1GJ6A

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj6A02
3H5CB 4MPWA 4X2VA 1NM6A 2BD4A 1A0LA 2FI4E 4LZ4B 2FX6A 4VGCC 1M9UA 1T32A 4AX9H 4WJG2 4DT7B 1GI1A 4XE4A 2FOHA 4ZROA 4BTTB 5DP8A 2H9TH 1LMWB 1ZTKA 2WV5A 3LIWA 1J9CH 4NIVA 1D3DB 1GJBB 5C5NA 1GWAA 2DE9A 1E0FD 1W10U 4H6SB 2HWLB 1NZQH 4D9RA 6LPRA 5JB8S 1AI8H 2ANKH 3K9XB 3QK1A 1H9LB 4KP0A 3RXOA 1C5TA 2EI7A 3ZZCA 3GYLB 1C5SA 2BLVA 1L4ZA 2QXGA 1W0ZU 4X1NU 5C5OA 1NFWA 4LOYH 1RGQA 1UTJA 1GI8B 2PKSB 2WINI 3UTUH 1TGNA 2GCTB 2FESH 5BRRE 2XTTB 5GIBA 2VVUA 5T6GA 1K1PA 1QCPA 2QCYA 4AB8A 1F0SA 2C3SA 3JZ1B 3S7HB 2BDGA 2J38A 4Y8YA 1XUKA 1CE5A 3SZNA 4B71A 4Y7BA 4A1VA 1LHFH 1DWDH 2C8ZB 3URDA 1Z7KA 3K6YA 3NZIA 3SJ8A 2OQUA 4Q2KA 1Z8GA 4K1EA 4OS2A 3MOCA 3GCOA 4X1RU 2VGCC 1XUHA 2P93A 3AW1A 1ELFA 3VGCC 2VIPA 3BTKE 1O32A 1JIRA 1TGSZ 1HFDA 1N8OC 1NN6A 2B9LA 1CA8B 1BOQA 3PV4A 2J9NA 1W3CA 1GG6C 2R0KA 1EZSC 2F9BH 1T8LA 1QY6A 3KGPA 3LDXH 5DPAA 1E35B 2BY5X 2ZU2A 1HGTH 1HJAC 5GJ4B 3T26A 5DO4H 1S6HA 1ZSJA 5EPNA 2HRVA 1EB1H 1QA7A 5B6OA 2OINA 5AHGH 4I8HA 3IG6B 2D8WA 2SGDE 1GJ8B 5CHAB 3GY6A 3TJNA 4F49A 1AVGH 1PFXC 3O8DA 1TNIA 4AB9A 3QX5H 1G3BA 1JXPA 2XNIA 5L30H 1VGCC 1UVTH 1SHYA 1H9IE 2TBSA 3EDXB 1QQ4A 1RRKA 3KEEA 3SUDA 3KQDA 3TJUA 4SGBE 1GVLA 1GHBF 1O36A 4ZXXH 1OP8A 2XRCA 1IOEA 1O2HA 1J16A 3A7TA 3CENA 1ZMNA 2P3FH 3B23B 2VVCA 2NU4E 3QTOH 2ZC9H 5F6MA 3ZZ8A 2W26A 1XXDA 3QUMP 3TK6A 3VEQB 3VB4A 1Z1JA 4FUFA 3U9AH 4KTSA 3S69A 3BG4C 1TNHA 2BHGA 2GT7A 1E37B 1EAIA 1IQKA 1HAOH 2WPKS 1NROH 2EC9H 1O3EA 2OC1A 3TGJE 3RXCA 1TNLA 3CS7A 1AZ8A 2ZHFH 3ZZ3A 1BQYA 4CRDA 5I46H 1OWDA 1WU1A 2J92A 4ABDA 2C8YB 4NIXA 5ESBA 1UVUH 3ESTA 3ZVEA 3SGQE 2SNVA 1GJAB 5DP7A 1V2NT 4R0IA 4D7FA 4FXGH 3PWBA 2OTVA 1LTOA 4ISLA 1O3NA 2G5VA 3SV7A 1K22H 1FN8A 1SVPA 1TBZH 2BDCA 3RXFA 1ZRKA 1AGJA 2QGRA 1DE7H 2Z9JA 2ZFTA 4OS7A 1O3AA 3SNEA 2FOFA 1S0QA 2UWLA 4U2WA 1XUFA 3QGNB 5EQSA 1Q31A 5BPEA 2P3TB 4UEHH 2Q6GA 1ZSLA 4CBOA 3HGNA 2ZFPH 3ATWA 2ZDVH 4Y8ZA 3A7VA 3H7TA 1C5QA 4M7GA 4Y10E 4X2WA 4TY6A 1FZZA 1PPFE 3MNBA 2ZCKP 3UNQA 1Z8RA 1SGFG 1X7AC 1QL9A 4JZEH 5CE1A 4YOIA 3SJIA 1HXEH 3DA9B 1FY3A 3EA7A 1IQMA 1EJNA 1D4PB 4FUGA 4B75A 1V2VT 1ELEE 1HDTH 4YOJA 1SG8B 1KTSB 2BM2A 3VPKA 2PGQB 1CT0E 1XKBC 3W94A 1VCPA 3KHVA 3SUGA 1FV9A 1W14U 1C1MA 1KSNA 3SW2B 4CRAA 1N6XA 1CGIE 3OX7U 1ETSH 2PKAB 2BZAA 1MMJN 5FX6A 4KKDA 3A7WA 4FU8A 2A7HA 3E6PH 1P2IA 3QZRA 3U69H 2FEQH 2PWXA 4XDEA 1B0EA 1G9IE 2QC2A 1N6YA 1CBWC 1O5AB 5LPEA 2K1QA 4NFEA 5A8YA 3Q3KA 3T5FH 3RXIA 5T3HA 1JMOH 1BMAA 1JBUH 3NCLA 4CRFA 1Q3XA 2TGTA 2FWWA 5C2ZA 2CV3A 1CGJE 4B2CA 3LC5A 1BJUA 1QJ1B 2ZPSA 1ZGIA 3A7XA 3MNXA 4X1SU 1PPGE 2BY9X 1N8OB 3AW0A 1TX8A 4MPVA 4O9VA 3O8CA 1O5BB 1GL0E 1WSSH 1YF4A 1AVWA 1GG6B 1IQHA 1EPTA 1O3MA 1O2UA 5FAHA 2GGVB 1O2RA 1B0FA 2EI8A 5AVDA 1SGQE 1HJAB 4INLA 4K5ZA 2XXLA 3ZVDA 1O39A 1AU8A 9ESTA 1YPHC 1SFIA 2QXJA 1DXPA 1C2LA 5GWZA 2FI5E 1BTPA 3GCHC 3R0FA 2ZI2H 1GJ6A 2Z6BD 1NRQH 4UFFH 2GV6A 1LQEA 3VXFH 1MBQA 2UUFB 1C4U2 4WH8A 1QBOA 1ZHRA 3E0PB 1O2KA 4Y7AA 2D26C 4WH6A 1BTWA 2SGPE 1MD7A 2XBYA 3GDUA 3QZQA 1O3CA 3RC6A 2GZ7A 2GKVE 1BT7A 2R3UA 9LPRA 1WQVH 3M7TA 3GICB 2VJ1A 4MPXA 1Q2WA 4CR5A 1HAPH 2QIQA 2D2DA 2NU2E 2A5AA 4MLFB 1YPKH 3BG4B 1O5CB 1MZDA 1SL3A 1DWBH 1G3EA 1PPZA 1ORFA 3VFEA 3A82A 1DT2A 1KLTA 2BDAA 1HYLA 4I8LA 4Y0YE 1DWEH 1H4WA 4LXBH 1MU6B 2ZG0H 3RC4A 4A92A 1LO6A 1O3IA 1A46H 1ZPZA 1GHBG 1C2HA 1C1QA 5HMAA 2ZGHA 2W5EA 4K8BA 1GHVH 4H4FA 1ZYOA 1TBRH 1PPHE 2O9QA 2UUYA 4WMEA 3RM0H 4I32A 1O2IA 1W7GH 1HJ8A 2FOAA 4UE7H 3A7ZA 1DY9A 1KXCA 1G3DA 5H4IB 1SLVB 3SU1A 2XW9A 1DX5M 2G81E 4ISOA 1O3BA 2BQ7B 3P95A 2ZQ2A 2PKSC 3LU9B 5FBIA 1JOUB 1GJDB 1RTFB 3I77A 5ESTE 1P2NA 2A31A 3SNDA 4X2YA 5EXNA 3PLPA 4OS1A 2P94A 3SJOA 3TLOA 4OGXA 1GBLA 3NUMA 3DFLA 1CT2E 3M3TA 3RM2H 1SLUB 3VB6A 2WYJA 1QGFA 2UUKB 3LH1A 1UK2A 3A86A 1ZSKA 2ANMH 3SNAA 2Y80A 1OX1A 3BTFE 1DM4B 1G3CA 3QO6A 1EQ9A 1K9OE 2STBE 1KXEA 4RKJB 2RDLA 3KCGH 3SU2A 1YLDA 1TQ7B 3ZZ4A 3DD2H 1UCYH 4MG3A 4NWKA 2VH6A 2BXTH 2A4GA 4NIYA 3UOPA 3BEUA 3L33A 1O5EH 1UK4A 1ZRBA 4WVPE 3UOUA 1AHTH 5JYIA 1V2MT 1TYNA 1FPHH 4AN7A 1AQ7A 1ESAA 4UFEH 3ZVGA 5FBEA 2C93B 1HAYB 1C2FA 2PSXA 2GP9B 4ZUHA 3FZZA 1UVOA 1BUIA 4CRCA 4K1TA 2ZHQH 3BIVH 3KNXA 1BRUP 4UFGH 3U8RH 3GISB 3U8OH 1O5GH 1EAUA 4AFZA 5E2PA 4QT8C 4IMZA 1NS3A 1TA2A 1V2WT 2F9NA 1AFEH 2CMYA 5FPSA 1AKSA 3EA9A 4X8UH 1FY1A 1SGTA 3TH4H 2A7CA 3D23A 1C5VA 1JIMA 3NK8A 2G51A 2G4TA 4MNYA 2BY8X 2A0QB 1SLWB 1F5LA 2ZDAH 3M5LA 2HNTC 4D76A 4Y11E 2ZTYA 5EQQA 5GDSH 8ESTE 4SGAE 1OP0A 2VIQA 1B7XB 1XMNB 1L1GA 4CBNA 1TABE 3PWCA 4K2YA 4DOQA 3E91A 2Z9GA 2Y82A 1JWTA 1O35A 5AFYH 3SNCA 3SNBA 2G4UA 1LQDB 1ESBA 3GCHB 2ZZUH 1GBFA 2PR3A 4INHA 4X2XA 1P2QA 3BEIB 2H1UA 1GI4A 3TK5A 1A0HB 1YYY1 1C1UH 4K60A 3SU5A 2P16A 3E0NB 1C5YB 5EOKA 2ALPA 1QIXB 1XUGA 4WXVA 3S0NA 3V3MA 3Q3YA 1C1TA 1XKAC 4YTAA 1WUNH 2BD3A 1IQNA 3MU0A 1RIWB 3PROA 1C2EA 2SNWA 2YNBA 4HFPB 5FCKA 3F6UH 2GDDA 1MKWK 2VWMA 4RSPA 1VJ9U 1DUEA 1K28D 2HALA 5C1YA 3RXHA 4Y8XA 4JYVH 1C2IA 2JETC 1O0DH 1GI5A 1CQQA 2AERH 1SLXB 1GVZA 2ZCLP 1H8DH 3KQEA 4FUEA 1KXAA 2Y6TA 1EPTC 2F83A 4O3TA 3E90B 2RA0A 3ZVBA 3S9CA 4XBDA 1H8IH 1FY5A 3RXJA 1RFNA 7KMEH 1HBTH 3VB5A 4I8KA 4OGYA 3ZZDA 1SGPE 3TIUA 4AZ2B 1CU1A 1ANCA 4WY3A 2R0LA 2P95A 1EATA 1GHAF 2Z3DA 3LONA 1C5LH 2BVSH 2ZFQH 4CHAC 3L6PA 1ELCA 3ELAH 1O2XA 3ATLA 5K0HA 4H6TA 1ZGVA 5DP3A 4B73A 1SGRE 2TGPZ 3BSQA 2HPQH 4DW2U 1QRWA 1Z6EA 3OYPA 1B5GH 1AD8H 3LKWA 4A5TS 3STJA 1OKXA 3F68H 3OSYA 3AAUA 4X6NA 1GGDC 1UK3A 2XWAA 3ZYDA 4FVDA 1T31A 4GHTA 2BY7X 1GI2A 1GI3A 1D6RA 1TBQH 4HZHA 4R8TB 1Y59T 1V2LT 1Y5AT 1A5IA 4DJZB 1BIOA 3ATMA 1AO5A 1AVXA 5EODA 2WUBA 3MMGA 1GBKA 3A85A 4BXWA 1ID5H 1HXFH 1LHEH 2BXUH 3B8JA 3T28A 2VWOA 4GHQA 2NWNA 1PJPA 4E7RG 4AFQA 2UWOA 1GCTC 1GHWH 1KLJH 3P70B 3RXTA 2SGFE 2QAAA 2WPJS 4IGDA 1MH0A 3HK6B 5EW1H 1E34B 1ARBA 2BVRH 3A8DA 1KIGH 2Y5HA 3SGBE 3P6ZB 1P06A 2V35A 2OLGA 2ZU4A 2OP9A 1FMGA 3LGWA 1FLEE 4BAMB 5SGAE 3T29A 4THNH 1GI9B 1O3LA 3FAOA 3TU7H 4CH8B 4AORA 4X6PA 1BTXA 2ZP0H 3M3SA 1LHDH 4Y0ZE 3STIA 4WXIA 2J34A 1TALA 1TMTH 4JK5A 1QB6A 4FUHA 2QV1A 4DCDA 3NKKA 4FUDA 1LVMA 1UCYK 5FX5A 1DWCH 4O3UA 4FUJA 1GJCB 1O2GH 1PYTC 2ODYB 1O3FA 2OQ5A 2A7JA 5PTPA 1NRRH 1O37A 5LGOA 3SUFA 5I25A 1TE0A 1C4V2 1C9PA 1SOTA 2FZZA 1SBWA 1SGYE 4NWLA 2NU1E 1O2QA 1EAWA 3O8RA 1GDNA 1V2ST 1C2MA 4DGJA 1O3DA 1O2WA 4MNWA 3ATKA 2FYQA 3ITIA 1BBRH 3BN9A 5JBTA 1AIXH 3Q77A 2FX4A 3UQOA 4A1TA 1G30B 3AASA 1NY22 3CS0A 1LCYA 1SHHB 1TNJA 5EG4A 2XCNA 1OS8A 1E36B 1H9HE 1YKTA 1J15A 3L3TA 1GBEA 1ZHPA 1Y3VA 3URCA 2GV7A 1ABIH 1G2LA 5HXFA 1HJ9A 2F3CE 2PV9B 2Z7FE 1UMAH 2GMTC 2ZTZA 1Y3YA 1SQOA 1LVOA 2Q6FA 2SFAA 3K2UA 4YOGA 2CF9H 1DICA 3MHWU 1BTZA 1QTFA 2LNCA 4OS5A 4DVAU 4Q7ZA 2B7DH 2M5TA 2ESTE 2HNTF 1IAUA 1INCA 1NFYA 2AGIX 2C90B 2FM2A 2G5NA 2UUJB 3T2NA 4O03A 1P09A 2GX4A 1GCDA 3M37A 1IQFA 3A8AA 1A5GH 1GL1A 1KY9A 2ZTXA 3W95A 1FAKH 3A88A 1CA0C 4X8SH 5JDUB 1BJVA 3A83A 2JETB 3BTME 3EYDA 3LGVA 1HAXB 1LPGB 1WV7H 4XFQA 2VIDA 3CP7A 1T4VH 1QRZA 1GJ5H 1EPTB 4ABAA 1QA0A 1L1NA 4NA8A 5GCHF 2Z9IA 4HI3A 2H9EH 2BOHB 1MTUA 1S5SA 2FO9A 2PFEA 3SU6A 1OOKB 1FI8A 2ZNKH 1TFXA 3M5OA 3SV2H 1T8NA 4I8JA 3EE0B 4IMQA 4MTBA 3MI4A 1VJAU 4FUIA 1V2KT 4CH2B 1TWXB 1Z8JB 5L2ZH 5EXMA 1GBBA 1IQEA 2XWBI 2BDHA 4AG2A 1GBJA 4UDWH 1XX9A 2NU0E 4K8YA 3BV9B 4B76A 1HLTH 1DFPA 1S85A 3LGYA 2ULLA 1DITH 2OBQA 3M61U 3MU4A 4BANB 4CHAB 5J4QA 2W3KA 1GBAA 3GCNA 1L2EA 4I31A 4BTUB 1Y8TA 2FDAA 2PTCE 3G01A 2J94A 3KIDU 2R2WU 2CXVA 3ENSB 3RXDA 3ATIA 1K1MA 1W0YH 4NA9H 1GBHA 2FYRA 3PLBA 3PB1E 1O34A 1GGDB 1KDQA 1ZMLA 4AYYB 3SI4H 1QB1A 5EQRA 1L0ZA 5G4BA 2FS9A 3BEFB 3IITA 4KGAA 1ANBA 1BRBE 2HPPH 3DFJA 2FP7B 1MTSA 1K21H 3FFGA 1WTHD 5L6NH 5HGGA 4WWYA 1V6DA 3SN8A 1GHAG 1J17T 1V2PT 1G36A 2ZHDA 4INKA 5E0JA 3RXVA 2ZU3A 4JZIA 1BTUA 2PLXA 1AE5A 1GBDA 2THFB 3A8BA 2W3IA 4Y76A 1GCTB 1DXWA 3KN2A 3GY5A 4YLQH 2F9VA 2AYWA 3EGKH 1P03A 2AFQB 5C67A 2YNAA 1TRYA 3GY3A 1OWKA 3S7KB 2CGAA 3FP7E 3PO1C 4GUXA 4IN2A 3TK9A 2HGTH 3RU4E 3TNSA 1DY8A 3A80A 1P10A 3IWMA 2VH0A 1YLCA 1NU9A 2H5CA 2KAIA 1QFKH 2V6NA 2QXIA 1RTKA 3MO6A 1Z71A 5F8XA 7LPRA 5EXLA 3TVJB 6GCHF 1ELDE 1A0JA 1KXFA 4NFFA 3BIUH 4KTCA 2ZQ1A 1MKWH 4BAQB 1D3PB 1F0RA 2XBXA 2HLCA 2VNTA 1O3HA 1IQLA 2STAE 1TGCA 2QXHA 2ZGCA 2J95A 1D3TB 1MTWA 1Y5BT 5DP9A 3F9HA 4J2YB 4CREA 1ABJH 2XBWA 1F5RA 1C2JA 3BTWE 1TRNA 3ZZ7A 4I33A 1RIWC 1ZPBA 1P0SH 3ODDA 2XCFA 2ZFFH 3U8TH 3V7TA 1OPHB 1F0TA 1F5KU 2AEIH 1PQAA 3BTQE 4ZKNU 2ZPQA 3A8CA 5DP5A 3SJKA 3TNTA 2BD5A 3SI3H 1W12U 2FOEA 2Q6DA 4JCNA 1O30A 1P2JA 3C1KA 1HIAA 5C3NA 1FONA 4B1TA 4H42U 5DGJA 1ARCA 4X6MA 1THPB 1AZZA 1EXFA 5A0CA 2VWNA 2EI6A 2FOGA 3FZDA 3P8NA 1VCWA 1PQ8A 5EGMA 1SSXA 2FOBA 1A3BH 2ILNA 2GMTB 5C1UA 1BBRK 1UCYE 1YCPK 3MU8A 2FOMB 1XUJA 1GBIA 1K1IA 1O2PA 3ZZ9A 1XM1A 3KQBA 2NU3E 3UWJH 2ANYA 1BMNH 4UD9H 4UFDH 5AFZH 3RMMH 1GBCA 2Y5GA 1UTPA 1SQTA 4GVUA 3OTJE 1W8BH 2O8WA 1QRXA 4J1YA 1AWHB 4XBCA 2IJOB 5TJXA 2ZKSA 1CA0B 2BDYA 2Z94A 3LGUA 1AKSB 3M7QA 2A32A 3I78A 1ZZZA 1ANDA 2PUXB 1MU8B 1CGHA 3EQ0H 2BLWA 1FXYA 3Q76A 4GPGA 4NGAH 1NFUA 1S83A 2FS8A 4CR9A 1OWHA 1GJ4H 1C5MD 1O5FH 1SFQB 1GHZA 2H9HA 3M5MA 5E2OA 1W13U 4ABHA 2B0FA 2ZHWH 3GY4A 2YOLA 4JZ1A 4BTIB 2BOKA 1V2QT 1FIWA 1BMMH 3ZZAA 2R9PA 3U1JB 2P8OC 3TH2H 1FIZA 2EEKA 1EZUC 4ZHLU 2R2MB 1OYQA 1F7ZA 1W2KH 1GBTA 3R3GB 1OP2A 2TGDA 1T8OA 5HYOA 3MU5A 1UTKA 2A1DB 1AY6H 2QN5T 3KL6A 2GTBA 4IC6A 4B2BA 1CVWH 2AH4X 2G8TA 4NZQA 1C1SA 1RXPA 2PW8H 1BMLA 1TX6A 3MH7A 3TJVA 3SUEA 3ZZ5A 1K1JA 2ZF0H 4U32A 1ELAA 1Z6JH 1AE8H 1MZAA 1EZQA 1Y3XA 2VIWA 5GCHG 4ZMAH 1QNJA 4ASHA 1XVMA 2A2XH 3GDVA 3SV8A 1ZLRA 1WBGB 4NCYA 3SQEE 2ZA5A 3RXAA 2GVFA 3ZV9A 3F9FA 4TY7A 1OWEA 3HK3B 1YC0A 1HRTH 3M3VA 3UWIA 1AWFH 3VB7A 4CRGA 1ANEA 4Q7YA 2AMQA 2JH5D 2TGAA 1YPHE 5JB9S 3SU4A 4BOHA 1S6FA 3BG8A 1UHBA 1IQGA 3RXSA 4MNVA 3RXQA 2ZEBA 2QF0A 3UNSA 1C1OA 1MTNC 3PO1B 1YPJH 3V0XA 1BRAA 1PPBH 1EP6A 5A0BA 1ELGA 5T6FA 1TPPA 1HPGA 2FTMA 3WY8A 3HKIB 1SGEE 1XXFA 1C1NA 2BX4A 4D8NA 1JRTA 1TB6H 4ESTE 3BTEE 5GPIB 2A45B 4YO9A 4AYVB 2DE8A 1DPOA 3RXMA 3QGJA 1C5PA 4YESB 5E0GA 2R3YA 3PMHB 1IHSH 1HAVA 4TWYA 1O38A 2G52A 1C2DA 1MQ6A 2ZU1A 4E06H 5J4SA 2SGEE 1Y5UT 1EOLA 1O3JA 1K1NA 4GLYA 1C5NH 1RJXB 1SGNE 2VB0A 3HATH 4E05H 1GJ9B 1TMBH 3VB3A 2FMJA 3UR9A 1FN6A 1UTNA 3DHKH 3A89A 3EAJA 1HAGE 2ZFSA 2PUQH 4BAKB 1ELVA 1DLKB 2IN2A 4FUBA 3QWCH 2BLOA 1QBVH 3OY6U 2G00A 1GMHF 1K2I1 2OCVB 4AFUA 1NESE 1TOCB 3N7OA 4DIHH 3MFJA 2TIOA 1QHRB 4K1SA 1GVKB 1DS2E 1BTYA 5TCCA 4ISIH 1O2MA 1FUJA 1C1VH 1EASA 1G37A 2VWLA 3TPIZ 7GCHF 1NC6A 3SQHE 1FJSA 1VR1H 5FPTA 2BYAX 3KQCA 1IQIA 1TLDA 1KYNA 1CO7E 2H5DA 1EX3A 1DUAA 3GDSA 2AIQA 2J2UA 2ODPA 3LGTA 4WMFA 5IYTA 2WV4A 1GHXH 3H7OA 1P3EA 1YGCH 2GD4B 4ISHH 1BCUH 1QJ6B 4B2AA 5JBCS 1SGIB 1MCTA 3B9FH 3MH5A 1DVAH 1XUIA 1C5ZB 5DP6A 1WTGH 1P11E 3RXLA 2O8UA 1U6QA 1W11U 3UY9A 1YBWA 2B8OH 7ESTE 5TCAA 3MO9A 3M7UA 1SGFA 3RXGA 2PHBA 1GPZA 2FODA 4JZDH 1BBRE 3KF2A 4DY7B 1O2ZA 1ZOMA 1DSUA 2SGQE 3FP8E 3SGAE 4ZHMU 4U30A 1AB9C 2P8OB 1ZR0A 2WPMS 3MYWA 3ZYEA 1EKBB 4B74A 1SOZA 1FDPA 3F9EA 1TQ0B 3MNSA 2QYIA 2P59A 1C5RA 5A2MH 1ZTJA 1T8MA 4X8TH 1OYTH 3MO3A 1PQ5A 1PYTD 2FXRA 1QBNA 4TPYA 4TYDA 3FVFB 4BAHB 4Y79A 3RU4D 6ESTA 1EJMA 2OC7A 2RCEA 4ZXYH 1C5WB 5FCRA 3S9AA 4D9QA 2ZGJA 1GI0A 1AN1E 1NRSH 4HTCH 3T62A 3BTGE 2VVVA 1OXGA 1HV7A 4JYUH 2XC5A 5DKMA 3RXPA 4Y71A 1FNIA 2CHAC 2F9OA 3AAVA 3RLYH 3P92A 1S82A 4ABIA 2ANWA 2HNTE 2VU8E 2FLRH 4BNRA 2A5KA 5ETXA 2ZCHP 1BHXB 2WPIS 5F8TA 1LDTT 4MQAA 1A7SA 3OY5U 1TNKA 1C5XB 1UJ1A 2FIRH 3RP2A 1V2TT 4GCHF 2ZU5A 3T25A 3DUXH 4FU9A 1FQ3A 3GYMA 3PTNA 1YCPH 4IN1A 4CRBA 4A1XA 3PM3A 2ZDNA 1MTNB 2V0BA 3BTHE 3JZ2B 1N1LA 2BX3A 4IBLH 4AGKA 3UFAA 1YM0A 2GT8A 5EPYA 5LPRA 1LPZB 1FY4A 1PPCE 1SQAA 1YPLH 1L4DA 2AGGX 1RD3B 2B5TB 2BTCE 1K1OA 1C5UA 2IPHA 3M35A 3HKJB 1SB1H 3QTVH 1BHXF 4X1PU 1FPCH 4YM9A 2OUAA 2ZO3H 4I8GA 1THSH 4U01A 3UNRA 1RTLA 1C2KA 3RXEA 1T4UH 1LHGH 5FPYA 1QJ7B 2BY6X 1KDQB 2ZPRA 1MKXH 4Y6DA 1NRPH 5T6DA 1AFQC 3P8OA 5JBBS 1SI5H 1GDUA 1C1PA 3Q00A 3M36A 1HCGA 3GY7A 4GSOA 4K3JA 1O3OA 1O3KA 1RS0A 1UVSH 1KXBA 2I6QA 2OD3B 1P2OA 3V13A 4IS5A 1CSOE 1IHTH 2IOTA 1BTHH 4MDSA 2AIPA 4Z6AH 1V2OT 1O2JA 1TPAE 2Z9KA 4ISNA 1V3XA 3SU0A 4ABEA 1NO9H 4FU7A 3UREA 1QL8A 3ODFA 1EAXA 3RUOA 5A8ZA 2FLBH 1QURH 1P02A 1MD8A 3UPEA 2ZDMA 4OS6A 4OS4A 4NSVA 3PMBB 1ESTA 1Z1IA 4RKOB 5ABWA 1OWIA 3RDZA 1VITF 4AGJA 2KAIB 3QLPH 2GDEH 4Q7XA 1J14A 1TRMA 1ZPCA 4KELA 5GXPA 3A84A 4D7GA 1BITA 3MWIU 1EJAA 2VIVA 3GCTF 4A6LA 1GMDF 1Y3UA 2C4FH 1P8VC 4VGCB 4YZUA 1VITH 4JZFH 4DIIH 3E8LA 2JH0D 4JK6A 4RN6A 1HAIH 1FY8E 2D1JA 1SC8U 1JRSA 1GMCF 3SHCH 2A4RA 4JMYA 4LK4A 1GHYH 3RC5A 2AMPA 2VIOA 2GCHF 1E38B 5F8ZA 2XC0A 1GMHG 2BQWB 3MTYA 3NWUA 5EW2H 3U1IB 1S81A 3MU1A 2GZ8A 1WOFA 1O2VA 1NFXA 4TWWA 3SJ9A 2QY0B 1MAXA 1O2YA 4HGCA 3ZZBA 2ALVA 7GCHG 2PSYA 1NTPA 3K65B 1AUTC 1HIAB 1MAYA 5E0HA 2W7UA 1MBMA 1CHOF 1AB9B 3A81A 1DDJA 1WQSA 1P2MA 2XC4A 4NZLA 1YP9A 2SGAA 4ZKOU 3MH4A 1GJ7B 3BTDE 1ZTLA 2RG3A 4ABBA 1BRCE 1O2TA 1MUEB 2BD2A 5DJ7A 4AOQA 1PPEE 1MCVA 4Z0KA 1QR3E 8LPRA 1LPKB 1BB0B 1A1RA 4XSKU 3RXRA 4ZHAA 1IQJA 3GOVB 1S0RA 1F92A 3E3TA 2VGCB 1HNEE 1OWJA 1ELTA 3VGCB 1GI7B 4UONA 5DG6A 2OC8A 1LHCH 3RXBA 1SR5C 1OSSA 3ZVFA 2FTLE 3UQVA 2CHAB 1O2OA 2G55A 6CHAC 2ODQA 3PTBA 8GCHF 1TX7A 1QQUA 2EA3A 2HOBA 2O8LA 4LZ1H 1A2CH 1TPSA 3P8FA 1DLEA 1YPGH 4TPIZ 5C1XA 1GI6A 2F91A 1EP5A 1XVOA 5FXLA 2CJIA 1C1WH 4BXSA 4YT7H 4ZAEA 1C4Y2 1C9TA 4Q80A 1ACBE 1O2NA 1DSTA 4BAOB 1P9UA 3SO3A 4X8VH 1ETRH 3LOXA 4NSYA 1G2MA 1UTQA 1VGCB 4XBBA 1GBMA 1F0UA 1QB9A 2OC0A 1L1JA 3P17H 1CHGA 4PROA 2Z3EA 3U98H 4E7NA 3OU0A 3TGIE 3LJJA 2QF3A 3QDZB 2OBOA 3P8GA 2WYGA 2PKAA 3D49H 1WCZA 4DG4A 5DK1A 2H2ZA 3TH3H 3TITA 1K1LA 1D6WA 3K6ZA 2ZGBH 4NIWA 5A8XA 3PMAB 1YPEH 1H1BA 1NPMA 1VZQH 1P2KA 1ZMJA 1TNGA 2BZ6H 2GZ9A 1WYKA 1TOMH 1D3QB 1UTMA 3VXEH 3D65E 1EB2A 2BDIA 3SBKA 2RA3A 4GCHG 2FI3E 2OXSA 3V12A 1YCPM 5K7RA 2V3OH 1NU7B 1HAHH 1ZJDA 3LH3A 1HUTH 1AFQB 3MH6A 3TJOA 4KTUA 1BDAA 2AGEX 1V2JT 3ZV8A 2Y81A 5C20A 4MNXA 3A7YA 1MQ5A 2C8XB 3Q3XA 1SGCA 1Y3WA 2WPHS 2TRMA 1KXDA 1BA8B 1HB0B 1T7CA 1D9IA 1SPJA 3TGKE 4DURA 3SV6A 1MKXK 5DP4A 2PGBB 1UHBB 2LPRA 3RMNH 1GDQA 3FP6E 2Y7ZA 5FHTA 3LJOA 5L2YH 1O3PB 4WMDA 2JKHA 1AUJA 2ZDLA 5CMXH 1A3EH 2HVXA 1ELBA 3HPTB 2Z9LA 1VCQA 1MTVA 4X0WU 4A7IB 1G32B 1PQ7A 1O2SA 2XYAA 4NG9H 1O31A 3UR6A 4WF8A 8KME2 4ABJA 5F03A 2ZIQH 1V2UT 3F9GA 3UUZA 2A4QA 2GCTC 2CF8H 1TGTA 2I6SA 5HM9A 3GY2A 1ZJKA 3S9BA 1P12E 3ZVCA 2XBVA 3PYHA 1HAVB 1O2LA 1P05A 5A09A 1SGDE 4FUCA 1TONA 5JBAS 1C5OH 2AMDA 3HGPA 1UTOA 2ZECA 2ZDKA 3ZVAA 4X6OA 3RMOH 1TMUH 2C8WB 3M5NA 1LKAA 3FANA 1UVPA 2J4IA 2ZFRH 2O8MA 3D62A 1J8AA 1VITG 1DOJA 2BVXH 3UIRA 4FVBA 5LPFA 1AMHA 2WPLS 4AFSA 2ZWLH 2Y7XA 2VINA 1C2GA 4ZKRU 2Z3CA 1A4WH 2ZHEH 3GCTG 1GMDG 2BB4A 3GY8A 3SHAH 2UWPA 3RLWH 2A2QH 1YPMH 5EU8A 3AVZA 1GMCG 1WAYB 3SU3A 2A4OA 4I7YH 4IW4E 3BTTE 1ZHMA 2JH6D 2GCHG 1THRH 4ABFA 3O8BA 1TA6A 2DUCA 5CHAC 3RU4T 1KTTB 3LPRA 3T27A 1CBWB 1O33A 5E8EH 3SOSA 1P01A 1EOJA 1O3GA 4MPUA 3RMLH 4XOJA 5A0AE 1A5HA 2Q1JA 2FOCA 4O97A 1ETTH 2W7SA 1SMFE 5LH8A 3EA8A 4IC5A 4NA7A 1NT1A 4GAWA 4ZKSU 4K69A 4F4OC 1CHOG 1CT4E 2BLQA 3E16B 2BQ6B 2BMGB 4ABGA 3RXUA 4X1QU 3RXKA 1UTLM 2V3HH 6CHAB 2QA9E 3E1XB 2BD8A 3ZZ6A 2CN0H 1Z8IB 2F9PA 4YT6H 2P3UB 1TIOA 1LVBA 3PMJA 1O5DH 1HAZB 3A87A 1TGBA 2F9UA 1DANH 1S84A 1TPOA 2ZGXH 3DT0H 1F2SE 3BF6H 1NRNH 2BD7A 1EUFA 1W7XH 1P3CA 1P9SA 1UO6A 1V2RT 2BDBA 4JYTA 1LKBA 1KLIH 3LGIA 1LVYA 3NPSA 4YLUA 2AS9A 1P04A 5HM2A 3NXPA 6GCHG 8GCHG 3SV9A 3QN7A 3F1SB 3LT3A 1P57B 3SORA 4MVNA 3I29A 5IDKA 2ASUB 1C1RA 4AG1A 1BZXE 4ZH8A 5JPMH 2Y5FA 2A5IA 3MNCA 2PTNA 1QL7A 3C27B 2FPZA 2O8TA 2TPIZ 1A61H 3LC3A 2WUCA 1FAXA 1TAWA 3PLKA 1EZXC 2BD9A 5AF9H 2H6MA
chains in the Genus database with same CATH superfamily
3H5CB 4MPWA 4X2VA 3GS9A 1NM6A 2BD4A 1A0LA 2FI4E 4LZ4B 2FX6A 3SZEA 4VGCC 1M9UA 1T32A 4AX9H 4WJG2 4DT7B 1GI1A 4XE4A 2FOHA 4ZROA 4BTTB 5DP8A 2H9TH 1LMWB 1ZTKA 2WV5A 3LIWA 1J9CH 4NIVA 1D3DB 1GJBB 5C5NA 1GWAA 2DE9A 1E0FD 1W10U 4H6SB 2HWLB 1NZQH 4D9RA 6LPRA 5JB8S 1AI8H 2ANKH 3K9XB 3QK1A 1H9LB 3PRDA 4KP0A 3RXOA 1C5TA 2EI7A 3ZZCA 3GYLB 1C5SA 2BLVA 1L4ZA 2QXGA 1W0ZU 4X1NU 5C5OA 1NFWA 2VBCA 4LOYH 1RGQA 1UTJA 1GI8B 2PKSB 2WINI 3UTUH 1TGNA 2GCTB 2FESH 5BRRE 2XTTB 5GIBA 2VVUA 5T6GA 1K1PA 1QCPA 2QCYA 4AB8A 1F0SA 2C3SA 3JZ1B 3S7HB 2KM0A 2BDGA 2J38A 4Y8YA 1XUKA 1CE5A 3SZNA 4B71A 4Y7BA 4A1VA 1LHFH 1DWDH 2C8ZB 3URDA 1Z7KA 3K6YA 3NZIA 3SJ8A 2OQUA 4Q2KA 1Z8GA 4K1EA 4OS2A 3MOCA 3GCOA 4X1RU 2VGCC 1XUHA 2P93A 2WPDD 3AW1A 1ELFA 4ACAA 3VGCC 2VIPA 3BTKE 1O32A 1JIRA 1TGSZ 1HFDA 1N8OC 1NN6A 2B9LA 1CA8B 1BOQA 3PV4A 2J9NA 1W3CA 1GG6C 2R0KA 1EZSC 2F9BH 1T8LA 1QY6A 3KGPA 3LDXH 5DPAA 1E35B 2BY5X 2ZU2A 1HGTH 1HJAC 5GJ4B 3OFND 3T26A 5DO4H 1S6HA 1ZSJA 5EPNA 2HRVA 1EB1H 1QA7A 5B6OA 2OINA 5AHGH 4I8HA 3IG6B 2D8WA 2SGDE 1GJ8B 5CHAB 3GY6A 3TJNA 4F49A 1AVGH 1PFXC 3O8DA 1TNIA 4AB9A 3QX5H 1G3BA 2L6OA 1JXPA 2XNIA 5L30H 2KZ4A 1VGCC 1UVTH 2XOKD 1SHYA 1H9IE 2TBSA 3EDXB 1QQ4A 1RRKA 3KEEA 3SUDA 3KQDA 3TJUA 4SGBE 1GVLA 1GHBF 1O36A 4ZXXH 1OP8A 2XRCA 3OEED 1IOEA 1O2HA 1J16A 3A7TA 3CENA 1ZMNA 2P3FH 3B23B 2VVCA 2NU4E 3QTOH 2ZC9H 5F6MA 3ZZ8A 2W26A 1XXDA 3QUMP 3TK6A 3VEQB 3VB4A 1Z1JA 4FUFA 3U9AH 4KTSA 3S69A 3BG4C 1TNHA 2BHGA 2GT7A 1E37B 1EAIA 1IQKA 2GJGA 2WPKS 1HAOH 3KYFA 1NROH 2EC9H 1O3EA 2OC1A 3TGJE 3RXCA 1TNLA 3CS7A 1AZ8A 2ZHFH 3ZZ3A 1BQYA 4CRDA 5I46H 1OWDA 1WU1A 2J92A 4ABDA 2C8YB 4NIXA 5ESBA 1UVUH 3ESTA 3ZVEA 3SGQE 2SNVA 1GJAB 5DP7A 1V2NT 4R0IA 4D7FA 4FXGH 3PWBA 2OTVA 1LTOA 2K0QA 4ISLA 1O3NA 1YY3A 2EQNA 2G5VA 3SV7A 1K22H 1FN8A 1SVPA 1TBZH 2BDCA 3RXFA 1ZRKA 1AGJA 2QGRA 1DE7H 2Z9JA 2ZFTA 4OS7A 1O3AA 3SNEA 2FOFA 1S0QA 2UWLA 4U2WA 1XUFA 3QGNB 5EQSA 1Q31A 5BPEA 2P3TB 4UEHH 2Q6GA 1ZSLA 4CBOA 3HGNA 2ZFPH 3ATWA 2ZDVH 4Y8ZA 3A7VA 3H7TA 1C5QA 4M7GA 4Y10E 2YMSC 4X2WA 4TY6A 1FZZA 1PPFE 3MNBA 2ZCKP 4P00A 3UNQA 1Z8RA 1SGFG 1X7AC 1QL9A 4JZEH 5CE1A 4YOIA 3SJIA 1HXEH 3DA9B 1FY3A 2KR7A 3EA7A 1IQMA 1EJNA 1D4PB 4FUGA 4B75A 1V2VT 1ELEE 1HDTH 4YOJA 1SG8B 1KTSB 2BM2A 3VPKA 2PGQB 1CT0E 1XKBC 3W94A 1VCPA 3KHVA 3SUGA 1FV9A 1W14U 1C1MA 1KSNA 2RFKC 3SW2B 4CRAA 1N6XA 1CGIE 3OX7U 1ETSH 2PKAB 2BZAA 1MMJN 5FX6A 4KKDA 1S6LA 3A7WA 4FU8A 2A7HA 3E6PH 1P2IA 3QZRA 3U69H 2FEQH 2PWXA 4XDEA 1B0EA 1G9IE 2QC2A 5HIZA 1N6YA 1CBWC 1O5AB 5LPEA 2K1QA 4NFEA 5A8YA 3Q3KA 3T5FH 3RXIA 5C0UA 5T3HA 1JMOH 1BMAA 1JBUH 2J98A 3NCLA 4CRFA 1Q3XA 2TGTA 2FWWA 5C2ZA 2CV3A 1CGJE 4B2CA 3LC5A 1BJUA 1QJ1B 2ZPSA 1ZGIA 3A7XA 1K0HA 1SKYE 3MNXA 4X1SU 1PPGE 2BY9X 1N8OB 3AW0A 1TX8A 4MPVA 3PV5A 4O9VA 3O8CA 1O5BB 1GL0E 1WSSH 1YF4A 1AVWA 1GG6B 1IQHA 1EPTA 1O3MA 1O2UA 5FAHA 2GGVB 1O2RA 1B0FA 2EI8A 1YWUA 5AVDA 1SGQE 1HJAB 4INLA 4K5ZA 2XXLA 2WSSD 3ZVDA 1O39A 1AU8A 9ESTA 1YPHC 1SFIA 2QXJA 1DXPA 5KEDA 1C2LA 5GWZA 2FI5E 1BTPA 3GCHC 3R0FA 4RT0A 2ZI2H 1GJ6A 5C94A 2Z6BD 5F53A 1NRQH 4UFFH 2GV6A 1LQEA 3VXFH 1MBQA 2UUFB 1C4U2 4WH8A 1QBOA 1ZHRA 3E0PB 1O2KA 4Y7AA 2D26C 4WH6A 1BTWA 2SGPE 1MD7A 4HG6A 2XBYA 3GDUA 3QZQA 1O3CA 3RC6A 2GZ7A 4YXWD 3H09A 2GKVE 1BT7A 2R3UA 9LPRA 1WQVH 3M7TA 3GICB 2VJ1A 4MPXA 1Q2WA 3EE7A 4CR5A 1HAPH 2QIQA 2D2DA 2NU2E 1NBME 2A5AA 4MLFB 1YPKH 3BG4B 1O5CB 1MZDA 1SL3A 1DWBH 1G3EA 1PPZA 1ORFA 3VFEA 3A82A 1DT2A 1KLTA 2BDAA 1HYLA 4I8LA 4Y0YE 2EY4C 1DWEH 1H4WA 4LXBH 1MU6B 2ZG0H 3RC4A 4A92A 1LO6A 1O3IA 1A46H 1ZPZA 1GHBG 1C2HA 1C1QA 5HMAA 2QF5A 2ZGHA 3DCLA 2W5EA 4K8BA 1GHVH 4H4FA 1ZYOA 1TBRH 1PPHE 2O9QA 2UUYA 4WMEA 3RM0H 2JJ2D 4I32A 1O2IA 1W7GH 1HJ8A 2FOAA 4UE7H 3A7ZA 1DY9A 1KXCA 1G3DA 5H4IB 1SLVB 3SU1A 2XW9A 1DX5M 2G81E 4ISOA 1O3BA 2BQ7B 3P95A 2ZQ2A 2PKSC 3LU9B 5FBIA 1E1QD 1JOUB 1GJDB 1RTFB 3I77A 5ESTE 1P2NA 2A31A 3SNDA 4X2YA 5EXNA 3PLPA 4OS1A 2P94A 3SJOA 3TLOA 4OGXA 1GBLA 3NUMA 3DFLA 1CT2E 3M3TA 1WDIA 3RM2H 1SLUB 3VB6A 2WYJA 1QGFA 2UUKB 3LH1A 1UK2A 3A86A 1ZSKA 2ANMH 3SNAA 2Y80A 1OX1A 3BTFE 1DM4B 1G3CA 3QO6A 1EQ9A 1K9OE 2STBE 1KXEA 4RKJB 2RDLA 3KCGH 3SU2A 1YLDA 1TQ7B 3ZZ4A 3DD2H 1QZ8A 1UCYH 4MG3A 4NWKA 2VH6A 2BXTH 2A4GA 4NIYA 3UOPA 3BEUA 3L33A 1O5EH 1UK4A 1ZRBA 4WVPE 3UOUA 1AHTH 5JYIA 1V2MT 2M2AA 3KYGA 5T1VA 1E79D 1TYNA 1FX0B 1FPHH 4AN7A 1AQ7A 1ESAA 4UFEH 3ZVGA 5FBEA 2C93B 1HAYB 1C2FA 2PSXA 2GP9B 4ZUHA 3FZZA 1UVOA 1BUIA 4CRCA 4K1TA 2ZHQH 3BIVH 3KNXA 5EJ1A 1BRUP 4UFGH 3U8RH 3GISB 3U8OH 1O5GH 1EAUA 4AFZA 5E2PA 4QT8C 4IMZA 1NS3A 1TA2A 3FOAA 1V2WT 2F9NA 3UB0A 1AFEH 2CMYA 5FPSA 1AKSA 3EA9A 4X8UH 1FY1A 3DSPA 1SGTA 5KECA 3TH4H 2A7CA 3D23A 1C5VA 1JIMA 3NK8A 2G51A 2G4TA 4MNYA 2BY8X 2A0QB 1SLWB 4Z1MD 1F5LA 2ZDAH 3M5LA 2HNTC 4D76A 1KMHB 2ZTYA 4Y11E 5EQQA 5GDSH 4SGAE 8ESTE 1OP0A 2VIQA 1B7XB 1XMNB 1L1GA 4CBNA 1TABE 3PWCA 4K2YA 4DOQA 3E91A 2Z9GA 2Y82A 1JWTA 1O35A 5AFYH 3SNCA 3SNBA 2G4UA 1LQDB 1ESBA 3GCHB 2ZZUH 1GBFA 2PR3A 4INHA 4X2XA 1P2QA 3BEIB 2H1UA 1GI4A 3TK5A 1A0HB 1YYY1 1C1UH 4K60A 3SU5A 2P16A 3E0NB 1C5YB 5EOKA 2ALPA 1QIXB 1XUGA 4WXVA 3S0NA 3V3MA 3Q3YA 1C1TA 1XKAC 1OHHD 4YTAA 3OTPA 1WUNH 2BD3A 1IQNA 3MU0A 1RIWB 3PROA 1C2EA 2SNWA 2YNBA 4HFPB 5FCKA 3F6UH 2GDDA 1MKWK 2VWMA 4Q4LA 4RSPA 1VJ9U 1DUEA 1K28D 2HALA 5C1YA 3RXHA 4Y8XA 4JYVH 1C2IA 2JETC 1O0DH 1GI5A 1CQQA 2AERH 1SLXB 1GVZA 2ZCLP 2LP6A 1H8DH 3KQEA 4FUEA 1KXAA 2Y6TA 1EPTC 2F83A 3SYJA 4O3TA 3E90B 2RA0A 3ZVBA 3S9CA 4XBDA 1H8IH 1FY5A 3RXJA 1RFNA 7KMEH 1HBTH 3VB5A 4I8KA 4OGYA 3ZZDA 1SGPE 3TIUA 4AZ2B 1CU1A 1ANCA 4WY3A 2R0LA 2P95A 1EATA 1GHAF 2Z3DA 3LONA 1C5LH 2BVSH 2ZFQH 4CHAC 3L6PA 1ELCA 3ELAH 1O2XA 3ATLA 5K0HA 4H6TA 1ZGVA 5DP3A 4B73A 1SGRE 2TGPZ 3BSQA 2HPQH 4DW2U 1QRWA 1Z6EA 2JIZD 3OYPA 1B5GH 5CHBA 1AD8H 3LKWA 4A5TS 3STJA 1OKXA 3F68H 3OSYA 3AAUA 4X6NA 1GGDC 1UK3A 2XWAA 3ZYDA 4FVDA 1T31A 4GHTA 2BY7X 1GI2A 1GI3A 1D6RA 1TBQH 4HZHA 4R8TB 1Y59T 1V2LT 1Y5AT 1A5IA 4DJZB 1BIOA 3ATMA 1AO5A 1AVXA 5EODA 4I86A 2WUBA 3MMGA 1GBKA 3A85A 4BXWA 1ID5H 1HXFH 1LHEH 2BXUH 3B8JA 3T28A 2VWOA 4GHQA 2NWNA 1PJPA 4E7RG 4AFQA 2UWOA 1GCTC 1GHWH 1KLJH 3P70B 3RXTA 2SGFE 2QAAA 2WPJS 4IGDA 1MH0A 3HK6B 5EW1H 1E34B 1ARBA 2BVRH 3A8DA 1KIGH 2Y5HA 3SGBE 3P6ZB 1P06A 2V35A 2OLGA 3F3BA 2ZU4A 2OP9A 1FMGA 3LGWA 1FLEE 4BAMB 5SGAE 3T29A 4THNH 1GI9B 1O3LA 3FAOA 3TU7H 4CH8B 4AORA 4X6PA 1BTXA 2ZP0H 3M3SA 1LHDH 4Y0ZE 3STIA 4WXIA 2J34A 1TALA 1TMTH 4JK5A 1QB6A 4FUHA 2QV1A 4DCDA 3NKKA 4FUDA 1LVMA 1UCYK 5FX5A 1DWCH 4DT4A 4O3UA 4FUJA 5IK2D 1GJCB 1O2GH 1PYTC 2ODYB 1O3FA 2OQ5A 2A7JA 5PTPA 1NRRH 1O37A 5LGOA 3SUFA 5I25A 1TE0A 1C4V2 1C9PA 1SOTA 3F2HA 2FZZA 1SBWA 1SGYE 4NWLA 2NU1E 1O2QA 1EAWA 3O8RA 1GDNA 1V2ST 1C2MA 4DGJA 1O3DA 1O2WA 4MNWA 3ATKA 2FYQA 1NBMD 3ITIA 1BBRH 3BN9A 5JBTA 1AIXH 3Q77A 2FX4A 3UQOA 4A1TA 1G30B 1VKYA 1NY22 3AASA 3CS0A 1LCYA 1SHHB 1TNJA 5EG4A 2XCNA 1OS8A 1E36B 1H9HE 1YKTA 1J15A 3L3TA 1GBEA 1ZHPA 1Y3VA 3URCA 2GV7A 1ABIH 1G2LA 5HXFA 1HJ9A 2F3CE 2PV9B 2Z7FE 1UMAH 2GMTC 2ZTZA 4TSFD 3F0OA 1Y3YA 1SQOA 1LVOA 2Q6FA 2SFAA 2IPQX 3K2UA 4YOGA 4ACBA 2CF9H 1DICA 3MHWU 1BTZA 1QTFA 2LNCA 4OS5A 4DVAU 2YMSD 4Q7ZA 2B7DH 2M5TA 2ESTE 2HNTF 1IAUA 1INCA 1NFYA 2AGIX 2C90B 2FM2A 2G5NA 1UW7A 2UUJB 4O03A 3T2NA 1P09A 2K8IA 2GX4A 1GCDA 3M37A 1IQFA 3A8AA 2J98B 1A5GH 1GL1A 1KY9A 2ZTXA 3W95A 1FAKH 2WV9A 3A88A 1CA0C 4X8SH 5JDUB 1BJVA 3WWBA 3A83A 2JETB 3BTME 3EYDA 3LGVA 1HAXB 1LPGB 1WV7H 4XFQA 2VIDA 3CP7A 1T4VH 1QRZA 1GJ5H 1EPTB 4RT1A 4ABAA 1QA0A 1L1NA 4NA8A 5GCHF 2Z9IA 4HI3A 2H9EH 2BOHB 3WW7A 1MTUA 1S5SA 2FO9A 2PFEA 3SU6A 1OOKB 1FI8A 2ZNKH 1TFXA 3M5OA 3SV2H 1T8NA 4I8JA 3EE0B 4IMQA 4MTBA 3MI4A 3OE7D 1VJAU 4FUIA 1V2KT 4CH2B 1TWXB 1Z8JB 5L2ZH 5EXMA 1GBBA 1IQEA 2XWBI 2BDHA 4AG2A 1GBJA 4UDWH 1XX9A 2NU0E 4K8YA 3BV9B 4B76A 1HLTH 1DFPA 1S85A 3LGYA 2ULLA 1DITH 2OBQA 3M61U 3MU4A 4BANB 4CHAB 5J4QA 2W3KA 1GBAA 3GCNA 1L2EA 4I31A 4BTUB 1Y8TA 2FDAA 2PTCE 3G01A 2J94A 3KIDU 2R2WU 5C0TA 2CXVA 3ENSB 3RXDA 4Q63A 3ATIA 1K1MA 1W0YH 4NA9H 4B6FA 1GBHA 2FYRA 3PLBA 3PB1E 1O34A 1GGDB 3U28C 1KDQA 1ZMLA 4AYYB 3SI4H 1QB1A 5EQRA 1L0ZA 5G4BA 2FS9A 3BEFB 3IITA 4KGAA 1ANBA 1BRBE 2HPPH 3DFJA 2FP7B 1MTSA 1K21H 3FFGA 1WTHD 5L6NH 5HGGA 4WWYA 1V6DA 3SN8A 1GHAG 1J17T 1V2PT 1G36A 2ZHDA 4INKA 5E0JA 3RXVA 2ZU3A 4JZIA 1BTUA 2PLXA 1AE5A 1GBDA 2THFB 3A8BA 2W3IA 4Y76A 1GCTB 1DXWA 3KN2A 3GY5A 4YLQH 2F9VA 2AYWA 3EGKH 1P03A 2AFQB 5C67A 2YNAA 1TRYA 3GY3A 1OWKA 3N7EA 3S7KB 2CGAA 3FP7E 3PO1C 4GUXA 4IN2A 3TK9A 2HGTH 3RU4E 3TNSA 1DY8A 3A80A 1P10A 3IWMA 2VH0A 1YLCA 1NU9A 2H5CA 2KAIA 1QFKH 2V6NA 2QXIA 1RTKA 3MO6A 1Z71A 5F8XA 7LPRA 5EXLA 3TVJB 6GCHF 1ELDE 1A0JA 1KXFA 4NFFA 3BIUH 1MABB 4KTCA 2ZQ1A 1MKWH 4BAQB 1D3PB 1F0RA 2XBXA 2HLCA 2VNTA 4B6EA 1O3HA 1IQLA 2STAE 1TGCA 2QXHA 2ZGCA 2J95A 1D3TB 1MTWA 1Y5BT 5DP9A 3F9HA 4J2YB 4CREA 1ABJH 2XBWA 1F5RA 1C2JA 3BTWE 2W6ID 1TRNA 3ZZ7A 4I33A 1RIWC 1ZPBA 1P0SH 3ODDA 2XCFA 2ZFFH 3U8TH 3V7TA 1OPHB 1F0TA 1F5KU 2AEIH 1PQAA 3BTQE 4ZKNU 2ZPQA 3A8CA 5DP5A 3SJKA 3TNTA 2BD5A 3SI3H 1W12U 2FOEA 2Q6DA 4ASUD 4JCNA 1O30A 1P2JA 3C1KA 1HIAA 5C3NA 1FONA 4B1TA 4H42U 5DGJA 1ARCA 4X6MA 1THPB 1AZZA 1EXFA 5A0CA 2VWNA 2EI6A 2FOGA 3FZDA 3P8NA 1VCWA 1PQ8A 2JDID 5EGMA 1SSXA 2FOBA 1A3BH 2ILNA 2GMTB 5C1UA 1BBRK 1UCYE 1YCPK 3MU8A 1W0JD 2FOMB 1XUJA 4OM9A 1GBIA 1K1IA 1O2PA 3ZZ9A 1XM1A 3KQBA 2NU3E 2WZQA 3UWJH 4TT3D 2ANYA 1BMNH 4UD9H 4UFDH 5AFZH 3RMMH 2KCYA 1GBCA 2Y5GA 1UTPA 1SQTA 4GVUA 3OTJE 1W8BH 2O8WA 1QRXA 2WHXA 4J1YA 1AWHB 4XBCA 2IJOB 5TJXA 2ZKSA 1CA0B 2BDYA 2Z94A 3LGUA 1AKSB 3M7QA 2A32A 3I78A 1ZZZA 1ANDA 2PUXB 1MU8B 1CGHA 3EQ0H 5C17A 2BLWA 1FXYA 3Q76A 4GPGA 4NGAH 4F55A 1NFUA 1S83A 2FS8A 4FETA 4CR9A 1OWHA 1GJ4H 1C5MD 1O5FH 1SFQB 2LELA 1GHZA 2H9HA 3M5MA 5E2OA 1W13U 4ABHA 2B0FA 2ZHWH 3GY4A 2YOLA 4JZ1A 4BTIB 2BOKA 1V2QT 1FIWA 1BMMH 3ZZAA 2R9PA 3U1JB 2P8OC 3OAAD 3TH2H 1FIZA 2EEKA 1EZUC 4ZHLU 2R2MB 1OYQA 1F7ZA 1W2KH 1GBTA 3R3GB 1OP2A 2TGDA 1T8OA 5HYOA 3MU5A 1UTKA 2A1DB 1AY6H 2QN5T 3KL6A 2GTBA 4IC6A 1BMFD 4B2BA 1CVWH 1H8HD 2AH4X 2G8TA 4NZQA 5EJZA 1C1SA 1RXPA 2PW8H 1BMLA 1TX6A 3MH7A 3TJVA 3SUEA 3ZZ5A 5KGOA 1K1JA 2ZF0H 4XRNA 5CDFE 4U32A 1ELAA 1Z6JH 4XD7D 1AE8H 1MZAA 1EZQA 1Y3XA 2VIWA 5GCHG 4ZMAH 1QNJA 4ASHA 1XVMA 2A2XH 3GDVA 3SV8A 1ZLRA 1WBGB 4NCYA 3SQEE 2ZA5A 3RXAA 2V3MA 2GVFA 3ZV9A 3F9FA 4TY7A 1OWEA 3HK3B 1YC0A 1HRTH 3M3VA 3UWIA 1AWFH 3VB7A 4CRGA 3KQ5A 1ANEA 4Q7YA 2AMQA 2JH5D 2QF4A 2TGAA 1WXRA 1YPHE 5JB9S 3SU4A 2V7QD 4BOHA 1S6FA 3BG8A 1UHBA 1IQGA 3RXSA 4MNVA 3FO8D 3RXQA 5HKKD 2ZEBA 1COWD 2QF0A 3UNSA 1C1OA 1MTNC 3PO1B 1YPJH 3V0XA 1BRAA 1PPBH 1EP6A 5A0BA 1ELGA 5T6FA 1TPPA 1HPGA 2FTMA 3WY8A 3HKIB 1SGEE 1XXFA 1C1NA 2BX4A 4D8NA 1JRTA 1TB6H 3FN8A 4ESTE 3BTEE 5GPIB 2A45B 4YO9A 4AYVB 2DE8A 1DPOA 3RXMA 3QGJA 1C5PA 4YESB 5E0GA 2R3YA 3PMHB 1IHSH 1HAVA 3N99A 1O38A 2G52A 1C2DA 4TWYA 1MQ6A 2ZU1A 2KCPA 4E06H 3OEHD 5J4SA 2SGEE 1Y5UT 1EOLA 1O3JA 1K1NA 4GLYA 1C5NH 1RJXB 1SGNE 2VB0A 3HATH 4E05H 1GJ9B 1TMBH 3VB3A 3PV2A 2FMJA 3UR9A 1FN6A 1UTNA 3DHKH 3A89A 2J97A 3EAJA 1HAGE 2ZFSA 2PUQH 4BAKB 1ELVA 1DLKB 2IN2A 4FUBA 3QWCH 2BLOA 3F0PA 1QBVH 3OY6U 3W1EA 2G00A 1GMHF 1K2I1 2OCVB 4AFUA 1NESE 1TOCB 3N7OA 4DIHH 3MFJA 2TIOA 1QHRB 4K1SA 1GVKB 1DS2E 1BTYA 5TCCA 4ISIH 1O2MA 1FUJA 1C1VH 1EASA 1G37A 2VWLA 3TPIZ 7GCHF 1NC6A 3SQHE 1FJSA 1VR1H 5FPTA 2BYAX 3KQCA 1IQIA 1TLDA 1KYNA 1CO7E 2H5DA 1EX3A 1DUAA 3GDSA 2AIQA 2J2UA 2ODPA 3LGTA 4WMFA 5IYTA 2WV4A 1GHXH 3H7OA 1P3EA 1YGCH 3WWFA 2GD4B 4ISHH 1BCUH 1QJ6B 4B2AA 5JBCS 1SGIB 1MCTA 3B9FH 3MH5A 1DVAH 1XUIA 1C5ZB 3NRLA 5DP6A 1WTGH 3F2GA 1P11E 3RXLA 2O8UA 1U6QA 1W11U 3UY9A 1YBWA 2B8OH 7ESTE 5TCAA 3MO9A 3M7UA 1SGFA 3RXGA 2PHBA 1GPZA 2FODA 4JZDH 1BBRE 3KF2A 4DY7B 1O2ZA 1ZOMA 1DSUA 2SGQE 3FP8E 3SGAE 4ZHMU 4U30A 1AB9C 2P8OB 1ZR0A 4P02A 2WPMS 3MYWA 3ZYEA 1EKBB 4B74A 1SOZA 1FDPA 3F9EA 1TQ0B 3MNSA 2QYIA 2P59A 1C5RA 5A2MH 1ZTJA 1T8MA 4X8TH 1OYTH 3MO3A 2HVYB 1PQ5A 1PYTD 2FXRA 1QBNA 4TPYA 4TYDA 3FVFB 4BAHB 4Y79A 3RU4D 6ESTA 1EJMA 5DN6D 2OC7A 2RCEA 4ZXYH 1C5WB 5FCRA 1E1RD 3S9AA 4D9QA 2ZGJA 1GI0A 4RI0A 1AN1E 1NRSH 4HTCH 3T62A 3BTGE 2VVVA 1OXGA 1HV7A 4JYUH 2XC5A 5DKMA 3RXPA 4Y71A 1FNIA 2CHAC 2F9OA 3AAVA 3RLYH 5EIYA 3P92A 1S82A 4ABIA 2ANWA 2HNTE 2VU8E 2FLRH 5FL7D 4F48B 4BNRA 2A5KA 5ETXA 2ZCHP 1BHXB 2WPIS 5F8TA 1LDTT 4MQAA 1A7SA 3OY5U 1TNKA 1C5XB 1UJ1A 2FIRH 3RP2A 1V2TT 4GCHF 2ZU5A 3T25A 3DUXH 4FU9A 1FQ3A 3GYMA 3PTNA 1YCPH 4IN1A 4CRBA 3VG8A 4A1XA 3PM3A 2ZDNA 1MTNB 2V0BA 3BTHE 3JZ2B 1N1LA 2BX3A 4IBLH 4AGKA 3UFAA 1YM0A 2GT8A 5EPYA 5LPRA 1LPZB 1FY4A 1PPCE 1SQAA 1YPLH 1L4DA 2AGGX 1RD3B 2B5TB 2BTCE 1K1OA 1C5UA 2IPHA 3M35A 3HKJB 1SB1H 1W0KD 3QTVH 1BHXF 4X1PU 1FPCH 4YM9A 2OUAA 2ZO3H 4I8GA 1THSH 4U01A 3UNRA 1RTLA 1C2KA 3RXEA 1T4UH 1LHGH 5FPYA 1QJ7B 2BY6X 1KDQB 2ZPRA 1MKXH 4Y6DA 1NRPH 2QE7D 5T6DA 1AFQC 3P8OA 5JBBS 1SI5H 1GDUA 1C1PA 3Q00A 3M36A 1HCGA 3GY7A 4GSOA 4K3JA 1O3OA 1O3KA 1RS0A 1YLNA 1UVSH 3FKSD 1KXBA 2I6QA 2L74A 1P2OA 2OD3B 4IS5A 3V13A 1CSOE 1IHTH 2F43B 2RDEA 2IOTA 1BTHH 4MDSA 2AIPA 4Z6AH 1V2OT 1O2JA 1TPAE 2Z9KA 4ISNA 1V3XA 3SU0A 4ABEA 1NO9H 4FU7A 3UREA 1QL8A 3ODFA 1EAXA 3RUOA 5A8ZA 2FLBH 1QURH 1P02A 1MD8A 3PRBA 3UPEA 2ZDMA 4OS6A 4OS4A 4NSVA 3PMBB 1ESTA 1Z1IA 4RKOB 5ABWA 1OWIA 3RDZA 1VITF 4AGJA 2KAIB 3QLPH 2GDEH 4Q7XA 1J14A 1TRMA 1ZPCA 4KELA 5GXPA 3A84A 2KX4A 4D7GA 1BITA 3MWIU 1EJAA 2VIVA 3GCTF 4A6LA 1GMDF 1Y3UA 2C4FH 1P8VC 4VGCB 4YZUA 1VITH 4JZFH 4DIIH 3E8LA 2JH0D 4JK6A 4RN6A 1HAIH 1FY8E 2D1JA 1SC8U 1JRSA 1GMCF 3SHCH 2A4RA 4JMYA 4LK4A 1GHYH 3RC5A 2AMPA 2VIOA 2GCHF 1E38B 5F8ZA 2CK3D 2XC0A 1GMHG 5GNDA 2BQWB 3MTYA 3NWUA 5EW2H 3U1IB 1S81A 3MU1A 2GZ8A 1WOFA 1O2VA 1NFXA 4TWWA 3SJ9A 2QY0B 1MAXA 3DSOA 1O2YA 4HGCA 3ZZBA 2ALVA 7GCHG 3UAIC 2PSYA 1NTPA 3K65B 1AUTC 1HIAB 1MAYA 5E0HA 2W7UA 1MBMA 1CHOF 1AB9B 3A81A 1DDJA 1WQSA 1P2MA 2XC4A 4NZLA 1YP9A 2SGAA 4ZKOU 3MH4A 1GJ7B 2PP6A 3BTDE 1ZTLA 2RG3A 4ABBA 1BRCE 1O2TA 1MUEB 2BD2A 5DJ7A 4AOQA 1PPEE 1MCVA 4AC9A 4Z0KA 1QR3E 8LPRA 1LPKB 1BB0B 1A1RA 4XSKU 3RXRA 4ZHAA 1IQJA 3GOVB 1S0RA 1F92A 3E3TA 2VGCB 1HNEE 1OWJA 1ELTA 3VGCB 1GI7B 4UONA 5DG6A 2OC8A 1LHCH 3RXBA 1SR5C 1OSSA 3ZVFA 2FTLE 3UQVA 2CHAB 1O2OA 2G55A 6CHAC 2ODQA 3PTBA 8GCHF 1TX7A 1QQUA 2EA3A 2HOBA 2O8LA 4LZ1H 1A2CH 1TPSA 3ZIAD 3P8FA 1DLEA 1YPGH 4TPIZ 5C1XA 1GI6A 2F91A 1EP5A 1XVOA 5FXLA 2CJIA 1C1WH 4BXSA 4YT7H 4ZAEA 1C4Y2 1C9TA 4Q80A 1ACBE 1O2NA 1DSTA 4BAOB 1P9UA 3SO3A 1EFRD 4X8VH 1ETRH 3LOXA 1SQRA 2XNDD 4NSYA 1G2MA 1UTQA 1VGCB 4XBBA 1GBMA 1F0UA 1QB9A 2OC0A 1L1JA 3P17H 1CHGA 4PROA 2Z3EA 3U98H 4E7NA 3OU0A 3AK5A 3TGIE 3LJJA 2QF3A 3QDZB 2OBOA 3P8GA 2WYGA 2PKAA 3D49H 1WCZA 4DG4A 5DK1A 5B6LA 2H2ZA 3TH3H 3TITA 1K1LA 1D6WA 3K6ZA 2ZGBH 4NIWA 5A8XA 3PMAB 1YPEH 1H1BA 1NPMA 1VZQH 2W6JD 1P2KA 1ZMJA 1TNGA 2BZ6H 2GZ9A 1WYKA 1TOMH 1D3QB 1UTMA 3VXEH 3D65E 1EB2A 2BDIA 3SBKA 2RA3A 4GCHG 2OK5A 3F2FA 2FI3E 2OXSA 3V12A 1YCPM 5K7RA 2V3OH 1NU7B 1HAHH 1ZJDA 3LH3A 1HUTH 1AFQB 2KFWA 3MH6A 4KTUA 3TJOA 1BDAA 2AGEX 1V2JT 3ZV8A 2Y81A 5EJLA 5C20A 4MNXA 3A7YA 1MQ5A 2C8XB 3Q3XA 1SGCA 1Y3WA 2WPHS 2TRMA 1KXDA 1BA8B 1HB0B 1T7CA 1D9IA 1SPJA 3TGKE 4DURA 3SV6A 1MKXK 5DP4A 2PGBB 1UHBB 2LPRA 3RMNH 1GDQA 3FP6E 2Y7ZA 5FHTA 2KCAA 3LJOA 5L2YH 1O3PB 4WMDA 2JKHA 1AUJA 2ZDLA 5CMXH 1A3EH 2HVXA 3CNRA 1ELBA 3HPTB 2Z9LA 1VCQA 1MTVA 2JJ1D 4X0WU 4A7IB 1G32B 1PQ7A 1O2SA 2XYAA 4NG9H 1O31A 3UR6A 4WF8A 8KME2 4ABJA 5F03A 2ZIQH 1V2UT 3F9GA 3UUZA 2A4QA 2GCTC 2CF8H 1TGTA 2I6SA 5HM9A 3GY2A 1ZJKA 3S9BA 1P12E 3ZVCA 2XBVA 3PYHA 1HAVB 1O2LA 1P05A 2YMSB 5A09A 1SGDE 4FUCA 1TONA 5JBAS 1C5OH 4FOUC 1H8ED 2AMDA 3HGPA 1UTOA 2KCOA 2ZECA 2ZDKA 3ZVAA 4X6OA 3RMOH 1TMUH 2C8WB 3M5NA 1LKAA 3FANA 1UVPA 2J4IA 2ZFRH 2O8MA 3D62A 1J8AA 1VITG 1DOJA 4M9FA 2BVXH 3UIRA 4FVBA 5LPFA 1AMHA 2WPLS 4AFSA 2ZWLH 2Y7XA 2VINA 1C2GA 4ZKRU 2Z3CA 1A4WH 2ZHEH 3GCTG 1GMDG 2BB4A 3GY8A 3SHAH 2UWPA 3RLWH 2A2QH 1YPMH 5EU8A 3AVZA 3N7DA 1GMCG 1WAYB 3SU3A 2A4OA 4I7YH 4IW4E 4ZCNA 3BTTE 1ZHMA 2J5UA 2JH6D 2GCHG 1THRH 4ABFA 3O8BA 1TA6A 2DUCA 5CHAC 3RU4T 1KTTB 3LPRA 3T27A 1CBWB 1O33A 5E8EH 2IJD1 3SOSA 1P01A 1EOJA 1O3GA 4MPUA 3RMLH 4XOJA 5A0AE 1A5HA 2Q1JA 2FOCA 4O97A 1ETTH 2W7SA 1SMFE 5LH8A 3EA8A 4IC5A 4NA7A 1NT1A 4GAWA 4ZKSU 2F4LA 4K69A 4F4OC 5DSFA 1CHOG 1CT4E 2BLQA 3E16B 2BQ6B 2BMGB 4ABGA 3RXUA 4X1QU 3RXKA 1UTLM 2V3HH 6CHAB 2QA9E 3E1XB 2BD8A 3ZZ6A 2CN0H 1Z8IB 2F9PA 4YT6H 2P3UB 1TIOA 1LVBA 3PMJA 1O5DH 1HAZB 3A87A 1TGBA 2F9UA 1DANH 1S84A 1TPOA 2AHME 2ZGXH 3DT0H 1F2SE 3BF6H 1NRNH 2BD7A 1EUFA 1W7XH 1P3CA 1P9SA 1UO6A 1V2RT 2BDBA 4JYTA 1LKBA 1KLIH 2HLDD 3LGIA 1LVYA 3NPSA 4YLUA 2AS9A 1P04A 5HM2A 3NXPA 6GCHG 8GCHG 3SV9A 3QN7A 3F1SB 3LT3A 5HIYA 1P57B 3SORA 4MVNA 3I29A 5IDKA 2ASUB 1C1RA 4AG1A 1BZXE 4ZH8A 5JPMH 2Y5FA 2A5IA 3DSGA 2PTNA 3MNCA 1QL7A 3C27B 2FPZA 2O8TA 2TPIZ 1A61H 3LC3A 2WUCA 1FAXA 1TAWA 3PLKA 3MQKC 1EZXC 2BD9A 5AF9H 2H6MA
chains in the Genus database with same CATH topology
3H5CB 4MPWA 4X2VA 1NM6A 2BD4A 1A0LA 2FI4E 4LZ4B 2FX6A 4VGCC 1M9UA 1T32A 4AX9H 4WJG2 4DT7B 1GI1A 4XE4A 2FOHA 4ZROA 4BTTB 5DP8A 2H9TH 1LMWB 1ZTKA 2WV5A 3LIWA 1J9CH 4NIVA 1D3DB 1GJBB 5C5NA 1GWAA 2DE9A 1E0FD 1W10U 4H6SB 2HWLB 1NZQH 4D9RA 6LPRA 5JB8S 1AI8H 2ANKH 3K9XB 3QK1A 1H9LB 4KP0A 3RXOA 1C5TA 2EI7A 3ZZCA 3GYLB 1C5SA 2BLVA 1L4ZA 2QXGA 1W0ZU 4X1NU 5C5OA 1NFWA 4LOYH 1RGQA 1UTJA 1GI8B 2PKSB 2WINI 3UTUH 1TGNA 2GCTB 2FESH 5BRRE 2XTTB 5GIBA 2VVUA 5T6GA 1K1PA 1QCPA 2QCYA 4AB8A 1F0SA 2C3SA 3JZ1B 3S7HB 2BDGA 2J38A 4Y8YA 1XUKA 1CE5A 3SZNA 4B71A 4Y7BA 4A1VA 1LHFH 1DWDH 2C8ZB 3URDA 1Z7KA 3K6YA 3NZIA 3SJ8A 2OQUA 4Q2KA 1Z8GA 4K1EA 4OS2A 3MOCA 3GCOA 4X1RU 2VGCC 1XUHA 2P93A 3AW1A 1ELFA 3VGCC 2VIPA 3BTKE 1O32A 1JIRA 1TGSZ 1HFDA 1N8OC 1NN6A 2B9LA 1CA8B 1BOQA 3PV4A 2J9NA 1W3CA 1GG6C 2R0KA 1EZSC 2F9BH 1T8LA 1QY6A 3KGPA 3LDXH 5DPAA 1E35B 2BY5X 2ZU2A 1HGTH 1HJAC 5GJ4B 3T26A 5DO4H 1S6HA 1ZSJA 5EPNA 2HRVA 1EB1H 1QA7A 5B6OA 2OINA 5AHGH 4I8HA 3IG6B 2D8WA 2SGDE 1GJ8B 5CHAB 3GY6A 3TJNA 4F49A 1AVGH 1PFXC 3O8DA 1TNIA 4AB9A 3QX5H 1G3BA 1JXPA 2XNIA 5L30H 1VGCC 1UVTH 1SHYA 1H9IE 2TBSA 3EDXB 1QQ4A 1RRKA 3KEEA 3SUDA 3KQDA 3TJUA 4SGBE 1GVLA 1GHBF 1O36A 4ZXXH 1OP8A 2XRCA 1IOEA 1O2HA 1J16A 3A7TA 3CENA 1ZMNA 2P3FH 3B23B 2VVCA 2NU4E 3QTOH 2ZC9H 5F6MA 3ZZ8A 2W26A 1XXDA 3QUMP 3TK6A 3VEQB 3VB4A 1Z1JA 4FUFA 3U9AH 4KTSA 3S69A 3BG4C 1TNHA 2BHGA 2GT7A 1E37B 1EAIA 1IQKA 1HAOH 2WPKS 1NROH 2EC9H 1O3EA 2OC1A 3TGJE 3RXCA 1TNLA 3CS7A 1AZ8A 2ZHFH 3ZZ3A 1BQYA 4CRDA 5I46H 1OWDA 1WU1A 2J92A 4ABDA 2C8YB 4NIXA 5ESBA 1UVUH 3ESTA 3ZVEA 3SGQE 2SNVA 1GJAB 5DP7A 1V2NT 4R0IA 4D7FA 4FXGH 3PWBA 2OTVA 1LTOA 4ISLA 1O3NA 2G5VA 3SV7A 1K22H 1FN8A 1SVPA 1TBZH 2BDCA 3RXFA 1ZRKA 1AGJA 2QGRA 1DE7H 2Z9JA 2ZFTA 4OS7A 1O3AA 3SNEA 2FOFA 1S0QA 2UWLA 4U2WA 1XUFA 3QGNB 5EQSA 1Q31A 5BPEA 2P3TB 4UEHH 2Q6GA 1ZSLA 4CBOA 3HGNA 2ZFPH 3ATWA 2ZDVH 4Y8ZA 3A7VA 3H7TA 1C5QA 4M7GA 4Y10E 4X2WA 4TY6A 1FZZA 1PPFE 3MNBA 2ZCKP 3UNQA 1Z8RA 1SGFG 1X7AC 1QL9A 4JZEH 5CE1A 4YOIA 3SJIA 1HXEH 3DA9B 1FY3A 3EA7A 1IQMA 1EJNA 1D4PB 4FUGA 4B75A 1V2VT 1ELEE 1HDTH 4YOJA 1SG8B 1KTSB 2BM2A 3VPKA 2PGQB 1CT0E 1XKBC 3W94A 1VCPA 3KHVA 3SUGA 1FV9A 1W14U 1C1MA 1KSNA 3SW2B 4CRAA 1N6XA 1CGIE 3OX7U 1ETSH 2PKAB 2BZAA 1MMJN 5FX6A 4KKDA 3A7WA 4FU8A 2A7HA 3E6PH 1P2IA 3QZRA 3U69H 2FEQH 2PWXA 4XDEA 1B0EA 1G9IE 2QC2A 1N6YA 1CBWC 1O5AB 5LPEA 2K1QA 4NFEA 5A8YA 3Q3KA 3T5FH 3RXIA 5T3HA 1JMOH 1BMAA 1JBUH 3NCLA 4CRFA 1Q3XA 2TGTA 2FWWA 5C2ZA 2CV3A 1CGJE 4B2CA 3LC5A 1BJUA 1QJ1B 2ZPSA 1ZGIA 3A7XA 3MNXA 4X1SU 1PPGE 2BY9X 1N8OB 3AW0A 1TX8A 4MPVA 4O9VA 3O8CA 1O5BB 1GL0E 1WSSH 1YF4A 1AVWA 1GG6B 1IQHA 1EPTA 1O3MA 1O2UA 5FAHA 2GGVB 1O2RA 1B0FA 2EI8A 5AVDA 1SGQE 1HJAB 4INLA 4K5ZA 2XXLA 3ZVDA 1O39A 1AU8A 9ESTA 1YPHC 1SFIA 2QXJA 1DXPA 1C2LA 5GWZA 2FI5E 1BTPA 3GCHC 3R0FA 2ZI2H 1GJ6A 2Z6BD 1NRQH 4UFFH 2GV6A 1LQEA 3VXFH 1MBQA 2UUFB 1C4U2 4WH8A 1QBOA 1ZHRA 3E0PB 1O2KA 4Y7AA 2D26C 4WH6A 1BTWA 2SGPE 1MD7A 2XBYA 3GDUA 3QZQA 1O3CA 3RC6A 2GZ7A 2GKVE 1BT7A 2R3UA 9LPRA 1WQVH 3M7TA 3GICB 2VJ1A 4MPXA 1Q2WA 4CR5A 1HAPH 2QIQA 2D2DA 2NU2E 2A5AA 4MLFB 1YPKH 3BG4B 1O5CB 1MZDA 1SL3A 1DWBH 1G3EA 1PPZA 1ORFA 3VFEA 3A82A 1DT2A 1KLTA 2BDAA 1HYLA 4I8LA 4Y0YE 1DWEH 1H4WA 4LXBH 1MU6B 2ZG0H 3RC4A 4A92A 1LO6A 1O3IA 1A46H 1ZPZA 1GHBG 1C2HA 1C1QA 5HMAA 2ZGHA 2W5EA 4K8BA 1GHVH 4H4FA 1ZYOA 1TBRH 1PPHE 2O9QA 2UUYA 4WMEA 3RM0H 4I32A 1O2IA 1W7GH 1HJ8A 2FOAA 4UE7H 3A7ZA 1DY9A 1KXCA 1G3DA 5H4IB 1SLVB 3SU1A 2XW9A 1DX5M 2G81E 4ISOA 1O3BA 2BQ7B 3P95A 2ZQ2A 2PKSC 3LU9B 5FBIA 1JOUB 1GJDB 1RTFB 3I77A 5ESTE 1P2NA 2A31A 3SNDA 4X2YA 5EXNA 3PLPA 4OS1A 2P94A 3SJOA 3TLOA 4OGXA 1GBLA 3NUMA 3DFLA 1CT2E 3M3TA 3RM2H 1SLUB 3VB6A 2WYJA 1QGFA 2UUKB 3LH1A 1UK2A 3A86A 1ZSKA 2ANMH 3SNAA 2Y80A 1OX1A 3BTFE 1DM4B 1G3CA 3QO6A 1EQ9A 1K9OE 2STBE 1KXEA 4RKJB 2RDLA 3KCGH 3SU2A 1YLDA 1TQ7B 3ZZ4A 3DD2H 1UCYH 4MG3A 4NWKA 2VH6A 2BXTH 2A4GA 4NIYA 3UOPA 3BEUA 3L33A 1O5EH 1UK4A 1ZRBA 4WVPE 3UOUA 1AHTH 5JYIA 1V2MT 1TYNA 1FPHH 4AN7A 1AQ7A 1ESAA 4UFEH 3ZVGA 5FBEA 2C93B 1HAYB 1C2FA 2PSXA 2GP9B 4ZUHA 3FZZA 1UVOA 1BUIA 4CRCA 4K1TA 2ZHQH 3BIVH 3KNXA 1BRUP 4UFGH 3U8RH 3GISB 3U8OH 1O5GH 1EAUA 4AFZA 5E2PA 4QT8C 4IMZA 1NS3A 1TA2A 1V2WT 2F9NA 1AFEH 2CMYA 5FPSA 1AKSA 3EA9A 4X8UH 1FY1A 1SGTA 3TH4H 2A7CA 3D23A 1C5VA 1JIMA 3NK8A 2G51A 2G4TA 4MNYA 2BY8X 2A0QB 1SLWB 1F5LA 2ZDAH 3M5LA 2HNTC 4D76A 4Y11E 2ZTYA 5EQQA 5GDSH 8ESTE 4SGAE 1OP0A 2VIQA 1B7XB 1XMNB 1L1GA 4CBNA 1TABE 3PWCA 4K2YA 4DOQA 3E91A 2Z9GA 2Y82A 1JWTA 1O35A 5AFYH 3SNCA 3SNBA 2G4UA 1LQDB 1ESBA 3GCHB 2ZZUH 1GBFA 2PR3A 4INHA 4X2XA 1P2QA 3BEIB 2H1UA 1GI4A 3TK5A 1A0HB 1YYY1 1C1UH 4K60A 3SU5A 2P16A 3E0NB 1C5YB 5EOKA 2ALPA 1QIXB 1XUGA 4WXVA 3S0NA 3V3MA 3Q3YA 1C1TA 1XKAC 4YTAA 1WUNH 2BD3A 1IQNA 3MU0A 1RIWB 3PROA 1C2EA 2SNWA 2YNBA 4HFPB 5FCKA 3F6UH 2GDDA 1MKWK 2VWMA 4RSPA 1VJ9U 1DUEA 1K28D 2HALA 5C1YA 3RXHA 4Y8XA 4JYVH 1C2IA 2JETC 1O0DH 1GI5A 1CQQA 2AERH 1SLXB 1GVZA 2ZCLP 1H8DH 3KQEA 4FUEA 1KXAA 2Y6TA 1EPTC 2F83A 4O3TA 3E90B 2RA0A 3ZVBA 3S9CA 4XBDA 1H8IH 1FY5A 3RXJA 1RFNA 7KMEH 1HBTH 3VB5A 4I8KA 4OGYA 3ZZDA 1SGPE 3TIUA 4AZ2B 1CU1A 1ANCA 4WY3A 2R0LA 2P95A 1EATA 1GHAF 2Z3DA 3LONA 1C5LH 2BVSH 2ZFQH 4CHAC 3L6PA 1ELCA 3ELAH 1O2XA 3ATLA 5K0HA 4H6TA 1ZGVA 5DP3A 4B73A 1SGRE 2TGPZ 3BSQA 2HPQH 4DW2U 1QRWA 1Z6EA 3OYPA 1B5GH 1AD8H 3LKWA 4A5TS 3STJA 1OKXA 3F68H 3OSYA 3AAUA 4X6NA 1GGDC 1UK3A 2XWAA 3ZYDA 4FVDA 1T31A 4GHTA 2BY7X 1GI2A 1GI3A 1D6RA 1TBQH 4HZHA 4R8TB 1Y59T 1V2LT 1Y5AT 1A5IA 4DJZB 1BIOA 3ATMA 1AO5A 1AVXA 5EODA 2WUBA 3MMGA 1GBKA 3A85A 4BXWA 1ID5H 1HXFH 1LHEH 2BXUH 3B8JA 3T28A 2VWOA 4GHQA 2NWNA 1PJPA 4E7RG 4AFQA 2UWOA 1GCTC 1GHWH 1KLJH 3P70B 3RXTA 2SGFE 2QAAA 2WPJS 4IGDA 1MH0A 3HK6B 5EW1H 1E34B 1ARBA 2BVRH 3A8DA 1KIGH 2Y5HA 3SGBE 3P6ZB 1P06A 2V35A 2OLGA 2ZU4A 2OP9A 1FMGA 3LGWA 1FLEE 4BAMB 5SGAE 3T29A 4THNH 1GI9B 1O3LA 3FAOA 3TU7H 4CH8B 4AORA 4X6PA 1BTXA 2ZP0H 3M3SA 1LHDH 4Y0ZE 3STIA 4WXIA 2J34A 1TALA 1TMTH 4JK5A 1QB6A 4FUHA 2QV1A 4DCDA 3NKKA 4FUDA 1LVMA 1UCYK 5FX5A 1DWCH 4O3UA 4FUJA 1GJCB 1O2GH 1PYTC 2ODYB 1O3FA 2OQ5A 2A7JA 5PTPA 1NRRH 1O37A 5LGOA 3SUFA 5I25A 1TE0A 1C4V2 1C9PA 1SOTA 2FZZA 1SBWA 1SGYE 4NWLA 2NU1E 1O2QA 1EAWA 3O8RA 1GDNA 1V2ST 1C2MA 4DGJA 1O3DA 1O2WA 4MNWA 3ATKA 2FYQA 3ITIA 1BBRH 3BN9A 5JBTA 1AIXH 3Q77A 2FX4A 3UQOA 4A1TA 1G30B 3AASA 1NY22 3CS0A 1LCYA 1SHHB 1TNJA 5EG4A 2XCNA 1OS8A 1E36B 1H9HE 1YKTA 1J15A 3L3TA 1GBEA 1ZHPA 1Y3VA 3URCA 2GV7A 1ABIH 1G2LA 5HXFA 1HJ9A 2F3CE 2PV9B 2Z7FE 1UMAH 2GMTC 2ZTZA 1Y3YA 1SQOA 1LVOA 2Q6FA 2SFAA 3K2UA 4YOGA 2CF9H 1DICA 3MHWU 1BTZA 1QTFA 2LNCA 4OS5A 4DVAU 4Q7ZA 2B7DH 2M5TA 2ESTE 2HNTF 1IAUA 1INCA 1NFYA 2AGIX 2C90B 2FM2A 2G5NA 2UUJB 3T2NA 4O03A 1P09A 2GX4A 1GCDA 3M37A 1IQFA 3A8AA 1A5GH 1GL1A 1KY9A 2ZTXA 3W95A 1FAKH 3A88A 1CA0C 4X8SH 5JDUB 1BJVA 3A83A 2JETB 3BTME 3EYDA 3LGVA 1HAXB 1LPGB 1WV7H 4XFQA 2VIDA 3CP7A 1T4VH 1QRZA 1GJ5H 1EPTB 4ABAA 1QA0A 1L1NA 4NA8A 5GCHF 2Z9IA 4HI3A 2H9EH 2BOHB 1MTUA 1S5SA 2FO9A 2PFEA 3SU6A 1OOKB 1FI8A 2ZNKH 1TFXA 3M5OA 3SV2H 1T8NA 4I8JA 3EE0B 4IMQA 4MTBA 3MI4A 1VJAU 4FUIA 1V2KT 4CH2B 1TWXB 1Z8JB 5L2ZH 5EXMA 1GBBA 1IQEA 2XWBI 2BDHA 4AG2A 1GBJA 4UDWH 1XX9A 2NU0E 4K8YA 3BV9B 4B76A 1HLTH 1DFPA 1S85A 3LGYA 2ULLA 1DITH 2OBQA 3M61U 3MU4A 4BANB 4CHAB 5J4QA 2W3KA 1GBAA 3GCNA 1L2EA 4I31A 4BTUB 1Y8TA 2FDAA 2PTCE 3G01A 2J94A 3KIDU 2R2WU 2CXVA 3ENSB 3RXDA 3ATIA 1K1MA 1W0YH 4NA9H 1GBHA 2FYRA 3PLBA 3PB1E 1O34A 1GGDB 1KDQA 1ZMLA 4AYYB 3SI4H 1QB1A 5EQRA 1L0ZA 5G4BA 2FS9A 3BEFB 3IITA 4KGAA 1ANBA 1BRBE 2HPPH 3DFJA 2FP7B 1MTSA 1K21H 3FFGA 1WTHD 5L6NH 5HGGA 4WWYA 1V6DA 3SN8A 1GHAG 1J17T 1V2PT 1G36A 2ZHDA 4INKA 5E0JA 3RXVA 2ZU3A 4JZIA 1BTUA 2PLXA 1AE5A 1GBDA 2THFB 3A8BA 2W3IA 4Y76A 1GCTB 1DXWA 3KN2A 3GY5A 4YLQH 2F9VA 2AYWA 3EGKH 1P03A 2AFQB 5C67A 2YNAA 1TRYA 3GY3A 1OWKA 3S7KB 2CGAA 3FP7E 3PO1C 4GUXA 4IN2A 3TK9A 2HGTH 3RU4E 3TNSA 1DY8A 3A80A 1P10A 3IWMA 2VH0A 1YLCA 1NU9A 2H5CA 2KAIA 1QFKH 2V6NA 2QXIA 1RTKA