1GI8B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
molecule tags Blood clotting, hydrolase
source organism Homo sapiens
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi8B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi8B01
2B0FA 4NIWA 2GGVB 4CH8B 1N8OC 1T8OA 1QA0A 2ZHDA 1SGNE 1UTQA 4IC6A 3SUDA 2QXJA 1OS8A 1TNIA 1EAWA 4AB9A 3TJVA 2BLQA 1O3NA 1T7CA 2J95A 1C1OA 1DITH 1BHXB 2BD2A 1CE5A 4ISOA 1O2SA 1V2WT 4OGXA 4XDEA 4DVAU 1W0ZU 1IQJA 1CSOE 1P8VC 4IMZA 1GI7B 5DP8A 5ETXA 2FOMB 1XM1A 2BTCE 3RP2A 1SB1H 1YPKH 3RXRA 1YLDA 1HBTH 2EI8A 1P0SH 3MH7A 2BD5A 1AIXH 1BRBE 1DXWA 5HM9A 3GDSA 4ABAA 1B7XB 1D9IA 1FQ3A 4BAHB 2G81E 3SU3A 3T28A 4B2CA 1QFKH 5AF9H 3QGNB 4XE4A 1ZOMA 1ELBA 3ZVCA 2PLXA 4UFDH 2KAIB 3BTEE 4NGAH 3A83A 1WCZA 2FLRH 4YTAA 1QBNA 1K1OA 1OWKA 3RXHA 2BMGB 1LHFH 1ZGIA 2ZECA 4AYVB 1H9IE 3LONA 2AMPA 1HXFH 2PHBA 5CHAC 4INLA 2OTVA 3SI4H 4AFSA 4AN7A 1C2IA 2JETB 2ZHFH 1SLVB 2ZDMA 1HJ9A 4X2XA 3TGIE 4A7IB 4Q80A 1MH0A 2GTBA 2O9QA 4CHAB 1ZZZA 3Q3XA 3SI3H 1JWTA 2V0BA 4X2YA 4FUDA 3RXEA 1EZUC 5T6GA 1UK4A 3G01A 4YLUA 3EA7A 1C1RA 1O3FA 1DLEA 2AERH 2C4FH 2BOKA 2G4TA 1YYY1 2PTNA 5C1YA 1C1SA 1ANBA 1VGCB 1O33A 3JZ1B 3RM0H 1FV9A 3RMMH 4GSOA 3MO3A 1SFQB 1ZJKA 2BB4A 1TPPA 2AMDA 3AW0A 4X1RU 1INCA 1MAYA 2Z3CA 1Y3VA 2YNBA 4KTUA 2GD4B 5A0BA 1GMCF 2F9BH 3PLBA 1O2GH 1HAXB 4TYDA 3GCTF 2BY5X 3TPIZ 4CHAC 1G30B 2NU0E 2J9NA 2GCTB 2ZHWH 1V2VT 2QAAA 5A8XA 1GHAF 3BEUA 4A1XA 2ANWA 1GBMA 1GPZA 7LPRA 4YT7H 1NRQH 2FXRA 4B76A 2FX4A 1ZTKA 4B71A 1GHZA 3SUEA 4NWKA 1EAUA 1XXFA 3LT3A 1THRH 1AVXA 1O3DA 1WTGH 1TRNA 1C1UH 1RD3B 4JYTA 1NTPA 1X7AC 2C3SA 1C5XB 3LOXA 1J9CH 3C1KA 1LDTT 1QBOA 1DY9A 1GGDC 1RFNA 1XVOA 4PROA 1GBEA 3UFAA 3VB3A 1HAVA 2ZFQH 1MKXK 4DY7B 3D62A 4O97A 3ZVGA 4FVBA 1QRWA 5FCRA 4UDWH 3SHAH 5JBBS 2F9UA 1AZZA 1TMUH 4BAKB 1AWHB 1N6XA 3GYLB 2XTTB 4X8SH 1AHTH 3GY5A 2QXGA 5EU8A 1Z1JA 1EQ9A 1FJSA 1QB1A 3LDXH 8GCHG 1NROH 3STIA 2ZDVH 4JZEH 4NSYA 1SR5C 4MLFB 2FIRH 1T8MA 2BD9A 2FDAA 2BDBA 2TGDA 4ESTE 1LO6A 3ZVEA 3IITA 1GCTC 2GT7A 1QJ7B 2AS9A 5I46H 4AFQA 2WYJA 4OS2A 2GMTB 5FPSA 3RMOH 1HUTH 1G32B 1QL9A 8KME2 2ZU4A 1A46H 2VWOA 3LJOA 1EUFA 2GX4A 1WUNH 3ATLA 1QY6A 3OTJE 3PROA 1C4U2 1JOUB 3A86A 2OP9A 3BIUH 3SNCA 3BTQE 1BMLA 4UFFH 4WMEA 1NFWA 2EC9H 2P59A 3OSYA 1AB9B 2FPZA 1A5IA 1TONA 3PB1E 4AGJA 4BAQB 3H5CB 2FWWA 1MTNB 5GIBA 1V3XA 1NZQH 1WBGB 1LQDB 1GVZA 3QZQA 1SI5H 2ANYA 3MU1A 4GCHF 2PGQB 3UIRA 1O2JA 2WUCA 1UK2A 1DUAA 2QGRA 1UJ1A 2A5IA 1F5KU 2Y7ZA 5AHGH 1CGJE 4Y7AA 1KXBA 2P3UB 1G37A 2HNTC 4CRDA 3BF6H 3FP7E 1BDAA 1V2TT 1D3PB 3M36A 1EZSC 3HGNA 4E7NA 1E35B 3M5LA 3N7OA 1VCQA 3ZVBA 5I25A 3NUMA 3ZYEA 3ZZ5A 1QL7A 5PTPA 3U8OH 3GY6A 2ZNKH 1QNJA 1P2OA 1C9TA 1NFYA 1UVTH 5A0AE 1CO7E 4K69A 4ISNA 1GL1A 1GI9B 2ZPQA 1EASA 3TJOA 5JB8S 1SLUB 1L1GA 4H42U 3FVFB 3RUOA 2BD4A 3P95A 3ZVAA 1EJAA 1EJMA 1LQEA 4AG1A 3O8CA 1IQMA 2WV4A 2CHAB 2FESH 1NN6A 1XUFA 1QJ1B 2AH4X 3KQCA 5FPYA 3PYHA 4CRFA 2FODA 2XBVA 3U9AH 4X6OA 1C2MA 1W0YH 3VB4A 1HAIH 2BVXH 5EXLA 3EGKH 5FBIA 3CENA 1ZMNA 1UVSH 1O31A 3SNEA 3MTYA 5JB9S 5L2YH 3KL6A 1EKBB 1ELFA 1CBWB 3PMHB 1FN6A 2ZCHP 2Q6GA 2Z9IA 4O9VA 4GLYA 3ZVFA 2ZQ2A 2HRVA 3L6PA 2OC0A 5E8EH 1O2MA 4X2VA 1C1QA 2QXIA 3DFLA 3K6YA 2WPHS 3TNSA 4IMQA 2B7DH 3RXKA 1O2KA 4R8TB 3S69A 1SQTA 2ZU2A 3CS7A 1AFEH 1IAUA 4WH6A 1TAWA 5TJXA 1FIWA 1AU8A 2R9PA 1C5VA 1WAYB 2V35A 1YPLH 3TH2H 4IGDA 2Y5HA 1CHOG 5GCHF 6GCHG 1O32A 1VITH 1BJUA 3UQOA 5C5OA 3HATH 1A3BH 3LC5A 1KTSB 1LTOA 7KMEH 3SQHE 5AVDA 4NG9H 1O2WA 1V2OT 4K8YA 3UUZA 1MU8B 1GI0A 1L1JA 2BXUH 2NU3E 4B1TA 2FYRA 2C90B 4K60A 1GBHA 1D6RA 2ZZUH 3RMLH 1GMHF 3VB5A 3AVZA 1AMHA 1Y3UA 5K7RA 1FY1A 4A92A 1PQ7A 2Q6FA 3F1SB 1W7XH 3HGPA 2DUCA 2P3TB 3AASA 1DICA 2ANKH 3UY9A 1FI8A 3RXDA 1HB0B 3B8JA 3LC3A 1MCTA 2OCVB 1TBQH 1NRRH 1LHDH 2ZHEH 1YPHE 5LPFA 3MI4A 3UNQA 3QO6A 1Y3XA 3KNXA 3URDA 3SNBA 4DIIH 2HNTF 4YT6H 4YZUA 3EYDA 1BMNH 1GBFA 2TGTA 1C9PA 1T8LA 2BQ7B 4CRGA 2OC1A 5CE1A 1IOEA 4H6SB 1A1RA 4HTCH 5E2PA 3D65E 1W11U 3NXPA 4NCYA 6ESTA 4F49A 1O3LA 1AVGH 3Q3YA 3RXIA 3BG4C 1GMDG 4WY3A 1O35A 3GDUA 1HDTH 4NSVA 5ESTE 4YM9A 3LJJA 1GJCB 1O2PA 1V2ST 3S9BA 3LIWA 1ZPBA 2FS8A 4J2YB 5JYIA 1DDJA 2PGBB 1GBKA 1OWIA 3MU5A 2B8OH 2VINA 3QZRA 1E37B 1TRMA 2ZGCA 3TK6A 3DT0H 5E0JA 1ZJDA 1A5GH 3RMNH 2F9OA 3QK1A 4K5ZA 1FAKH 1DPOA 2VIQA 1DT2A 1BZXE 4MVNA 1OWJA 2BVRH 4ZROA 5EXNA 1HAPH 2A4GA 2FI3E 3MWIU 1C5NH 1QJ6B 3VXFH 1Z8RA 1OP8A 4X1SU 3SNDA 1SGTA 1A7SA 2XXLA 3W95A 4FXGH 1ELVA 4Y76A 2FOEA 3VGCB 5DKMA 4D8NA 2XBYA 1GJ6A 2Y5FA 5AFYH 1EZXC 3BTME 1AUTC 3K9XB 1J14A 5EQRA 5A09A 1ZRBA 3BV9B 1AZ8A 1A2CH 4U32A 1P2MA 3BG4B 3GCHB 5L2ZH 1O3AA 3A7VA 3SO3A 1HAOH 1TA2A 4D76A 2SFAA 3SU0A 1W13U 2ZHQH 4JZFH 2TBSA 5F8ZA 1DLKB 5FXLA 2AIPA 5TCAA 4Y8YA 1F0SA 2R2WU 4NFEA 2Z3DA 1IQGA 2D8WA 2O8UA 4AFUA 1ELGA 1IQFA 1S6HA 3VGCC 3TJUA 4BTUB 1NESE 1V2UT 2A7CA 3RXTA 3GY4A 5EW1H 1PQAA 2AIQA 2GKVE 1C5WB 2P8OB 1DWCH 1OP0A 2SGPE 3KF2A 2J2UA 2XC5A 2VVCA 4M7GA 1ANEA 1EAIA 1FMGA 4BAMB 3VFEA 2SNWA 1K1LA 2ZGBH 5EPNA 1TGBA 3PLPA 1GI1A 3RU4T 3V13A 4ISLA 1GVLA 2H6MA 1HIAA 1UTJA 2SGQE 1DM4B 1NS3A 1CVWH 3ZYDA 4A1TA 1JMOH 1TOCB 1FXYA 4ZH8A 2ZU5A 1T4VH 2ZFFH 4NA8A 1IQLA 4WVPE 2RA3A 1BTXA 1WQSA 3A7WA 1C5MD 1YPGH 1ACBE 1BB0B 5HXFA 4NIYA 3ELAH 3DD2H 1SBWA 2R2MB 1D4PB 1MQ6A 1GI4A 1G3DA 1H9HE 2M5TA 1MBMA 2A7JA 4MNWA 1MTNC 2PSXA 1B0FA 1QGFA 1K1NA 2VIWA 1EATA 1THPB 3GISB 3NKKA 1SSXA 2YNAA 1T8NA 2AGGX 1O3PB 1JBUH 4I8JA 4KTSA 3ESTA 2BQ6B 1SQOA 5E0HA 1TABE 1TWXB 1UCYH 1V2NT 2BD8A 3IWMA 1FUJA 4Y8XA 3T27A 5JBCS 2CHAC 2Z9JA 1P06A 3FANA 3U8TH 3BTWE 1SGIB 2FS9A 3MO9A 4FUIA 3K6ZA 1RS0A 3A7YA 1K28D 1CHGA 1HYLA 4UONA 3DHKH 5EPYA 5L6NH 1A0HB 1GBAA 1Y59T 2BDYA 2EEKA 4Y8ZA 4CRBA 1FY5A 1ZR0A 3BTGE 1Z6JH 4X1NU 1K22H 1IQIA 4OGYA 3SV2H 3EAJA 1CA0C 2C93B 1GI5A 2FOCA 3VB6A 1WYKA 3ZZ3A 1XKBC 2GZ7A 1P04A 2D26C 3MU0A 1TRYA 1C1MA 5FPTA 3TGJE 1GHBG 1N1LA 2PV9B 5G4BA 3Q77A 1YBWA 1ORFA 3LPRA 5F6MA 1P3CA 5T6DA 4TPIZ 4GVUA 1AWFH 2O8MA 1P02A 3TU7H 2ZFRH 1GJDB 3BN9A 2TGAA 1UTOA 4CH2B 3UR9A 3TNTA 1G3EA 1EXFA 3MNSA 2UWPA 3HKJB 2PTCE 1VR1H 2FI5E 1YCPH 1KLJH 5C20A 4DIHH 2WPMS 1VGCC 1FY3A 2J34A 1CA0B 1LKAA 1AGJA 3MOCA 1ZMLA 3PO1B 1G3BA 1BTHH 3U69H 1AUJA 1Z1IA 1DANH 1C5TA 4IC5A 3PTNA 2BD7A 4CBNA 3OX7U 1ZSKA 2DE8A 1NT1A 5J4SA 1O2TA 4I32A 3NPSA 3T29A 1GMDF 1AE5A 2ODQA 1OXGA 3P70B 1EZQA 2BY7X 1XMNB 3TVJB 1KXCA 4DJZB 2A4OA 2H2ZA 2BDIA 1S85A 5DP9A 1ZHPA 2G52A 1HGTH 4FUJA 1TNLA 4BXSA 3P8GA 1LVOA 1WOFA 1LKBA 1TNHA 4UFGH 1P2JA 2HALA 2B9LA 4XOJA 1GL0E 2XCNA 4F4OC 1F0UA 2PSYA 1O2HA 4Y7BA 2FO9A 1O3HA 3SW2B 1NRSH 3ITIA 2ZA5A 1UTLM 5DP6A 1K1MA 1P01A 1TALA 2Z9LA 4LXBH 4MPWA 4GHQA 3MO6A 2NWNA 4BTIB 2ZFSA 2P95A 1ZRKA 1TQ0B 1EPTA 4HFPB 3A89A 2HLCA 2BQWB 1TX8A 2XBWA 2BLVA 1G9IE 1SPJA 2VWLA 3SBKA 2Y7XA 1MZAA 2QF0A 1MAXA 1HJAB 1FY8E 3URCA 1YPJH 3ZZBA 1A0LA 1RXPA 4ZXYH 3RC5A 3H7OA 1MKXH 1QTFA 1W2KH 2FM2A 4KTCA 2IOTA 1P09A 2ILNA 5DGJA 4ZXXH 1MQ5A 3MH6A 4I8HA 1C1PA 3MNBA 1D3DB 2LNCA 1ELEE 2QXHA 4BXWA 1C2GA 1C2DA 3VB7A 5K0HA 4HI3A 2ZG0H 2BD3A 4WF8A 3RXBA 5GXPA 1TNGA 2ZO3H 1TBZH 1XX9A 4I7YH 1DVAH 4TPYA 4BOHA 1F92A 3TLOA 4ZHLU 3TH3H 1KXEA 1LHEH 3F9HA 3RXUA 1YGCH 4MPXA 1MZDA 4IN2A 2OC7A 3QLPH 4H6TA 4ZHMU 1C5YB 3T26A 3M35A 4NZLA 2CJIA 4Y10E 3UQVA 1AB9C 1ZLRA 2WPKS 1LCYA 2F83A 1GHVH 1A4WH 1ETRH 1C1VH 1VITF 1L4DA 3MYWA 1FPHH 2UWOA 3E16B 3FP8E 1SGCA 3F6UH 3PMBB 4GCHG 1S84A 3UREA 2SGFE 2OUAA 3OY5U 3D23A 3SU1A 4MG3A 1PQ8A 1BUIA 1GDUA 3GCOA 6CHAC 1HJ8A 1BTYA 2BLWA 2R3YA 6LPRA 9ESTA 3PTBA 1PYTD 1ETSH 1O37A 1SGRE 3NK8A 3LH3A 1E34B 1C4Y2 3CS0A 1GJ9B 3M61U 2BDAA 3LGVA 4OS5A 4U2WA 2BOHB 4VGCB 4AB8A 1RRKA 4CRCA 1EP6A 1GDQA 2PW8H 1XUJA 2PKSC 3SORA 2ALPA 4JZDH 1TE0A 1GWAA 4A6LA 1KYNA 1C1NA 3BTDE 2NU4E 2R0KA 4ABGA 1C4V2 4JMYA 5DP4A 5JDUB 3RXOA 1DSUA 3UNRA 2WINI 3DA9B 2QA9E 4DURA 1A0JA 1ANCA 4MNXA 2ZQ1A 1TIOA 3RLWH 1O3MA 1NRPH 5A0CA 3EQ0H 4X6MA 1MTVA 1ZSJA 1BTWA 4YOGA 1YPHC 4FUHA 1O2OA 4X6PA 2H1UA 1JIRA 1S0RA 1O2ZA 2ZEBA 4I33A 1SGDE 1CHOF 2FZZA 1MBQA 3FP6E 1P9SA 4Y71A 2Z94A 1F0RA 2A31A 2ZC9H 4OS6A 1YCPM 3A85A 3GCHC 4KP0A 2ASUB 1VCWA 1E36B 1MD8A 1EAXA 1AFQC 1THSH 1EB1H 5ESBA 3SJ9A 2CV3A 4UD9H 2H5DA 1H9LB 3NCLA 1OX1A 1Y3YA 2THFB 4J1YA 5EODA 2ALVA 2FOFA 5HM2A 4Y6DA 1P2NA 3ZZDA 1IHTH 1ABIH 4LOYH 4AYYB 3GY8A 4Q7XA 3S9CA 1LVMA 2H9EH 1XXDA 1KIGH 2BVSH 3PMJA 1SVPA 4KELA 1Z8GA 1ANDA 1O5CB 1N8OB 4WH8A 1C2JA 5FBEA 3RM2H 1OOKB 2VH6A 3UNSA 3S7KB 2J4IA 4DT7B 1XUGA 2V6NA 4A1VA 4ABBA 1FIZA 2QN5T 1AN1E 3EDXB 4FUCA 2XWBI 5IYTA 2VH0A 1YF4A 4MTBA 2NU2E 1H4WA 1SG8B 2ZDNA 1TYNA 2GVFA 1P12E 1C5SA 1FNIA 2VIVA 3E3TA 3RXSA 1ARBA 3S0NA 5F8TA 5GDSH 3A84A 1P2QA 5IDKA 2R0LA 5GWZA 2UUJB 3M5NA 4U01A 1LPZB 2OXSA 1EX3A 4D9QA 4CRAA 2ZGXH 3E91A 3M3VA 3P8NA 3C27B 1HLTH 2WPLS 4WWYA 1ZGVA 1GJ8B 1OWEA 3GOVB 1HAVB 1ZHRA 4YOIA 4DW2U 2GP9B 4ZHAA 4XBBA 1GI2A 2EI7A 2OD3B 5AFZH 5T6FA 1SHHB 4LZ4B 2ZDKA 4ZAEA 4CBOA 3IG6B 4ISHH 4TWWA 3RXQA 3I78A 1WSSH 4K1TA 1T4UH 3TJNA 2D1JA 1GJ7B 4HGCA 1CT0E 1UTMA 1DWBH 1MU6B 1K1IA 2V3HH 1UMAH 1EOJA 1O3OA 1BTUA 1KTTB 1GGDB 1TFXA 3K2UA 5J4QA 3TGKE 1OPHB 3SJ8A 4XSKU 5GPIB 4JZIA 1B5GH 2FMJA 3BG8A 5CHAB 4Q7YA 3WY8A 4K8BA 1PQ5A 1KXAA 1Z8JB 1Q3XA 5EOKA 1GI3A 1FAXA 1SGYE 3T2NA 1BQYA 3QN7A 1Z71A 1AO5A 3B9FH 5DP5A 3A81A 3RXLA 3E90B 3LH1A 2UWLA 1EJNA 4XBCA 3MMGA 2QY0B 3U98H 5LPRA 3ZZ4A 1ESAA 3MNCA 3KQBA 2RCEA 1A3EH 4Q7ZA 1W7GH 2Y6TA 1GJ4H 2GCTC 3M7TA 4ZMAH 4MNVA 2ESTE 3F9GA 1TBRH 4O3TA 2PKAA 3SUGA 3MFJA 1QQ4A 2AEIH 3RXAA 4XFQA 4K1EA 5EXMA 3GCNA 3LKWA 2UUYA 5FX6A 1O5BB 1HAHH 3QTOH 1DOJA 1NFXA 1D3QB 4JK6A 2A32A 4INHA 5FCKA 4Y0YE 1DXPA 2GT8A 4NIXA 2ZI2H 3LGWA 2C8WB 1SFIA 4I31A 2GV7A 2OINA 1GBTA 2ZGJA 2Y82A 4JYUH 2OC8A 8GCHF 2ZPRA 4FUBA 1FPCH 3BTTE 2VVUA 1NRNH 3D49H 1SGFG 2FYQA 4WMFA 1P9UA 1LHCH 3T5FH 1C2KA 4O03A 5LH8A 2VGCB 4Q2KA 1O39A 3EE0B 1O5DH 3TITA 3Q76A 1BIOA 2F91A 1Q2WA 2LPRA 1YKTA 1SQAA 3HK3B 1XVMA 1LPGB 3SU4A 1A61H 1GJAB 5TCCA 1GMCG 1O3JA 2P16A 1CT4E 4CR5A 3P17H 3M5OA 1VCPA 3K65B 2Z7FE 4LK4A 1P03A 2CMYA 2V3OH 3AW1A 2KAIA 2A5KA 1UHBB 2ZTYA 2PR3A 1LVYA 3SHCH 3M7UA 1RIWC 1ABJH 2HGTH 2OQUA 2FOAA 4NWLA 2ZPSA 1QA7A 3RC6A 1V2LT 4RKJB 2XBXA 2SGDE 2WV5A 1SMFE 3SU5A 2Y81A 4H4FA 3SU6A 1VZQH 2XCFA 3BSQA 1Y5AT 2Z3EA 1PYTC 3DFJA 1ELTA 3ATKA 2BHGA 2P3FH 1GG6C 1SHYA 3AAVA 4FU7A 3O8BA 1YCPK 3ATIA 1FY4A 1HIAB 2HVXA 5LGOA 3BEIB 3LGUA 4ASHA 3MHWU 1YM0A 1C1TA 1ZPZA 2IJOB 2ZTZA 4ZKOU 1Y8TA 3M3SA 1O5GH 1IHSH 3ZZ7A 1M9UA 3ZZAA 1QHRB 2VIDA 5C67A 1QL8A 4GPGA 4YO9A 1O2QA 1S83A 1W10U 2ANMH 2F9PA 1DE7H 1PPEE 3OYPA 2XYAA 1QRZA 1EOLA 1PJPA 2BZ6H 1TLDA 5FAHA 1UTPA 1O5FH 1GI8B 1F5RA 1TMBH 3A7TA 3O8DA 5C1XA 3A87A 1C5QA 4D9RA 1QB9A 1ETTH 1GBLA 1HAGE 1BCUH 3SZNA 1BBRE 4TY7A 7ESTE 1MTUA 4D7GA 3E0NB 1OYQA 2FOHA 3A8CA 1TMTH 1RTLA 1YC0A 1CQQA 1OYTH 5A2MH 1SLWB 4A5TS 5GCHG 1J17T 1ZSLA 4VGCC 2XWAA 2ZF0H 3I77A 1NO9H 3MH5A 3KHVA 1O30A 1TGSZ 1T31A 1EP5A 3UPEA 1YPEH 3FZDA 4K2YA 2BY6X 3FAOA 1O2UA 4IN1A 3M3TA 1P05A 4ABDA 2G8TA 1EPTB 1WU1A 1BHXF 1TGNA 3M37A 2ZU3A 1IQEA 1WQVH 4UEHH 6GCHF 2VWMA 3L3TA 2HOBA 2BXTH 3PWBA 3TH4H 1O5EH 4FUEA 1GJBB 7GCHF 2VB0A 1NM6A 3ZVDA 3V12A 9LPRA 1BTZA 2AMQA 4JK5A 1BOQA 4X8UH 2BY9X 3A82A 1NC6A 2OLGA 4E7RG 3P6ZB 1KSNA 5JBTA 1CU1A 4GAWA 1CGHA 1VJAU 2B5TB 3BTHE 3UOUA 1AKSA 1GHXH 2ZU1A 3SU2A 3KIDU 1L4ZA 5C3NA 1WV7H 1ZYOA 2O8WA 1P11E 1Z6EA 4CREA 3ODDA 4RSPA 3P92A 2C8YB 3RXPA 1AQ7A 1AE8H 2XW9A 1A5HA 1C5RA 4BAOB 1BMAA 3S7HB 1DS2E 2XC4A 5CMXH 4ZKRU 4CR9A 1JRSA 3QWCH 4B2BA 3U1IB 2VGCC 1QR3E 1ZPCA 4E05H 3SN8A 1T32A 1TGCA 1NPMA 1D3TB 3EA8A 4NFFA 3SUFA 3E0PB 1DWDH 1HNEE 1GBBA 2PUXB 1ELCA 4MPVA 1O38A 1F2SE 1O2XA 1CT2E 2G00A 2QIQA 3L33A 5EGMA 3V7TA 5EQSA 4NIVA 1VJ9U 1IQHA 1O0DH 5A8YA 1Y5BT 5A8ZA 5EW2H 4ABHA 4I8LA 2BDGA 3KEEA 5DO4H 1SL3A 3U8RH 3Q00A 1HPGA 1Q31A 2I6QA 2GMTC 4WMDA 3V0XA 1MKWH 1TPOA 1C5UA 2CN0H 2HWLB 1C5ZB 2FP7B 4AORA 3TIUA 4BANB 1F0TA 2STAE 4WJG2 1TGTA 1MTSA 1UVUH 2QC2A 3LGIA 2CF8H 1G3CA 3UWIA 2ZIQH 2PKAB 2BYAX 8ESTE 3MU8A 3SGAE 3RXVA 1DX5M 1O2RA 3PMAB 2A1DB 1QBVH 2FI4E 2BY8X 1HJAC 3RC4A 3HPTB 5FX5A 1K1PA 1MUEB 1O2VA 1IQKA 1PPHE 2PFEA 3STJA 4QT8C 2QF3A 4GUXA 1C2HA 2Z6BD 3ODFA 5HGGA 5EQQA 3E8LA 5DPAA 2XC0A 1GHYH 2ZTXA 3RXGA 2O8TA 4IS5A 4MPUA 2VIOA 1U6QA 2W26A 2VWNA 1ZTJA 4RKOB 1RGQA 4AG2A 5HMAA 4INKA 1N6YA 1L1NA 1RTFB 1G2MA 2A2QH 3GY7A 2GZ9A 2SNVA 5DP7A 1TPAE 5DG6A 4Y79A 3PWCA 2UUFB 5F8XA 3ZZCA 2OBOA 2BX3A 1PPGE 2FEQH 2Q6DA 3OU0A 5SGAE 1O2NA 2AGEX 4MDSA 1C5PA 2W7SA 4FUFA 3VPKA 1V6DA 1O2LA 2PUQH 3ATMA 2W3KA 1V2PT 2D2DA 2BLOA 4KKDA 3I29A 3M5MA 1NY22 1NFUA 1ZMJA 5EG4A 1BTPA 2UUKB 3FFGA 4ABEA 4AFZA 3ATWA 3BTKE 3PM3A 2OQ5A 4ZUHA 2XNIA 2GCHG 3KGPA 1FONA 1GHWH 2J94A 1UVOA 1ZHMA 2A4QA 4ABIA 1O3GA 3ZZ8A 3Q3KA 1S5SA 3BEFB 1SOTA 1L0ZA 1SGEE 4JYVH 8LPRA 3P8FA 2OBQA 1JIMA 1PPBH 1C5OH 1GCDA 1Z7KA 2PWXA 3QGJA 3GYMA 3QDZB 3GY3A 4Y11E 2Z9GA 3UWJH 2ZFPH 3MU4A 3SJOA 1NU7B 2CXVA 2TIOA 1PFXC 1ID5H 5C5NA 3W94A 2A0QB 4DCDA 1EB2A 1O3CA 4GHTA 1O3EA 2HPQH 1KDQA 1F7ZA 2GDEH 4WXVA 2JETC 1BBRK 2P8OC 4X2WA 1W12U 2WUBA 2H9TH 2XRCA 1MCVA 4WXIA 1HFDA 2GDDA 4IW4E 4DGJA 1VITG 5C2ZA 1P2KA 4ABJA 2G51A 4X1PU 1HCGA 1BRUP 2ZP0H 1TX7A 2SGAA 1UCYE 2FX6A 3SV8A 1TPSA 1UHBA 1FZZA 1OSSA 1HAZB 1AY6H 2P94A 1W14U 2J92A 5FHTA 1GCTB 2F9NA 1OP2A 1ESBA 2IPHA 3LGYA 3A8AA 4K1SA 4XBDA 4B75A 2Y80A 3LU9B 4OS4A 1UO6A 3B23B 3NZIA 4TY6A 1XUKA 2VU8E 4DG4A 3DUXH 3A88A 1H1BA 1DUEA 2ZFTA 1GHBF 1KLTA 2HPPH 1B0EA 1GHAG 1HXEH 1MTWA 1UCYK 4FUGA 1O34A 4BNRA 4ZKNU 1QB6A 2RA0A 1PPFE 2QYIA 4B74A 3RU4E 3GCTG 2ZWLH 1UTKA 3RXCA 2WYGA 1MMJN 1DFPA 1TQ7B 1JXPA 1LPKB 3M7QA 3SV9A 2Z9KA 1ELAA 4NZQA 4Z6AH 2J38A 1CBWC 1J15A 1V2MT 2ZGHA 3KN2A 1CGIE 2ZCLP 3SOSA 3SNAA 3RXFA 1SC8U 1RIWB 1GJ5H 2CGAA 3AAUA 4ISIH 1L2EA 2BDHA 1GBDA 3ZZ6A 3GDVA 1C2FA 3RLYH 5DJ7A 4K3JA 4X1QU 4Y0ZE 2AFQB 1SLXB 3FZZA 1HV7A 3HKIB 1V2QT 3KQDA 4X8VH 1LHGH 1XUIA 5C1UA 1CA8B 3P8OA 1SGPE 4ZKSU 3RDZA 1G2LA 2VVVA 1GG6B 2W7UA 1K2I1 2G5VA 3A8BA 5LPEA 3ZZ9A 4JZ1A 1YPMH 1TOMH 2F9VA 2GV6A 2BM2A 1GBIA 1BITA 1GBCA 5H4IB 2FOGA 4YLQH 5HYOA 1Y3WA 2ODPA 2JH5D 3RXJA 4X8TH 4OS1A 1YLCA 2O8LA 2QCYA 2RG3A 2F3CE 2YOLA 1MD7A 1BRAA 4NA7A 1UTNA 3BIVH 1DSTA 4UE7H 1NU9A 5JPMH 4X0WU 1AVWA 1BA8B 3GICB 5L30H 2A4RA 1S82A 2IN2A 2AYWA 4AX9H 1D6WA 2CF9H 1E0FD 1V2RT 3E1XB 3UR6A 1GMHG 1WTHD 3TK9A 3F9FA 1W8BH 1OKXA 2W5EA 1Z8IB 2BZAA 3BTFE 2GCHF 2EA3A 4DOQA 4I8GA 3EA9A 4AGKA 3MNXA 2VIPA 2FLBH 1S6FA 4AOQA 1O2IA 3A80A 2BX4A 5B6OA 2VNTA 1V2JT 1KXFA 1C2LA 1QIXB 3F9EA 3GY2A 1BJVA 4FVDA 2TGPZ 3R0FA 1FLEE 4D7FA 1BT7A 2PKSB 2VJ1A 3H7TA 2AGIX 1QURH 2DE9A 3KQEA 4U30A 4AZ2B 4B2AA 1GBJA 1C2EA 4B73A 4R0IA 1RJXB 1EPTC 4FU8A 1W3CA 1ARCA 1O3KA 2C8ZB 1ESTA 3QUMP 1Y5UT 5T3HA 1TX6A 1KY9A 3JZ2B 3UOPA 1HRTH 1O5AB 1UK3A 5GJ4B 3CP7A 2A2XH 2ODYB 3SQEE 1OWDA 1TB6H 1PPZA 3T25A 3NWUA 1O3IA 1J16A 4MNYA 1C5LH 1S0QA 2A7HA 3E6PH 1J8AA 1XKAC 5E2OA 2TPIZ 3MH4A 2TRMA 1O3BA 1TNJA 2SGEE 1FDPA 1SGQE 1KLIH 1K9OE 1P3EA 2WPJS 1P57B 3PLKA 2W3IA 1P10A 5E0GA 4FU9A 1AKSB 1OWHA 1H8DH 2ZCKP 1O36A 1DY8A 2K1QA 2ZKSA 3T62A 5DP3A 2NU1E 2G4UA 2I6SA 3VXEH 1AFQB 3HK6B 4IBLH 3O8RA 1BRCE 4LZ1H 1TA6A 1S81A 5BRRE 4THNH 1G36A 3A7XA 4KGAA 4YESB 2JH6D 2H5CA 1K21H 4Z0KA 1K1JA 4UFEH 3SV7A 3TK5A 4TWYA 5JBAS 2QV1A 2Y5GA 2FTMA 2JH0D 3S9AA 4SGAE 2C8XB 1E38B 1KXDA 1LMWB 4RN6A 1RTKA 2R3UA 6CHAB 1ELDE 3A7ZA 1O2YA 3PO1C 1SOZA 1GVKB 1PPCE 3PV4A 1H8IH 2JKHA 1BBRH 1ZTLA 3SGQE 1FN8A 3ZV9A 3U1JB 2ULLA 4BTTB 3A8DA 3F68H 3RXMA 4HZHA 4JCNA 1QQUA 2EI6A 3R3GB 4X6NA 1XUHA 1GDNA 1V2KT 1LVBA 2A45B 3ZV8A 2BDCA 4NA9H 7GCHG 1F5LA 5F03A 1IQNA 3ENSB 2P93A 1QCPA 1YP9A 5DK1A 1JRTA 2G5NA 3KCGH 1AI8H 3OY6U 5BPEA 1GI6A 1MKWK 3SJIA 1AD8H 3SGBE 1TNKA 3LGTA 1UVPA 2HNTE 4MQAA 3RU4D 5ABWA 2ZDAH 2FTLE 1C1WH 1BMMH 1QRXA 3SJKA 2RDLA 4YOJA 3SV6A 1SGFA 3QTVH 3UTUH 2ZDLA 2G55A 1KDQB 2GZ8A 1P2IA 4OS7A 1DWEH 2FOBA 2Q1JA 4ABFA 4SGBE 4O3UA 2STBE 1HAYB 2WPIS 2A5AA 2H9HA 3QX5H 3VEQB 4I8KA 4E06H 3V3MA
chains in the Genus database with same CATH superfamily
2B0FA 4NIWA 2GGVB 4CH8B 1N8OC 1T8OA 1QA0A 2ZHDA 1YWUA 1SGNE 1UTQA 4IC6A 3SUDA 2QXJA 1OS8A 1TNIA 1EAWA 4AB9A 3TJVA 2BLQA 4B6FA 2IJD1 1O3NA 1T7CA 2J95A 5C0TA 1C1OA 1DITH 1BHXB 2BD2A 1CE5A 4ISOA 1O2SA 1V2WT 4OGXA 4XDEA 4DVAU 1W0ZU 1IQJA 1CSOE 1P8VC 4IMZA 1GI7B 5DP8A 5ETXA 2FOMB 1XM1A 2BTCE 3RP2A 1SB1H 4OM9A 1YPKH 3RXRA 1YLDA 1HBTH 2EI8A 1P0SH 3MH7A 2BD5A 2RFKC 1AIXH 1BRBE 1DXWA 5HM9A 5C0UA 3GDSA 4ABAA 1B7XB 1D9IA 1FQ3A 4BAHB 2G81E 3SU3A 3T28A 4B2CA 1QFKH 5AF9H 3QGNB 4XE4A 1ZOMA 1E1RD 1ELBA 3ZVCA 2PLXA 4UFDH 2KAIB 3BTEE 4NGAH 3A83A 1WCZA 2FLRH 4YTAA 1QBNA 1K1OA 1OWKA 3RXHA 2BMGB 1LHFH 1ZGIA 2ZECA 3FKSD 4AYVB 1H9IE 3LONA 3PV5A 2AMPA 1HXFH 2PHBA 1S6LA 5CHAC 4INLA 2OTVA 3SI4H 4AFSA 4AN7A 1C2IA 2JETB 2ZHFH 1SLVB 2ZDMA 1HJ9A 4X2XA 3TGIE 4A7IB 4Q80A 1MH0A 2GTBA 2O9QA 4CHAB 1ZZZA 1FX0B 3Q3XA 3SI3H 1JWTA 2V0BA 4X2YA 4FUDA 3RXEA 1EZUC 5T6GA 1UK4A 2KCPA 3G01A 4YLUA 3EA7A 1C1RA 1O3FA 1DLEA 2AERH 2C4FH 2BOKA 2G4TA 1YYY1 2PTNA 5C1YA 1C1SA 1ANBA 1VGCB 1O33A 3JZ1B 3RM0H 1FV9A 3RMMH 4GSOA 3MO3A 1SFQB 1ZJKA 2J97A 2BB4A 1TPPA 2AMDA 3AW0A 4X1RU 1INCA 1MAYA 2Z3CA 1Y3VA 2YNBA 4KTUA 2GD4B 5A0BA 1GMCF 2F9BH 3PLBA 1O2GH 1HAXB 4TYDA 3GCTF 2BY5X 3TPIZ 4CHAC 1G30B 2NU0E 2J9NA 2GCTB 2ZHWH 1V2VT 2QAAA 5A8XA 1GHAF 3BEUA 4A1XA 2ANWA 3FO8D 1GBMA 1GPZA 7LPRA 4YT7H 1NRQH 2FXRA 4B76A 2FX4A 1ZTKA 4B71A 1GHZA 1WDIA 4NWKA 1EAUA 3SUEA 1XXFA 3LT3A 1THRH 1AVXA 1O3DA 2J98A 1WTGH 1TRNA 1C1UH 1RD3B 4JYTA 1NTPA 1X7AC 2C3SA 1C5XB 3LOXA 1J9CH 3C1KA 1LDTT 1QBOA 1DY9A 1GGDC 1RFNA 1XVOA 4PROA 1GBEA 3UFAA 3VB3A 1HAVA 2ZFQH 1MKXK 4DY7B 3D62A 4O97A 3ZVGA 4FVBA 1QRWA 5FCRA 4UDWH 3SHAH 5JBBS 2F9UA 1AZZA 1TMUH 4BAKB 1AWHB 1N6XA 3GYLB 2XTTB 4X8SH 1AHTH 3GY5A 2QXGA 5EU8A 1Z1JA 1EQ9A 1FJSA 5C94A 1QB1A 3LDXH 8GCHG 1NROH 3STIA 2ZDVH 4JZEH 4NSYA 1SR5C 4MLFB 2FIRH 1T8MA 2BD9A 2FDAA 2BDBA 2TGDA 4ESTE 1LO6A 3ZVEA 3IITA 1GCTC 2GT7A 1QJ7B 2AS9A 5B6LA 5I46H 4AFQA 2WYJA 4OS2A 2GMTB 5FPSA 3RMOH 1HUTH 1G32B 1QL9A 8KME2 2ZU4A 1A46H 2VWOA 3LJOA 1EUFA 2GX4A 1WUNH 3ATLA 1QY6A 3OTJE 3PROA 1C4U2 1JOUB 3A86A 2OP9A 3BIUH 3SNCA 3BTQE 1BMLA 4UFFH 4WMEA 1NFWA 2EC9H 2P59A 3OSYA 4TT3D 1AB9B 2FPZA 1A5IA 1TONA 3PB1E 4AGJA 4BAQB 3H5CB 2FWWA 1MTNB 5GIBA 1V3XA 3FOAA 1NZQH 3F2HA 1WBGB 1LQDB 1GVZA 3QZQA 1SI5H 2ANYA 3MU1A 4GCHF 2PGQB 3UIRA 1O2JA 2WUCA 1UK2A 1DUAA 2QGRA 1UJ1A 2A5IA 1F5KU 2Y7ZA 5AHGH 1CGJE 4Y7AA 1KXBA 2P3UB 1G37A 2HNTC 4CRDA 3BF6H 3FP7E 1BDAA 1V2TT 1D3PB 3M36A 4XD7D 1EZSC 3HGNA 4E7NA 1E35B 3M5LA 3N7OA 1VCQA 3VG8A 3ZVBA 5I25A 3NUMA 3ZYEA 3ZZ5A 1QL7A 5PTPA 3U8OH 3GY6A 2ZNKH 1QNJA 1P2OA 1C9TA 1NFYA 1UVTH 5A0AE 1CO7E 4K69A 4ISNA 1GL1A 1GI9B 2ZPQA 2JDID 1EASA 3TJOA 3N7DA 5JB8S 1SLUB 1UW7A 1L1GA 4H42U 3FVFB 3RUOA 2BD4A 3P95A 3ZVAA 1EJAA 1EJMA 1LQEA 2RDEA 4AG1A 3O8CA 1IQMA 1VKYA 2CHAB 2FESH 2WV4A 1NN6A 1XUFA 1QJ1B 2AH4X 3KQCA 3AK5A 5FPYA 3PYHA 4CRFA 2FODA 2XBVA 3U9AH 4X6OA 1C2MA 1W0YH 3VB4A 1HAIH 2BVXH 5EXLA 3EGKH 5FBIA 3CENA 1ZMNA 1UVSH 1O31A 3SNEA 3MTYA 5JB9S 5L2YH 3KL6A 1EKBB 1ELFA 1CBWB 3PMHB 5EJZA 4ZCNA 1FN6A 2ZCHP 2Q6GA 2Z9IA 4O9VA 4GLYA 3ZVFA 2ZQ2A 2HRVA 3L6PA 2OC0A 5E8EH 1O2MA 4X2VA 1C1QA 2QXIA 3DFLA 1YY3A 3K6YA 2WPHS 3TNSA 4IMQA 2B7DH 3RXKA 1O2KA 4R8TB 3S69A 1SQTA 3MQKC 2ZU2A 3F0PA 3CS7A 1AFEH 1IAUA 4WH6A 1TAWA 2CK3D 1FIWA 5TJXA 1AU8A 2R9PA 1C5VA 1WAYB 2V35A 1YPLH 2J5UA 3TH2H 4IGDA 2Y5HA 1CHOG 5GCHF 6GCHG 1O32A 1VITH 1BJUA 3UQOA 5C5OA 3HATH 1A3BH 3LC5A 1KTSB 1LTOA 7KMEH 3SQHE 5AVDA 4NG9H 1O2WA 1V2OT 4K8YA 3UUZA 1MU8B 1GI0A 1L1JA 2BXUH 2NU3E 4B1TA 2FYRA 2C90B 4K60A 1GBHA 1D6RA 2ZZUH 3RMLH 1GMHF 3VB5A 3AVZA 1AMHA 1Y3UA 5K7RA 1FY1A 4A92A 4FOUC 1PQ7A 2Q6FA 3F1SB 1W7XH 3HGPA 2DUCA 2P3TB 3AASA 1DICA 2ANKH 3UY9A 1FI8A 3RXDA 1HB0B 3B8JA 3LC3A 1MCTA 2OCVB 1TBQH 1NRRH 1LHDH 2ZHEH 1YPHE 5LPFA 3MI4A 3UNQA 3QO6A 1Y3XA 3KNXA 3URDA 3SNBA 4DIIH 2HNTF 4YT6H 4YZUA 3EYDA 1BMNH 1GBFA 3N99A 2TGTA 1C9PA 1T8LA 2BQ7B 4CRGA 2OC1A 5CE1A 1IOEA 4H6SB 1A1RA 4HTCH 5E2PA 3D65E 1W11U 3NXPA 4NCYA 6ESTA 4F49A 1O3LA 1AVGH 3Q3YA 3RXIA 3BG4C 1GMDG 4WY3A 1O35A 3GDUA 1HDTH 4NSVA 5ESTE 4YM9A 3LJJA 2W6JD 1GJCB 4P02A 1O2PA 1V2ST 3S9BA 3LIWA 1ZPBA 2FS8A 4J2YB 5JYIA 1DDJA 2PGBB 1GBKA 1OWIA 3MU5A 2B8OH 5KGOA 2VINA 3QZRA 1E37B 1TRMA 2ZGCA 4TSFD 3TK6A 3DT0H 5E0JA 1ZJDA 1A5GH 3RMNH 1H8ED 2F9OA 3QK1A 4K5ZA 1FAKH 1DPOA 2VIQA 2YMSB 1DT2A 1BZXE 4MVNA 1OWJA 2BVRH 4ZROA 1E1QD 5EXNA 1HAPH 2A4GA 4RI0A 2FI3E 4ACBA 3MWIU 1C5NH 1QJ6B 3VXFH 1Z8RA 1OP8A 4X1SU 3SNDA 1SGTA 1A7SA 2XXLA 3W95A 4FXGH 1ELVA 4Y76A 2FOEA 3VGCB 5DKMA 4D8NA 2XBYA 1GJ6A 2Y5FA 5AFYH 1EZXC 3BTME 1AUTC 3K9XB 1J14A 5EQRA 5A09A 1ZRBA 3BV9B 1AZ8A 1A2CH 4U32A 1P2MA 3BG4B 3GCHB 5L2ZH 1O3AA 3A7VA 3SO3A 1HAOH 1TA2A 4D76A 2SFAA 3SU0A 1W13U 2ZHQH 4JZFH 2TBSA 5F8ZA 1DLKB 5FXLA 2AIPA 5TCAA 4Y8YA 3EE7A 1F0SA 3OAAD 2R2WU 4NFEA 2Z3DA 1IQGA 2D8WA 2O8UA 4AFUA 1ELGA 1IQFA 1S6HA 3VGCC 3TJUA 4BTUB 1NESE 1V2UT 2A7CA 3SZEA 3RXTA 3GY4A 5EW1H 1PQAA 2AIQA 2GKVE 1C5WB 2KFWA 2P8OB 1DWCH 1OP0A 2SGPE 3KF2A 2J2UA 2KZ4A 2XC5A 2VVCA 4M7GA 1ANEA 5F53A 1EAIA 1FMGA 5GNDA 4BAMB 3VFEA 2SNWA 1K1LA 2ZGBH 5EPNA 1TGBA 3PLPA 1GI1A 3RU4T 3V13A 4ISLA 1GVLA 2H6MA 1HIAA 2KCYA 1UTJA 2SGQE 1DM4B 1NS3A 1CVWH 3ZYDA 4A1TA 1JMOH 1TOCB 1FXYA 4ZH8A 2ZU5A 1T4VH 2ZFFH 4NA8A 1IQLA 4WVPE 2RA3A 1BTXA 1WQSA 3A7WA 1C5MD 1YPGH 1ACBE 1BB0B 5HXFA 4NIYA 3ELAH 3DD2H 1SBWA 2R2MB 1D4PB 1MQ6A 1GI4A 1G3DA 1H9HE 2M5TA 1MBMA 2A7JA 3DSOA 4MNWA 2HVYB 1MTNC 2PSXA 5FL7D 1B0FA 1QGFA 1K1NA 3UAIC 2VIWA 1EATA 1THPB 3CNRA 3GISB 2WPDD 3NKKA 1SSXA 2YNAA 1T8NA 2AGGX 1O3PB 1JBUH 4I8JA 4KTSA 3ESTA 2BQ6B 1SQOA 5E0HA 1TABE 1TWXB 1UCYH 1V2NT 2BD8A 3DSGA 1FUJA 3IWMA 4Y8XA 3T27A 5JBCS 2CHAC 2Z9JA 1P06A 3FANA 3U8TH 3BTWE 1SGIB 2FS9A 3MO9A 4FUIA 3K6ZA 1RS0A 4ACAA 3A7YA 1K28D 1CHGA 1HYLA 4UONA 3DHKH 3OFND 2QF4A 1A0HB 1GBAA 1Y59T 2BDYA 5EPYA 5L6NH 2V3MA 2EEKA 4Y8ZA 4CRBA 1FY5A 1ZR0A 3BTGE 1Z6JH 4X1NU 1K22H 3OEED 1IQIA 4OGYA 3SV2H 3EAJA 1CA0C 2C93B 1GI5A 2FOCA 3VB6A 1WYKA 2EY4C 3ZZ3A 1XKBC 2GZ7A 1P04A 2D26C 3MU0A 1TRYA 1C1MA 5FPTA 3TGJE 2K0QA 1GHBG 1N1LA 2PV9B 5G4BA 3Q77A 1YBWA 1ORFA 3LPRA 4YXWD 5F6MA 4F55A 1P3CA 5T6DA 4TPIZ 4GVUA 1AWFH 2O8MA 1P02A 3TU7H 2ZFRH 1GJDB 3BN9A 2TGAA 1UTOA 4CH2B 3UR9A 3TNTA 1G3EA 1EXFA 3MNSA 2UWPA 3HKJB 2PTCE 1VR1H 2FI5E 1YCPH 1KLJH 5C20A 4DIHH 2WPMS 1VGCC 1FY3A 2J34A 1CA0B 1LKAA 1AGJA 3MOCA 1ZMLA 3PO1B 1G3BA 1BTHH 3U69H 1AUJA 1Z1IA 1DANH 1C5TA 4IC5A 3PTNA 2BD7A 4CBNA 3OX7U 1ZSKA 2DE8A 1NT1A 5J4SA 1O2TA 4I32A 3NPSA 3T29A 1GMDF 1AE5A 2ODQA 1OXGA 3P70B 1EZQA 2BY7X 1XMNB 3TVJB 1KXCA 4DJZB 2A4OA 2H2ZA 2BDIA 1S85A 2HLDD 5DP9A 1ZHPA 2G52A 1HGTH 4FUJA 1TNLA 4BXSA 3P8GA 1LVOA 1WOFA 1LKBA 1TNHA 4UFGH 1P2JA 2HALA 2B9LA 4XOJA 2QF5A 1GL0E 2XCNA 4F4OC 1F0UA 2PSYA 1O2HA 4Y7BA 3WWBA 2FO9A 1O3HA 3SW2B 1NRSH 3ITIA 2ZA5A 1UTLM 5DP6A 1K1MA 1P01A 1TALA 2Z9LA 4LXBH 4MPWA 4GHQA 3MO6A 2NWNA 4BTIB 2ZFSA 2P95A 1ZRKA 2WV9A 1TQ0B 1EPTA 4HFPB 3A89A 2HLCA 1QZ8A 2BQWB 1TX8A 2XBWA 2BLVA 1G9IE 1SPJA 2VWLA 3SBKA 2Y7XA 1MZAA 2QF0A 5T1VA 1MAXA 1HJAB 1MABB 4AC9A 2F4LA 5KEDA 1FY8E 3URCA 2YMSC 1YPJH 3ZZBA 1A0LA 2K8IA 1RXPA 4ZXYH 3RC5A 3H7OA 1MKXH 1QTFA 1W2KH 2FM2A 2IPQX 4KTCA 2IOTA 1P09A 2ILNA 5DGJA 4ZXXH 1MQ5A 3F2GA 3MH6A 4I8HA 1C1PA 3MNBA 1D3DB 2LNCA 1ELEE 2QXHA 4BXWA 1C2GA 1C2DA 3VB7A 5K0HA 4HI3A 2ZG0H 2BD3A 2F43B 4WF8A 3RXBA 5GXPA 1TNGA 3UB0A 2ZO3H 1TBZH 1XX9A 4I7YH 1DVAH 4TPYA 4BOHA 1F92A 3TLOA 4ZHLU 3TH3H 1KXEA 1LHEH 3F9HA 3RXUA 1YGCH 4MPXA 1MZDA 4IN2A 2OC7A 3QLPH 4M9FA 4H6TA 4ZHMU 1C5YB 3T26A 3M35A 4NZLA 2CJIA 4Y10E 3UQVA 3U28C 1AB9C 1ZLRA 2WPKS 1LCYA 3SYJA 2F83A 1GHVH 1A4WH 1ETRH 1C1VH 1VITF 1L4DA 3MYWA 1FPHH 2UWOA 3E16B 3FP8E 1SGCA 3F6UH 2KCOA 3PMBB 4GCHG 1S84A 3UREA 2SGFE 2OUAA 2LP6A 3OY5U 3D23A 2JJ1D 3SU1A 4MG3A 1PQ8A 3H09A 1BUIA 5IK2D 1GDUA 3GCOA 6CHAC 1HJ8A 1BTYA 2BLWA 2R3YA 2M2AA 6LPRA 9ESTA 3PTBA 1PYTD 1ETSH 1O37A 1SGRE 3NK8A 3LH3A 1E34B 1C4Y2 3CS0A 1GJ9B 3M61U 2BDAA 3LGVA 4OS5A 4U2WA 2BOHB 4VGCB 4AB8A 1RRKA 4CRCA 1EP6A 1GDQA 2PW8H 1XUJA 2PKSC 3SORA 2ALPA 4JZDH 1TE0A 1GWAA 4A6LA 1KYNA 1C1NA 3BTDE 2NU4E 2R0KA 4ABGA 1C4V2 4JMYA 5DP4A 5JDUB 3RXOA 1DSUA 3UNRA 2WINI 3DA9B 2QA9E 4DURA 1A0JA 1ANCA 4MNXA 2ZQ1A 1TIOA 3RLWH 1O3MA 1NRPH 5A0CA 3EQ0H 4X6MA 1MTVA 1ZSJA 1BTWA 4YOGA 1YPHC 4FUHA 1O2OA 4X6PA 2H1UA 1JIRA 1S0RA 1O2ZA 2ZEBA 4I33A 1SGDE 1CHOF 2FZZA 1MBQA 3FP6E 1P9SA 4Y71A 2Z94A 1F0RA 2A31A 2ZC9H 4OS6A 1YCPM 3A85A 3GCHC 4KP0A 2ASUB 1VCWA 1E36B 1EFRD 1MD8A 1EAXA 1AFQC 1THSH 1EB1H 5ESBA 3SJ9A 2CV3A 2QE7D 4UD9H 5EJ1A 2H5DA 1H9LB 3NCLA 1OX1A 1Y3YA 2THFB 4J1YA 5EODA 2ALVA 2FOFA 5HM2A 4Y6DA 1P2NA 3ZZDA 1IHTH 1ABIH 4LOYH 4AYYB 3GY8A 4Q7XA 3S9CA 1LVMA 2H9EH 1XXDA 1KIGH 2BVSH 3PMJA 1SVPA 4KELA 1Z8GA 1ANDA 1O5CB 1N8OB 4WH8A 1C2JA 5FBEA 3RM2H 1OOKB 2VH6A 3UNSA 1H8HD 3S7KB 2J4IA 3NRLA 4DT7B 1XUGA 2V6NA 4A1VA 4ABBA 1FIZA 2QN5T 1AN1E 3EDXB 4FUCA 2XWBI 5IYTA 2VH0A 1YF4A 4MTBA 2NU2E 1H4WA 1SG8B 2ZDNA 1TYNA 2GVFA 1P12E 1C5SA 1FNIA 2VIVA 3E3TA 3RXSA 1ARBA 3S0NA 5F8TA 5GDSH 3A84A 1P2QA 5IDKA 2R0LA 5GWZA 3N7EA 2UUJB 3M5NA 4U01A 1LPZB 2L74A 2OXSA 1EX3A 4D9QA 4CRAA 2ZGXH 3E91A 3M3VA 3P8NA 3C27B 1HLTH 2WPLS 4WWYA 1ZGVA 1GJ8B 3ZIAD 1OWEA 3GOVB 1HAVB 1ZHRA 4YOIA 4DW2U 2AHME 2GP9B 4ZHAA 4XBBA 1GI2A 2EI7A 2OD3B 5AFZH 5T6FA 1SHHB 4LZ4B 2ZDKA 4ZAEA 2KM0A 4CBOA 3IG6B 4ISHH 4TWWA 3RXQA 3I78A 1WSSH 4K1TA 1T4UH 3TJNA 2D1JA 1GJ7B 4HGCA 1CT0E 1UTMA 1DWBH 1MU6B 1K1IA 2V3HH 1UMAH 1EOJA 1O3OA 1BTUA 1KTTB 1GGDB 1TFXA 3K2UA 5J4QA 3TGKE 3GS9A 1OPHB 3SJ8A 4XSKU 5GPIB 4JZIA 1B5GH 2FMJA 3BG8A 5CHAB 4Q7YA 3WY8A 4K8BA 1PQ5A 1KXAA 1Z8JB 1Q3XA 5EOKA 1GI3A 1FAXA 1SGYE 3T2NA 1BQYA 3QN7A 1Z71A 1AO5A 3PRBA 3B9FH 5DP5A 3A81A 3RXLA 3E90B 3LH1A 2UWLA 1EJNA 4XBCA 3MMGA 2QY0B 3U98H 5LPRA 3ZZ4A 1ESAA 3MNCA 3KQBA 2RCEA 1A3EH 4Q7ZA 1W7GH 2Y6TA 1GJ4H 2GCTC 3M7TA 4ZMAH 4MNVA 2ESTE 3F9GA 1TBRH 4O3TA 2PKAA 3SUGA 3MFJA 1QQ4A 2AEIH 3RXAA 4XFQA 4K1EA 5EXMA 3GCNA 3LKWA 2UUYA 5FX6A 1O5BB 1HAHH 3QTOH 1DOJA 1NFXA 1NBMD 1D3QB 4JK6A 2A32A 4INHA 5CDFE 5FCKA 4Y0YE 1DXPA 2GT8A 4NIXA 3OEHD 2ZI2H 3LGWA 2C8WB 1SFIA 4I31A 2GV7A 2OINA 1GBTA 2ZGJA 2Y82A 4JYUH 2OC8A 8GCHF 2ZPRA 4FUBA 1FPCH 3BTTE 2VVUA 1NRNH 3D49H 1SGFG 2FYQA 4WMFA 1P9UA 1LHCH 3T5FH 1C2KA 4O03A 5LH8A 2VGCB 4Q2KA 1O39A 3EE0B 1O5DH 3TITA 3Q76A 1BIOA 2F91A 1Q2WA 2LPRA 1YKTA 1SQAA 3HK3B 1XVMA 1LPGB 3SU4A 1A61H 1GJAB 5TCCA 1GMCG 1O3JA 1SKYE 3KYGA 2P16A 1CT4E 4CR5A 3P17H 3M5OA 1VCPA 3K65B 2Z7FE 4LK4A 1P03A 2CMYA 2V3OH 3AW1A 2KAIA 2A5KA 1UHBB 2ZTYA 2PR3A 1LVYA 3SHCH 3M7UA 1RIWC 1ABJH 2HGTH 2OQUA 2FOAA 4NWLA 2ZPSA 1QA7A 3RC6A 1V2LT 4RKJB 2XBXA 5EIYA 2SGDE 2WV5A 1SMFE 3SU5A 1NBME 3DSPA 2Y81A 4H4FA 3SU6A 1VZQH 2XCFA 3BSQA 1Y5AT 2Z3EA 1PYTC 3DFJA 1ELTA 3ATKA 2BHGA 2P3FH 1GG6C 1SHYA 3AAVA 4FU7A 3O8BA 1YCPK 3ATIA 1FY4A 1HIAB 2HVXA 5LGOA 1E79D 3BEIB 3LGUA 1YLNA 4ASHA 3MHWU 1YM0A 1C1TA 1ZPZA 2IJOB 2ZTZA 4ZKOU 1Y8TA 3M3SA 1O5GH 1IHSH 3ZZ7A 1M9UA 3ZZAA 1QHRB 2VIDA 5C67A 1QL8A 5DSFA 4GPGA 4YO9A 1O2QA 1S83A 1W10U 2ANMH 2F9PA 1DE7H 1PPEE 3OYPA 3W1EA 2XYAA 1QRZA 1EOLA 1PJPA 2BZ6H 1TLDA 5FAHA 1UTPA 1O5FH 1GI8B 1F5RA 1TMBH 3A7TA 3OE7D 3O8DA 5C1XA 3A87A 1C5QA 4D9RA 1K0HA 1QB9A 1ETTH 1GBLA 1HAGE 1BCUH 3SZNA 1BBRE 4TY7A 7ESTE 1MTUA 4D7GA 2XOKD 3E0NB 1OYQA 2FOHA 3A8CA 1TMTH 1RTLA 2PP6A 1YC0A 1CQQA 1OYTH 5A2MH 1SLWB 4A5TS 5GCHG 1J17T 1ZSLA 4VGCC 2XWAA 2ZF0H 3I77A 1NO9H 3MH5A 3KHVA 1O30A 1TGSZ 1T31A 1EP5A 3UPEA 1YPEH 3FZDA 3F3BA 4K2YA 2BY6X 3FAOA 1O2UA 4IN1A 3M3TA 1P05A 4ABDA 2G8TA 1EPTB 1WU1A 1BHXF 1TGNA 1SQRA 3M37A 2ZU3A 1IQEA 1WQVH 4UEHH 6GCHF 2VWMA 3L3TA 2HOBA 2BXTH 3PWBA 3TH4H 1O5EH 4FUEA 1GJBB 7GCHF 2VB0A 1NM6A 3WWFA 3ZVDA 3V12A 9LPRA 1BTZA 5HIZA 2AMQA 4JK5A 1BOQA 4X8UH 2BY9X 3A82A 1NC6A 2OLGA 4E7RG 3P6ZB 1KSNA 5JBTA 1CU1A 4GAWA 1CGHA 1VJAU 2B5TB 2WHXA 3BTHE 3DCLA 1AKSA 3UOUA 1COWD 1GHXH 2ZU1A 3PRDA 3SU2A 3KIDU 1L4ZA 4FETA 5C3NA 1WV7H 1ZYOA 2O8WA 1P11E 1Z6EA 4CREA 3ODDA 4RSPA 3P92A 2C8YB 3RXPA 1AQ7A 2WZQA 4B6EA 1AE8H 2XW9A 1A5HA 1C5RA 5HIYA 4BAOB 1BMAA 3S7HB 1DS2E 2XC4A 5CMXH 4ZKRU 4CR9A 1JRSA 3QWCH 4B2BA 3U1IB 2VGCC 1QR3E 1ZPCA 4E05H 3SN8A 1T32A 1TGCA 1NPMA 1D3TB 3EA8A 4NFFA 3SUFA 3E0PB 1DWDH 1HNEE 2XNDD 1GBBA 2PUXB 1ELCA 4MPVA 1O38A 1F2SE 1O2XA 1CT2E 2G00A 2QIQA 3L33A 5EGMA 3V7TA 5EQSA 4NIVA 1VJ9U 1IQHA 1O0DH 5A8YA 1Y5BT 5A8ZA 5EW2H 4ABHA 4I8LA 2BDGA 3KEEA 5DO4H 1SL3A 3U8RH 3Q00A 1HPGA 1Q31A 2I6QA 2GMTC 4WMDA 3V0XA 1MKWH 1W0KD 1TPOA 1C5UA 2CN0H 2HWLB 1C5ZB 2FP7B 4AORA 3TIUA 4BANB 1F0TA 2STAE 4WJG2 1TGTA 1MTSA 1UVUH 2QC2A 3LGIA 2CF8H 1G3CA 3FN8A 3UWIA 2ZIQH 2PKAB 2BYAX 5EJLA 8ESTE 3MU8A 3SGAE 3RXVA 1DX5M 1O2RA 3PMAB 2A1DB 1QBVH 2FI4E 2BY8X 1HJAC 3RC4A 3HPTB 5FX5A 1W0JD 1K1PA 1MUEB 1O2VA 1IQKA 1PPHE 2PFEA 3STJA 4QT8C 2QF3A 4GUXA 1C2HA 2Z6BD 3ODFA 5HGGA 5EQQA 3E8LA 5DPAA 2XC0A 1GHYH 2ZTXA 3RXGA 2O8TA 4IS5A 4MPUA 2VIOA 1U6QA 2W26A 2VWNA 1ZTJA 3F0OA 4RKOB 1RGQA 4AG2A 5HMAA 4INKA 1N6YA 1L1NA 1RTFB 1G2MA 2A2QH 3GY7A 2GZ9A 2KR7A 2SNVA 5DP7A 1TPAE 5DG6A 4Y79A 3PWCA 2JIZD 2UUFB 5F8XA 3ZZCA 2OBOA 2BX3A 1PPGE 2FEQH 2Q6DA 3OU0A 5SGAE 1O2NA 2LELA 2AGEX 4MDSA 1C5PA 2W7SA 4FUFA 3VPKA 1V6DA 1O2LA 2PUQH 3ATMA 2W3KA 1V2PT 2D2DA 2BLOA 2EQNA 4KKDA 1BMFD 3I29A 3M5MA 1NY22 1NFUA 1ZMJA 5EG4A 1BTPA 2UUKB 3FFGA 4ABEA 4AFZA 3ATWA 3BTKE 3PM3A 2OQ5A 4ZUHA 2XNIA 2GCHG 3KGPA 1FONA 1GHWH 2J94A 1UVOA 1ZHMA 2A4QA 4ABIA 1O3GA 3ZZ8A 3Q3KA 1S5SA 3BEFB 1SOTA 1L0ZA 1SGEE 4JYVH 8LPRA 3P8FA 2OBQA 1JIMA 1PPBH 1C5OH 1GCDA 1Z7KA 2PWXA 3QGJA 3GYMA 3QDZB 3GY3A 4Y11E 2Z9GA 3UWJH 2ZFPH 3MU4A 3SJOA 1NU7B 2CXVA 2TIOA 1PFXC 1ID5H 5C5NA 3W94A 2A0QB 4DCDA 1EB2A 1O3CA 4GHTA 1O3EA 2HPQH 1KDQA 1F7ZA 2GDEH 4WXVA 2JETC 1BBRK 2P8OC 4X2WA 1W12U 2WUBA 2H9TH 2XRCA 1MCVA 4WXIA 1HFDA 2GDDA 4IW4E 4DGJA 1VITG 2W6ID 5C2ZA 1P2KA 3KYFA 4ABJA 2G51A 4X1PU 1HCGA 1BRUP 2ZP0H 1TX7A 2SGAA 1UCYE 2FX6A 3SV8A 1TPSA 1UHBA 1FZZA 1OSSA 1HAZB 1AY6H 2P94A 1W14U 1OHHD 2J92A 5FHTA 1GCTB 2F9NA 1OP2A 1ESBA 2V7QD 2IPHA 3LGYA 3A8AA 4K1SA 4XBDA 4B75A 2Y80A 3LU9B 4OS4A 1UO6A 3B23B 3NZIA 4TY6A 1XUKA 2VU8E 4DG4A 3DUXH 3A88A 1H1BA 1DUEA 3F2FA 2ZFTA 1GHBF 1KLTA 2HPPH 1B0EA 1GHAG 1HXEH 1MTWA 1UCYK 4FUGA 1O34A 4BNRA 4ZKNU 1QB6A 2RA0A 1PPFE 2QYIA 4B74A 3RU4E 3GCTG 2ZWLH 1UTKA 3RXCA 2WYGA 1MMJN 1DFPA 2KCAA 1TQ7B 2OK5A 1JXPA 1LPKB 3M7QA 3SV9A 2Z9KA 1ELAA 4NZQA 4Z6AH 2J38A 1CBWC 1J15A 1V2MT 2ZGHA 3KN2A 1CGIE 2ZCLP 3SOSA 3SNAA 3RXFA 1SC8U 1RIWB 1GJ5H 2CGAA 3WW7A 3AAUA 4ISIH 1L2EA 2BDHA 1GBDA 3ZZ6A 3GDVA 1C2FA 3RLYH 5DJ7A 4K3JA 4X1QU 4Y0ZE 2AFQB 1SLXB 3FZZA 1HV7A 3HKIB 1V2QT 3KQDA 4X8VH 4DT4A 1LHGH 1XUIA 5C1UA 1CA8B 3P8OA 1SGPE 4ZKSU 3RDZA 1G2LA 2VVVA 1GG6B 2W7UA 1K2I1 2G5VA 3A8BA 5LPEA 3ZZ9A 4JZ1A 1YPMH 1TOMH 2F9VA 2GV6A 2BM2A 1GBIA 1BITA 1GBCA 5H4IB 2FOGA 4YLQH 5HYOA 4P00A 1Y3WA 2ODPA 2JH5D 3RXJA 4X8TH 4OS1A 1YLCA 2O8LA 2QCYA 2YMSD 4Z1MD 2RG3A 2F3CE 2YOLA 1MD7A 1BRAA 4NA7A 1UTNA 3BIVH 1DSTA 4UE7H 1NU9A 4Q4LA 4F48B 5JPMH 4X0WU 1AVWA 1BA8B 5KECA 3GICB 2JJ2D 2A4RA 5L30H 1S82A 2IN2A 2AYWA 4AX9H 1D6WA 2CF9H 1E0FD 1V2RT 2L6OA 3E1XB 3UR6A 1GMHG 1WTHD 3TK9A 3F9FA 1W8BH 5HKKD 1OKXA 2GJGA 2W5EA 1Z8IB 2BZAA 3BTFE 2GCHF 2EA3A 4DOQA 4I8GA 3EA9A 4AGKA 3MNXA 2VIPA 2FLBH 1S6FA 4AOQA 1O2IA 3A80A 2BX4A 4RT1A 5B6OA 2VNTA 2KX4A 1V2JT 1KXFA 1C2LA 1QIXB 3F9EA 3GY2A 5CHBA 1BJVA 4FVDA 2TGPZ 3R0FA 1FLEE 4D7FA 1BT7A 2PKSB 2VJ1A 3H7TA 2AGIX 1QURH 2DE9A 3KQEA 4U30A 4AZ2B 4B2AA 1GBJA 1C2EA 4B73A 4R0IA 1RJXB 1EPTC 4FU8A 1W3CA 1ARCA 1O3KA 2C8ZB 1ESTA 3QUMP 1Y5UT 5T3HA 1TX6A 2J98B 1KY9A 3JZ2B 3UOPA 1HRTH 1O5AB 1UK3A 3KQ5A 5GJ4B 3CP7A 2A2XH 2ODYB 3SQEE 1OWDA 1TB6H 1PPZA 3T25A 3NWUA 5DN6D 1O3IA 1J16A 4MNYA 1C5LH 1S0QA 2A7HA 3E6PH 1J8AA 1XKAC 5E2OA 2TPIZ 3MH4A 2TRMA 1O3BA 1TNJA 2SGEE 1FDPA 1SGQE 1KLIH 1K9OE 1P3EA 2WPJS 4Q63A 1P57B 3PLKA 2W3IA 1P10A 5E0GA 4FU9A 4ASUD 1AKSB 1OWHA 1H8DH 2ZCKP 1O36A 1DY8A 2K1QA 2ZKSA 3T62A 5DP3A 2NU1E 2G4UA 2I6SA 3OTPA 1AFQB 3VXEH 3HK6B 4IBLH 3O8RA 1BRCE 4LZ1H 1TA6A 1S81A 5BRRE 4THNH 1G36A 3A7XA 4KGAA 4YESB 2JH6D 2H5CA 1K21H 4Z0KA 1K1JA 4UFEH 3SV7A 3TK5A 4TWYA 5JBAS 2QV1A 2Y5GA 2FTMA 2JH0D 3S9AA 4SGAE 2C8XB 1E38B 1KXDA 1LMWB 4RT0A 4RN6A 1RTKA 2WSSD 2R3UA 6CHAB 1ELDE 4I86A 3A7ZA 1O2YA 3PO1C 4HG6A 1SOZA 1GVKB 1PPCE 3PV4A 1H8IH 2JKHA 1BBRH 1ZTLA 3SGQE 1FN8A 3ZV9A 3U1JB 2ULLA 4BTTB 3A8DA 3F68H 3RXMA 3PV2A 4HZHA 4JCNA 1QQUA 2EI6A 3R3GB 4X6NA 1XUHA 1GDNA 1V2KT 1LVBA 2A45B 2VBCA 3ZV8A 2BDCA 4NA9H 7GCHG 1F5LA 1KMHB 5F03A 1IQNA 3ENSB 2P93A 1QCPA 1YP9A 5DK1A 1JRTA 2G5NA 4XRNA 3KCGH 1AI8H 3OY6U 5BPEA 1GI6A 1MKWK 3SJIA 1AD8H 3SGBE 1TNKA 3LGTA 1UVPA 1WXRA 2HNTE 4MQAA 3RU4D 5ABWA 2ZDAH 2FTLE 1C1WH 1BMMH 1QRXA 3SJKA 2RDLA 4YOJA 3SV6A 1SGFA 3QTVH 3UTUH 2ZDLA 2G55A 1KDQB 2GZ8A 1P2IA 4OS7A 1DWEH 2FOBA 2Q1JA 4ABFA 4SGBE 5C17A 4O3UA 2STBE 1HAYB 2WPIS 2A5AA 2H9HA 3QX5H 3VEQB 4I8KA 4E06H 3V3MA
chains in the Genus database with same CATH topology
2B0FA 4NIWA 2GGVB 4CH8B 1N8OC 1T8OA 1QA0A 2ZHDA 1SGNE 1UTQA 4IC6A 3SUDA 2QXJA 1OS8A 1TNIA 1EAWA 4AB9A 3TJVA 2BLQA 1O3NA 1T7CA 2J95A 1C1OA 1DITH 1BHXB 2BD2A 1CE5A 4ISOA 1O2SA 1V2WT 4OGXA 4XDEA 4DVAU 1W0ZU 1IQJA 1CSOE 1P8VC 4IMZA 1GI7B 5DP8A 5ETXA 2FOMB 1XM1A 2BTCE 3RP2A 1SB1H 1YPKH 3RXRA 1YLDA 1HBTH 2EI8A 1P0SH 3MH7A 2BD5A 1AIXH 1BRBE 1DXWA 5HM9A 3GDSA 4ABAA 1B7XB 1D9IA 1FQ3A 4BAHB 2G81E 3SU3A 3T28A 4B2CA 1QFKH 5AF9H 3QGNB 4XE4A 1ZOMA 1ELBA 3ZVCA 2PLXA 4UFDH 2KAIB 3BTEE 4NGAH 3A83A 1WCZA 2FLRH 4YTAA 1QBNA 1K1OA 1OWKA 3RXHA 2BMGB 1LHFH 1ZGIA 2ZECA 4AYVB 1H9IE 3LONA 2AMPA 1HXFH 2PHBA 5CHAC 4INLA 2OTVA 3SI4H 4AFSA 4AN7A 1C2IA 2JETB 2ZHFH 1SLVB 2ZDMA 1HJ9A 4X2XA 3TGIE 4A7IB 4Q80A 1MH0A 2GTBA 2O9QA 4CHAB 1ZZZA 3Q3XA 3SI3H 1JWTA 2V0BA 4X2YA 4FUDA 3RXEA 1EZUC 5T6GA 1UK4A 3G01A 4YLUA 3EA7A 1C1RA 1O3FA 1DLEA 2AERH 2C4FH 2BOKA 2G4TA 1YYY1 2PTNA 5C1YA 1C1SA 1ANBA 1VGCB 1O33A 3JZ1B 3RM0H 1FV9A 3RMMH 4GSOA 3MO3A 1SFQB 1ZJKA 2BB4A 1TPPA 2AMDA 3AW0A 4X1RU 1INCA 1MAYA 2Z3CA 1Y3VA 2YNBA 4KTUA 2GD4B 5A0BA 1GMCF 2F9BH 3PLBA 1O2GH 1HAXB 4TYDA 3GCTF 2BY5X 3TPIZ 4CHAC 1G30B 2NU0E 2J9NA 2GCTB 2ZHWH 1V2VT 2QAAA 5A8XA 1GHAF 3BEUA 4A1XA 2ANWA 1GBMA 1GPZA 7LPRA 4YT7H 1NRQH 2FXRA 4B76A 2FX4A 1ZTKA 4B71A 1GHZA 3SUEA 4NWKA 1EAUA 1XXFA 3LT3A 1THRH 1AVXA 1O3DA 1WTGH 1TRNA 1C1UH 1RD3B 4JYTA 1NTPA 1X7AC 2C3SA 1C5XB 3LOXA 1J9CH 3C1KA 1LDTT 1QBOA 1DY9A 1GGDC 1RFNA 1XVOA 4PROA 1GBEA 3UFAA 3VB3A 1HAVA 2ZFQH 1MKXK 4DY7B 3D62A 4O97A 3ZVGA 4FVBA 1QRWA 5FCRA 4UDWH 3SHAH 5JBBS 2F9UA 1AZZA 1TMUH 4BAKB 1AWHB 1N6XA 3GYLB 2XTTB 4X8SH 1AHTH 3GY5A 2QXGA 5EU8A 1Z1JA 1EQ9A 1FJSA 1QB1A 3LDXH 8GCHG 1NROH 3STIA 2ZDVH 4JZEH 4NSYA 1SR5C 4MLFB 2FIRH 1T8MA 2BD9A 2FDAA 2BDBA 2TGDA 4ESTE 1LO6A 3ZVEA 3IITA 1GCTC 2GT7A 1QJ7B 2AS9A 5I46H 4AFQA 2WYJA 4OS2A 2GMTB 5FPSA 3RMOH 1HUTH 1G32B 1QL9A 8KME2 2ZU4A 1A46H 2VWOA 3LJOA 1EUFA 2GX4A 1WUNH 3ATLA 1QY6A 3OTJE 3PROA 1C4U2 1JOUB 3A86A 2OP9A 3BIUH 3SNCA 3BTQE 1BMLA 4UFFH 4WMEA 1NFWA 2EC9H 2P59A 3OSYA 1AB9B 2FPZA 1A5IA 1TONA 3PB1E 4AGJA 4BAQB 3H5CB 2FWWA 1MTNB 5GIBA 1V3XA 1NZQH 1WBGB 1LQDB 1GVZA 3QZQA 1SI5H 2ANYA 3MU1A 4GCHF 2PGQB 3UIRA 1O2JA 2WUCA 1UK2A 1DUAA 2QGRA 1UJ1A 2A5IA 1F5KU 2Y7ZA 5AHGH 1CGJE 4Y7AA 1KXBA 2P3UB 1G37A 2HNTC 4CRDA 3BF6H 3FP7E 1BDAA 1V2TT 1D3PB 3M36A 1EZSC 3HGNA 4E7NA 1E35B 3M5LA 3N7OA 1VCQA 3ZVBA 5I25A 3NUMA 3ZYEA 3ZZ5A 1QL7A 5PTPA 3U8OH 3GY6A 2ZNKH 1QNJA 1P2OA 1C9TA 1NFYA 1UVTH 5A0AE 1CO7E 4K69A 4ISNA 1GL1A 1GI9B 2ZPQA 1EASA 3TJOA 5JB8S 1SLUB 1L1GA 4H42U 3FVFB 3RUOA 2BD4A 3P95A 3ZVAA 1EJAA 1EJMA 1LQEA 4AG1A 3O8CA 1IQMA 2WV4A 2CHAB 2FESH 1NN6A 1XUFA 1QJ1B 2AH4X 3KQCA 5FPYA 3PYHA 4CRFA 2FODA 2XBVA 3U9AH 4X6OA 1C2MA 1W0YH 3VB4A 1HAIH 2BVXH 5EXLA 3EGKH 5FBIA 3CENA 1ZMNA 1UVSH 1O31A 3SNEA 3MTYA 5JB9S 5L2YH 3KL6A 1EKBB 1ELFA 1CBWB 3PMHB 1FN6A 2ZCHP 2Q6GA 2Z9IA 4O9VA 4GLYA 3ZVFA 2ZQ2A 2HRVA 3L6PA 2OC0A 5E8EH 1O2MA 4X2VA 1C1QA 2QXIA 3DFLA 3K6YA 2WPHS 3TNSA 4IMQA 2B7DH 3RXKA 1O2KA 4R8TB 3S69A 1SQTA 2ZU2A 3CS7A 1AFEH 1IAUA 4WH6A 1TAWA 5TJXA 1FIWA 1AU8A 2R9PA 1C5VA 1WAYB 2V35A 1YPLH 3TH2H 4IGDA 2Y5HA 1CHOG 5GCHF 6GCHG 1O32A 1VITH 1BJUA 3UQOA 5C5OA 3HATH 1A3BH 3LC5A 1KTSB 1LTOA 7KMEH 3SQHE 5AVDA 4NG9H 1O2WA 1V2OT 4K8YA 3UUZA 1MU8B 1GI0A 1L1JA 2BXUH 2NU3E 4B1TA 2FYRA 2C90B 4K60A 1GBHA 1D6RA 2ZZUH 3RMLH 1GMHF 3VB5A 3AVZA 1AMHA 1Y3UA 5K7RA 1FY1A 4A92A 1PQ7A 2Q6FA 3F1SB 1W7XH 3HGPA 2DUCA 2P3TB 3AASA 1DICA 2ANKH 3UY9A 1FI8A 3RXDA 1HB0B 3B8JA 3LC3A 1MCTA 2OCVB 1TBQH 1NRRH 1LHDH 2ZHEH 1YPHE 5LPFA 3MI4A 3UNQA 3QO6A 1Y3XA 3KNXA 3URDA 3SNBA 4DIIH 2HNTF 4YT6H 4YZUA 3EYDA 1BMNH 1GBFA 2TGTA 1C9PA 1T8LA 2BQ7B 4CRGA 2OC1A 5CE1A 1IOEA 4H6SB 1A1RA 4HTCH 5E2PA 3D65E 1W11U 3NXPA 4NCYA 6ESTA 4F49A 1O3LA 1AVGH 3Q3YA 3RXIA 3BG4C 1GMDG 4WY3A 1O35A 3GDUA 1HDTH 4NSVA 5ESTE 4YM9A 3LJJA 1GJCB 1O2PA 1V2ST 3S9BA 3LIWA 1ZPBA 2FS8A 4J2YB 5JYIA 1DDJA 2PGBB 1GBKA 1OWIA 3MU5A 2B8OH 2VINA 3QZRA 1E37B 1TRMA 2ZGCA 3TK6A 3DT0H 5E0JA 1ZJDA 1A5GH 3RMNH 2F9OA 3QK1A 4K5ZA 1FAKH 1DPOA 2VIQA 1DT2A 1BZXE 4MVNA 1OWJA 2BVRH 4ZROA 5EXNA 1HAPH 2A4GA 2FI3E 3MWIU 1C5NH 1QJ6B 3VXFH 1Z8RA 1OP8A 4X1SU 3SNDA 1SGTA 1A7SA 2XXLA 3W95A 4FXGH 1ELVA 4Y76A 2FOEA 3VGCB 5DKMA 4D8NA 2XBYA 1GJ6A 2Y5FA 5AFYH 1EZXC 3BTME 1AUTC 3K9XB 1J14A 5EQRA 5A09A 1ZRBA 3BV9B 1AZ8A 1A2CH 4U32A 1P2MA 3BG4B 3GCHB 5L2ZH 1O3AA 3A7VA 3SO3A 1HAOH 1TA2A 4D76A 2SFAA 3SU0A 1W13U 2ZHQH 4JZFH 2TBSA 5F8ZA 1DLKB 5FXLA 2AIPA 5TCAA 4Y8YA 1F0SA 2R2WU 4NFEA 2Z3DA 1IQGA 2D8WA 2O8UA 4AFUA 1ELGA 1IQFA 1S6HA 3VGCC 3TJUA 4BTUB 1NESE 1V2UT 2A7CA 3RXTA 3GY4A 5EW1H 1PQAA 2AIQA 2GKVE 1C5WB 2P8OB 1DWCH 1OP0A 2SGPE 3KF2A 2J2UA 2XC5A 2VVCA 4M7GA 1ANEA 1EAIA 1FMGA 4BAMB 3VFEA 2SNWA 1K1LA 2ZGBH 5EPNA 1TGBA 3PLPA 1GI1A 3RU4T 3V13A 4ISLA 1GVLA 2H6MA 1HIAA 1UTJA 2SGQE 1DM4B 1NS3A 1CVWH 3ZYDA 4A1TA 1JMOH 1TOCB 1FXYA 4ZH8A 2ZU5A 1T4VH 2ZFFH 4NA8A 1IQLA 4WVPE 2RA3A 1BTXA 1WQSA 3A7WA 1C5MD 1YPGH 1ACBE 1BB0B 5HXFA 4NIYA 3ELAH 3DD2H 1SBWA 2R2MB 1D4PB 1MQ6A 1GI4A 1G3DA 1H9HE 2M5TA 1MBMA 2A7JA 4MNWA 1MTNC 2PSXA 1B0FA 1QGFA 1K1NA 2VIWA 1EATA 1THPB 3GISB 3NKKA 1SSXA 2YNAA 1T8NA 2AGGX 1O3PB 1JBUH 4I8JA 4KTSA 3ESTA 2BQ6B 1SQOA 5E0HA 1TABE 1TWXB 1UCYH 1V2NT 2BD8A 3IWMA 1FUJA 4Y8XA 3T27A 5JBCS 2CHAC 2Z9JA 1P06A 3FANA 3U8TH 3BTWE 1SGIB 2FS9A 3MO9A 4FUIA 3K6ZA 1RS0A 3A7YA 1K28D 1CHGA 1HYLA 4UONA 3DHKH 5EPYA 5L6NH 1A0HB 1GBAA 1Y59T 2BDYA 2EEKA 4Y8ZA 4CRBA 1FY5A 1ZR0A 3BTGE 1Z6JH 4X1NU 1K22H 1IQIA 4OGYA 3SV2H 3EAJA 1CA0C 2C93B 1GI5A 2FOCA 3VB6A 1WYKA 3ZZ3A 1XKBC 2GZ7A 1P04A 2D26C 3MU0A 1TRYA 1C1MA 5FPTA 3TGJE 1GHBG 1N1LA 2PV9B 5G4BA 3Q77A 1YBWA 1ORFA 3LPRA 5F6MA 1P3CA 5T6DA 4TPIZ 4GVUA 1AWFH 2O8MA 1P02A 3TU7H 2ZFRH 1GJDB 3BN9A 2TGAA 1UTOA 4CH2B 3UR9A 3TNTA 1G3EA 1EXFA 3MNSA 2UWPA 3HKJB 2PTCE 1VR1H 2FI5E 1YCPH 1KLJH 5C20A 4DIHH 2WPMS 1VGCC 1FY3A 2J34A 1CA0B 1LKAA 1AGJA 3MOCA 1ZMLA 3PO1B 1G3BA 1BTHH 3U69H 1AUJA 1Z1IA 1DANH 1C5TA 4IC5A 3PTNA 2BD7A 4CBNA 3OX7U 1ZSKA 2DE8A 1NT1A 5J4SA 1O2TA 4I32A 3NPSA 3T29A 1GMDF 1AE5A 2ODQA 1OXGA 3P70B 1EZQA 2BY7X 1XMNB 3TVJB 1KXCA 4DJZB 2A4OA 2H2ZA 2BDIA 1S85A 5DP9A 1ZHPA 2G52A 1HGTH 4FUJA 1TNLA 4BXSA 3P8GA 1LVOA 1WOFA 1LKBA 1TNHA 4UFGH 1P2JA 2HALA 2B9LA 4XOJA 1GL0E 2XCNA 4F4OC 1F0UA 2PSYA 1O2HA 4Y7BA 2FO9A 1O3HA 3SW2B 1NRSH 3ITIA 2ZA5A 1UTLM 5DP6A 1K1MA 1P01A 1TALA 2Z9LA 4LXBH 4MPWA 4GHQA 3MO6A 2NWNA 4BTIB 2ZFSA 2P95A 1ZRKA 1TQ0B 1EPTA 4HFPB 3A89A 2HLCA 2BQWB 1TX8A 2XBWA 2BLVA 1G9IE 1SPJA 2VWLA 3SBKA 2Y7XA 1MZAA 2QF0A 1MAXA 1HJAB 1FY8E 3URCA 1YPJH 3ZZBA 1A0LA 1RXPA 4ZXYH 3RC5A 3H7OA 1MKXH 1QTFA 1W2KH 2FM2A 4KTCA 2IOTA 1P09A 2ILNA 5DGJA 4ZXXH 1MQ5A 3MH6A 4I8HA 1C1PA 3MNBA 1D3DB 2LNCA 1ELEE 2QXHA 4BXWA 1C2GA 1C2DA 3VB7A 5K0HA 4HI3A 2ZG0H 2BD3A 4WF8A 3RXBA 5GXPA 1TNGA 2ZO3H 1TBZH 1XX9A 4I7YH 1DVAH 4TPYA 4BOHA 1F92A 3TLOA 4ZHLU 3TH3H 1KXEA 1LHEH 3F9HA 3RXUA 1YGCH 4MPXA 1MZDA 4IN2A 2OC7A 3QLPH 4H6TA 4ZHMU 1C5YB 3T26A 3M35A 4NZLA 2CJIA 4Y10E 3UQVA 1AB9C 1ZLRA 2WPKS 1LCYA 2F83A 1GHVH 1A4WH 1ETRH 1C1VH 1VITF 1L4DA 3MYWA 1FPHH 2UWOA 3E16B 3FP8E 1SGCA 3F6UH 3PMBB 4GCHG 1S84A 3UREA 2SGFE 2OUAA 3OY5U 3D23A 3SU1A 4MG3A 1PQ8A 1BUIA 1GDUA 3GCOA 6CHAC 1HJ8A 1BTYA 2BLWA 2R3YA 6LPRA 9ESTA 3PTBA 1PYTD 1ETSH 1O37A 1SGRE 3NK8A 3LH3A 1E34B 1C4Y2 3CS0A 1GJ9B 3M61U 2BDAA 3LGVA 4OS5A 4U2WA 2BOHB 4VGCB 4AB8A 1RRKA 4CRCA 1EP6A 1GDQA 2PW8H 1XUJA 2PKSC 3SORA 2ALPA 4JZDH 1TE0A 1GWAA 4A6LA 1KYNA 1C1NA 3BTDE 2NU4E 2R0KA 4ABGA 1C4V2 4JMYA 5DP4A 5JDUB 3RXOA 1DSUA 3UNRA 2WINI 3DA9B 2QA9E 4DURA 1A0JA 1ANCA 4MNXA 2ZQ1A 1TIOA 3RLWH 1O3MA 1NRPH 5A0CA 3EQ0H 4X6MA 1MTVA 1ZSJA 1BTWA 4YOGA 1YPHC 4FUHA 1O2OA 4X6PA 2H1UA 1JIRA 1S0RA 1O2ZA 2ZEBA 4I33A 1SGDE 1CHOF 2FZZA 1MBQA 3FP6E 1P9SA 4Y71A 2Z94A 1F0RA 2A31A 2ZC9H 4OS6A 1YCPM 3A85A 3GCHC 4KP0A 2ASUB 1VCWA 1E36B 1MD8A 1EAXA 1AFQC 1THSH 1EB1H 5ESBA 3SJ9A 2CV3A 4UD9H 2H5DA 1H9LB 3NCLA 1OX1A 1Y3YA 2THFB 4J1YA 5EODA 2ALVA 2FOFA 5HM2A 4Y6DA 1P2NA 3ZZDA