LA 2Y7ZA 1EASA 1WUNH 2EQNA 2ASUB 2CN0H 4BAMB 3ATKA 3AW0A 3K2UA 1H8HD 2FX6A 1O3EA 3E0NB 1OYTH 1QRZA 3VFEA 3RXJA 1NM6A 2WPHS 1IQJA 3GY3A 1K1OA 4ISHH 4Z0KA 1O34A 2QXHA 1VGCB 2W6ID 1DX5M 1AD8H 3BEFB 1LVYA 3P95A 3V7TA 3ZZ5A 3SV9A 3L3TA 4K5ZA 1QL7A 2J92A 1FN6A 2FX4A 2F9BH 5L2ZH 1F0SA 2GKVE 1KLTA 2YMSC 3RC6A 3SJOA 1J8AA 1THPB 4RKOB 4ZH8A 3SORA 2K8IA 1ANBA 1FMGA 1KXCA 1JBUH 1E79D 1SOTA 1BTZA 1O2YA 5FCKA 2R3UA 3HGNA 5DG6A 3A8BA 5DSFA 5EQRA 1C1RA 1SB1H 3PMAB 1C2FA 4I33A 1NRPH 4AYVB 1ELVA 3RXGA 1NBME 2A7HA 1TA6A 1W0JD 2ZDAH 2ZDKA 3Q3YA 1TRMA 4XBCA 3A83A 1PPFE 1ELCA 3IITA 1ELEE 1DY9A 2FI5E 4NGAH 1EJAA 2ZFFH 1LHEH 2C3SA 2OINA 4D7GA 4Y7AA 4Y79A 1O2JA 3SZNA 4J2YB 2PGQB 4FUDA 1PYTD 1QL9A 2GJGA 1QB1A 3F2HA 2GT7A 2ZPRA 3E3TA 4X6OA 3SU3A 3BTDE 1CA0B 2CF9H 1V2JT 3EE0B 4I8KA 5IDKA 1GJ7B 1ORFA 1D3DB 2D8WA 3UOPA 4H6TA 3K9XB 4IMZA 1GJBB 1GMCF 1OWDA 4ACAA 2GCHF 1BJVA 1GI8B 1V2NT 4DURA 1B7XB 1DICA 2G8TA 3PMBB 2OXSA 1LKBA 3RU4D 3BIUH 4MTBA 2P94A 1HLTH 2EI6A 5ESBA 3RXSA 2BDBA 1D6WA 3HPTB 1GCTB 2ANWA 2F83A 2GCTC 2KX4A 5AVDA 4A1VA 4BTIB 1EP5A 1IQIA 4CRGA 3S7HB 4OGYA 1UHBA 4OS4A
chains in the Genus database with same CATH topology
4MNYA 2Y5GA 1YKTA 5LH8A 1N8OB 3NK8A 3ZVEA 2QC2A 4I8JA 2P8OB 2QAAA 2B9LA 3URDA 3RXQA 1UTLM 2PW8H 3DUXH 1PJPA 2OC0A 3KHVA 5FPYA 1RIWC 1TQ0B 3SUEA 3V12A 2AGGX 1OWHA 2PFEA 2Y5FA 3DA9B 2GD4B 5HXFA 5EU8A 1BHXF 1AVWA 1O3NA 3D49H 1GBIA 3QLPH 3EAJA 2RG3A 2PSYA 5FXLA 3SO3A 3VGCB 2BDCA 1O2OA 4AB8A 1QRXA 1PQ7A 1Y3XA 1ELTA 1TGSZ 1ARCA 1YCPK 1MCTA 1ARBA 3KEEA 3SJIA 3H7OA 1G37A 2H1UA 4ABEA 1OSSA 3G01A 1W12U 2FOCA 1DFPA 1E34B 1YM0A 3C1KA 1W2KH 4MQAA 5C5NA 3TK6A 2FS8A 4CBOA 1MAXA 2V3HH 2QY0B 3PTBA 2H5CA 6LPRA 4BTTB 2HVXA 7KMEH 1O33A 1W13U 4YESB 4B2CA 2FOAA 4I8LA 1W8BH 3I77A 1C5XB 5LPEA 1F0UA 3FAOA 2JKHA 1SGDE 2G52A 4JCNA 1NN6A 2TGPZ 2CF8H 2ZKSA 3BN9A 4JYUH 4AOQA 4ZKNU 2UUFB 2BZ6H 1GBAA 4FUCA 2K1QA 3T25A 4X8UH 5EQQA 1MBMA 1O3CA 1ESBA 1YPMH 2FXRA 1V2TT 1OWJA 1D9IA 2NU3E 4JYVH 5AFZH 1OWIA 1GWAA 3PTNA 1MTNC 1O3IA 2CMYA 4AG2A 2PTCE 1LO6A 2BYAX 3GCHC 3SJ9A 3T26A 4NG9H 4ISOA 1TMTH 1LHDH 2XBWA 1O3KA 2ZHDA 1O36A 3EQ0H 3SU5A 2ZTZA 2BB4A 1AO5A 4KP0A 1OP8A 5JBAS 1GGDC 1WU1A 2J34A 4OS7A 4NWKA 3SOSA 1UTMA 1UMAH 3OTJE 3A7TA 2BD8A 4Y0YE 4ABDA 1ANEA 2XNIA 4TPIZ 3GDUA 2QXGA 1FN8A 2FOMB 4X8TH 1N6YA 3MH7A 1TE0A 3GY5A 1YLDA 1HV7A 1V2LT 3OX7U 3GCOA 1A0JA 1A2CH 4XOJA 2BD3A 3TGKE 1DSTA 4IW4E 1LVBA 5PTPA 2THFB 5EOKA 1EAUA 2FYQA 3Q3KA 3GDVA 4HTCH 5C1YA 1DWCH 2B0FA 1H9IE 3FP7E 2ANYA 4X1SU 2WPKS 3BTGE 1GJ5H 3MU1A 4I7YH 1O5AB 1GBFA 1J9CH 1KXFA 1Y5AT 2Z9GA 4E7RG 2BDIA 1SR5C 1C2MA 1RTLA 1H9HE 2ZCHP 2A2XH 1GMHG 3GCTF 1AN1E 1UVUH 2FIRH 4K60A 4NA7A 1F92A 5ABWA 5GPIB 2VIVA 2ANMH 3VXEH 2OC7A 1WQVH 4UE7H 1TPOA 5JYIA 2Z3CA 4J1YA 1PYTC 3SJ8A 1G36A 3P6ZB 5F6MA 3NPSA 3GDSA 1WCZA 2C8YB 5E0JA 4UEHH 4B74A 2FODA 1QGFA 4GCHG 1DM4B 4GHQA 6CHAB 5E2OA 4TYDA 1ZRBA 3LDXH 2FOFA 3BF6H 4NSYA 5T3HA 1E35B 1IHSH 1QJ1B 4DJZB 4ZKSU 1JWTA 1WOFA 2EI8A 3AASA 1P05A 4K3JA 2PR3A 1LPKB 1SL3A 1DLKB 1QBNA 1CE5A 1UTNA 1MBQA 1Y3YA 1HNEE 4DT7B 5K7RA 2ZIQH 1P01A 1ELGA 2H2ZA 3RXMA 1J16A 1ETRH 3FVFB 3RXIA 1J17T 3A7WA 2ZTXA 3OYPA 2NU1E 2RA3A 4A5TS 2R2MB 2VGCB 2ZU1A 3EA7A 1SVPA 4MVNA 1W11U 1HJ8A 5C5OA 1O2IA 3RXBA 3HGPA 1B0EA 1KYNA 1MUEB 1SBWA 1YPHE 3RXFA 3QN7A 3TH4H 3PO1C 1O5FH 1DY8A 1QL8A 3NXPA 3RMOH 2A45B 1DXPA 4BXWA 1QY6A 1EAXA 1KXBA 1OKXA 1SOZA 1N1LA 1GDNA 1OP0A 1XUFA 1A4WH 4JZ1A 3MU4A 1TOMH 4ABBA 4DOQA 1WTHD 2GP9B 4BAOB 2ZHEH 1JIRA 2BQ7B 1CQQA 3N7OA 1TMBH 1T4UH 1U6QA 4NWLA 1K1PA 1UVPA 4JMYA 1NU7B 3T5FH 3NKKA 1O3AA 3PLKA 4WMDA 3VB3A 1V2PT 1CO7E 1PPGE 2ZEBA 2ZGBH 2ZPQA 1O2XA 1XKAC 2PUQH 5E0HA 3MU5A 2Y82A 3MNBA 4U2WA 5GDSH 1DXWA 1WQSA 1C5WB 1GI5A 5C1UA 1YPHC 3K6ZA 2A4RA 1O5CB 3P70B 3MNSA 3UQOA 2AMDA 3AVZA 1BMMH 3R3GB 1C2EA 2OUAA 1OPHB 3PYHA 1HJAB 2ZHQH 1O2KA 5EXLA 3IG6B 3LJOA 3F9FA 1TPPA 1IQKA 2XBYA 1C5NH 1FUJA 1E0FD 3ZVCA 1L0ZA 1JMOH 1O30A 2RDLA 3RC4A 3M61U 1JIMA 1GJAB 1XUGA 3ZV9A 1TA2A 1GG6B 2KAIB 2A31A 3A87A 3RU4T 2O8TA 2VH0A 2O9QA 3C27B 5EXMA 1ANDA 1GBJA 1V6DA 3H7TA 2BDAA 5FX6A 1SC8U 1HIAB 1RRKA 1AFQB 3M7TA 4E06H 1TRYA 4YOIA 4X0WU 1F5RA 1S83A 1C2JA 4CRFA 4INHA 5EGMA 3LGYA 1NU9A 1OXGA 2ANKH 1ANCA 2J2UA 4DIHH 1GHWH 1GMDF 1MKWH 2GT8A 4FU9A 3O8BA 4OS5A 1NFXA 3KQBA 1DE7H 1UCYE 1EUFA 3A88A 2G5VA 4X1RU 5GIBA 3RMNH 5CHAB 3ZZ9A 2D26C 2BOKA 4ABFA 1W0ZU 4AFSA 2CHAC 3A80A 3PLPA 1TGCA 3KQEA 2G81E 1UO6A 2ZHWH 1HAZB 4CRCA 2Z9LA 3NCLA 1A0HB 1Z1IA 3V13A 2ZFPH 5LPRA 1Y5UT 4JYTA 3SU2A 3OY6U 1C1UH 2SGFE 4MPXA 3A8AA 3UIRA 1XMNB 1HBTH 4ZHAA 5JB8S 1PQAA 3A89A 2ODQA 4IGDA 4QT8C 4WWYA 4NZQA 1SGPE 1C2KA 3LGWA 4X6NA 2FESH 1O2MA 4WH6A 5JBTA 1AVXA 1Y3WA 1BRAA 1EJMA 2ZGCA 3FANA 2FTMA 4O03A 4DVAU 4GSOA 1CGHA 1O3OA 1QURH 2ZNKH 4WMFA 2BD9A 3M35A 2C8XB 2AMPA 1ZSLA 1GBTA 2GDEH 3DD2H 4KTCA 1LVOA 4MPVA 2CXVA 2Z9IA 1Y8TA 3VPKA 4MDSA 1MU6B 1ZHRA 4CRAA 3MU8A 2BVSH 2ZG0H 1FV9A 1SGFG 2W7SA 1W0YH 3RXCA 5E8EH 3LH3A 5J4SA 1NC6A 2FM2A 1UVSH 4B1TA 1VZQH 2V6NA 4FU8A 1AQ7A 3U98H 1XUIA 2HWLB 2TGDA 3RXTA 2QF0A 4OGXA 1MTNB 1FI8A 1GJ4H 1G3CA 3KL6A 3GCHB 1W7GH 1ESAA 1T32A 2TGAA 1TBZH 1P12E 1AWFH 4AFUA 2KAIA 1ELDE 2Z6BD 1BTYA 4JZIA 2EEKA 1P03A 2ZGXH 4GHTA 2F9PA 3LGTA 1NROH 2QGRA 2ZGHA 2B7DH 3TGIE 1P2IA 1ZMJA 5A0BA 1QR3E 5DK1A 4B2AA 3OY5U 1KXDA 3LGUA 2PKSC 1H4WA 1Z1JA 1D3PB 3F9HA 3M5OA 3SNBA 1GI1A 2P3UB 4Y10E 3BTHE 2VJ1A 1AIXH 1O3BA 2VIOA 1SLXB 1FPCH 3GYLB 5H4IB 3BTWE 1TNLA 4NFFA 2ZFQH 1EPTA 1M9UA 3UNQA 3UY9A 2PTNA 3RXDA 1UTKA 3QUMP 1RTFB 1EOJA 1C5MD 1HCGA 3CP7A 3A84A 1S0QA 5HYOA 1E38B 1CGIE 1C1VH 5TJXA 1ZSKA 3GYMA 1C5ZB 1VCWA 1AUTC 3A82A 1C1MA 2AIPA 2OBQA 2CGAA 1WSSH 4UFFH 3SV6A 1B5GH 5JPMH 1LPGB 4WJG2 2BM2A 1DWEH 1P0SH 2RCEA 1CBWC 1O3DA 2BVXH 2BXTH 1AU8A 4UD9H 4JZFH 3GICB 2IJOB 5F03A 2FWWA 3P17H 3HATH 3TVJB 1MQ5A 2JH6D 3MU0A 1XUHA 3STJA 1ZPBA 2BQWB 3P8GA 2OLGA 3GCNA 2SNWA 1W3CA 4R8TB 1EOLA 4ZXYH 1Z8GA 2Q6GA 2BLQA 4R0IA 1MQ6A 2WYGA 4O9VA 4YOJA 2DE8A 2XC0A 3NZIA 4CBNA 1K9OE 3DFJA 3I29A 2XW9A 1CHOF 5EPNA 2BDGA 1YLCA 1FXYA 1H8IH 1GI7B 1CT2E 3KN2A 2B5TB 3V0XA 5B6OA 1PPEE 2ZWLH 1YPJH 1CHGA 1J14A 2FOEA 1A46H 2WYJA 1C5UA 2QCYA 1AY6H 4NA9H 1GJ9B 2HOBA 5E0GA 3SV8A 4K8YA 4PROA 1EZSC 3HK3B 4MNXA 2VINA 1GL1A 1Z7KA 3U8OH 1YP9A 2ZF0H 2PKAB 1ZSJA 2OBOA 5HM9A 1QBOA 1AVGH 4Q7ZA 1PQ5A 1BDAA 2VH6A 3FZZA 4ZHLU 1SFQB 2OQUA 1VR1H 1PFXC 1RFNA 1LQDB 2AMQA 1HYLA 4OS1A 1O0DH 1YCPH 3BG4C 1V2WT 4X2WA 1O3LA 4Y6DA 5T6DA 4ZUHA 1T8NA 1L4DA 1P2OA 3SU4A 1HAOH 2BHGA 2IN2A 2ZC9H 2W7UA 5JDUB 2ESTE 2BZAA 2F91A 4XSKU 3O8RA 4KTSA 1W10U 5AFYH 3ZZ8A 1FY8E 3RXEA 1ABJH 1ACBE 1IQEA 1NRQH 3BG8A 1IQMA 1LHCH 2F9VA 5JBCS 1O2PA 1BQYA 2R0LA 1BTWA 1CGJE 2A5AA 4B76A 1TPSA 4GLYA 5TCCA 1P3CA 5FBIA 3RLWH 1ZTJA 1AGJA 1GI0A 3E6PH 1ZYOA 2C90B 2OCVB 2TIOA 3QTOH 4YT6H 2YNBA 1AFEH 1NESE 3ODFA 2A4QA 2AH4X 2STBE 2QYIA 3UR9A 3ZZ4A 3M5MA 1FJSA 2G51A 1SSXA 1E37B 2D1JA 2BY8X 1A61H 1XUKA 1TNKA 1FPHH 2LPRA 1ZHMA 1ID5H 3E91A 1GVKB 4MLFB 5ESTE 3TU7H 2TPIZ 1BRUP 3F1SB 1DDJA 1EB2A 1WYKA 4MPUA 1O3JA 3RMLH 2P59A 1JRSA 1F0RA 5IYTA 1Y5BT 2VVUA 3TJOA 3SBKA 3TPIZ 2NU4E 3BEUA 2Y81A 1L1JA 4Y11E 3ZZDA 2XWBI 2G00A 1EZUC 4HGCA 5GJ4B 1HFDA 3ZVAA 1YCPM 2OTVA 2A0QB 4X6MA 5CMXH 3ODDA 1P10A 5FBEA 5C1XA 1C2HA 2O8WA 2A4GA 3VB7A 2WPIS 3A7XA 1Y3VA 2PV9B 2Q1JA 1NT1A 1ESTA 1EXFA 1G3BA 1Y59T 2HLCA 1LHFH 4MNWA 3TK9A 1SLUB 3PM3A 1Y3UA 2VVVA 3RXHA 4BOHA 3EYDA 1KLJH 3LH1A 3TGJE 3RP2A 3S9BA 1GPZA 3VXFH 5K0HA 4I32A 1FLEE 2W3IA 1P09A 2PKAA 6ESTA 2UWOA 4BAQB 1AMHA 3UWIA 1BBRK 4B2BA 3M3SA 5C20A 4CHAC 1O37A 5DP7A 1GBMA 4X6PA 1LVMA 1O39A 2AEIH 1EZQA 2P93A 1K28D 4NIYA 1K21H 3HKIB 1V3XA 1K1MA 2UUKB 1YPGH 2BX4A 2GMTC 1ZJDA 4DW2U 1GDUA 1TWXB 1AB9B 1NFYA 2GZ7A 1GBBA 1KIGH 1L1NA 1V2UT 2W3KA 3LU9B 2SGQE 3RM2H 1AZ8A 1F0TA 5F8XA 5DGJA 3RXVA 4F4OC 3ZVDA 4NSVA 5ETXA 3GOVB 1HB0B 1GI4A 4LOYH 2P95A 1VCPA 1ZPCA 1C9TA 1YYY1 1BCUH 1C1TA 4ZROA 3TLOA 1C5OH 3PLBA 1VGCC 4SGBE 3CS7A 3V3MA 2J95A 4WY3A 4YLQH 1Q31A 3Q00A 1W7XH 3SUFA 4HFPB 1VITG 1ZMNA 3LGIA 4ISIH 4IN1A 4UONA 3LT3A 4ZKRU 1OYQA 4M7GA 1GJDB 3QGNB 4KELA 5JB9S 4ABIA 3LC3A 4FUJA 1C2DA 7GCHG 1A5HA 1FY3A 3DHKH 1T31A 4TY6A 1C5PA 3T2NA 4Y71A 1V2RT 2FTLE 1A5GH 1NFUA 3Q3XA 1GBDA 2NWNA 1PPBH 5A8ZA 3P8FA 4Q80A 1O5GH 1XKBC 2PKSB 3B8JA 4ISNA 1KLIH 1EKBB 3RXAA 3TH2H 1HJ9A 3ZZCA 5C3NA 2BY7X 5EQSA 2HPQH 3VB4A 1KY9A 4XBBA 1SGFA 5A0CA 4AB9A 1JOUB 3M3TA 3ZVGA 1HGTH 4B71A 4D76A 1P2NA 4YT7H 5F8TA 1EP6A 1P3EA 1T8OA 3U8TH 4JZEH 1HXEH 1VJAU 4DIIH 2GV6A 3TJNA 1P2MA 4Y8XA 2H6MA 1DLEA 4IMQA 4A7IB 1ZHPA 3QTVH 4JZDH 3E16B 2C8ZB 3QZRA 1ELFA 3VB6A 1P2JA 1Z8IB 1L4ZA 1GBEA 1V2VT 1GCTC 4AG1A 1O3MA 1TPAE 1C5RA 4YTAA 1UJ1A 2VWMA 4NCYA 1C5TA 1FAKH 3FP6E 2NU2E 2SGPE 1MD7A 2PWXA 2G5NA 5FX5A 3LGVA 4GUXA 3MFJA 2QA9E 2Y6TA 1HAHH 2P8OC 2ZU5A 2G4UA 3OSYA 2J4IA 1PPZA 3GY4A 3LONA 4X2YA 2GDDA 4Y8YA 1L2EA 1GHXH 1MKXK 2BOHB 5DP6A 2CV3A 4MNVA 5BPEA 3W95A 1PPCE 4AGKA 3U9AH 1GHVH 2FI3E 1A0LA 3BTFE 1BMAA 4SGAE 3ESTA 3RUOA 3TNSA 2PSXA 1GMHF 3Q77A 1WAYB 4I8HA 1GDQA 4LZ4B 1MAYA 5L2YH 2BLVA 4ISLA 1QCPA 2W5EA 1EX3A 4Y76A 4Y0ZE 4AN7A 1GI9B 1MMJN 1Z8JB 2ULLA 1BRCE 3SQEE 2WPMS 1KDQB 1LQEA 1LHGH 1ZR0A 3A85A 3AAVA </