1GJDB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 53
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB01
1WV7H 1GI0A 1UK3A 2DE8A 2V3HH 1YLDA 2FOCA 4HGCA 1HFDA 4K1EA 1BCUH 1DY8A 1GI6A 1MCVA 1O2WA 4GVUA 3VB3A 3BN9A 3V0XA 1SHHB 3M5MA 3ZYDA 1WYKA 3RXGA 1DWBH 2A4OA 3A7YA 4GCHF 4ABEA 1VJAU 1IQIA 2DUCA 1JRTA 1A46H 5TCAA 4HI3A 4FUBA 4YM9A 1N8OB 2OC0A 1UTMA 1BJVA 1G36A 1EZQA 4BANB 1AFQB 1MCTA 1XUJA 2G5NA 1V2WT 4JYUH 1IQMA 2EI6A 1OOKB 2CXVA 3RM0H 4GAWA 4MNVA 3RDZA 2Z3DA 1KLJH 2A4RA 5PTPA 1S0RA 3A88A 1SGPE 4F4OC 1MKXK 2STBE 1AE5A 3T28A 3DD2H 4ABGA 2ZPSA 2VH6A 4XE4A 1ZHRA 3M37A 3GY6A 4JMYA 1K1PA 6GCHG 1ETSH 1TRMA 3GCOA 3SU4A 3TGKE 3DHKH 4AB9A 4AFZA 5T6FA 3LC5A 2BZAA 3SV7A 1EZUC 4BXWA 2FOMB 1KXFA 1GL0E 1MAYA 1G37A 2GKVE 1SGCA 1EPTA 1NN6A 2W26A 3TK9A 1GDUA 1ELTA 3KQBA 1TRYA 4UE7H 2FEQH 2BQ7B 2H9TH 3OTJE 2FS9A 3ZZDA 1Y3UA 1MKWK 4U2WA 2ZZUH 4INHA 1C2MA 2ZO3H 4K2YA 3ODDA 3GY5A 3ZZ4A 3T25A 4OS7A 4YT7H 2P8OC 1A1RA 4YZUA 2BD7A 2PLXA 4I31A 4ZKOU 2O8TA 3GY3A 1L1NA 1P2NA 1P2QA 2J34A 4ABHA 3VEQB 1O3OA 2ZHQH 2PW8H 3RXBA 1BQYA 2BHGA 2XBXA 1AQ7A 1EAIA 1PFXC 1UVOA 1T4VH 1ANBA 1GG6C 5FCKA 2ZFRH 2GX4A 4X1QU 1MD7A 1ZTJA 2BLWA 4HFPB 3UTUH 2G55A 1NRNH 1NC6A 1CVWH 3FP8E 3M7QA 1W14U 1O33A 4X1SU 4TYDA 1A0HB 2RCEA 3TJUA 5C2ZA 3SZNA 7GCHG 1WOFA 4GUXA 3DFJA 1YP9A 3A86A 3SUGA 1Z1IA 1FN6A 2WYJA 1TOCB 1GJ7B 1BTWA 2OC8A 1ESBA 2R2WU 1DSTA 1GI1A 1SGEE 3GICB 4AN7A 1KTSB 1GVZA 4I33A 1DE7H 2W7UA 1XKBC 3ITIA 3U8TH 2FWWA 4ISIH 5CHAB 3SUEA 3CP7A 3F68H 2V35A 1C2JA 1O3AA 3A8BA 1AO5A 1O2NA 1ELFA 4ZHMU 4NFFA 3D23A 1TALA 5EQQA 1IQHA 4ABDA 1OXGA 1QB6A 4CREA 3ZVDA 4O03A 3A7WA 1QB9A 1H9IE 1GJCB 2QF3A 5GCHG 2J92A 1AKSA 1RIWC 1AU8A 2BDCA 1SGTA 1P12E 1CHGA 3HKJB 1FUJA 3S69A 3Q00A 4TPYA 4DCDA 5BPEA 1TYNA 2P59A 1PYTC 4Y71A 2C8ZB 3OY6U 1QR3E 1TQ7B 2AS9A 1TE0A 1O5EH 2OBOA 3VGCB 2AEIH 2THFB 2BDGA 2NWNA 6CHAC 2ZGJA 1V2VT 4IW4E 2CHAB 4VGCC 1MKWH 3P8GA 4AG2A 2R9PA 3QGNB 4UEHH 1WQSA 1ESAA 4KTSA 3E8LA 2BVRH 2ZGHA 8KME2 5DJ7A 1TNGA 4ISHH 3SNCA 1WTGH 2RDLA 1O3KA 2ZKSA 4FUCA 1FIZA 1O2QA 4BTUB 1GBTA 1O5BB 3SU5A 3E16B 3LJOA 2ZFPH 3ZV8A 4J1YA 3UR6A 3B23B 5ETXA 2ALVA 1EJMA 1GPZA 2Y6TA 1SVPA 1OP8A 2PGQB 1ZOMA 2QA9E 1SB1H 1DANH 1GVKB 3QX5H 1T7CA 2G51A 4U01A 1SLUB 1O2RA 1WBGB 2H9HA 4LK4A 1FMGA 2Z3EA 3A84A 2OP9A 4XDEA 1AVGH 1PJPA 3KL6A 5I25A 1HJAC 2TGDA 3F1SB 1AWHB 1P9SA 1P2MA 1NY22 1IQNA 3BTME 2GCTC 4K3JA 1AZZA 1ZPZA 3NK8A 2OC1A 2QXJA 1DITH 1TRNA 4MNXA 2ZGXH 1BOQA 3BTFE 2A2XH 1IQJA 2BLVA 9LPRA 2PUQH 4B73A 1HXEH 2GCHG 1G32B 1Z7KA 1P3CA 3BV9B 3RXCA 1HCGA 3E0NB 2FYQA 1ELVA 2BVXH 1A2CH 4KTUA 1C2KA 3BEUA 3E0PB 1O36A 3ZZ9A 4DT7B 3ATWA 5SGAE 5LPEA 1EJAA 2GV6A 1BHXF 1FONA 1YCPM 2ANWA 2WPMS 1TGNA 1MTWA 2PTNA 2QIQA 4SGBE 3A81A 3K65B 2GT7A 2QY0B 3BF6H 4Y8XA 2AERH 4NA7A 3O8BA 1NFYA 2RA0A 1GHXH 2EI8A 3ZZCA 5GIBA 3TGIE 1TBQH 4X2WA 3BEFB 1FN8A 5IYTA 1EAXA 2GDEH 1O2VA 3CS0A 4FXGH 1NRRH 1ETTH 4BAQB 2ZTXA 1O3BA 4DOQA 4CHAC 2BD9A 2ZA5A 2P8OB 3FANA 3H5CB 4FUEA 4MPVA 3RXLA 4Y0ZE 3LOXA 1EAUA 1A61H 1W0YH 1YF4A 1GMDF 3KIDU 3M5LA 2FOFA 1UVPA 2FLBH 3MHWU 3TNSA 4H4FA 3MO6A 3ATLA 1BTYA 3RXEA 1FXYA 3HK3B 1INCA 1YPHC 1BBRE 2VIPA 2TRMA 1ZTKA 1FJSA 1EZXC 1MTNC 2ZG0H 4BNRA 1Z8RA 5F8XA 1Y5BT 3AASA 3MU8A 3ELAH 3O8CA 1O30A 4K1SA 1O3DA 1ZRBA 2BZ6H 2H6MA 3FZZA 1K28D 1NRPH 2BY8X 2GDDA 2P3UB 4NSVA 4OGYA 4B76A 1IQGA 4GPGA 1T8OA 1TOMH 2A4QA 1HAGE 5FBEA 4B2CA 1XUFA 4YESB 5FPSA 2Z9GA 1O3CA 1VGCC 1KDQB 4Y10E 2VIWA 4RN6A 2VGCC 1SGQE 4JYVH 1XMNB 2H1UA 1L1GA 2XXLA 2VJ1A 4X2VA 5GWZA 4XBCA 3F6UH 2C4FH 1Q3XA 1GI7B 4HZHA 3PM3A 3UNRA 1IAUA 4U32A 1YKTA 2R0KA 2VVCA 5L2YH 2XWBI 4YLQH 2FX4A 1DXWA 2LPRA 1RTFB 4KP0A 1C1OA 4IC5A 1ACBE 1RIWB 1ZMLA 4GLYA 1O2SA 3MYWA 3ZZ8A 1C1NA 3BTTE 2KAIA 1Y3WA 3CS7A 1E38B 4D9RA 1P9UA 1G3BA 2Z6BD 4H42U 3TK6A 3WY8A 1QJ6B 2W7SA 3V3MA 4ASHA 6CHAB 1QY6A 2BOKA 1Z8GA 3IITA 1T4UH 5CMXH 4O3UA 4VGCB 5HXFA 5IDKA 1QNJA 1QURH 4UFEH 1HV7A 1O31A 3TGJE 1O2YA 1O37A 2H5CA 1SFQB 3E90B 5DPAA 1MU6B 4TPIZ 3S9BA 4Q7ZA 1N6YA 2BY5X 2SGFE 1B5GH 4MQAA 3M3SA 1WQVH 3RXRA 5JBAS 3UQVA 1DVAH 5JBCS 1LVOA 4IMZA 3B9FH 6GCHF 1EASA 3TU7H 2TIOA 1TB6H 4THNH 4WMDA 1YPHE 3PMBB 1D4PB 1G3DA 4MTBA 3PMHB 2A5IA 1A7SA 2H9EH 3A7ZA 2PSXA 3I78A 1V2OT 5CE1A 1WU1A 3LGVA 4WXIA 4X1NU 1FPHH 3RXAA 3UREA 1UTLM 1QL9A 2ZTYA 2ZDVH 1DPOA 3BG8A 3HK6B 3D65E 1TNLA 1HJAB 1PQAA 3M7TA 2ZU4A 4BAKB 2BVSH 1C9PA 2GCTB 1NFWA 3JZ1B 1GJDB 2Z9KA 2R3YA 4FUHA 2IN2A 2AH4X 1BT7A 2ZPQA 1ABJH 2UUYA 2G81E 1H9LB 5ESBA 2BXUH 4FVBA 1DOJA 1HAIH 2ZFFH 1BUIA 2HVXA 1S81A 1SGFA 1QL8A 2TBSA 4A5TS 2WPJS 3SJ8A 2AIQA 3M3VA 3NPSA 3MFJA 3QDZB 1YPEH 3UR9A 1JIMA 2A4GA 1ELBA 2FI3E 3C27B 4NSYA 2V3OH 1RXPA 1FLEE 2Z9JA 1HAVB 1NRSH 3PV4A 2STAE 1SQTA 1HNEE 1UK4A 5C5NA 1P2OA 2BMGB 2J9NA 3KHVA 2Y5GA 3NXPA 3RLWH 2AMQA 1Z71A 2Q6DA 2ZCKP 3SUDA 1QHRB 1K1LA 3GYLB 1UTQA 4ZROA 4I8HA 1TPPA 1JIRA 3BTKE 1K1NA 2QXGA 1RGQA 1BRCE 1GHVH 2WPHS 4CHAB 1BBRK 2YNAA 4RKJB 4ISLA 1AN1E 1UCYH 2BTCE 2K1QA 3S9AA 1QA7A 1EAWA 4LXBH 1BRBE 1GI5A 2BY6X 2G4TA 4MNWA 1C5XB 5EQRA 2R0LA 3G01A 3SHAH 2VIQA 1VJ9U 1O5GH 3PB1E 2AIPA 1XUIA 1FV9A 4NIWA 4MVNA 2HGTH 1VITH 1MQ6A 6LPRA 1P11E 1GBFA 2SGDE 5F6MA 2ZDNA 1THPB 2XWAA 2HPPH 2VB0A 5GCHF 1QB1A 3GY7A 5C1XA 1IQFA 3T27A 1C4V2 2AGEX 1BTXA 3SV6A 4AG1A 1O3EA 4O97A 1YM0A 1W3CA 4X2XA 4Y0YE 1TX8A 2XCNA 4K69A 1W12U 2FX6A 1P06A 2FESH 4Y6DA 1J8AA 4DIHH 4MG3A 2OC7A 1F5LA 1VCQA 2HWLB 5J4SA 2GV7A 5A0AE 3KNXA 1ZGVA 1Y3YA 4QT8C 2B0FA 5DO4H 1ESTA 1O2UA 1THSH 1VGCB 4MPXA 1F7ZA 1HIAB 2W3IA 2H5DA 2VGCB 1AZ8A 1YYY1 1KYNA 1FAKH 3RUOA 4X8VH 1HXFH 1BMLA 1K1OA 2BLOA 1ELAA 3KQDA 1C5OH 1Y3VA 3Q3XA 3LGYA 1MZDA 4JZFH 2BDAA 3QUMP 4WVPE 1V2MT 1NT1A 2OD3B 1CGHA 3PLBA 1YPJH 1IOEA 3LDXH 1LQDB 2GD4B 3EE0B 4I8JA 3RXQA 1HDTH 1TNHA 1XXDA 1CT0E 4JZ1A 4BTTB 1J14A 5DP7A 1O2IA 2F9UA 1W7XH 4ZHLU 2OINA 3QK1A 1UHBA 3BG4C 1GHZA 3TIUA 2D8WA 4IMQA 3BTHE 1S84A 3GCNA 4SGAE 1O5CB 1C1SA 3SNAA 1O38A 4DY7B 3P8OA 2ODQA 1ANDA 2FPZA 2ZIQH 4NG9H 3MH7A 1DWCH 1GI9B 2ZF0H 3D62A 1SOTA 1FAXA 4E06H 4MDSA 4A6LA 4FU8A 4DVAU 1O3MA 3SHCH 4CBNA 2ZDAH 3IG6B 1EXFA 1YPKH 1GBIA 3GDVA 1TLDA 4MPUA 3ZZAA 4AGJA 1CT2E 1UTNA 2GCHF 2J38A 1AUJA 1GBMA 3F9GA 2ZCHP 1TMUH 4B2BA 1C5MD 3H7OA 1RS0A 1EJNA 4CRDA 3S9CA 4ABFA 3M36A 4AB8A 4B74A 1O2KA 2GVFA 3TVJB 3RU4T 2P95A 3GDUA 4Y11E 2JH6D 3SJKA 4CH8B 2PKSC 1LPZB 4Z0KA 3LT3A 3ZZBA 5L2ZH 1HAZB 1SHYA 1O2JA 1QQUA 4RSPA 5E2PA 2WYGA 3SUFA 1KXAA 3U9AH 1F92A 4WJG2 3QGJA 2PKAA 3LGUA 3MOCA 3BSQA 2XC4A 1K22H 4ZHAA 2Y80A 1P3EA 3M7UA 1C4U2 3VXEH 1ABIH 3SI4H 4B2AA 2CV3A 4Y76A 1C1RA 2FODA 4ESTE 3W95A 4UONA 1XUKA 1EPTC 1O3NA 1KY9A 3ZZ7A 3SJIA 3Q76A 1QCPA 4FU9A 2O8LA 1A5GH 3K9XB 5K0HA 3O8RA 1QRZA 2PHBA 1P01A 4GHTA 1LHDH 1MKXH 1QBVH 5DP9A 1GBDA 1L1JA 1MUEB 1O2OA 4KGAA 3RU4E 1NO9H 5HMAA 3SORA 1NZQH 2F9OA 1GBBA 3JZ2B 1ELEE 2UWLA 1P8VC 1H9HE 1NS3A 1V2NT 1YPMH 1PQ8A 2DE9A 4MLFB 1ZPCA 1XUHA 2BDIA 4X8SH 4NA9H 1C5YB 2OBQA 3ATKA 1TX7A 2RA3A 2UWOA 3UQOA 1O34A 4NIYA 2ZU5A 3SU6A 3B8JA 2ZQ2A 1CGIE 3GISB 1HAPH 1MH0A 2FYRA 4RKOB 5EQSA 1DS2E 4AOQA 2ZHDA 1HB0B 1VCWA 1HAHH 1S82A 4JZIA 3F9FA 1D6WA 1Z1JA 1SQAA 5EODA 4WY3A 3UUZA 2ASUB 3T29A 1GL1A 4J2YB 1C5LH 4X6MA 4FVDA 1C5SA 2IPHA 1YLCA 2H2ZA 1X7AC 3I77A 1DLEA 2OLGA 1D3PB 2GZ9A 4CH2B 1BTHH 4NGAH 2F3CE 3OYPA 1OPHB 4X1RU 4UFGH 1O5AB 1K21H 1VR1H 2A7CA 3UOPA 1NM6A 1Z8IB 4WMEA 2ZGCA 3NKKA 3MNCA 3HGNA 4D9QA 1LTOA 3LGIA 5FCRA 4BAOB 1D3DB 2XYAA 1P05A 3ATMA 3M5NA 4ISOA 2BD5A 2ZHFH 2BQ6B 5HM2A 3KCGH 4AORA 1WTHD 1MBMA 1OX1A 1GI2A 3T2NA 3ZVFA 3BTQE 3P70B 4B71A 2SFAA 4WWYA 2PR3A 3PMAB 3D49H 3MO3A 2XBWA 1UMAH 3ENSB 1TPAE 2W3KA 4Q2KA 2ODPA 2ZFSA 3RMLH 3Q77A 2A7HA 2BD4A 2G8TA 4YT6H 1WCZA 5GXPA 5JPMH 3S0NA 2IOTA 1F0TA 5LH8A 1MU8B 1SLXB 4XBDA 1PPZA 3U1JB 1LKAA 3O8DA 2J2UA 1P2JA 3BIVH 1FY1A 2EEKA 3RXHA 3LIWA 2PWXA 3M61U 1Z6JH 3U98H 4AFUA 2VWOA 4ZH8A 4A7IB 1EOLA 4AZ2B 1C1PA 2ZHEH 2A32A 4FUGA 4A92A 3VB7A 4XSKU 1CE5A 3QTVH 1F0UA 1BITA 3U69H 3BG4B 2BY9X 1OWJA 1HLTH 1D3TB 4MPWA 4JZEH 2UUJB 1N1LA 2CF9H 1EB2A 3LONA 2XBYA 8GCHG 1FZZA 2F9VA 5A0BA 4D7GA 2FTLE 4ABIA 3T5FH 1C2FA 2CGAA 2GT8A 1ZSKA 3UIRA 1LVMA 1GMHF 3RXTA 1UVSH 4JK6A 1P03A 2NU1E 3SI3H 5FX6A 1GBAA 1GHBG 3EA9A 1PPCE 5T6GA 1HBTH 3RXUA 1G2MA 4YOGA 1K1JA 1HYLA 2VU8E 1V2PT 1UVTH 3SU3A 2EI7A 2ALPA 1SLWB 3ZZ5A 1ZR0A 3FVFB 2BM2A 1QRWA 3SU0A 1GJ6A 2ULLA 3LU9B 3ODFA 3SV9A 2PKSB 5C20A 2HNTC 4INLA 2Q6FA 4B75A 1GG6B 3VB6A 3A8AA 2WUBA 2I6QA 1G2LA 2C8XB 3RP2A 1BRUP 3P17H 3VB5A 1AI8H 1SR5C 1SSXA 1O0DH 1SBWA 1T32A 3SW2B 3ZVCA 3NWUA 1M9UA 1DUAA 4UFFH 1Y59T 1GHYH 3P95A 5EXMA 3MWIU 2SGQE 2B9LA 2WV4A 3SQEE 1OYTH 3QZRA 1SGFG 1CQQA 1EPTB 3ZVBA 3L3TA 3RXKA 2R2MB 1K9OE 1TGCA 2ZWLH 2OXSA 1QA0A 1DM4B 3PTNA 3LJJA 1QTFA 3GCHC 1LHEH 2G52A 3TH4H 2VWLA 4YTAA 4Y7AA 3RXIA 1DUEA 1ARBA 3MU5A 2AGGX 3BTGE 1C2HA 1V2KT 3LC3A 2A5KA 3A8CA 1DXPA 3AAVA 3SU1A 1QQ4A 4NWKA 3KQCA 5F8ZA 1GBCA 1RTKA 1NU9A 3LH1A 5EW2H 1BTPA 1XVMA 2Z94A 3MU1A 1THRH 2FXRA 1FY8E 4XFQA 5A8YA 3L6PA 4LZ1H 2ANKH 2VIVA 5B6OA 3ZZ3A 1O2GH 2Y7XA 4TY7A 3STJA 2HPQH 2ZDLA 3PLPA 5EU8A 1LMWB 5G4BA 2F91A 1IQLA 3ATIA 1L4DA 1O3LA 3C1KA 3T62A 1BTUA 2P93A 3RXDA 1GBKA 1SLVB 1O3HA 4CRGA 2A5AA 1KXBA 3T26A 1K2I1 4H6TA 2PGBB 4WH8A 2Y7ZA 4E05H 1EP5A 5E0JA 2WPIS 3A82A 5GDSH 5K7RA 4FUIA 5E8EH 3EQ0H 5A8XA 1B0EA 4MNYA 4I8LA 1YCPK 1KSNA 9ESTA 1ETRH 2P3FH 1CBWC 4R8TB 1YGCH 1TNKA 2SNWA 1SQOA 3BTEE 8LPRA 1MAXA 4BAMB 1LVYA 2GMTC 4AYYB 1Y3XA 3V13A 1LO6A 2BX3A 1LHCH 1AKSB 1ZYOA 1C1WH 1IHSH 2HOBA 1E37B 2JH5D 1F0RA 1TGBA 1O3PB 1F5RA 1LCYA 1AVXA 3DUXH 2ZFQH 1O2TA 1GI8B 3LH3A 3N7OA 2PTCE 4YO9A 1RD3B 5DP6A 4DGJA 1S5SA 3P92A 1XX9A 4UDWH 1LKBA 3EAJA 3SQHE 1TPSA 1Q2WA 2ZC9H 1TMBH 5FHTA 4A1VA 4CBOA 3LGWA 1CHOG 5LPRA 2OQUA 2ZU1A 2F9BH 1BB0B 2NU2E 1TFXA 4LZ4B 3OY5U 2WPLS 1UTKA 2QN5T 1F5KU 2A1DB 1T8NA 1BA8B 3Q3KA 4NZQA 1KXEA 4HTCH 1AVWA 4ZXYH 1QFKH 4BTIB 4KKDA 1P04A 2WPKS 4KELA 1ZZZA 4CRBA 1Y5AT 2ZECA 4CRCA 1B7XB 1DT2A 2XCFA 1GMDG 1S6HA 1FQ3A 7GCHF 1VITG 3RC6A 1C1UH 3ZYEA 1KIGH 1TX6A 5A8ZA 2NU0E 3OSYA 4I8KA 5AVDA 3MTYA 1PPGE 2BY7X 2PSYA 3Q3YA 5GJ4B 1ANCA 4ZXXH 3AVZA 5C67A 1A5HA 1DWDH 3E91A 2LNCA 5JBBS 5C1UA 1P10A 3K6YA 4H6SB 1FY3A 2FOEA 4CR5A 1BRAA 2SGPE 1J9CH 4OS4A 2AGIX 1HJ9A 3TK5A 1C1MA 2JH0D 3PWBA 3FAOA 4OGXA 4INKA 3URCA 2FO9A 1C1QA 1MBQA 2YOLA 1A4WH 3A7VA 4ABAA 1E36B 3TH2H 4JYTA 4K5ZA 1W13U 3QLPH 1YCPH 5A0CA 1JMOH 1MTNB 3GDSA 2ZCLP 1LVBA 2GTBA 3SJOA 3MH6A 1OWDA 1ZJKA 1OWIA 1A5IA 2ZFTA 3RM2H 1YPGH 2BDYA 1UO6A 2FTMA 4KTCA 4I7YH 2FDAA 1W10U 1NESE 4D7FA 1ID5H 2NU3E 1FIWA 1TNIA 2SGAA 3E3TA 1GCTC 2PFEA 3U8OH 3MH4A 1NROH 1W11U 3SBKA 2AMDA 1GBLA 4D76A 1SPJA 4X2YA 4DURA 4IN2A 2WV5A 1CSOE 1H8DH 1P2IA 1GWAA 1ORFA 3GCHB 5E0GA 3E1XB 1AHTH 1XXFA 5DGJA 2FZZA 4NCYA 2C8WB 5HM9A 2TGAA 1GMCG 5J4QA 1MTSA 3FZDA 3P6ZB 4NIVA 4ZAEA 4D8NA 2G5VA 4IS5A 3V12A 5L30H 5F03A 1GGDC 1O2PA 1GJAB 2CF8H 2VVVA 3L33A 4TWYA 5E2OA 1GJ4H 2FP7B 5I46H 1ZTLA 5EPNA 2FI4E 4NFEA 1OP0A 2VWNA 3UY9A 1MTUA 1TA6A 3FP7E 1AFEH 5AFYH 1BIOA 1RRKA 1TMTH 2ZU2A 1ANEA 2WUCA 2J4IA 4GHQA 1DX5M 5LGOA 3STIA 1YC0A 1EQ9A 1Y8TA 2VWMA 1C4Y2 3NCLA 5DKMA 1C2LA 1T8MA 2Y5FA 2ZI2H 2OCVB 2JETC 3GOVB 1AD8H 2G00A 1EP6A 3DFLA 2ZTZA 1S6FA 1HPGA 1G9IE 1BBRH 1DWEH 1C5NH 2BOHB 2BDHA 1HAYB 4UFDH 2ZDMA 3KN2A 7LPRA 2XW9A 5EOKA 3SOSA 4CRAA 3PWCA 4I32A 1OKXA 3HKIB 1DFPA 4NA8A 1MD8A 5AF9H 1S0QA 1QJ1B 3GCTG 1KDQA 3RXSA 1GHAG 1J15A 2VIDA 1VCPA 1ZHPA 1XVOA 1ZGIA 1TBZH 3ESTA 3A83A 3RU4D 2YNBA 4AFQA 3SGBE 5AFZH 1CBWB 2C3SA 3S7KB 2C8YB 4TWWA 1FI8A 1LDTT 1SC8U 1C1VH 3A85A 5LPFA 2FS8A 3KEEA 2GMTB 1HUTH 8GCHF 3ZVAA 1DY9A 2FI5E 4M7GA 1T8LA 2OTVA 3KQEA 4ZUHA 3UNQA 2D26C 4O9VA 1WSSH 3R3GB 4YOJA 2ZEBA 1ZMJA 2KAIB 2SNVA 2I6SA 4X0WU 1NTPA 3AW1A 2Y5HA 1V2TT 3URDA 1C5QA 4Z6AH 3S7HB 3QZQA 1GHBF 1TONA 4X6OA 4ZKSU 3P8NA 5L6NH 1Z6EA 2HALA 1RJXB 1O2MA 2FM2A 4X6NA 3HATH 1GI4A 4IBLH 3RC4A 3MNSA 1GDQA 2A2QH 2VNTA 1LPGB 2ANYA 2RG3A 4IGDA 1C5UA 3HGPA 5BRRE 4BOHA 4TY6A 1AE8H 3TJOA 2BD2A 2F9PA 2QAAA 3M3TA 1AMHA 1XM1A 5FBIA 1NPMA 1C5TA 2AYWA 2ZP0H 4FUDA 1K1MA 1RFNA 2ZHWH 1D9IA 2XC5A 2TGTA 1BMMH 2GGVB 3SO3A 2SGEE 2QXIA 3SJ9A 1NU7B 1JOUB 2OQ5A 2HRVA 1CA0C 1U6QA 3A89A 3ZVEA 1GJBB 3MNXA 3SGAE 4CR9A 5A09A 2B5TB 3P8FA 5JB9S 3TH3H 3PTBA 4UD9H 1KLTA 3A80A 1D6RA 2QC2A 1EKBB 3RMOH 2CJIA 5T3HA 1EB1H 3PLKA 1O39A 1FY4A 1V2ST 4WMFA 2BD3A 3QTOH 1TGSZ 4WXVA 4Y8ZA 3NUMA 2FMJA 4X8TH 2Z7FE 4GCHG 3GY8A 5EXNA 2ZNKH 1SMFE 2M5TA 1FY5A 3SV2H 3SU2A 1Y5UT 2C90B 1N6XA 2W5EA 4A1TA 2Q1JA 5AHGH 5DP4A 2TPIZ 3UWJH 3EGKH 2FOAA 3SNBA 1GDNA 1ZMNA 1GVLA 2QV1A 2ODYB 1V2RT 3KGPA 1K1IA 1W0ZU 2BXTH 3OX7U 1NFXA 3RXVA 1PYTD 8ESTE 1S85A 1HAVA 1JBUH 1EX3A 1PPHE 2A7JA 3BTDE 7KMEH 1C2DA 2ZDKA 1J16A 5HYOA 1GCTB 3E6PH 2FIRH 1OP2A 3RXJA 3IWMA 1SGIB 4Q7YA 4JK5A 1O3IA 2QYIA 1V6DA 3TJVA 1TWXB 1UCYE 2XRCA 5C1YA 3RXOA 1OSSA 4XOJA 2PV9B 5E0HA 1OYQA 1WAYB 1J17T 1O5DH 4ABBA 2AFQB 1T31A 1HJ8A 1BMNH 2XTTB 3VFEA 2XBVA 5ABWA 3MNBA 3GY4A 1DICA 1HRTH 1GGDB 3DT0H 4E7NA 1O3JA 3AAUA 1H1BA 1GBJA 1ZLRA 2HLCA 1W7GH 3V7TA 1GJ9B 2Z9IA 1E35B 1DSUA 4NZLA 1RTLA 4BAHB 1YPLH 1G30B 2R3UA 5F8TA 4XBBA 4ZKNU 3SNEA 4K8YA 3MU0A 2P3TB 1G3EA 3ZV9A 2VH0A 1GJ8B 1V2UT 1MQ5A 1AB9C 2JETB 1TBRH 2FOBA 2QF0A 3RC5A 3MMGA 4IN1A 1VZQH 1A0JA 5H4IB 3M35A 3RXMA 3F9EA 5T6DA 3PO1C 3M5OA 4R0IA 1DLKB 2ZPRA 3UWIA 1ARCA 2EA3A 1L0ZA 1KXCA 1O32A 1FDPA 4K8BA 4Y8YA 1UTJA 1KXDA 4E7RG 1A3BH 4X8UH 1CHOF 3TITA 4OS6A 3HPTB 3SV8A 1D3QB 1HIAA 1UK2A 3QN7A 3SGQE 4Y7BA 2XC0A 2V6NA 5DP3A 1NRQH 2ZGBH 2OUAA 1HAOH 1PQ5A 1BTZA 1BHXB 3OU0A 2UUKB 1PPBH 1QBNA 1V2QT 1TGTA 1MMJN 1AUTC 3FP6E 3SN8A 3U1IB 4X6PA 1YBWA 3EDXB 3QO6A 1ZPBA 1FNIA 2A31A 5FPYA 3R0FA 3A7XA 1V2LT 1SI5H 1VITF 3MH5A 1TQ0B 1AIXH 1TIOA 5FAHA 1UHBB 1SFIA 1A0LA 1SGNE 4WF8A 1C2GA 1ELGA 1PQ7A 2B8OH 5EPYA 1LHGH 2J95A 4AFSA 1JXPA 1OS8A 1QL7A 1Z8JB 1EUFA 1KTTB 1GHWH 4PROA 1SGYE 2FLRH 1C5ZB 1ZJDA 3FFGA 1SOZA 1C2IA 3RMNH 1C5VA 4DW2U 1JRSA 2ILNA 1SGRE 2D2DA 3AW0A 1E34B 1ZSJA 1EOJA 1C5PA 5JB8S 3MI4A 3PROA 2Y82A 2EC9H 2QGRA 2P16A 1CU1A 1MTVA 4Q7XA 1UTOA 1O3FA 1N8OC 5C3NA 4K60A 2BDBA 2BX4A 1AFQC 1MZAA 5ESTE 3TJNA 1CT4E 4ZMAH 2FOGA 2B7DH 2WINI 2VVUA 3MU4A 5DP5A 4JCNA 1F2SE 1CA0B 1Q31A 2Y81A 5C5OA 1V3XA 3U8RH 1TA2A 4FUFA 5DP8A 3H7TA 2Q6GA 1O2XA 2O8UA 3EYDA 1CGJE 2BYAX 1P0SH 4ZKRU 5TCCA 1PPFE 2PKAB 1IQEA 5HGGA 2QXHA 1LHFH 3NZIA 1QJ7B 2BQWB 1ZHMA 6ESTA 2VIOA 1ELCA 3GYMA 1ZSLA 2BLQA 3BIUH 1GMCF 1O2HA 1ZRKA 3UNSA 2GZ8A 3BTWE 1HGTH 4AX9H 5TJXA 2AMPA 4Y79A 3CENA 4YLUA 3UPEA 1GBEA 2GZ7A 3A8DA 1L2EA 1GJ5H 1IQKA 3PMJA 1O2ZA 4F49A 1UCYK 2BB4A 2P94A 2Z9LA 4GSOA 3LGTA 5EW1H 2HNTE 3TPIZ 2VINA 1CA8B 3VB4A 2Z3CA 2BD8A 3QWCH 4I8GA 1GCDA 1GBHA 2ESTE 3A7TA 4A1XA 1AGJA 1BZXE 4LOYH 4DIIH 2QCYA 4FU7A 2NU4E 5A2MH 1AWFH 1TAWA 2F9NA 1UVUH 2UUFB 1V2JT 2UWPA 3K2UA 4ISNA 4AGKA 1C9TA 1O5FH 1QBOA 1SG8B 4Q80A 5GPIB 1ELDE 4X1PU 4JZDH 2J94A 3RXFA 3EA8A 4DG4A 1A3EH 1HAXB 5EGMA 2C93B 2TGPZ 1O35A 1OWEA 2ZU3A 3GCTF 3BEIB 1BJUA 1GHAF 3LKWA 3LPRA 3ZZ6A 3I29A 1F0SA 1LQEA 3VPKA 2XNIA 4WH6A 3RLYH 1QIXB 2FOHA 2O8MA 1DDJA 1BMAA 3MO9A 2ANMH 3UFAA 5EG4A 4U30A 3KF2A 1GMHG 4B1TA 3UOUA 3ZVGA 1H4WA 1OWHA 2ZQ1A 1UTPA 1P57B 4OS1A 1C1TA 1AB9B 3EA7A 5EXLA 5CHAC 1P2KA 5FX5A 4DJZB 1W8BH 1XUGA 1P09A 1QGFA 1B0FA 1LPKB 1CO7E 2PUXB 1C5RA 2D1JA 1FPCH 1SL3A 3PO1B 5DG6A 1BDAA 2HNTF 4IC6A 1KLIH 1L4ZA 1JWTA 3TNTA 1TABE 1P02A 2JKHA 3DA9B 4OS5A 4CRFA 5JBTA 2O9QA 2A0QB 2CN0H 3VXFH 4AYVB 1WUNH 1UJ1A 5DK1A 1E0FD 1S83A 2F83A 1PPEE 3K6ZA 1GI3A 1OWKA 3TLOA 4K1TA 1O3GA 2G4UA 5JYIA 2CMYA 2O8WA 3SNDA 1TNJA 4ABJA 5FPTA 4BXSA 3GY2A 4OS2A 3F9HA 3VGCC 3RMMH 5JDUB 3W94A 4O3TA 3PYHA 1EATA 2GP9B 2V0BA 4FUJA 1G3CA 2CHAC 1SGDE 7ESTE 2A45B 1AY6H 1C5WB 1W2KH 4NIXA 4YOIA 1IHTH 2IJOB 1XKAC 1NFUA 1QRXA 1TPOA 1EZSC 4NWLA 1C2EA 3RXPA 3A87A 5FXLA 1O2LA 1H8IH
chains in the Genus database with same CATH superfamily
1KMHB 1WV7H 1GI0A 1UK3A 2DE8A 2V3HH 1YLDA 2FOCA 4HGCA 1HFDA 4K1EA 1BCUH 1DY8A 1GI6A 1MCVA 2RDEA 1O2WA 4GVUA 3VB3A 3BN9A 3V0XA 1SHHB 3M5MA 3ZYDA 1WYKA 3RXGA 1DWBH 2A4OA 3A7YA 4GCHF 4ABEA 1VJAU 1IQIA 2DUCA 1JRTA 1A46H 5TCAA 4HI3A 4FUBA 4YM9A 1N8OB 2OC0A 1UTMA 1BJVA 2WZQA 1G36A 1EZQA 4BANB 1AFQB 1MCTA 1XUJA 2G5NA 1V2WT 4JYUH 1IQMA 2EI6A 5EJLA 1OOKB 2CXVA 3RM0H 4GAWA 4MNVA 3RDZA 2Z3DA 1KLJH 2A4RA 5PTPA 1S0RA 3A88A 1SGPE 4F4OC 1MKXK 2STBE 1AE5A 3T28A 3DD2H 4ABGA 2ZPSA 5KGOA 2VH6A 4XE4A 1ZHRA 3M37A 3GY6A 4JMYA 1K1PA 6GCHG 1ETSH 1TRMA 3GCOA 3SU4A 3TGKE 3DHKH 4AB9A 4AFZA 5T6FA 3LC5A 2BZAA 3SV7A 1EZUC 4BXWA 2FOMB 1KXFA 1GL0E 1MAYA 1G37A 2GKVE 1SGCA 1EPTA 1NN6A 2RFKC 2W26A 3TK9A 1GDUA 1ELTA 3KQBA 1TRYA 4UE7H 2FEQH 2BQ7B 2H9TH 3OTJE 2FS9A 3ZZDA 1Y3UA 1MKWK 4U2WA 2ZZUH 4INHA 1C2MA 2ZO3H 4K2YA 3ODDA 3GY5A 3ZZ4A 3T25A 4OS7A 4YT7H 2P8OC 1A1RA 4YZUA 2BD7A 2PLXA 4I31A 4ZKOU 2O8TA 3GY3A 1L1NA 1P2NA 1P2QA 2J34A 4ABHA 3VEQB 1O3OA 2ZHQH 2PW8H 3RXBA 1BQYA 2BHGA 2XBXA 1AQ7A 1EAIA 1PFXC 1UVOA 4P00A 1T4VH 1ANBA 1GG6C 5FCKA 2ZFRH 1NBME 2GX4A 4X1QU 1MD7A 1ZTJA 2BLWA 4HFPB 3UTUH 2G55A 1NRNH 3F3BA 1NC6A 1CVWH 3FP8E 3M7QA 1W14U 1O33A 4X1SU 4TYDA 1A0HB 2WHXA 2RCEA 3TJUA 5C2ZA 3SZNA 2GJGA 7GCHG 1WOFA 4GUXA 3DFJA 1YP9A 3A86A 3SUGA 1Z1IA 1FN6A 2WYJA 1TOCB 1GJ7B 1BTWA 2OC8A 1ESBA 2KFWA 2R2WU 1DSTA 1GI1A 1SGEE 1SKYE 3GICB 2HVYB 4AN7A 1KTSB 1GVZA 4I33A 2YMSC 1DE7H 2W7UA 1XKBC 3ITIA 3U8TH 2FWWA 4ISIH 5CHAB 3SUEA 3CP7A 4AC9A 3F68H 2V35A 1C2JA 1O3AA 5CHBA 3A8BA 1AO5A 1O2NA 1ELFA 4ZHMU 4NFFA 3D23A 1TALA 5EQQA 1IQHA 4ABDA 1OXGA 1QB6A 4CREA 3ZVDA 4O03A 3A7WA 1QB9A 1H9IE 1GJCB 2QF3A 5GCHG 2J92A 1AKSA 1RIWC 1AU8A 2BDCA 1SGTA 1P12E 3N99A 1CHGA 3HKJB 1FUJA 3S69A 3Q00A 4TPYA 4DCDA 5BPEA 1TYNA 2P59A 1PYTC 4Y71A 2C8ZB 3OY6U 1QR3E 1TQ7B 2AS9A 1TE0A 1O5EH 2OBOA 3VGCB 2AEIH 2THFB 2BDGA 2NWNA 6CHAC 2ZGJA 1V2VT 4IW4E 2CHAB 4VGCC 1MKWH 3P8GA 4AG2A 2R9PA 3QGNB 4UEHH 1WQSA 1ESAA 4KTSA 3E8LA 2BVRH 2ZGHA 8KME2 5DJ7A 1TNGA 4ISHH 3SNCA 1WTGH 2RDLA 1O3KA 2ZKSA 4FUCA 1FIZA 1O2QA 4BTUB 1GBTA 1O5BB 3SU5A 3E16B 3LJOA 2ZFPH 3ZV8A 4J1YA 3UR6A 3B23B 2WSSD 5ETXA 2ALVA 1EJMA 1GPZA 2Y6TA 1SVPA 1OP8A 2PGQB 1ZOMA 2QA9E 1SB1H 1DANH 1GVKB 3QX5H 1T7CA 2G51A 4U01A 1SLUB 3FN8A 1O2RA 1WBGB 2H9HA 4LK4A 1FMGA 2Z3EA 3A84A 2HLDD 2OP9A 4XDEA 1AVGH 1PJPA 3KL6A 5I25A 1HJAC 2TGDA 3F1SB 1AWHB 1P9SA 1P2MA 1NY22 1IQNA 3BTME 2GCTC 4K3JA 1AZZA 1ZPZA 3NK8A 4ZCNA 2OC1A 2QXJA 1DITH 1TRNA 4MNXA 2ZGXH 3ZIAD 1BOQA 3BTFE 2A2XH 1IQJA 2BLVA 9LPRA 2PUQH 3WWFA 4B73A 1HXEH 2GCHG 1G32B 1Z7KA 1P3CA 3BV9B 3RXCA 1HCGA 3E0NB 2FYQA 1ELVA 2BVXH 1A2CH 4KTUA 1C2KA 3WW7A 3BEUA 3E0PB 1O36A 3ZZ9A 4DT7B 3ATWA 5SGAE 5LPEA 5B6LA 1EJAA 2XOKD 2GV6A 1BHXF 1FONA 1YCPM 2ANWA 2WPMS 1TGNA 1MTWA 2PTNA 2QIQA 4SGBE 3PV5A 3A81A 3K65B 2GT7A 2QY0B 3BF6H 4Y8XA 2F43B 5EIYA 4ACAA 2AERH 4NA7A 3O8BA 1NFYA 2LP6A 2RA0A 1GHXH 2EI8A 3ZZCA 5GIBA 3TGIE 1TBQH 4X2WA 3BEFB 3N7EA 1FN8A 5IYTA 1EAXA 2GDEH 1O2VA 3CS0A 4FXGH 1NRRH 1ETTH 4BAQB 2ZTXA 1O3BA 4DOQA 4CHAC 2BD9A 2ZA5A 2P8OB 3FANA 3H5CB 4FUEA 4MPVA 3RXLA 4Y0ZE 3LOXA 1EAUA 1A61H 1W0YH 3KQ5A 1YF4A 4FOUC 1GMDF 3KIDU 3M5LA 2FOFA 1UVPA 1E79D 2FLBH 3MHWU 3VG8A 3TNSA 4H4FA 3MO6A 1COWD 3ATLA 1BTYA 2KCPA 3RXEA 1FXYA 3HK3B 1INCA 1YPHC 1BBRE 2VIPA 2TRMA 1ZTKA 1FJSA 1EZXC 1MTNC 2ZG0H 4BNRA 5DN6D 1Z8RA 5F8XA 1Y5BT 1UW7A 3AASA 3MU8A 3ELAH 3O8CA 1O30A 4K1SA 1O3DA 1ZRBA 2BZ6H 2H6MA 3FZZA 2KX4A 1K28D 1NRPH 2BY8X 2GDDA 2P3UB 4NSVA 4OGYA 4B76A 3MQKC 1IQGA 4GPGA 1T8OA 1TOMH 2A4QA 1HAGE 5FBEA 4B2CA 1XUFA 4YESB 3U28C 5FPSA 2Z9GA 1O3CA 1VGCC 1KDQB 4Y10E 2YMSB 2VIWA 3NRLA 4RN6A 2VGCC 1SGQE 4JYVH 1XMNB 2H1UA 1L1GA 2XXLA 2VJ1A 4X2VA 5GWZA 4XBCA 3F6UH 2C4FH 1Q3XA 1GI7B 4HZHA 3PM3A 5EJ1A 3UNRA 1IAUA 4U32A 1YKTA 2R0KA 2VVCA 5L2YH 2XWBI 2M2AA 4YLQH 2FX4A 1DXWA 2LPRA 1RTFB 4KP0A 1C1OA 4IC5A 1ACBE 1RIWB 4I86A 1ZMLA 4GLYA 1O2SA 3MYWA 3ZZ8A 5C0TA 1C1NA 3BTTE 2KAIA 1Y3WA 3CS7A 1E38B 4D9RA 1P9UA 1G3BA 2Z6BD 4H42U 3TK6A 3WY8A 1QJ6B 2W7SA 3V3MA 4ASHA 6CHAB 1QY6A 2BOKA 1Z8GA 3CNRA 3IITA 1T4UH 5CMXH 4O3UA 4VGCB 5HXFA 5IDKA 1QNJA 1QURH 4UFEH 1HV7A 1O31A 3TGJE 1O2YA 1O37A 2H5CA 1SFQB 1QZ8A 3E90B 5DPAA 1MU6B 4TPIZ 3S9BA 4Q7ZA 1N6YA 2BY5X 2SGFE 1B5GH 4MQAA 3M3SA 1WQVH 3RXRA 5JBAS 3UQVA 1DVAH 5JBCS 1LVOA 4IMZA 3B9FH 6GCHF 1EASA 3TU7H 2TIOA 1TB6H 4THNH 4WMDA 1YPHE 3PMBB 1D4PB 1G3DA 4MTBA 3PMHB 5HKKD 2A5IA 1A7SA 2H9EH 3A7ZA 2PSXA 3I78A 1V2OT 3DSPA 2LELA 5CE1A 1WU1A 3LGVA 4WXIA 4X1NU 1FPHH 3RXAA 3UREA 1UTLM 1QL9A 2ZTYA 2ZDVH 1DPOA 3BG8A 3HK6B 3D65E 1TNLA 1HJAB 3N7DA 1PQAA 3M7TA 2ZU4A 4BAKB 2J98A 2BVSH 1C9PA 2GCTB 1NFWA 3JZ1B 1GJDB 2Z9KA 2R3YA 4FUHA 2IN2A 4Q63A 2AH4X 1BT7A 2ZPQA 1ABJH 2UUYA 2G81E 3F0OA 1H9LB 5ESBA 2BXUH 4FVBA 1DOJA 1EFRD 1HAIH 2ZFFH 1BUIA 2HVXA 1S81A 1SGFA 1QL8A 5KECA 2TBSA 4A5TS 2WPJS 3SJ8A 2AIQA 3M3VA 3NPSA 3MFJA 3QDZB 1YPEH 1WDIA 3UR9A 1JIMA 2A4GA 1ELBA 2FI3E 3C27B 4NSYA 2V3OH 1RXPA 1FLEE 2Z9JA 1HAVB 1NRSH 3PV4A 2STAE 1SQTA 1HNEE 1UK4A 1W0JD 1P2OA 5C5NA 2BMGB 2J9NA 3KHVA 2Y5GA 3NXPA 3RLWH 2AMQA 1Z71A 2Q6DA 2ZCKP 3SUDA 1QHRB 1K1LA 3GYLB 1UTQA 4ZROA 2JJ2D 4I8HA 1TPPA 1JIRA 3BTKE 1K1NA 2QXGA 1RGQA 1BRCE 1GHVH 2V3MA 2WPHS 4CHAB 1BBRK 2YNAA 4RKJB 4ISLA 1AN1E 1UCYH 2BTCE 2K1QA 3S9AA 1QA7A 4XD7D 1EAWA 4LXBH 1BRBE 1GI5A 2BY6X 2G4TA 4MNWA 1C5XB 5EQRA 2R0LA 3G01A 3SHAH 2VIQA 1VJ9U 1O5GH 3PB1E 2AIPA 1XUIA 1FV9A 4NIWA 4MVNA 2HGTH 1VITH 1MQ6A 6LPRA 1P11E 1GBFA 2SGDE 5F6MA 2ZDNA 1THPB 2XWAA 2HPPH 2VB0A 3OEED 2WV9A 5GCHF 1QB1A 3GY7A 5C1XA 1IQFA 3T27A 1C4V2 2AGEX 1BTXA 3SV6A 4AG1A 1O3EA 4O97A 1YM0A 1W3CA 4X2XA 4Y0YE 2KR7A 1TX8A 2XCNA 4K69A 1W12U 2FX6A 1P06A 2FESH 4Y6DA 1J8AA 4XRNA 4DIHH 4MG3A 2OC7A 1F5LA 3WWBA 1VCQA 2HWLB 5J4SA 2GV7A 2PP6A 5A0AE 3KNXA 1ZGVA 1Y3YA 4QT8C 2B0FA 5DO4H 1ESTA 1O2UA 1THSH 1VGCB 4MPXA 3OTPA 1F7ZA 1HIAB 2W3IA 2H5DA 2VGCB 1AZ8A 1YYY1 1KYNA 1FAKH 3RUOA 4X8VH 1HXFH 1BMLA 1K1OA 2BLOA 1ELAA 3KQDA 2KCOA 1C5OH 1Y3VA 3Q3XA 3LGYA 1MZDA 4JZFH 2BDAA 3QUMP 4WVPE 1V2MT 1NT1A 2OD3B 3GS9A 1CGHA 3PLBA 1YPJH 1IOEA 3LDXH 1LQDB 2GD4B 3EE0B 4I8JA 3RXQA 1HDTH 1NBMD 1TNHA 1XXDA 1CT0E 4JZ1A 4BTTB 1J14A 5DP7A 1O2IA 2F9UA 1W7XH 4ZHLU 2OINA 3QK1A 1UHBA 3BG4C 1GHZA 3TIUA 2D8WA 4IMQA 3BTHE 3AK5A 1S84A 3GCNA 4SGAE 1O5CB 1C1SA 3SNAA 1O38A 4DY7B 3P8OA 2ODQA 1ANDA 2FPZA 2ZIQH 4NG9H 3MH7A 1DWCH 1GI9B 2ZF0H 3D62A 1SOTA 1FAXA 4E06H 4MDSA 4A6LA 4FU8A 4DVAU 1O3MA 3SHCH 4CBNA 2ZDAH 3IG6B 1EXFA 1YPKH 1GBIA 3GDVA 1TLDA 4MPUA 3ZZAA 4AGJA 1CT2E 1UTNA 2GCHF 2J38A 1AUJA 1GBMA 3F9GA 2ZCHP 1TMUH 4B2BA 4RT0A 1C5MD 3H7OA 1RS0A 1EJNA 4CRDA 3S9CA 4ABFA 3M36A 4AB8A 4B74A 1O2KA 2GVFA 3TVJB 3RU4T 2P95A 3GDUA 4Y11E 2JH6D 3SJKA 4CH8B 2PKSC 1LPZB 4Z0KA 3LT3A 3ZZBA 5L2ZH 1HAZB 1SHYA 1O2JA 1QQUA 4RSPA 5E2PA 2WYGA 3SUFA 1KXAA 3U9AH 1F92A 4WJG2 1YWUA 5DSFA 3QGJA 2KCAA 2PKAA 3LGUA 3MOCA 3BSQA 2XC4A 1K22H 4ZHAA 2Y80A 1P3EA 3M7UA 1C4U2 3VXEH 5HIYA 1ABIH 3SI4H 4B2AA 2CV3A 4Y76A 1C1RA 2FODA 4ESTE 3W95A 4UONA 1XUKA 4B6EA 1EPTC 1O3NA 1KY9A 3ZZ7A 3SJIA 3Q76A 1QCPA 4FU9A 2O8LA 2CK3D 1A5GH 3K9XB 4Q4LA 5K0HA 3O8RA 1QRZA 2PHBA 1P01A 4GHTA 1LHDH 1MKXH 1QBVH 5DP9A 4ACBA 1GBDA 1L1JA 1MUEB 1O2OA 4KGAA 3RU4E 1NO9H 5HMAA 3SORA 1NZQH 2F9OA 5FL7D 1GBBA 3JZ2B 1ELEE 2UWLA 1P8VC 1H9HE 1NS3A 1V2NT 1YPMH 1PQ8A 2DE9A 4MLFB 1ZPCA 1XUHA 2BDIA 4X8SH 4NA9H 1C5YB 2OBQA 3ATKA 1TX7A 2RA3A 2UWOA 3UQOA 1O34A 4NIYA 2ZU5A 3SU6A 3B8JA 2ZQ2A 1CGIE 5IK2D 3GISB 1HAPH 1MH0A 2FYRA 4RKOB 5EQSA 1DS2E 4AOQA 2ZHDA 1HB0B 1VCWA 1HAHH 1S82A 4JZIA 3F9FA 1D6WA 1Z1JA 1SQAA 5EODA 4WY3A 3UUZA 2ASUB 3T29A 1GL1A 4J2YB 1C5LH 4X6MA 4FVDA 1C5SA 2IPHA 1YLCA 2H2ZA 1X7AC 3I77A 1DLEA 2OLGA 1D3PB 2GZ9A 4CH2B 1BTHH 4NGAH 2F3CE 3OYPA 1OPHB 4X1RU 2KM0A 1O5AB 1K21H 1VR1H 4UFGH 2A7CA 2K0QA 3UOPA 1NM6A 1Z8IB 4WMEA 2ZGCA 3NKKA 3MNCA 3HGNA 4D9QA 1LTOA 3DSOA 3LGIA 5FCRA 4BAOB 1D3DB 2XYAA 1P05A 3ATMA 3M5NA 4ISOA 2BD5A 2ZHFH 2BQ6B 5HM2A 3KCGH 4AORA 1WTHD 1MBMA 1OX1A 1GI2A 3T2NA 3ZVFA 3BTQE 3P70B 4B71A 2SFAA 4WWYA 2PR3A 3PMAB 3D49H 3MO3A 2XBWA 1UMAH 3ENSB 1TPAE 2W3KA 4Q2KA 2ODPA 2ZFSA 3RMLH 3Q77A 2A7HA 2BD4A 2G8TA 4YT6H 1WCZA 5GXPA 5JPMH 3S0NA 2IOTA 1F0TA 5LH8A 1MU8B 1SLXB 4XBDA 1PPZA 3U1JB 1LKAA 4OM9A 3O8DA 2J2UA 1P2JA 3BIVH 1FY1A 2EEKA 3RXHA 3LIWA 2PWXA 3M61U 1Z6JH 3U98H 4AFUA 2VWOA 4ZH8A 4A7IB 1EOLA 4AZ2B 1C1PA 2ZHEH 2A32A 2J5UA 4FUGA 4A92A 3F2GA 3VB7A 4XSKU 1CE5A 3QTVH 1F0UA 1BITA 3U69H 3BG4B 2BY9X 1OWJA 1HLTH 1D3TB 4MPWA 4JZEH 2UUJB 1N1LA 2CF9H 1EB2A 3LONA 5EJZA 2XBYA 8GCHG 1FZZA 2F9VA 5A0BA 4D7GA 2FTLE 4ABIA 3T5FH 1C2FA 2CGAA 2GT8A 1ZSKA 3UIRA 1LVMA 1GMHF 3RXTA 4YXWD 1UVSH 3F2HA 4JK6A 1P03A 2NU1E 3SI3H 5FX6A 1GBAA 1W0KD 3PRDA 1GHBG 3EA9A 1PPCE 5T6GA 1HBTH 3RXUA 1G2MA 4YOGA 1K1JA 1HYLA 2VU8E 1V2PT 1UVTH 3SU3A 2EI7A 2ALPA 1SLWB 3ZZ5A 1ZR0A 3FVFB 2BM2A 1QRWA 3SU0A 1GJ6A 2ULLA 3LU9B 3ODFA 3SV9A 2PKSB 5C20A 2HNTC 4INLA 2Q6FA 4B75A 1GG6B 3VB6A 3A8AA 2WUBA 2I6QA 2VBCA 1G2LA 2C8XB 2EY4C 3RP2A 1BRUP 3P17H 3VB5A 1AI8H 5T1VA 1SR5C 1SSXA 1O0DH 1SBWA 1T32A 3SW2B 3ZVCA 3NWUA 1M9UA 1DUAA 4UFFH 1Y59T 1GHYH 3P95A 5EXMA 3MWIU 2SGQE 2B9LA 2WV4A 3SQEE 2IJD1 1OYTH 3QZRA 1SGFG 1CQQA 1EPTB 3ZVBA 3L3TA 5GNDA 3RXKA 2R2MB 1K9OE 4P02A 1TGCA 2ZWLH 2OXSA 1QA0A 4B6FA 1DM4B 3PTNA 3OFND 3LJJA 1QTFA 3GCHC 1LHEH 1H8ED 2G52A 3TH4H 2VWLA 4YTAA 4Y7AA 3RXIA 1DUEA 1ARBA 2EQNA 2QF4A 3MU5A 2AGGX 3BTGE 1C2HA 1V2KT 3LC3A 2A5KA 3A8CA 1DXPA 3AAVA 3SU1A 1QQ4A 3F0PA 4NWKA 3KQCA 5F8ZA 4F48B 1GBCA 1RTKA 1NU9A 3LH1A 5EW2H 1BTPA 1XVMA 2Z94A 3MU1A 1THRH 2FXRA 1FY8E 4XFQA 5A8YA 3L6PA 4LZ1H 2ANKH 2AHME 2VIVA 5B6OA 1FX0B 5HIZA 3ZZ3A 1O2GH 2Y7XA 4TY7A 3STJA 2HPQH 2ZDLA 3PLPA 5EU8A 1LMWB 5G4BA 2F91A 1IQLA 3ATIA 1L4DA 1O3LA 3C1KA 3T62A 1BTUA 2P93A 3RXDA 1GBKA 1SLVB 1O3HA 1OHHD 2A5AA 1KXBA 4CRGA 3T26A 1K2I1 4H6TA 2PGBB 4WH8A 2Y7ZA 4E05H 1EP5A 4TT3D 3FKSD 5E0JA 2WPIS 3A82A 5GDSH 5K7RA 4FUIA 5E8EH 3EQ0H 5A8XA 1B0EA 4MNYA 4I8LA 1YCPK 1KSNA 9ESTA 1ETRH 2P3FH 3UB0A 1CBWC 3OE7D 3OAAD 4R8TB 1YGCH 1TNKA 2SNWA 1SQOA 3BTEE 8LPRA 1MAXA 4BAMB 1LVYA 2GMTC 4AYYB 1Y3XA 3V13A 1LO6A 2BX3A 1LHCH 1AKSB 1ZYOA 1C1WH 1IHSH 2HOBA 1S6LA 1E37B 3SZEA 2JH5D 1F0RA 1TGBA 5C94A 1O3PB 1F5RA 1LCYA 1AVXA 3DUXH 2ZFQH 1O2TA 3KYGA 1GI8B 3LH3A 3N7OA 2PTCE 4YO9A 1RD3B 5DP6A 4DGJA 1S5SA 3P92A 1XX9A 4UDWH 1LKBA 3EAJA 3SQHE 1TPSA 1Q2WA 2ZC9H 1TMBH 5FHTA 4A1VA 4CBOA 3LGWA 1CHOG 5LPRA 2OQUA 2ZU1A 2F9BH 1BB0B 2NU2E 1TFXA 4LZ4B 3OY5U 2WPLS 1UTKA 2QN5T 1F5KU 2A1DB 4RI0A 1T8NA 1BA8B 3Q3KA 2IPQX 4NZQA 1KXEA 4HTCH 1AVWA 4ZXYH 1QFKH 4BTIB 4KKDA 1P04A 2WPKS 4HG6A 4KELA 1ZZZA 4CRBA 1Y5AT 2ZECA 4CRCA 1B7XB 1DT2A 2XCFA 1GMDG 1S6HA 1FQ3A 7GCHF 1VITG 3RC6A 1C1UH 3ZYEA 1KIGH 1TX6A 5A8ZA 2NU0E 3OSYA 4I8KA 5AVDA 3MTYA 1PPGE 2BY7X 2PSYA 3Q3YA 5GJ4B 1ANCA 4ZXXH 3AVZA 5C67A 1A5HA 1DWDH 3E91A 2LNCA 5JBBS 5C1UA 1P10A 3K6YA 4H6SB 1FY3A 4M9FA 2FOEA 4CR5A 1BRAA 2SGPE 1J9CH 4OS4A 2AGIX 1HJ9A 3TK5A 1C1MA 2JH0D 3PWBA 3FAOA 4OGXA 4INKA 3URCA 2FO9A 1C1QA 1MBQA 2YOLA 1A4WH 3A7VA 4ABAA 1E36B 3TH2H 4JYTA 1YY3A 1W13U 4K5ZA 3QLPH 1YCPH 4TSFD 5A0CA 1JMOH 1MTNB 3GDSA 2ZCLP 1LVBA 2GTBA 3SJOA 3MH6A 1OWDA 1ZJKA 1OWIA 1A5IA 2ZFTA 3RM2H 1YPGH 2BDYA 1UO6A 2FTMA 4KTCA 4I7YH 2FDAA 1W10U 1NESE 4D7FA 1ID5H 2NU3E 1FIWA 1TNIA 2SGAA 3E3TA 1GCTC 2L6OA 2PFEA 3U8OH 3MH4A 2QF5A 1NROH 2J97A 1W11U 3PRBA 3SBKA 2AMDA 1GBLA 4D76A 1SPJA 4X2YA 4DURA 3F2FA 4IN2A 2WV5A 1CSOE 1H8DH 1P2IA 1GWAA 1ORFA 3GCHB 5E0GA 3E1XB 1AHTH 1XXFA 5DGJA 2FZZA 4NCYA 2C8WB 5HM9A 2TGAA 1GMCG 5J4QA 1MTSA 3FZDA 3P6ZB 3OEHD 4NIVA 4ZAEA 4D8NA 2G5VA 4IS5A 3V12A 5L30H 5F03A 1GGDC 1O2PA 1GJAB 2CF8H 2VVVA 3L33A 4TWYA 5E2OA 1GJ4H 2FP7B 5I46H 1ZTLA 5EPNA 2FI4E 4NFEA 1OP0A 2VWNA 3UY9A 1MTUA 1TA6A 3FP7E 1AFEH 5AFYH 1BIOA 1RRKA 1TMTH 2ZU2A 1ANEA 2WUCA 2J4IA 4GHQA 1DX5M 5LGOA 3STIA 1YC0A 1EQ9A 1Y8TA 2VWMA 1C4Y2 3NCLA 5DKMA 2KZ4A 1C2LA 1T8MA 2Y5FA 2ZI2H 2OCVB 1VKYA 2JETC 3GOVB 1AD8H 2G00A 1EP6A 3DFLA 2ZTZA 1S6FA 1HPGA 1G9IE 1BBRH 1DWEH 1C5NH 2BOHB 2BDHA 1HAYB 4UFDH 2ZDMA 3KN2A 5KEDA 7LPRA 2XW9A 5EOKA 3SOSA 4CRAA 3PWCA 4I32A 1OKXA 3HKIB 1DFPA 4NA8A 1MD8A 5AF9H 1S0QA 1QJ1B 3GCTG 1KDQA 3RXSA 1GHAG 1J15A 2VIDA 1VCPA 1ZHPA 1XVOA 1H8HD 4RT1A 1ZGIA 1TBZH 3ESTA 3A83A 3RU4D 2YNBA 4AFQA 3SGBE 5AFZH 1CBWB 2C3SA 3S7KB 2C8YB 4TWWA 1FI8A 1LDTT 1SC8U 1C1VH 3A85A 5LPFA 2FS8A 3KEEA 2GMTB 1HUTH 8GCHF 3ZVAA 1DY9A 2FI5E 4M7GA 1T8LA 2OTVA 3KQEA 1WXRA 4ZUHA 3UNQA 2D26C 4O9VA 1WSSH 3R3GB 4YOJA 2ZEBA 1ZMJA 2KAIB 2SNVA 4FETA 2I6SA 4X0WU 1NTPA 3AW1A 2Y5HA 1V2TT 3URDA 1C5QA 4Z6AH 3S7HB 3QZQA 3DSGA 1GHBF 1MABB 1TONA 4X6OA 4ZKSU 3P8NA 5L6NH 1Z6EA 2HALA 1RJXB 1O2MA 2FM2A 4X6NA 3HATH 1GI4A 4IBLH 3RC4A 3MNSA 1GDQA 2A2QH 2VNTA 1LPGB 2ANYA 2RG3A 4IGDA 1C5UA 3HGPA 5BRRE 2JDID 4BOHA 4TY6A 1AE8H 3TJOA 2BD2A 2F9PA 2QAAA 3M3TA 1AMHA 3UAIC 1XM1A 5FBIA 1NPMA 1C5TA 2AYWA 2ZP0H 4FUDA 1K1MA 1RFNA 2ZHWH 1D9IA 2XC5A 2TGTA 1BMMH 2XNDD 2QE7D 2GGVB 3SO3A 2SGEE 2QXIA 3SJ9A 1NU7B 1JOUB 2OQ5A 2HRVA 1CA0C 1BMFD 1U6QA 3A89A 3ZVEA 1GJBB 3MNXA 3SGAE 4CR9A 5A09A 2B5TB 3P8FA 5JB9S 2KCYA 3TH3H 3PTBA 4UD9H 1KLTA 2J98B 3A80A 1D6RA 2QC2A 1EKBB 2YMSD 3RMOH 2CJIA 5T3HA 1EB1H 3PLKA 1O39A 1FY4A 1V2ST 4WMFA 2BD3A 3QTOH 1TGSZ 4WXVA 4Y8ZA 3NUMA 2FMJA 4X8TH 2Z7FE 4GCHG 3GY8A 1K0HA 5EXNA 2ZNKH 1SMFE 2M5TA 1FY5A 3SV2H 3SU2A 1Y5UT 2C90B 1N6XA 2W5EA 4A1TA 2Q1JA 5AHGH 5DP4A 2TPIZ 2W6JD 3UWJH 3EGKH 2FOAA 3SNBA 1GDNA 1ZMNA 1GVLA 2QV1A 2ODYB 1V2RT 3KGPA 1K1IA 1W0ZU 2BXTH 3OX7U 2V7QD 1NFXA 3RXVA 1PYTD 8ESTE 1S85A 1HAVA 1JBUH 1EX3A 1PPHE 2W6ID 2A7JA 3BTDE 7KMEH 1C2DA 2ZDKA 1J16A 5HYOA 1GCTB 3E6PH 2FIRH 1OP2A 3RXJA 3IWMA 1SGIB 4F55A 4Q7YA 4JK5A 1O3IA 2QYIA 1V6DA 3TJVA 1TWXB 1UCYE 2XRCA 5C1YA 3RXOA 1OSSA 4XOJA 2PV9B 5E0HA 1OYQA 1WAYB 1J17T 1O5DH 4ABBA 2AFQB 1T31A 1HJ8A 1BMNH 5C17A 2XTTB 3VFEA 2XBVA 5ABWA 3MNBA 3GY4A 1DICA 1HRTH 1GGDB 3DT0H 4E7NA 1O3JA 3AAUA 1H1BA 1GBJA 1ZLRA 2HLCA 1W7GH 3V7TA 1GJ9B 2JIZD 2Z9IA 1E35B 1DSUA 4NZLA 1RTLA 4BAHB 1YPLH 1G30B 2R3UA 5F8TA 4XBBA 4ZKNU 3SNEA 4K8YA 3MU0A 2P3TB 1G3EA 3ZV9A 2VH0A 1GJ8B 1V2UT 4DT4A 1MQ5A 1AB9C 2JETB 1TBRH 2FOBA 2QF0A 3RC5A 3MMGA 4IN1A 1VZQH 1A0JA 5H4IB 3M35A 3RXMA 3F9EA 5T6DA 3PO1C 3M5OA 4R0IA 1DLKB 2ZPRA 3UWIA 1ARCA 5CDFE 2EA3A 1L0ZA 1KXCA 1O32A 1FDPA 4K8BA 4Y8YA 5C0UA 1UTJA 1KXDA 4E7RG 1A3BH 4X8UH 1CHOF 3TITA 4OS6A 3HPTB 3SV8A 1D3QB 1HIAA 1UK2A 3QN7A 3SGQE 4Y7BA 2XC0A 2V6NA 5DP3A 1NRQH 2ZGBH 2OUAA 1HAOH 1PQ5A 1BTZA 1BHXB 3OU0A 2UUKB 1PPBH 1QBNA 1V2QT 1TGTA 2L74A 1MMJN 1AUTC 3H09A 3FP6E 3SN8A 3U1IB 4X6PA 1YBWA 3EDXB 3QO6A 1ZPBA 1FNIA 2A31A 5FPYA 3R0FA 3A7XA 3W1EA 1V2LT 1SI5H 1VITF 3MH5A 1TQ0B 1AIXH 1TIOA 5FAHA 1UHBB 1SFIA 1A0LA 1SGNE 4WF8A 1C2GA 1ELGA 1PQ7A 2B8OH 5EPYA 1LHGH 2J95A 4AFSA 1JXPA 1OS8A 1QL7A 1Z8JB 1EUFA 1KTTB 1GHWH 4PROA 1SGYE 2FLRH 4Z1MD 1C5ZB 1ZJDA 3FFGA 2JJ1D 1SOZA 1C2IA 3RMNH 1C5VA 4DW2U 1JRSA 3DCLA 2ILNA 1SGRE 2D2DA 3AW0A 1E34B 1ZSJA 1EOJA 1C5PA 5JB8S 3MI4A 2OK5A 3PROA 2Y82A 2EC9H 2QGRA 2P16A 1CU1A 1MTVA 4Q7XA 1UTOA 1O3FA 1N8OC 5C3NA 4K60A 2BDBA 2BX4A 1AFQC 1MZAA 5ESTE 3TJNA 1CT4E 4ZMAH 2FOGA 2B7DH 2WINI 2VVUA 3MU4A 5DP5A 4JCNA 1F2SE 1CA0B 1Q31A 2Y81A 5C5OA 1SQRA 1V3XA 3U8RH 1TA2A 4FUFA 5DP8A 3H7TA 2Q6GA 1O2XA 2O8UA 3EYDA 1CGJE 2BYAX 1P0SH 4ZKRU 5TCCA 1PPFE 2PKAB 1IQEA 5HGGA 2QXHA 1LHFH 3NZIA 1QJ7B 2BQWB 1ZHMA 6ESTA 2VIOA 1ELCA 3GYMA 1ZSLA 2BLQA 3BIUH 1GMCF 1O2HA 1ZRKA 3FO8D 2GZ8A 3UNSA 3BTWE 1HGTH 3PV2A 4AX9H 5TJXA 2AMPA 4Y79A 3CENA 4YLUA 3UPEA 1GBEA 2GZ7A 3A8DA 1L2EA 1GJ5H 1IQKA 3PMJA 1O2ZA 4F49A 1UCYK 2BB4A 2P94A 2Z9LA 4GSOA 3LGTA 5EW1H 2HNTE 3TPIZ 2VINA 1CA8B 3VB4A 2Z3CA 2BD8A 3QWCH 3SYJA 4I8GA 1GCDA 1GBHA 2ESTE 3A7TA 4A1XA 1AGJA 1BZXE 4LOYH 4DIIH 2QCYA 4FU7A 2NU4E 5A2MH 1AWFH 1E1QD 1TAWA 2F9NA 1UVUH 2UUFB 1V2JT 2UWPA 3K2UA 4ISNA 4AGKA 1C9TA 1O5FH 1QBOA 1SG8B 4Q80A 5GPIB 1ELDE 4X1PU 4JZDH 2J94A 3RXFA 3EA8A 4DG4A 1A3EH 1HAXB 5EGMA 2C93B 2TGPZ 1O35A 1OWEA 5F53A 2ZU3A 3GCTF 3BEIB 1BJUA 1GHAF 3LKWA 3LPRA 3ZZ6A 3I29A 1F0SA 1LQEA 3VPKA 2XNIA 4WH6A 3RLYH 1QIXB 2FOHA 2O8MA 1DDJA 1BMAA 3KYFA 3MO9A 2ANMH 3UFAA 5EG4A 4U30A 3KF2A 1YLNA 1GMHG 4B1TA 3UOUA 3ZVGA 1H4WA 1OWHA 2ZQ1A 1UTPA 1P57B 4OS1A 1C1TA 1AB9B 3EA7A 5EXLA 5CHAC 1P2KA 5FX5A 4DJZB 1W8BH 1XUGA 1P09A 1QGFA 1B0FA 1LPKB 1CO7E 2PUXB 1C5RA 2D1JA 1FPCH 2F4LA 1SL3A 3PO1B 5DG6A 1BDAA 2HNTF 4IC6A 1KLIH 1L4ZA 1JWTA 3TNTA 1TABE 3FOAA 2WPDD 1P02A 2JKHA 3DA9B 1E1RD 4OS5A 4CRFA 5JBTA 2O9QA 2A0QB 2CN0H 3VXFH 4AYVB 1WUNH 1UJ1A 5DK1A 1E0FD 1S83A 2F83A 1PPEE 3K6ZA 1GI3A 1OWKA 3TLOA 4K1TA 1O3GA 2G4UA 5JYIA 2CMYA 2O8WA 3SNDA 1TNJA 4ABJA 5FPTA 4BXSA 2K8IA 4ASUD 3GY2A 4OS2A 3F9HA 3VGCC 3RMMH 5JDUB 3W94A 4O3TA 3PYHA 1EATA 2GP9B 2V0BA 4FUJA 1G3CA 2CHAC 1SGDE 7ESTE 2A45B 1AY6H 1C5WB 1W2KH 4NIXA 4YOIA 1IHTH 2IJOB 1XKAC 1NFUA 1QRXA 1TPOA 1EZSC 4NWLA 3EE7A 1C2EA 3RXPA 3A87A 5FXLA 1O2LA 1H8IH
chains in the Genus database with same CATH topology
1WV7H 1GI0A 1UK3A 2DE8A 2V3HH 1YLDA 2FOCA 4HGCA 1HFDA 4K1EA 1BCUH 1DY8A 1GI6A 1MCVA 1O2WA 4GVUA 3VB3A 3BN9A 3V0XA 1SHHB 3M5MA 3ZYDA 1WYKA 3RXGA 1DWBH 2A4OA 3A7YA 4GCHF 4ABEA 1VJAU 1IQIA 2DUCA 1JRTA 1A46H 5TCAA 4HI3A 4FUBA 4YM9A 1N8OB 2OC0A 1UTMA 1BJVA 1G36A 1EZQA 4BANB 1AFQB 1MCTA 1XUJA 2G5NA 1V2WT 4JYUH 1IQMA 2EI6A 1OOKB 2CXVA 3RM0H 4GAWA 4MNVA 3RDZA 2Z3DA 1KLJH 2A4RA 5PTPA 1S0RA 3A88A 1SGPE 4F4OC 1MKXK 2STBE 1AE5A 3T28A 3DD2H 4ABGA 2ZPSA 2VH6A 4XE4A 1ZHRA 3M37A 3GY6A 4JMYA 1K1PA 6GCHG 1ETSH 1TRMA 3GCOA 3SU4A 3TGKE 3DHKH 4AB9A 4AFZA 5T6FA 3LC5A 2BZAA 3SV7A 1EZUC 4BXWA 2FOMB 1KXFA 1GL0E 1MAYA 1G37A 2GKVE 1SGCA 1EPTA 1NN6A 2W26A 3TK9A 1GDUA 1ELTA 3KQBA 1TRYA 4UE7H 2FEQH 2BQ7B 2H9TH 3OTJE 2FS9A 3ZZDA 1Y3UA 1MKWK 4U2WA 2ZZUH 4INHA 1C2MA 2ZO3H 4K2YA 3ODDA 3GY5A 3ZZ4A 3T25A 4OS7A 4YT7H 2P8OC 1A1RA 4YZUA 2BD7A 2PLXA 4I31A 4ZKOU 2O8TA 3GY3A 1L1NA 1P2NA 1P2QA 2J34A 4ABHA 3VEQB 1O3OA 2ZHQH 2PW8H 3RXBA 1BQYA 2BHGA 2XBXA 1AQ7A 1EAIA 1PFXC 1UVOA 1T4VH 1ANBA 1GG6C 5FCKA 2ZFRH 2GX4A 4X1QU 1MD7A 1ZTJA 2BLWA 4HFPB 3UTUH 2G55A 1NRNH 1NC6A 1CVWH 3FP8E 3M7QA 1W14U 1O33A 4X1SU 4TYDA 1A0HB 2RCEA 3TJUA 5C2ZA 3SZNA 7GCHG 1WOFA 4GUXA 3DFJA 1YP9A 3A86A 3SUGA 1Z1IA 1FN6A 2WYJA 1TOCB 1GJ7B 1BTWA 2OC8A 1ESBA 2R2WU 1DSTA 1GI1A 1SGEE 3GICB 4AN7A 1KTSB 1GVZA 4I33A 1DE7H 2W7UA 1XKBC 3ITIA 3U8TH 2FWWA 4ISIH 5CHAB 3SUEA 3CP7A 3F68H 2V35A 1C2JA 1O3AA 3A8BA 1AO5A 1O2NA 1ELFA 4ZHMU 4NFFA 3D23A 1TALA 5EQQA 1IQHA 4ABDA 1OXGA 1QB6A 4CREA 3ZVDA 4O03A 3A7WA 1QB9A 1H9IE 1GJCB 2QF3A 5GCHG 2J92A 1AKSA 1RIWC 1AU8A 2BDCA 1SGTA 1P12E 1CHGA 3HKJB 1FUJA 3S69A 3Q00A 4TPYA 4DCDA 5BPEA 1TYNA 2P59A 1PYTC 4Y71A 2C8ZB 3OY6U 1QR3E 1TQ7B 2AS9A 1TE0A 1O5EH 2OBOA 3VGCB 2AEIH 2THFB 2BDGA 2NWNA 6CHAC 2ZGJA 1V2VT 4IW4E 2CHAB 4VGCC 1MKWH 3P8GA 4AG2A 2R9PA 3QGNB 4UEHH 1WQSA 1ESAA 4KTSA 3E8LA 2BVRH 2ZGHA 8KME2 5DJ7A 1TNGA 4ISHH 3SNCA 1WTGH 2RDLA 1O3KA 2ZKSA 4FUCA 1FIZA 1O2QA 4BTUB 1GBTA 1O5BB 3SU5A 3E16B 3LJOA 2ZFPH 3ZV8A 4J1YA 3UR6A 3B23B 5ETXA 2ALVA 1EJMA 1GPZA 2Y6TA 1SVPA 1OP8A 2PGQB 1ZOMA 2QA9E 1SB1H 1DANH 1GVKB 3QX5H 1T7CA 2G51A 4U01A 1SLUB 1O2RA 1WBGB 2H9HA 4LK4A 1FMGA 2Z3EA 3A84A 2OP9A 4XDEA 1AVGH 1PJPA 3KL6A 5I25A 1HJAC 2TGDA 3F1SB 1AWHB 1P9SA 1P2MA 1NY22 1IQNA 3BTME 2GCTC 4K3JA 1AZZA 1ZPZA 3NK8A 2OC1A 2QXJA 1DITH 1TRNA 4MNXA 2ZGXH 1BOQA 3BTFE 2A2XH 1IQJA 2BLVA 9LPRA 2PUQH 4B73A 1HXEH 2GCHG 1G32B 1Z7KA 1P3CA 3BV9B 3RXCA 1HCGA 3E0NB 2FYQA 1ELVA 2BVXH 1A2CH 4KTUA 1C2KA 3BEUA 3E0PB 1O36A 3ZZ9A 4DT7B 3ATWA 5SGAE 5LPEA 1EJAA 2GV6A 1BHXF 1FONA 1YCPM 2ANWA 2WPMS 1TGNA 1MTWA 2PTNA 2QIQA 4SGBE 3A81A 3K65B 2GT7A 2QY0B 3BF6H 4Y8XA 2AERH 4NA7A 3O8BA 1NFYA 2RA0A 1GHXH 2EI8A 3ZZCA 5GIBA 3TGIE 1TBQH 4X2WA 3BEFB 1FN8A 5IYTA 1EAXA 2GDEH 1O2VA 3CS0A 4FXGH 1NRRH 1ETTH 4BAQB 2ZTXA 1O3BA 4DOQA 4CHAC 2BD9A 2ZA5A 2P8OB 3FANA 3H5CB 4FUEA 4MPVA 3RXLA 4Y0ZE 3LOXA 1EAUA 1A61H 1W0YH 1YF4A 1GMDF 3KIDU 3M5LA 2FOFA 1UVPA 2FLBH 3MHWU 3TNSA 4H4FA 3MO6A 3ATLA 1BTYA 3RXEA 1FXYA 3HK3B 1INCA 1YPHC 1BBRE 2VIPA 2TRMA 1ZTKA 1FJSA 1EZXC 1MTNC 2ZG0H 4BNRA 1Z8RA 5F8XA 1Y5BT 3AASA 3MU8A 3ELAH 3O8CA 1O30A 4K1SA 1O3DA 1ZRBA 2BZ6H 2H6MA 3FZZA 1K28D 1NRPH 2BY8X 2GDDA 2P3UB 4NSVA 4OGYA 4B76A 1IQGA 4GPGA 1T8OA 1TOMH 2A4QA 1HAGE 5FBEA 4B2CA 1XUFA 4YESB 5FPSA 2Z9GA 1O3CA 1VGCC 1KDQB 4Y10E 2VIWA 4RN6A 2VGCC 1SGQE 4JYVH 1XMNB 2H1UA 1L1GA 2XXLA 2VJ1A 4X2VA 5GWZA 4XBCA 3F6UH 2C4FH 1Q3XA 1GI7B 4HZHA 3PM3A 3UNRA 1IAUA 4U32A 1YKTA 2R0KA 2VVCA 5L2YH 2XWBI 4YLQH 2FX4A 1DXWA 2LPRA 1RTFB 4KP0A 1C1OA 4IC5A 1ACBE 1RIWB 1ZMLA 4GLYA 1O2SA 3MYWA 3ZZ8A 1C1NA 3BTTE 2KAIA 1Y3WA 3CS7A 1E38B 4D9RA 1P9UA 1G3BA 2Z6BD 4H42U 3TK6A 3WY8A 1QJ6B 2W7SA 3V3MA 4ASHA 6CHAB 1QY6A 2BOKA 1Z8GA 3IITA 1T4UH 5CMXH 4O3UA 4VGCB 5HXFA 5IDKA 1QNJA 1QURH 4UFEH 1HV7A 1O31A 3TGJE 1O2YA 1O37A 2H5CA 1SFQB 3E90B 5DPAA 1MU6B 4TPIZ 3S9BA 4Q7ZA 1N6YA 2BY5X 2SGFE 1B5GH 4MQAA 3M3SA 1WQVH 3RXRA 5JBAS 3UQVA 1DVAH 5JBCS 1LVOA 4IMZA 3B9FH 6GCHF 1EASA 3TU7H 2TIOA 1TB6H 4THNH 4WMDA 1YPHE 3PMBB 1D4PB 1G3DA 4MTBA 3PMHB 2A5IA 1A7SA 2H9EH 3A7ZA 2PSXA 3I78A 1V2OT 5CE1A 1WU1A 3LGVA 4WXIA 4X1NU 1FPHH 3RXAA 3UREA 1UTLM 1QL9A 2ZTYA 2ZDVH 1DPOA 3BG8A 3HK6B 3D65E 1TNLA 1HJAB 1PQAA 3M7TA 2ZU4A 4BAKB 2BVSH 1C9PA 2GCTB 1NFWA 3JZ1B 1GJDB 2Z9KA 2R3YA 4FUHA 2IN2A 2AH4X 1BT7A 2ZPQA 1ABJH 2UUYA 2G81E 1H9LB 5ESBA 2BXUH 4FVBA 1DOJA 1HAIH 2ZFFH 1BUIA 2HVXA 1S81A 1SGFA 1QL8A 2TBSA 4A5TS 2WPJS 3SJ8A 2AIQA 3M3VA 3NPSA 3MFJA 3QDZB 1YPEH 3UR9A 1JIMA 2A4GA 1ELBA 2FI3E 3C27B 4NSYA 2V3OH 1RXPA 1FLEE 2Z9JA 1HAVB 1NRSH 3PV4A 2STAE 1SQTA 1HNEE 1UK4A 5C5NA 1P2OA 2BMGB 2J9NA 3KHVA 2Y5GA 3NXPA 3RLWH 2AMQA 1Z71A 2Q6DA 2ZCKP 3SUDA 1QHRB 1K1LA 3GYLB 1UTQA 4ZROA 4I8HA 1TPPA 1JIRA 3BTKE 1K1NA 2QXGA 1RGQA 1BRCE 1GHVH 2WPHS 4CHAB 1BBRK 2YNAA 4RKJB 4ISLA 1AN1E 1UCYH 2BTCE 2K1QA 3S9AA 1QA7A 1EAWA 4LXBH 1BRBE 1GI5A 2BY6X 2G4TA 4MNWA 1C5XB 5EQRA 2R0LA 3G01A 3SHAH 2VIQA 1VJ9U 1O5GH 3PB1E 2AIPA 1XUIA 1FV9A 4NIWA 4MVNA 2HGTH 1VITH 1MQ6A 6LPRA 1P11E 1GBFA 2SGDE 5F6MA 2ZDNA 1THPB 2XWAA 2HPPH 2VB0A 5GCHF 1QB1A 3GY7A 5C1XA 1IQFA 3T27A 1C4V2 2AGEX 1BTXA 3SV6A 4AG1A 1O3EA 4O97A 1YM0A 1W3CA 4X2XA 4Y0YE 1TX8A 2XCNA 4K69A 1W12U 2FX6A 1P06A 2FESH 4Y6DA 1J8AA 4DIHH 4MG3A 2OC7A 1F5LA 1VCQA 2HWLB 5J4SA 2GV7A 5A0AE 3KNXA 1ZGVA 1Y3YA 4QT8C 2B0FA 5DO4H 1ESTA 1O2UA 1THSH 1VGCB 4MPXA 1F7ZA 1HIAB 2W3IA 2H5DA 2VGCB 1AZ8A 1YYY1 1KYNA 1FAKH 3RUOA 4X8VH 1HXFH 1BMLA 1K1OA 2BLOA 1ELAA 3KQDA 1C5OH 1Y3VA 3Q3XA 3LGYA 1MZDA 4JZFH 2BDAA 3QUMP 4WVPE 1V2MT 1NT1A 2OD3B 1CGHA 3PLBA 1YPJH 1IOEA 3LDXH 1LQDB 2GD4B 3EE0B 4I8JA 3RXQA 1HDTH 1TNHA 1XXDA 1CT0E 4JZ1A 4BTTB 1J14A 5DP7A 1O2IA 2F9UA 1W7XH 4ZHLU 2OINA 3QK1A 1UHBA 3BG4C 1GHZA 3TIUA 2D8WA 4IMQA 3BTHE 1S84A 3GCNA 4SGAE 1O5CB 1C1SA 3SNAA 1O38A 4DY7B 3P8OA 2ODQA 1ANDA 2FPZA 2ZIQH 4NG9H 3MH7A 1DWCH 1GI9B 2ZF0H 3D62A 1SOTA 1FAXA 4E06H 4MDSA 4A6LA 4FU8A 4DVAU 1O3MA 3SHCH 4CBNA 2ZDAH 3IG6B 1EXFA 1YPKH 1GBIA 3GDVA 1TLDA 4MPUA 3ZZAA 4AGJA 1CT2E 1UTNA 2GCHF 2J38A 1AUJA 1GBMA 3F9GA 2ZCHP 1TMUH 4B2BA 1C5MD 3H7OA 1RS0A 1EJNA 4CRDA 3S9CA 4ABFA 3M36A 4AB8A 4B74A 1O2KA 2GVFA 3TVJB 3RU4T 2P95A 3GDUA 4Y11E 2JH6D 3SJKA 4CH8B 2PKSC 1LPZB 4Z0KA 3LT3A 3ZZBA 5L2ZH 1HAZB 1SHYA 1O2JA 1QQUA 4RSPA 5E2PA 2WYGA 3SUFA 1KXAA 3U9AH 1F92A 4WJG2 3QGJA 2PKAA 3LGUA 3MOCA 3BSQA 2XC4A 1K22H 4ZHAA 2Y80A 1P3EA 3M7UA 1C4U2 3VXEH 1ABIH 3SI4H 4B2AA 2CV3A 4Y76A 1C1RA 2FODA 4ESTE 3W95A 4UONA 1XUKA 1EPTC 1O3NA 1KY9A 3ZZ7A 3SJIA 3Q76A 1QCPA 4FU9A 2O8LA 1A5GH 3K9XB 5K0HA 3O8RA 1QRZA 2PHBA 1P01A 4GHTA 1LHDH 1MKXH 1QBVH 5DP9A 1GBDA 1L1JA 1MUEB 1O2OA 4KGAA 3RU4E 1NO9H 5HMAA 3SORA 1NZQH 2F9OA 1GBBA 3JZ2B 1ELEE 2UWLA 1P8VC 1H9HE 1NS3A 1V2NT 1YPMH 1PQ8A 2DE9A 4MLFB 1ZPCA 1XUHA 2BDIA 4X8SH 4NA9H 1C5YB 2OBQA 3ATKA 1TX7A 2RA3A 2UWOA 3UQOA 1O34A 4NIYA 2ZU5A 3SU6A 3B8JA 2ZQ2A 1CGIE 3GISB 1HAPH 1MH0A 2FYRA 4RKOB 5EQSA 1DS2E 4AOQA 2ZHDA 1HB0B 1VCWA 1HAHH 1S82A 4JZIA 3F9FA 1D6WA 1Z1JA 1SQAA 5EODA 4WY3A 3UUZA 2ASUB 3T29A 1GL1A 4J2YB 1C5LH 4X6MA 4FVDA 1C5SA 2IPHA 1YLCA 2H2ZA 1X7AC 3I77A 1DLEA 2OLGA 1D3PB 2GZ9A 4CH2B 1BTHH 4NGAH 2F3CE 3OYPA 1OPHB 4X1RU 4UFGH 1O5AB 1K21H 1VR1H 2A7CA 3UOPA 1NM6A 1Z8IB 4WMEA 2ZGCA 3NKKA 3MNCA 3HGNA 4D9QA 1LTOA 3LGIA 5FCRA 4BAOB 1D3DB 2XYAA 1P05A 3ATMA 3M5NA 4ISOA 2BD5A 2ZHFH 2BQ6B 5HM2A 3KCGH 4AORA 1WTHD 1MBMA 1OX1A 1GI2A 3T2NA 3ZVFA 3BTQE 3P70B 4B71A 2SFAA 4WWYA 2PR3A 3PMAB 3D49H 3MO3A 2XBWA 1UMAH 3ENSB 1TPAE 2W3KA 4Q2KA 2ODPA 2ZFSA 3RMLH 3Q77A 2A7HA 2BD4A 2G8TA 4YT6H 1WCZA 5GXPA 5JPMH 3S0NA 2IOTA 1F0TA 5LH8A 1MU8B 1SLXB 4XBDA 1PPZA 3U1JB 1LKAA 3O8DA 2J2UA 1P2JA 3BIVH 1FY1A 2EEKA 3RXHA 3LIWA 2PWXA 3M61U 1Z6JH 3U98H 4AFUA 2VWOA 4ZH8A 4A7IB 1EOLA 4AZ2B 1C1PA 2ZHEH 2A32A 4FUGA 4A92A 3VB7A 4XSKU 1CE5A 3QTVH 1F0UA 1BITA 3U69H 3BG4B 2BY9X 1OWJA 1HLTH 1D3TB 4MPWA 4JZEH 2UUJB 1N1LA 2CF9H 1EB2A 3LONA 2XBYA 8GCHG 1FZZA 2F9VA 5A0BA 4D7GA 2FTLE 4ABIA 3T5FH 1C2FA 2CGAA 2GT8A 1ZSKA 3UIRA