1GJDB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 53
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB01
3D62A 2CGAA 1DANH 4B76A 5BPEA 1S5SA 1ZTLA 1FAXA 3T2NA 4J1YA 1F92A 3JZ2B 1C1QA 3F9EA 1HUTH 3S9BA 3EA8A 3SI3H 3RXUA 2WPMS 4YT6H 2PLXA 1ELBA 5EGMA 1A5HA 3ZZ6A 1WOFA 3A7TA 4D8NA 3ZZCA 2K1QA 3ATLA 2FPZA 4ZHLU 1TPOA 1V2MT 2HRVA 3MYWA 1P12E 2Z3CA 5AF9H 2VB0A 1DLKB 4DCDA 3NZIA 3T62A 1FV9A 2P16A 3ENSB 5L2YH 4UFFH 3MNBA 1EZUC 1SGEE 3OTJE 4UFGH 2ZIQH 1S84A 1LHEH 2P3UB 1W8BH 1SHYA 3QK1A 1GHAF 4MPXA 4AFSA 2VVUA 3V3MA 3ATMA 5GCHG 2C3SA 2G4TA 4TYDA 1O3FA 3LT3A 4JYUH 3ESTA 4CRGA 1XKAC 3URDA 1YKTA 4GHTA 1TRNA 2QN5T 1GGDB 1YBWA 2QCYA 1TGNA 3T26A 2OC8A 3M7QA 2IN2A 1TQ7B 1OWJA 5F6MA 3SUEA 1GBJA 1OP0A 2G4UA 2ZNKH 2R2WU 2NU2E 1TGSZ 4UD9H 4X1PU 1JRTA 1Z8RA 2BTCE 1TPSA 3KHVA 1F2SE 1XM1A 4H6SB 4ISHH 2W26A 3BG8A 8KME2 3TLOA 1ANEA 4KTUA 1LHCH 4O97A 1ZMNA 3BIUH 1BRUP 3BV9B 1UTLM 3Q3KA 1FONA 2RA3A 4X6OA 1FN6A 3S0NA 2ZDNA 1O3KA 3RXJA 2SGEE 2A0QB 1JMOH 1UVOA 2XC0A 4A1XA 4OS1A 1CT2E 3QWCH 1O2HA 1OWKA 3DA9B 1BTPA 4ZHAA 1AKSB 4YZUA 1LVYA 1V2TT 2CF8H 1F0UA 5J4QA 1MKWK 3ZZ4A 1IQHA 1QR3E 1AFEH 1P09A 3SV6A 1PFXC 1ESBA 4A1VA 4NCYA 3MHWU 1M9UA 2QAAA 1HAOH 1Y5BT 2FDAA 2GZ7A 5GDSH 2H9EH 4UFEH 1UK3A 3RXMA 2F3CE 1C2FA 1ZPZA 3MU5A 4FUIA 5FHTA 4JZ1A 4ZKOU 4DIIH 1SGIB 1SGPE 5TJXA 4H4FA 3QTVH 1Z8GA 4JK6A 1MKXH 1TGTA 9ESTA 1TPPA 1FLEE 5E2OA 2VIWA 4ABIA 2PGQB 1NPMA 1RIWC 3ZVAA 1XXFA 1SI5H 8LPRA 1S82A 3H5CB 1Z6JH 1GCTB 1O5AB 1J8AA 1GMCG 4X1NU 2BY9X 1UCYH 5EW2H 4X6NA 3TK9A 2UWLA 1TLDA 4OS4A 3GY7A 1MQ5A 5T6FA 2F9PA 1IHTH 2EI6A 1C5NH 2A7HA 1UK2A 3HK3B 1ABIH 1FY3A 4X2VA 4JZEH 1CQQA 2SFAA 1C5LH 4Z0KA 1GCDA 1WBGB 2ZHFH 1G32B 3SNCA 4SGAE 2BY5X 1XUIA 1UVTH 3S7HB 1N1LA 2A5IA 5C20A 1GI5A 1Y3WA 1P2JA 3BTFE 1ABJH 4I8GA 4FUDA 4YT7H 1P3EA 3MH7A 1F5KU 3GCNA 1YPMH 4GLYA 5GCHF 3O8RA 2B9LA 1Z8IB 3MU1A 2PW8H 1NT1A 1LCYA 2A32A 2OXSA 4UDWH 4WY3A 1G2MA 1O5EH 2AH4X 1OS8A 1AFQB 1NROH 4ISIH 5EXLA 1YPLH 2G81E 2AS9A 2BD3A 2HPPH 3SQHE 3K9XB 4BTUB 2ANKH 1HDTH 2M5TA 2NU1E 2XBWA 4PROA 3LONA 2OBQA 1QJ6B 1BRBE 1XUKA 5GXPA 5AFYH 1HCGA 4X1SU 1EQ9A 1SLUB 4BTTB 1DOJA 2ZFFH 1QL8A 2J94A 3PROA 3KGPA 1W12U 2BLQA 4GPGA 4AB8A 2PUQH 1C5OH 5EQQA 1OWIA 5FPTA 4DIHH 1UO6A 4TY7A 1GI4A 1NFYA 2WV4A 3ZZ5A 3RP2A 3BSQA 2ZKSA 1MBQA 4KTCA 4ZKNU 1HAPH 1ZRBA 2PWXA 3ODFA 1GHBG 3LGIA 5T6GA 1SGQE 4XFQA 4A7IB 4NWKA 1HAVB 4Y6DA 4IN1A 2B0FA 1ACBE 1O0DH 3KIDU 1RS0A 2IJOB 4FXGH 1EJMA 1LDTT 1EJAA 3CS0A 3SW2B 3KNXA 2VWMA 1FNIA 2WUBA 4NWLA 1HAYB 4IN2A 5EXNA 4HI3A 1UVPA 1XUFA 3P92A 1LVMA 1YPHE 3VB3A 2WPLS 2F9VA 4X8VH 2AIQA 2BLWA 1BDAA 4R0IA 4RSPA 1P06A 4K8BA 4D9QA 1G3DA 5T6DA 3QLPH 1ZHMA 4K69A 1IQNA 5FCKA 2AMQA 1C1PA 1DLEA 1O3DA 3TNSA 1LKAA 1GMCF 4AORA 3RXHA 1GBTA 1TMBH 1Z1JA 3SU1A 2QA9E 3D23A 1EUFA 2ZGCA 2OLGA 3LJJA 4B71A 3BG4C 1UHBA 2H6MA 4FUGA 4ISOA 4WMFA 5K0HA 3BTME 1LTOA 1YCPH 1ZOMA 3T5FH 3A85A 2VNTA 1TX7A 3LDXH 5TCCA 2ZU5A 1BTHH 1BMLA 1C2GA 5FXLA 1ZJKA 2GV7A 1SOZA 1QNJA 1C1TA 3QO6A 2O8WA 3BTWE 3A82A 1O2XA 3BTTE 3UNSA 4MVNA 1PYTC 3FZDA 2I6SA 1N8OB 3IG6B 2TGAA 1K1IA 4SGBE 4AOQA 2RA0A 1ZGIA 1YLDA 9LPRA 3ZZ7A 3GCHB 1BUIA 1J17T 5G4BA 4RKOB 1CT4E 1NFUA 1V2VT 1GBFA 3L33A 1ESTA 4YO9A 1GHWH 1AO5A 1FY8E 1O34A 1LPGB 3UNRA 2FS9A 5C1UA 5HM9A 1YP9A 1V2UT 4DJZB 1Z8JB 3LOXA 3SV2H 1AGJA 3ZVCA 1IAUA 4UEHH 4CRAA 2NU4E 4DOQA 5ESBA 2HWLB 2PHBA 3GY8A 1DDJA 3A8DA 1MZAA 2BYAX 4FUHA 3SV8A 5JBCS 1ZSJA 1LQEA 3V12A 3MFJA 1G3CA 4JYTA 1EPTB 3TVJB 5A0CA 2O8UA 2J34A 2ZF0H 3UWJH 3GY6A 1KIGH 2BY7X 3PYHA 1MCVA 4O9VA 1FAKH 2B8OH 2EI8A 3DT0H 1GHBF 4X2YA 3VPKA 1HAIH 1O39A 1TNLA 1RFNA 1ELCA 1L0ZA 4R8TB 2R2MB 2PSXA 3LGUA 1P9UA 4MTBA 1EP6A 2FZZA 3GY5A 3TU7H 1Z71A 1C4V2 2D8WA 4E06H 1B0FA 4I31A 1C2DA 3BTGE 1DICA 3M35A 1PPZA 3FZZA 1GGDC 2VGCC 1O3NA 1EZSC 3KN2A 2ZGXH 1IQLA 3ZYDA 3VB4A 2VWLA 2Z3EA 4NA8A 3RXLA 3SQEE 3P8GA 4JCNA 3SO3A 1Y3XA 1HBTH 2FM2A 2YNAA 3GYMA 1TNHA 2RDLA 1LQDB 2ZDLA 4NFEA 3FP7E 1HFDA 3PLKA 5E8EH 2TBSA 2WPHS 2F9OA 1TX6A 2AMPA 1SVPA 2ZHDA 3KCGH 2VWNA 3BEIB 1AKSA 2H2ZA 3PMBB 3SOSA 1O5GH 4OS2A 1BHXB 1HJ8A 2ZG0H 2OINA 1EAWA 3V13A 1HAGE 1PPCE 3PO1B 2FOMB 3ZVBA 5IDKA 5K7RA 1EB2A 1QB6A 1ELFA 2B5TB 1N6XA 3A86A 1C2EA 1PPEE 1C1MA 1NZQH 4DGJA 2FOHA 4Q80A 1QCPA 3RXFA 3UWIA 3ATWA 1GBDA 1K1JA 5DGJA 5FPYA 2NU0E 1ZYOA 3QN7A 3M5OA 4X0WU 3LKWA 2BQ7B 1MTNB 4ABFA 2FTLE 2FX6A 1AWFH 1V2WT 4ASHA 1BTYA 3GDSA 3PMHB 3SUDA 1QQUA 1A5IA 3SBKA 1CGHA 3MH5A 2AGEX 2Y7ZA 3EE0B 1C5YB 2BXUH 2H1UA 6GCHF 3TH3H 3HGNA 2QXIA 2V3OH 5HMAA 1Y8TA 1GBEA 3ZZ3A 1QFKH 1AQ7A 3QZRA 1GCTC 1AWHB 1FY5A 1QL7A 4TPIZ 1E38B 1S81A 1VZQH 2VVCA 3RXEA 1CHOG 4Y8YA 3SGBE 3RU4E 3U1JB 3EYDA 3E0PB 1TOMH 1E34B 4ISNA 1FDPA 1GVKB 4WMDA 2C4FH 2TGDA 2Z94A 3GCTF 1CA8B 1P03A 3RXOA 1FPHH 1P05A 2ZU3A 1SQTA 1PYTD 2B7DH 6CHAC 2G8TA 1G9IE 4MPUA 1TNIA 5DP3A 3T29A 1TAWA 1TRYA 2W3IA 1O3PB 2J92A 3V7TA 2BQ6B 1K1LA 2G5NA 4TY6A 3OX7U 4X6MA 2RCEA 3K6ZA 3RXQA 2PR3A 3ZVGA 1Y59T 4B2CA 5A8ZA 3GCOA 2H9HA 3MNCA 3RMOH 2C8YB 4ABEA 1A1RA 1FQ3A 1QTFA 1BQYA 1SB1H 1O3LA 2GVFA 2TGTA 4KKDA 3SUGA 3O8CA 2A1DB 5F8XA 1C1VH 5DPAA 4U32A 1C1WH 1O2TA 3RXGA 3TJVA 4LZ4B 4YOJA 5FX6A 1AFQC 3ODDA 3QUMP 4YLQH 5HM2A 1J16A 1V6DA 3UR9A 2GX4A 1P2IA 4Q2KA 1MUEB 3C27B 1F0TA 5CE1A 3RUOA 1QY6A 3GYLB 5EPNA 1KXBA 4Y11E 1IQGA 3RC6A 2BD4A 3RMMH 3T25A 3SN8A 1O33A 1O2LA 1SGRE 4A1TA 2QF3A 7GCHF 2VIDA 3LGVA 1HYLA 3PV4A 1FY1A 5C1XA 3NCLA 4GCHG 2Z9LA 2R0KA 1NRRH 5JBTA 2W3KA 3UQVA 1HAVA 1TMTH 2ZCHP 4AG1A 1MKWH 3SGQE 3UR6A 3FP6E 1O32A 1FPCH 1H9LB 2Y80A 3LU9B 1YM0A 4X2WA 3S9AA 1G3BA 2XBVA 3U8OH 1TBZH 1V2ST 4AN7A 1GJBB 2CN0H 4TWYA 3MOCA 1SHHB 1CGIE 2BVSH 2GTBA 1EZQA 4HFPB 4HTCH 3KEEA 1W14U 2OC1A 1SSXA 3A7ZA 2ZEBA 1O2GH 2VIVA 3RXCA 1PQAA 2XWBI 2D26C 4CRFA 1W7GH 3NWUA 1SG8B 2PKSC 1DSUA 3NPSA 2ODYB 1O5BB 3A7XA 1UTNA 4GAWA 3EGKH 4NFFA 3P8OA 2ZU2A 3TIUA 4CBNA 1AE8H 2A7CA 4B2BA 4OS6A 2ALPA 2VGCB 1TPAE 2FMJA 1P0SH 1SGTA 3LJOA 3OYPA 1NRQH 1E37B 3OSYA 3M3SA 1GI7B 1ID5H 3Q77A 1XMNB 3M5MA 3PMJA 1O3CA 1O2WA 2XC5A 2SGQE 1Q3XA 2BDCA 1KY9A 2BDHA 2BX4A 1EAUA 1QA0A 5E0GA 1CHOF 2F9BH 2Z9IA 3UUZA 4ESTE 4WMEA 3A8CA 1O37A 4XBCA 1FY4A 2VIOA 4Y0YE 1ANDA 1QL9A 5L30H 3ZVEA 1W0YH 1ESAA 4YM9A 3Q76A 3NK8A 1CGJE 1BOQA 1HIAB 3GISB 4E7NA 1T8NA 2YOLA 1Y5AT 2C8ZB 4I32A 4THNH 2R0LA 2FYRA 1O2SA 2ZGBH 5DP8A 1OWEA 4H42U 5C67A 1GMHG 3KQBA 3RXAA 1ZRKA 3FP8E 1YPJH 1N8OC 4ABDA 2SNVA 4CRCA 1VGCB 4NA9H 3JZ1B 2ZC9H 4DY7B 4LK4A 1EXFA 5CMXH 1C2JA 2XCFA 4XOJA 1SGFG 1UTMA 4BAQB 3GCHC 2FS8A 1SBWA 2W7SA 1CSOE 2GZ9A 4LZ1H 1OWDA 1DFPA 2FEQH 2OUAA 5A8YA 1WYKA 4I33A 1O30A 1KLJH 1CHGA 1K22H 5LPRA 3E8LA 2PGBB 4BXSA 1AI8H 1EPTA 2ZA5A 2AMDA 2VVVA 1X7AC 2PUXB 2FOBA 4MPWA 2VU8E 1XUHA 3Q3XA 1H9HE 1TNJA 1CU1A 3DFLA 3VXEH 1EAIA 1NN6A 2ZFPH 3TJUA 1YPHC 2A4OA 1UK4A 3PB1E 4AFZA 1DY8A 2VINA 1UVSH 3I29A 1HXFH 4GCHF 5AHGH 1ZSLA 1EPTC 2AYWA 1LVBA 2Z9GA 3F6UH 2ZTZA 3A80A 2Y5HA 3VB7A 1L1JA 1YPKH 1XUGA 2ZU1A 3SJOA 6CHAB 1P9SA 2QIQA 2TGPZ 1GI2A 3SJ9A 1AU8A 4OS7A 1YYY1 2ZQ1A 2J2UA 1DUEA 4K1TA 3UIRA 1BBRK 1NY22 1WTGH 3MNSA 4NIYA 4DG4A 1K1NA 1GJ8B 3SHAH 3RXPA 1THPB 4CH8B 1DVAH 2STAE 3F68H 2BMGB 4E7RG 2Q6FA 2ASUB 1TFXA 1VCPA 1AB9B 1VCWA 2OBOA 1LHFH 3P95A 1T32A 4K2YA 1TMUH 1O3GA 3TK5A 1MH0A 1GJCB 1PQ5A 3A8BA 3WY8A 1GI1A 1QBOA 4IC5A 3TH2H 4F4OC 1ZLRA 5JYIA 3C1KA 3RMNH 2H5DA 3RC4A 3MO6A 5FBIA 2ZPRA 4Y8XA 5F8TA 1AUTC 1ELTA 4IBLH 2BDIA 3D65E 2OCVB 3Q3YA 1ZHPA 1DSTA 5EPYA 2QXHA 4JMYA 5DP4A 4WXIA 2TRMA 1NU9A 2OC7A 4XDEA 4JK5A 5C1YA 2A2XH 1GI3A 3BTQE 1AE5A 4AZ2B 4YOIA 2KAIB 5EW1H 1GWAA 2P3FH 2FOEA 1V2PT 4K1EA 3MO9A 2BD7A 1C1OA 4H6TA 1OP8A 3PO1C 1UVUH 3SHCH 2IPHA 1TWXB 2Z9JA 3SNEA 2A4QA 3LH3A 1NRSH 1BZXE 1KSNA 4AYVB 4WWYA 1AMHA 3LPRA 5EXMA 2J9NA 2ZDMA 1UTKA 1O38A 1Z6EA 1H8DH 2ZCKP 2ZHEH 4GVUA 1ANCA 1AZZA 4FU7A 1HPGA 4I8KA 1GMHF 1V2OT 2O8TA 3BTHE 3SI4H 2GD4B 2QV1A 2Y81A 2PSYA 4RN6A 4FUBA 1O3OA 1C1SA 1L4DA 1IQJA 1VCQA 2XWAA 4D7GA 2PKSB 3ZYEA 3LH1A 3N7OA 1MTNC 3EAJA 1EB1H 2GDEH 1C2IA 3S7KB 1GDNA 3RM2H 3GICB 4BAHB 4JYVH 1ETRH 5F8ZA 2BLVA 4X8TH 4DURA 1K9OE 1HXEH 2XBYA 3M5NA 3I77A 3U69H 1L2EA 2FI5E 4AFUA 2STBE 1C5XB 1GG6B 3ZVDA 4Y7BA 1KXCA 1SLWB 3RDZA 1FJSA 1S6HA 4WH8A 4B73A 3ZZDA 1VJAU 2GP9B 2A5AA 1P11E 4TPYA 1A7SA 4OGXA 2Z9KA 1DWBH 2SGPE 1GBMA 3DFJA 2HNTE 3I78A 2BDAA 2FLRH 3ITIA 3KQCA 4ABHA 4MNXA 4ZHMU 5CHAB 3M7TA 1ZMLA 2QGRA 1TOCB 1ZJDA 5T3HA 2C90B 4F49A 4O3UA 3T27A 1P8VC 4M7GA 1TABE 3VB5A 5DO4H 3A7YA 2XW9A 3MO3A 2A45B 1GI6A 1P57B 1TGBA 2P95A 2IOTA 2FODA 2FI4E 5DP7A 5DG6A 1C5TA 2UUJB 3SNDA 3RXSA 3IITA 2XCNA 1O2OA 1W10U 1P2OA 5E2PA 5JBAS 1FIZA 4XE4A 2BX3A 1D3DB 1QJ7B 1EASA 1O3HA 2FOCA 3P17H 2OTVA 3TJNA 5F03A 3LIWA 3RC5A 3UPEA 2FOGA 1HNEE 4A6LA 3AAUA 4NSYA 1QRZA 3M7UA 2NWNA 2ZPQA 1H8IH 3UQOA 3E90B 3TGIE 1QRXA 3ATKA 3B23B 3HGPA 1DWEH 2ZGHA 1Z1IA 3HKIB 4INHA 2Y5GA 1ZMJA 1ARCA 1P2MA 1B0EA 2J95A 2GV6A 2QXJA 1GVZA 3SNAA 3ZZ8A 1E35B 1H4WA 2HOBA 1UTOA 1WAYB 1G2LA 4BANB 2O8LA 1SGYE 1MQ6A 2BD5A 2CF9H 3SU5A 1WV7H 3H7OA 1V2RT 3H7TA 5JBBS 4IW4E 1BHXF 4MNWA 1C2KA 1BMMH 4CR5A 4NZLA 3MU0A 3RLWH 2A4GA 1SGNE 1FZZA 2ZHWH 2Q1JA 3F9HA 1RD3B 1DPOA 3PWCA 2D2DA 1KTTB 1L1GA 2GMTB 2BDGA 1D6RA 3VXFH 3K2UA 3V0XA 2BZAA 3ELAH 5H4IB 1O3EA 2FYQA 4ZXYH 1E0FD 1QB1A 1P2KA 5I46H 5JB8S 1SL3A 2Q6DA 2G5VA 4CRBA 1AD8H 3SJ8A 1P3CA 1AY6H 2QF0A 3AVZA 1HB0B 1YCPM 3T28A 1NU7B 3AW1A 3AW0A 2AIPA 2GKVE 5FPSA 1QURH 2H5CA 2P8OB 1MTWA 3QGJA 2XYAA 1BRAA 1PPGE 1KYNA 3D49H 4WXVA 4Y8ZA 1IHSH 4UFDH 1Q31A 3OU0A 1O35A 2BLOA 4I8LA 1PPBH 1DUAA 1JWTA 5EG4A 3QX5H 5FAHA 1KXDA 5GPIB 5IYTA 2P93A 1HRTH 1P02A 2WYGA 1O5DH 1ZZZA 1O3MA 1O2KA 4Y7AA 2A4RA 2AEIH 2WYJA 1O2IA 5EQSA 2JH6D 4INLA 4ZAEA 1KDQB 1WSSH 1XXDA 1GBBA 2FWWA 1SGCA 3QTOH 2VIQA 1MAXA 3KF2A 4FUFA 1OOKB 1VR1H 3NXPA 1IQMA 3SV7A 2ZFSA 3BEFB 1VGCC 1P2NA 5SGAE 1GHXH 1NC6A 1LO6A 3W94A 2XRCA 2DE9A 1CT0E 3R0FA 2R3YA 3TH4H 3LGWA 3MU4A 5JDUB 2H9TH 1W3CA 1A3EH 1KXEA 1O2YA 1W2KH 1QQ4A 1C5MD 1T4UH 1KLTA 1DM4B 1VITH 4INKA 1P10A 1GI0A 3F9FA 4NIWA 1N6YA 4BNRA 3OY5U 1TYNA 2VWOA 4Y10E 2YNBA 1A0LA 1C4U2 2BD2A 1TBQH 2AGIX 1S83A 2ANYA 3BTDE 4HGCA 2AERH 3Q00A 1JOUB 1OWHA 1THSH 2OQUA 2PFEA 3HK6B 4IC6A 2ZO3H 1TNGA 4MQAA 8GCHG 1YPEH 4CHAC 2PV9B 4JZDH 3E16B 4FU9A 4FVBA 4Q7XA 4ABAA 1BMAA 3SUFA 1WTHD 1HAXB 2EEKA 2Y7XA 4Q7YA 4K3JA 1NTPA 4FUJA 1GI8B 3ZZ9A 2CHAB 3RU4T 1O5CB 2ESTE 3R3GB 1HGTH 1ARBA 4AG2A 2SNWA 1F0SA 3PLPA 2WPJS 1AB9C 3PWBA 1ETTH 3MI4A 2ZFQH 1NM6A 2XNIA 1LHGH 3U8TH 2A7JA 2GT7A 1JRSA 2UWOA 1ORFA 1TRMA 3TNTA 1GJ9B 1BIOA 5ABWA 1JXPA 1O2PA 4JZFH 2KAIA 4B2AA 1V2LT 1LVOA 4NSVA 4AFQA 3TITA 1BTXA 1AVXA 1OYQA 4ZROA 4GSOA 3F1SB 1T4VH 5HGGA 3GOVB 1WUNH 3L3TA 4UE7H 4KELA 2EI7A 1BB0B 2ZTXA 1DWCH 1J14A 3RU4D 2WV5A 1O3IA 1NO9H 3UFAA 1EJNA 1XX9A 1BT7A 1UJ1A 3A89A 2UUYA 1IOEA 1W7XH 4K8YA 4LXBH 1A0JA 3AAVA 2C93B 2C8XB 1MD7A 2FO9A 3STIA 1ELAA 1RXPA 1XUJA 1C5SA 1TIOA 1PJPA 1LHDH 1O2RA 4O03A 3K65B 1BITA 1EZXC 2FTMA 4IMQA 2FOFA 4Z6AH 1LKBA 2CV3A 2P94A 4J2YB 4NIVA 1D3TB 1TONA 2ODQA 1GJ7B 1F0RA 2OD3B 1FN8A 2FOAA 1SLXB 4WVPE 1SGDE 1C5UA 2EC9H 4RKJB 4XBBA 1AVWA 4U30A 3U98H 1K1PA 2DE8A 1DXPA 3EQ0H 3FANA 1S85A 1Y3YA 3P8NA 3LC5A 1GG6C 1P2QA 1J9CH 4QT8C 5AVDA 3KQDA 5FX5A 1YC0A 2FP7B 1YF4A 2GCTB 5FBEA 3E0NB 3OY6U 1BJVA 1KXAA 2J38A 4YESB 4FU8A 4MNYA 5A0AE 1BBRH 3NUMA 1SGFA 4FUEA 3SU4A 1B7XB 1VITG 2XXLA 1OYTH 2ZCLP 3ZZBA 4CBOA 4A5TS 8GCHF 1O3JA 3PTNA 2BD9A 1W13U 3RXDA 3EA9A 2G00A 1JIRA 1BMNH 5CHAC 1CBWC 3UREA 3B9FH 4ZUHA 5JPMH 1CA0B 2BY8X 5EOKA 1C1NA 1UTQA 5AFZH 1LPZB 3PTBA 2FIRH 2GGVB 1V2NT 1GJ5H 2WPIS 4D76A 3MMGA 1BRCE 3NKKA 2ZI2H 1HJAB 2LPRA 3HATH 3SNBA 1SFIA 2ANWA 4ZH8A 4TWWA 2V3HH 3EDXB 4MG3A 1NFWA 3EA7A 1MCTA 1HJ9A 3QZQA 1GBAA 1IQEA 2UWPA 4X1RU 1HAHH 3A7VA 5BRRE 1OXGA 2ZFTA 2QYIA 1ZGVA 1O31A 4HZHA 2NU3E 1AVGH 1PPHE 1TB6H 2F83A 4X2XA 1F5RA 4U2WA 5E0HA 4KTSA 1LPKB 2V35A 5HYOA 5DKMA 3MH4A 2OC0A 3RXVA 2Q6GA 4NZQA 2ULLA 3GDUA 1FUJA 1L1NA 4XBDA 3VFEA 4OS5A 3SU6A 1Z7KA 2ZDKA 3TPIZ 3TGJE 2BOHB 2FXRA 5C2ZA 1QHRB 1B5GH 5ETXA 2BVRH 1SQOA 5I25A 5L2ZH 3U8RH 1ZHRA 2CMYA 1H9IE 2UUFB 4BTIB 3GY3A 2PKAB 1S0QA 1DY9A 4NG9H 4CHAB 3GDVA 1DE7H 1NESE 1O2QA 2VH6A 3MH6A 5A0BA 1RTKA 1U6QA 1C5VA 2HGTH 4B75A 1T7CA 3A84A 1IQFA 2BM2A 5DK1A 4OGYA 4BAMB 3ZVFA 1D4PB 2BDBA 2XC4A 3BTKE 4I8JA 2HNTC 1GMDG 1C5WB 2ZHQH 2GMTC 1BTWA 1GBIA 2G51A 2ZPSA 3E6PH 1A0HB 4CREA 1D6WA 1F5LA 2Y5FA 1DT2A 2GZ8A 1EATA 2R3UA 1C5QA 1MMJN 4IMZA 1UTJA 4ISLA 3GY4A 3A87A 1AN1E 2V6NA 2VJ1A 1G3EA 3E1XB 4CH2B 4AX9H 5LH8A 5PTPA 3VGCB 1QA7A 2P8OC 3MTYA 2BB4A 3PLBA 2QXGA 4BAOB 2AGGX 5ESTE 4BXWA 5EU8A 2UUKB 5LPFA 2O9QA 1OKXA 1MTVA 2XTTB 2HLCA 4D9RA 5A2MH 1OP2A 2G55A 1K28D 1DX5M 2VH0A 4A92A 3SGAE 3E3TA 1D3PB 1KTSB 2PTNA 1PQ8A 4VGCC 1KDQA 1H1BA 2W5EA 1VITF 1VJ9U 1K2I1 3UOUA 1C1RA 2FI3E 4IGDA 4MDSA 1OX1A 2GDDA 2TPIZ 2CXVA 3FVFB 1MKXK 4MPVA 3RLYH 3U1IB 3MNXA 1MBMA 3SJKA 1SOTA 1KXFA 1O5FH 7LPRA 1O2VA 1NS3A 5GIBA 6ESTA 1UCYK 5JB9S 1QBNA 4I7YH 2Z7FE 1A4WH 4Y76A 3L6PA 5B6OA 2BQWB 5GWZA 2OP9A 2O8MA 5HXFA 4WJG2 1SR5C 4K60A 5DJ7A 1DWDH 3QDZB 1QB9A 2JH5D 1DITH 1ANBA 3CENA 2DUCA 1T31A 4AGJA 3TJOA 1SC8U 1SQAA 1A2CH 2P59A 3S69A 4K1SA 2FX4A 1E36B 5LPEA 4CR9A 2ILNA 3M3TA 1P01A 4JZIA 3MWIU 3G01A 3BF6H 4DVAU 1WQSA 1AHTH 1T8MA 4YTAA 3SV9A 1EOJA 1AUJA 3A81A 2ZGJA 1C9TA 3B8JA 1WU1A 3RM0H 4Q7ZA 4X6PA 1W11U 3PMAB 3ZV9A 3HKJB 2BD8A 1ELVA 2ALVA 2F9UA 3E91A 2JETC 1TA6A 3UTUH 1ELEE 1CBWB 3BTEE 1YLCA 1V2KT 3PM3A 3U9AH 7ESTE 3RXRA 2BXTH 3RXIA 1A3BH 4ZMAH 1NRNH 1UTPA 1Y3VA 1WQVH 1BA8B 2JKHA 2CHAC 2XBXA 3ZV8A 2GCHG 2SGFE 1HV7A 3DUXH 1GMDF 4KP0A 1IQIA 2FLBH 1RJXB 2Y82A 4MNVA 4WH6A 3A83A 4GHQA 4WF8A 1SLVB 4KGAA 1O2ZA 5C5OA 1CO7E 1OSSA 4B1TA 1ZPBA 2WPKS 1QGFA 5A8XA 1GDUA 1GJ4H 4B74A 1HAZB 2HNTF 2SGAA 1BBRE 3S9CA 1OPHB 1GJAB 3TGKE 2ODPA 2ZU4A 1KLIH 2JH0D 3DHKH 3A8AA 1T8LA 1ZTKA 5L6NH 3M37A 3M5LA 1A5GH 1C5PA 1K21H 1O3BA 3P70B 1SMFE 2Z3DA 1C1UH 5EQRA 2WINI 3P6ZB 1EKBB 4AYYB 1PPFE 1TALA 1EP5A 3RMLH 1L4ZA 6GCHG 2EA3A 5TCAA 1RIWB 4Y71A 1A61H 4ABJA 1EAXA 1DS2E 3CS7A 3BIVH 1GVLA 1O3AA 1SPJA 3QGNB 1V3XA 3BN9A 2HPQH 2ZDVH 2PTCE 4ZXXH 3LGTA 1DXWA 2D1JA 1XKBC 3IWMA 3RXBA 1HLTH 2LNCA 1MU8B 3GCTG 3SU3A 8ESTE 3ZZAA 3A7WA 1NRPH 2AFQB 4NA7A 2HALA 3UOPA 3M36A 1BJUA 2CJIA 1BTUA 3K6YA 1TX8A 1TA2A 2ZP0H 3MU8A 1C4Y2 3M61U 3SU0A 1QBVH 3VB6A 1Y3UA 1YCPK 2RG3A 1GBCA 2QC2A 4XSKU 1WCZA 1P04A 4NGAH 2SGDE 1GHVH 1ELDE 2R9PA 3URCA 1G30B 1GJDB 3W95A 5J4SA 1BTZA 3A88A 1GJ6A 1SFQB 1Y5UT 1ELGA 1J15A 1TE0A 3M3VA 1HIAA 1CE5A 3RXTA 1GBLA 1UCYE 2GCTC 4IS5A 2HVXA 1MAYA 1TBRH 1QRWA 3SJIA 1T8OA 1C2LA 3FAOA 1ZPCA 4VGCB 3UY9A 5LGOA 4NIXA 2ZQ2A 2W7UA 4DT7B 2ZECA 1Q2WA 3AASA 3O8DA 7GCHG 2Y6TA 1D3QB 2C8WB 4E05H 2BZ6H 1CA0C 1ZTJA 2ZTYA 4MLFB 4DW2U 1TNKA 1ZSKA 3P8FA 5C3NA 5E0JA 5C5NA 4YOGA 1GPZA 1MD8A 1YGCH 4GUXA 4U01A 4BOHA 1HJAC 1G36A 4BAKB 2GCHF 1W0ZU 1MU6B 1FXYA 4Y0ZE 1EX3A 2ZFRH 1O2MA 1GHYH 3GY2A 3HPTB 1NFXA 1K1MA 1D9IA 1MZDA 2FESH 4CRDA 1RGQA 1GBHA 4ZKRU 1V2QT 1THRH 3TK6A 1GHAG 5A09A 1AZ8A 2WUCA 4LOYH 3SU2A 1MTUA 1C5RA 1JIMA 4Y79A 1XVMA 3DD2H 1INCA 3SORA 1GI9B 1BCUH 1GHZA 5DP9A 1LMWB 2V0BA 2BVXH 2F9NA 2J4IA 4FUCA 3RXKA 3KQEA 4ABGA 1A46H 1CVWH 6LPRA 1FIWA 2PKAA 2ZZUH 1RRKA 2ZWLH 4O3TA 2VIPA 1QJ1B 3KL6A 2GT8A 2A2QH 3O8BA 1O2NA 1AIXH 4D7FA 1C9PA 3VEQB 2I6QA 4FVDA 4AB9A 1IQKA 1GL1A 1RTLA 2QY0B 2JETB 3FFGA 2P3TB 1ZR0A 3BEUA 4UONA 4X8UH 2A5KA 1MTSA 5DP5A 1PQ7A 1JBUH 1XVOA 1O2JA 1GDQA 3BG4B 2BHGA 1C2MA 2BDYA 4X1QU 3UNQA 5FCRA 3STJA 4AGKA 5GJ4B 3CP7A 1S0RA 5DP6A 2BY6X 5EODA 1TGCA 3SZNA 2ANMH 3LGYA 1ETSH 1UHBB 1TQ0B 4ZKSU 1EOLA 4X8SH 3ATIA 7KMEH 1O36A 4K5ZA 2BOKA 1FI8A 3LC3A 3F9GA 4YLUA 1S6FA 4I8HA 1F7ZA 1C5ZB 2OQ5A 2A31A 3VGCC 2Z6BD 1K1OA 1QIXB 1C2HA 1O2UA 1FMGA 2THFB 1V2JT 2F91A 1UMAH 2ZDAH 1GBKA 2G52A 1YPGH 2TIOA 1RTFB 4ABBA 1GL0E 1G37A
chains in the Genus database with same CATH superfamily
3D62A 2CGAA 1DANH 4B76A 5BPEA 1S5SA 1ZTLA 1FAXA 3T2NA 4J1YA 1F92A 3JZ2B 1C1QA 3F9EA 1HUTH 3S9BA 3EA8A 3SI3H 3RXUA 2WPMS 4YT6H 2PLXA 1ELBA 5EGMA 5B6LA 1A5HA 3ZZ6A 1WOFA 3A7TA 4D8NA 3ZZCA 2K1QA 3ATLA 2FPZA 4ZHLU 1TPOA 1V2MT 2HRVA 3MYWA 1P12E 2Z3CA 3W1EA 5AF9H 2VB0A 1DLKB 4DCDA 4B6FA 2RDEA 3NZIA 3T62A 1FV9A 2P16A 3ENSB 5L2YH 5KECA 4UFFH 3MNBA 1EZUC 1SGEE 3OTJE 4UFGH 2ZIQH 1S84A 1LHEH 2P3UB 1W8BH 1SHYA 3QK1A 1GHAF 4MPXA 4AFSA 2VVUA 3V3MA 3ATMA 5GCHG 2C3SA 2G4TA 4TYDA 1O3FA 3LT3A 4JYUH 3ESTA 4CRGA 1XKAC 3URDA 1YKTA 4GHTA 1TRNA 2QN5T 1GGDB 1YBWA 2QCYA 1TGNA 3DCLA 3T26A 2OC8A 3M7QA 2IN2A 1TQ7B 4TSFD 1OWJA 5F6MA 3SUEA 1GBJA 2JDID 1OP0A 2G4UA 2ZNKH 2R2WU 2NU2E 1TGSZ 4UD9H 4X1PU 1JRTA 1Z8RA 2BTCE 1TPSA 3KHVA 1F2SE 1XM1A 4H6SB 4ISHH 2W26A 3BG8A 8KME2 3TLOA 1ANEA 4KTUA 1LHCH 4O97A 1ZMNA 3BIUH 1BRUP 3BV9B 1UTLM 3Q3KA 4XRNA 1FONA 2RA3A 4X6OA 1FN6A 3S0NA 2ZDNA 1O3KA 3RXJA 2SGEE 2A0QB 1JMOH 1UVOA 2XC0A 4A1XA 4OS1A 1CT2E 3QWCH 1O2HA 1OWKA 3DA9B 1BTPA 4ZHAA 1AKSB 4YZUA 1LVYA 1V2TT 2CF8H 1F0UA 5J4QA 2WZQA 1MKWK 3ZZ4A 1IQHA 1QR3E 1AFEH 1P09A 3SV6A 1PFXC 1ESBA 3OAAD 4NCYA 4A1VA 3MHWU 1UW7A 5IK2D 1M9UA 2QAAA 1HAOH 1Y5BT 2FDAA 2GZ7A 5GDSH 2H9EH 4UFEH 1UK3A 3RXMA 2F3CE 1C2FA 1ZPZA 3MU5A 4FUIA 5FHTA 4JZ1A 4ZKOU 4DIIH 1SGIB 1SGPE 5TJXA 4H4FA 3QTVH 1Z8GA 4JK6A 3MQKC 1MKXH 1TGTA 9ESTA 1TPPA 1FLEE 5E2OA 2VIWA 4ABIA 2PGQB 1NPMA 1RIWC 3ZVAA 1XXFA 1SI5H 8LPRA 1S82A 3H5CB 1Z6JH 1GCTB 1O5AB 1J8AA 1GMCG 4X1NU 2BY9X 1UCYH 5EW2H 4X6NA 3TK9A 2UWLA 3WWFA 1TLDA 4ZCNA 4OS4A 3GY7A 1MQ5A 5T6FA 2F9PA 1IHTH 2EI6A 1C5NH 2A7HA 1UK2A 3DSOA 1ABIH 3HK3B 1FY3A 3F2FA 4X2VA 4JZEH 1CQQA 2SFAA 1C5LH 4Z0KA 1GCDA 1WBGB 2ZHFH 2W6ID 1G32B 3SNCA 4SGAE 2BY5X 1XUIA 1UVTH 3S7HB 1N1LA 2A5IA 5C20A 1GI5A 1Y3WA 1P2JA 3BTFE 1ABJH 4I8GA 4FOUC 4FUDA 4YT7H 1P3EA 3MH7A 1F5KU 3GCNA 1YPMH 4GLYA 5GCHF 3O8RA 2B9LA 1Z8IB 3MU1A 2PW8H 1NT1A 1LCYA 2A32A 2OXSA 4UDWH 4WY3A 1G2MA 1O5EH 2AH4X 2K8IA 4AC9A 1OS8A 1AFQB 1NROH 4ISIH 5EXLA 1YPLH 2G81E 2AS9A 2BD3A 2HPPH 3SQHE 3K9XB 4BTUB 2ANKH 1HDTH 2M5TA 2NU1E 1E79D 2XBWA 4PROA 3LONA 3PV2A 2OBQA 1QJ6B 4ACBA 1BRBE 1XUKA 5GXPA 5AFYH 1HCGA 4X1SU 1EQ9A 1SLUB 4BTTB 1DOJA 2ZFFH 1QL8A 1OHHD 2J94A 3PROA 3KGPA 1W12U 2BLQA 4GPGA 1BMFD 4AB8A 2PUQH 1C5OH 5EQQA 1OWIA 5FPTA 4DIHH 1UO6A 4TY7A 1GI4A 1NFYA 2WV4A 3ZZ5A 3RP2A 3BSQA 2ZKSA 1MBQA 4KTCA 4ZKNU 1HAPH 1ZRBA 2PWXA 3ODFA 1GHBG 3LGIA 5T6GA 1SGQE 4XFQA 4A7IB 4NWKA 1HAVB 4Y6DA 4IN1A 2B0FA 1ACBE 1O0DH 3KIDU 1RS0A 4B6EA 2IJOB 4FXGH 1EJMA 1LDTT 1EJAA 3CS0A 3SW2B 3KNXA 2VWMA 1FNIA 2WUBA 4NWLA 1HAYB 4IN2A 5EXNA 4HI3A 1UVPA 1XUFA 3P92A 1LVMA 1W0JD 1YPHE 3VB3A 2WPLS 2F9VA 4X8VH 2AIQA 2BLWA 1BDAA 4R0IA 4RSPA 1P06A 4K8BA 4D9QA 1G3DA 5T6DA 3QLPH 1ZHMA 4K69A 1IQNA 5FCKA 2AMQA 1C1PA 1DLEA 1O3DA 2VBCA 3TNSA 1LKAA 1GMCF 4AORA 3RXHA 2KX4A 1GBTA 1TMBH 1Z1JA 3SU1A 2QA9E 3D23A 1EUFA 2ZGCA 2OLGA 3LJJA 4B71A 3BG4C 1UHBA 2H6MA 4FUGA 4ISOA 4WMFA 5K0HA 3BTME 1LTOA 1YCPH 1ZOMA 3T5FH 3A85A 2VNTA 1TX7A 3LDXH 5TCCA 2ZU5A 1BTHH 1BMLA 2OK5A 1C2GA 5FXLA 1ZJKA 2GV7A 1SOZA 1QNJA 1C1TA 3QO6A 2O8WA 3BTWE 3A82A 1O2XA 3BTTE 3UNSA 4MVNA 1PYTC 3FZDA 2I6SA 1N8OB 3IG6B 2TGAA 1K1IA 4SGBE 4AOQA 2RA0A 1ZGIA 1YLDA 9LPRA 3ZZ7A 3GCHB 1BUIA 1J17T 5G4BA 4RKOB 1CT4E 1VKYA 1NFUA 1V2VT 1GBFA 3L33A 1ESTA 4DT4A 4YO9A 1GHWH 1AO5A 1FY8E 1O34A 1LPGB 3ZIAD 2GJGA 2FS9A 5C1UA 3UNRA 5HM9A 1YP9A 1V2UT 4DJZB 1Z8JB 3LOXA 3SV2H 1AGJA 3ZVCA 1IAUA 4UEHH 4CRAA 2NU4E 4DOQA 5ESBA 2HWLB 2PHBA 3GY8A 1DDJA 3A8DA 1MZAA 2BYAX 4FUHA 3SV8A 5JBCS 1ZSJA 1LQEA 3V12A 3MFJA 1G3CA 4JYTA 1EPTB 3TVJB 5A0CA 2O8UA 2J34A 2ZF0H 3UWJH 3GY6A 1KIGH 3PRBA 2BY7X 3PYHA 1MCVA 4O9VA 1FAKH 2B8OH 2EI8A 3DT0H 1GHBF 4X2YA 3VPKA 2LELA 1HAIH 1O39A 1TNLA 1RFNA 1ELCA 1L0ZA 3UAIC 4R8TB 3OEED 3F0PA 2R2MB 2V7QD 2PSXA 3LGUA 1P9UA 3PV5A 4MTBA 1EP6A 2FZZA 3GY5A 3TU7H 1Z71A 1C4V2 2D8WA 4E06H 1B0FA 4I31A 1C2DA 3BTGE 1DICA 3M35A 1PPZA 3FZZA 5HIYA 1GGDC 2VGCC 5HIZA 1O3NA 1EZSC 3KN2A 2ZGXH 1IQLA 3ZYDA 3VB4A 2VWLA 2Z3EA 4NA8A 3RXLA 3SQEE 3P8GA 4JCNA 3SO3A 1Y3XA 1HBTH 2FM2A 2YNAA 3GYMA 1TNHA 2RDLA 1LQDB 2ZDLA 4NFEA 3FP7E 1HFDA 3PLKA 3F3BA 5E8EH 2TBSA 2WPHS 2F9OA 3DSPA 1TX6A 2AMPA 1SVPA 2ZHDA 2L6OA 2VWNA 3BEIB 1AKSA 2H2ZA 3KCGH 3PMBB 3SOSA 1O5GH 4OS2A 1BHXB 1HJ8A 2ZG0H 2OINA 1EAWA 3V13A 1COWD 1HAGE 3F2HA 1PPCE 3PO1B 2FOMB 3ZVBA 5IDKA 5K7RA 1EB2A 1QB6A 1ELFA 2B5TB 1N6XA 3A86A 1C2EA 1PPEE 1C1MA 1NZQH 4DGJA 2FOHA 4Q80A 1QCPA 3RXFA 3UWIA 3ATWA 1GBDA 2IPQX 1K1JA 5DGJA 2PP6A 5FPYA 2NU0E 1ZYOA 3QN7A 3M5OA 4X0WU 3LKWA 3U28C 1NBMD 2BQ7B 1MTNB 4ABFA 2FTLE 2FX6A 1AWFH 1V2WT 4ASHA 2YMSB 1BTYA 3GDSA 3PMHB 3SUDA 1QQUA 1A5IA 3SBKA 1CGHA 3MH5A 2AGEX 2Y7ZA 3EE0B 1C5YB 2BXUH 2H1UA 6GCHF 3TH3H 3HGNA 2QXIA 2V3OH 5HMAA 1Y8TA 1GBEA 3ZZ3A 1QFKH 1AQ7A 3QZRA 1GCTC 1AWHB 1FY5A 1QL7A 4TPIZ 1YWUA 1E38B 1S81A 1VZQH 2VVCA 3RXEA 1CHOG 4Y8YA 3SGBE 3RU4E 3U1JB 3EYDA 3E0PB 1TOMH 1E34B 4ISNA 1FDPA 1GVKB 4WMDA 2C4FH 2TGDA 1WDIA 2Z94A 1CA8B 3GCTF 1P03A 3RXOA 1FPHH 1P05A 2ZU3A 2B7DH 1PYTD 1SQTA 6CHAC 2KZ4A 1H8ED 2G8TA 1G9IE 4MPUA 1TNIA 5DP3A 3T29A 1TAWA 1TRYA 2W3IA 1O3PB 2J92A 3V7TA 2BQ6B 4RT0A 1K1LA 2G5NA 3FOAA 4TY6A 3OX7U 5FL7D 4X6MA 2RCEA 3K6ZA 3RXQA 2PR3A 3ZVGA 1Y59T 4B2CA 5A8ZA 3GCOA 2H9HA 3MNCA 3RMOH 2C8YB 4ABEA 1A1RA 1FQ3A 1QTFA 1BQYA 1SB1H 1O3LA 2GVFA 2TGTA 4KKDA 3SUGA 3O8CA 2A1DB 5F8XA 1C1VH 5DPAA 4U32A 1C1WH 1O2TA 3RXGA 3TJVA 4LZ4B 4YOJA 5FX6A 1AFQC 3ODDA 3QUMP 4YLQH 5HM2A 1J16A 3DSGA 1V6DA 3UR9A 2GX4A 1P2IA 4Q2KA 1MUEB 3C27B 1F0TA 5CE1A 3RUOA 1QY6A 3GYLB 5EPNA 1KXBA 4Y11E 1IQGA 3RC6A 2BD4A 3RMMH 3T25A 3SN8A 1O33A 1O2LA 1W0KD 1SGRE 4A1TA 2QF3A 7GCHF 2VIDA 3LGVA 1HYLA 3PV4A 1FY1A 5C1XA 3NCLA 4GCHG 2Z9LA 2R0KA 1NRRH 5JBTA 2W3KA 3UQVA 1HAVA 1TMTH 2ZCHP 4AG1A 1MKWH 3SGQE 3UR6A 3FP6E 1O32A 1FPCH 1H9LB 2Y80A 3LU9B 1YM0A 4X2WA 3S9AA 1G3BA 2XBVA 3U8OH 1TBZH 1V2ST 4AN7A 1GJBB 2CN0H 4TWYA 3MOCA 1SHHB 1CGIE 2BVSH 1MABB 2GTBA 1EZQA 4HFPB 4HTCH 3KEEA 1W14U 2RFKC 2OC1A 1SSXA 3A7ZA 2EY4C 2ZEBA 1O2GH 2J97A 2VIVA 3RXCA 1PQAA 1E1QD 2XWBI 2D26C 4CRFA 1W7GH 3NWUA 1SG8B 2PKSC 1DSUA 3NPSA 2ODYB 1O5BB 3A7XA 1UTNA 4GAWA 3EGKH 4NFFA 3P8OA 2ZU2A 3TIUA 4CBNA 1AE8H 3FKSD 2A7CA 4B2BA 4OS6A 2ALPA 2VGCB 1TPAE 2FMJA 1P0SH 1SGTA 3LJOA 3OYPA 5KEDA 1NRQH 1E37B 3OSYA 3M3SA 1GI7B 1ID5H 3Q77A 1XMNB 3M5MA 3PMJA 1O3CA 1O2WA 2XC5A 2SGQE 1Q3XA 2BDCA 1KY9A 2BDHA 2BX4A 1EAUA 1QA0A 2JIZD 2IJD1 1CHOF 2F9BH 2Z9IA 5E0GA 3UUZA 4ESTE 4WMEA 3A8CA 1O37A 4XBCA 1FY4A 2VIOA 4Y0YE 1ANDA 1QL9A 5L30H 3ZVEA 1W0YH 1ESAA 4YM9A 3Q76A 3NK8A 1CGJE 1BOQA 1HIAB 3GISB 4E7NA 1T8NA 2YOLA 1Y5AT 2C8ZB 4I32A 4THNH 2R0LA 3N99A 2FYRA 1O2SA 2ZGBH 5C17A 5DP8A 1OWEA 4H42U 5C67A 1GMHG 3KQBA 3RXAA 1ZRKA 3FP8E 1YPJH 1N8OC 4ABDA 2SNVA 4CRCA 1VGCB 4NA9H 3JZ1B 2ZC9H 4DY7B 4LK4A 1EXFA 5CMXH 1C2JA 2XCFA 4XOJA 1SGFG 1UTMA 4BAQB 3GCHC 2FS8A 1SBWA 2W7SA 1CSOE 2GZ9A 4LZ1H 1OWDA 1DFPA 2FEQH 2OUAA 5A8YA 1WYKA 4I33A 1O30A 1KLJH 1CHGA 1K22H 5LPRA 3E8LA 2PGBB 4BXSA 3FN8A 1AI8H 1EPTA 2ZA5A 2AMDA 2VVVA 1X7AC 2PUXB 2KFWA 2FOBA 4MPWA 2VU8E 1XUHA 3Q3XA 1H9HE 1TNJA 1CU1A 3DFLA 3VXEH 1EAIA 1NN6A 2ZFPH 3TJUA 1YPHC 2A4OA 1UK4A 3PB1E 4AFZA 1DY8A 2VINA 1UVSH 3I29A 1HXFH 4GCHF 5AHGH 1ZSLA 1EPTC 2AYWA 1LVBA 2Z9GA 3F6UH 2ZTZA 2J5UA 3A80A 2Y5HA 3VB7A 1L1JA 1YPKH 1XUGA 2ZU1A 3SJOA 6CHAB 1P9SA 2CK3D 2QIQA 1GI2A 2TGPZ 5CHBA 3SJ9A 1AU8A 4OS7A 1YYY1 2ZQ1A 2J2UA 1DUEA 4TT3D 5DN6D 4K1TA 3UIRA 1BBRK 1NY22 1WTGH 3MNSA 1QZ8A 4NIYA 3VG8A 1K1NA 4DG4A 1GJ8B 3SHAH 3RXPA 4M9FA 1THPB 4CH8B 1DVAH 4P02A 2STAE 3F68H 2BMGB 4E7RG 2Q6FA 2ASUB 1TFXA 1VCPA 1AB9B 1VCWA 2OBOA 1LHFH 3P95A 1T32A 4K2YA 1SKYE 1TMUH 1O3GA 3TK5A 1MH0A 1SQRA 1GJCB 1PQ5A 3A8BA 3WY8A 1GI1A 1QBOA 4IC5A 3TH2H 4F4OC 1ZLRA 5JYIA 3C1KA 3RMNH 2H5DA 3RC4A 3MO6A 5FBIA 2ZPRA 4Y8XA 5F8TA 1AUTC 1ELTA 4IBLH 2BDIA 3D65E 2OCVB 3Q3YA 1ZHPA 1DSTA 5EPYA 2QXHA 4JMYA 5DP4A 4WXIA 2TRMA 1NU9A 2OC7A 4XDEA 4JK5A 5C1YA 2A2XH 1GI3A 3BTQE 1AE5A 4AZ2B 4YOIA 2KAIB 5EW1H 1GWAA 1KMHB 2P3FH 2FOEA 1V2PT 4K1EA 3MO9A 2BD7A 1C1OA 4H6TA 1OP8A 3PO1C 1UVUH 3SHCH 2IPHA 1TWXB 2Z9JA 3SNEA 2A4QA 3LH3A 1NRSH 1BZXE 1KSNA 4AYVB 4WWYA 1AMHA 3LPRA 5EXMA 2J9NA 2ZDMA 1UTKA 1O38A 1Z6EA 1H8DH 2ZCKP 2ZHEH 4GVUA 1ANCA 1AZZA 4FU7A 1HPGA 4I8KA 1GMHF 1V2OT 2O8TA 3BTHE 3SI4H 2GD4B 2QV1A 2Y81A 2PSYA 4RN6A 4FUBA 1O3OA 1C1SA 1L4DA 1IQJA 1VCQA 2XWAA 4D7GA 2PKSB 3ZYEA 3LH1A 3N7OA 1MTNC 3EAJA 1EB1H 2GDEH 1C2IA 3S7KB 2YMSC 1GDNA 3RM2H 3GICB 4BAHB 5EIYA 4JYVH 1ETRH 5F8ZA 2BLVA 4X8TH 4DURA 1K9OE 1HXEH 2XBYA 3M5NA 3I77A 3U69H 1L2EA 2FI5E 4AFUA 2STBE 1C5XB 1GG6B 3ZVDA 2WSSD 4Y7BA 3SZEA 1KXCA 1SLWB 3RDZA 1FJSA 1S6HA 4WH8A 4B73A 3ZZDA 1VJAU 2GP9B 2A5AA 1P11E 4TPYA 1A7SA 4OGXA 2Z9KA 3WWBA 1DWBH 2SGPE 1GBMA 3DFJA 2HNTE 3I78A 2BDAA 2FLRH 3ITIA 3KQCA 4ABHA 4MNXA 4ZHMU 5CHAB 3M7TA 2J98B 1ZMLA 2QGRA 1TOCB 1ZJDA 5T3HA 2C90B 4F49A 4O3UA 3T27A 1P8VC 4M7GA 1TABE 3VB5A 5DO4H 3A7YA 2XW9A 3MO3A 2A45B 1GI6A 1P57B 1TGBA 2P95A 2IOTA 2FODA 2FI4E 5DP7A 5DG6A 1C5TA 2UUJB 3SNDA 3RXSA 3IITA 2XCNA 1O2OA 5EJZA 1W10U 1P2OA 5E2PA 5JBAS 1FIZA 4XE4A 2BX3A 1D3DB 1QJ7B 1EASA 1O3HA 2FOCA 3P17H 2OTVA 3TJNA 5F03A 3LIWA 3RC5A 3UPEA 2FOGA 1HNEE 4A6LA 3KYGA 3AK5A 3AAUA 4NSYA 1QRZA 3M7UA 2NWNA 2ZPQA 1H8IH 3UQOA 3E90B 3TGIE 1QRXA 3ATKA 3B23B 3HGPA 1DWEH 2ZGHA 1Z1IA 3HKIB 4INHA 2Y5GA 1ZMJA 1ARCA 1P2MA 1B0EA 2J95A 2GV6A 2QXJA 1GVZA 3SNAA 3ZZ8A 1E35B 1H4WA 2HOBA 1UTOA 1WAYB 3F0OA 1G2LA 4BANB 2O8LA 1SGYE 1MQ6A 2BD5A 2CF9H 3N7DA 1WV7H 3SU5A 3H7OA 1V2RT 3H7TA 5JBBS 4IW4E 1BHXF 4MNWA 1C2KA 1BMMH 4CR5A 4NZLA 3MU0A 3RLWH 2A4GA 1SGNE 1FZZA 2ZHWH 2Q1JA 3F9HA 1RD3B 1DPOA 3PWCA 2D2DA 1KTTB 2KCYA 1L1GA 2GMTB 2BDGA 1D6RA 3VXFH 3K2UA 3V0XA 2BZAA 3ELAH 5H4IB 1O3EA 2FYQA 4ZXYH 1E0FD 1QB1A 1P2KA 5I46H 5JB8S 1SL3A 2Q6DA 2G5VA 1EFRD 4CRBA 1AD8H 3SJ8A 1P3CA 1AY6H 2QF0A 3AVZA 1HB0B 1YCPM 3T28A 1NU7B 3AW1A 3AW0A 2AIPA 4Q63A 2GKVE 5FPSA 1QURH 2H5CA 2KR7A 2P8OB 1MTWA 3QGJA 2XYAA 1BRAA 1PPGE 1KYNA 3D49H 4WXVA 4P00A 4Y8ZA 3PRDA 3EE7A 1IHSH 4UFDH 1Q31A 3OU0A 1O35A 2BLOA 4I8LA 1PPBH 2HVYB 1DUAA 1JWTA 5EG4A 3QX5H 2KCOA 5FAHA 1KXDA 1K0HA 5GPIB 5IYTA 2P93A 1HRTH 1P02A 2WYGA 1O5DH 1ZZZA 1O3MA 1O2KA 4Y7AA 2A4RA 2AEIH 2WYJA 1O2IA 5EQSA 2JH6D 4INLA 4ZAEA 1KDQB 1WSSH 1XXDA 1GBBA 2FWWA 1SGCA 3QTOH 2VIQA 2YMSD 4XD7D 1MAXA 3KF2A 4FUFA 1OOKB 1VR1H 3KYFA 4FETA 3NXPA 1IQMA 3SV7A 2ZFSA 3BEFB 1VGCC 1P2NA 5SGAE 1GHXH 1NC6A 1LO6A 3OTPA 3W94A 5CDFE 2XRCA 2DE9A 3OE7D 1CT0E 3R0FA 2R3YA 3TH4H 3LGWA 3MU4A 5JDUB 2H9TH 1W3CA 1A3EH 1KXEA 1O2YA 1W2KH 1QQ4A 1C5MD 1T4UH 1KLTA 1DM4B 1VITH 2WPDD 4INKA 1P10A 1GI0A 3F9FA 4NIWA 1N6YA 4BNRA 3OY5U 1TYNA 2VWOA 4Y10E 2YNBA 1A0LA 1C4U2 2BD2A 1TBQH 2AGIX 1E1RD 1S83A 2ANYA 3BTDE 4HGCA 2AERH 3Q00A 1JOUB 1OWHA 1THSH 2OQUA 2PFEA 3HK6B 4IC6A 2ZO3H 1TNGA 4MQAA 2V3MA 8GCHG 1YPEH 4CHAC 2PV9B 4JZDH 3E16B 4FU9A 4FVBA 4Q7XA 4ABAA 1BMAA 3SUFA 3F2GA 1WTHD 1HAXB 2EEKA 2Y7XA 4Q7YA 2K0QA 4K3JA 1NTPA 4FUJA 1GI8B 3ZZ9A 2CHAB 3RU4T 1O5CB 2ESTE 3R3GB 1HGTH 1ARBA 4AG2A 2SNWA 1F0SA 3PLPA 2WPJS 2QF4A 1AB9C 3PWBA 1ETTH 3MI4A 2ZFQH 1NM6A 5F53A 2XNIA 1LHGH 3U8TH 2HLDD 4RI0A 2A7JA 2GT7A 1JRSA 2UWOA 1ORFA 4I86A 1TRMA 3TNTA 1GJ9B 1BIOA 5ABWA 1JXPA 1O2PA 4JZFH 2KAIA 2QE7D 3N7EA 1V2LT 4B2AA 1LVOA 4NSVA 4AFQA 3TITA 1BTXA 1AVXA 1OYQA 4ZROA 4GSOA 3F1SB 1T4VH 5HGGA 3GOVB 1WUNH 3L3TA 4UE7H 4KELA 2EI7A 1BB0B 2ZTXA 1DWCH 1J14A 3RU4D 2WV5A 1O3IA 1NO9H 3UFAA 1EJNA 1XX9A 1BT7A 1UJ1A 3A89A 2UUYA 1IOEA 1W7XH 4K8YA 4LXBH 1A0JA 3AAVA 2C93B 2C8XB 1MD7A 2FO9A 4ASUD 3STIA 1ELAA 1RXPA 1XUJA 1C5SA 1TIOA 1PJPA 1LHDH 1O2RA 4O03A 3K65B 1BITA 1EZXC 2FTMA 4IMQA 2FOFA 4Z6AH 1LKBA 2CV3A 2P94A 4J2YB 4NIVA 1D3TB 1TONA 2ODQA 2KCPA 1GJ7B 4RT1A 1F0RA 2OD3B 1FN8A 2FOAA 1SLXB 4WVPE 1SGDE 1C5UA 2EC9H 4RKJB 4XBBA 1AVWA 4U30A 3U98H 1K1PA 2DE8A 1DXPA 3EQ0H 3FANA 1S85A 1Y3YA 3P8NA 3LC5A 1GG6C 1P2QA 1J9CH 4QT8C 5AVDA 3KQDA 5FX5A 1YC0A 2FP7B 1YF4A 2GCTB 5FBEA 3E0NB 3OY6U 1BJVA 1KXAA 2J98A 3UB0A 2J38A 4YESB 4FU8A 4MNYA 5A0AE 1BBRH 3NUMA 4F55A 1SGFA 4FUEA 3SU4A 1B7XB 1VITG 2XXLA 1OYTH 2ZCLP 3ZZBA 4CBOA 4A5TS 8GCHF 1O3JA 3PTNA 2BD9A 1W13U 3RXDA 3EA9A 2G00A 1JIRA 1BMNH 5CHAC 1CBWC 3UREA 3B9FH 4ZUHA 5JPMH 1CA0B 2BY8X 5EOKA 1C1NA 1UTQA 5AFZH 1LPZB 3PTBA 2FIRH 2GGVB 1V2NT 1GJ5H 2WPIS 4D76A 3MMGA 1BRCE 3NKKA 2ZI2H 1HJAB 2LPRA 3HATH 2EQNA 3SNBA 1SFIA 2ANWA 4ZH8A 4TWWA 2V3HH 3EDXB 4MG3A 1NFWA 3EA7A 1MCTA 1HJ9A 3QZQA 1GBAA 1IQEA 2UWPA 4X1RU 1HAHH 3A7VA 5BRRE 1OXGA 2ZFTA 2JJ1D 2QYIA 1ZGVA 1O31A 4HZHA 2NU3E 3FO8D 1AVGH 1PPHE 1TB6H 2F83A 4X2XA 1F5RA 4U2WA 5E0HA 4KTSA 1LPKB 2V35A 5HYOA 5DKMA 3MH4A 2OC0A 3RXVA 2Q6GA 4NZQA 2ULLA 3GDUA 1FUJA 2W6JD 1L1NA 4XBDA 5C94A 3VFEA 4OS5A 3SU6A 1Z7KA 2ZDKA 3TPIZ 3TGJE 2BOHB 2FXRA 5C2ZA 1QHRB 1B5GH 5ETXA 2BVRH 1SQOA 5I25A 5L2ZH 3U8RH 1ZHRA 2CMYA 1H9IE 2UUFB 4BTIB 3GY3A 2PKAB 1S0QA 1DY9A 4NG9H 4CHAB 3GDVA 1DE7H 1NESE 1O2QA 2VH6A 3MH6A 5A0BA 1RTKA 1U6QA 1C5VA 2HGTH 4B75A 1T7CA 3A84A 1IQFA 2BM2A 5DK1A 4OGYA 4BAMB 3ZVFA 1FX0B 1D4PB 2BDBA 2XC4A 3BTKE 4I8JA 2HNTC 1GMDG 1C5WB 2ZHQH 2GMTC 1BTWA 1GBIA 2G51A 2ZPSA 3E6PH 1A0HB 4CREA 1D6WA 1F5LA 2Y5FA 1DT2A 2GZ8A 1EATA 2R3UA 1C5QA 1MMJN 5T1VA 4IMZA 1UTJA 4ISLA 1YLNA 4HG6A 3GY4A 3A87A 3NRLA 1AN1E 2V6NA 2VJ1A 5EJLA 1G3EA 3E1XB 4CH2B 4AX9H 5LH8A 5PTPA 3KQ5A 2WV9A 3VGCB 1QA7A 2P8OC 3MTYA 2BB4A 3PLBA 2QXGA 4BAOB 2AGGX 5ESTE 4BXWA 5EU8A 2UUKB 5LPFA 2O9QA 1OKXA 1MTVA 2XTTB 2HLCA 4D9RA 5A2MH 1OP2A 2G55A 1K28D 1DX5M 2VH0A 4A92A 3SGAE 3E3TA 1D3PB 4F48B 1KTSB 2PTNA 1PQ8A 4VGCC 1KDQA 2QF5A 1H1BA 2W5EA 1VITF 1VJ9U 1K2I1 3UOUA 1C1RA 2FI3E 4IGDA 4MDSA 1OX1A 2GDDA 2TPIZ 2CXVA 3FVFB 1MKXK 4MPVA 3RLYH 3U1IB 3MNXA 5GNDA 1MBMA 3SJKA 1SOTA 1KXFA 1O5FH 7LPRA 1O2VA 1NS3A 5GIBA 6ESTA 4ACAA 1UCYK 5JB9S 1QBNA 4I7YH 2Z7FE 1A4WH 4Y76A 3L6PA 5B6OA 2BQWB 5GWZA 2OP9A 2O8MA 5HXFA 4WJG2 1SR5C 4K60A 5DJ7A 1DWDH 3QDZB 1QB9A 2JH5D 1DITH 1ANBA 3CENA 2DUCA 1T31A 4AGJA 3TJOA 1SC8U 1SQAA 1A2CH 2P59A 3S69A 4K1SA 2FX4A 3OEHD 1E36B 5LPEA 4CR9A 2ILNA 3M3TA 1P01A 4JZIA 3MWIU 3G01A 3BF6H 4DVAU 2F43B 1WQSA 1AHTH 1T8MA 4YTAA 3SV9A 1EOJA 1AUJA 3A81A 2ZGJA 1C9TA 3B8JA 1WU1A 3RM0H 1YY3A 4Q7ZA 4X6PA 1W11U 4YXWD 3PMAB 3ZV9A 3HKJB 2BD8A 1ELVA 2ALVA 2F9UA 3E91A 2JETC 1TA6A 3UTUH 1ELEE 1CBWB 3BTEE 1YLCA 1V2KT 3PM3A 3U9AH 7ESTE 3RXRA 2BXTH 3RXIA 1A3BH 4ZMAH 1NRNH 1UTPA 1Y3VA 1WQVH 1BA8B 2JKHA 2CHAC 2XBXA 3ZV8A 2GCHG 2SGFE 1HV7A 3DUXH 1GMDF 4KP0A 1IQIA 2FLBH 1RJXB 2Y82A 4MNVA 4WH6A 3A83A 4GHQA 4WF8A 1SLVB 4KGAA 1O2ZA 5C5OA 1CO7E 1OSSA 4B1TA 1ZPBA 2WPKS 1QGFA 5A8XA 1GDUA 1GJ4H 4B74A 1HAZB 2HNTF 2L74A 2KM0A 2SGAA 1BBRE 3S9CA 1OPHB 1GJAB 3TGKE 2ODPA 2ZU4A 1KLIH 2JH0D 3DHKH 3A8AA 1T8LA 1ZTKA 5L6NH 3M37A 3M5LA 5DSFA 1A5GH 1C5PA 1K21H 1O3BA 3P70B 1SMFE 2Z3DA 1C1UH 5EQRA 2WINI 3P6ZB 1EKBB 4AYYB 1PPFE 1TALA 1EP5A 2JJ2D 3RMLH 1L4ZA 6GCHG 2EA3A 5TCAA 1RIWB 4Y71A 1A61H 4ABJA 1EAXA 1DS2E 3CS7A 3BIVH 1GVLA 1O3AA 1SPJA 3QGNB 1V3XA 3BN9A 2HPQH 2ZDVH 2PTCE 4ZXXH 3LGTA 1DXWA 2D1JA 1XKBC 3IWMA 3RXBA 1HLTH 2LNCA 1MU8B 3GCTG 3SU3A 8ESTE 3ZZAA 3A7WA 1NRPH 2AFQB 4NA7A 2HALA 3UOPA 3M36A 1BJUA 2CJIA 1BTUA 3K6YA 1TX8A 1TA2A 2ZP0H 3MU8A 1C4Y2 3M61U 3SU0A 1H8HD 1QBVH 3VB6A 1Y3UA 1YCPK 1S6LA 2LP6A 2RG3A 1GBCA 2QC2A 4XSKU 1WCZA 1P04A 4NGAH 2SGDE 1GHVH 1ELDE 1NBME 4Z1MD 2R9PA 3URCA 3OFND 1G30B 1GJDB 3W95A 5J4SA 1BTZA 3A88A 1GJ6A 1SFQB 1Y5UT 1ELGA 1J15A 1TE0A 3M3VA 1HIAA 1CE5A 3RXTA 1GBLA 1UCYE 2XNDD 2GCTC 4IS5A 2HVXA 1MAYA 1TBRH 1QRWA 5C0UA 3SJIA 1T8OA 1C2LA 3FAOA 1ZPCA 4VGCB 3UY9A 5LGOA 4NIXA 3GS9A 2ZQ2A 2W7UA 2M2AA 4DT7B 2ZECA 1Q2WA 3AASA 3O8DA 7GCHG 2Y6TA 1D3QB 4Q4LA 2C8WB 4E05H 2BZ6H 1CA0C 1ZTJA 2ZTYA 4MLFB 4DW2U 1TNKA 1ZSKA 3P8FA 5C3NA 5E0JA 5C5NA 4YOGA 1GPZA 1MD8A 1YGCH 4GUXA 4U01A 4BOHA 1HJAC 1G36A 4BAKB 2GCHF 1W0ZU 1MU6B 1FXYA 4Y0ZE 1EX3A 2ZFRH 1O2MA 1GHYH 3GY2A 3HPTB 1NFXA 1K1MA 1D9IA 1MZDA 2FESH 4CRDA 1RGQA 1GBHA 2WHXA 4ZKRU 1V2QT 1THRH 3TK6A 1GHAG 5A09A 1AZ8A 2WUCA 4LOYH 3SU2A 1MTUA 1C5RA 1JIMA 4Y79A 1XVMA 4OM9A 3DD2H 1INCA 3SORA 1GI9B 1BCUH 1GHZA 5DP9A 1LMWB 2V0BA 2BVXH 2F9NA 2F4LA 2J4IA 4FUCA 3RXKA 3KQEA 4ABGA 1A46H 1CVWH 6LPRA 1FIWA 2PKAA 2ZZUH 3H09A 1RRKA 2ZWLH 4O3TA 2VIPA 1QJ1B 3KL6A 2GT8A 2A2QH 3CNRA 3O8BA 1O2NA 1AIXH 2XOKD 4D7FA 1C9PA 3VEQB 2I6QA 4FVDA 4AB9A 1IQKA 1GL1A 1RTLA 2QY0B 2JETB 3FFGA 2P3TB 1ZR0A 3BEUA 4UONA 4X8UH 2A5KA 1MTSA 5HKKD 5DP5A 1PQ7A 1JBUH 1XVOA 1O2JA 1GDQA 3BG4B 2BHGA 1C2MA 3SYJA 2BDYA 4X1QU 3UNQA 5FCRA 3STJA 4AGKA 5GJ4B 3CP7A 1S0RA 5DP6A 2BY6X 5EODA 1WXRA 1TGCA 3SZNA 2ANMH 2KCAA 3LGYA 1ETSH 1UHBB 1TQ0B 4ZKSU 1EOLA 4X8SH 3ATIA 7KMEH 5C0TA 1O36A 4K5ZA 2BOKA 2AHME 1FI8A 5KGOA 3LC3A 3F9GA 4YLUA 1S6FA 4I8HA 1F7ZA 3WW7A 1C5ZB 2OQ5A 2A31A 3VGCC 2Z6BD 1K1OA 5EJ1A 1QIXB 1C2HA 1O2UA 1FMGA 2THFB 1V2JT 2F91A 1UMAH 2ZDAH 1GBKA 2G52A 1YPGH 2TIOA 1RTFB 4ABBA 1GL0E 1G37A
chains in the Genus database with same CATH topology
3D62A 2CGAA 1DANH 4B76A 5BPEA 1S5SA 1ZTLA 1FAXA 3T2NA 4J1YA 1F92A 3JZ2B 1C1QA 3F9EA 1HUTH 3S9BA 3EA8A 3SI3H 3RXUA 2WPMS 4YT6H 2PLXA 1ELBA 5EGMA 1A5HA 3ZZ6A 1WOFA 3A7TA 4D8NA 3ZZCA 2K1QA 3ATLA 2FPZA 4ZHLU 1TPOA 1V2MT 2HRVA 3MYWA 1P12E 2Z3CA 5AF9H 2VB0A 1DLKB 4DCDA 3NZIA 3T62A 1FV9A 2P16A 3ENSB 5L2YH 4UFFH 3MNBA 1EZUC 1SGEE 3OTJE 4UFGH 2ZIQH 1S84A 1LHEH 2P3UB 1W8BH 1SHYA 3QK1A 1GHAF 4MPXA 4AFSA 2VVUA 3V3MA 3ATMA 5GCHG 2C3SA 2G4TA 4TYDA 1O3FA 3LT3A 4JYUH 3ESTA 4CRGA 1XKAC 3URDA 1YKTA 4GHTA 1TRNA 2QN5T 1GGDB 1YBWA 2QCYA 1TGNA 3T26A 2OC8A 3M7QA 2IN2A 1TQ7B 1OWJA 5F6MA 3SUEA 1GBJA 1OP0A 2G4UA 2ZNKH 2R2WU 2NU2E 1TGSZ 4UD9H 4X1PU 1JRTA 1Z8RA 2BTCE 1TPSA 3KHVA 1F2SE 1XM1A 4H6SB 4ISHH 2W26A 3BG8A 8KME2 3TLOA 1ANEA 4KTUA 1LHCH 4O97A 1ZMNA 3BIUH 1BRUP 3BV9B 1UTLM 3Q3KA 1FONA 2RA3A 4X6OA 1FN6A 3S0NA 2ZDNA 1O3KA 3RXJA 2SGEE 2A0QB 1JMOH 1UVOA 2XC0A 4A1XA 4OS1A 1CT2E 3QWCH 1O2HA 1OWKA 3DA9B 1BTPA 4ZHAA 1AKSB 4YZUA 1LVYA 1V2TT 2CF8H 1F0UA 5J4QA 1MKWK 3ZZ4A 1IQHA 1QR3E 1AFEH 1P09A 3SV6A 1PFXC 1ESBA 4A1VA 4NCYA 3MHWU 1M9UA 2QAAA 1HAOH 1Y5BT 2FDAA 2GZ7A 5GDSH 2H9EH 4UFEH 1UK3A 3RXMA 2F3CE 1C2FA 1ZPZA 3MU5A 4FUIA 5FHTA 4JZ1A 4ZKOU 4DIIH 1SGIB 1SGPE 5TJXA 4H4FA 3QTVH 1Z8GA 4JK6A 1MKXH 1TGTA 9ESTA 1TPPA 1FLEE 5E2OA 2VIWA 4ABIA 2PGQB 1NPMA 1RIWC 3ZVAA 1XXFA 1SI5H 8LPRA 1S82A 3H5CB 1Z6JH 1GCTB 1O5AB 1J8AA 1GMCG 4X1NU 2BY9X 1UCYH 5EW2H 4X6NA 3TK9A 2UWLA 1TLDA 4OS4A 3GY7A 1MQ5A 5T6FA 2F9PA 1IHTH 2EI6A 1C5NH 2A7HA 1UK2A 3HK3B 1ABIH 1FY3A 4X2VA 4JZEH 1CQQA 2SFAA 1C5LH 4Z0KA 1GCDA 1WBGB 2ZHFH 1G32B 3SNCA 4SGAE 2BY5X 1XUIA 1UVTH 3S7HB 1N1LA 2A5IA 5C20A 1GI5A 1Y3WA 1P2JA 3BTFE 1ABJH 4I8GA 4FUDA 4YT7H 1P3EA 3MH7A 1F5KU 3GCNA 1YPMH 4GLYA 5GCHF 3O8RA 2B9LA 1Z8IB 3MU1A 2PW8H 1NT1A 1LCYA 2A32A 2OXSA 4UDWH 4WY3A 1G2MA 1O5EH 2AH4X 1OS8A 1AFQB 1NROH 4ISIH 5EXLA 1YPLH 2G81E 2AS9A 2BD3A 2HPPH 3SQHE 3K9XB 4BTUB 2ANKH 1HDTH 2M5TA 2NU1E 2XBWA 4PROA 3LONA 2OBQA 1QJ6B 1BRBE 1XUKA 5GXPA 5AFYH 1HCGA 4X1SU 1EQ9A 1SLUB 4BTTB 1DOJA 2ZFFH 1QL8A 2J94A 3PROA 3KGPA 1W12U 2BLQA 4GPGA 4AB8A 2PUQH 1C5OH 5EQQA 1OWIA 5FPTA 4DIHH 1UO6A 4TY7A 1GI4A 1NFYA 2WV4A 3ZZ5A 3RP2A 3BSQA 2ZKSA 1MBQA 4KTCA 4ZKNU 1HAPH 1ZRBA 2PWXA 3ODFA 1GHBG 3LGIA 5T6GA 1SGQE 4XFQA 4A7IB 4NWKA 1HAVB 4Y6DA 4IN1A 2B0FA 1ACBE 1O0DH 3KIDU 1RS0A 2IJOB 4FXGH 1EJMA 1LDTT 1EJAA 3CS0A 3SW2B 3KNXA 2VWMA 1FNIA 2WUBA 4NWLA 1HAYB 4IN2A 5EXNA 4HI3A 1UVPA 1XUFA 3P92A 1LVMA 1YPHE 3VB3A 2WPLS 2F9VA 4X8VH 2AIQA 2BLWA 1BDAA 4R0IA 4RSPA 1P06A 4K8BA 4D9QA 1G3DA 5T6DA 3QLPH 1ZHMA 4K69A 1IQNA 5FCKA 2AMQA 1C1PA 1DLEA 1O3DA 3TNSA 1LKAA 1GMCF 4AORA 3RXHA 1GBTA 1TMBH 1Z1JA 3SU1A 2QA9E 3D23A 1EUFA 2ZGCA 2OLGA 3LJJA 4B71A 3BG4C 1UHBA 2H6MA 4FUGA 4ISOA 4WMFA 5K0HA 3BTME 1LTOA 1YCPH 1ZOMA 3T5FH 3A85A 2VNTA 1TX7A 3LDXH 5TCCA 2ZU5A 1BTHH 1BMLA 1C2GA 5FXLA 1ZJKA 2GV7A 1SOZA 1QNJA 1C1TA 3QO6A 2O8WA 3BTWE 3A82A 1O2XA 3BTTE 3UNSA 4MVNA 1PYTC 3FZDA 2I6SA 1N8OB 3IG6B 2TGAA 1K1IA 4SGBE 4AOQA 2RA0A 1ZGIA 1YLDA 9LPRA 3ZZ7A 3GCHB 1BUIA 1J17T 5G4BA 4RKOB 1CT4E 1NFUA 1V2VT 1GBFA 3L33A 1ESTA 4YO9A 1GHWH 1AO5A 1FY8E 1O34A 1LPGB 3UNRA 2FS9A 5C1UA 5HM9A 1YP9A 1V2UT 4DJZB 1Z8JB 3LOXA 3SV2H 1AGJA 3ZVCA 1IAUA 4UEHH 4CRAA 2NU4E 4DOQA 5ESBA 2HWLB 2PHBA 3GY8A 1DDJA 3A8DA 1MZAA 2BYAX 4FUHA 3SV8A 5JBCS 1ZSJA 1LQEA 3V12A 3MFJA 1G3CA 4JYTA 1EPTB 3TVJB 5A0CA 2O8UA 2J34A 2ZF0H 3UWJH 3GY6A 1KIGH 2BY7X 3PYHA 1MCVA 4O9VA 1FAKH 2B8OH 2EI8A 3DT0H 1GHBF 4X2YA 3VPKA 1HAIH 1O39A 1TNLA 1RFNA 1ELCA 1L0ZA 4R8TB 2R2MB 2PSXA 3LGUA 1P9UA 4MTBA 1EP6A 2FZZA 3GY5A 3TU7H 1Z71A 1C4V2 2D8WA 4E06H 1B0FA 4I31A 1C2DA 3BTGE 1DICA 3M35A 1PPZA 3FZZA 1GGDC 2VGCC 1O3NA 1EZSC 3KN2A 2ZGXH 1IQLA 3ZYDA 3VB4A 2VWLA 2Z3EA 4NA8A 3RXLA 3SQEE 3P8GA 4JCNA 3SO3A 1Y3XA 1HBTH 2FM2A 2YNAA 3GYMA 1TNHA 2RDLA 1LQDB 2ZDLA 4NFEA 3FP7E 1HFDA 3PLKA 5E8EH 2TBSA 2WPHS 2F9OA 1TX6A 2AMPA 1SVPA 2ZHDA 3KCGH 2VWNA 3BEIB 1AKSA 2H2ZA 3PMBB 3SOSA 1O5GH 4OS2A 1BHXB 1HJ8A 2ZG0H 2OINA 1EAWA 3V13A 1HAGE 1PPCE 3PO1B 2FOMB 3ZVBA 5IDKA 5K7RA 1EB2A 1QB6A 1ELFA 2B5TB 1N6XA 3A86A 1C2EA 1PPEE 1C1MA 1NZQH 4DGJA 2FOHA 4Q80A 1QCPA 3RXFA 3UWIA 3ATWA 1GBDA 1K1JA 5DGJA 5FPYA 2NU0E 1ZYOA 3QN7A 3M5OA 4X0WU 3LKWA 2BQ7B 1MTNB 4ABFA 2FTLE 2FX6A 1AWFH 1V2WT 4ASHA 1BTYA 3GDSA 3PMHB 3SUDA 1QQUA 1A5IA 3SBKA 1CGHA 3MH5A 2AGEX 2Y7ZA 3EE0B 1C5YB 2BXUH 2H1UA 6GCHF 3TH3H 3HGNA 2QXIA 2V3OH 5HMAA 1Y8TA 1GBEA 3ZZ3A 1QFKH 1AQ7A 3QZRA 1GCTC 1AWHB 1FY5A 1QL7A 4TPIZ 1E38B 1S81A 1VZQH 2VVCA 3RXEA 1CHOG 4Y8YA 3SGBE 3RU4E 3U1JB 3EYDA 3E0PB 1TOMH 1E34B 4ISNA 1FDPA 1GVKB 4WMDA 2C4FH 2TGDA 2Z94A 3GCTF 1CA8B 1P03A 3RXOA 1FPHH 1P05A 2ZU3A 1SQTA 1PYTD 2B7DH 6CHAC 2G8TA 1G9IE 4MPUA 1TNIA 5DP3A 3T29A 1TAWA 1TRYA 2W3IA 1O3PB 2J92A 3V7TA 2BQ6B 1K1LA 2G5NA 4TY6A 3OX7U 4X6MA 2RCEA 3K6ZA 3RXQA 2PR3A 3ZVGA 1Y59T 4B2CA 5A8ZA 3GCOA 2H9HA 3MNCA 3RMOH 2C8YB 4ABEA 1A1RA 1FQ3A 1QTFA 1BQYA 1SB1H 1O3LA 2GVFA 2TGTA 4KKDA 3SUGA 3O8CA 2A1DB 5F8XA 1C1VH 5DPAA 4U32A 1C1WH 1O2TA 3RXGA 3TJVA 4LZ4B 4YOJA 5FX6A 1AFQC 3ODDA 3QUMP 4YLQH 5HM2A 1J16A 1V6DA 3UR9A 2GX4A 1P2IA 4Q2KA 1MUEB 3C27B 1F0TA 5CE1A 3RUOA 1QY6A 3GYLB 5EPNA 1KXBA 4Y11E 1IQGA 3RC6A 2BD4A 3RMMH 3T25A 3SN8A 1O33A 1O2LA 1SGRE 4A1TA 2QF3A 7GCHF 2VIDA 3LGVA 1HYLA 3PV4A 1FY1A 5C1XA 3NCLA 4GCHG 2Z9LA 2R0KA 1NRRH 5JBTA 2W3KA 3UQVA 1HAVA 1TMTH 2ZCHP 4AG1A 1MKWH 3SGQE 3UR6A 3FP6E 1O32A 1FPCH 1H9LB 2Y80A 3LU9B 1YM0A 4X2WA 3S9AA 1G3BA 2XBVA 3U8OH 1TBZH 1V2ST 4AN7A 1GJBB 2CN0H 4TWYA 3MOCA 1SHHB 1CGIE 2BVSH 2GTBA 1EZQA 4HFPB 4HTCH 3KEEA 1W14U 2OC1A 1SSXA 3A7ZA 2ZEBA 1O2GH 2VIVA 3RXCA 1PQAA 2XWBI 2D26C 4CRFA 1W7GH 3NWUA 1SG8B 2PKSC 1DSUA 3NPSA 2ODYB 1O5BB 3A7XA 1UTNA 4GAWA 3EGKH 4NFFA 3P8OA 2ZU2A 3TIUA 4CBNA 1AE8H 2A7CA 4B2BA 4OS6A 2ALPA 2VGCB 1TPAE 2FMJA 1P0SH 1SGTA 3LJOA 3OYPA 1NRQH 1E37B 3OSYA 3M3SA 1GI7B 1ID5H 3Q77A 1XMNB 3M5MA 3PMJA 1O3CA 1O2WA 2XC5A 2SGQE 1Q3XA 2BDCA 1KY9A 2BDHA 2BX4A 1EAUA 1QA0A 5E0GA 1CHOF 2F9BH 2Z9IA 3UUZA 4ESTE 4WMEA 3A8CA 1O37A 4XBCA 1FY4A 2VIOA 4Y0YE 1ANDA 1QL9A 5L30H 3ZVEA 1W0YH 1ESAA 4YM9A 3Q76A 3NK8A 1CGJE 1BOQA 1HIAB 3GISB 4E7NA 1T8NA 2YOLA 1Y5AT 2C8ZB 4I32A 4THNH 2R0LA 2FYRA 1O2SA 2ZGBH 5DP8A 1OWEA 4H42U 5C67A 1GMHG 3KQBA 3RXAA 1ZRKA 3FP8E 1YPJH 1N8OC 4ABDA 2SNVA 4CRCA 1VGCB 4NA9H 3JZ1B 2ZC9H 4DY7B 4LK4A 1EXFA 5CMXH 1C2JA 2XCFA 4XOJA 1SGFG 1UTMA 4BAQB 3GCHC 2FS8A 1SBWA 2W7SA 1CSOE 2GZ9A 4LZ1H 1OWDA 1DFPA 2FEQH 2OUAA 5A8YA 1WYKA 4I33A 1O30A 1KLJH 1CHGA 1K22H 5LPRA 3E8LA 2PGBB 4BXSA 1AI8H 1EPTA 2ZA5A 2AMDA 2VVVA 1X7AC 2PUXB 2FOBA 4MPWA 2VU8E 1XUHA 3Q3XA 1H9HE 1TNJA 1CU1A 3DFLA 3VXEH 1EAIA 1NN6A 2ZFPH 3TJUA 1YPHC 2A4OA 1UK4A 3PB1E 4AFZA 1DY8A 2VINA 1UVSH 3I29A 1HXFH 4GCHF 5AHGH 1ZSLA 1EPTC 2AYWA 1LVBA 2Z9GA 3F6UH 2ZTZA 3A80A 2Y5HA 3VB7A 1L1JA 1YPKH 1XUGA 2ZU1A 3SJOA 6CHAB 1P9SA 2QIQA 2TGPZ 1GI2A 3SJ9A 1AU8A 4OS7A 1YYY1 2ZQ1A 2J2UA 1DUEA 4K1TA 3UIRA 1BBRK 1NY22 1WTGH 3MNSA 4NIYA 4DG4A 1K1NA 1GJ8B 3SHAH 3RXPA 1THPB 4CH8B 1DVAH 2STAE 3F68H 2BMGB 4E7RG 2Q6FA 2ASUB 1TFXA 1VCPA 1AB9B 1VCWA 2OBOA 1LHFH 3P95A 1T32A 4K2YA 1TMUH 1O3GA 3TK5A 1MH0A 1GJCB 1PQ5A 3A8BA 3WY8A 1GI1A 1QBOA 4IC5A 3TH2H 4F4OC 1ZLRA 5JYIA 3C1KA 3RMNH 2H5DA 3RC4A 3MO6A 5FBIA 2ZPRA 4Y8XA 5F8TA 1AUTC 1ELTA 4IBLH 2BDIA 3D65E 2OCVB 3Q3YA 1ZHPA 1DSTA 5EPYA 2QXHA 4JMYA 5DP4A 4WXIA 2TRMA 1NU9A 2OC7A 4XDEA 4JK5A 5C1YA 2A2XH 1GI3A 3BTQE 1AE5A 4AZ2B 4YOIA 2KAIB 5EW1H 1GWAA 2P3FH 2FOEA 1V2PT 4K1EA 3MO9A 2BD7A 1C1OA 4H6TA 1OP8A 3PO1C 1UVUH 3SHCH 2IPHA 1TWXB 2Z9JA 3SNEA 2A4QA 3LH3A 1NRSH 1BZXE 1KSNA 4AYVB 4WWYA 1AMHA 3LPRA 5EXMA 2J9NA 2ZDMA 1UTKA 1O38A 1Z6EA 1H8DH 2ZCKP 2ZHEH 4GVUA 1ANCA 1AZZA 4FU7A 1HPGA 4I8KA 1GMHF 1V2OT 2O8TA 3BTHE 3SI4H 2GD4B 2QV1A 2Y81A 2PSYA 4RN6A 4FUBA 1O3OA 1C1SA 1L4DA 1IQJA 1VCQA 2XWAA 4D7GA 2PKSB 3ZYEA 3LH1A 3N7OA 1MTNC 3EAJA 1EB1H 2GDEH 1C2IA 3S7KB 1GDNA 3RM2H 3GICB 4BAHB 4JYVH 1ETRH 5F8ZA 2BLVA 4X8TH 4DURA 1K9OE 1HXEH 2XBYA 3M5NA 3I77A 3U69H 1L2EA 2FI5E 4AFUA 2STBE </