1GJ7B

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 50
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj7B01
1H1BA 2Y7ZA 5A8ZA 2BM2A 3B9FH 3SJOA 3S9CA 1EXFA 1C5LH 3O8BA 1KDQA 1YLDA 1HIAA 1TYNA 2FI3E 1BMAA 4FVBA 1IHSH 4IBLH 1RFNA 1UTLM 4DIIH 2ZGHA 1O5BB 4Y6DA 2WPHS 3T62A 5I46H 3VB7A 1SI5H 3HKIB 1F0SA 2Y82A 2Y5HA 1NC6A 4NWKA 3SU0A 1ZTJA 4WWYA 4R0IA 5EW1H 1YPHE 1OWKA 1XUHA 1NY22 4K1TA 2BHGA 1SLUB 1QGFA 1FY5A 1YPGH 2BYAX 2PLXA 3IITA 1NZQH 1YF4A 5CE1A 3L33A 1OSSA 3M5NA 4JK6A 1IQGA 1C1SA 1LCYA 1BDAA 5JB8S 1O2HA 4MNWA 3A7XA 3BTGE 2OXSA 2VINA 4AGJA 3E3TA 3NWUA 3PROA 1O5CB 3UWJH 1HJAB 1DWCH 1GJ7B 2ESTE 5DP8A 1TPPA 1O2UA 1SGEE 5DP4A 1TPOA 5BRRE 1H8IH 1TX8A 3OU0A 2VIQA 1P02A 1E36B 4BAQB 1P09A 3LGVA 5E2PA 1EB1H 2BDGA 1MMJN 4KKDA 2Z9JA 4FUEA 2ILNA 1GHAF 1C5SA 5GIBA 3F9EA 2ASUB 4X1RU 3U69H 3PMBB 1SL3A 1AZZA 1A3BH 2XTTB 1V6DA 3LOXA 3OTJE 4MVNA 2FEQH 1TRYA 1U6QA 1OWEA 1PPHE 1CGIE 3ESTA 1A0LA 2H6MA 1MKXH 1ESAA 1ELTA 3KF2A 7KMEH 3NKKA 1FAKH 4MDSA 4YESB 2Z6BD 4DOQA 1ZHRA 2AMPA 3ZZAA 3JZ1B 1AZ8A 1BITA 3GCHC 7GCHG 3K9XB 1TNHA 1YGCH 3BG4B 2P16A 3LGYA 4JYTA 5JPMH 2ZU2A 3TJUA 4MPUA 2WPKS 4NIVA 1G32B 1O2VA 3QTOH 1KXAA 1V2QT 1ZMNA 3UR9A 1GMHG 1YYY1 1MCVA 1UK3A 4BAOB 1A5GH 8GCHG 2OC0A 1C5MD 3A85A 1J17T 1FY1A 1JMOH 1P2OA 3NCLA 1FAXA 3GYMA 3UNSA 1YPKH 4AFQA 1UO6A 2FODA 2VVUA 2WYGA 4Y8XA 5IDKA 2FO9A 2G81E 3PTBA 3UFAA 2BB4A 1AHTH 2A7HA 2CJIA 2XWAA 4MPVA 1OYQA 1AVXA 1MZDA 3BTKE 5ABWA 2AIPA 1O30A 1A0JA 5F03A 2A5AA 2ZDLA 5HGGA 3ODDA 3F68H 5C1XA 3UREA 1L4ZA 1BRUP 3SV7A 2FOFA 2ZCKP 4O03A 1GCDA 1NS3A 2XW9A 1QCPA 2ODPA 5DG6A 3RXKA 4BAKB 5SGAE 3RXCA 1GBIA 3P70B 3RLWH 2B7DH 1P05A 1C1UH 4ZHAA 3DUXH 2YOLA 1BJUA 1C9PA 1MBMA 1LPZB 2VH6A 3PLKA 1E38B 2PTCE 2B9LA 4K1SA 3U1JB 5E2OA 4Z0KA 3LH3A 4IMQA 2JKHA 3SNDA 4VGCC 1Y5UT 1GI2A 1OX1A 4I32A 1AFQB 2WV5A 2Z3CA 1F5KU 2BD5A 5HXFA 1FUJA 2QA9E 3AW0A 4SGBE 8LPRA 4E7RG 3CENA 1E34B 3NZIA 1BTZA 1O2QA 1EB2A 1H4WA 5E0JA 1ESTA 1MBQA 2I6QA 3FFGA 1NFXA 1SGNE 1VJAU 2PR3A 1AU8A 1GI1A 1P01A 2FOBA 5FPYA 4U01A 3P6ZB 3T26A 1ZMLA 2CF9H 3QO6A 3RMMH 1FY4A 2PKAB 1ZSKA 4Z6AH 1QTFA 3F9HA 2ZFTA 5HM2A 3P8GA 1LPGB 1SGDE 4YOIA 1C4V2 2ZHWH 2PHBA 3E91A 4UFFH 1NESE 2G5NA 2Z94A 4SGAE 3KGPA 3MYWA 3SJKA 3ZV9A 1GHYH 4GVUA 1O3AA 2D1JA 1VITF 1GMDG 1GMCF 5BPEA 2J9NA 1P0SH 1SC8U 2A4OA 2JETC 3SU2A 1ID5H 1GI7B 1TNJA 1DXWA 4B2AA 1C1RA 1C4Y2 1GHAG 1EJNA 1YP9A 3KIDU 3GOVB 2VWNA 3M36A 3QN7A 4MLFB 2FXRA 2C4FH 2BLOA 4Y76A 5HYOA 1MTUA 2BDYA 5C1UA 1RGQA 2FPZA 3ZZBA 4TY7A 3A7YA 2C8XB 4Q2KA 1AD8H 1C5QA 3RXHA 2GZ8A 3M5OA 2A4GA 4ZAEA 1H8DH 3EYDA 3U9AH 1BRBE 3B8JA 3HGNA 1ZHMA 1OPHB 3ATLA 1DANH 2FOMB 1EZUC 1C5TA 2QC2A 1S6HA 2GZ9A 2VIPA 1S82A 3FZZA 1FPHH 2G51A 2SGPE 1ANBA 3KQCA 1V2ST 1XUKA 4X6NA 3SV8A 3GY8A 1G3CA 2SGEE 1C5NH 4WY3A 1YM0A 2GTBA 1BHXB 1WQSA 1AY6H 1NRNH 3BV9B 5AHGH 1JRTA 1HAIH 1GDQA 3SI3H 1J14A 3E0PB 2A7JA 1O2WA 3UY9A 2A7CA 2O8LA 1C2HA 1ABJH 3AASA 4QT8C 3R0FA 1YPHC 3LJJA 1Z71A 3I77A 2IPHA 3STIA 3MNCA 4D7FA 1AE5A 1SGTA 2UWOA 2SGFE 3LGUA 3KN2A 3R3GB 1O31A 3VGCC 2BXTH 1Z7KA 3ZVDA 1YPLH 3MWIU 4JZEH 1Z8RA 4B74A 5T6FA 1QR3E 4CREA 4X2VA 1N8OB 1UVSH 1ZSLA 2CHAC 3MHWU 1QL9A 3WY8A 3GCOA 2BY9X 3RXUA 1G2LA 3ZZDA 1TPAE 1MD8A 4XOJA 3T2NA 1SGIB 1ELVA 3QGJA 1O2NA 2A4QA 3MFJA 3LONA 1IHTH 1VR1H 2UWLA 2BQWB 2OCVB 2VVVA 1O3NA 2BVRH 4ZXXH 4WH8A 2SFAA 1CQQA 1P2QA 2O8UA 1QURH 3NK8A 3MO6A 1SGFA 3UPEA 1ZMJA 5DP6A 3HATH 1MAYA 1EX3A 3A88A 2J92A 3RUOA 5FCRA 2Q6DA 3BTEE 5GWZA 1UHBB 4B1TA 1WU1A 1ZTLA 2W26A 1SGCA 1TWXB 2V6NA 2OINA 1HAVB 1K1NA 1TBRH 1Z8IB 4UONA 2ZZUH 1LQDB 1XXDA 2ZDVH 1BMNH 3TH2H 1TB6H 2HNTE 3D65E 2A1DB 1Z8GA 3EGKH 1GVZA 4X2WA 1CU1A 4KTCA 1MUEB 4DURA 3TITA 1QY6A 5DP9A 1V2PT 2UUJB 1L4DA 1UMAH 1AVGH 1EAUA 4ZUHA 1V2TT 2ZPQA 3P8NA 1TMTH 1PPCE 3I78A 1GI5A 1VCQA 3M3TA 1B0FA 3SUEA 1ZLRA 1O5EH 1KTSB 2H9HA 3M7QA 1QBNA 1F5RA 2CF8H 1LHGH 1CVWH 4Q7XA 4X1QU 2TGTA 3B23B 1DY9A 4NFFA 3CP7A 1FZZA 1PQ7A 4B71A 2GKVE 2ZWLH 1G3EA 1W14U 3TIUA 3U1IB 4GLYA 3ZVEA 1O2RA 4X1PU 2GV6A 2HGTH 1C1PA 4AFUA 2BLQA 1IQHA 1GBJA 2FWWA 3U8TH 5LPFA 2H5DA 3TK5A 5DK1A 1TRNA 2OTVA 1J9CH 2BVXH 3RXGA 4ZKNU 1FONA 3VXEH 2CGAA 4NGAH 4NCYA 4O9VA 1QHRB 4Q7ZA 1P9UA 2A2QH 1KLJH 2FOCA 1C1VH 1SVPA 2V35A 2VIVA 1ZJDA 1AE8H 3W94A 4AZ2B 5L2YH 2BXUH 1Q31A 3P17H 3SI4H 2R0LA 2AGEX 3P8OA 3UR6A 1N6YA 1XVOA 2XNIA 5E0GA 5A8XA 1NU9A 2AFQB 1ZTKA 1C2IA 5TCAA 5L6NH 2QAAA 2FESH 1JIRA 2FM2A 1C2EA 1C5XB 1KIGH 5EXNA 2YNBA 3GCHB 3KCGH 1QB9A 2ZEBA 2SGDE 4AYYB 4YLQH 3MU0A 8GCHF 1ANDA 1YPJH 4DCDA 2Y5GA 3A7TA 2BTCE 4I8LA 1CA8B 4TWYA 3A7VA 3QWCH 2GP9B 1V2KT 2G5VA 2ZFPH 3LDXH 4MPWA 3E6PH 1WV7H 5HM9A 2BD2A 3F1SB 2FYRA 1GWAA 2FTMA 1ZPZA 3Q77A 5JBTA 2PKAA 3TU7H 3RXFA 2V3OH 1ZJKA 2CXVA 3JZ2B 2ZF0H 3SUGA 5GJ4B 4X6OA 2CN0H 4NA7A 2AH4X 2LPRA 3GYLB 2Q6FA 3EDXB 1Y8TA 1SLXB 4Y8YA 2ZA5A 3SZNA 1AB9C 1O36A 2BY8X 1A5HA 1P2NA 4LZ4B 1YC0A 3ZZ7A 4B2CA 1GDNA 4NIYA 1TOMH 2ANYA 2P93A 1SQTA 1O3PB 1GVKB 3H7OA 1GPZA 2GX4A 1C1TA 2FOEA 3STJA 1UK4A 1O5DH 1O37A 4ZXYH 5C3NA 1SBWA 3CS7A 3SBKA 1BBRK 1W11U 4D9QA 4TYDA 1LO6A 2D2DA 3VB6A 2F9NA 1V2OT 1BMMH 4F49A 1GHXH 3TK9A 1CGJE 5E0HA 5DP5A 2GDEH 1BCUH 1M9UA 8KME2 1PPEE 4CBNA 4IC6A 3ATMA 1LPKB 3S9AA 3U8OH 4ISOA 1MQ5A 4VGCB 4FU8A 4CRCA 2A0QB 4B73A 1GCTC 1WCZA 1RTKA 1UK2A 2P3TB 1DOJA 1K21H 1V2JT 2OBQA 1SMFE 3TGIE 1W0ZU 2PUQH 5A0AE 2AERH 2QXIA 2NU0E 4ZROA 5FX5A 1CGHA 3PM3A 1NPMA 2Z9GA 3RXSA 1SOZA 4YT6H 1JIMA 1VZQH 1GHWH 1LDTT 1F0RA 1GMDF 4MTBA 2QF0A 1VJ9U 2H1UA 2ZPSA 1O2JA 4F4OC 1D4PB 2HPQH 2BVSH 2K1QA 1TGCA 2AGIX 3ZYDA 1QJ1B 3IWMA 1P57B 1MTSA 1Y3VA 4BXWA 1MTNC 1S5SA 3RXQA 2ZIQH 4ABJA 3SW2B 3M7UA 5EXLA 2JETB 3M5LA 1ARBA 3RC5A 1GI4A 5EGMA 1EQ9A 1FPCH 1RXPA 1WAYB 2ZNKH 1Y5AT 1UVPA 5EPYA 4WF8A 1S83A 2J95A 1ANEA 1DWBH 5CHAC 2PUXB 4Q80A 3VFEA 2VH0A 2R0KA 3A80A 7ESTE 1CHGA 1Q3XA 4Y0ZE 2AIQA 3MNSA 2NU3E 1DS2E 3LU9B 3GY3A 1QA7A 3HK3B 1BTXA 3A86A 4CHAC 2P3FH 3A83A 4YOGA 2A5IA 3UWIA 1NRPH 1Y3YA 1O3EA 4INHA 2F9BH 3GY4A 4CH8B 4GAWA 1O3HA 2OC1A 3TJOA 3BIUH 1V2LT 1T8OA 1W8BH 4UFGH 3U8RH 2FOGA 2QY0B 3LGWA 3RXOA 3SQEE 1C5ZB 1MU6B 1EOJA 3V0XA 1WSSH 2STBE 1HCGA 4ABHA 1HAVA 1MTVA 3D23A 1DLKB 3PB1E 1V2NT 1A2CH 1EAIA 1O3IA 4IS5A 3F6UH 2Y7XA 3V3MA 3MH7A 1EAWA 4FUFA 3RXIA 1D6WA 3KQEA 2GZ7A 3P95A 2TGDA 1J16A 1P12E 3RP2A 4WMFA 3O8DA 4MNYA 3RC4A 1QNJA 2EI7A 1AMHA 3EA8A 4OS6A 2CMYA 2UUYA 3LC3A 2VGCC 1D3TB 1XUFA 4UEHH 2XYAA 3MU1A 1GJ4H 2AGGX 1EPTC 4BAHB 2VIDA 4YZUA 2BOKA 1C2JA 1W2KH 2BDBA 1OP2A 1UVUH 4WMEA 1BBRH 1DDJA 1B5GH 3VGCB 3GDVA 2GMTC 5AF9H 4K1EA 2ZECA 4NFEA 1MH0A 5FXLA 5A0CA 1P3CA 3C1KA 3ZVAA 4BXSA 5F6MA 2BD4A 2FLRH 1NFYA 1BTHH 2PGQB 2CHAB 9ESTA 1VITH 2B0FA 1PPBH 1B7XB 1F7ZA 1DWEH 1FIWA 3FP7E 3L3TA 1ACBE 1ELEE 2CV3A 2QV1A 3LC5A 5C5NA 1PFXC 2ZFFH 1GGDC 4DIHH 2P94A 1F2SE 2Y5FA 3RM2H 1DT2A 1GJAB 1HDTH 2ZHQH 1EAXA 1XKBC 3K2UA 3ZVFA 1T8LA 1T7CA 1FI8A 3RMNH 1THSH 1HAOH 1O2GH 1NFUA 2A31A 3BTDE 3RXBA 1GHBG 1NRSH 4GCHG 1DSUA 4ZKOU 1FV9A 2Q6GA 1C5PA 3ZV8A 3DFJA 3NPSA 1C2MA 1FY3A 1TE0A 1HAZB 2DUCA 4YLUA 4BAMB 4YT7H 1SPJA 5GPIB 3TGJE 3H5CB 1KY9A 2OD3B 3OYPA 3PYHA 5LPRA 1GL0E 2ZGXH 2BDHA 1A7SA 2XCFA 4FU7A 1P03A 1C5UA 1QB6A 4FUGA 4JMYA 1KXFA 2H9TH 5PTPA 2ZP0H 4BTUB 2QXJA 3BTQE 2QN5T 2P95A 3T25A 3UOUA 2VU8E 1KXCA 2P3UB 4OS5A 3RU4E 1Z8JB 3UQVA 4DW2U 1EJAA 3QZRA 1C2KA 2BOHB 3A87A 2G8TA 1GJ6A 2ZI2H 4GHTA 1GI8B 3KQDA 1SQOA 2W5EA 4YM9A 1EZXC 2EA3A 3PMAB 1SQAA 1WYKA 5K7RA 4D9RA 4ISHH 4AB8A 4X1SU 1HJ9A 3P8FA 1K1JA 2FX4A 3LKWA 1GBFA 1ETSH 1AKSA 2THFB 3RMLH 3SHAH 1AIXH 1NRRH 1OS8A 4TY6A 1DVAH 1CSOE 1G30B 3I29A 2FTLE 4A7IB 1O5GH 2G55A 1JXPA 1T4UH 4XDEA 5DJ7A 1D9IA 1HIAB 3BIVH 2ZDKA 1G2MA 3DD2H 1QRWA 4Y10E 4KGAA 1BJVA 1J15A 2TGPZ 3KHVA 1O38A 1MTWA 2XBYA 1O3LA 5EW2H 3PO1B 1CT4E 1NROH 2V0BA 3M35A 1AGJA 1YBWA 1MAXA 3GCTG 1A61H 2A5KA 1O3MA 2QYIA 1LTOA 5GXPA 1O3KA 2SNVA 1FY8E 3BG8A 1GBBA 3RXMA 1DWDH 3RXDA 3A8CA 3VB3A 1O33A 1QIXB 2GT8A 5F8XA 1AWFH 2XCNA 1C1QA 1ZPCA 1OOKB 4FUJA 2ZPRA 3TH3H 1HJ8A 1GL1A 1UVOA 4FU9A 5A8YA 4IMZA 3SU1A 1O2YA 4CRBA 1HGTH 5JBAS 4H6TA 2F3CE 3LJOA 1DM4B 4WXVA 4M7GA 1EP6A 1YPEH 4H4FA 4CR5A 5FPSA 4FXGH 1L0ZA 1K1MA 2V3HH 3FP6E 2BDAA 1W7GH 1IQJA 4D7GA 4WH6A 1FQ3A 2OQUA 1BOQA 1CE5A 4NZQA 3M5MA 1BT7A 2F9PA 1AUJA 1J8AA 2F9UA 1IQNA 3OY5U 3KL6A 1QJ7B 1C9TA 4ESTE 1TNIA 2ANMH 1KYNA 1NN6A 4A6LA 3QK1A 4O3TA 4OS7A 2W7UA 1GBKA 4BANB 1ELAA 1DE7H 3MTYA 3EAJA 4UD9H 6GCHG 1ZRKA 4AYVB 1RS0A 1JOUB 5H4IB 1HBTH 1UTNA 2OQ5A 1QA0A 2BMGB 4I8GA 3U98H 1AN1E 4ZMAH 1OWJA 1TNGA 2W3KA 3BSQA 1W12U 3E16B 3LPRA 4O97A 5L2ZH 2AMQA 1SHYA 3T28A 3SOSA 4WXIA 4XFQA 4JZIA 4NIXA 1YCPK 3S7KB 3MO3A 3SJ8A 5JBCS 1TQ7B 1O3GA 1ZHPA 2ODQA 4LZ1H 2AEIH 3HGPA 3KEEA 3QX5H 1AB9B 1SR5C 1ZGVA 2PFEA 3FP8E 4ASHA 2ZO3H 2OC8A 3A7WA 2QXGA 5AFYH 1O2XA 2A45B 4U30A 3ZZ9A 1CHOF 2ZHEH 1HYLA 4KP0A 2BX4A 3SU6A 1QB1A 3ZZ3A 3ODFA 3SHCH 2ZC9H 5B6OA 1UTJA 1MD7A 1IQKA 1HAYB 3M7TA 4E7NA 4TPIZ 3SNCA 4X6PA 1FN8A 1GJ5H 1K28D 5GCHG 2QF3A 3EA7A 4K8BA 1MU8B 2Z3EA 1N6XA 4TWWA 1GBDA 4THNH 1CT0E 1DXPA 2FP7B 3MI4A 1ELBA 1S81A 3BTWE 3D62A 3RXPA 4GSOA 1P06A 1W13U 1DUAA 1WUNH 4HFPB 1BRCE 2BLWA 2D8WA 2JH6D 5FBEA 1GCTB 5AVDA 1HFDA 2ZTXA 2FLBH 5F8TA 1DITH 1ZYOA 2PGBB 3RXVA 4ABGA 4OGXA 4ISLA 4CBOA 2A32A 4X8TH 3DFLA 1TONA 1PQAA 1ZZZA 1TAWA 2GV7A 2ZHFH 1RTLA 4X6MA 3GISB 2BY5X 1PPFE 1FNIA 1ELGA 3OX7U 1O3FA 1SGFG 3PO1C 1L1JA 3DT0H 1GG6C 5A2MH 6CHAC 2D26C 4GUXA 1FMGA 2ZFQH 3SU5A 2ZGJA 2Y6TA 2BZAA 3BTTE 1XM1A 1F0TA 1XUJA 1CBWB 1RRKA 2ALPA 2J4IA 4IC5A 4RKOB 5TCCA 4CH2B 1KSNA 2VVCA 1A46H 4ISNA 3AVZA 1BTWA 1MTNB 1TIOA 2PKSC 2QXHA 2R3UA 8ESTE 1P04A 3SGBE 1Y3WA 4K2YA 1SLVB 3IG6B 1TLDA 1H9LB 4WJG2 4K8YA 1W3CA 3BTHE 3VB5A 1X7AC 1V2RT 2R9PA 5EQSA 1NO9H 1GJDB 4BTTB 1G3BA 4CR9A 4HI3A 3ZVBA 3Q00A 1DSTA 4OS1A 1DUEA 5CHAB 3SGAE 1F92A 2ZQ1A 1TGNA 1JWTA 1QBOA 1BBRE 4HGCA 4X0WU 5J4SA 3TH4H 1V2UT 3ZZ6A 3E0NB 4CHAB 2ZTYA 5FPTA 2EEKA 6LPRA 1S0QA 2PWXA 3GY2A 1TA6A 4HZHA 1FLEE 2WPLS 2VB0A 1KLTA 1AWHB 2TRMA 3A89A 3RU4T 4B76A 3MU4A 2GDDA 4INLA 2ZU1A 2HWLB 3AW1A 5C20A 2GD4B 4MPXA 1YCPM 2OC7A 3FANA 1G3DA 4AFSA 2GVFA 2AMDA 5C1YA 3HK6B 2BQ7B 2J38A 1TFXA 4UDWH 1G37A 1OWHA 4A1XA 1V2WT 1L2EA 3UIRA 4U32A 4CRDA 1Z6JH 3ENSB 1DFPA 2RA0A 2HVXA 3NXPA 3PLBA 1GI6A 1YCPH 3O8RA 4IW4E 2WINI 1TGSZ 3D49H 1KLIH 1O2OA 1O5AB 2PV9B 2Y80A 1PYTD 1EZQA 3TNSA 2ZFSA 2O8MA 4K60A 1INCA 1S6FA 3VPKA 2ALVA 4XBCA 2VGCB 2VIWA 3C27B 3A8AA 1EPTB 3VB4A 3ZYEA 5A09A 1EUFA 3UUZA 1BQYA 2P8OB 3S9BA 2FOAA 1HAGE 1UTOA 1CA0B 2PW8H 2GMTB 1T4VH 2QIQA 3H7TA 3ZZ8A 4CRGA 2BD3A 4UE7H 3BEUA 1TGBA 3EA9A 1CHOG 3SU3A 1AUTC 1KXDA 1P3EA 2XC0A 2STAE 2OP9A 3ITIA 4JZDH 5CMXH 1VGCC 3AAVA 2WPMS 2XBXA 3TLOA 3SNBA 1RJXB 4GHQA 1O34A 3DHKH 1ELCA 2BZ6H 2TBSA 1P9SA 1GHBF 1UCYK 4GCHF 3SUFA 1GGDB 1VCWA 3UTUH 1IQEA 1OWDA 1Y59T 2BLVA 1SOTA 1TNLA 1C2DA 1IQFA 1ABIH 3UQOA 1MKWK 3MO9A 2FS9A 1NT1A 1WTGH 1ZR0A 2HRVA 2ULLA 1O2MA 3CS0A 4X2YA 5DGJA 1YLCA 1XKAC 2OBOA 4JK5A 2C8WB 1ANCA 1O3BA 1WOFA 1BTUA 2PTNA 1SFQB 5A0BA 2FIRH 1A1RA 4Y11E 1O2TA 2GCTB 2ZU5A 3E8LA 4DGJA 1GBLA 2JH0D 1SGYE 1Y3XA 1CBWC 2O8WA 2ZGCA 3QLPH 2F9VA 2QGRA 1LVMA 3FAOA 1HPGA 1GBCA 1C5VA 1P8VC 2Z7FE 5E8EH 1TBQH 1CT2E 4I31A 2F9OA 1PQ8A 5EOKA 5EG4A 5JB9S 2BDIA 3Q3KA 5FX6A 4DJZB 2VIOA 1O39A 4RSPA 1ETRH 1P2IA 1XVMA 4KELA 5FHTA 2FZZA 3MH4A 5DPAA 1HAHH 3LH1A 4Y7AA 1GVLA 3URCA 2HLCA 4JZ1A 1S84A 4ZHMU 1RIWC 1C5YB 4Y71A 3SJIA 3LT3A 3T27A 2XC5A 4FVDA 2A4RA 4NIWA 1SSXA 4FUIA 3RM0H 5IYTA 3Q76A 3A82A 1TBZH 1K22H 1THPB 1K1OA 3HPTB 4YOJA 4J1YA 3VXFH 1XUIA 2FI4E 1F0UA 1KXBA 1T8NA 2WV4A 3GCTF 1LHCH 5EQQA 1C2LA 3SN8A 2IOTA 1O2SA 4WVPE 1DY8A 4TPYA 3RXEA 2F91A 3TJVA 1LHDH 3EE0B 5DKMA 1G36A 1GBEA 1XX9A 4HTCH 1H9IE 3TJNA 4Y8ZA 4ABAA 9LPRA 1UHBA 1O2KA 2DE9A 3S0NA 3RDZA 4A1VA 2ANWA 4AN7A 1DICA 2ZCLP 4XBBA 3PV4A 4FUDA 1GDUA 2HNTC 1E37B 3MNXA 4MG3A 1BMLA 1D3QB 2BQ6B 2C90B 4E06H 2OUAA 4ZH8A 1IOEA 2ZHDA 1V3XA 2FOHA 2HNTF 3M61U 1SG8B 4KTUA 1EJMA 5DP7A 4D8NA 1NFWA 4XE4A 4ZHLU 1GJ8B 1QRZA 1AQ7A 2J94A 4K5ZA 2I6SA 4AFZA 1ZRBA 3SV9A 2FYQA 1QQ4A 1DX5M 1QL8A 2G00A 4LXBH 2W7SA 1GJCB 1ZOMA 3KNXA 4BTIB 1NU7B 4IN1A 3UOPA 4AX9H 1GI0A 1B0EA 4E05H 1E35B 1GBMA 4H42U 4ISIH 5I25A 1W7XH 2ZU3A 1A0HB 4NZLA 3RXRA 4CRFA 2P8OC 5LPEA 1PYTC 1TMUH 5G4BA 1CA0C 2F83A 3LIWA 6GCHF 1NRQH 3TNTA 2J34A 1LQEA 1LMWB 1TOCB 1Z1JA 1TGTA 1SFIA 5J4QA 1QBVH 4B75A 2B8OH 1O3CA 2W3IA 4I8KA 1D3PB 1LVYA 3MH6A 2RCEA 1S0RA 5FBIA 2Y81A 1UJ1A 1XMNB 2ZCHP 1UCYH 1UTQA 1OP8A 1FN6A 1LVOA 2WPIS 3SORA 3A8DA 4X8UH 1K9OE 2FDAA 1OYTH 1WBGB 1MKWH 4JCNA 3BF6H 4JYUH 4ABFA 5GDSH 1TA2A 3RXLA 1E0FD 4NA9H 4BNRA 1QL7A 1YKTA 4NSVA 2EC9H 1HAPH 2YNAA 2BD8A 3UNRA 3FVFB 2NU1E 3ATWA 5AFZH 5EODA 1W0YH 5L30H 5T6GA 1W10U 3MH5A 2GCTC 1IAUA 1JBUH 2FI5E 2VWMA 1LKAA 2EI6A 2UWPA 3GICB 1UTPA 2XRCA 4O3UA 1ZSJA 5GCHF 1HJAC 3K6YA 1RTFB 1TPSA 3GDUA 2ZFRH 1V2VT 4AB9A 5K0HA 2UUKB 1L1NA 2TGAA 3ZZ5A 2KAIB 3PWCA 1Z6EA 1DLEA 3ATKA 4Y0YE 1PQ5A 1LHFH 1C5OH 1FIZA 2TIOA 3PTNA 1QJ6B 1OP0A 3MNBA 3OSYA 3PMHB 1LKBA 2RG3A 1T31A 4A1TA 5T6DA 1P2KA 3BEFB 3SUDA 2P59A 3MU8A 4JYVH 4K3JA 5FCKA 3V13A 1GI9B 4ZKSU 1O5FH 4A5TS 2WUCA 2GT7A 2R3YA 1MZAA 2M5TA 1TX7A 1KDQB 2ZDNA 4KTSA 1BA8B 3SNAA 2GGVB 3PMJA 4R8TB 4I8HA 3T29A 4NWLA 3F9GA 1C1MA 1O32A 4X8SH 1NM6A 2C8ZB 3BEIB 4XBDA 4RKJB 5EPNA 4UFEH 3BG4C 1C5WB 2ANKH 2C3SA 1GG6B 3F9FA 3MU5A 4ZKRU 1ARCA 3SJ9A 6CHAB 4I7YH 1N1LA 3O8CA 1A4WH 1EZSC 4WMDA 4MNVA 4UFDH 3A8BA 4ABEA 1EPTA 1HAXB 3Q3XA 1GI3A 5C2ZA 3A7ZA 3SQHE 1O0DH 2PKSB 2ZKSA 1AO5A 1P2JA 1AFEH 1IQIA 1SB1H 1XXFA 2HALA 2ZU4A 3BTFE 3ZVCA 4RN6A 3LGIA 1BIOA 1ETTH 4BOHA 2VWOA 3PWBA 2ZDAH 1G9IE 2HPPH 3QGNB 2OLGA 5TJXA 3BTME 5T3HA 4AGKA 1C4U2 3LGTA 4NA8A 4MQAA 2XC4A 1HXEH 3N7OA 1GBTA 1O2PA 1O2ZA 4MNXA 1L1GA 3BN9A 1EKBB 2BD9A 1EP5A 4AORA 1C2FA 2BDCA 2EI8A 1O2LA 1BB0B 3A84A 3ZZCA 1JRSA 2IJOB 1C1NA 1GBAA 3E1XB 3M3SA 1H9HE 1HNEE 4Q7YA 2G52A 1A3EH 2O9QA 1QRXA 1A5IA 4LK4A 4IGDA 1O3JA 4ABIA 5DO4H 2GCHF 1QQUA 3RU4D 3E90B 1D6RA 1O2IA 1SLWB 3NUMA 3ELAH 1IQMA 3GDSA 4FUCA 1C1WH 2A2XH 4FUBA 3QUMP 3MOCA 3UNQA 1EOLA 2Z9KA 1FDPA 1Y3UA 1LHEH 2J2UA 1CO7E 1HV7A 2NWNA 1AFQC 3DA9B 1XUGA 1WTHD 4J2YB 1ZPBA 4LOYH 2SGQE 3GY6A 3PLPA 1OWIA 1T8MA 1TNKA 3P92A 1EATA 1QFKH 4FUHA 1V2MT 2ZQ2A 4AG1A 1HUTH 3GCNA 4I33A 1K2I1 1OXGA 1BRAA 1F5LA 3T5FH 4NG9H 3M37A 2C8YB 1HB0B 2G4UA 1P11E 2VJ1A 3TPIZ 1O3OA 3SV6A 3K6ZA 4I8JA 1O35A 4YTAA 3S69A 1P10A 3RXAA 1K1LA 5ESBA 2PSYA 2BX3A 3L6PA 5C67A 1VGCB 1MQ6A 2Z9LA 4NSYA 3K65B 2SGAA 3MMGA 2WPJS 2VWLA 4IN2A 3EQ0H 4DVAU 1BTYA 1SGRE 1TALA 1C2GA 3RXTA 3ZZ4A 2WUBA 4PROA 2IN2A 1SGPE 3RMOH 2SNWA 2LNCA 1WQVH 2FX6A 1VITG 3FZDA 1K1IA 1UTMA 2DE8A 1GMCG 3ATIA 3QTVH 3A81A 3KQBA 1PJPA 2XWBI 3QDZB 3OY6U 2H9EH 1HLTH 3SV2H 3GY7A 2WYJA 3SU4A 4DG4A 4Y7BA 1AVWA 2TPIZ 3HKJB 5DP3A 1KTTB 1SGQE 2AS9A 2H5CA 3V12A 4ABBA 1HRTH 2G4TA 5C5OA 2BD7A 1Y5BT 2BY7X 2AYWA 2B5TB 1ESBA 2XXLA 1ELDE 2ODYB 2R2MB 4B2BA 1EASA 1NTPA 2R2WU 2O8TA 1P2MA 4GPGA 1GHVH 1LVBA 4CRAA 2UUFB 7LPRA 1OKXA 3AAUA 2H2ZA 2ZDMA 1RIWB 1K1PA 2C93B 1GJBB 2ZG0H 2Q1JA 1D3DB 2RDLA 1ELFA 5EQRA 1FJSA 4OGYA 1THRH 4ABDA 4AG2A 7GCHF 1RD3B 2Z9IA 1GBHA 1BHXF 1TABE 3URDA 1MKXK 1SHHB 4Y79A 4U2WA 3W95A 4A92A 1TQ0B 4X8VH 1YPMH 4INKA 1Q2WA 4X1NU 4X2XA 2QCYA 4AOQA 1KXEA 3VEQB 5F8ZA 1GMHF 1GHZA 3RLYH 4K69A 1UCYE 3M3VA 3S7HB 5JDUB 1PPZA 4OS2A 2Z3DA 3SGQE 2FMJA 1GJ9B 1N8OC 2JH5D 3V7TA 2GCHG 1C1OA 1UTKA 1DPOA 1UVTH 3TGKE 1PPGE 2NU4E 5ETXA 2HOBA 5ESTE 3QZQA 5LGOA 3TVJB 1O3DA 2PSXA 1MCTA 4DY7B 1HXFH 4JZFH 1IQLA 3RC6A 1BZXE 2KAIA 4H6SB 1AI8H 1AKSB 1S85A 1BTPA 2ZGBH 1Z1IA 5JBBS 1ZGIA 1BUIA 3TK6A 3RXJA 3G01A 4OS4A 2FS8A 1ORFA 3SNEA 5LH8A 2ZTZA 5FAHA 1T32A 4XSKU 5EXMA 3ZVGA 2BY6X 4D76A 3SO3A 3GY5A 2XBWA 1VCPA 2XBVA 4DT7B 2NU2E 1FXYA 1TRMA 3Q3YA 1C5RA 1TMBH 1TX6A 2VNTA 4YO9A 5JYIA 2RA3A 6ESTA 5EU8A 5HMAA
chains in the Genus database with same CATH superfamily
1H1BA 2Y7ZA 5A8ZA 2BM2A 2RDEA 3B9FH 3SJOA 3S9CA 1EXFA 1C5LH 3O8BA 1KDQA 1YLDA 1HIAA 1TYNA 2FI3E 1BMAA 4FVBA 1IHSH 4RT0A 4IBLH 1RFNA 1UTLM 4DIIH 2ZGHA 1O5BB 4Y6DA 2WPHS 3T62A 5I46H 3VB7A 1SI5H 3HKIB 1F0SA 2Y82A 2Y5HA 1NC6A 4NWKA 3SU0A 1ZTJA 4WWYA 4R0IA 5EW1H 1YPHE 1OWKA 1XUHA 1NY22 4K1TA 2BHGA 1SLUB 1QGFA 1FY5A 1YPGH 2BYAX 2PLXA 3IITA 1NZQH 1YF4A 5CE1A 3L33A 1OSSA 3M5NA 3OFND 4JK6A 1IQGA 1C1SA 1LCYA 1BDAA 5JB8S 1O2HA 3PV2A 4MNWA 3A7XA 3BTGE 2OXSA 2VINA 4AGJA 3E3TA 3NWUA 3PROA 3KYFA 1O5CB 3UWJH 1HJAB 1DWCH 1GJ7B 2ESTE 5DP8A 1TPPA 1O2UA 1SGEE 5DP4A 1TPOA 5BRRE 1H8IH 1TX8A 3OU0A 2VIQA 3PRBA 1P02A 1H8ED 1E36B 4BAQB 1P09A 3LGVA 5E2PA 1EB1H 2BDGA 1MMJN 4KKDA 1SKYE 2Z9JA 4FUEA 2ILNA 1GHAF 1C5SA 5GIBA 3F9EA 2ASUB 4X1RU 3U69H 3PMBB 1SL3A 1AZZA 1A3BH 2XTTB 1V6DA 3LOXA 3OTJE 4MVNA 4F48B 2FEQH 1TRYA 1U6QA 1OWEA 1PPHE 1CGIE 3ESTA 1A0LA 2H6MA 3H09A 1MKXH 1ESAA 1ELTA 3KF2A 7KMEH 3NKKA 1FAKH 4MDSA 4YESB 2Z6BD 4DOQA 1ZHRA 2AMPA 3ZZAA 3JZ1B 1AZ8A 1BITA 3GCHC 7GCHG 3K9XB 1TNHA 1YGCH 3BG4B 2P16A 3LGYA 4JYTA 5JPMH 2ZU2A 3TJUA 4MPUA 2WPKS 4NIVA 1G32B 1O2VA 3QTOH 1KXAA 1V2QT 1ZMNA 3UR9A 1GMHG 1YYY1 1MCVA 1UK3A 4BAOB 1A5GH 8GCHG 2OC0A 1C5MD 3A85A 1J17T 1FY1A 1JMOH 1P2OA 3NCLA 1FAXA 3GYMA 3UNSA 1YPKH 4AFQA 1UO6A 2FODA 2VVUA 2WYGA 4Y8XA 5IDKA 2FO9A 2G81E 3PTBA 3UFAA 2BB4A 1AHTH 2A7HA 2CJIA 2XWAA 4MPVA 1OYQA 1AVXA 1MZDA 3BTKE 4HG6A 5ABWA 2AIPA 1O30A 1A0JA 5F03A 2A5AA 2ZDLA 5HGGA 3ODDA 3F68H 5C1XA 3UREA 2J97A 1L4ZA 1BRUP 3SV7A 2FOFA 2ZCKP 4O03A 1GCDA 1NS3A 2XW9A 1QCPA 2ODPA 5DG6A 3RXKA 4BAKB 5SGAE 3RXCA 1GBIA 3P70B 3RLWH 2B7DH 1P05A 1C1UH 4ZHAA 3ZIAD 3DUXH 2YOLA 1BJUA 1C9PA 3FN8A 1MBMA 1LPZB 2VH6A 3PLKA 1E38B 2PTCE 2B9LA 4K1SA 3U1JB 5E2OA 4Z0KA 3LH3A 4IMQA 2JKHA 3SNDA 4VGCC 1Y5UT 3F2GA 1GI2A 1OX1A 4I32A 1AFQB 2WV5A 2Z3CA 1F5KU 2BD5A 5HXFA 1FUJA 2QA9E 3AW0A 4SGBE 8LPRA 4E7RG 3CENA 1E34B 3NZIA 1BTZA 1O2QA 1EB2A 1H4WA 5E0JA 1ESTA 1MBQA 2I6QA 3FFGA 1NFXA 1SGNE 1VJAU 2PR3A 1AU8A 1GI1A 1P01A 2VBCA 2FOBA 5FPYA 4U01A 3P6ZB 3T26A 3OAAD 1ZMLA 2CF9H 3QO6A 3RMMH 1FY4A 2PKAB 1ZSKA 4Z6AH 1QTFA 3F9HA 2ZFTA 5HM2A 3P8GA 1LPGB 1SGDE 4YOIA 1C4V2 2ZHWH 2PHBA 2WSSD 3E91A 4UFFH 1NESE 2G5NA 3F0OA 2Z94A 5HIZA 4SGAE 3KGPA 3MYWA 3SJKA 3ZV9A 1GHYH 4GVUA 5KEDA 1O3AA 2D1JA 1VITF 1GMDG 1GMCF 5BPEA 2J9NA 1P0SH 1SC8U 2A4OA 2JETC 3SU2A 1ID5H 1GI7B 1TNJA 1DXWA 4B2AA 1C1RA 1C4Y2 1GHAG 1EJNA 1YP9A 3KIDU 3GOVB 2VWNA 3M36A 3QN7A 4MLFB 2FXRA 2C4FH 2BLOA 4Y76A 5HYOA 1MTUA 2BDYA 4M9FA 5C1UA 1RGQA 2FPZA 3ZZBA 4OM9A 4TY7A 3A7YA 2C8XB 4Q2KA 1AD8H 1C5QA 3RXHA 2GZ8A 3M5OA 2A4GA 4ZAEA 1H8DH 3EYDA 3U9AH 1BRBE 3B8JA 3HGNA 1ZHMA 1OPHB 3ATLA 1DANH 2FOMB 1EZUC 1C5TA 2QC2A 1S6HA 2GZ9A 2JDID 2VIPA 1S82A 3FZZA 1FPHH 2G51A 2SGPE 1ANBA 3KQCA 1V2ST 1XUKA 4X6NA 4FOUC 3SV8A 3GY8A 1G3CA 2SGEE 1C5NH 4WY3A 1YM0A 2GTBA 1BHXB 1WQSA 1AY6H 1NRNH 3BV9B 1K0HA 5AHGH 1JRTA 1HAIH 1GDQA 3SI3H 1J14A 3E0PB 2A7JA 1O2WA 3UY9A 2A7CA 2O8LA 1C2HA 1ABJH 5DSFA 3AASA 4QT8C 3R0FA 1YPHC 3LJJA 1Z71A 3I77A 2IPHA 2KCPA 3STIA 3MNCA 4D7FA 1AE5A 1SGTA 2UWOA 2SGFE 3LGUA 3KN2A 3R3GB 1O31A 3VGCC 2BXTH 1Z7KA 3ZVDA 1YPLH 3MWIU 4JZEH 1Z8RA 4B74A 5T6FA 1QR3E 4CREA 2XOKD 4X2VA 1N8OB 1UVSH 1ZSLA 2CHAC 3MHWU 1QL9A 3WY8A 3GCOA 1BMFD 2BY9X 3RXUA 1G2LA 3ZZDA 1TPAE 1MD8A 4XOJA 3T2NA 1SGIB 1ELVA 3QGJA 1O2NA 2JJ1D 2A4QA 3MFJA 3LONA 1IHTH 1VR1H 2UWLA 2BQWB 3SYJA 2OCVB 2VVVA 1O3NA 2BVRH 4ZXXH 4WH8A 2SFAA 1CQQA 1P2QA 2O8UA 1QURH 3NK8A 3MO6A 1SGFA 3UPEA 1ZMJA 5DP6A 3HATH 1MAYA 1EX3A 3A88A 2J92A 3RUOA 5FCRA 2Q6DA 3BTEE 3VG8A 5GWZA 1UHBB 4B1TA 1WU1A 1ZTLA 2W26A 1SGCA 1TWXB 2V6NA 2OINA 1HAVB 1K1NA 1TBRH 1Z8IB 2WV9A 4UONA 2ZZUH 1LQDB 1XXDA 2ZDVH 1BMNH 3TH2H 1TB6H 2HNTE 3D65E 2A1DB 1Z8GA 3EGKH 1GVZA 4X2WA 1CU1A 4KTCA 1MUEB 4DURA 3TITA 1QY6A 5DP9A 1V2PT 2UUJB 1L4DA 5C94A 1UMAH 4TT3D 1AVGH 1EAUA 4ZUHA 1V2TT 2ZPQA 3P8NA 1TMTH 1PPCE 3I78A 1GI5A 1VCQA 3M3TA 1B0FA 3SUEA 1ZLRA 1O5EH 1KTSB 2H9HA 2QF4A 3M7QA 1QBNA 1F5RA 2CF8H 1LHGH 1CVWH 4Q7XA 4X1QU 2TGTA 3B23B 1DY9A 4NFFA 3CP7A 1FZZA 1PQ7A 4B71A 2QE7D 2GKVE 2ZWLH 1G3EA 1W14U 3TIUA 3U1IB 4GLYA 3ZVEA 1O2RA 2W6JD 4X1PU 2GV6A 2HGTH 1C1PA 4AFUA 2BLQA 2OK5A 1IQHA 1VKYA 1GBJA 2FWWA 3U8TH 5LPFA 2H5DA 3TK5A 5DK1A 5FL7D 1TRNA 2OTVA 1J9CH 2BVXH 3RXGA 4ZKNU 1FONA 3VXEH 2CGAA 4NGAH 4NCYA 4XRNA 4O9VA 1NBMD 1QHRB 2L6OA 4Q7ZA 1P9UA 2A2QH 1KLJH 2FOCA 1C1VH 1SVPA 2V35A 2VIVA 1ZJDA 1AE8H 3W94A 4AZ2B 5L2YH 2BXUH 1Q31A 2M2AA 3P17H 3SI4H 2R0LA 2AGEX 3P8OA 3UR6A 1N6YA 1XVOA 2XNIA 5E0GA 5A8XA 1NU9A 2AFQB 1ZTKA 1C2IA 5TCAA 5L6NH 2QAAA 2FESH 1JIRA 2FM2A 1C2EA 1C5XB 1KIGH 3UAIC 3DSPA 5EXNA 2YNBA 3GCHB 3KCGH 1QB9A 2ZEBA 2SGDE 3PV5A 4AYYB 4YLQH 3MU0A 8GCHF 1ANDA 1YPJH 4DCDA 2Y5GA 3A7TA 2BTCE 4I8LA 1CA8B 4TWYA 3A7VA 3DCLA 3QWCH 2GP9B 1V2KT 2G5VA 2ZFPH 3LDXH 4MPWA 3E6PH 1WV7H 5HM9A 2BD2A 3F1SB 2FYRA 5EJLA 1GWAA 2FTMA 1ZPZA 3Q77A 5JBTA 2HVYB 2PKAA 3TU7H 3RXFA 2V3OH 1ZJKA 2CXVA 3WWBA 3JZ2B 2ZF0H 3DSOA 3SUGA 5GJ4B 4B6EA 4X6OA 2CN0H 4NA7A 3KYGA 1E1RD 2K0QA 2CK3D 2AH4X 2LPRA 3GYLB 2Q6FA 3EDXB 1Y8TA 1SLXB 4Y8YA 2ZA5A 3SZNA 1AB9C 1O36A 2BY8X 1A5HA 1P2NA 4LZ4B 1YC0A 3ZZ7A 4B2CA 1GDNA 2J98A 1TOMH 2ANYA 2P93A 4NIYA 1SQTA 1O3PB 1GVKB 3H7OA 1GPZA 2GX4A 1C1TA 2FOEA 3STJA 1UK4A 1O5DH 1O37A 4ZXYH 5C3NA 1SBWA 3CS7A 3SBKA 1BBRK 1W11U 4D9QA 4TYDA 1LO6A 2D2DA 3VB6A 2F9NA 1V2OT 1BMMH 4F49A 1GHXH 3TK9A 3CNRA 1CGJE 5E0HA 5DP5A 2GDEH 1BCUH 1M9UA 8KME2 3N99A 1PPEE 4CBNA 4IC6A 1WDIA 2RFKC 3ATMA 1LPKB 3S9AA 3U8OH 4ISOA 1MQ5A 4VGCB 4FU8A 4CRCA 2A0QB 4B73A 1GCTC 1WCZA 1RTKA 1UK2A 2P3TB 1DOJA 1K21H 1V2JT 2OBQA 1SMFE 3WW7A 3TGIE 2K8IA 1W0ZU 2PUQH 5A0AE 2AERH 2QXIA 2NU0E 4ZROA 5FX5A 1CGHA 5EJZA 2AHME 3PM3A 1NPMA 2Z9GA 3RXSA 1SOZA 4YT6H 1JIMA 1VZQH 1GHWH 1LDTT 1F0RA 1GMDF 4MTBA 2QF0A 1VJ9U 2H1UA 2ZPSA 1O2JA 4F4OC 1D4PB 2HPQH 2BVSH 2K1QA 1TGCA 2AGIX 3ZYDA 1QJ1B 3IWMA 1P57B 1MTSA 5HKKD 1Y3VA 4BXWA 1MTNC 1S5SA 3RXQA 2ZIQH 4ABJA 3SW2B 3M7UA 5EXLA 2JETB 3M5LA 1ARBA 3RC5A 1GI4A 5EGMA 1EQ9A 1FPCH 1RXPA 1WAYB 2ZNKH 1Y5AT 1UVPA 5EPYA 4WF8A 1S83A 2J95A 1ANEA 1DWBH 5CHAC 2PUXB 4Q80A 3VFEA 4Q63A 2VH0A 2R0KA 3A80A 7ESTE 1CHGA 1Q3XA 4Y0ZE 2AIQA 3MNSA 2NU3E 5GNDA 1DS2E 3LU9B 3GY3A 1QA7A 3HK3B 1BTXA 3A86A 4CHAC 2P3FH 3A83A 4YOGA 2A5IA 3UWIA 1NRPH 1Y3YA 1O3EA 4INHA 2F9BH 3GY4A 4CH8B 4GAWA 1O3HA 2OC1A 3TJOA 3BIUH 1V2LT 1T8OA 1W8BH 4UFGH 3U8RH 2FOGA 2QY0B 3LGWA 3RXOA 3SQEE 1C5ZB 1MU6B 3EE7A 1EOJA 2WPDD 3V0XA 1WSSH 2STBE 1HCGA 4ABHA 1HAVA 1MTVA 3D23A 2V3MA 1DLKB 3PB1E 1V2NT 1A2CH 1EAIA 1O3IA 4IS5A 3F6UH 2Y7XA 3V3MA 5IK2D 3MH7A 1EAWA 2KCAA 4FUFA 3RXIA 1D6WA 3KQEA 2GZ7A 3P95A 2TGDA 1J16A 1P12E 3RP2A 4WMFA 3O8DA 4MNYA 3RC4A 5DN6D 1QNJA 2EI7A 1AMHA 2WZQA 3EA8A 4OS6A 2CMYA 2UUYA 2IJD1 3LC3A 2VGCC 1D3TB 1XUFA 4UEHH 2XYAA 3MU1A 1GJ4H 2AGGX 1EPTC 4BAHB 2VIDA 4YZUA 2BOKA 1C2JA 1W2KH 2BDBA 1OP2A 1UVUH 4WMEA 1BBRH 1DDJA 1B5GH 3VGCB 3GDVA 1YLNA 2GMTC 5AF9H 4K1EA 2ZECA 4NFEA 1MH0A 5FXLA 5A0CA 1P3CA 3C1KA 3ZVAA 4BXSA 5F6MA 2BD4A 2FLRH 1NFYA 2W6ID 1BTHH 2PGQB 2CHAB 9ESTA 1VITH 2B0FA 1KMHB 1PPBH 1B7XB 1F7ZA 1DWEH 1FIWA 3FP7E 3L3TA 1ACBE 1ELEE 2CV3A 2QV1A 3LC5A 5C5NA 1PFXC 2ZFFH 1GGDC 4DIHH 2P94A 1F2SE 2Y5FA 2JJ2D 3RM2H 1DT2A 1GJAB 1HDTH 2ZHQH 1EAXA 1XKBC 3K2UA 3ZVFA 1T8LA 1T7CA 1FI8A 3RMNH 1THSH 1HAOH 1O2GH 1NFUA 2A31A 3BTDE 3RXBA 1GHBG 1NRSH 4GCHG 1DSUA 4ZKOU 1FV9A 2Q6GA 1C5PA 3ZV8A 3DFJA 3NPSA 1C2MA 1FY3A 1TE0A 1HAZB 2DUCA 4YLUA 4BAMB 4YT7H 1SPJA 5GPIB 3TGJE 3H5CB 1KY9A 2OD3B 3OYPA 3PYHA 5LPRA 1GL0E 2ZGXH 2BDHA 1A7SA 2XCFA 4FU7A 1P03A 1C5UA 1QB6A 4FUGA 4JMYA 1KXFA 2H9TH 5PTPA 2ZP0H 4BTUB 2QXJA 3BTQE 5HIYA 2QN5T 2P95A 3F3BA 3T25A 3UOUA 2VU8E 1KXCA 2P3UB 4OS5A 3RU4E 1Z8JB 3UQVA 4DW2U 1EJAA 3QZRA 1C2KA 2BOHB 3A87A 2G8TA 1GJ6A 2ZI2H 4RI0A 5C0TA 4GHTA 1GI8B 3KQDA 1SQOA 2W5EA 4YM9A 1EZXC 2EA3A 3PMAB 1SQAA 1WYKA 5K7RA 4D9RA 3AK5A 4ISHH 2PP6A 4AB8A 2KM0A 4X1SU 1HJ9A 3P8FA 1K1JA 2FX4A 3LKWA 1GBFA 1ETSH 1AKSA 2THFB 3RMLH 3SHAH 2J5UA 1AIXH 1NRRH 1OS8A 4P02A 4TY6A 1DVAH 1CSOE 1G30B 3I29A 2FTLE 4A7IB 5CDFE 1O5GH 2G55A 1JXPA 1T4UH 4XDEA 5DJ7A 1D9IA 4Q4LA 1HIAB 3BIVH 2ZDKA 1G2MA 3DD2H 4Z1MD 1QRWA 4Y10E 4KGAA 1BJVA 1J15A 2TGPZ 3KHVA 1O38A 1MTWA 4RT1A 2XBYA 1O3LA 5EW2H 3PO1B 1CT4E 1NROH 2V0BA 3M35A 1AGJA 1YBWA 1MAXA 3GCTG 1A61H 2A5KA 1O3MA 2QYIA 1LTOA 5GXPA 1O3KA 2SNVA 1FY8E 2EQNA 3BG8A 1GBBA 3RXMA 1DWDH 3RXDA 3A8CA 3VB3A 1O33A 1QIXB 2GT8A 3UB0A 5F8XA 1FX0B 1AWFH 2XCNA 1C1QA 1ZPCA 1OOKB 4FUJA 2ZPRA 4XD7D 3TH3H 1HJ8A 1GL1A 1UVOA 4FU9A 5A8YA 4IMZA 3SU1A 1O2YA 4CRBA 1HGTH 5JBAS 2LELA 4H6TA 2F3CE 3LJOA 1DM4B 4WXVA 4M7GA 1EP6A 1YPEH 4H4FA 4CR5A 5FPSA 4FXGH 1L0ZA 1K1MA 2V3HH 3FP6E 2BDAA 1W7GH 1IQJA 4D7GA 4WH6A 1FQ3A 2OQUA 1BOQA 1CE5A 4NZQA 3M5MA 1BT7A 2F9PA 1AUJA 1J8AA 2F9UA 1IQNA 3OY5U 3KL6A 1QJ7B 1C9TA 4ESTE 1TNIA 2ANMH 1KYNA 1NN6A 5CHBA 3QK1A 4O3TA 4OS7A 4A6LA 2W7UA 1GBKA 3FKSD 4BANB 1ELAA 1DE7H 3MTYA 3EAJA 4UD9H 6GCHG 1ZRKA 4AYVB 4B6FA 1RS0A 1JOUB 5H4IB 1HBTH 1UTNA 2OQ5A 1QA0A 2BMGB 4I8GA 1H8HD 3U98H 1AN1E 4ZMAH 1OWJA 1TNGA 2W3KA 3BSQA 1W12U 3E16B 3LPRA 4O97A 5L2ZH 2AMQA 1SHYA 3T28A 3SOSA 4WXIA 4XFQA 4JZIA 4NIXA 1YCPK 3S7KB 3MO3A 1SQRA 3SJ8A 5JBCS 1TQ7B 1O3GA 2LP6A 1ZHPA 2ODQA 4LZ1H 2AEIH 1WXRA 3HGPA 3KEEA 3QX5H 1AB9B 1SR5C 1ZGVA 2PFEA 3DSGA 3FP8E 4ASHA 2ZO3H 2OC8A 3A7WA 2QXGA 5AFYH 1O2XA 2A45B 4U30A 3ZZ9A 1CHOF 2ZHEH 1HYLA 4KP0A 2BX4A 3SU6A 1QB1A 3ZZ3A 3ODFA 3SHCH 2ZC9H 5B6OA 1UTJA 2QF5A 1MD7A 2YMSD 1IQKA 1HAYB 3M7TA 4E7NA 4TPIZ 3SNCA 4X6PA 1FN8A 1GJ5H 1K28D 5GCHG 2QF3A 3EA7A 4K8BA 1MU8B 2Z3EA 1N6XA 4TWWA 1GBDA 4THNH 3FO8D 1CT0E 1DXPA 2FP7B 3MI4A 1ELBA 1S81A 2YMSB 3BTWE 3D62A 3RXPA 4GSOA 1P06A 1W13U 1DUAA 1WUNH 4HFPB 1BRCE 2BLWA 2D8WA 2JH6D 5FBEA 1GCTB 5AVDA 1HFDA 2ZTXA 2FLBH 5F8TA 1DITH 1ZYOA 3F2FA 2PGBB 3RXVA 4ABGA 4OGXA 4ISLA 4CBOA 2A32A 4X8TH 3DFLA 1TONA 1PQAA 1ZZZA 1TAWA 2GV7A 2ZHFH 1RTLA 4X6MA 3GISB 2BY5X 2F4LA 1PPFE 1FNIA 1ELGA 3OX7U 1O3FA 1SGFG 3PO1C 1L1JA 3DT0H 1GG6C 5A2MH 6CHAC 2D26C 4GUXA 1FMGA 2ZFQH 3SU5A 2ZGJA 2Y6TA 2BZAA 3BTTE 1XM1A 1YWUA 1F0TA 1XUJA 1CBWB 1RRKA 2ALPA 2J4IA 4IC5A 4RKOB 5TCCA 4CH2B 1KSNA 2VVCA 1A46H 4ISNA 3AVZA 1BTWA 1MTNB 1TIOA 2PKSC 2QXHA 2R3UA 8ESTE 1P04A 3SGBE 1Y3WA 4K2YA 1SLVB 3IG6B 1TLDA 2EY4C 1H9LB 4WJG2 4K8YA 1W3CA 3BTHE 3VB5A 1X7AC 1V2RT 2R9PA 5EQSA 1NO9H 1GJDB 4BTTB 1G3BA 4CR9A 4HI3A 3ZVBA 3Q00A 1DSTA 4F55A 4OS1A 1DUEA 5CHAB 3SGAE 1F92A 1W0KD 2ZQ1A 1TGNA 2IPQX 1JWTA 1QBOA 1BBRE 4HGCA 4X0WU 5J4SA 3TH4H 1V2UT 3ZZ6A 3E0NB 4CHAB 2ZTYA 5FPTA 2EEKA 6LPRA 1S0QA 2PWXA 3GY2A 1TA6A 4HZHA 1FLEE 2WPLS 2VB0A 1KLTA 1AWHB 2TRMA 3A89A 3RU4T 4B76A 3MU4A 2GDDA 4INLA 2ZU1A 2HWLB 3AW1A 5C20A 2GD4B 4MPXA 1YCPM 2OC7A 3FANA 1G3DA 4AFSA 2GVFA 2AMDA 5C1YA 3HK6B 2BQ7B 2J38A 1TFXA 4UDWH 1G37A 1OWHA 4A1XA 1V2WT 1L2EA 3UIRA 4U32A 4CRDA 1Z6JH 3ENSB 1DFPA 2RA0A 2HVXA 3NXPA 3PLBA 1GI6A 1YCPH 5C17A 3O8RA 4IW4E 2WINI 1TGSZ 3SZEA 3D49H 3OEED 1KLIH 3WWFA 1O2OA 1O5AB 5F53A 2PV9B 2Y80A 2V7QD 1PYTD 1EZQA 3TNSA 2ZFSA 2O8MA 4K60A 1INCA 1S6FA 3VPKA 2ALVA 4XBCA 2VGCB 2VIWA 3C27B 3A8AA 3W1EA 1EPTB 3VB4A 2KCOA 3ZYEA 5A09A 1EUFA 3UUZA 1BQYA 3OEHD 2P8OB 3S9BA 2FOAA 2KZ4A 1HAGE 1UTOA 1CA0B 2PW8H 2GMTB 1T4VH 2QIQA 3H7TA 3ZZ8A 4CRGA 2BD3A 4UE7H 3BEUA 1TGBA 3EA9A 1CHOG 3N7EA 3SU3A 1AUTC 1KXDA 1P3EA 2XC0A 2STAE 2OP9A 3ITIA 4JZDH 5CMXH 1VGCC 3AAVA 2WPMS 2XBXA 3TLOA 3SNBA 1E1QD 1RJXB 4GHQA 1O34A 2YMSC 3DHKH 1ELCA 2BZ6H 2TBSA 1P9SA 1GHBF 1UCYK 4GCHF 3SUFA 1GGDB 1VCWA 3UTUH 1IQEA 1OWDA 1Y59T 2BLVA 1SOTA 1TNLA 1C2DA 1IQFA 1ABIH 3UQOA 1MKWK 3MO9A 2FS9A 1NT1A 1WTGH 1ZR0A 2HRVA 2ULLA 1O2MA 3CS0A 4X2YA 5DGJA 1YLCA 1XKAC 2OBOA 4JK5A 2C8WB 1ANCA 1O3BA 1WOFA 1BTUA 2PTNA 1SFQB 5A0BA 2FIRH 1A1RA 4Y11E 1O2TA 2GCTB 2ZU5A 3E8LA 4FETA 4DGJA 1GBLA 2JH0D 1SGYE 1Y3XA 1CBWC 2O8WA 2ZGCA 3QLPH 2F9VA 2QGRA 1LVMA 2JIZD 3FAOA 3OTPA 1W0JD 1HPGA 1GBCA 1C5VA 1P8VC 2Z7FE 5E8EH 1TBQH 1CT2E 4I31A 2F9OA 1PQ8A 5EOKA 5EG4A 5JB9S 2BDIA 3Q3KA 5FX6A 4DJZB 2VIOA 1O39A 4RSPA 1ETRH 1P2IA 1XVMA 4KELA 5FHTA 2FZZA 3MH4A 5DPAA 1HAHH 2HLDD 3LH1A 4Y7AA 1GVLA 3URCA 2HLCA 4JZ1A 1S84A 4ZHMU 1RIWC 1C5YB 4Y71A 3SJIA 3LT3A 3T27A 2XC5A 4FVDA 2A4RA 4NIWA 1SSXA 4FUIA 3RM0H 5IYTA 3Q76A 3A82A 1TBZH 1K22H 1THPB 1K1OA 3HPTB 4YOJA 4J1YA 3VXFH 1COWD 1XUIA 2FI4E 1F0UA 1KXBA 1T8NA 2F43B 2WV4A 2KCYA 3GCTF 1LHCH 5EQQA 1C2LA 3SN8A 2IOTA 5B6LA 1O2SA 4WVPE 1DY8A 4TPYA 3RXEA 2F91A 3TJVA 1LHDH 3EE0B 5DKMA 1G36A 1GBEA 1XX9A 4HTCH 1H9IE 3TJNA 4Y8ZA 4ABAA 9LPRA 1UHBA 1O2KA 2DE9A 3S0NA 3RDZA 4A1VA 2ANWA 4AN7A 1DICA 2ZCLP 4XBBA 3PV4A 4FUDA 1GDUA 2HNTC 1E37B 3MNXA 4MG3A 1BMLA 1D3QB 2BQ6B 3PRDA 2C90B 4E06H 2OUAA 4ZH8A 5EIYA 1IOEA 2ZHDA 1V3XA 2FOHA 2HNTF 3M61U 1SG8B 4KTUA 1EJMA 5DP7A 4D8NA 1NFWA 4XE4A 4ZHLU 1GJ8B 1QRZA 1AQ7A 2J94A 4K5ZA 2I6SA 4AFZA 1ZRBA 3SV9A 2FYQA 1QQ4A 1DX5M 1QL8A 2G00A 4LXBH 2W7SA 1GJCB 1ZOMA 3KNXA 4BTIB 1NU7B 4IN1A 3UOPA 4AX9H 1GI0A 1B0EA 4E05H 1E35B 1GBMA 4H42U 4ISIH 4ASUD 5I25A 1W7XH 2ZU3A 1A0HB 3FOAA 1YY3A 4NZLA 3RXRA 4CRFA 2P8OC 5LPEA 4P00A 1PYTC 1TMUH 5G4BA 1CA0C 2F83A 3LIWA 6GCHF 1NRQH 3TNTA 2J34A 1LQEA 1LMWB 1TOCB 1Z1JA 1TGTA 1SFIA 5J4QA 1QBVH 4B75A 2B8OH 1O3CA 2W3IA 4I8KA 1D3PB 1LVYA 3MH6A 2RCEA 1S0RA 5FBIA 2Y81A 1UJ1A 1XMNB 2ZCHP 1UCYH 1UTQA 1OP8A 1FN6A 1LVOA 2WPIS 3SORA 3A8DA 4X8UH 1K9OE 2FDAA 1OYTH 1WBGB 1MKWH 4JCNA 3BF6H 4JYUH 4ABFA 5GDSH 5T1VA 1TA2A 3OE7D 3RXLA 1E0FD 3U28C 4NA9H 4BNRA 1QL7A 1YKTA 4NSVA 2EC9H 1HAPH 4DT4A 2YNAA 2KFWA 2BD8A 3UNRA 3FVFB 2NU1E 3ATWA 5AFZH 5EODA 1W0YH 5L30H 5T6GA 1W10U 3MH5A 2GCTC 1IAUA 1JBUH 2FI5E 2VWMA 1LKAA 2EI6A 2UWPA 2L74A 4AC9A 5JYIA 3GICB 1UTPA 4ACAA 2XRCA 4O3UA 1ZSJA 5GCHF 1HJAC 3K6YA 1RTFB 1TPSA 3GDUA 2ZFRH 1V2VT 4AB9A 2KX4A 5K0HA 2UUKB 1L1NA 2TGAA 3ZZ5A 2KAIB 3NRLA 3PWCA 1Z6EA 1DLEA 3ATKA 4Y0YE 1PQ5A 1LHFH 1C5OH 1FIZA 2TIOA 3PTNA 1QJ6B 1OP0A 3MNBA 3OSYA 3PMHB 1LKBA 2RG3A 1T31A 4A1TA 5T6DA 1P2KA 3BEFB 3SUDA 2P59A 3MU8A 4JYVH 4K3JA 1UW7A 5FCKA 3V13A 1GI9B 4ZKSU 1O5FH 4A5TS 2WUCA 2J98B 2GT7A 2R3YA 1MZAA 2M5TA 1TX7A 1KDQB 2ZDNA 4KTSA 1BA8B 3SNAA 2GGVB 3PMJA 4R8TB 4I8HA 3T29A 4NWLA 3F9GA 1C1MA 1O32A 4X8SH 1NM6A 2C8ZB 3BEIB 4XBDA 4RKJB 5EPNA 4UFEH 3BG4C 1C5WB 2KR7A 2ANKH 2C3SA 1GG6B 3F9FA 3MU5A 4ZKRU 1ARCA 3SJ9A 6CHAB 4I7YH 1N1LA 3O8CA 1A4WH 1EZSC 4WMDA 4MNVA 4UFDH 3A8BA 4ABEA 1EPTA 1HAXB 3Q3XA 1GI3A 5C2ZA 3A7ZA 3SQHE 1O0DH 2PKSB 2ZKSA 1AO5A 1P2JA 1AFEH 1IQIA 1SB1H 1XXFA 2HALA 2ZU4A 3BTFE 3ZVCA 3N7DA 4RN6A 3LGIA 1BIOA 1ETTH 4BOHA 2VWOA 5EJ1A 3PWBA 2ZDAH 1G9IE 2HPPH 3QGNB 2OLGA 2XNDD 5TJXA 3BTME 5T3HA 4AGKA 1C4U2 3LGTA 4NA8A 4MQAA 2XC4A 1HXEH 3N7OA 1GBTA 1O2PA 1O2ZA 1E79D 4MNXA 1L1GA 3BN9A 1EKBB 2BD9A 1EP5A 4AORA 1C2FA 2BDCA 2EI8A 1O2LA 1BB0B 3A84A 3ZZCA 1JRSA 2IJOB 1C1NA 1GBAA 3E1XB 3M3SA 1H9HE 1HNEE 2GJGA 4Q7YA 2G52A 1A3EH 2O9QA 1QRXA 1A5IA 4LK4A 4IGDA 1O3JA 4ABIA 5DO4H 2GCHF 4ZCNA 1QQUA 3RU4D 3E90B 1D6RA 1O2IA 1SLWB 3NUMA 3ELAH 1IQMA 3GDSA 4FUCA 1C1WH 2A2XH 4FUBA 3QUMP 3MOCA 3UNQA 1EOLA 2Z9KA 1FDPA 1OHHD 1Y3UA 1LHEH 2J2UA 1CO7E 1HV7A 1NBME 2NWNA 1AFQC 3DA9B 1XUGA 1WTHD 4J2YB 1ZPBA 4LOYH 2SGQE 3GY6A 3PLPA 1OWIA 1T8MA 4I86A 1TNKA 3P92A 1EATA 1QFKH 4FUHA 1V2MT 2ZQ2A 4AG1A 1HUTH 3GCNA 4I33A 1K2I1 1OXGA 1BRAA 1F5LA 3GS9A 3T5FH 4NG9H 3M37A 2C8YB 1HB0B 2G4UA 1P11E 2VJ1A 3TPIZ 4TSFD 1O3OA 1QZ8A 3SV6A 3K6ZA 4I8JA 1O35A 3F2HA 4YTAA 3S69A 1P10A 3RXAA 1K1LA 5ESBA 2PSYA 2BX3A 3L6PA 5C67A 1VGCB 1MQ6A 2Z9LA 4NSYA 3K65B 2SGAA 3MMGA 2WPJS 2VWLA 4IN2A 3EQ0H 4DVAU 1BTYA 1SGRE 1TALA 1C2GA 3RXTA 3ZZ4A 2WUBA 4PROA 2IN2A 1SGPE 3RMOH 2SNWA 2LNCA 1WQVH 2FX6A 3F0PA 1VITG 3FZDA 1K1IA 1UTMA 2DE8A 1GMCG 3ATIA 3QTVH 3A81A 3KQBA 1PJPA 2XWBI 3QDZB 3OY6U 2H9EH 1HLTH 3SV2H 3GY7A 2WYJA 3SU4A 4DG4A 4Y7BA 1AVWA 2TPIZ 3HKJB 1S6LA 5KGOA 5DP3A 1KTTB 4ACBA 1SGQE 2AS9A 2H5CA 3V12A 4ABBA 1HRTH 2G4TA 5C5OA 1MABB 2BD7A 1Y5BT 2BY7X 2AYWA 2B5TB 1ESBA 2XXLA 1ELDE 2ODYB 3KQ5A 2R2MB 4B2BA 1EASA 1NTPA 2R2WU 2O8TA 1P2MA 4GPGA 1GHVH 1LVBA 4CRAA 2UUFB 7LPRA 1EFRD 1OKXA 3AAUA 2H2ZA 2ZDMA 1RIWB 1K1PA 2C93B 1GJBB 2ZG0H 4YXWD 2Q1JA 1D3DB 2RDLA 1ELFA 5EQRA 1FJSA 4OGYA 1THRH 4ABDA 4AG2A 7GCHF 1RD3B 2Z9IA 1GBHA 1BHXF 1TABE 3URDA 1MKXK 1SHHB 4Y79A 4U2WA 3W95A 4A92A 1TQ0B 4X8VH 1YPMH 4INKA 5C0UA 1Q2WA 4X1NU 4X2XA 2QCYA 4AOQA 1KXEA 3VEQB 5F8ZA 1GMHF 1GHZA 3RLYH 4K69A 1UCYE 3M3VA 3S7HB 5JDUB 1PPZA 4OS2A 2Z3DA 3SGQE 2FMJA 1GJ9B 1N8OC 2JH5D 3V7TA 2GCHG 1C1OA 1UTKA 1DPOA 1UVTH 3TGKE 1PPGE 2NU4E 5ETXA 2HOBA 5ESTE 3QZQA 5LGOA 3TVJB 1O3DA 2PSXA 1MCTA 4DY7B 1HXFH 4JZFH 1IQLA 3RC6A 1BZXE 2KAIA 4H6SB 1AI8H 1AKSB 1S85A 1BTPA 2ZGBH 1Z1IA 5JBBS 1ZGIA 1BUIA 3TK6A 3RXJA 3G01A 4OS4A 2FS8A 1ORFA 3SNEA 5LH8A 2ZTZA 5FAHA 1T32A 4XSKU 5EXMA 3ZVGA 2BY6X 4D76A 3MQKC 3SO3A 3GY5A 2XBWA 1VCPA 2XBVA 4DT7B 5KECA 1FXYA 2NU2E 1TRMA 3Q3YA 1C5RA 1TMBH 1TX6A 2VNTA 2WHXA 4YO9A 2RA3A 6ESTA 5EU8A 5HMAA
chains in the Genus database with same CATH topology
1H1BA 2Y7ZA 5A8ZA 2BM2A 3B9FH 3SJOA 3S9CA 1EXFA 1C5LH 3O8BA 1KDQA 1YLDA 1HIAA 1TYNA 2FI3E 1BMAA 4FVBA 1IHSH 4IBLH 1RFNA 1UTLM 4DIIH 2ZGHA 1O5BB 4Y6DA 2WPHS 3T62A 5I46H 3VB7A 1SI5H 3HKIB 1F0SA 2Y82A 2Y5HA 1NC6A 4NWKA 3SU0A 1ZTJA 4WWYA 4R0IA 5EW1H 1YPHE 1OWKA 1XUHA 1NY22 4K1TA 2BHGA 1SLUB 1QGFA 1FY5A 1YPGH 2BYAX 2PLXA 3IITA 1NZQH 1YF4A 5CE1A 3L33A 1OSSA 3M5NA 4JK6A 1IQGA 1C1SA 1LCYA 1BDAA 5JB8S 1O2HA 4MNWA 3A7XA 3BTGE 2OXSA 2VINA 4AGJA 3E3TA 3NWUA 3PROA 1O5CB 3UWJH 1HJAB 1DWCH 1GJ7B 2ESTE 5DP8A 1TPPA 1O2UA 1SGEE 5DP4A 1TPOA 5BRRE 1H8IH 1TX8A 3OU0A 2VIQA 1P02A 1E36B 4BAQB 1P09A 3LGVA 5E2PA 1EB1H 2BDGA 1MMJN 4KKDA 2Z9JA 4FUEA 2ILNA 1GHAF 1C5SA 5GIBA 3F9EA 2ASUB 4X1RU 3U69H 3PMBB 1SL3A 1AZZA 1A3BH 2XTTB 1V6DA 3LOXA 3OTJE 4MVNA 2FEQH 1TRYA 1U6QA 1OWEA 1PPHE 1CGIE 3ESTA 1A0LA 2H6MA 1MKXH 1ESAA 1ELTA 3KF2A 7KMEH 3NKKA 1FAKH 4MDSA 4YESB 2Z6BD 4DOQA 1ZHRA 2AMPA 3ZZAA 3JZ1B 1AZ8A 1BITA 3GCHC 7GCHG 3K9XB 1TNHA 1YGCH 3BG4B 2P16A 3LGYA 4JYTA 5JPMH 2ZU2A 3TJUA 4MPUA 2WPKS 4NIVA 1G32B 1O2VA 3QTOH 1KXAA 1V2QT 1ZMNA 3UR9A 1GMHG 1YYY1 1MCVA 1UK3A 4BAOB 1A5GH 8GCHG 2OC0A 1C5MD 3A85A 1J17T 1FY1A 1JMOH 1P2OA 3NCLA 1FAXA 3GYMA 3UNSA 1YPKH 4AFQA 1UO6A 2FODA 2VVUA 2WYGA 4Y8XA 5IDKA 2FO9A 2G81E 3PTBA 3UFAA 2BB4A 1AHTH 2A7HA 2CJIA 2XWAA 4MPVA 1OYQA 1AVXA 1MZDA 3BTKE 5ABWA 2AIPA 1O30A 1A0JA 5F03A 2A5AA 2ZDLA 5HGGA 3ODDA 3F68H 5C1XA 3UREA 1L4ZA 1BRUP 3SV7A 2FOFA 2ZCKP 4O03A 1GCDA 1NS3A 2XW9A 1QCPA 2ODPA 5DG6A 3RXKA 4BAKB 5SGAE 3RXCA 1GBIA 3P70B 3RLWH 2B7DH 1P05A 1C1UH 4ZHAA 3DUXH 2YOLA 1BJUA 1C9PA 1MBMA 1LPZB 2VH6A 3PLKA 1E38B 2PTCE 2B9LA 4K1SA 3U1JB 5E2OA 4Z0KA 3LH3A 4IMQA 2JKHA 3SNDA 4VGCC 1Y5UT 1GI2A 1OX1A 4I32A 1AFQB 2WV5A 2Z3CA 1F5KU 2BD5A 5HXFA 1FUJA 2QA9E 3AW0A 4SGBE 8LPRA 4E7RG 3CENA 1E34B 3NZIA 1BTZA 1O2QA 1EB2A 1H4WA 5E0JA 1ESTA 1MBQA 2I6QA 3FFGA 1NFXA 1SGNE 1VJAU 2PR3A 1AU8A 1GI1A 1P01A 2FOBA 5FPYA 4U01A 3P6ZB 3T26A 1ZMLA 2CF9H 3QO6A 3RMMH 1FY4A 2PKAB 1ZSKA 4Z6AH 1QTFA 3F9HA 2ZFTA 5HM2A 3P8GA 1LPGB 1SGDE 4YOIA 1C4V2 2ZHWH 2PHBA 3E91A 4UFFH 1NESE 2G5NA 2Z94A 4SGAE 3KGPA 3MYWA 3SJKA 3ZV9A 1GHYH 4GVUA 1O3AA 2D1JA 1VITF 1GMDG 1GMCF 5BPEA 2J9NA 1P0SH 1SC8U 2A4OA 2JETC 3SU2A 1ID5H 1GI7B 1TNJA 1DXWA 4B2AA 1C1RA 1C4Y2 1GHAG 1EJNA 1YP9A 3KIDU 3GOVB 2VWNA 3M36A 3QN7A 4MLFB 2FXRA 2C4FH 2BLOA 4Y76A 5HYOA 1MTUA 2BDYA 5C1UA 1RGQA 2FPZA 3ZZBA 4TY7A 3A7YA 2C8XB 4Q2KA 1AD8H 1C5QA 3RXHA 2GZ8A 3M5OA 2A4GA 4ZAEA 1H8DH 3EYDA 3U9AH 1BRBE 3B8JA 3HGNA 1ZHMA 1OPHB 3ATLA 1DANH 2FOMB 1EZUC 1C5TA 2QC2A 1S6HA 2GZ9A 2VIPA 1S82A 3FZZA 1FPHH 2G51A 2SGPE 1ANBA 3KQCA 1V2ST 1XUKA 4X6NA 3SV8A 3GY8A 1G3CA 2SGEE 1C5NH 4WY3A 1YM0A 2GTBA 1BHXB 1WQSA 1AY6H 1NRNH 3BV9B 5AHGH 1JRTA 1HAIH 1GDQA 3SI3H 1J14A 3E0PB 2A7JA 1O2WA 3UY9A 2A7CA 2O8LA 1C2HA 1ABJH 3AASA 4QT8C 3R0FA 1YPHC 3LJJA 1Z71A 3I77A 2IPHA 3STIA 3MNCA 4D7FA 1AE5A 1SGTA 2UWOA 2SGFE 3LGUA 3KN2A 3R3GB 1O31A 3VGCC 2BXTH 1Z7KA 3ZVDA 1YPLH 3MWIU 4JZEH 1Z8RA 4B74A 5T6FA 1QR3E 4CREA 4X2VA 1N8OB 1UVSH 1ZSLA 2CHAC 3MHWU 1QL9A 3WY8A 3GCOA 2BY9X 3RXUA 1G2LA 3ZZDA 1TPAE 1MD8A 4XOJA 3T2NA 1SGIB 1ELVA 3QGJA 1O2NA 2A4QA 3MFJA 3LONA 1IHTH 1VR1H 2UWLA 2BQWB 2OCVB 2VVVA 1O3NA 2BVRH 4ZXXH 4WH8A 2SFAA 1CQQA 1P2QA 2O8UA 1QURH 3NK8A 3MO6A 1SGFA 3UPEA 1ZMJA 5DP6A 3HATH 1MAYA 1EX3A 3A88A 2J92A 3RUOA 5FCRA 2Q6DA 3BTEE 5GWZA 1UHBB 4B1TA 1WU1A 1ZTLA 2W26A 1SGCA 1TWXB 2V6NA 2OINA 1HAVB 1K1NA 1TBRH 1Z8IB 4UONA 2ZZUH 1LQDB 1XXDA 2ZDVH 1BMNH 3TH2H 1TB6H 2HNTE 3D65E 2A1DB 1Z8GA 3EGKH 1GVZA 4X2WA 1CU1A 4KTCA 1MUEB 4DURA 3TITA 1QY6A 5DP9A 1V2PT 2UUJB 1L4DA 1UMAH 1AVGH 1EAUA 4ZUHA 1V2TT 2ZPQA 3P8NA 1TMTH 1PPCE 3I78A 1GI5A 1VCQA 3M3TA 1B0FA 3SUEA 1ZLRA 1O5EH 1KTSB 2H9HA 3M7QA 1QBNA 1F5RA 2CF8H 1LHGH 1CVWH 4Q7XA 4X1QU 2TGTA 3B23B 1DY9A 4NFFA 3CP7A 1FZZA 1PQ7A 4B71A 2GKVE 2ZWLH 1G3EA 1W14U 3TIUA 3U1IB 4GLYA 3ZVEA 1O2RA 4X1PU 2GV6A 2HGTH 1C1PA 4AFUA 2BLQA 1IQHA 1GBJA 2FWWA 3U8TH 5LPFA 2H5DA 3TK5A 5DK1A 1TRNA 2OTVA 1J9CH 2BVXH 3RXGA 4ZKNU 1FONA 3VXEH 2CGAA 4NGAH 4NCYA 4O9VA 1QHRB 4Q7ZA 1P9UA 2A2QH 1KLJH 2FOCA 1C1VH 1SVPA 2V35A 2VIVA 1ZJDA 1AE8H 3W94A 4AZ2B 5L2YH 2BXUH 1Q31A 3P17H 3SI4H 2R0LA 2AGEX 3P8OA 3UR6A 1N6YA 1XVOA 2XNIA 5E0GA 5A8XA 1NU9A 2AFQB 1ZTKA 1C2IA 5TCAA 5L6NH 2QAAA 2FESH 1JIRA 2FM2A 1C2EA 1C5XB 1KIGH 5EXNA 2YNBA 3GCHB 3KCGH 1QB9A 2ZEBA 2SGDE 4AYYB 4YLQH 3MU0A 8GCHF 1ANDA 1YPJH 4DCDA 2Y5GA 3A7TA 2BTCE 4I8LA 1CA8B 4TWYA 3A7VA 3QWCH 2GP9B 1V2KT 2G5VA 2ZFPH 3LDXH 4MPWA 3E6PH 1WV7H 5HM9A 2BD2A 3F1SB 2FYRA 1GWAA 2FTMA 1ZPZA 3Q77A 5JBTA 2PKAA 3TU7H 3RXFA 2V3OH 1ZJKA 2CXVA 3JZ2B 2ZF0H 3SUGA 5GJ4B 4X6OA 2CN0H 4NA7A 2AH4X 2LPRA 3GYLB 2Q6FA 3EDXB 1Y8TA 1SLXB 4Y8YA 2ZA5A 3SZNA 1AB9C 1O36A 2BY8X 1A5HA 1P2NA 4LZ4B 1YC0A 3ZZ7A 4B2CA 1GDNA 4NIYA 1TOMH 2ANYA 2P93A 1SQTA 1O3PB 1GVKB 3H7OA 1GPZA 2GX4A 1C1TA 2FOEA 3STJA 1UK4A 1O5DH 1O37A 4ZXYH 5C3NA 1SBWA 3CS7A 3SBKA 1BBRK 1W11U 4D9QA 4TYDA 1LO6A 2D2DA 3VB6A 2F9NA 1V2OT 1BMMH 4F49A 1GHXH 3TK9A 1CGJE 5E0HA 5DP5A 2GDEH 1BCUH 1M9UA 8KME2 1PPEE 4CBNA 4IC6A 3ATMA 1LPKB 3S9AA 3U8OH 4ISOA 1MQ5A 4VGCB 4FU8A 4CRCA 2A0QB 4B73A 1GCTC 1WCZA 1RTKA 1UK2A 2P3TB 1DOJA 1K21H 1V2JT 2OBQA 1SMFE 3TGIE 1W0ZU 2PUQH 5A0AE 2AERH 2QXIA 2NU0E 4ZROA 5FX5A 1CGHA 3PM3A 1NPMA 2Z9GA 3RXSA 1SOZA 4YT6H 1JIMA 1VZQH 1GHWH 1LDTT 1F0RA 1GMDF 4MTBA 2QF0A 1VJ9U 2H1UA 2ZPSA 1O2JA 4F4OC 1D4PB 2HPQH 2BVSH 2K1QA 1TGCA 2AGIX 3ZYDA 1QJ1B 3IWMA 1P57B 1MTSA 1Y3VA 4BXWA 1MTNC 1S5SA 3RXQA 2ZIQH 4ABJA 3SW2B 3M7UA 5EXLA 2JETB 3M5LA 1ARBA 3RC5A 1GI4A 5EGMA 1EQ9A 1FPCH 1RXPA 1WAYB 2ZNKH 1Y5AT 1UVPA 5EPYA 4WF8A 1S83A 2J95A 1ANEA 1DWBH 5CHAC 2PUXB 4Q80A 3VFEA 2VH0A 2R0KA 3A80A 7ESTE 1CHGA 1Q3XA 4Y0ZE 2AIQA 3MNSA 2NU3E 1DS2E 3LU9B 3GY3A 1QA7A 3HK3B 1BTXA 3A86A 4CHAC 2P3FH 3A83A 4YOGA 2A5IA 3UWIA 1NRPH 1Y3YA 1O3EA 4INHA 2F9BH 3GY4A 4CH8B 4GAWA 1O3HA 2OC1A 3TJOA 3BIUH 1V2LT 1T8OA 1W8BH 4UFGH 3U8RH 2FOGA 2QY0B 3LGWA 3RXOA 3SQEE 1C5ZB 1MU6B 1EOJA 3V0XA 1WSSH 2STBE 1HCGA 4ABHA 1HAVA 1MTVA 3D23A 1DLKB 3PB1E 1V2NT 1A2CH 1EAIA 1O3IA 4IS5A 3F6UH 2Y7XA 3V3MA 3MH7A 1EAWA 4FUFA 3RXIA 1D6WA 3KQEA 2GZ7A 3P95A 2TGDA 1J16A 1P12E 3RP2A 4WMFA 3O8DA 4MNYA 3RC4A 1QNJA 2EI7A 1AMHA 3EA8A 4OS6A 2CMYA 2UUYA 3LC3A 2VGCC 1D3TB 1XUFA 4UEHH 2XYAA 3MU1A 1GJ4H 2AGGX 1EPTC 4BAHB 2VIDA 4YZUA 2BOKA 1C2JA 1W2KH 2BDBA 1OP2A 1UVUH 4WMEA 1BBRH 1DDJA 1B5GH 3VGCB 3GDVA 2GMTC 5AF9H 4K1EA 2ZECA 4NFEA 1MH0A 5FXLA 5A0CA 1P3CA 3C1KA 3ZVAA 4BXSA 5F6MA 2BD4A 2FLRH 1NFYA 1BTHH 2PGQB 2CHAB 9ESTA 1VITH 2B0FA 1PPBH 1B7XB 1F7ZA 1DWEH 1FIWA 3FP7E 3L3TA 1ACBE 1ELEE 2CV3A 2QV1A 3LC5A 5C5NA 1PFXC 2ZFFH 1GGDC 4DIHH 2P94A 1F2SE 2Y5FA 3RM2H 1DT2A 1GJAB 1HDTH 2ZHQH 1EAXA 1XKBC 3K2UA 3ZVFA 1T8LA 1T7CA 1FI8A 3RMNH 1THSH 1HAOH 1O2GH 1NFUA 2A31A 3BTDE 3RXBA 1GHBG 1NRSH 4GCHG 1DSUA 4ZKOU 1FV9A 2Q6GA 1C5PA 3ZV8A 3DFJA 3NPSA 1C2MA 1FY3A 1TE0A 1HAZB 2DUCA 4YLUA 4BAMB 4YT7H 1SPJA 5GPIB 3TGJE 3H5CB 1KY9A 2OD3B 3OYPA 3PYHA 5LPRA 1GL0E 2ZGXH 2BDHA 1A7SA 2XCFA 4FU7A 1P03A 1C5UA 1QB6A 4FUGA 4JMYA 1KXFA 2H9TH 5PTPA 2ZP0H 4BTUB 2QXJA 3BTQE 2QN5T 2P95A 3T25A 3UOUA 2VU8E 1KXCA 2P3UB 4OS5A 3RU4E 1Z8JB 3UQVA 4DW2U 1EJAA 3QZRA 1C2KA 2BOHB 3A87A 2G8TA 1GJ6A 2ZI2H 4GHTA 1GI8B 3KQDA 1SQOA 2W5EA 4YM9A 1EZXC 2EA3A 3PMAB 1SQAA 1WYKA 5K7RA 4D9RA 4ISHH 4AB8A 4X1SU 1HJ9A 3P8FA 1K1JA 2FX4A 3LKWA 1GBFA 1ETSH 1AKSA 2THFB 3RMLH 3SHAH 1AIXH 1NRRH 1OS8A 4TY6A 1DVAH 1CSOE 1G30B 3I29A 2FTLE 4A7IB 1O5GH 2G55A 1JXPA 1T4UH 4XDEA 5DJ7A 1D9IA 1HIAB 3BIVH 2ZDKA 1G2MA 3DD2H 1QRWA 4Y10E 4KGAA 1BJVA 1J15A 2TGPZ 3KHVA 1O38A 1MTWA 2XBYA 1O3LA 5EW2H 3PO1B 1CT4E 1NROH 2V0BA 3M35A 1AGJA 1YBWA 1MAXA 3GCTG 1A61H 2A5KA 1O3MA 2QYIA 1LTOA 5GXPA 1O3KA 2SNVA 1FY8E 3BG8A 1GBBA 3RXMA 1DWDH 3RXDA 3A8CA 3VB3A 1O33A 1QIXB 2GT8A 5F8XA 1AWFH 2XCNA 1C1QA 1ZPCA 1OOKB 4FUJA 2ZPRA 3TH3H 1HJ8A 1GL1A 1UVOA 4FU9A 5A8YA 4IMZA 3SU1A 1O2YA 4CRBA 1HGTH 5JBAS 4H6TA 2F3CE 3LJOA 1DM4B 4WXVA 4M7GA 1EP6A 1YPEH 4H4FA 4CR5A 5FPSA 4FXGH