1GJ7B

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 50
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj7B01
1P2KA 1EAWA 1H1BA 3KGPA 2BTCE 3VXFH 3BEUA 5HM9A 1O3MA 3GICB 3PLBA 2G5NA 2ESTE 3EE0B 1UTMA 3M3SA 4GLYA 4I8KA 5EOKA 4NGAH 5A8ZA 4GCHG 1V2TT 2BZ6H 2H9TH 3MMGA 4ZH8A 1Y3XA 2A5AA 2XCFA 2ZPRA 1A61H 2W26A 1LPKB 1QL9A 2DE9A 3MU0A 2FI4E 2P16A 4NWLA 3ODDA 3RC5A 5DKMA 5DG6A 2HNTC 1F2SE 4K1EA 1PPCE 2ZO3H 1TBQH 1WOFA 1UMAH 2OP9A 4KP0A 4ZHAA 3RLYH 1TAWA 4Y7BA 1OS8A 4MG3A 4FUHA 2BB4A 1DWDH 4I8LA 1SLUB 1HPGA 3SNCA 4ZKOU 2A32A 4A1XA 1UJ1A 5EW1H 1ELDE 1K9OE 1AZ8A 4X2VA 1DICA 2UUFB 3A7TA 1YPMH 2PFEA 1TRMA 1C2EA 2F91A 3BTFE 3SBKA 4IMZA 3TGKE 3VB5A 1IQIA 1BHXF 2AGEX 3ATMA 2R3UA 4UONA 1H4WA 5EODA 1SGDE 1TMUH 1GI2A 2Z3DA 5GCHF 1UK3A 3AW1A 2HPQH 4LZ4B 3HGNA 1H8DH 5TCAA 1HAGE 2WPJS 1TLDA 1GHYH 2ZI2H 1SGFA 1WV7H 2AMDA 2ZDAH 3DT0H 2TIOA 2A45B 1SHHB 5AVDA 1DY8A 4J2YB 1O2UA 5AF9H 3GCTG 1JIRA 1T4VH 1TBRH 4MPVA 1C5SA 1GCTB 3ZZ5A 4CH2B 1SFQB 4KGAA 3AASA 4ABFA 4XBCA 1AFQC 1ORFA 3EA9A 1HIAB 1TX7A 1L1NA 4NZQA 5F03A 4AORA 3P8FA 3VB4A 4Z0KA 3QTOH 1MCVA 1YC0A 3QWCH 4TYDA 5HM2A 1IQNA 1XXDA 1ZSLA 4ABAA 4B76A 2XTTB 1MTNC 2WPMS 5EXMA 1WQSA 3SUFA 4ABBA 3A7WA 4NIYA 2ZCKP 3NKKA 2RA3A 4X2XA 3SUDA 1WYKA 1Y3UA 1A1RA 3SNBA 2BY7X 2P95A 3KEEA 3NPSA 3DD2H 2FXRA 2ZKSA 1CT4E 1V2ST 1KLTA 2P59A 1YCPK 4RN6A 1GJ4H 2A4RA 1EB2A 3PWBA 1EOLA 4FUJA 4ZKRU 2Y7ZA 6GCHG 3A8BA 1O5GH 5EG4A 2AIPA 5JBAS 2AERH 2WV5A 3P8OA 1SGRE 3AAVA 1WBGB 4DVAU 1FY5A 1LPZB 3T28A 4Y0ZE 2OBQA 3N7OA 3OSYA 3GDSA 3M35A 2OUAA 3RDZA 3FP8E 2R2MB 1ELGA 1NC6A 2XNIA 1Z1IA 2SNVA 4FU9A 1GI5A 3D65E 3GY5A 3AAUA 4FU8A 1K1IA 3UOPA 3LC5A 1O30A 4ISNA 1GBTA 4MDSA 1GJ7B 1GGDB 1HV7A 1NESE 1RRKA 3M61U 5J4SA 4O9VA 3QO6A 2QA9E 1EKBB 1P09A 1LCYA 1THSH 2THFB 2G52A 3F9FA 3K65B 1TGCA 1P3EA 1SSXA 2JKHA 1P12E 5FCKA 1DXWA 3M5MA 1V2OT 2J34A 2FODA 1ETSH 3S69A 3SO3A 4X8TH 1O2XA 4Y0YE 3NWUA 1C4Y2 4JZ1A 2A7CA 1ZR0A 2SNWA 4IN2A 3BIUH 2PTNA 3BIVH 3PMHB 4B2BA 2WYGA 2G51A 1O2YA 3M3VA 1G37A 1BRCE 1RFNA 2F3CE 1G2LA 1OWHA 2AYWA 1YGCH 8ESTE 2BOHB 4IGDA 3K6ZA 4XBBA 4KTUA 3S7HB 4Y8YA 2FS8A 1DANH 2KAIB 1G9IE 1ABJH 1E38B 2HWLB 3MI4A 2KAIA 1HRTH 3EYDA 1ZPBA 1ZZZA 2J95A 3RC4A 2PGBB 1CU1A 5A09A 1ZGVA 3KNXA 1FY3A 1ZLRA 2GDDA 2FLBH 1GI1A 4CBNA 3CP7A 1VGCB 3E91A 4GHTA 1C2LA 4OS5A 3LH1A 1ZHPA 1KXEA 1MTWA 2K1QA 2NU1E 1EPTA 2HNTF 1O2KA 4Z6AH 4LK4A 1HFDA 1GCTC 1GMCG 1MQ5A 1DFPA 1YCPM 4U32A 3P92A 1MTSA 2ZHWH 2FI3E 3EGKH 4U30A 1A4WH 2G55A 4WXVA 4I8JA 1EZXC 3URCA 1AMHA 2OC7A 3CENA 3RXMA 1T8NA 4OS4A 1K1LA 1O3KA 2VVVA 2Y81A 1FZZA 1ESTA 1VCPA 3BTQE 1OYQA 1QL8A 1P2IA 3LH3A 1GBCA 1Y3WA 1NT1A 5FXLA 2PKAA 1EP5A 5C5OA 1SR5C 1O5DH 4ESTE 1QB1A 1BQYA 3EQ0H 3ZZ3A 2ZCHP 1MKXK 3HPTB 4B1TA 5JYIA 4WWYA 4Q7YA 5EQSA 4IC5A 1OXGA 1TOMH 4IN1A 1SBWA 3LONA 4H6TA 3SORA 1IQGA 2YNBA 2SGQE 1CT0E 1L2EA 3VGCC 2SGFE 2QYIA 5ETXA 4NG9H 3U1IB 4AFUA 4OS1A 4OS7A 5EW2H 1A5HA 3RXRA 1SGYE 2FOAA 2BY6X 1IQHA 1ZGIA 1XUFA 1TNGA 2Z9LA 4F4OC 1OWKA 2HNTE 7KMEH 1PPFE 3TIUA 4I32A 3NXPA 5A0BA 3S0NA 1AQ7A 1FPCH 1TRYA 2BLQA 1C9TA 2ZZUH 1S85A 1FXYA 3MO3A 2BDHA 3U8TH 3RXQA 5L2YH 1P03A 1GBJA 1O38A 5F8ZA 1BT7A 1HGTH 1TONA 4K3JA 1P2QA 1DVAH 1EJMA 4BTIB 3KQDA 5JPMH 1BJUA 1AU8A 1PQ5A 8GCHF 4D7FA 2BX4A 4UFFH 2ZDNA 3H7TA 2GZ9A 1A0HB 1JOUB 1ARCA 1C5OH 1ZHRA 5FX5A 5DO4H 1HDTH 3I77A 1W7XH 1QFKH 4H4FA 5E0HA 1O3OA 3SNAA 2FTLE 2SFAA 1V6DA 1GHAF 3MO6A 3UOUA 3ATLA 1FN6A 2ZEBA 4ZXYH 2UUYA 3TLOA 3E0NB 1YF4A 2ZDLA 1C5MD 3PV4A 2WPIS 1QRWA 2FIRH 2O8UA 1HYLA 1BMMH 2OQ5A 2F9NA 4YLUA 1GJ9B 2PWXA 3DFJA 2ZU2A 2XBYA 1LO6A 1SQTA 1AVWA 2ZQ1A 2C93B 4YT6H 1VR1H 4AGKA 1OWIA 1TMBH 1V2LT 2ZDMA 2Z9IA 4I33A 1CHOF 1SOZA 1VGCC 1QL7A 3ESTA 3DUXH 1KXDA 3SU3A 3VB3A 3RXHA 1Z7KA 2OC8A 4E7RG 1C1SA 3A7VA 3BG8A 4YZUA 1JWTA 4U01A 1M9UA 1FAXA 4X6NA 3EA7A 1TX6A 1C1NA 3TH4H 1GJ5H 5HMAA 1C2MA 3LIWA 1MBMA 5TCCA 3GY4A 2ZHFH 1TGBA 3RMLH 1S84A 2OC1A 1QA0A 1NROH 2C3SA 3U1JB 2QV1A 1SLVB 1FN8A 1O3GA 3LOXA 1BTWA 3A82A 2C90B 2YNAA 4XOJA 1GI0A 3BG4B 3P8GA 1KXCA 3LT3A 1HBTH 1SC8U 1BTXA 1TQ7B 1HAXB 3RXDA 1SG8B 3HK6B 1C4V2 2LPRA 3SJ8A 1AN1E 1O2VA 3E1XB 3D62A 4CH8B 1TWXB 3W94A 1YPGH 3FP6E 1ZMJA 3UWIA 2GCTB 1MD7A 2ZFSA 1TPOA 5DP6A 4XDEA 4NZLA 1L1JA 3ZV8A 2W7UA 4BANB 3MWIU 1TA2A 1O3HA 1T4UH 1W3CA 2Y5FA 1BCUH 1B7XB 2TGTA 1A3EH 3M5NA 1ANCA 3MYWA 3SJOA 5CMXH 4B75A 2ILNA 2BXTH 4WJG2 5E0JA 3O8RA 2FX4A 2VH6A 3K2UA 3GCNA 4WH6A 3SJIA 2W7SA 3SV9A 3GY8A 1O2TA 5EPNA 4K60A 1V2PT 1XUGA 4Q7XA 3VB7A 2O8WA 1LVBA 2A2QH 2I6SA 1O2SA 1G2MA 1V2RT 1BBRK 3A87A 1OWDA 2CXVA 1GDQA 2BVXH 1EXFA 3UUZA 2P93A 4MVNA 1ETRH 1XMNB 3LGIA 2ZC9H 1J9CH 1FLEE 4ZHMU 3A80A 4ISOA 5EQQA 4DGJA 2H6MA 4YLQH 5T6DA 1MKWK 3UR6A 5JBBS 1RGQA 5LH8A 1ELFA 3DFLA 1HAYB 1TPSA 1TNJA 1ZTJA 5FPSA 4FUCA 5BPEA 5GDSH 1ANBA 3T26A 4I31A 4MNXA 5A2MH 3HATH 4CRGA 1UVPA 1VITH 3MH5A 5IYTA 3TITA 1W13U 3PM3A 1XX9A 1SFIA 3TPIZ 1DPOA 1O2RA 2ZGHA 3RXPA 1DSUA 3L6PA 4BTTB 1GL1A 3RU4T 2Z3CA 1C1RA 3RXAA 1AVXA 3SQEE 1SGTA 2P8OC 2FWWA 2QC2A 1NRNH 1GHWH 3BSQA 1MTUA 3M37A 2G4TA 2ZWLH 1IQFA 1C1QA 1FY4A 1PFXC 9LPRA 1GG6B 5HXFA 5I46H 5K0HA 3OTJE 1P2JA 4B73A 1ZJKA 1ELBA 2OC0A 3RXOA 3FP7E 3A88A 3GDVA 4UDWH 3RXGA 2AMQA 2GTBA 4A5TS 1U6QA 4NA7A 4MNYA 1D3PB 1LQEA 3DA9B 3AW0A 4YTAA 3OYPA 1YYY1 4BAKB 1BOQA 3K9XB 4JMYA 3PLKA 3L33A 1K1MA 4AZ2B 1C5QA 4X8VH 5GCHG 2DUCA 3E16B 1DSTA 1ZMLA 2SGEE 1AO5A 4INLA 2JH6D 2ZNKH 2PUQH 2XC0A 1D3TB 4Y8XA 3RXBA 2D1JA 4XFQA 3T5FH 4AYVB 3BG4C 3V3MA 2ODQA 3A8CA 4E7NA 2ZGBH 1OX1A 1P10A 4FUBA 1SGQE 4H6SB 2BY5X 2FS9A 1ELEE 1L4ZA 3SGBE 4AFSA 3BTTE 1F5KU 2Z7FE 3RC6A 1SGEE 2Y5GA 1P04A 1HXFH 1UK4A 1JMOH 1F7ZA 1NO9H 2BDGA 1EASA 3UPEA 2OBOA 2ULLA 5A8YA 4NIVA 1QURH 2FLRH 2VIWA 4GCHF 1LVOA 4ZUHA 1PPBH 1UVTH 1SGCA 4KELA 1EB1H 4X1NU 1F5LA 1P3CA 3TNTA 2J92A 3ITIA 1LHEH 4BAHB 1DLEA 4A1VA 1MZAA 1OYTH 4IMQA 1TB6H 2G4UA 1NS3A 1ZJDA 2G81E 3F9HA 2GMTB 5ESBA 3PLPA 2IJOB 3ZZAA 1C5XB 1LPGB 2BY8X 1E35B 1VITF 2FP7B 2EI8A 2UWPA 1AKSA 1YP9A 1BA8B 1QJ6B 2FOFA 1LKBA 3EAJA 3SU6A 2ZGJA 4UD9H 3IG6B 4WVPE 4X1PU 1VJAU 5DGJA 4DG4A 2GCHG 4RSPA 1WSSH 1O5CB 2VJ1A 3SGQE 3C27B 3P8NA 1SQOA 2A4OA 1FJSA 4FXGH 4NFFA 3ZYDA 1GI4A 1MMJN 2ZU3A 2XC5A 1XVOA 1Y5BT 2FOCA 2IPHA 1TPAE 1Q3XA 3O8DA 3FAOA 3S9AA 3M5LA 4DCDA 2R9PA 6CHAC 3B23B 2UUKB 4YM9A 1ESAA 3RXIA 4AFQA 1J14A 1KLIH 1RIWC 1QB9A 6LPRA 1S81A 1T7CA 2XWAA 1AVGH 3O8BA 2TGPZ 5C1UA 3CS0A 3K6YA 1CGHA 2O8TA 1C4U2 2R2WU 5E8EH 1B5GH 2V35A 1N1LA 3GCTF 3LKWA 5C5NA 3TK5A 1P02A 1FV9A 2ANWA 2W3KA 3Q3XA 3MHWU 1FIZA 5EGMA 1A7SA 5FPYA 2ASUB 2CV3A 5C2ZA 1AD8H 2GV7A 1A46H 1V2JT 4O97A 5EXNA 2YOLA 2ZHQH 4AOQA 4IW4E 1GG6C 3E3TA 3NCLA 3ZV9A 4F49A 1DX5M 3T62A 2NU0E 2NU4E 1CO7E 1GVZA 4CR9A 2OTVA 1TNKA 3QLPH 3ZZ8A 2J9NA 1YPJH 1XUJA 3GYLB 2ZTZA 1G3BA 4X8UH 4CBOA 1TGNA 2WPKS 1J8AA 4OGYA 3PO1B 5FHTA 4JZIA 5K7RA 2PLXA 2ZP0H 1PYTD 2ZF0H 3KQBA 3CS7A 3SZNA 3S9CA 1NM6A 2BD3A 1C1VH 2ZU4A 5L6NH 1EJNA 4INHA 1FUJA 1KXFA 2BX3A 3MNCA 5B6OA 6GCHF 1ZOMA 4J1YA 4CREA 3SW2B 2Q6FA 3RXTA 4MQAA 2XRCA 2NWNA 1MZDA 3KIDU 1KYNA 1KSNA 4TY6A 4Y7AA 4I8GA 4Y10E 1BMNH 5L30H 7GCHG 3Q76A 3LGTA 1AUJA 2VIOA 3QGJA 3QTVH 3Q00A 2VU8E 2OD3B 3DHKH 1FPHH 2HRVA 2Y80A 3F1SB 3HKIB 2P3UB 1WAYB 1SGPE 1Z8JB 1FDPA 1GWAA 1HB0B 1O33A 1O2OA 2J4IA 1NFUA 1YPEH 3UTUH 3FANA 1NRQH 2FESH 1SGNE 4FVDA 1TNIA 1YPHC 4UFEH 3AVZA 1A3BH 1Z8IB 3GDUA 2AIQA 4ABGA 3PMJA 1P06A 3UIRA 2CN0H 1HAHH 1DUAA 1RTKA 1UVOA 1YPKH 1EPTB 2DE8A 3A7XA 1VCWA 2GMTC 3GOVB 5DP7A 3GCOA 1BB0B 1YLCA 3KHVA 4BOHA 1EOJA 2Z9GA 1QGFA 5HYOA 2AFQB 1A2CH 1FONA 2ZA5A 1EZUC 3QN7A 4X2WA 1GBDA 1P9UA 3PROA 1V2QT 1GJDB 4MTBA 2BDAA 2BYAX 2FPZA 1ETTH 5G4BA 3UQOA 2Q1JA 3RMNH 2G5VA 3BV9B 1C1MA 3LGVA 3SU1A 1CGJE 3A8AA 1OPHB 3ATIA 2QXGA 2WPHS 3IITA 1NZQH 3QZQA 1SQAA 2RDLA 4K8BA 5JB9S 1ZYOA 2VWNA 4GPGA 4JCNA 1DS2E 3SU5A 2XW9A 4O3TA 2PKAB 4H42U 3ZVDA 1DE7H 1UHBB 4JK6A 5JB8S 2GP9B 1F0TA 1DT2A 5ESTE 1UHBA 2ZFTA 1QBVH 1GHZA 1Q2WA 3U9AH 4AGJA 1QTFA 5JBTA 2HVXA 3UNRA 1OP8A 3VFEA 3GY6A 5DK1A 3TNSA 2QXHA 3LDXH 4UFDH 1W2KH 1AB9B 2P94A 3SNEA 1HJ9A 5F8XA 2PV9B 2ZFRH 2V0BA 2PKSB 1VJ9U 3VEQB 1GJAB 8GCHG 1MAYA 2VB0A 1ABIH 4JYUH 4QT8C 5GIBA 2UWOA 4B74A 4SGAE 3UNSA 3SHCH 4K2YA 1UTJA 4BAMB 5SGAE 1OWEA 1LDTT 1XM1A 1QBNA 3PWCA 4X6OA 2WYJA 3MU1A 1C5VA 2BXUH 1D6WA 5IDKA 1O2PA 3TK6A 2ODPA 2SGDE 4BAOB 3RXJA 4DURA 1QJ7B 1VCQA 1C5NH 4TY7A 1LHDH 1O5BB 2BVRH 5A0AE 3A83A 1GGDC 1SLXB 1MD8A 2AH4X 2CF8H 3ATKA 3MU8A 2BDBA 2OQUA 1KY9A 4Q80A 4K8YA 3SU0A 3MU4A 4A7IB 1GBFA 1Z6JH 3PO1C 4ABIA 1OKXA 2CMYA 1GJCB 4DY7B 2GX4A 1TX8A 4CHAB 1N6XA 4AB9A 2PW8H 3B9FH 2TGAA 1N6YA 2Z94A 4O3UA 2QN5T 1O3EA 3M36A 1TBZH 5J4QA 3E90B 4TWWA 1B0FA 3MH7A 2FTMA 1YLDA 2ANMH 3ZZCA 4D9RA 1K21H 2HALA 2GD4B 1AE5A 1GBMA 2B5TB 3G01A 1HAZB 4DW2U 3V0XA 1LVMA 1AWFH 3A7ZA 2R3YA 1A5IA 4OS6A 3STJA 3URDA 1LMWB 1RXPA 1Y5UT 3LGUA 3TJNA 2AS9A 2O8MA 2P3TB 1AE8H 3RXEA 2C8YB 1C2KA 1UTPA 1O3IA 1UCYK 1UTOA 3EA8A 3F68H 4X6MA 3GY2A 1YBWA 3UNQA 2ALPA 1O39A 2IN2A 1GHBG 1ELAA 1EAUA 1O3BA 5AHGH 3SQHE 7LPRA 1UTQA 1ESBA 1SGFG 1O0DH 2CGAA 3ZYEA 1O3FA 3F9EA 2PSXA 1V2WT 1SOTA 1O2MA 4MPUA 1CBWB 2Z6BD 2Z9KA 4I8HA 1GDUA 5T3HA 2ANYA 1DDJA 1P2MA 4R8TB 3UWJH 1OWJA 1Y8TA 3ZZ6A 1NU7B 5DP4A 1GMDG 3LC3A 1QNJA 3A8DA 5LGOA 4HZHA 1D3QB 3TGIE 1O2WA 1QRXA 4FUEA 4Q7ZA 1GHVH 2GKVE 1PQ8A 2C8WB 3SI3H 2QF3A 2STAE 1QIXB 3BTGE 1DOJA 3HGPA 4R0IA 1J16A 1ACBE 1OOKB 3STIA 4M7GA 1C2FA 4Y8ZA 4WY3A 1OSSA 2M5TA 3T29A 3D23A 4UEHH 1XUKA 2BD5A 1ZTKA 4X0WU 2OXSA 1QRZA 4ZKNU 1LVYA 5FBIA 2XCNA 3GY3A 4HFPB 1EX3A 5PTPA 2VIDA 4SGBE 1O5FH 1S5SA 2A31A 2QGRA 3R3GB 4KTSA 1AB9C 2VVCA 1SL3A 2P3FH 3P6ZB 4ASHA 4AG1A 1TIOA 3ATWA 4X8SH 2QCYA 4K1SA 7ESTE 1QJ1B 2PKSC 4WF8A 4FVBA 4ABHA 4YT7H 2ZGXH 1C5LH 2ZGCA 2A7JA 3W95A 3LGYA 1THPB 1V2KT 3SHAH 2D26C 1BRAA 2Q6GA 3U98H 3KQEA 3RM2H 3SN8A 5LPFA 4WXIA 1BUIA 1MQ6A 4B71A 1Z6EA 1HAVA 1W11U 1QY6A 1GCDA 1O2QA 3MU5A 2STBE 2XWBI 1O2NA 3V13A 2VWOA 3TH2H 1TABE 2O9QA 1C5ZB 3SOSA 1AY6H 3H7OA 5FBEA 1Y59T 1DITH 1LHFH 2B7DH 2J2UA 1NRPH 1JIMA 2ZPQA 3SI4H 3FVFB 1ELTA 3RMOH 1P01A 1KDQA 2BD9A 2BHGA 3LU9B 5C1XA 1P0SH 1FQ3A 1W0ZU 2H2ZA 3QK1A 3MOCA 4ABJA 4LZ1H 4BAQB 4TPYA 4Y71A 5EXLA 1N8OB 4HTCH 3Q77A 3BTWE 1G36A 1ANEA 4JZFH 4CRCA 3MFJA 1BIOA 1Y3YA 4FUFA 1HXEH 3QGNB 1O2JA 1TFXA 2FOHA 5GPIB 1O3JA 4MNVA 1DY9A 3U69H 1D3DB 1CSOE 1TGSZ 2QF0A 2VWMA 3KL6A 1WU1A 1NRSH 1ZRKA 1AHTH 2CJIA 3PMAB 4B2CA 1YPHE 2BQ7B 1QCPA 1AUTC 2A5IA 3QX5H 3L3TA 2F9OA 3SV8A 1MAXA 1GMHF 3ODFA 2BZAA 2F83A 2WUBA 1HLTH 3RXCA 2ODYB 2ZCLP 2AGGX 4ABDA 1ZSJA 4NWKA 4ZXXH 1NY22 1ID5H 1WTHD 3VB6A 1C2GA 1ZPCA 4NCYA 3LJJA 1O3DA 2BLOA 3PTBA 5A0CA 5TJXA 3TH3H 1FIWA 1FAKH 4VGCB 2JETB 2XXLA 2ZDVH 1MUEB 9ESTA 2R0KA 1S6FA 2ZTYA 3O8CA 3BEFB 1C1PA 1C5TA 3ENSB 2Y5HA 3SGAE 1DWEH 1C5RA 1LQDB 2H9HA 3ZVEA 1O2GH 1Z71A 1SPJA 4K69A 4AN7A 1PQAA 5C20A 1QR3E 3LPRA 1H9LB 4DIIH 1J17T 4BNRA 1DLKB 2TPIZ 1IHTH 1XUIA 3Q3YA 3A89A 1BBRE 1O34A 1IQKA 1MU6B 1QHRB 1Z8GA 2HOBA 3C1KA 3PB1E 4JK5A 2FM2A 3BF6H 1TYNA 1FY1A 1CQQA 1YCPH 2ALVA 2IOTA 1D9IA 3M5OA 4NIXA 1RJXB 5L2ZH 1V2UT 2JH5D 2ZDKA 4NSYA 2VWLA 3T25A 1RD3B 1VITG 1LHGH 2TBSA 4YOGA 2ZFQH 1ZMNA 1WTGH 2VIQA 4DJZB 2A4GA 2GCTC 2H5CA 4GHQA 1E36B 1IHSH 1OP0A 1TE0A 2BQ6B 1CA8B 1O35A 2D8WA 3NUMA 2XBWA 3RXFA 2FYQA 5DP5A 2NU2E 3QDZB 2BMGB 3RU4D 1G3CA 1G32B 1YM0A 1O2LA 1NPMA 4ZMAH 1L1GA 3A7YA 4X1QU 1JRTA 4UFGH 3SU2A 4JYTA 4K1TA 2A2XH 1FMGA 5FAHA 1UVSH 1C5YB 1KXBA 3ZZDA 1NTPA 1BTUA 1B0EA 1AKSB 1TQ0B 4X1RU 1E34B 2ZU5A 1FI8A 1KXAA 1HJAB 3I29A 1UVUH 1F0UA 3TJOA 1TNLA 1MH0A 4ISHH 1C2JA 5CHAB 2ZG0H 4BTUB 1D4PB 1JBUH 1THRH 5CE1A 3VPKA 3ZVCA 1EAIA 4WMDA 1N8OC 5DJ7A 2A4QA 2C4FH 1IAUA 1ZPZA 2ZQ2A 3V12A 1P11E 1W0YH 1UTLM 3SV2H 3E0PB 4GVUA 2ZHDA 1VZQH 2FMJA 4ISIH 2ZECA 1CT2E 2BQWB 3MO9A 5E2PA 4GSOA 3RMMH 1P2NA 4TWYA 2WPLS 3SUGA 5GWZA 1G3DA 2Y7XA 1GBBA 4ISLA 1S83A 2FZZA 3MNBA 1GVKB 1HIAA 3MH4A 1O37A 3P17H 4HI3A 1GJ6A 1O3LA 4YO9A 3WY8A 1BZXE 1EAXA 1K22H 1QQ4A 2GV6A 3S7KB 1PPHE 3V7TA 1BMLA 5BRRE 4DIHH 1PYTC 4MNWA 1INCA 1ANDA 1YPLH 2VH0A 1YKTA 1PPZA 3RXVA 2BDYA 1K1PA 1C2IA 2UUJB 3BTKE 5GXPA 5F8TA 2BDIA 1WQVH 3LGWA 2BLWA 2WUCA 3BTHE 1SVPA 3VGCB 3GYMA 2ANKH 2JETC 4VGCC 2V6NA 1QA7A 3ZVAA 3S9BA 1GBKA 2RG3A 1PPGE 3MNXA 2GCHF 6ESTA 1S6HA 4CRAA 1W8BH 4FUDA 1C5PA 1XKBC 1K28D 2ZPSA 4A92A 1WUNH 3TK9A 2AGIX 3SV7A 3VXEH 1F92A 5HGGA 2EC9H 4INKA 2PHBA 2B0FA 3KN2A 1AFEH 4WMFA 1DUEA 2A1DB 5LPRA 3TVJB 3FZZA 3RXUA 2VNTA 1TPPA 1MBQA 2RA0A 1GDNA 3E8LA 1AIXH 2I6QA 1KTTB 2F9UA 3R0FA 4XSKU 3UY9A 1MKXH 4TPIZ 3F9GA 1TNHA 2SGPE 1HAOH 1O36A 4YOJA 3ZVGA 4JZEH 4NFEA 1GBHA 1P2OA 1O2IA 1HUTH 1K1JA 2BD2A 2NU3E 1C2DA 3PMBB 3OX7U 2XBXA 1LTOA 1O5EH 4IC6A 3RLWH 4ZHLU 1ZHMA 1Y5AT 1CGIE 1SI5H 3ZZ4A 1DM4B 3M3TA 4JZDH 4XE4A 1OP2A 1GI8B 1FNIA 2F9VA 1GVLA 2J38A 2PR3A 5DP8A 1Z8RA 3UQVA 1TGTA 3F6UH 1BITA 3TU7H 3PTNA 1TRNA 1EUFA 1ELCA 4BXWA 5E0GA 1S0QA 2VGCB 2BDCA 3U8OH 3UR9A 3SU4A 3FZDA 1AZZA 2V3OH 3JZ1B 4E06H 2GZ8A 3IWMA 1KLJH 1LHCH 4ZAEA 2B8OH 2CF9H 1K2I1 3OY6U 1IQLA 3RUOA 2OCVB 3D49H 2BM2A 1HJAC 1BDAA 1WCZA 3NZIA 3A84A 2HPPH 4MPWA 1C1UH 1BHXB 1UTKA 3SJKA 5JDUB 3KF2A 5LPEA 5CHAC 4HGCA 2FEQH 1JXPA 2PUXB 2XBVA 2B9LA 1O3PB 1T8MA 1QQUA 4JYVH 4Y79A 1GPZA 2G8TA 7GCHF 5AFZH 1GI6A 4D8NA 1L0ZA 3A85A 1V2NT 1EJAA 1TALA 4A6LA 1EATA 1W12U 1S82A 5FPTA 1UCYH 1MCTA 3H5CB 4ABEA 4U2WA 5A8XA 1SHYA 1CVWH 2FOBA 3I78A 2AMPA 3NK8A 4FUGA 4WH8A 3T27A 2AEIH 1H9HE 1NFYA 1UO6A 1O2HA 1KTSB 1P57B 1TMTH 1MU8B 1NU9A 2A0QB 2QY0B 4FUIA 1BTYA 4KTCA 3P70B 1GL0E 1NN6A 4D76A 4IS5A 1GMCF 1SB1H 2GZ7A 4AYYB 1NRRH 3TJVA 1E37B 5T6GA 3SJ9A 5DPAA 2FDAA 1S0RA 4RKJB 1IOEA 1GHAG 2FI5E 2EEKA 2QXJA 2FO9A 4MLFB 3P95A 1BRUP 4WMEA 3RP2A 4FU7A 3RU4E 4KKDA 1O3AA 2EI7A 5EQRA 1E0FD 3GISB 1C1TA 1CA0B 2H9EH 2FOEA 1G3EA 8LPRA 5H4IB 1BRBE 5AFYH 2W5EA 1W14U 1BMAA 1SGIB 1UTNA 4IBLH 2C8XB 4AG2A 2CHAB 5JBCS 4ZKSU 2EA3A 1HAIH 2VIPA 1GHXH 2VINA 2C8ZB 1GI3A 1O3NA 1J15A 2WV4A 1TA6A 4XBDA 1CHOG 4PROA 3MTYA 3KCGH 4K5ZA 1TOCB 2WINI 2VVUA 2ZFPH 4NA8A 1K1OA 2Z9JA 2VIVA 1BTZA 1P9SA 2O8LA 4DT7B 2Q6DA 3QZRA 1P05A 1Y3VA 1AI8H 2ZHEH 3ZVFA 3M7QA 3MNSA 4X2YA 3Q3KA 4Y11E 3ELAH 3GCHB 3BTME 1PPEE 2FYRA 5FX6A 4LOYH 2V3HH 1BTHH 2W3IA 4RKOB 4NA9H 1BJVA 1RTLA 1W7GH 2BD7A 4OS2A 1C2HA 1T8LA 2QIQA 1O31A 1H9IE 1A5GH 1GI9B 2RCEA 1X7AC 1O3CA 1JRSA 3QUMP 3B8JA 3SUEA 3ZVBA 1P8VC 2EI6A 1EZSC 2XYAA 2VGCC 1ZTLA 1GJBB 5I25A 1XVMA 2F9BH 2D2DA 1EPTC 3FFGA 3TJUA 3KQCA 1H8IH 1V2VT 1BBRH 1IQEA 2QXIA 5FCRA 1A0JA 1GBLA 4Y76A 1RS0A 2QAAA 4GUXA 1XXFA 2P8OB 1GBAA 3A81A 3RXLA 1T8OA 4CR5A 1KIGH 2GT8A 3BN9A 1O2ZA 1MKWH 2FOMB 4THNH 3SNDA 2GDEH 1O32A 2G00A 1Q31A 4AFZA 2ZFFH 5EPYA 2Z3EA 1EP6A 2A7HA 2PGQB 4YESB 4OGXA 2FX6A 5GJ4B 2H5DA 3JZ2B 3RXKA 1GI7B 2BOKA 1DWCH 4NIWA 4CRDA 3SV6A 2BD8A 1C1OA 2BLVA 3ZZBA 2R0LA 1C9PA 2BY9X 1GHBF 3UFAA 1F5RA 1PJPA 1SMFE 1GBIA 1MTVA 4GAWA 5DP3A 4ZROA 1HNEE 2HLCA 1G30B 2GGVB 1SLWB 3OU0A 4X6PA 3T2NA 1T32A 1K1NA 1FY8E 3TGJE 4NSVA 2TRMA 4B2AA 1F0RA 3MH6A 4LXBH 2Y82A 1IQMA 1GMDF 1V3XA 3UREA 3M7UA 2JH0D 1C1WH 2XC4A 1CHGA 4A1TA 1UCYE 2HGTH 5F6MA 1Z1JA 1HAVB 2J94A 5ABWA 2GVFA 1F0SA 4Q2KA 4I7YH 1LKAA 3EDXB 2ZIQH 1NFWA 1O5AB 1W10U 3PYHA 2ZU1A 4D7GA 1CA0C 1ZSKA 1KDQB 3HKJB 1GMHG 1NFXA 1V2MT 4CRBA 2UWLA 2Y6TA 1EQ9A 3BTDE 3U8RH 2PTCE 3BTEE 2H1UA 3GY7A 4CHAC 3M7TA 2CHAC 1QB6A 4UE7H 1GJ8B 1D6RA 1QBOA 2OLGA 1PQ7A 1L4DA 5C67A 4AX9H 3HK3B 2LNCA 1AWHB 1RTFB 2OINA 3A86A 4O03A 4YOIA 1IQJA 5E2OA 5C1YA 4MPXA 1UK2A 1AFQB 1XUHA 1HJ8A 1ZRBA 2TGDA 2F9PA 4D9QA 2A5KA 1ARBA 3LJOA 3BEIB 8KME2 3RM0H 3GCHC 2FOGA 1C5UA 3OY5U 3ZZ9A 1A0LA 3RXSA 5C3NA 1HAPH 5EU8A 1MTNB 1ELVA 4CRFA 5DP9A 1HCGA 4E05H 4BXSA 3E6PH 1XKAC 4DOQA 4AB8A 1CE5A 1T31A 6CHAB 4Y6DA 3ZZ7A 2GT7A 2PSYA 1GBEA 1DXPA 2SGAA 1RIWB 2ZTXA 1BTPA 1DWBH 4X1SU 2BD4A 1C5WB 1CBWC 1EZQA 5T6FA 2BVSH 1AGJA
chains in the Genus database with same CATH superfamily
1P2KA 1EAWA 1H1BA 2GJGA 3KGPA 2BTCE 3VXFH 3BEUA 5HM9A 1O3MA 3GICB 3PLBA 2G5NA 2ESTE 3EE0B 4M9FA 1UTMA 3M3SA 4GLYA 4I8KA 5EOKA 2KR7A 4NGAH 5A8ZA 4GCHG 1V2TT 2BZ6H 2H9TH 3MMGA 4ZH8A 1Y3XA 2A5AA 4P02A 2XCFA 2ZPRA 1A61H 2W26A 1LPKB 1QL9A 2DE9A 3MU0A 2FI4E 2P16A 4NWLA 3ODDA 3RC5A 5DKMA 5DG6A 2HNTC 1F2SE 4K1EA 1PPCE 2ZO3H 1TBQH 1WOFA 1UMAH 2OP9A 4KP0A 4ZHAA 3RLYH 1TAWA 4Y7BA 1OS8A 4MG3A 4FUHA 2BB4A 1DWDH 4I8LA 1SLUB 2WPDD 1HPGA 3SNCA 4ZKOU 2A32A 3OE7D 4A1XA 1UJ1A 5EW1H 1ELDE 1K9OE 4TT3D 1AZ8A 4X2VA 1DICA 2UUFB 3A7TA 1YPMH 3N99A 2PFEA 1TRMA 1C2EA 2F91A 3BTFE 3SBKA 4IMZA 3TGKE 3VB5A 1IQIA 1BHXF 2AGEX 3ATMA 3PRDA 2R3UA 4UONA 1H4WA 5EODA 1SGDE 3UAIC 1TMUH 1GI2A 2Z3DA 5GCHF 1UK3A 2L6OA 3AW1A 2HPQH 4LZ4B 3HGNA 1H8DH 5TCAA 1HAGE 4OM9A 2WPJS 1TLDA 1GHYH 2ZI2H 1SGFA 1WV7H 2AMDA 2ZDAH 3DT0H 2TIOA 2A45B 1SHHB 5AVDA 1DY8A 4J2YB 1O2UA 5AF9H 3GCTG 3ZIAD 1JIRA 1T4VH 1TBRH 4MPVA 4F48B 1C5SA 1GCTB 1E1QD 3ZZ5A 4CH2B 1SFQB 4KGAA 3AASA 4ABFA 4XBCA 1AFQC 1ORFA 3EE7A 3EA9A 1HIAB 1TX7A 1L1NA 4NZQA 5F03A 4AORA 3P8FA 3VB4A 2JJ2D 4Z0KA 3QTOH 1MCVA 1YC0A 3QWCH 4TYDA 5HM2A 1IQNA 1XXDA 1ZSLA 1E1RD 4ABAA 4B76A 2XTTB 1MTNC 2WPMS 2L74A 5EXMA 1WQSA 3SUFA 4ABBA 3A7WA 4NIYA 2ZCKP 3NKKA 2RA3A 4X2XA 3SUDA 1WYKA 1Y3UA 1A1RA 2KZ4A 2BY7X 3SNBA 2J5UA 2P95A 3KEEA 3NPSA 3DD2H 2FXRA 2ZKSA 1CT4E 1V2ST 1KLTA 2P59A 1YCPK 4RN6A 1GJ4H 2A4RA 1EB2A 3PWBA 1EOLA 4FUJA 4ZKRU 2Y7ZA 6GCHG 3A8BA 1O5GH 5EG4A 2AIPA 5JBAS 2AERH 2W6ID 2WV5A 3P8OA 5EJLA 1SGRE 3AAVA 3DSOA 1WBGB 4DVAU 1FY5A 1LPZB 3T28A 4Y0ZE 2OBQA 3N7OA 3OSYA 3GDSA 3M35A 2OUAA 3RDZA 3FP8E 2R2MB 1ELGA 3PRBA 1NC6A 2XNIA 2OK5A 1Z1IA 2SNVA 4FU9A 1GI5A 3D65E 3GY5A 2CK3D 3AAUA 4FU8A 4Q4LA 1K1IA 3UOPA 3LC5A 1O30A 4ISNA 1GBTA 4MDSA 1GJ7B 1GGDB 1HV7A 1NESE 1RRKA 3M61U 5J4SA 4O9VA 3QO6A 2QA9E 1EKBB 1P09A 1LCYA 1THSH 2THFB 3OTPA 2G52A 3DCLA 3F9FA 3K65B 1TGCA 1SKYE 1P3EA 1SSXA 2JKHA 1P12E 5FCKA 1DXWA 4ACBA 3M5MA 1V2OT 2J34A 2FODA 5HKKD 1ETSH 3S69A 3SO3A 4X8TH 1O2XA 4Y0YE 3NWUA 1C4Y2 4JZ1A 2A7CA 1ZR0A 2SNWA 4IN2A 3BIUH 2PTNA 3BIVH 3PMHB 4B2BA 2WYGA 2G51A 1O2YA 3M3VA 1G37A 1BRCE 1RFNA 2F3CE 1G2LA 1OWHA 2AYWA 1YGCH 8ESTE 2BOHB 4IGDA 3K6ZA 4XBBA 4KTUA 3S7HB 4Y8YA 2FS8A 1DANH 2KAIB 1G9IE 1ABJH 1E38B 2HWLB 3MI4A 2KAIA 1HRTH 2JJ1D 3EYDA 1ZPBA 1ZZZA 2J95A 3RC4A 2PGBB 1CU1A 5A09A 1ZGVA 3KNXA 1FY3A 1ZLRA 2GDDA 2FLBH 1GI1A 4CBNA 3CP7A 1VGCB 3E91A 3F2FA 4GHTA 3N7EA 1C2LA 4OS5A 3LH1A 1ZHPA 1KXEA 1MTWA 2K1QA 2NU1E 1EPTA 2HNTF 3F0OA 1O2KA 4Z6AH 4LK4A 1HFDA 1GCTC 1GMCG 5EJZA 1MQ5A 1DFPA 1YCPM 4U32A 3P92A 1MTSA 2ZHWH 2FI3E 3EGKH 4U30A 1A4WH 2G55A 4WXVA 2JDID 4I8JA 1EZXC 3URCA 1AMHA 2OC7A 3CENA 3RXMA 1T8NA 4OS4A 1K1LA 1O3KA 2VVVA 2Y81A 1FZZA 1ESTA 1VCPA 3BTQE 1OYQA 2V7QD 1YLNA 1QL8A 1P2IA 3LH3A 1GBCA 1Y3WA 1NT1A 5FXLA 2PKAA 1EP5A 5C5OA 1SR5C 3FOAA 1O5DH 4ESTE 1QB1A 1BQYA 3EQ0H 3ZZ3A 2ZCHP 1MKXK 3HPTB 4B1TA 5JYIA 4WWYA 4Q7YA 5EQSA 4IC5A 1OXGA 1TOMH 4IN1A 1SBWA 3LONA 4H6TA 3SORA 1IQGA 2YNBA 2SGQE 1CT0E 1L2EA 3VGCC 2SGFE 2QYIA 5ETXA 4NG9H 3U1IB 4AFUA 4OS1A 5IK2D 4OS7A 5EW2H 1A5HA 3RXRA 1SGYE 2FOAA 2BY6X 1IQHA 1ZGIA 1XUFA 4ASUD 1TNGA 2Z9LA 4F4OC 1OWKA 2HNTE 2WSSD 7KMEH 1PPFE 3TIUA 4I32A 3VG8A 3NXPA 5A0BA 3OAAD 3S0NA 1AQ7A 1FPCH 1TRYA 2BLQA 1C9TA 2ZZUH 1S85A 3KYFA 1FXYA 3MO3A 2BDHA 3U8TH 3RXQA 5L2YH 1P03A 1GBJA 1O38A 5F8ZA 1BT7A 1HGTH 1TONA 4K3JA 4I86A 1P2QA 1DVAH 1EJMA 4BTIB 3KQDA 5JPMH 1BJUA 1AU8A 1PQ5A 8GCHF 4D7FA 2BX4A 4UFFH 2ZDNA 3H7TA 2GZ9A 1A0HB 1JOUB 5CHBA 1ARCA 1C5OH 1ZHRA 5FX5A 5DO4H 1HDTH 3I77A 1W7XH 1QFKH 4H4FA 5E0HA 1O3OA 3SNAA 2FTLE 2SFAA 1V6DA 1GHAF 3MO6A 3UOUA 3ATLA 4ACAA 2W6JD 1FN6A 2ZEBA 4ZXYH 2UUYA 2KCPA 3TLOA 3E0NB 1YF4A 2ZDLA 1C5MD 3PV4A 2WPIS 1QRWA 2FIRH 2O8UA 1HYLA 1BMMH 1W0KD 2OQ5A 2F9NA 4YLUA 1GJ9B 2PWXA 3DFJA 1OHHD 2ZU2A 2XBYA 1LO6A 1SQTA 1AVWA 2ZQ1A 2C93B 4YT6H 1VR1H 4AGKA 2M2AA 1OWIA 1TMBH 1V2LT 2ZDMA 2Z9IA 4I33A 1CHOF 1SOZA 1VGCC 2IPQX 1QL7A 3ESTA 3DUXH 1KXDA 3SU3A 3VB3A 3RXHA 3OEED 1Z7KA 2OC8A 4E7RG 1C1SA 3A7VA 3BG8A 4YZUA 1JWTA 4U01A 1M9UA 1FAXA 4X6NA 3EA7A 1TX6A 1C1NA 3TH4H 1GJ5H 5HMAA 1C2MA 3LIWA 1MBMA 5TCCA 3GY4A 2ZHFH 1TGBA 3RMLH 1S84A 2OC1A 1QA0A 1NROH 2C3SA 3U1JB 2QV1A 1SLVB 1FN8A 1O3GA 3LOXA 1BTWA 3A82A 2C90B 2YNAA 4XOJA 1GI0A 4TSFD 3BG4B 3P8GA 1KXCA 3LT3A 1HBTH 1SC8U 1BTXA 2EY4C 1TQ7B 1HAXB 3RXDA 1E79D 1SG8B 3HK6B 1C4V2 2LPRA 3SJ8A 1AN1E 1O2VA 3E1XB 3D62A 4CH8B 1TWXB 3W94A 1YPGH 3FP6E 1ZMJA 3UWIA 2GCTB 1MD7A 2ZFSA 1TPOA 5DP6A 4XDEA 4NZLA 1L1JA 3ZV8A 2W7UA 4BANB 3MWIU 1TA2A 1O3HA 1T4UH 1W3CA 2Y5FA 1BCUH 2KM0A 1B7XB 2TGTA 2AHME 1A3EH 3M5NA 1ANCA 3MYWA 3SJOA 5CMXH 4B75A 2ILNA 2BXTH 4WJG2 5E0JA 3O8RA 2FX4A 2VH6A 3F0PA 3K2UA 3GCNA 4WH6A 3SJIA 2W7SA 3SV9A 3GY8A 1O2TA 5EPNA 4K60A 1V2PT 1XUGA 4Q7XA 3VB7A 2O8WA 1LVBA 2A2QH 2I6SA 1O2SA 1G2MA 1V2RT 1BBRK 3A87A 1OWDA 2CXVA 1GDQA 2BVXH 1EXFA 3UUZA 5HIYA 2P93A 4MVNA 1ETRH 1XMNB 3LGIA 2ZC9H 1J9CH 1FLEE 4ZHMU 3A80A 4ISOA 5EQQA 4DGJA 2H6MA 4YLQH 5T6DA 2LELA 3FO8D 1MKWK 3UR6A 5JBBS 1RGQA 5LH8A 1ELFA 3DFLA 1HAYB 1TPSA 1TNJA 1ZTJA 5FPSA 4FUCA 2HVYB 5BPEA 5GDSH 1ANBA 3T26A 4I31A 4MNXA 5A2MH 1COWD 3HATH 2KCAA 4CRGA 1UVPA 1VITH 3MH5A 5IYTA 3TITA 1W13U 3PM3A 1XX9A 1SFIA 3TPIZ 1DPOA 1O2RA 2ZGHA 3RXPA 1DSUA 3L6PA 4BTTB 1GL1A 3RU4T 5CDFE 2Z3CA 5DN6D 1C1RA 3RXAA 1AVXA 3F3BA 3SQEE 1SGTA 2P8OC 2FWWA 2QC2A 1NRNH 1GHWH 3BSQA 1MTUA 3M37A 2G4TA 2ZWLH 1IQFA 1C1QA 1FY4A 1PFXC 9LPRA 1GG6B 5HXFA 5I46H 5K0HA 3OTJE 1P2JA 4B73A 1MABB 1ZJKA 1ELBA 2OC0A 3RXOA 3FP7E 3A88A 3GDVA 4UDWH 3RXGA 2AMQA 2GTBA 4A5TS 1U6QA 4NA7A 4MNYA 1D3PB 1LQEA 3DA9B 3AW0A 4YTAA 3OYPA 1YYY1 4BAKB 1BOQA 3K9XB 4JMYA 3PLKA 3L33A 1K1MA 4AZ2B 1C5QA 4X8VH 5GCHG 2DUCA 3E16B 1DSTA 1ZMLA 2SGEE 1AO5A 4INLA 2JH6D 2ZNKH 2PUQH 2XC0A 1D3TB 4Y8XA 3RXBA 2D1JA 4XFQA 3T5FH 4AYVB 3BG4C 3V3MA 2ODQA 3A8CA 4E7NA 2ZGBH 1OX1A 1P10A 4FUBA 1SGQE 4H6SB 2BY5X 2FS9A 1ELEE 1L4ZA 3SGBE 4AFSA 3BTTE 1F5KU 2Z7FE 3RC6A 1SGEE 1UW7A 2Y5GA 1P04A 1HXFH 1UK4A 1JMOH 1F7ZA 1NO9H 2BDGA 1EASA 3UPEA 2OBOA 2ULLA 5A8YA 4NIVA 1QURH 2FLRH 2VIWA 4GCHF 1LVOA 4ZUHA 1PPBH 1UVTH 1SQRA 1SGCA 4KELA 1EB1H 4X1NU 1F5LA 1P3CA 3TNTA 2J92A 3ITIA 5C94A 1LHEH 4BAHB 1DLEA 4A1VA 1MZAA 1OYTH 4IMQA 1TB6H 4B6EA 2G4UA 1NS3A 1ZJDA 2G81E 3F9HA 2GMTB 5ESBA 3PLPA 2IJOB 3ZZAA 1C5XB 1LPGB 2BY8X 1E35B 1VITF 2FP7B 2EI8A 2UWPA 1AKSA 1YP9A 1BA8B 1QJ6B 3H09A 2FOFA 1LKBA 3EAJA 3SU6A 2ZGJA 3OFND 4UD9H 3IG6B 4WVPE 4X1PU 1VJAU 5DGJA 4DG4A 2GCHG 4RSPA 1WSSH 1O5CB 2VJ1A 3SGQE 3C27B 3P8NA 1SQOA 2A4OA 1FJSA 4FXGH 4NFFA 3ZYDA 1GI4A 1MMJN 2ZU3A 2XC5A 3NRLA 3AK5A 1XVOA 1Y5BT 2FOCA 5KEDA 2IPHA 1TPAE 1Q3XA 3O8DA 3FAOA 3S9AA 3M5LA 4DCDA 2R9PA 6CHAC 3B23B 2UUKB 4YM9A 1ESAA 3RXIA 4AFQA 1J14A 1KLIH 1S6LA 1RIWC 1QB9A 6LPRA 1S81A 1T7CA 2XWAA 1AVGH 3O8BA 2TGPZ 5C1UA 3CS0A 3K6YA 1CGHA 2O8TA 1C4U2 2R2WU 5E8EH 1B5GH 2V35A 1N1LA 3GCTF 3LKWA 5C5NA 3TK5A 1P02A 1FV9A 2ANWA 2W3KA 3Q3XA 3MHWU 1FIZA 5EGMA 1A7SA 5FPYA 2ASUB 1NBME 2CV3A 5C2ZA 1AD8H 2GV7A 1A46H 1V2JT 4O97A 5EXNA 2YOLA 2ZHQH 4AOQA 4IW4E 1GG6C 3E3TA 3NCLA 3ZV9A 4F49A 1DX5M 3T62A 2NU0E 2NU4E 1CO7E 3WWFA 1GVZA 4CR9A 1W0JD 2OTVA 1TNKA 3QLPH 3ZZ8A 2YMSB 2J9NA 1FX0B 1YPJH 1XUJA 3GYLB 2ZTZA 1G3BA 4X8UH 4CBOA 1TGNA 2WPKS 1J8AA 4OGYA 3PO1B 5FHTA 4JZIA 5K7RA 2PLXA 2ZP0H 1PYTD 2ZF0H 3KQBA 3CS7A 3SZNA 3SZEA 3S9CA 1NM6A 2BD3A 1C1VH 2ZU4A 5L6NH 1EJNA 4INHA 1FUJA 2J97A 1KXFA 2BX3A 3MNCA 5B6OA 6GCHF 1ZOMA 4J1YA 4CREA 3SW2B 5EIYA 2V3MA 5DSFA 2Q6FA 3RXTA 4MQAA 2XRCA 2NWNA 1MZDA 3KIDU 1QZ8A 1KYNA 1KSNA 4TY6A 4Y7AA 4I8GA 4Y10E 1BMNH 5L30H 7GCHG 3Q76A 3LGTA 1AUJA 2VIOA 3QGJA 3QTVH 3Q00A 2VU8E 2OD3B 3DHKH 1FPHH 2HRVA 2Y80A 3F1SB 3HKIB 2P3UB 1WAYB 1SGPE 3PV5A 1Z8JB 1FDPA 1GWAA 1HB0B 1O33A 1O2OA 2J4IA 1NFUA 1YPEH 3UTUH 3FANA 1NRQH 2FESH 1SGNE 4FVDA 1TNIA 1YPHC 4UFEH 3AVZA 3MQKC 1A3BH 1Z8IB 2WHXA 3GDUA 2AIQA 4ABGA 3PMJA 1P06A 3UIRA 2CN0H 1HAHH 1DUAA 1RTKA 1UVOA 1YPKH 1EPTB 2DE8A 3A7XA 1VCWA 2GMTC 3GOVB 5DP7A 2WV9A 3GCOA 1BB0B 1YLCA 3KHVA 4BOHA 1EOJA 2Z9GA 1QGFA 4Q63A 5HYOA 2AFQB 1A2CH 1FONA 2ZA5A 1EZUC 3QN7A 3W1EA 4X2WA 1GBDA 1P9UA 3PROA 1V2QT 1GJDB 4MTBA 2BDAA 2BYAX 2FPZA 1ETTH 5G4BA 3UQOA 2Q1JA 3RMNH 2G5VA 3BV9B 1C1MA 3LGVA 3SU1A 1CGJE 3A8AA 1OPHB 3ATIA 2QXGA 2WPHS 3IITA 1NZQH 3QZQA 1SQAA 2RDLA 4K8BA 5JB9S 1ZYOA 2VWNA 4GPGA 4JCNA 1DS2E 3SU5A 2XW9A 4O3TA 2PKAB 4H42U 4RI0A 3ZVDA 1DE7H 1UHBB 4JK6A 5JB8S 2GP9B 1F0TA 1DT2A 5ESTE 1UHBA 2ZFTA 2KFWA 1QBVH 1GHZA 1Q2WA 4ZCNA 3U9AH 4AGJA 1QTFA 5JBTA 2HVXA 3UNRA 1OP8A 3VFEA 3GY6A 5DK1A 3TNSA 2QXHA 3LDXH 4UFDH 1W2KH 1AB9B 2P94A 1YWUA 1HJ9A 5F8XA 2PV9B 3SNEA 2ZFRH 2V0BA 2PKSB 1VJ9U 3VEQB 1GJAB 8GCHG 1MAYA 5C17A 2VB0A 1ABIH 4JYUH 4QT8C 5GIBA 2UWOA 4B74A 4SGAE 3UNSA 2QF5A 3SHCH 4K2YA 1UTJA 4BAMB 5SGAE 1OWEA 1LDTT 1XM1A 1QBNA 3PWCA 3SYJA 4X6OA 2WYJA 3MU1A 1C5VA 2BXUH 1D6WA 5IDKA 1O2PA 3TK6A 2ODPA 2SGDE 4BAOB 3RXJA 4DURA 1QJ7B 1VCQA 2YMSC 1C5NH 4TY7A 1LHDH 1O5BB 2BVRH 5A0AE 3A83A 1GGDC 1SLXB 1MD8A 2AH4X 2CF8H 3ATKA 3MU8A 2BDBA 2OQUA 1KY9A 4Q80A 4K8YA 3SU0A 3MU4A 4A7IB 1GBFA 1Z6JH 3PO1C 4ABIA 1OKXA 2CMYA 1GJCB 4DY7B 2GX4A 1TX8A 4CHAB 1N6XA 4AB9A 2XOKD 2PW8H 3B9FH 2TGAA 1N6YA 2Z94A 4O3UA 2QN5T 1O3EA 3M36A 1TBZH 5J4QA 3E90B 4TWWA 1B0FA 3MH7A 2FTMA 1YLDA 2ANMH 3ZZCA 4D9RA 2IJD1 1K21H 2HALA 2GD4B 1AE5A 1GBMA 2B5TB 3G01A 1HAZB 4DW2U 3V0XA 1LVMA 1AWFH 3A7ZA 2R3YA 1A5IA 2YMSD 4OS6A 3STJA 2F43B 3URDA 1LMWB 1VKYA 1RXPA 1Y5UT 3LGUA 2PP6A 3TJNA 2AS9A 2O8MA 2P3TB 1AE8H 3RXEA 2C8YB 1C2KA 1UTPA 1O3IA 1UCYK 1UTOA 3EA8A 3F68H 4X6MA 3GY2A 1YBWA 3UNQA 2ALPA 1O39A 4RT0A 2IN2A 1GHBG 1ELAA 1EAUA 1O3BA 5AHGH 3SQHE 7LPRA 1UTQA 1ESBA 1SGFG 1O0DH 2CGAA 3ZYEA 1O3FA 3F9EA 2PSXA 1V2WT 1SOTA 1O2MA 4MPUA 1CBWB 2Z6BD 2Z9KA 4I8HA 1GDUA 1H8ED 5T3HA 2ANYA 1DDJA 1P2MA 4R8TB 3UWJH 1OWJA 1Y8TA 3ZZ6A 1NU7B 5DP4A 1GMDG 3LC3A 1QNJA 3A8DA 5LGOA 4HZHA 1D3QB 1KMHB 3TGIE 1O2WA 1QRXA 4FUEA 4Q7ZA 1GHVH 2GKVE 1PQ8A 2C8WB 3SI3H 2QF3A 2STAE 1QIXB 3BTGE 1DOJA 3HGPA 4R0IA 1J16A 1ACBE 1OOKB 3STIA 4M7GA 1C2FA 4Y8ZA 4WY3A 1OSSA 2M5TA 3T29A 3D23A 4UEHH 1XUKA 2BD5A 1ZTKA 4X0WU 2OXSA 1QRZA 4ZKNU 1LVYA 5FBIA 2XCNA 3GY3A 4FETA 4FOUC 4HFPB 1EX3A 5PTPA 2VIDA 4SGBE 1O5FH 1S5SA 2A31A 2QGRA 3R3GB 4KTSA 1AB9C 2VVCA 1SL3A 2P3FH 3P6ZB 2WZQA 4ASHA 4AG1A 1TIOA 3ATWA 4X8SH 2QCYA 4K1SA 7ESTE 1QJ1B 2PKSC 4WF8A 4FVBA 4ABHA 4YT7H 2QE7D 1C5LH 2ZGCA 2A7JA 2ZGXH 3W95A 3LGYA 1THPB 1V2KT 3SHAH 2D26C 1BRAA 2Q6GA 3U98H 3KQEA 4P00A 3RM2H 3SN8A 5LPFA 4WXIA 1BUIA 1MQ6A 4B71A 1Z6EA 1HAVA 1W11U 1QY6A 1GCDA 1O2QA 3MU5A 2STBE 2XWBI 1H8HD 1O2NA 3V13A 2VWOA 3TH2H 1TABE 2O9QA 1C5ZB 3SOSA 1AY6H 3H7OA 5FBEA 3N7DA 1Y59T 1DITH 1LHFH 2B7DH 2J2UA 1NRPH 1JIMA 2ZPQA 3SI4H 3FVFB 1ELTA 3RMOH 1P01A 1KDQA 2BD9A 2BHGA 3LU9B 5C1XA 1P0SH 1FQ3A 1W0ZU 2H2ZA 3QK1A 3MOCA 4ABJA 4LZ1H 4BAQB 4TPYA 4Y71A 5EXLA 1N8OB 4HTCH 3Q77A 3BTWE 1G36A 1ANEA 4JZFH 4CRCA 3MFJA 1BIOA 5F53A 1Y3YA 4FUFA 1HXEH 3QGNB 1O2JA 1TFXA 2FOHA 5GPIB 1O3JA 4MNVA 1DY9A 3U69H 1D3DB 1CSOE 1TGSZ 2QF0A 2VWMA 3KL6A 1WU1A 1NRSH 1ZRKA 1AHTH 2CJIA 3PMAB 4B2CA 5B6LA 5T1VA 1YPHE 2BQ7B 1QCPA 1AUTC 2A5IA 3F2GA 3QX5H 3L3TA 2F9OA 3SV8A 1MAXA 2HLDD 1GMHF 3ODFA 2BZAA 2F83A 2WUBA 1HLTH 3RXCA 2ODYB 2ZCLP 2AGGX 4ABDA 1ZSJA 4NWKA 4ZXXH 1NY22 1ID5H 1WTHD 3VB6A 1C2GA 1ZPCA 4NCYA 3LJJA 1O3DA 2BLOA 3PTBA 5A0CA 2F4LA 5TJXA 4HG6A 3TH3H 1FIWA 1FAKH 3GS9A 4VGCB 2JETB 2XXLA 2ZDVH 1MUEB 9ESTA 2R0KA 1S6FA 2ZTYA 3O8CA 3BEFB 5FL7D 1C1PA 1C5TA 3ENSB 2Y5HA 3SGAE 1DWEH 1C5RA 1LQDB 2H9HA 3ZVEA 1O2GH 1Z71A 1SPJA 4K69A 4AN7A 1PQAA 5C20A 1QR3E 3LPRA 1H9LB 4DIIH 1J17T 4BNRA 1DLKB 2TPIZ 1IHTH 1XUIA 3Q3YA 1WDIA 2QF4A 3A89A 1BBRE 1O34A 1IQKA 1MU6B 1QHRB 1Z8GA 2HOBA 3C1KA 3PB1E 4JK5A 2FM2A 3BF6H 1TYNA 1FY1A 1CQQA 1YCPH 2ALVA 2IOTA 1D9IA 3M5OA 4NIXA 1RJXB 5L2ZH 1V2UT 2JH5D 2ZDKA 4NSYA 2VWLA 3FN8A 3T25A 1RD3B 1VITG 1LHGH 2TBSA 4YOGA 4DT4A 2ZFQH 1ZMNA 1WTGH 2VIQA 4DJZB 2A4GA 2GCTC 2H5CA 4GHQA 2K0QA 1E36B 1IHSH 1OP0A 1TE0A 2BQ6B 1CA8B 1O35A 2D8WA 3NUMA 2XBWA 3RXFA 2FYQA 5DP5A 2NU2E 2XNDD 3QDZB 2BMGB 3RU4D 1G3CA 1G32B 1YM0A 1O2LA 1NPMA 4ZMAH 1L1GA 3WWBA 3A7YA 4X1QU 1JRTA 4UFGH 3SU2A 4JYTA 4K1TA 2A2XH 1FMGA 3F2HA 5FAHA 1UVSH 1C5YB 1KXBA 3ZZDA 1NTPA 1BTUA 1B0EA 1AKSB 1TQ0B 4X1RU 1E34B 2ZU5A 4B6FA 1FI8A 1KXAA 1HJAB 3I29A 1UVUH 1F0UA 3TJOA 1TNLA 1MH0A 4ISHH 1C2JA 5CHAB 2ZG0H 4BTUB 1D4PB 1JBUH 1THRH 5CE1A 3VPKA 3ZVCA 1EAIA 4WMDA 1N8OC 5DJ7A 2A4QA 2C4FH 1IAUA 1ZPZA 2ZQ2A 4RT1A 3V12A 1P11E 1W0YH 1UTLM 3SV2H 3E0PB 4GVUA 2ZHDA 1VZQH 2FMJA 4ISIH 2ZECA 1CT2E 2BQWB 3KQ5A 3MO9A 5E2PA 4GSOA 3RMMH 1P2NA 4TWYA 2WPLS 3SUGA 5GWZA 1G3DA 2Y7XA 1GBBA 4ISLA 1S83A 2FZZA 3FKSD 3MNBA 1GVKB 1HIAA 3MH4A 3U28C 1O37A 3P17H 4HI3A 1GJ6A 1O3LA 4YO9A 3WY8A 1BZXE 1EAXA 1K22H 1QQ4A 2GV6A 3S7KB 1PPHE 3V7TA 1BMLA 5BRRE 4DIHH 5GNDA 1PYTC 4MNWA 1INCA 1ANDA 1YPLH 2VH0A 1YKTA 1PPZA 3RXVA 2BDYA 1K1PA 1C2IA 2UUJB 3BTKE 5GXPA 5F8TA 2BDIA 1WQVH 3LGWA 2BLWA 2WUCA 3BTHE 1SVPA 3VGCB 3GYMA 2ANKH 2JETC 4VGCC 2V6NA 1QA7A 3ZVAA 3S9BA 1GBKA 2RG3A 1PPGE 3MNXA 2GCHF 4XRNA 6ESTA 1S6HA 4CRAA 1W8BH 4FUDA 1C5PA 1XKBC 1K28D 2ZPSA 4A92A 1WUNH 3TK9A 2AGIX 3SV7A 3VXEH 2LP6A 1F92A 5HGGA 2EC9H 4INKA 2PHBA 2B0FA 3KN2A 1AFEH 4WMFA 1DUEA 2A1DB 5LPRA 3TVJB 3FZZA 3RXUA 2VNTA 1TPPA 1WXRA 1MBQA 2RA0A 1GDNA 3E8LA 1AIXH 2I6QA 1KTTB 2F9UA 3R0FA 4XSKU 1K0HA 3UY9A 1MKXH 4TPIZ 3F9GA 1TNHA 2SGPE 1HAOH 1BMFD 1O36A 4YOJA 3ZVGA 4JZEH 4NFEA 1GBHA 1P2OA 1O2IA 1HUTH 5HIZA 1K1JA 2BD2A 2NU3E 1C2DA 3PMBB 3OX7U 2XBXA 1LTOA 1O5EH 4IC6A 3RLWH 4ZHLU 1ZHMA 2KX4A 1Y5AT 1CGIE 1SI5H 3ZZ4A 1DM4B 3M3TA 4JZDH 4XE4A 1OP2A 1GI8B 1FNIA 2F9VA 1GVLA 2J38A 2PR3A 5DP8A 1Z8RA 3UQVA 1TGTA 3F6UH 1BITA 3TU7H 3PTNA 1TRNA 3PV2A 1EUFA 1ELCA 4BXWA 5E0GA 1S0QA 2VGCB 2BDCA 3U8OH 3UR9A 3SU4A 3FZDA 1AZZA 2V3OH 3JZ1B 4E06H 2GZ8A 3IWMA 1KLJH 1LHCH 4ZAEA 2B8OH 2CF9H 1K2I1 3OY6U 1IQLA 3RUOA 4XD7D 2OCVB 3D49H 2BM2A 1HJAC 1BDAA 1WCZA 3NZIA 3A84A 2HPPH 4MPWA 1C1UH 1BHXB 1UTKA 3SJKA 5JDUB 3KF2A 5LPEA 5CHAC 4HGCA 2FEQH 1JXPA 5C0TA 2PUXB 2XBVA 2B9LA 1O3PB 1T8MA 1QQUA 4JYVH 4Y79A 3KYGA 1GPZA 2G8TA 7GCHF 5AFZH 3OEHD 1GI6A 4D8NA 1L0ZA 3A85A 1V2NT 1EJAA 1TALA 4A6LA 1EATA 1W12U 1S82A 5FPTA 1UCYH 1MCTA 3H5CB 4ABEA 4U2WA 5A8XA 1SHYA 1CVWH 2FOBA 3I78A 2AMPA 3NK8A 4FUGA 4WH8A 3T27A 2AEIH 1H9HE 1NFYA 1UO6A 1O2HA 1KTSB 1P57B 1TMTH 1MU8B 1NU9A 2A0QB 2QY0B 4FUIA 1BTYA 4KTCA 3P70B 1GL0E 1NN6A 3DSPA 4D76A 4IS5A 1GMCF 1SB1H 2J98B 2GZ7A 4AYYB 1NRRH 3TJVA 1E37B 5T6GA 3SJ9A 5DPAA 2FDAA 2J98A 5KGOA 1S0RA 5EJ1A 4RKJB 1IOEA 1GHAG 2FI5E 2EEKA 2QXJA 2FO9A 4MLFB 2RDEA 3P95A 1BRUP 4WMEA 3RP2A 4FU7A 3RU4E 4KKDA 1O3AA 2EI7A 5EQRA 1E0FD 3GISB 1C1TA 1CA0B 2H9EH 2FOEA 1G3EA 8LPRA 5H4IB 1BRBE 5AFYH 2W5EA 1W14U 1BMAA 1SGIB 1UTNA 2JIZD 4IBLH 2C8XB 4AG2A 2CHAB 5JBCS 4ZKSU 2EA3A 1HAIH 2VIPA 1GHXH 2VINA 2C8ZB 1GI3A 1O3NA 1J15A 2WV4A 1TA6A 4XBDA 1CHOG 4PROA 3MTYA 3KCGH 4K5ZA 1TOCB 2WINI 2VVUA 2ZFPH 4NA8A 1K1OA 2Z9JA 2VIVA 1BTZA 1P9SA 2O8LA 4DT7B 2Q6DA 3QZRA 1P05A 1Y3VA 1AI8H 2ZHEH 3ZVFA 3M7QA 3MNSA 4X2YA 3Q3KA 4Y11E 3WW7A 3ELAH 3GCHB 3BTME 1PPEE 2FYRA 3CNRA 5FX6A 4LOYH 2V3HH 1BTHH 2W3IA 4RKOB 4NA9H 1BJVA 1RTLA 1W7GH 2BD7A 4OS2A 1C2HA 1T8LA 2QIQA 1O31A 1H9IE 1A5GH 1GI9B 2RCEA 1X7AC 1O3CA 1JRSA 3QUMP 3B8JA 3SUEA 3ZVBA 1P8VC 2EI6A 2VBCA 1EZSC 2XYAA 2VGCC 1ZTLA 1GJBB 5I25A 1XVMA 2F9BH 2D2DA 1EPTC 3FFGA 3TJUA 3KQCA 1H8IH 1V2VT 1BBRH 1IQEA 2KCYA 2QXIA 5FCRA 1A0JA 1GBLA 4Y76A 1RS0A 2QAAA 4GUXA 1XXFA 2P8OB 1GBAA 3A81A 3RXLA 4AC9A 1T8OA 4CR5A 1KIGH 2GT8A 3BN9A 1O2ZA 1MKWH 2FOMB 4THNH 3SNDA 5KECA 2GDEH 1O32A 2G00A 1Q31A 4AFZA 2ZFFH 5EPYA 2Z3EA 1EP6A 2A7HA 2PGQB 4YESB 4OGXA 2FX6A 5GJ4B 2H5DA 2KCOA 3JZ2B 3RXKA 1GI7B 2BOKA 1DWCH 4NIWA 4CRDA 3SV6A 2BD8A 1C1OA 2BLVA 2RFKC 3ZZBA 2R0LA 1C9PA 2BY9X 1GHBF 3UFAA 1F5RA 1PJPA 1SMFE 1GBIA 1MTVA 4GAWA 5DP3A 4ZROA 1HNEE 2HLCA 5C0UA 1G30B 2GGVB 1SLWB 3OU0A 4X6PA 3T2NA 1T32A 1K1NA 1FY8E 3TGJE 4NSVA 2TRMA 4B2AA 1F0RA 3MH6A 4LXBH 2Y82A 1IQMA 1GMDF 4YXWD 1V3XA 3UREA 3M7UA 2JH0D 1C1WH 2XC4A 1CHGA 4A1TA 1UCYE 2HGTH 5F6MA 1Z1JA 1HAVB 1NBMD 2J94A 5ABWA 3UB0A 2GVFA 1F0SA 4Q2KA 4I7YH 1LKAA 3DSGA 3EDXB 2ZIQH 1NFWA 1O5AB 1W10U 3PYHA 2ZU1A 4D7GA 1CA0C 2EQNA 1ZSKA 1KDQB 3HKJB 1GMHG 1NFXA 1V2MT 4CRBA 2UWLA 2Y6TA 1EQ9A 3BTDE 3U8RH 2PTCE 3BTEE 2H1UA 3GY7A 4CHAC 3M7TA 2CHAC 1QB6A 4UE7H 1GJ8B 2K8IA 4Z1MD 1D6RA 1QBOA 2OLGA 1PQ7A 1L4DA 4F55A 5C67A 4AX9H 3HK3B 2LNCA 1AWHB 1RTFB 2OINA 3A86A 4O03A 4YOIA 1IQJA 5E2OA 5C1YA 1EFRD 1UK2A 4MPXA 1YY3A 1AFQB 1XUHA 1HJ8A 1ZRBA 2TGDA 2F9PA 4D9QA 2A5KA 1ARBA 3LJOA 3BEIB 8KME2 3RM0H 3GCHC 2FOGA 1C5UA 3OY5U 3ZZ9A 1A0LA 3RXSA 5C3NA 1HAPH 5EU8A 1MTNB 1ELVA 4CRFA 5DP9A 1HCGA 4E05H 4BXSA 3E6PH 1XKAC 4DOQA 4AB8A 1CE5A 1T31A 6CHAB 4Y6DA 3ZZ7A 2GT7A 2PSYA 1GBEA 1DXPA 2SGAA 1RIWB 2ZTXA 1BTPA 1DWBH 4X1SU 2BD4A 1C5WB 1CBWC 1EZQA 5T6FA 2BVSH 1AGJA
chains in the Genus database with same CATH topology
1P2KA 1EAWA 1H1BA 3KGPA 2BTCE 3VXFH 3BEUA 5HM9A 1O3MA 3GICB 3PLBA 2G5NA 2ESTE 3EE0B 1UTMA 3M3SA 4GLYA 4I8KA 5EOKA 4NGAH 5A8ZA 4GCHG 1V2TT 2BZ6H 2H9TH 3MMGA 4ZH8A 1Y3XA 2A5AA 2XCFA 2ZPRA 1A61H 2W26A 1LPKB 1QL9A 2DE9A 3MU0A 2FI4E 2P16A 4NWLA 3ODDA 3RC5A 5DKMA 5DG6A 2HNTC 1F2SE 4K1EA 1PPCE 2ZO3H 1TBQH 1WOFA 1UMAH 2OP9A 4KP0A 4ZHAA 3RLYH 1TAWA 4Y7BA 1OS8A 4MG3A 4FUHA 2BB4A 1DWDH 4I8LA 1SLUB 1HPGA 3SNCA 4ZKOU 2A32A 4A1XA 1UJ1A 5EW1H 1ELDE 1K9OE 1AZ8A 4X2VA 1DICA 2UUFB 3A7TA 1YPMH 2PFEA 1TRMA 1C2EA 2F91A 3BTFE 3SBKA 4IMZA 3TGKE 3VB5A 1IQIA 1BHXF 2AGEX 3ATMA 2R3UA 4UONA 1H4WA 5EODA 1SGDE 1TMUH 1GI2A 2Z3DA 5GCHF 1UK3A 3AW1A 2HPQH 4LZ4B 3HGNA 1H8DH 5TCAA 1HAGE 2WPJS 1TLDA 1GHYH 2ZI2H 1SGFA 1WV7H 2AMDA 2ZDAH 3DT0H 2TIOA 2A45B 1SHHB 5AVDA 1DY8A 4J2YB 1O2UA 5AF9H 3GCTG 1JIRA 1T4VH 1TBRH 4MPVA 1C5SA 1GCTB 3ZZ5A 4CH2B 1SFQB 4KGAA 3AASA 4ABFA 4XBCA 1AFQC 1ORFA 3EA9A 1HIAB 1TX7A 1L1NA 4NZQA 5F03A 4AORA 3P8FA 3VB4A 4Z0KA 3QTOH 1MCVA 1YC0A 3QWCH 4TYDA 5HM2A 1IQNA 1XXDA 1ZSLA 4ABAA 4B76A 2XTTB 1MTNC 2WPMS 5EXMA 1WQSA 3SUFA 4ABBA 3A7WA 4NIYA 2ZCKP 3NKKA 2RA3A 4X2XA 3SUDA 1WYKA 1Y3UA 1A1RA 3SNBA 2BY7X 2P95A 3KEEA 3NPSA 3DD2H 2FXRA 2ZKSA 1CT4E 1V2ST 1KLTA 2P59A 1YCPK 4RN6A 1GJ4H 2A4RA 1EB2A 3PWBA 1EOLA 4FUJA 4ZKRU 2Y7ZA 6GCHG 3A8BA 1O5GH 5EG4A 2AIPA 5JBAS 2AERH 2WV5A 3P8OA 1SGRE 3AAVA 1WBGB 4DVAU 1FY5A 1LPZB 3T28A 4Y0ZE 2OBQA 3N7OA 3OSYA 3GDSA 3M35A 2OUAA 3RDZA 3FP8E 2R2MB 1ELGA 1NC6A 2XNIA 1Z1IA 2SNVA 4FU9A 1GI5A 3D65E 3GY5A 3AAUA 4FU8A 1K1IA 3UOPA 3LC5A 1O30A 4ISNA 1GBTA 4MDSA 1GJ7B 1GGDB 1HV7A 1NESE 1RRKA 3M61U 5J4SA 4O9VA 3QO6A 2QA9E 1EKBB 1P09A 1LCYA 1THSH 2THFB 2G52A 3F9FA 3K65B 1TGCA 1P3EA 1SSXA 2JKHA 1P12E 5FCKA 1DXWA 3M5MA 1V2OT 2J34A 2FODA 1ETSH 3S69A 3SO3A 4X8TH 1O2XA 4Y0YE 3NWUA 1C4Y2 4JZ1A 2A7CA 1ZR0A 2SNWA 4IN2A 3BIUH 2PTNA 3BIVH 3PMHB 4B2BA 2WYGA 2G51A 1O2YA 3M3VA 1G37A 1BRCE 1RFNA 2F3CE 1G2LA 1OWHA 2AYWA 1YGCH 8ESTE 2BOHB 4IGDA 3K6ZA 4XBBA 4KTUA 3S7HB 4Y8YA 2FS8A 1DANH 2KAIB 1G9IE 1ABJH 1E38B 2HWLB 3MI4A 2KAIA 1HRTH 3EYDA 1ZPBA 1ZZZA 2J95A 3RC4A 2PGBB 1CU1A 5A09A 1ZGVA 3KNXA 1FY3A 1ZLRA 2GDDA 2FLBH 1GI1A 4CBNA 3CP7A 1VGCB 3E91A 4GHTA 1C2LA 4OS5A 3LH1A 1ZHPA 1KXEA 1MTWA 2K1QA 2NU1E 1EPTA 2HNTF 1O2KA 4Z6AH 4LK4A 1HFDA 1GCTC 1GMCG 1MQ5A 1DFPA 1YCPM 4U32A 3P92A 1MTSA 2ZHWH 2FI3E 3EGKH 4U30A 1A4WH 2G55A 4WXVA 4I8JA 1EZXC 3URCA 1AMHA 2OC7A 3CENA 3RXMA 1T8NA 4OS4A 1K1LA 1O3KA 2VVVA 2Y81A 1FZZA 1ESTA 1VCPA 3BTQE 1OYQA 1QL8A 1P2IA 3LH3A 1GBCA 1Y3WA 1NT1A 5FXLA 2PKAA 1EP5A 5C5OA 1SR5C 1O5DH 4ESTE 1QB1A 1BQYA 3EQ0H 3ZZ3A 2ZCHP 1MKXK 3HPTB 4B1TA 5JYIA 4WWYA 4Q7YA 5EQSA 4IC5A 1OXGA 1TOMH 4IN1A 1SBWA 3LONA 4H6TA 3SORA 1IQGA 2YNBA 2SGQE 1CT0E 1L2EA 3VGCC 2SGFE 2QYIA 5ETXA 4NG9H 3U1IB 4AFUA 4OS1A 4OS7A 5EW2H 1A5HA 3RXRA 1SGYE 2FOAA 2BY6X 1IQHA 1ZGIA 1XUFA 1TNGA 2Z9LA 4F4OC 1OWKA 2HNTE 7KMEH 1PPFE 3TIUA 4I32A 3NXPA 5A0BA 3S0NA 1AQ7A 1FPCH 1TRYA 2BLQA 1C9TA 2ZZUH 1S85A 1FXYA 3MO3A 2BDHA 3U8TH 3RXQA 5L2YH 1P03A 1GBJA 1O38A 5F8ZA 1BT7A 1HGTH 1TONA 4K3JA 1P2QA 1DVAH 1EJMA 4BTIB 3KQDA 5JPMH 1BJUA 1AU8A 1PQ5A 8GCHF 4D7FA 2BX4A 4UFFH 2ZDNA 3H7TA 2GZ9A 1A0HB 1JOUB 1ARCA 1C5OH 1ZHRA 5FX5A 5DO4H 1HDTH 3I77A 1W7XH 1QFKH 4H4FA 5E0HA 1O3OA 3SNAA 2FTLE 2SFAA 1V6DA 1GHAF 3MO6A 3UOUA 3ATLA 1FN6A 2ZEBA 4ZXYH 2UUYA 3TLOA 3E0NB 1YF4A 2ZDLA 1C5MD 3PV4A 2WPIS 1QRWA 2FIRH 2O8UA 1HYLA 1BMMH 2OQ5A 2F9NA 4YLUA 1GJ9B 2PWXA 3DFJA 2ZU2A 2XBYA 1LO6A 1SQTA 1AVWA 2ZQ1A 2C93B 4YT6H 1VR1H 4AGKA 1OWIA 1TMBH 1V2LT 2ZDMA 2Z9IA 4I33A 1CHOF 1SOZA 1VGCC 1QL7A 3ESTA 3DUXH 1KXDA 3SU3A 3VB3A 3RXHA 1Z7KA 2OC8A 4E7RG 1C1SA 3A7VA 3BG8A 4YZUA 1JWTA 4U01A 1M9UA 1FAXA 4X6NA 3EA7A 1TX6A 1C1NA 3TH4H 1GJ5H 5HMAA 1C2MA 3LIWA 1MBMA 5TCCA 3GY4A 2ZHFH 1TGBA 3RMLH 1S84A 2OC1A 1QA0A 1NROH 2C3SA 3U1JB 2QV1A 1SLVB 1FN8A 1O3GA 3LOXA 1BTWA 3A82A 2C90B 2YNAA 4XOJA 1GI0A 3BG4B 3P8GA 1KXCA 3LT3A 1HBTH 1SC8U 1BTXA 1TQ7B 1HAXB 3RXDA 1SG8B 3HK6B 1C4V2 2LPRA 3SJ8A 1AN1E 1O2VA 3E1XB 3D62A 4CH8B 1TWXB 3W94A 1YPGH 3FP6E 1ZMJA 3UWIA 2GCTB 1MD7A 2ZFSA 1TPOA 5DP6A 4XDEA 4NZLA 1L1JA 3ZV8A 2W7UA 4BANB 3MWIU 1TA2A 1O3HA 1T4UH 1W3CA 2Y5FA 1BCUH 1B7XB 2TGTA 1A3EH 3M5NA 1ANCA 3MYWA 3SJOA 5CMXH 4B75A 2ILNA 2BXTH 4WJG2 5E0JA 3O8RA 2FX4A 2VH6A 3K2UA 3GCNA 4WH6A 3SJIA 2W7SA 3SV9A 3GY8A 1O2TA 5EPNA 4K60A 1V2PT 1XUGA 4Q7XA 3VB7A 2O8WA 1LVBA 2A2QH 2I6SA 1O2SA 1G2MA 1V2RT 1BBRK 3A87A 1OWDA 2CXVA 1GDQA 2BVXH 1EXFA 3UUZA 2P93A 4MVNA 1ETRH 1XMNB 3LGIA 2ZC9H 1J9CH 1FLEE 4ZHMU 3A80A 4ISOA 5EQQA 4DGJA 2H6MA 4YLQH 5T6DA 1MKWK 3UR6A 5JBBS 1RGQA 5LH8A 1ELFA 3DFLA 1HAYB 1TPSA 1TNJA 1ZTJA 5FPSA 4FUCA 5BPEA 5GDSH 1ANBA 3T26A 4I31A 4MNXA 5A2MH 3HATH 4CRGA 1UVPA 1VITH 3MH5A 5IYTA 3TITA 1W13U 3PM3A 1XX9A 1SFIA 3TPIZ 1DPOA 1O2RA 2ZGHA 3RXPA 1DSUA 3L6PA 4BTTB 1GL1A 3RU4T 2Z3CA 1C1RA 3RXAA 1AVXA 3SQEE 1SGTA 2P8OC 2FWWA 2QC2A 1NRNH 1GHWH 3BSQA 1MTUA 3M37A 2G4TA 2ZWLH 1IQFA 1C1QA 1FY4A 1PFXC 9LPRA 1GG6B 5HXFA 5I46H 5K0HA 3OTJE 1P2JA 4B73A 1ZJKA 1ELBA 2OC0A 3RXOA 3FP7E 3A88A 3GDVA 4UDWH 3RXGA 2AMQA 2GTBA 4A5TS 1U6QA 4NA7A 4MNYA 1D3PB 1LQEA 3DA9B 3AW0A 4YTAA 3OYPA 1YYY1 4BAKB 1BOQA 3K9XB 4JMYA 3PLKA 3L33A 1K1MA 4AZ2B 1C5QA 4X8VH 5GCHG 2DUCA 3E16B 1DSTA 1ZMLA 2SGEE 1AO5A 4INLA 2JH6D 2ZNKH 2PUQH 2XC0A 1D3TB 4Y8XA 3RXBA 2D1JA 4XFQA 3T5FH 4AYVB 3BG4C 3V3MA 2ODQA 3A8CA 4E7NA 2ZGBH 1OX1A 1P10A 4FUBA 1SGQE 4H6SB 2BY5X 2FS9A 1ELEE 1L4ZA 3SGBE 4AFSA 3BTTE 1F5KU 2Z7FE 3RC6A 1SGEE 2Y5GA 1P04A 1HXFH 1UK4A 1JMOH 1F7ZA 1NO9H 2BDGA 1EASA 3UPEA 2OBOA 2ULLA 5A8YA 4NIVA 1QURH 2FLRH 2VIWA 4GCHF 1LVOA 4ZUHA 1PPBH 1UVTH 1SGCA 4KELA 1EB1H 4X1NU 1F5LA 1P3CA 3TNTA 2J92A 3ITIA 1LHEH 4BAHB 1DLEA 4A1VA 1MZAA 1OYTH 4IMQA 1TB6H 2G4UA 1NS3A 1ZJDA 2G81E 3F9HA 2GMTB 5ESBA 3PLPA 2IJOB 3ZZAA 1C5XB 1LPGB 2BY8X 1E35B 1VITF 2FP7B 2EI8A 2UWPA 1AKSA 1YP9A 1BA8B 1QJ6B 2FOFA 1LKBA 3EAJA 3SU6A 2ZGJA 4UD9H 3IG6B 4WVPE 4X1PU 1VJAU 5DGJA 4DG4A 2GCHG 4RSPA 1WSSH 1O5CB 2VJ1A 3SGQE 3C27B 3P8NA 1SQOA 2A4OA 1FJSA 4FXGH 4NFFA 3ZYDA 1GI4A 1MMJN 2ZU3A 2XC5A 1XVOA 1Y5BT 2FOCA 2IPHA 1TPAE 1Q3XA 3O8DA 3FAOA 3S9AA 3M5LA 4DCDA 2R9PA 6CHAC 3B23B 2UUKB 4YM9A 1ESAA 3RXIA 4AFQA 1J14A 1KLIH 1RIWC 1QB9A 6LPRA 1S81A 1T7CA 2XWAA 1AVGH 3O8BA 2TGPZ 5C1UA 3CS0A 3K6YA 1CGHA 2O8TA 1C4U2 2R2WU 5E8EH 1B5GH 2V35A 1N1LA 3GCTF 3LKWA 5C5NA 3TK5A 1P02A 1FV9A 2ANWA 2W3KA 3Q3XA 3MHWU 1FIZA 5EGMA 1A7SA 5FPYA 2ASUB 2CV3A 5C2ZA 1AD8H 2GV7A 1A46H 1V2JT 4O97A 5EXNA 2YOLA 2ZHQH 4AOQA 4IW4E 1GG6C 3E3TA 3NCLA 3ZV9A 4F49A 1DX5M 3T62A 2NU0E 2NU4E 1CO7E 1GVZA 4CR9A 2OTVA 1TNKA 3QLPH 3ZZ8A 2J9NA 1YPJH 1XUJA 3GYLB 2ZTZA 1G3BA 4X8UH 4CBOA 1TGNA 2WPKS 1J8AA 4OGYA 3PO1B 5FHTA 4JZIA 5K7RA 2PLXA 2ZP0H 1PYTD 2ZF0H 3KQBA 3CS7A 3SZNA 3S9CA 1NM6A 2BD3A 1C1VH 2ZU4A 5L6NH 1EJNA 4INHA 1FUJA 1KXFA 2BX3A 3MNCA 5B6OA 6GCHF 1ZOMA 4J1YA 4CREA 3SW2B 2Q6FA 3RXTA 4MQAA 2XRCA 2NWNA 1MZDA 3KIDU 1KYNA 1KSNA 4TY6A 4Y7AA 4I8GA 4Y10E 1BMNH 5L30H 7GCHG 3Q76A 3LGTA 1AUJA 2VIOA 3QGJA 3QTVH 3Q00A 2VU8E 2OD3B 3DHKH 1FPHH 2HRVA 2Y80A 3F1SB 3HKIB 2P3UB 1WAYB 1SGPE 1Z8JB 1FDPA 1GWAA 1HB0B 1O33A 1O2OA 2J4IA 1NFUA 1YPEH 3UTUH 3FANA 1NRQH 2FESH 1SGNE 4FVDA 1TNIA 1YPHC 4UFEH 3AVZA 1A3BH 1Z8IB 3GDUA 2AIQA 4ABGA 3PMJA 1P06A 3UIRA 2CN0H 1HAHH 1DUAA 1RTKA 1UVOA 1YPKH 1EPTB 2DE8A 3A7XA 1VCWA 2GMTC 3GOVB 5DP7A 3GCOA 1BB0B 1YLCA 3KHVA 4BOHA 1EOJA 2Z9GA 1QGFA 5HYOA 2AFQB 1A2CH 1FONA 2ZA5A 1EZUC 3QN7A 4X2WA 1GBDA 1P9UA 3PROA 1V2QT 1GJDB 4MTBA 2BDAA 2BYAX 2FPZA 1ETTH 5G4BA 3UQOA 2Q1JA 3RMNH 2G5VA 3BV9B 1C1MA 3LGVA 3SU1A 1CGJE 3A8AA 1OPHB 3ATIA 2QXGA 2WPHS 3IITA 1NZQH 3QZQA 1SQAA 2RDLA 4K8BA 5JB9S 1ZYOA 2VWNA 4GPGA 4JCNA 1DS2E 3SU5A 2XW9A 4O3TA 2PKAB 4H42U 3ZVDA 1DE7H 1UHBB 4JK6A 5JB8S 2GP9B 1F0TA 1DT2A 5ESTE 1UHBA 2ZFTA 1QBVH 1GHZA 1Q2WA 3U9AH 4AGJA 1QTFA 5JBTA 2HVXA 3UNRA 1OP8A 3VFEA 3GY6A 5DK1A 3TNSA 2QXHA 3LDXH 4UFDH 1W2KH 1AB9B 2P94A 3SNEA 1HJ9A 5F8XA 2PV9B 2ZFRH 2V0BA 2PKSB 1VJ9U 3VEQB 1GJAB 8GCHG 1MAYA 2VB0A