1GJ6A

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj6A02
4HTCH 4MNWA 4INLA 3OSYA 3TK5A 1LMWB 1FPCH 2RDLA 2A4RA 1BMMH 4IC5A 3BG8A 5FPSA 3E6PH 1E37B 1HAGE 3ZZ8A 4UD9H 4E7NA 4AG2A 3RXCA 2A1DB 3TJNA 1UVSH 1ARBA 1P0SH 1HCGA 3GY2A 2VIQA 2WINI 1ARCA 4Q80A 3RXEA 1GDQA 1BTPA 3TH2H 1NZQH 3U98H 2O8MA 1A3EH 1SOZA 3UY9A 1XXFA 1ELGA 3SV9A 5FBIA 1Y5BT 3HATH 4JZ1A 2NU0E 3ATKA 1VITG 1C2LA 2F9NA 3QGNB 1PPZA 3SU4A 2Y7XA 1KXEA 1TONA 1GBDA 2HOBA 2R3YA 2J2UA 4IC6A 2W26A 2ZCLP 4ABFA 1BITA 1GJ5H 1LTOA 2V0BA 2WPHS 1UVPA 3KHVA 3FANA 3A80A 3RU4T 1XUJA 4A7IB 1NRSH 1U6QA 2WYJA 2C8XB 3P8GA 1AWHB 1YM0A 1GBTA 4ZHMU 1ZSKA 3MNSA 3KNXA 1C1UH 1GMDF 2A32A 1YPKH 3AVZA 1Y3UA 1H9IE 3QLPH 3F9GA 1FNIA 5EXNA 3FZZA 1BQYA 1SLXB 5DP7A 4WXVA 1GHYH 4ZROA 4O9VA 1XUFA 1S82A 2XXLA 2AGGX 1HPGA 7LPRA 3U69H 3GCOA 4BAKB 2XW9A 1O2QA 1KDQA 4H6SB 1GDNA 3EAJA 1QA7A 2FX6A 2GZ8A 5DG6A 1W11U 1RGQA 4AZ2B 2Z9KA 1BTUA 4Y8YA 1VR1H 3GY5A 1K1MA 4HZHA 3RXRA 2ZFPH 4VGCB 4D8NA 5C1UA 1DSTA 1MBQA 2FOHA 1O2OA 4AX9H 3HPTB 3A7TA 1O36A 3QN7A 3SV2H 2H2ZA 4LK4A 1DM4B 5TCCA 1D6WA 1SLUB 2DUCA 3FZDA 4ISOA 3SN8A 8ESTE 2STAE 4GPGA 2SGPE 1O5BB 1MKWK 1K28D 2XCFA 4U30A 3MU1A 3VB6A 1BMAA 3KCGH 2AMDA 1X7AC 2UWLA 3B8JA 1W12U 3PMHB 1P12E 4AB8A 2LNCA 1C1QA 1EJMA 2PSYA 4JK6A 3NZIA 2ZHWH 4YOGA 3SU6A 1QFKH 1Y5UT 1KLJH 2BVSH 1QJ6B 1ZMJA 4MNXA 1DS2E 4FUFA 1NO9H 2PWXA 2BD2A 1NU7B 4K1SA 4NFFA 3U1IB 5AVDA 3MHWU 1BRAA 1FIZA 5E8EH 1E38B 2FLBH 2FOGA 4I8GA 2A7CA 1IOEA 1V2UT 2NU3E 1O2WA 1D3QB 1F92A 1J17T 1TA2A 1MTNC 2FYQA 3QUMP 1EASA 4B2AA 5E2PA 1GBFA 3DFLA 2FWWA 1NRPH 2ZGHA 4TY7A 3GOVB 4LXBH 2W5EA 3EYDA 4BOHA 1RIWC 3VEQB 4DVAU 2A4QA 2ZU2A 3NXPA 3VB3A 2ANYA 2D8WA 1VJ9U 4AYYB 1O3GA 3OTJE 4F4OC 1C2EA 3OU0A 2XTTB 1ESAA 1GMHG 1Q3XA 1PPFE 1ANEA 2AYWA 5GDSH 2DE9A 3UPEA 3BTME 1G36A 1TNIA 1VCQA 4XBCA 1OWJA 1ZGVA 4TWWA 4TWYA 1DANH 2WUBA 1HAVB 3V12A 5K7RA 3UR9A 1G2MA 1K1NA 3DHKH 1YBWA 2AH4X 4KTSA 3KQCA 1V2LT 1B7XB 1KY9A 3P8FA 5AF9H 2BXUH 1GMCF 1HIAA 4RSPA 3MYWA 1E35B 1GGDB 3UREA 1Z6JH 3QO6A 1C5XB 1C1SA 3KF2A 2J38A 4WH6A 1UVOA 1OWIA 1C5RA 3URCA 3AW0A 5JBTA 3SQEE 2PKSB 2G5VA 2Y7ZA 5DP5A 1TOMH 1DXPA 5LPFA 1HAVA 2IJOB 3SZNA 2ZHEH 4DG4A 1K1OA 1ZYOA 3I77A 2YNAA 4YESB 1SGIB 2SGAA 3O8BA 3GY6A 1MCVA 5FX5A 1QB9A 1BDAA 2XYAA 3RMNH 3UR6A 3RXDA 1F0RA 2V3HH 3A7ZA 2I6SA 3SV7A 2ZF0H 1YGCH 3T2NA 4TY6A 4NG9H 2ZC9H 3P92A 2FI5E 4H4FA 1Y3XA 3A8CA 2G4TA 1HXFH 1O2MA 3Q3XA 1C1MA 1QIXB 2KAIA 3RMLH 3HKIB 1THSH 1UTPA 5FBEA 5C3NA 4MLFB 1JIRA 1INCA 1PYTD 1PPHE 1J15A 1HAPH 2C8WB 3RXSA 1BA8B 1W0ZU 1O31A 3ATIA 2O8LA 1DICA 4ABHA 2ZQ2A 1A1RA 1GG6B 1GI2A 2QXHA 3MFJA 3HK6B 4A5TS 3V7TA 5CHAC 1YLDA 3QWCH 1MQ5A 1O3HA 3PLPA 3MU8A 4AOQA 5A8YA 2F83A 4X2XA 3NKKA 2BHGA 4U32A 3UQOA 2QF0A 1HRTH 1S84A 2FOBA 3F6UH 1A5IA 4ZXYH 4X1RU 1BTXA 3GY7A 2ODYB 3GDVA 4Q7XA 4NIWA 1C5NH 4ABIA 1ZPCA 2UUFB 2ZDKA 1AHTH 2ZPRA 5AFZH 3SNEA 4IGDA 4A6LA 1SGNE 1HB0B 1W2KH 3SI4H 5A2MH 1BZXE 5DPAA 3TLOA 3LC3A 1AUTC 3LH1A 2XCNA 1LDTT 4RN6A 1AY6H 5FPYA 3ODFA 1ELAA 3MOCA 1KTTB 2XBXA 4Z6AH 3M3SA 4NZQA 5E0GA 4AORA 3BIVH 3E0PB 4B76A 1E36B 2FP7B 1EX3A 1PPGE 3P95A 2BDBA 2G81E 5HYOA 2ZU1A 2IPHA 1AQ7A 4A1VA 1GHBF 2OP9A 1KDQB 4OS1A 3RXHA 1P2NA 5FAHA 1YPEH 4DOQA 1ETTH 1TMBH 1W7GH 3FFGA 1ELTA 1JXPA 1H1BA 1SPJA 1LO6A 3EQ0H 3UNSA 2W7SA 1LHGH 3ZZ7A 4Q7ZA 2FI3E 1O2HA 3PMJA 2P3FH 3P17H 1C2DA 4CRFA 3HGNA 1RIWB 1TGCA 4FVBA 1TB6H 1DT2A 2PGQB 1JMOH 3DFJA 4Y6DA 2FLRH 3SI3H 5DKMA 1UJ1A 4ZH8A 1O5GH 2H1UA 3S69A 4DY7B 4UFEH 4BANB 3RXOA 1V2VT 1O3MA 2VVCA 5E0HA 1GCTB 2Z9IA 2G8TA 1YC0A 2PTNA 2G4UA 2BZAA 2GCHF 2GD4B 1FN6A 4WMDA 1GJ9B 1Y8TA 2RA3A 5TJXA 1NPMA 4UONA 1V2KT 1FY5A 2VIWA 1QRXA 1P03A 1AFQC 4INKA 1P57B 1SQTA 1HYLA 3M5MA 3ZZ5A 1SVPA 4AB9A 2EA3A 3AAUA 2Y5FA 4Y76A 1DFPA 2G51A 3SW2B 1TGSZ 2BDGA 2GZ9A 1KXDA 1C1OA 2OXSA 3ZZBA 2BOKA 1IQLA 3H7TA 3D65E 1C5YB 1BTYA 1KTSB 1LCYA 1CGJE 1H9HE 1F0SA 3KEEA 1IQFA 1GL0E 1AB9B 1NC6A 4X6OA 5FHTA 3VPKA 5JBCS 1QJ1B 1CHOG 1ZLRA 1WV7H 1IQEA 3SJOA 3GY3A 2R2WU 1WCZA 3SQHE 5DP9A 1YPHC 1O35A 1ELEE 2GV7A 1C1PA 2THFB 2BD4A 1AZ8A 1BTHH 4I32A 1QGFA 3T29A 2QXJA 4UFGH 2QF3A 2HVXA 3GCHB 1GJAB 3A87A 3RU4D 3A89A 3SUGA 2BY6X 4MPWA 1MKWH 5ESTE 2PKAA 2H9TH 4NSVA 2ZG0H 4MNYA 1L1NA 1AE5A 1VCWA 2HLCA 4IN1A 1K1JA 1MUEB 2ANKH 3KQDA 1HAOH 1AN1E 3B23B 1TBRH 3VFEA 1GBEA 4X8VH 1YPGH 4X6MA 3B9FH 5GIBA 2Z9GA 1TRMA 1Z8RA 1EB1H 1GMHF 1MQ6A 1PQ5A 5I46H 2PR3A 4X1SU 1GCTC 1FY4A 1P09A 2TGTA 1SG8B 1Z6EA 3UTUH 2A0QB 1AVWA 2BLVA 1C2JA 1FZZA 6ESTA 1DX5M 2CJIA 3EGKH 1ZHPA 2ZCHP 7ESTE 3PROA 1RD3B 3SU1A 1ACBE 1V2OT 4KGAA 1P2QA 1G3BA 3D49H 2BY9X 3EA8A 1HJAC 2NU1E 3LPRA 1VITF 2NU4E 1LHFH 1UTOA 4ABAA 5HGGA 4AN7A 4X6NA 3KGPA 3A82A 1YP9A 1VJAU 3U8OH 4GCHF 1LPGB 2VNTA 1F5RA 4YTAA 1VCPA 1DE7H 4OS5A 3R0FA 2A7HA 1MTUA 1JIMA 2G55A 3PWCA 1XVMA 2GCHG 1DDJA 2VVUA 1TNHA 2GT8A 1BRUP 1O3KA 1LVMA 5EPYA 2VB0A 1TYNA 4MVNA 4IS5A 1C5LH 2O8WA 4O97A 1OSSA 1YF4A 1ZOMA 3SHCH 4E06H 2FOFA 2ZFTA 1O3DA 1TE0A 1QQUA 1HIAB 1VZQH 1S0QA 2R0KA 5JPMH 1C1NA 1ESTA 3K6YA 4YLQH 1MKXH 4MQAA 2TPIZ 3T27A 1XXDA 1N6YA 1FY8E 2F9PA 1QL7A 1D6RA 2VWMA 2G5NA 1NTPA 3SBKA 1PJPA 5ESBA 1QA0A 3AW1A 4RKOB 2O8TA 4B75A 1AKSB 4R0IA 2XBWA 1BB0B 4X8TH 4D7FA 4YOJA 5DP6A 1FN8A 3U1JB 3SGQE 1C4U2 5EW1H 2HPPH 1DWDH 1EAIA 2HNTE 1GJ4H 1SOTA 1T4VH 3SJIA 1O2GH 1HDTH 2CV3A 3F1SB 6LPRA 2BM2A 4X2WA 2R3UA 4TYDA 4ISIH 4E05H 1FQ3A 1MTSA 1CHGA 1CT0E 1UO6A 1EPTB 1O5AB 2AFQB 4Q7YA 4X0WU 1TPOA 3VXFH 4O3UA 4WJG2 3RXPA 1O39A 1KSNA 2OBOA 3DD2H 3LGYA 1A5HA 3MWIU 3HK3B 5IYTA 5EOKA 1GBLA 4HI3A 4NFEA 1C5SA 3A88A 1WBGB 1DXWA 4YLUA 1RS0A 2VIOA 6CHAB 1V2ST 2ZO3H 1Z8JB 2GCTB 1ANBA 2A45B 5B6OA 3BEUA 3M7TA 3RXIA 3EDXB 1NRQH 4FU8A 5EXMA 3RXUA 2ZFRH 4BXSA 3BG4B 2OQ5A 4UDWH 2XWBI 1C2GA 1FONA 1XUHA 3ZYEA 1J16A 2ZGJA 3BEIB 5C2ZA 1XKAC 1OXGA 2RG3A 1G3CA 1V3XA 2GDDA 2ZWLH 1HAHH 3SJKA 2FTMA 3LKWA 1BRBE 4I8KA 1Z8GA 1GL1A 1D9IA 1L2EA 1MMJN 1SHYA 1QURH 4BTIB 3JZ1B 1FY1A 1LVBA 2YNBA 1TIOA 1BJVA 2RCEA 3HGPA 3L3TA 2VGCB 4ZUHA 4IN2A 2VWNA 2Z94A 1FDPA 8GCHF 1WQVH 1A0LA 1O2SA 3M3TA 2ALPA 8LPRA 3KQBA 4ABDA 1GBIA 2LPRA 3PB1E 1J8AA 3SJ9A 4X2VA 4AGJA 2PUXB 3V13A 1GI1A 2CF9H 1ZPBA 2ZTYA 1P2MA 4MTBA 4WF8A 3ZYDA 1O32A 1S81A 4K60A 1EATA 1C1VH 2I6QA 3GCTF 3RM2H 4DURA 4X8UH 1GCDA 3M5LA 1NRRH 1Z1IA 2GP9B 1BBRK 1GI4A 1ORFA 3GCHC 1MD7A 2KAIB 2GX4A 3EA7A 1QQ4A 4WMEA 1QTFA 1PQ7A 1OYQA 3LOXA 1C5WB 1B0EA 5JYIA 3TNSA 5C1YA 1JBUH 3UOUA 5HMAA 1QBVH 2FOEA 1HJAB 3P8NA 3CENA 1EAWA 1D3PB 4FUDA 3U8RH 1V2MT 2VVVA 2AEIH 2GVFA 3GYLB 1VGCB 3PMAB 1GMCG 4GUXA 4K1TA 4DIIH 1O2LA 3TIUA 4X2YA 2Y80A 1ZGIA 1GVZA 1MBMA 1W3CA 3MU4A 4GHQA 9ESTA 3IG6B 4CHAC 5F03A 1DLEA 2EEKA 2VIPA 4FU7A 1CT2E 3W95A 1HNEE 1P2KA 5HM9A 3EA9A 1YLCA 1ZJDA 4WMFA 4MG3A 1AO5A 2BQ6B 2PFEA 1C1WH 2NU2E 1W14U 4XOJA 1V2QT 3K65B 2AMPA 3D23A 4O03A 3SV8A 2ZFQH 2A5KA 4GLYA 4NIYA 2JETB 3BTQE 2UUYA 4M7GA 4Y0ZE 3A85A 3BTGE 1TQ7B 2FODA 5DJ7A 1N6XA 3GY8A 3VB7A 3OYPA 3SORA 2Q6GA 1N1LA 2AERH 3F68H 4GSOA 3A7XA 5A8XA 3RXKA 3FP8E 5FXLA 1SBWA 5JB9S 1D3TB 1FUJA 3R3GB 1NY22 1SGEE 1QHRB 3HKJB 5GPIB 5HXFA 1NROH 1H4WA 1O3JA 2WV4A 2GDEH 1C4V2 1RTKA 2A2XH 1G30B 1WQSA 2ZKSA 3TNTA 3SJ8A 2BB4A 4CRBA 2BY7X 4BNRA 3ATWA 1HGTH 1GHAF 2Y5GA 2A7JA 2HALA 1IQMA 5JBAS 3E90B 1P01A 2UUJB 5BRRE 1SGFA 3BTDE 4FUCA 1EXFA 1TNLA 1V2NT 2Y5HA 2P3UB 3E3TA 1GJ8B 3E16B 1NESE 2B0FA 4FUEA 5JBBS 2VIVA 2ESTE 5C5OA 4GCHG 3ATMA 2IN2A 1GHAG 3SOSA 6GCHG 3UWJH 4NWLA 2J9NA 2PKSC 1MKXK 4YT6H 1HAYB 1YPMH 3A81A 2WYGA 2QYIA 1FV9A 4AFZA 4YZUA 4CBNA 3UQVA 4CRGA 1ETSH 5EU8A 2SFAA 3MNCA 2HWLB 4Y7BA 1GI9B 1OP0A 2XBVA 3ESTA 2BDHA 1LVOA 2A4OA 1ZHMA 4JYUH 1V2PT 3UFAA 1F5KU 1JRSA 2A5AA 1C9PA 1SGCA 2GMTB 3E91A 4WWYA 5C1XA 1WTHD 2ULLA 2YOLA 5T3HA 2SNVA 1SGPE 2ZPQA 1DUEA 4UFFH 4Y79A 4OS6A 4K1EA 1GI3A 4Y8XA 1CO7E 3ELAH 2J34A 2QV1A 2GCTC 1MTNB 1TRNA 2BMGB 1O2VA 1C5UA 3GDSA 1TWXB 1IHSH 1A3BH 4CREA 2QXGA 2FS9A 1GHWH 4LOYH 1ESBA 1TLDA 3KN2A 2W3KA 2RA0A 2BYAX 1NN6A 3U9AH 1FLEE 4OS7A 4K3JA 3ZV8A 1A46H 1RFNA 1O3PB 2VH0A 1SR5C 2CMYA 1C9TA 1FMGA 3LJOA 3KIDU 1TGNA 1SGQE 3QTOH 1HAXB 1D4PB 3S7KB 4TPIZ 1G3DA 1BJUA 1OWHA 5CHAB 2QN5T 1BOQA 3ZVEA 2A4GA 1O2PA 3RP2A 2AGIX 2W7UA 3ODDA 4K2YA 1WAYB 3KL6A 2R9PA 1HJ9A 1HV7A 4A1XA 4AG1A 1UTKA 2H5DA 4CH8B 2ZECA 2FM2A 2ZCKP 3IITA 4BTTB 4GAWA 4R8TB 2J95A 1O2IA 5IDKA 1S6FA 1MU8B 3VB5A 3CS7A 1IHTH 3H7OA 3TJVA 3U8TH 2SGQE 1T8NA 1A7SA 2P3TB 4YM9A 1TNJA 2P94A 1EOLA 2QC2A 1GVKB 1OWDA 2FIRH 3MU5A 1TRYA 2OC8A 2BY5X 1DLKB 1LPKB 2AMQA 4SGBE 2O8UA 5L2YH 3MH5A 1G37A 1SGFG 1GHZA 2VH6A 1WSSH 1AKSA 4IW4E 3LGVA 5GJ4B 2VGCC 2F9OA 1MTVA 1OWEA 1BTWA 4LZ4B 1EB2A 2ZDVH 2SGFE 1K1LA 2HNTF 1BMNH 2PUQH 1QRWA 4Q2KA 1NM6A 1QB1A 1ZMLA 8KME2 1Q2WA 2TGPZ 1GWAA 1W10U 2VIDA 1E0FD 1ELCA 4TPYA 2BLOA 1MU6B 4KELA 3BTHE 5EW2H 7GCHF 2OTVA 1IQNA 2FMJA 1QL9A 5F8ZA 2ZHQH 2FS8A 1BBRH 1ELBA 1AE8H 4ZKSU 5T6FA 3VGCB 1YCPM 2FDAA 3F9HA 3UUZA 1NRNH 2Y6TA 2OC7A 2CHAC 4ISLA 4A1TA 3GCNA 3TGJE 3DA9B 5C67A 4ABBA 1GHXH 2H9EH 3A84A 1SB1H 3S9BA 4AYVB 4CHAB 1C5QA 1GDUA 1EOJA 1ZTLA 2ZI2H 5EQQA 1P06A 2FEQH 2SGDE 2OC1A 5SGAE 1ZTJA 1GBKA 2XBYA 1FI8A 1Q31A 1S0RA 1BIOA 2P8OC 3MH4A 3LT3A 1YPHE 1MCTA 3O8RA 5LPEA 3E1XB 1PPEE 3PLKA 3PMBB 4OGYA 1VGCC 1SC8U 1OP2A 3PWBA 1K1PA 3SUFA 1KXAA 1GJ6A 2GZ7A 4UFDH 1BT7A 2ALVA 1BHXF 3GICB 4DJZB 2ANMH 1MAXA 1LVYA 4NZLA 3TJUA 3FAOA 3MMGA 5DP4A 3RXTA 1K9OE 4FU9A 5T6GA 2C93B 1BTZA 1JWTA 1MAYA 4ZHLU 1LHDH 2GT7A 3SNDA 1UVTH 3MU0A 3ZZ3A 1GBHA 3ZVBA 1AB9C 4XDEA 4DCDA 2QY0B 2PTCE 1S6HA 1KLIH 3P8OA 3A8BA 2SGEE 3PO1C 4IMZA 2CF8H 1C5OH 1EPTA 2PKAB 3RXLA 4E7RG 2F91A 4ZAEA 1O2ZA 3QK1A 1B0FA 2HRVA 1ANDA 1CBWC 2CN0H 2TBSA 4I8LA 4NWKA 2ILNA 3RXQA 4X1QU 1EJAA 2V3OH 3ATLA 4ASHA 3ZVCA 2OUAA 1YKTA 1N8OB 3UIRA 1GBBA 2F9UA 4J2YB 1UMAH 4MPUA 5EGMA 1QR3E 3OY5U 3EE0B 1SGYE 4WVPE 4NA7A 3A8DA 1KXCA 4JYTA 1AZZA 1O5CB 1RTLA 3S7HB 5EXLA 7GCHG 2AS9A 2ZU5A 4YO9A 1O30A 4ZMAH 1PQAA 3TVJB 4WH8A 3LDXH 1TX6A 1LHCH 5DO4H 4B1TA 3PLBA 1TBZH 1TX8A 1ZPZA 3LU9B 3AAVA 4FXGH 1IQGA 1UTJA 2UWOA 2F9BH 1AFEH 3TH3H 1A5GH 4ZXXH 3FVFB 2AGEX 3OX7U 4MPXA 5PTPA 1P11E 2FYRA 5L6NH 4LZ1H 1DITH 1C2MA 1A0HB 2VU8E 2BVXH 2HPQH 1T4UH 3SO3A 1UCYH 1F5LA 1F7ZA 1Y5AT 4AFUA 3M5NA 3QX5H 5HM2A 1O2KA 3O8DA 1GJBB 2ZEBA 1DOJA 1Z1JA 4BAOB 1AFQB 4IMQA 3AASA 4OGXA 2BY8X 1CGIE 1CT4E 3BTKE 3BTTE 3Q3KA 3RUOA 5A0AE 1P3EA 3D62A 5LH8A 4XSKU 4H42U 1K1IA 3PO1B 3RXMA 3ZVFA 1O3AA 4NIXA 2AIPA 1W13U 2BD5A 1TGBA 3MH6A 2BLWA 2Q6DA 3BTWE 3KQEA 1GI7B 1S83A 1C2IA 1EQ9A 1NFXA 4X1PU 1CE5A 2FI4E 1T7CA 1DWEH 1N8OC 1TPPA 1TPSA 5A0CA 1DSUA 3BN9A 4UEHH 3LJJA 2GKVE 3RXBA 1DWBH 4BAHB 4CR9A 1YYY1 1UTMA 2ZP0H 1C2HA 1T31A 1WUNH 2F9VA 1O5DH 3SUDA 4CH2B 3I29A 3TPIZ 1SGRE 1K21H 5E0JA 3SV6A 1O3OA 3GYMA 4NCYA 2GGVB 2C3SA 3WY8A 3LGTA 5ABWA 1Y3YA 1UHBA 2J4IA 3VB4A 1YCPH 2ODQA 3I78A 1CHOF 4B2CA 2P8OB 5FPTA 4ESTE 3PTBA 2WPKS 1SGTA 3RM0H 2FXRA 1EJNA 1GI5A 1ELVA 2AIQA 3LH3A 5K0HA 3GY4A 4Y10E 4CRCA 3STIA 1P3CA 3FP6E 5H4IB 1CU1A 6GCHF 2BDYA 4ISHH 4D9RA 1W7XH 2DE8A 2PW8H 4JYVH 2Q6FA 3SNAA 4IBLH 1ELDE 2P93A 1DWCH 2CHAB 1EPTC 1UK4A 2Z9JA 1SHHB 4OS2A 1BRCE 2FOMB 4B2BA 2CGAA 1IQJA 2ZQ1A 2BOHB 3MO6A 5JDUB 4FUIA 5DP3A 1J9CH 3P6ZB 3DT0H 3K2UA 1GHVH 1PPCE 2TIOA 2PLXA 4Y0YE 2D26C 2R0LA 3PYHA 4K8BA 1HAIH 2BTCE 1AU8A 2ZDNA 3BG4C 1GBMA 4HFPB 5FCRA 2QGRA 1LQEA 1P9UA 4XBDA 1SI5H 2OQUA 4Y7AA 4RKJB 1EZXC 5GXPA 3A83A 5DGJA 1V6DA 3M5OA 1AGJA 1EZSC 3TGKE 1V2JT 1Z7KA 4B73A 1QJ7B 2FESH 4NA8A 1CBWB 1PFXC 3T26A 4BTUB 4XBBA 4VGCC 4AFSA 3C1KA 2ZFSA 1WTGH 1GI6A 2B5TB 2G52A 3ZVDA 3M61U 2XC5A 5F8XA 1LHEH 4NIVA 4U01A 1ZR0A 2Z7FE 1CQQA 4JK5A 4H6TA 2ZGBH 2XWAA 1TNKA 1ZSLA 1TA6A 1O34A 4X6PA 1AWFH 1L4DA 1NFYA 2ODPA 3ZZCA 1JOUB 3CS0A 4BAMB 2A31A 1Z8IB 1UCYE 1O3NA 3QDZB 1JRTA 2P95A 1F0TA 3BV9B 3M7QA 5EQSA 4D7GA 1QL8A 3NK8A 1RTFB 1P9SA 1C1TA 2CXVA 2FZZA 5AHGH 1QBNA 3ITIA 5I25A 1CA8B 4ABJA 2SNWA 2J94A 2XRCA 3L33A 1SSXA 4JZIA 2ASUB 5F6MA 1DVAH 2BDCA 1O38A 5C20A 1O2TA 3Q77A 1BUIA 1GJDB 2FPZA 3S9CA 4QT8C 1DUAA 1LQDB 1C5PA 1QBOA 3BF6H 2BD3A 2C8ZB 2ZTXA 3SUEA 1C2FA 3A7YA 4CR5A 1C5ZB 6CHAC 1P2OA 1DPOA 9LPRA 4KTCA 1K22H 1G9IE 1P2JA 1O2UA 2EC9H 1EKBB 3T5FH 2O9QA 2WPIS 1OP8A 4YOIA 3NWUA 3LIWA 1F2SE 3RXFA 1FAXA 3RXVA 3NUMA 1YPLH 3ZZ9A 1KYNA 3RC6A 5A8ZA 1SMFE 1AD8H 1L1GA 2BDAA 3BTFE 4FVDA 1UHBB 2Z6BD 3ZVAA 4CRDA 1RXPA 8GCHG 2OLGA 1TMTH 1TALA 2TGAA 1EUFA 1L4ZA 1FY3A 4BXWA 1NS3A 3SNBA 1T8MA 4OS4A 4Z0KA 4JZDH 2WV5A 1IQHA 1SLVB 5LPRA 1HBTH 1T8LA 2HGTH 2D2DA 1GGDC 2WPMS 2XC0A 3T62A 1O2YA 4MDSA 3STJA 1O3BA 4FUGA 1ABJH 5JB8S 3UNQA 1ZZZA 1A0JA 2Z3EA 4K5ZA 1MZDA 4WXIA 3A8AA 2QCYA 4SGAE 1FXYA 1LKBA 3F9EA 4I7YH 3RDZA 2BXTH 1FAKH 2D1JA 1D3DB 2W3IA 2Z9LA 1P05A 5FX6A 4JZFH 1AMHA 1LKAA 4KTUA 3SNCA 5ETXA 3BSQA 2QAAA 1PPBH 1WOFA 1K2I1 1H8DH 4CRAA 1ABIH 1TOCB 3TITA 4DW2U 4GVUA 2G00A 2FOCA 3RLYH 2BD9A 4YT7H 2B7DH 1EP5A 5T6DA 3F9FA 1XX9A 3Q3YA 2OINA 1YPJH 5EPNA 5J4QA 2XC4A 4NSYA 2C90B 2P59A 4A92A 2EI6A 2B9LA 4Y11E 2BVRH 2VJ1A 1C1RA 1MZAA 2IOTA 2OD3B 2J92A 3ZZAA 1FJSA 2WPJS 3RXGA 3TK9A 1EZQA 1FIWA 3MI4A 1SQOA 1O2NA 3S0NA 3M37A 1HJ8A 1LPZB 2VWLA 3LGUA 2BD7A 2EI8A 1DY9A 1HAZB 1NFWA 2ZDLA 1O3FA 1HFDA 1QNJA 4I33A 2HNTC 3BIUH 3L6PA 1CA0C 1TABE 1O0DH 2ZDAH 4Y71A 1O3IA 4HGCA 3VXEH 1WYKA 2VWOA 1KIGH 2BX4A 1E34B 5DP8A 2JETC 3M35A 1O2XA 5AFYH 1GI8B 2Z3CA 2ZIQH 1ZJKA 1V2RT 1WU1A 3RC5A 2ZZUH 2QIQA 4I31A 5FCKA 1S5SA 1ID5H 2OC0A 5A09A 1EAUA 3UWIA 1KLTA 3RC4A 3UNRA 4NGAH 1EP6A 1NFUA 1MTWA 3CP7A 1TX7A 2R2MB 1A61H 2PV9B 1IAUA 3ZZ4A 3N7OA 1AVXA 2OCVB 3TH4H 1BBRE 4DIHH 3QZRA 5L30H 1OYTH 2TGDA 1HUTH 1GVLA 2PSXA 1THPB 1HXEH 2H5CA 3RXAA 4MPVA 1Y3VA 3ZV9A 1P04A 3SU2A 2ZA5A 1GG6C 2BDIA 3LONA 1B5GH 4DGJA 5GWZA 1THRH 4JZEH 1EAXA 2STBE 1GJCB 1C5VA 1ELFA 2NWNA 3MO9A 4ZHAA 3RLWH 4AFQA 2Y81A 2ZHFH 1DY8A 1ZRBA 3NPSA 2JH5D 3DUXH 3SHAH 2WPLS 1KXBA 4Y8ZA 1O5EH 3GISB 3S9AA 3E8LA 3TK6A 2H9HA 1YCPK 4NA9H 2FOAA 1OPHB 3QGJA 2QXIA 2GTBA 4XFQA 1H9LB 3RXJA 3RU4E 4ZKRU 2BQWB 4AGKA 3PM3A 1TNGA 1UCYK 1SL3A 1O33A 1ZMNA 1C2KA 3TU7H 4O3TA 1XUKA 1SGDE 1UTLM 1AI8H 1QB6A 4K69A 1CA0B 3ZZ6A 2GMTC 5A0BA 2FO9A 1GMDG 5F8TA 4KP0A 4DT7B 3SGBE 5EQRA 1GI0A 1GPZA 3BEFB 1Y3WA 1KXFA 2PGBB 1XUIA 3MTYA 1XMNB 1CSOE 3M7UA 3V0XA 3RMMH 3MNXA 4F49A 2JH0D 1O37A 5EODA 1GJ7B 3Q00A 1NU9A 1W0YH 4PROA 1V2TT 1T8OA 3W94A 1Z71A 2UWPA 5LGOA 3K9XB 3MNBA 4I8JA 1O2RA 4XE4A 3JZ2B 3ENSB 4UE7H 4B74A 1CVWH 2BLQA 1TBQH 1J14A 2C4FH 4CBOA 1O3LA 1S85A 1UTNA 1EZUC 1GBCA 2V35A 2Y82A 1G32B 1P10A 1O5FH 3LGWA 2ZPSA 1SFQB 1A2CH 1XVOA 3NCLA 3RMOH 3G01A 3P70B 1UK2A 1W8BH 1O3CA 1M9UA 4JMYA 1IQKA 4ABGA 2UUKB 3H5CB 1QRZA 3M36A 1O3EA 2BX3A 4GHTA 2V6NA 2K1QA 4ABEA 3MO3A 1HLTH 1GBAA 1TQ0B 5L2ZH 5C5NA 1OKXA 2ZU3A 1CGHA 1AVGH 1P2IA 2PHBA 1T32A 1QCPA 3V3MA 1QY6A 2JKHA 4ZKOU 5EG4A 3O8CA 5G4BA 7KMEH 3A7WA 1ZSJA 3SU3A 1C4Y2 1FPHH 3GDUA 2ZGXH 2Q1JA 3TJOA 3OY6U 4KKDA 3BTEE 4X1NU 2ZDMA 2GV6A 1GBJA 1P02A 1Y59T 3C27B 4D76A 1UVUH 3SU0A 3T28A 5J4SA 1C5TA 2B8OH 1XM1A 1XKBC 1ANCA 2ZNKH 2M5TA 1SLWB 1H8IH 2ZTZA 1MD8A 1OOKB 4THNH 1RJXB 1SFIA 2QA9E 5CMXH 1UK3A 1RRKA 4U2WA 4MNVA 1GHBG 3ZZDA 1ZHRA 2Z3DA 3K6ZA 3PV4A 2A5IA 2FTLE 3TGIE 3PTNA 1C5MD 1TAWA 5GCHG 4ISNA 4INHA 3SGAE 3SU5A 3VGCC 1AIXH 3QTVH 1SQAA 1XUGA 2ZHDA 1OS8A 1OWKA 4B71A 1PQ8A 2JH6D 1A4WH 2BQ7B 3URDA 4I8HA 1OX1A 5GCHF 1MH0A 1IQIA 3M3VA 3Q76A 2FX4A 2C8YB 4FUJA 1O2JA 1NT1A 3LGIA 1F0UA 2ANWA 4D9QA 3A86A 4J1YA 3MH7A 2P16A 1UTQA 5TCAA 1PYTC 4ZKNU 2H6MA 4FUHA 1AUJA 2A2QH 3QZQA 2ZGCA 1TMUH 5E2OA 1L0ZA 1G3EA 4X8SH 3T25A 1BMLA 5CE1A 3ZVGA 2BZ6H 2F3CE 4WY3A 1L1JA 1TPAE 1VITH 4BAQB 2EI7A 3E0NB 1ETRH 4K8YA 2ZFFH 3A7VA 2TRMA 2OBQA 2VINA 2BD8A 1G2LA 1BHXB 1BCUH 5BPEA 1P8VC 3GCTG 5DK1A 1TGTA 2ZU4A 2WUCA 3UOPA 3FP7E 1ZRKA 1ZTKA 1V2WT 4FUBA 3IWMA 1TFXA 2XNIA 3LC5A 4JCNA
chains in the Genus database with same CATH superfamily
4HTCH 4MNWA 4INLA 3OSYA 3TK5A 1LMWB 1FPCH 2RDLA 2A4RA 1BMMH 4IC5A 3BG8A 5FPSA 3E6PH 1E37B 1HAGE 3ZZ8A 4UD9H 4E7NA 4AG2A 3RXCA 2A1DB 3TJNA 1UVSH 1ARBA 1P0SH 1HCGA 3GY2A 2VIQA 2WINI 1ARCA 4Q80A 3RXEA 1GDQA 1BTPA 3TH2H 1NZQH 3F0PA 3U98H 2O8MA 1A3EH 1SOZA 3UY9A 1XXFA 1ELGA 3SV9A 5FBIA 1Y5BT 1COWD 3HATH 4JZ1A 5CDFE 2NU0E 3ATKA 1VITG 1C2LA 2F9NA 3QGNB 3WWBA 1PPZA 3SU4A 2Y7XA 1KXEA 1TONA 1GBDA 2HOBA 2R3YA 2J2UA 4F55A 4IC6A 5T1VA 2W26A 2ZCLP 4ABFA 1BITA 1FX0B 1GJ5H 1LTOA 2V0BA 2WPHS 1UVPA 3KHVA 3FANA 3A80A 3RU4T 1XUJA 4A7IB 1NRSH 1U6QA 2WYJA 2C8XB 3P8GA 1AWHB 1YM0A 5C17A 1GBTA 4ZHMU 1ZSKA 3MNSA 3KNXA 1C1UH 1GMDF 2A32A 1YPKH 3AVZA 1Y3UA 1H9IE 3QLPH 3F9GA 1FNIA 2KX4A 5EXNA 3FZZA 1BQYA 1SLXB 5DP7A 4WXVA 1GHYH 4ZROA 4O9VA 1XUFA 1S82A 2XXLA 2AGGX 3PRDA 2M2AA 1HPGA 7LPRA 3U69H 3GCOA 4BAKB 2XW9A 1O2QA 1KDQA 4H6SB 1GDNA 3EAJA 1QA7A 4YXWD 2FX6A 2GZ8A 5DG6A 1W11U 1RGQA 4AZ2B 2Z9KA 1BTUA 4Y8YA 1VR1H 3GY5A 1K1MA 4HZHA 3RXRA 2ZFPH 4VGCB 4D8NA 5C1UA 1DSTA 1MBQA 2FOHA 1O2OA 4AX9H 3HPTB 3A7TA 1O36A 3QN7A 3SV2H 2H2ZA 4LK4A 1DM4B 5TCCA 1D6WA 1SLUB 2DUCA 3FZDA 4ISOA 3SN8A 8ESTE 2STAE 4GPGA 2SGPE 1O5BB 1MKWK 1K28D 2XCFA 4U30A 3MU1A 3VB6A 1BMAA 2L6OA 3KCGH 2AMDA 1X7AC 2UWLA 2EQNA 3B8JA 1W12U 3PMHB 1P12E 4AB8A 2LNCA 1C1QA 1EJMA 2PSYA 4JK6A 3NZIA 2ZHWH 4YOGA 5KGOA 3SU6A 1QFKH 1Y5UT 1KLJH 2BVSH 1QJ6B 1ZMJA 4MNXA 1DS2E 4FUFA 1NO9H 2PWXA 2BD2A 1NU7B 4K1SA 4NFFA 3U1IB 3SYJA 5AVDA 3MHWU 1BRAA 1FIZA 5E8EH 1E38B 2FLBH 2FOGA 4I8GA 2A7CA 1IOEA 1V2UT 2NU3E 1O2WA 1D3QB 1F92A 1J17T 1TA2A 1MTNC 2FYQA 3QUMP 1EASA 4B2AA 5E2PA 3FN8A 1GBFA 3DFLA 2FWWA 1NRPH 2ZGHA 1OHHD 4TY7A 3GOVB 4LXBH 2W5EA 3EYDA 4BOHA 1RIWC 3VEQB 4DVAU 2A4QA 2ZU2A 3NXPA 3VB3A 2ANYA 2D8WA 1VJ9U 4AYYB 1O3GA 3OTJE 4F4OC 1C2EA 3OU0A 2XTTB 1ESAA 1GMHG 1Q3XA 1PPFE 5EJ1A 1ANEA 2AYWA 5GDSH 2DE9A 3UPEA 3BTME 1G36A 1TNIA 1VCQA 4XBCA 1OWJA 1ZGVA 4TWWA 4TWYA 1DANH 2WUBA 1HAVB 3V12A 5K7RA 4FETA 3UR9A 1G2MA 1K1NA 3DHKH 3WWFA 1YBWA 2AH4X 4KTSA 3KQCA 1V2LT 1B7XB 1KY9A 3P8FA 5AF9H 2BXUH 1GMCF 1HIAA 4RSPA 3MYWA 1E35B 1GGDB 3UREA 1Z6JH 3QO6A 1C5XB 1C1SA 3KF2A 2J38A 4WH6A 1UVOA 1OWIA 1C5RA 3URCA 3AW0A 5JBTA 3SQEE 2PKSB 2G5VA 2KM0A 2Y7ZA 4TSFD 5DP5A 1TOMH 1DXPA 5LPFA 1HAVA 2IJOB 3SZNA 2ZHEH 4DG4A 1K1OA 1UW7A 1ZYOA 3I77A 2YNAA 4YESB 1SGIB 2SGAA 3O8BA 3GY6A 1MCVA 5FX5A 1QB9A 1BDAA 2XYAA 3RMNH 3UR6A 3RXDA 1F0RA 2V3HH 3A7ZA 2I6SA 3SV7A 2ZF0H 1YGCH 3T2NA 4TY6A 4NG9H 2ZC9H 3P92A 2FI5E 4H4FA 1Y3XA 3A8CA 2G4TA 1HXFH 1O2MA 3Q3XA 1C1MA 1QIXB 2KAIA 3RMLH 3HKIB 1THSH 1UTPA 5FBEA 5C3NA 4MLFB 1JIRA 3W1EA 1INCA 1PYTD 1PPHE 1J15A 1HAPH 2C8WB 3RXSA 1BA8B 1W0ZU 1O31A 3ATIA 2O8LA 3UB0A 1DICA 3MQKC 4ABHA 2ZQ2A 1A1RA 1GG6B 1GI2A 2QXHA 3MFJA 3HK6B 4A5TS 3V7TA 5CHAC 1YLDA 3QWCH 1MQ5A 1O3HA 2XOKD 3MU8A 3PLPA 4AOQA 5A8YA 2F83A 4X2XA 3NKKA 2BHGA 4U32A 3UQOA 2QF0A 1HRTH 1S84A 2FOBA 3F6UH 1A5IA 4ZXYH 4X1RU 1BTXA 3GY7A 2ODYB 3GDVA 4Q7XA 4NIWA 2HVYB 1C5NH 4ABIA 1ZPCA 2UUFB 2ZDKA 1AHTH 2XNDD 2ZPRA 5AFZH 3SNEA 4IGDA 4A6LA 1SGNE 1HB0B 1W2KH 3SI4H 5A2MH 1BZXE 5DPAA 2VBCA 1BMFD 3TLOA 3LC3A 1AUTC 3LH1A 2XCNA 1LDTT 4RN6A 1AY6H 5FPYA 3ODFA 1ELAA 3MOCA 1W0JD 1KTTB 2XBXA 4Z6AH 3M3SA 4NZQA 5E0GA 4AORA 3BIVH 3E0PB 4B76A 1E36B 2FP7B 1EX3A 1PPGE 3P95A 2BDBA 2G81E 5HYOA 3DSPA 2ZU1A 2IPHA 4OM9A 1AQ7A 4A1VA 1GHBF 2OP9A 1KDQB 4OS1A 3RXHA 1P2NA 5FAHA 1YPEH 4DOQA 1ETTH 1TMBH 1W7GH 3FFGA 1ELTA 1JXPA 1H1BA 1SPJA 1LO6A 3EQ0H 3UNSA 2W7SA 1LHGH 3ZZ7A 4Q7ZA 2FI3E 1O2HA 3PMJA 2P3FH 3P17H 4Z1MD 1C2DA 4CRFA 3HGNA 1RIWB 1TGCA 4FVBA 1TB6H 1DT2A 2PGQB 5GNDA 1JMOH 4ACAA 3DFJA 4Y6DA 2FLRH 3SI3H 5DKMA 1UJ1A 4ZH8A 1O5GH 3F3BA 2H1UA 3S69A 4DY7B 4UFEH 4BANB 2CK3D 1V2VT 3RXOA 1O3MA 2VVCA 5E0HA 1GCTB 2Z9IA 2G8TA 1YC0A 2PTNA 2G4UA 2BZAA 2GCHF 2GD4B 1FN6A 4WMDA 1GJ9B 1Y8TA 3PV2A 2RA3A 5TJXA 1NPMA 4UONA 1V2KT 1FY5A 2VIWA 1QRXA 1P03A 1AFQC 4INKA 5CHBA 1P57B 1SQTA 1HYLA 3M5MA 3ZZ5A 1SVPA 4AB9A 2EA3A 3AAUA 2Y5FA 4Y76A 1DFPA 2G51A 3SW2B 1TGSZ 2BDGA 2GZ9A 1KXDA 2K0QA 1C1OA 2OXSA 3ZZBA 2BOKA 1IQLA 2J98A 3H7TA 4DT4A 3D65E 1C5YB 1BTYA 1KTSB 1LCYA 5HIYA 1CGJE 1H9HE 1F0SA 3KEEA 1IQFA 1GL0E 1AB9B 1NC6A 4X6OA 5FHTA 3VPKA 5JBCS 1QJ1B 1CHOG 1ZLRA 2YMSD 1WV7H 1IQEA 1H8HD 3SJOA 3GY3A 2R2WU 1WCZA 4F48B 3SQHE 5DP9A 1YPHC 1O35A 1ELEE 2GV7A 1C1PA 2THFB 2BD4A 1AZ8A 1BTHH 4I32A 1QGFA 3T29A 2LELA 2QXJA 4UFGH 2QF3A 2HVXA 3GCHB 1GJAB 3A87A 3RU4D 3A89A 3SUGA 2BY6X 4MPWA 1MKWH 5ESTE 2PKAA 2H9TH 4NSVA 2ZG0H 4MNYA 1L1NA 2QE7D 1AE5A 1VCWA 2HLCA 4IN1A 1K1JA 2QF4A 1MUEB 2ANKH 3KQDA 1HAOH 1AN1E 3B23B 1TBRH 3VFEA 1GBEA 4X8VH 1YPGH 4X6MA 3B9FH 5GIBA 2Z9GA 1TRMA 1Z8RA 1EB1H 1GMHF 1MQ6A 1PQ5A 5I46H 2PR3A 4X1SU 1GCTC 1FY4A 1P09A 2TGTA 1SG8B 1Z6EA 3UTUH 2A0QB 1AVWA 2BLVA 1C2JA 1FZZA 1KMHB 1DX5M 6ESTA 2CJIA 3EGKH 1ZHPA 2ZCHP 7ESTE 3PROA 1RD3B 3SU1A 1ACBE 1V2OT 4KGAA 1P2QA 1G3BA 3D49H 2BY9X 3EA8A 1HJAC 2NU1E 3LPRA 1VITF 2NU4E 1LHFH 1UTOA 4ABAA 5HGGA 4AN7A 4X6NA 3KGPA 3A82A 1YP9A 1VJAU 3U8OH 4GCHF 1LPGB 2VNTA 1F5RA 4YTAA 1VCPA 1DE7H 4OS5A 3R0FA 2A7HA 1MTUA 1JIMA 2G55A 3FO8D 3PWCA 1XVMA 2GCHG 1DDJA 2VVUA 1TNHA 2GT8A 1BRUP 1O3KA 2J98B 1LVMA 5EPYA 2VB0A 1TYNA 4MVNA 4IS5A 1C5LH 2O8WA 4O97A 1OSSA 3AK5A 1YF4A 1ZOMA 3SHCH 4E06H 2FOFA 2K8IA 2ZFTA 1O3DA 1TE0A 1QQUA 1HIAB 1VZQH 1S0QA 2R0KA 5JPMH 2WHXA 1C1NA 1ESTA 3K6YA 4YLQH 1MKXH 4MQAA 2TPIZ 3T27A 1XXDA 1N6YA 1FY8E 2F9PA 1QL7A 1D6RA 2VWMA 2G5NA 1NTPA 2WZQA 3SBKA 1PJPA 5ESBA 1QA0A 3DSOA 3AW1A 4RKOB 2O8TA 4B75A 1AKSB 4R0IA 2XBWA 1BB0B 4X8TH 4D7FA 4YOJA 5DP6A 1FN8A 3U1JB 3SGQE 1YLNA 1C4U2 3PRBA 5EW1H 2HPPH 1DWDH 1EAIA 2HNTE 3ZIAD 1GJ4H 1SOTA 1T4VH 3SJIA 1O2GH 1HDTH 2CV3A 3F1SB 6LPRA 2BM2A 4X2WA 2R3UA 4TYDA 4ISIH 4E05H 1FQ3A 1MTSA 1CHGA 1CT0E 1UO6A 1EPTB 1O5AB 2AFQB 4Q7YA 4X0WU 1TPOA 3VXFH 4B6FA 4O3UA 4WJG2 3RXPA 1O39A 1KSNA 2OBOA 3DD2H 3LGYA 1A5HA 3MWIU 3HK3B 5IYTA 5EOKA 1GBLA 4HI3A 4NFEA 1C5SA 3A88A 1WBGB 1DXWA 4YLUA 1RS0A 2VIOA 6CHAB 1V2ST 2ZO3H 1Z8JB 2GCTB 1ANBA 2A45B 5B6OA 3BEUA 3M7TA 3RXIA 2KCAA 3EDXB 1NRQH 4FU8A 5EXMA 3RXUA 2OK5A 2ZFRH 4BXSA 3BG4B 2OQ5A 4UDWH 2XWBI 1FONA 1XUHA 3ZYEA 1J16A 2ZGJA 3BEIB 5C2ZA 1XKAC 1OXGA 2RG3A 1QZ8A 3U28C 1G3CA 1V3XA 2GDDA 2ZWLH 1HAHH 3SJKA 2FTMA 2JIZD 3LKWA 1BRBE 4I8KA 1Z8GA 1GL1A 1D9IA 1L2EA 1MMJN 1SHYA 1QURH 4BTIB 3JZ1B 1FY1A 1LVBA 2YNBA 1TIOA 1BJVA 2J97A 2RCEA 3HGPA 3L3TA 2VGCB 4ZUHA 4IN2A 2VWNA 2Z94A 1FDPA 8GCHF 1WQVH 1A0LA 1O2SA 3M3TA 2ALPA 8LPRA 3KQBA 4ABDA 1GBIA 2LPRA 3PB1E 1J8AA 3SJ9A 4X2VA 4AGJA 2PUXB 3V13A 1GI1A 2CF9H 5KEDA 1ZPBA 1NBMD 2ZTYA 1P2MA 4MTBA 4WF8A 3ZYDA 1O32A 1S81A 4K60A 1EATA 1C1VH 2I6QA 3GCTF 3RM2H 4DURA 4X8UH 1GCDA 3M5LA 1NRRH 1Z1IA 2GP9B 1BBRK 1GI4A 1ORFA 3GCHC 1MD7A 2KAIB 2GX4A 3EA7A 1QQ4A 4WMEA 1QTFA 1PQ7A 1OYQA 2QF5A 3LOXA 1C5WB 1B0EA 5JYIA 3TNSA 5C1YA 1JBUH 3UOUA 5HMAA 1QBVH 2FOEA 1HJAB 3P8NA 3CENA 1EAWA 1D3PB 4FUDA 3U8RH 1V2MT 2VVVA 2AEIH 2GVFA 3GYLB 1VGCB 3PMAB 1GMCG 4GUXA 4K1TA 4DIIH 1O2LA 3TIUA 4X2YA 2Y80A 1ZGIA 1GVZA 1MBMA 1W3CA 3MU4A 4GHQA 9ESTA 3IG6B 4CHAC 5F03A 1DLEA 2EEKA 2VIPA 4FU7A 1CT2E 3W95A 1HNEE 1P2KA 5HM9A 3EA9A 1YLCA 1ZJDA 4WMFA 4MG3A 1AO5A 2W6JD 2BQ6B 2PFEA 1C1WH 4I86A 2NU2E 2KR7A 1W14U 4XOJA 1V2QT 3K65B 2AMPA 3D23A 4O03A 3SV8A 2ZFQH 2A5KA 4GLYA 4NIYA 2JETB 3BTQE 2UUYA 4M7GA 4Y0ZE 3A85A 3BTGE 1TQ7B 2FODA 5DJ7A 1N6XA 3GY8A 3VB7A 3OYPA 3SORA 2Q6GA 1N1LA 2AERH 3F68H 3H09A 4GSOA 2YMSC 3A7XA 4FOUC 5A8XA 3RXKA 3FP8E 5FXLA 1SBWA 5JB9S 1D3TB 1FUJA 3R3GB 1NY22 1SGEE 1QHRB 3HKJB 5GPIB 5HXFA 1NROH 1H4WA 1O3JA 2WV4A 2GDEH 1C4V2 1RTKA 2A2XH 1G30B 1WQSA 2ZKSA 3TNTA 3SJ8A 2BB4A 4CRBA 2BY7X 4BNRA 3ATWA 1HGTH 1GHAF 2Y5GA 2A7JA 2HALA 1IQMA 5JBAS 3E90B 1P01A 2UUJB 5BRRE 1SGFA 3BTDE 5C0TA 4FUCA 1EXFA 1TNLA 1V2NT 2Y5HA 4RT1A 2P3UB 3E3TA 1GJ8B 3E16B 1NESE 2B0FA 4FUEA 5JBBS 2VIVA 2ESTE 5C5OA 4GCHG 3ATMA 3CNRA 2IN2A 2F4LA 1GHAG 3SOSA 6GCHG 3UWJH 4NWLA 2J9NA 2PKSC 1MKXK 2RDEA 4YT6H 1HAYB 1YPMH 3A81A 2WYGA 2QYIA 1FV9A 4AFZA 4YZUA 4CBNA 3UQVA 4CRGA 1ETSH 5EU8A 2SFAA 4Q63A 3MNCA 2HWLB 4Y7BA 1GI9B 1OP0A 2XBVA 4HG6A 3ESTA 2BDHA 1LVOA 2A4OA 1ZHMA 3KYGA 4JYUH 1V2PT 3UFAA 1F5KU 1JRSA 2A5AA 1C9PA 1SGCA 2GMTB 3E91A 4WWYA 5C1XA 1WTHD 2ULLA 2YOLA 5T3HA 2SNVA 1SGPE 2ZPQA 1DUEA 4UFFH 4Y79A 4OS6A 4K1EA 1GI3A 4Y8XA 1CO7E 3ELAH 2J34A 2QV1A 5C94A 2GCTC 1MTNB 1TRNA 2BMGB 2EY4C 1O2VA 1C5UA 3GDSA 1TWXB 1IHSH 1A3BH 4CREA 2QXGA 2FS9A 1GHWH 4LOYH 1ESBA 1TLDA 3KN2A 2W3KA 2RA0A 2BYAX 1NN6A 3U9AH 1FLEE 4OS7A 4K3JA 3ZV8A 1A46H 1RFNA 1O3PB 2VH0A 1SR5C 2CMYA 1C9TA 1FMGA 3LJOA 3KIDU 1TGNA 1SGQE 3QTOH 1HAXB 1D4PB 3S7KB 4TPIZ 1G3DA 1BJUA 1OWHA 5CHAB 2QN5T 1BOQA 3ZVEA 2A4GA 3F0OA 1O2PA 3RP2A 2AGIX 2W7UA 3ODDA 4K2YA 1WAYB 3KL6A 2R9PA 1HJ9A 1HV7A 4A1XA 4AG1A 1UTKA 2H5DA 4CH8B 2ZECA 2FM2A 2ZCKP 3IITA 2AHME 4BTTB 4GAWA 4R8TB 2J95A 1O2IA 5IDKA 1S6FA 1MU8B 2XNIA 3CS7A 3VB5A 1IHTH 3H7OA 3TJVA 3U8TH 2SGQE 1T8NA 1A7SA 2P3TB 4YM9A 1TNJA 2P94A 1EOLA 2QC2A 1GVKB 1OWDA 2FIRH 1NBME 1TRYA 2OC8A 3MU5A 1H8ED 2BY5X 1DLKB 1LPKB 2AMQA 1MABB 4SGBE 2O8UA 5L2YH 3MH5A 1G37A 1SGFG 1GHZA 2VH6A 1WSSH 1AKSA 4IW4E 3LGVA 5GJ4B 2VGCC 2F9OA 1MTVA 1OWEA 2WV9A 1BTWA 4LZ4B 5EJLA 1EB2A 2ZDVH 2SGFE 1K1LA 2HNTF 1BMNH 2PUQH 1QRWA 4Q2KA 1NM6A 1QB1A 1ZMLA 8KME2 1Q2WA 2TGPZ 4RT0A 1GWAA 1W10U 2VIDA 3GS9A 1E0FD 1ELCA 4TPYA 2BLOA 1MU6B 4KELA 3BTHE 5EW2H 7GCHF 2OTVA 1IQNA 2FMJA 1QL9A 4P02A 2ZHQH 5F8ZA 2FS8A 1BBRH 1ELBA 1AE8H 4ZKSU 5T6FA 3VGCB 1YCPM 2FDAA 3F9HA 3UUZA 1NRNH 2Y6TA 2OC7A 2CHAC 4ISLA 4A1TA 3GCNA 3TGJE 3DA9B 5C67A 4ABBA 1GHXH 2H9EH 3A84A 1SB1H 3S9BA 4AYVB 4CHAB 1C5QA 1GDUA 1EOJA 1ZTLA 2ZI2H 5EQQA 3DSGA 1P06A 2FEQH 2SGDE 2OC1A 3NRLA 5SGAE 1ZTJA 1GBKA 2XBYA 1FI8A 1Q31A 1S0RA 1BIOA 2P8OC 3MH4A 3LT3A 1YPHE 1MCTA 3O8RA 5LPEA 3E1XB 1PPEE 4AC9A 3PLKA 3PMBB 4OGYA 1VGCC 1SC8U 1OP2A 3PWBA 1K1PA 3SUFA 1KXAA 4XRNA 1GJ6A 2GZ7A 4UFDH 1BT7A 2ALVA 1BHXF 3GICB 4DJZB 2ANMH 1MAXA 1LVYA 4NZLA 3TJUA 3FAOA 3MMGA 5DP4A 3RXTA 1K9OE 4FU9A 5T6GA 2C93B 1BTZA 1JWTA 5B6LA 1WDIA 1MAYA 4ZHLU 1LHDH 2GT7A 3SNDA 1UVTH 3MU0A 3ZZ3A 1GBHA 3ZVBA 1AB9C 4XDEA 4DCDA 2YMSB 2QY0B 2PTCE 1S6HA 1KLIH 3P8OA 3A8BA 2SGEE 3PO1C 4IMZA 2CF8H 1C5OH 1EPTA 2PKAB 3RXLA 4E7RG 2F91A 4ZAEA 1O2ZA 3QK1A 1B0FA 2HRVA 1ANDA 1CBWC 2CN0H 2LP6A 2TBSA 4I8LA 2ILNA 4NWKA 3RXQA 4X1QU 1EJAA 2V3OH 3ATLA 4ASHA 3ZVCA 2OUAA 1YKTA 3DCLA 1N8OB 2KZ4A 3UIRA 1GBBA 2F9UA 4J2YB 1UMAH 4MPUA 5EGMA 1QR3E 3OY5U 3EE0B 1SGYE 4WVPE 4NA7A 3A8DA 1KXCA 2RFKC 4JYTA 1AZZA 1O5CB 1WXRA 1RTLA 3S7HB 5EXLA 7GCHG 2AS9A 2ZU5A 4YO9A 1O30A 4ZMAH 5EIYA 1PQAA 3TVJB 4WH8A 2JJ1D 3LDXH 1TX6A 1LHCH 5DO4H 4B1TA 2F43B 3PLBA 1TBZH 1TX8A 1ZPZA 3LU9B 3AAVA 4FXGH 1IQGA 5F53A 1UTJA 2UWOA 2F9BH 1AFEH 3TH3H 1A5GH 4ZXXH 3FVFB 2AGEX 3OX7U 4MPXA 5PTPA 1P11E 2FYRA 5L6NH 4LZ1H 1DITH 1C2MA 1A0HB 2VU8E 2BVXH 2HPQH 1T4UH 3SO3A 1UCYH 1F5LA 1F7ZA 1Y5AT 3F2HA 4AFUA 3M5NA 3QX5H 5HM2A 1O2KA 3O8DA 1GJBB 2ZEBA 1DOJA 1Z1JA 4BAOB 1AFQB 4IMQA 3AASA 4OGXA 1YWUA 2BY8X 1CGIE 1VKYA 1CT4E 3BTKE 3BTTE 3Q3KA 3RUOA 5A0AE 1P3EA 3D62A 5LH8A 3FKSD 4XSKU 4H42U 1K1IA 3PO1B 3RXMA 3ZVFA 1O3AA 4NIXA 2AIPA 1W13U 2BD5A 1TGBA 3MH6A 2BLWA 2Q6DA 3BTWE 5C0UA 3KQEA 1GI7B 1S83A 1C2IA 1EQ9A 1NFXA 4X1PU 1CE5A 3FOAA 2FI4E 1T7CA 1DWEH 1N8OC 1TPPA 1TPSA 5A0CA 1DSUA 3BN9A 4UEHH 3LJJA 2GKVE 3RXBA 1DWBH 4BAHB 4CR9A 1YYY1 1UTMA 2ZP0H 1C2HA 1T31A 1WUNH 2F9VA 3OAAD 1O5DH 3SUDA 4CH2B 3I29A 3TPIZ 1SGRE 1K21H 5E0JA 2GJGA 3SV6A 1O3OA 3GYMA 3N7DA 4NCYA 2GGVB 2C3SA 3WY8A 3LGTA 5ABWA 1Y3YA 1UHBA 2J4IA 4TT3D 3VB4A 1YCPH 2ODQA 3I78A 1CHOF 4B2CA 2P8OB 5FPTA 4ESTE 3PTBA 2WPKS 1SGTA 3RM0H 2FXRA 1EJNA 1GI5A 1ELVA 2AIQA 3LH3A 5K0HA 3GY4A 4Y10E 4CRCA 3STIA 1P3CA 3FP6E 5H4IB 1CU1A 6GCHF 2BDYA 4ISHH 4D9RA 1W7XH 2DE8A 2PW8H 4JYVH 2Q6FA 3SNAA 4IBLH 1ELDE 2P93A 1DWCH 2CHAB 1EPTC 2KCPA 1UK4A 2Z9JA 1SHHB 4OS2A 1BRCE 2FOMB 4ASUD 4B2BA 2CGAA 1IQJA 2ZQ1A 2BOHB 3MO6A 5JDUB 4FUIA 5DP3A 1J9CH 3P6ZB 3DT0H 3K2UA 1GHVH 1PPCE 2TIOA 3F2FA 2PLXA 4Y0YE 2D26C 2R0LA 3PYHA 4K8BA 1HAIH 2BTCE 1AU8A 2ZDNA 3BG4C 1GBMA 4HFPB 5FCRA 2QGRA 1LQEA 1P9UA 4M9FA 4XBDA 2W6ID 1SI5H 2OQUA 4Y7AA 4RKJB 1EZXC 5GXPA 3A83A 5DGJA 1V6DA 3M5OA 4ACBA 1AGJA 4RI0A 4P00A 1EZSC 3TGKE 1V2JT 1Z7KA 4B73A 1QJ7B 2FESH 4NA8A 1CBWB 1PFXC 3T26A 2IJD1 4BTUB 4XBBA 4VGCC 2J5UA 4AFSA 3C1KA 2ZFSA 1WTGH 1GI6A 2B5TB 3UAIC 2G52A 3ZVDA 3M61U 2XC5A 5EJZA 5F8XA 1LHEH 4NIVA 4U01A 1ZR0A 2Z7FE 1CQQA 4JK5A 4H6TA 1SKYE 2ZGBH 2XWAA 1TNKA 1ZSLA 1TA6A 1O34A 4X6PA 1AWFH 1L4DA 1NFYA 2ODPA 3ZZCA 1JOUB 3CS0A 4BAMB 2A31A 3N7EA 1K0HA 1Z8IB 1UCYE 1O3NA 3QDZB 1JRTA 2P95A 1F0TA 3BV9B 3M7QA 5EQSA 4D7GA 1QL8A 3NK8A 1RTFB 1P9SA 1C1TA 2CXVA 2FZZA 5AHGH 1QBNA 3ITIA 5I25A 1CA8B 4ABJA 2SNWA 5IK2D 2J94A 2XRCA 3L33A 1SSXA 4JZIA 2ASUB 5F6MA 1DVAH 2BDCA 1O38A 5C20A 1O2TA 3Q77A 1BUIA 1GJDB 2FPZA 3S9CA 4QT8C 1DUAA 1LQDB 1C5PA 1QBOA 3BF6H 2BD3A 2C8ZB 2ZTXA 3SUEA 1C2FA 3A7YA 4CR5A 1C5ZB 6CHAC 1P2OA 1DPOA 9LPRA 4KTCA 1K22H 1G9IE 1P2JA 1O2UA 2EC9H 1EKBB 3T5FH 2O9QA 2WPIS 1OP8A 4YOIA 3NWUA 3LIWA 1F2SE 3RXFA 1FAXA 3RXVA 3NUMA 2PP6A 1YPLH 3ZZ9A 1KYNA 3RC6A 5A8ZA 1SMFE 1AD8H 1L1GA 2BDAA 2KFWA 3BTFE 1UHBB 2Z6BD 4FVDA 3ZVAA 1RXPA 4CRDA 8GCHG 2OLGA 1SQRA 1TMTH 2JJ2D 1TALA 2TGAA 1EUFA 1L4ZA 1FY3A 4BXWA 1NS3A 3SNBA 1T8MA 4OS4A 3F2GA 4Z0KA 4JZDH 2WV5A 1IQHA 3EE7A 2KCYA 1SLVB 5LPRA 1HBTH 1T8LA 2HGTH 2D2DA 1GGDC 3KQ5A 2WPMS 2XC0A 3T62A 1O2YA 4MDSA 3STJA 1O3BA 4FUGA 1ABJH 5JB8S 3UNQA 1ZZZA 1A0JA 2Z3EA 4K5ZA 1MZDA 4WXIA 3A8AA 2QCYA 4SGAE 1FXYA 1LKBA 3F9EA 4I7YH 3RDZA 2BXTH 1FAKH 2D1JA 1D3DB 2W3IA 2Z9LA 1P05A 5FX6A 4JZFH 1AMHA 1LKAA 4KTUA 3SNCA 5ETXA 3BSQA 2QAAA 1PPBH 1WOFA 1K2I1 1H8DH 4CRAA 1ABIH 1TOCB 3PV5A 3TITA 4DW2U 4GVUA 2G00A 2FOCA 3RLYH 2BD9A 4YT7H 2B7DH 1EP5A 5T6DA 3F9FA 1XX9A 3Q3YA 2OINA 1YPJH 5EPNA 3WW7A 5KECA 5J4QA 2XC4A 4NSYA 2C90B 2P59A 4A92A 2V3MA 2EI6A 2HLDD 5FL7D 2B9LA 4Y11E 2BVRH 2VJ1A 1C1RA 1MZAA 2IOTA 2OD3B 2J92A 3ZZAA 1FJSA 2WPJS 3RXGA 3TK9A 1EZQA 1FIWA 3MI4A 1SQOA 1O2NA 3S0NA 3M37A 1HJ8A 1LPZB 2VWLA 3LGUA 2BD7A 2EI8A 1DY9A 1HAZB 1NFWA 2ZDLA 1O3FA 1HFDA 1QNJA 4I33A 2HNTC 3BIUH 3L6PA 1CA0C 1TABE 1O0DH 2ZDAH 4Y71A 1O3IA 4HGCA 3VXEH 1WYKA 2VWOA 1KIGH 2BX4A 1E34B 5DP8A 2JETC 3M35A 1O2XA 5AFYH 1GI8B 2Z3CA 2ZIQH 1ZJKA 1V2RT 1WU1A 3RC5A 2ZZUH 2QIQA 4I31A 5FCKA 1S5SA 1ID5H 2OC0A 5A09A 1EAUA 3UWIA 1KLTA 5HKKD 3RC4A 3UNRA 4NGAH 1EP6A 1NFUA 1MTWA 3CP7A 1TX7A 2R2MB 1A61H 2PV9B 1IAUA 5DSFA 3N7OA 1AVXA 3ZZ4A 2OCVB 3TH4H 1BBRE 4DIHH 3QZRA 5L30H 1OYTH 2TGDA 1HUTH 1GVLA 2PSXA 1THPB 1HXEH 4XD7D 2H5CA 3RXAA 4MPVA 1Y3VA 4ZCNA 3ZV9A 1P04A 3SU2A 2ZA5A 1GG6C 2BDIA 3LONA 1B5GH 4DGJA 5GWZA 1THRH 4JZEH 1EAXA 2STBE 1GJCB 1C5VA 1ELFA 2NWNA 3MO9A 4ZHAA 3RLWH 4AFQA 2Y81A 2ZHFH 1DY8A 1ZRBA 3N99A 3NPSA 2JH5D 3DUXH 3SHAH 2WPLS 1KXBA 4Y8ZA 1O5EH 3GISB 3S9AA 3E8LA 3TK6A 2H9HA 1YCPK 4NA9H 2FOAA 1OPHB 3QGJA 2QXIA 2GTBA 4XFQA 1H9LB 3RXJA 3RU4E 4ZKRU 2BQWB 4AGKA 3PM3A 1TNGA 1UCYK 1SL3A 1O33A 1ZMNA 4B6EA 1C2KA 3TU7H 4O3TA 1XUKA 1SGDE 4Q4LA 1UTLM 2JDID 1AI8H 1QB6A 4K69A 1CA0B 3ZZ6A 2GMTC 5A0BA 2FO9A 1GMDG 5F8TA 4KP0A 4DT7B 3SGBE 5EQRA 3OE7D 1GI0A 1GPZA 3BEFB 1Y3WA 1KXFA 2PGBB 1XUIA 3MTYA 1XMNB 1CSOE 3M7UA 3V0XA 3RMMH 3MNXA 4F49A 2JH0D 1O37A 5EODA 1GJ7B 3Q00A 1NU9A 1W0YH 4PROA 1V2TT 1T8OA 3W94A 1Z71A 2UWPA 5LGOA 3K9XB 3MNBA 4I8JA 1O2RA 4XE4A 3JZ2B 3ENSB 4UE7H 4B74A 1CVWH 3OEHD 2BLQA 1TBQH 1J14A 2C4FH 4CBOA 1O3LA 1E1QD 1S85A 1UTNA 1EZUC 1GBCA 2V35A 2Y82A 1G32B 1P10A 1O5FH 3LGWA 2ZPSA 1SFQB 1A2CH 1XVOA 3NCLA 3RMOH 3G01A 3P70B 1UK2A 1W8BH 1O3CA 1M9UA 4JMYA 1IQKA 4ABGA 2UUKB 3H5CB 1QRZA 2IPQX 3M36A 2WPDD 1O3EA 2BX3A 4GHTA 2V6NA 2K1QA 4ABEA 3MO3A 1HLTH 1GBAA 1TQ0B 5L2ZH 5C5NA 1OKXA 2ZU3A 3OTPA 2L74A 1CGHA 1AVGH 1P2IA 2PHBA 1T32A 2KCOA 2V7QD 1QCPA 3V3MA 1QY6A 2JKHA 4ZKOU 5EG4A 3O8CA 5G4BA 7KMEH 3A7WA 1ZSJA 3SU3A 1C4Y2 1FPHH 3GDUA 2ZGXH 2Q1JA 3TJOA 3OY6U 4KKDA 3BTEE 4X1NU 3SZEA 2ZDMA 2GV6A 1GBJA 1P02A 1Y59T 2WSSD 3C27B 4D76A 1UVUH 3SU0A 3T28A 5J4SA 1C5TA 2B8OH 1XM1A 1XKBC 5HIZA 1ANCA 2ZNKH 2M5TA 1SLWB 1H8IH 2ZTZA 1MD8A 1OOKB 3OFND 4THNH 1RJXB 1SFIA 2QA9E 5CMXH 1UK3A 1RRKA 4U2WA 4MNVA 1GHBG 3ZZDA 5DN6D 1ZHRA 2Z3DA 3K6ZA 3PV4A 2A5IA 2FTLE 3TGIE 3PTNA 1C5MD 1TAWA 5GCHG 4ISNA 4INHA 3SGAE 3SU5A 3VGCC 1AIXH 3QTVH 1SQAA 1XUGA 2ZHDA 1OS8A 1OWKA 4B71A 1YY3A 1PQ8A 2JH6D 1A4WH 2BQ7B 3URDA 4I8HA 1W0KD 1OX1A 5GCHF 1MH0A 1IQIA 3M3VA 3Q76A 2FX4A 2C8YB 4FUJA 1O2JA 1NT1A 3LGIA 1F0UA 2ANWA 4D9QA 3A86A 4J1YA 3MH7A 2P16A 1UTQA 5TCAA 1PYTC 4ZKNU 2H6MA 4FUHA 1AUJA 2A2QH 3QZQA 2ZGCA 1TMUH 5E2OA 1L0ZA 1G3EA 1E1RD 4X8SH 3T25A 1BMLA 5CE1A 1EFRD 3ZVGA 2BZ6H 2F3CE 4WY3A 1L1JA 1S6LA 1TPAE 1VITH 1E79D 4BAQB 2EI7A 3E0NB 3KYFA 1ETRH 4K8YA 2ZFFH 3OEED 3A7VA 2TRMA 2OBQA 2BD8A 2VINA 1G2LA 1BHXB 1BCUH 5BPEA 1P8VC 3GCTG 5DK1A 3VG8A 1TGTA 2ZU4A 2WUCA 3UOPA 3FP7E 1ZRKA 1ZTKA 1V2WT 4FUBA 3IWMA 1TFXA 1C2GA 3LC5A 4JCNA
chains in the Genus database with same CATH topology
4HTCH 4MNWA 4INLA 3OSYA 3TK5A 1LMWB 1FPCH 2RDLA 2A4RA 1BMMH 4IC5A 3BG8A 5FPSA 3E6PH 1E37B 1HAGE 3ZZ8A 4UD9H 4E7NA 4AG2A 3RXCA 2A1DB 3TJNA 1UVSH 1ARBA 1P0SH 1HCGA 3GY2A 2VIQA 2WINI 1ARCA 4Q80A 3RXEA 1GDQA 1BTPA 3TH2H 1NZQH 3U98H 2O8MA 1A3EH 1SOZA 3UY9A 1XXFA 1ELGA 3SV9A 5FBIA 1Y5BT 3HATH 4JZ1A 2NU0E 3ATKA 1VITG 1C2LA 2F9NA 3QGNB 1PPZA 3SU4A 2Y7XA 1KXEA 1TONA 1GBDA 2HOBA 2R3YA 2J2UA 4IC6A 2W26A 2ZCLP 4ABFA 1BITA 1GJ5H 1LTOA 2V0BA 2WPHS 1UVPA 3KHVA 3FANA 3A80A 3RU4T 1XUJA 4A7IB 1NRSH 1U6QA 2WYJA 2C8XB 3P8GA 1AWHB 1YM0A 1GBTA 4ZHMU 1ZSKA 3MNSA 3KNXA 1C1UH 1GMDF 2A32A 1YPKH 3AVZA 1Y3UA 1H9IE 3QLPH 3F9GA 1FNIA 5EXNA 3FZZA 1BQYA 1SLXB 5DP7A 4WXVA 1GHYH 4ZROA 4O9VA 1XUFA 1S82A 2XXLA 2AGGX 1HPGA 7LPRA 3U69H 3GCOA 4BAKB 2XW9A 1O2QA 1KDQA 4H6SB 1GDNA 3EAJA 1QA7A 2FX6A 2GZ8A 5DG6A 1W11U 1RGQA 4AZ2B 2Z9KA 1BTUA 4Y8YA 1VR1H 3GY5A 1K1MA 4HZHA 3RXRA 2ZFPH 4VGCB 4D8NA 5C1UA 1DSTA 1MBQA 2FOHA 1O2OA 4AX9H 3HPTB 3A7TA 1O36A 3QN7A 3SV2H 2H2ZA 4LK4A 1DM4B 5TCCA 1D6WA 1SLUB 2DUCA 3FZDA 4ISOA 3SN8A 8ESTE 2STAE 4GPGA 2SGPE 1O5BB 1MKWK 1K28D 2XCFA 4U30A 3MU1A 3VB6A 1BMAA 3KCGH 2AMDA 1X7AC 2UWLA 3B8JA 1W12U 3PMHB 1P12E 4AB8A 2LNCA 1C1QA 1EJMA 2PSYA 4JK6A 3NZIA 2ZHWH 4YOGA 3SU6A 1QFKH 1Y5UT 1KLJH 2BVSH 1QJ6B 1ZMJA 4MNXA 1DS2E 4FUFA 1NO9H 2PWXA 2BD2A 1NU7B 4K1SA 4NFFA 3U1IB 5AVDA 3MHWU 1BRAA 1FIZA 5E8EH 1E38B 2FLBH 2FOGA 4I8GA 2A7CA 1IOEA 1V2UT 2NU3E 1O2WA 1D3QB 1F92A 1J17T 1TA2A 1MTNC 2FYQA 3QUMP 1EASA 4B2AA 5E2PA 1GBFA 3DFLA 2FWWA 1NRPH 2ZGHA 4TY7A 3GOVB 4LXBH 2W5EA 3EYDA 4BOHA 1RIWC 3VEQB 4DVAU 2A4QA 2ZU2A 3NXPA 3VB3A 2ANYA 2D8WA 1VJ9U 4AYYB 1O3GA 3OTJE 4F4OC 1C2EA 3OU0A 2XTTB 1ESAA 1GMHG 1Q3XA 1PPFE 1ANEA 2AYWA 5GDSH 2DE9A 3UPEA 3BTME 1G36A 1TNIA 1VCQA 4XBCA 1OWJA 1ZGVA 4TWWA 4TWYA 1DANH 2WUBA 1HAVB 3V12A 5K7RA 3UR9A 1G2MA 1K1NA 3DHKH 1YBWA 2AH4X 4KTSA 3KQCA 1V2LT 1B7XB 1KY9A 3P8FA 5AF9H 2BXUH 1GMCF 1HIAA 4RSPA 3MYWA 1E35B 1GGDB 3UREA 1Z6JH 3QO6A 1C5XB 1C1SA 3KF2A 2J38A 4WH6A 1UVOA 1OWIA 1C5RA 3URCA 3AW0A 5JBTA 3SQEE 2PKSB 2G5VA 2Y7ZA 5DP5A 1TOMH 1DXPA 5LPFA 1HAVA 2IJOB 3SZNA 2ZHEH 4DG4A 1K1OA 1ZYOA 3I77A 2YNAA 4YESB 1SGIB 2SGAA 3O8BA 3GY6A 1MCVA 5FX5A 1QB9A 1BDAA 2XYAA 3RMNH 3UR6A 3RXDA 1F0RA 2V3HH 3A7ZA 2I6SA 3SV7A 2ZF0H 1YGCH 3T2NA 4TY6A 4NG9H 2ZC9H 3P92A 2FI5E 4H4FA 1Y3XA 3A8CA 2G4TA 1HXFH 1O2MA 3Q3XA 1C1MA 1QIXB 2KAIA 3RMLH 3HKIB 1THSH 1UTPA 5FBEA 5C3NA 4MLFB 1JIRA 1INCA 1PYTD 1PPHE 1J15A 1HAPH 2C8WB 3RXSA 1BA8B 1W0ZU 1O31A 3ATIA 2O8LA 1DICA 4ABHA 2ZQ2A 1A1RA 1GG6B 1GI2A 2QXHA 3MFJA 3HK6B 4A5TS 3V7TA 5CHAC 1YLDA 3QWCH 1MQ5A 1O3HA 3PLPA 3MU8A 4AOQA 5A8YA 2F83A 4X2XA 3NKKA 2BHGA 4U32A 3UQOA 2QF0A 1HRTH 1S84A 2FOBA 3F6UH 1A5IA 4ZXYH 4X1RU 1BTXA 3GY7A 2ODYB 3GDVA 4Q7XA 4NIWA 1C5NH 4ABIA 1ZPCA 2UUFB 2ZDKA 1AHTH 2ZPRA 5AFZH 3SNEA 4IGDA 4A6LA 1SGNE 1HB0B 1W2KH 3SI4H 5A2MH 1BZXE 5DPAA 3TLOA 3LC3A 1AUTC 3LH1A 2XCNA 1LDTT 4RN6A 1AY6H 5FPYA 3ODFA 1ELAA 3MOCA 1KTTB 2XBXA 4Z6AH 3M3SA 4NZQA 5E0GA 4AORA 3BIVH 3E0PB 4B76A 1E36B 2FP7B 1EX3A 1PPGE 3P95A 2BDBA 2G81E 5HYOA 2ZU1A 2IPHA 1AQ7A 4A1VA 1GHBF 2OP9A 1KDQB 4OS1A 3RXHA 1P2NA 5FAHA 1YPEH 4DOQA 1ETTH 1TMBH 1W7GH 3FFGA 1ELTA 1JXPA 1H1BA 1SPJA 1LO6A 3EQ0H 3UNSA 2W7SA 1LHGH 3ZZ7A 4Q7ZA 2FI3E 1O2HA 3PMJA 2P3FH 3P17H 1C2DA 4CRFA 3HGNA 1RIWB 1TGCA 4FVBA 1TB6H 1DT2A 2PGQB 1JMOH 3DFJA 4Y6DA 2FLRH 3SI3H 5DKMA 1UJ1A 4ZH8A 1O5GH 2H1UA 3S69A 4DY7B 4UFEH 4BANB 3RXOA 1V2VT 1O3MA 2VVCA 5E0HA 1GCTB 2Z9IA 2G8TA 1YC0A 2PTNA 2G4UA 2BZAA 2GCHF 2GD4B 1FN6A 4WMDA 1GJ9B 1Y8TA 2RA3A 5TJXA 1NPMA 4UONA 1V2KT 1FY5A 2VIWA 1QRXA 1P03A 1AFQC 4INKA 1P57B 1SQTA 1HYLA 3M5MA 3ZZ5A 1SVPA 4AB9A 2EA3A 3AAUA 2Y5FA 4Y76A 1DFPA 2G51A 3SW2B 1TGSZ 2BDGA 2GZ9A 1KXDA 1C1OA 2OXSA 3ZZBA 2BOKA 1IQLA 3H7TA 3D65E 1C5YB 1BTYA 1KTSB 1LCYA 1CGJE 1H9HE 1F0SA 3KEEA 1IQFA 1GL0E 1AB9B 1NC6A 4X6OA 5FHTA 3VPKA 5JBCS 1QJ1B 1CHOG 1ZLRA 1WV7H 1IQEA 3SJOA 3GY3A 2R2WU 1WCZA 3SQHE 5DP9A 1YPHC 1O35A 1ELEE 2GV7A 1C1PA 2THFB 2BD4A 1AZ8A 1BTHH 4I32A 1QGFA 3T29A 2QXJA 4UFGH 2QF3A 2HVXA 3GCHB 1GJAB 3A87A 3RU4D 3A89A 3SUGA 2BY6X 4MPWA 1MKWH 5ESTE 2PKAA 2H9TH 4NSVA 2ZG0H 4MNYA 1L1NA 1AE5A 1VCWA 2HLCA 4IN1A 1K1JA 1MUEB 2ANKH 3KQDA 1HAOH 1AN1E 3B23B 1TBRH 3VFEA 1GBEA 4X8VH 1YPGH 4X6MA 3B9FH 5GIBA 2Z9GA 1TRMA 1Z8RA 1EB1H 1GMHF 1MQ6A 1PQ5A 5I46H 2PR3A 4X1SU 1GCTC 1FY4A 1P09A 2TGTA 1SG8B 1Z6EA 3UTUH 2A0QB 1AVWA 2BLVA 1C2JA 1FZZA 6ESTA 1DX5M 2CJIA 3EGKH 1ZHPA 2ZCHP 7ESTE 3PROA 1RD3B 3SU1A 1ACBE 1V2OT 4KGAA 1P2QA 1G3BA 3D49H 2BY9X 3EA8A 1HJAC 2NU1E 3LPRA 1VITF 2NU4E 1LHFH 1UTOA 4ABAA 5HGGA 4AN7A 4X6NA 3KGPA 3A82A 1YP9A 1VJAU 3U8OH 4GCHF 1LPGB 2VNTA 1F5RA 4YTAA 1VCPA 1DE7H 4OS5A 3R0FA 2A7HA 1MTUA 1JIMA 2G55A 3PWCA 1XVMA 2GCHG 1DDJA 2VVUA 1TNHA 2GT8A 1BRUP 1O3KA 1LVMA 5EPYA 2VB0A 1TYNA 4MVNA 4IS5A 1C5LH 2O8WA 4O97A 1OSSA 1YF4A 1ZOMA 3SHCH 4E06H 2FOFA 2ZFTA 1O3DA 1TE0A 1QQUA 1HIAB 1VZQH 1S0QA 2R0KA 5JPMH 1C1NA 1ESTA 3K6YA 4YLQH 1MKXH 4MQAA 2TPIZ 3T27A 1XXDA 1N6YA 1FY8E 2F9PA 1QL7A 1D6RA 2VWMA 2G5NA 1NTPA 3SBKA 1PJPA 5ESBA 1QA0A 3AW1A 4RKOB 2O8TA 4B75A 1AKSB 4R0IA 2XBWA 1BB0B 4X8TH 4D7FA 4YOJA 5DP6A 1FN8A 3U1JB 3SGQE 1C4U2 5EW1H 2HPPH 1DWDH 1EAIA 2HNTE 1GJ4H 1SOTA 1T4VH 3SJIA 1O2GH 1HDTH 2CV3A 3F1SB 6LPRA 2BM2A 4X2WA 2R3UA 4TYDA 4ISIH 4E05H 1FQ3A 1MTSA 1CHGA 1CT0E 1UO6A 1EPTB 1O5AB 2AFQB 4Q7YA 4X0WU 1TPOA 3VXFH 4O3UA 4WJG2 3RXPA 1O39A 1KSNA 2OBOA 3DD2H 3LGYA 1A5HA 3MWIU 3HK3B 5IYTA 5EOKA 1GBLA 4HI3A 4NFEA 1C5SA 3A88A 1WBGB 1DXWA 4YLUA 1RS0A 2VIOA 6CHAB 1V2ST 2ZO3H 1Z8JB 2GCTB 1ANBA 2A45B 5B6OA 3BEUA 3M7TA 3RXIA 3EDXB 1NRQH 4FU8A 5EXMA 3RXUA 2ZFRH 4BXSA 3BG4B 2OQ5A 4UDWH 2XWBI 1C2GA 1FONA 1XUHA 3ZYEA 1J16A 2ZGJA 3BEIB 5C2ZA 1XKAC 1OXGA 2RG3A 1G3CA 1V3XA 2GDDA 2ZWLH 1HAHH 3SJKA 2FTMA 3LKWA 1BRBE 4I8KA 1Z8GA 1GL1A 1D9IA 1L2EA 1MMJN 1SHYA 1QURH 4BTIB 3JZ1B 1FY1A 1LVBA 2YNBA 1TIOA 1BJVA 2RCEA 3HGPA 3L3TA 2VGCB 4ZUHA 4IN2A 2VWNA 2Z94A 1FDPA 8GCHF 1WQVH 1A0LA 1O2SA 3M3TA 2ALPA 8LPRA 3KQBA 4ABDA 1GBIA 2LPRA 3PB1E 1J8AA 3SJ9A 4X2VA 4AGJA 2PUXB 3V13A 1GI1A 2CF9H 1ZPBA 2ZTYA 1P2MA 4MTBA 4WF8A 3ZYDA 1O32A 1S81A 4K60A 1EATA 1C1VH 2I6QA 3GCTF 3RM2H 4DURA 4X8UH 1GCDA 3M5LA 1NRRH 1Z1IA 2GP9B 1BBRK 1GI4A 1ORFA 3GCHC 1MD7A 2KAIB 2GX4A 3EA7A 1QQ4A 4WMEA 1QTFA 1PQ7A 1OYQA 3LOXA 1C5WB 1B0EA 5JYIA 3TNSA 5C1YA 1JBUH 3UOUA 5HMAA 1QBVH 2FOEA 1HJAB 3P8NA 3CENA 1EAWA 1D3PB 4FUDA 3U8RH 1V2MT 2VVVA 2AEIH 2GVFA 3GYLB 1VGCB 3PMAB 1GMCG 4GUXA 4K1TA 4DIIH 1O2LA 3TIUA 4X2YA 2Y80A 1ZGIA 1GVZA 1MBMA 1W3CA 3MU4A 4GHQA 9ESTA 3IG6B 4CHAC 5F03A 1DLEA 2EEKA 2VIPA 4FU7A 1CT2E 3W95A 1HNEE 1P2KA 5HM9A 3EA9A 1YLCA 1ZJDA 4WMFA 4MG3A 1AO5A 2BQ6B 2PFEA 1C1WH 2NU2E 1W14U 4XOJA 1V2QT 3K65B 2AMPA 3D23A 4O03A 3SV8A 2ZFQH 2A5KA 4GLYA 4NIYA 2JETB 3BTQE 2UUYA 4M7GA 4Y0ZE 3A85A 3BTGE 1TQ7B 2FODA 5DJ7A 1N6XA 3GY8A 3VB7A 3OYPA 3SORA 2Q6GA 1N1LA 2AERH 3F68H 4GSOA 3A7XA 5A8XA 3RXKA 3FP8E 5FXLA 1SBWA 5JB9S 1D3TB 1FUJA 3R3GB 1NY22 1SGEE 1QHRB 3HKJB 5GPIB 5HXFA 1NROH 1H4WA 1O3JA 2WV4A 2GDEH 1C4V2 1RTKA 2A2XH 1G30B 1WQSA 2ZKSA 3TNTA 3SJ8A 2BB4A 4CRBA 2BY7X 4BNRA 3ATWA 1HGTH 1GHAF 2Y5GA 2A7JA 2HALA 1IQMA 5JBAS 3E90B 1P01A 2UUJB 5BRRE 1SGFA 3BTDE 4FUCA 1EXFA 1TNLA 1V2NT 2Y5HA 2P3UB 3E3TA 1GJ8B 3E16B 1NESE 2B0FA 4FUEA 5JBBS 2VIVA 2ESTE 5C5OA 4GCHG 3ATMA 2IN2A 1GHAG 3SOSA 6GCHG 3UWJH 4NWLA 2J9NA 2PKSC 1MKXK 4YT6H 1HAYB 1YPMH 3A81A 2WYGA 2QYIA 1FV9A 4AFZA 4YZUA 4CBNA 3UQVA 4CRGA 1ETSH 5EU8A 2SFAA 3MNCA 2HWLB 4Y7BA 1GI9B 1OP0A 2XBVA 3ESTA 2BDHA 1LVOA 2A4OA 1ZHMA 4JYUH 1V2PT 3UFAA 1F5KU 1JRSA 2A5AA 1C9PA 1SGCA 2GMTB 3E91A 4WWYA 5C1XA 1WTHD 2ULLA 2YOLA 5T3HA 2SNVA 1SGPE 2ZPQA 1DUEA 4UFFH 4Y79A 4OS6A 4K1EA 1GI3A 4Y8XA 1CO7E 3ELAH 2J34A 2QV1A 2GCTC 1MTNB 1TRNA 2BMGB 1O2VA 1C5UA 3GDSA 1TWXB 1IHSH 1A3BH 4CREA 2QXGA 2FS9A 1GHWH 4LOYH 1ESBA 1TLDA 3KN2A 2W3KA 2RA0A 2BYAX 1NN6A 3U9AH 1FLEE 4OS7A 4K3JA 3ZV8A 1A46H 1RFNA 1O3PB 2VH0A 1SR5C 2CMYA 1C9TA 1FMGA 3LJOA 3KIDU 1TGNA 1SGQE 3QTOH 1HAXB 1D4PB 3S7KB 4TPIZ