1GJDB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 53
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjdB01
1RTKA 3E3TA 1S5SA 4FUDA 2CHAB 4TPIZ 5A2MH 1FJSA 8GCHG 1HJAC 2PKAB 4A1VA 4ABAA 2GX4A 3SQHE 1MZAA 2OTVA 2WV5A 3KF2A 3RXCA 2Z3CA 3SI4H 1BTHH 5I46H 2PSYA 1O2SA 2AH4X 1SC8U 4NZQA 1ANDA 4AFUA 3AASA 3ZZ5A 1A0HB 1XUGA 5GJ4B 1PPZA 1CA0C 2FTMA 3ZZ9A 1P12E 4YLQH 1W7XH 4Q2KA 1O2TA 2OQ5A 2R3UA 4RSPA 1BQYA 4GCHG 1N6YA 2AS9A 4OS1A 2QCYA 4M7GA 1O2GH 2EI6A 2PV9B 1OP2A 4X8SH 4YT6H 5DK1A 2FS8A 1SHHB 1B0EA 5EXNA 1ZHPA 1HB0B 3ODFA 2ZHEH 1EJAA 1YGCH 1DOJA 1P0SH 2BDYA 3ENSB 3EA8A 3SGQE 1G37A 1C5RA 3LGYA 4FUHA 5JYIA 2BB4A 5C2ZA 2W3IA 4I8HA 2FOHA 1HPGA 2F3CE 1SSXA 5EW1H 6GCHF 4UDWH 1OWHA 3SUEA 1ZYOA 2ZCKP 3OY5U 3E0NB 2PR3A 3PMHB 1UTMA 4KELA 1O5CB 2A4RA 1O33A 2XRCA 3UR6A 2PLXA 3TGKE 2A7JA 4OS7A 2WYGA 2EI7A 1V2PT 9ESTA 1ELBA 1YLDA 5EU8A 3UR9A 1O5BB 2BVRH 2FWWA 1CGIE 4K2YA 1UVSH 1GHAF 1RGQA 1QQ4A 1PFXC 4KTSA 3QZRA 1S6FA 4XBDA 1F0TA 1HXFH 1UVUH 4WY3A 1GCDA 3Q77A 3RP2A 1QJ1B 5LPEA 3EGKH 1EJMA 1GJAB 2A4QA 4KTUA 3JZ1B 1ABIH 3RXOA 1C5VA 4CREA 3V0XA 2FMJA 7KMEH 5HMAA 2FOGA 2VINA 4Y79A 1SGFA 1VCPA 2VB0A 1CVWH 4O3TA 2XC5A 2PTNA 2Z9GA 4K1SA 2B0FA 1NFXA 1C1NA 1RIWC 2SNWA 3LJOA 4UFFH 1CA8B 4FUFA 5J4SA 3A7VA 3LU9B 2CF8H 4E06H 3SNDA 1OKXA 3RMOH 1E37B 2PKSC 3NUMA 1C9PA 1TGTA 1JWTA 2ZO3H 4WMEA 1O2WA 1DX5M 5HM2A 3BTDE 2FOCA 1AD8H 1EB1H 4AG1A 4B2AA 2GCHF 1NROH 6GCHG 4ISLA 1TABE 1W2KH 1CGHA 1FN8A 1IQIA 5CMXH 2WPMS 3HKIB 3QGNB 1GHVH 5C20A 4JZDH 1MZDA 4AFSA 3RXIA 1UK2A 2EI8A 4MNWA 2BD8A 2HPQH 1GI9B 3SU5A 3KQDA 2Z3EA 1AVWA 1T4UH 1PJPA 3ATKA 3GCNA 2BQ6B 4F49A 1C1PA 1GHZA 6CHAB 2BQ7B 2R0KA 1DWEH 1O3PB 1O2YA 6LPRA 1YLCA 4X0WU 3BSQA 4U30A 1GJ9B 4U01A 1ELVA 1E34B 1MU6B 1NC6A 3RMLH 4K8YA 1Z1JA 2QC2A 3U98H 2HNTF 1AVXA 1O2QA 2VIVA 1Y5UT 1DS2E 1QR3E 1QBOA 3U1JB 1ZSJA 3MTYA 2Y81A 1C5QA 4SGAE 2BZAA 1SQOA 1GJCB 3PLPA 2UWLA 2BHGA 3OU0A 2W5EA 1O3NA 1Y3XA 2P3TB 4OS6A 1GMHG 1V2OT 1V2WT 1NS3A 3RXEA 1C5WB 3SU2A 5E2PA 1KLJH 4OGXA 1XM1A 2SGEE 3VB3A 2ZGCA 2ALPA 1ZOMA 3ZVBA 3ZV8A 4ZROA 1AO5A 5FBEA 2QXJA 2XTTB 2GMTB 4MG3A 3RXPA 8ESTE 3SQEE 4Z0KA 3RXDA 4CRDA 2VU8E 2XWBI 1EOJA 4ZHAA 1QQUA 1Z8GA 1TQ7B 4ZXXH 4X2WA 2P8OC 3ELAH 1A7SA 1FONA 3E91A 2P16A 1TQ0B 4X6NA 3LC3A 1GJ7B 1QY6A 1J15A 1D6RA 4AB8A 1H4WA 3QZQA 1BZXE 1HJAB 2ODPA 5FXLA 1TMUH 1VCWA 3TNSA 1T31A 3RXKA 3BTTE 5FPSA 1P9UA 3W95A 1N6XA 2P93A 3LDXH 3RU4D 2GCTB 1YPHE 3A8CA 4Y76A 1A5GH 1TOMH 2GCHG 4DCDA 1TFXA 1EAUA 1BMMH 1BTWA 2JETC 4X1PU 3T27A 3MNCA 1A1RA 3D49H 3BTHE 1O2XA 2BMGB 5JBTA 1NPMA 1SGRE 2JKHA 3ZYEA 1V2UT 3PTNA 1SL3A 1HYLA 4TY7A 4D7FA 1MD7A 1AZ8A 3IITA 3I29A 2D2DA 5GCHF 1GVLA 5F8ZA 1GMHF 1PQ8A 1LQDB 1VITF 4IS5A 2G51A 1MTUA 1DM4B 1EPTA 1QBNA 2R9PA 3O8BA 1BBRH 1TPAE 1YPGH 2WPIS 3QK1A 4MDSA 3U69H 1ARCA 1VITH 4B75A 5C1XA 4NSVA 2ODYB 4CHAC 1P09A 2OQUA 1BHXB 1C1VH 4ZKSU 2OC7A 2FS9A 3QDZB 5CHAC 1UK3A 4THNH 5ABWA 1AI8H 1WUNH 1ZMLA 4JYVH 4DW2U 1V2QT 3RXFA 1SGQE 1YYY1 1GDQA 1GI7B 3M5MA 3SO3A 5DO4H 2SGPE 3TH4H 1FLEE 2Q6FA 3DFJA 1KXBA 3MU4A 1O2KA 1LPZB 1MBQA 2Z9LA 1ZRBA 4FU7A 1NRPH 2BD5A 2C8WB 1DSUA 1GJDB 1TBRH 3UQVA 1O2ZA 1THRH 1TRMA 2D1JA 2A2XH 1O35A 2Z94A 3MWIU 6CHAC 2O8WA 1QA7A 1BA8B 4X8VH 4NFFA 2ZP0H 4YT7H 1HLTH 2F9UA 2IJOB 2ZDVH 1P57B 3K2UA 1SGNE 4YOJA 1Z1IA 2RDLA 2ZKSA 3SZNA 1O2UA 2NU2E 2R3YA 1SGTA 5PTPA 2J95A 1DICA 1ANBA 3L6PA 5JBCS 1E36B 1Q2WA 1S85A 2W7SA 3S9AA 1FY8E 4GPGA 1GHXH 1KXEA 5AFYH 3BEIB 4U2WA 2G55A 1AWFH 1HAHH 3UNRA 2R0LA 4IN2A 5DP4A 1ZGIA 1GBMA 2VWMA 2VIDA 1ELTA 4XDEA 3RXQA 1F92A 1GL0E 1A61H 1FY3A 3BTGE 4Z6AH 3PM3A 4NG9H 2A5AA 4TY6A 1GBCA 1HAZB 3F6UH 1K1LA 3GYMA 1J9CH 3E16B 1MCVA 1BMNH 1CBWB 1O2RA 4B76A 1DANH 2TBSA 3R3GB 3M37A 2A5KA 2XYAA 3E8LA 1V2KT 3P6ZB 2B5TB 4JYUH 2TIOA 4CH8B 2ZF0H 4D9RA 3BTFE 2CV3A 1O3FA 2BM2A 1G3DA 2SGQE 2BQWB 1QRZA 1NM6A 4CR9A 2DE8A 3M35A 1HRTH 2HALA 1C5PA 1DT2A 1A0LA 4A7IB 3LGVA 3LJJA 3K6ZA 2HWLB 4E7NA 2ULLA 5K0HA 5DP9A 2ZWLH 1CHOG 4B2CA 1SGYE 1B7XB 2GT8A 3MO6A 1C2KA 2GV6A 1HCGA 2R2MB 3OYPA 1C2EA 4NCYA 1O3CA 3SUGA 4I32A 1LCYA 1EOLA 2NU3E 1UTPA 3P70B 4MQAA 4AZ2B 2QF0A 2BX4A 3A81A 1C5LH 1EP6A 1KXDA 1O5EH 4B1TA 1WQVH 4E7RG 3HPTB 2QV1A 1AKSA 1H8DH 3Q3YA 4MPUA 3GDVA 1GL1A 3TH2H 2AMPA 5T6DA 3P8FA 4ZHMU 3RXJA 1NFUA 1UCYH 4GAWA 4CRFA 1NRNH 3BTME 1FPCH 3ATLA 2H9EH 2PW8H 4XFQA 1UO6A 1C2HA 1O30A 3EAJA 1UTKA 1HBTH 3NPSA 4X1SU 4AGKA 1O5AB 1TNJA 1NO9H 3RXLA 4Q7XA 1BT7A 4YESB 2BVSH 5BPEA 2ZI2H 1QHRB 2A31A 3A7WA 3DA9B 1C2FA 1T32A 1C4V2 3MO9A 1C1RA 3V12A 1H9LB 3SNCA 2ASUB 8KME2 1BJUA 4ISIH 4A92A 5EQRA 1DWBH 2UUYA 2WUBA 3M5OA 4X2YA 1L0ZA 1MKXH 1SQTA 2UUKB 5JPMH 5C5OA 2CGAA 2C3SA 1QURH 2ZFSA 4CRAA 1W13U 1AMHA 5C1UA 3ITIA 4UE7H 4FUJA 2FX4A 1ELGA 1DITH 1GI8B 1GHYH 3K9XB 4U32A 3K65B 2F83A 1HAYB 1QL7A 2P8OB 1ETSH 5LPRA 1H8IH 2Q6GA 1C2DA 3MNBA 3A7ZA 2QF3A 1UHBB 3E6PH 1XXFA 3MFJA 3LPRA 3RXHA 2UWOA 1SGIB 2EEKA 1MD8A 2XCFA 1JIRA 2UWPA 2Y5HA 3EQ0H 2BOHB 1EUFA 1WV7H 1GCTB 4FUEA 4NWLA 1LVOA 4K69A 3BTKE 1H9IE 4A6LA 1LTOA 5L30H 4UFDH 4YZUA 2AERH 1W12U 2ZDNA 2ZFFH 1MBMA 1GMDG 1W8BH 1NESE 2TPIZ 3TJNA 3MI4A 3GY4A 1FNIA 1SFQB 1W10U 1UK4A 3QUMP 2O8MA 3LC5A 1P8VC 1C2MA 1O31A 2AMQA 4WMFA 2ZTZA 5DPAA 2V6NA 2G52A 1T7CA 1NFYA 2C8XB 1ETTH 3A84A 1XX9A 4D76A 3T28A 1D9IA 1GBTA 1TX8A 2RG3A 3Q3XA 3C1KA 1P2KA 3PV4A 4H4FA 1MTNB 3LIWA 1O39A 1KTSB 1THPB 5A09A 7ESTE 2F91A 3UUZA 4X1NU 3SV8A 1HUTH 5C5NA 3ZZBA 1BCUH 1Y3YA 4GVUA 2C93B 2NU0E 1K1IA 1V6DA 2O8UA 2PWXA 1G32B 1BTUA 2Y7XA 1AVGH 5AVDA 1O38A 4H6TA 3MU5A 1EP5A 1UVTH 1SHYA 3QN7A 2H9TH 3SV7A 3C27B 1TLDA 2WPKS 3K6YA 3ZZCA 1F7ZA 1O2VA 1FIZA 1FI8A 2RCEA 3A88A 3UOUA 1P2QA 2NWNA 4NA8A 1DDJA 4BTTB 1O3OA 3UNSA 3SU1A 1V2TT 4OS5A 4AX9H 1UCYE 1IQFA 3PWBA 1ORFA 1Y3UA 1O3MA 4I7YH 1QJ7B 4B71A 1VJ9U 1FQ3A 1ZRKA 4FUCA 3TGIE 4BNRA 1TOCB 3UFAA 5LH8A 1P10A 1D4PB 1WAYB 3GY2A 1C1OA 3HGPA 1QA0A 2H9HA 2GZ9A 2ZHFH 1MUEB 3MH5A 4JYTA 1G3EA 2FZZA 3ZZ4A 3KNXA 4TYDA 1OP8A 2FPZA 2NU4E 1E38B 4X6OA 1BDAA 1BOQA 3O8DA 3RC6A 3RXBA 2G4UA 1C5NH 1W7GH 4IN1A 1A5IA 3EYDA 3S9CA 2XC0A 3IWMA 1GBBA 3RMNH 4FVBA 1BMAA 5ESBA 1DUAA 1ZSLA 5FAHA 1ANCA 2BDAA 1NU7B 2BY7X 2A45B 1JRTA 2QXHA 1G3CA 2BTCE 1PPBH 4JK5A 4ABFA 3V3MA 2CF9H 3VEQB 4SGBE 3UTUH 3SU3A 2F9PA 1C2GA 1X7AC 5HXFA 3TITA 1MKXK 1LHCH 3BG4C 5ETXA 1N8OB 1QL8A 2GGVB 2BDBA 3FP7E 3ZVAA 1HIAA 1TNIA 3HK6B 1P02A 4NIVA 3TJVA 1G2MA 1S82A 2ILNA 4F4OC 1P3EA 3RUOA 1WCZA 4GLYA 2XXLA 5F6MA 4D8NA 1ZTKA 2FOMB 4GHQA 1CT2E 4HZHA 1IHSH 2V35A 3V7TA 4CRGA 2H1UA 4YOIA 3D23A 1B0FA 5T6GA 3A7XA 2W26A 3LOXA 1YC0A 1T4VH 1JRSA 1KY9A 1WTHD 3BF6H 4HTCH 3BTWE 4MLFB 4IBLH 1VR1H 1TA6A 3JZ2B 3I78A 1TNHA 1SPJA 4MNXA 4ISHH 1XVOA 1EZQA 1GMCF 1K1JA 4TPYA 3UQOA 1C5OH 1Z7KA 1ESAA 1C1UH 3ZV9A 3ZVEA 2VWLA 1TNKA 3PLKA 5TJXA 2R2WU 4ZH8A 1S81A 3ZZ8A 4D9QA 1IHTH 4DURA 1F5KU 2AMDA 2Z9IA 2QXIA 5E0JA 1ZTJA 1SGCA 2BDCA 2ZU2A 3D65E 1QGFA 1A2CH 2ALVA 1PPFE 2XBVA 5DGJA 1CE5A 2KAIB 1ZLRA 2FLRH 4JZFH 1AE8H 2TGPZ 1SMFE 1C1MA 5JB8S 2J92A 3B23B 5A8YA 1ACBE 2P3FH 5FBIA 4D7GA 2C4FH 4AB9A 3ZZAA 1P2NA 1XUHA 1ZJKA 2ZG0H 4A1XA 3F1SB 3MYWA 1SFIA 1D3DB 1QB9A 1V2RT 1HAVB 1NU9A 4FVDA 3VXFH 3MU0A 1EQ9A 1DSTA 4Y7AA 2BDGA 4K1TA 2GDEH 4Y71A 5CE1A 3G01A 3RLWH 4Q7ZA 3RXUA 1ESTA 4Y7BA 1O36A 3RC5A 5TCAA 2HGTH 3SU0A 1GI2A 3SBKA 3KEEA 3A83A 2ZPSA 1LHGH 5SGAE 2GVFA 2ZHQH 3SU4A 3O8CA 4MNVA 1DE7H 1RRKA 1GBEA 1BHXF 2ZECA 4RKJB 1D6WA 1VJAU 1SG8B 2FOEA 3LH1A 1TYNA 1BRBE 3GOVB 2A2QH 2VVVA 1AY6H 2AEIH 1BTPA 2GCTC 5HM9A 3F9EA 2G8TA 1BTYA 2FIRH 2V0BA 4K5ZA 4Y10E 2OP9A 1OWIA 4DY7B 1VGCB 2OCVB 5GCHG 3GISB 5T6FA 1UVOA 2G5NA 1Z6JH 1GBFA 3LGWA 2FI3E 4JMYA 5C3NA 2FXRA 5E0GA 2A32A 1PPGE 1DPOA 3DD2H 1MU8B 1TPOA 2DE9A 2ZNKH 3GY5A 3SNAA 3M3TA 1FDPA 2QXGA 3ZVDA 1FV9A 4BXWA 4XOJA 3QO6A 1BRUP 4MPXA 4K1EA 2RA0A 1TGNA 3M5NA 3NCLA 4BXSA 1LHEH 4BAMB 4YLUA 5DJ7A 5E8EH 2YOLA 4ZKRU 1OX1A 2F9NA 1FY4A 1AQ7A 2G81E 1ZHMA 3MH6A 2ZDKA 1C1TA 3QWCH 1YPEH 1GJ5H 1WYKA 2EA3A 1HDTH 4I31A 3SI3H 1O2LA 3U8OH 3P8OA 4ABIA 2FYRA 1K1MA 4BAHB 3SU6A 3LGIA 1BITA 1GI4A 1AKSB 2WUCA 3GY7A 4O03A 2OC1A 2A4GA 1DY8A 1O2MA 5IYTA 5FCKA 3VPKA 2VVUA 1HAVA 3PMAB 2BDHA 1C1QA 4JK6A 4ABGA 1N1LA 1IQMA 4MPWA 1FIWA 1GBJA 1LMWB 3H7OA 5H4IB 3RU4T 1FAKH 4KTCA 4DJZB 3SW2B 5EOKA 4IC5A 3NKKA 1SGEE 4O9VA 1FAXA 5DP7A 1AFQC 1PYTC 1OWKA 4Q7YA 2VGCB 1C5MD 1V3XA 5F8TA 3ATWA 4KP0A 2KAIA 1BTXA 1XVMA 2BD3A 3SNEA 1TAWA 1ZPBA 1NFWA 2Y5GA 3PMJA 1OOKB 2GZ8A 2NU1E 3OSYA 2AIPA 1T8LA 5JBAS 3TIUA 1AWHB 4XE4A 1SVPA 3Q76A 1PPEE 1VITG 2PSXA 1GGDB 2HOBA 3M61U 1GCTC 3V13A 4AYYB 2B8OH 5FHTA 1YP9A 3DFLA 1CO7E 1IQGA 1YCPM 3UWIA 1S6HA 1QCPA 3OY6U 4UFGH 2FESH 3KQBA 1GVZA 1J8AA 1K2I1 1DWDH 1Z71A 4NA9H 1OWJA 2ZTXA 4HI3A 1P2IA 3SUFA 4LK4A 3RXGA 3B8JA 3NXPA 2B9LA 4A5TS 5A8ZA 1SLUB 1HAXB 1KYNA 2ZPRA 4FUGA 1JBUH 1ELDE 2QAAA 3WY8A 3TJUA 3SORA 8LPRA 1UTOA 3S7KB 1GI3A 1HAGE 1G9IE 1BIOA 1MKWK 2IN2A 2PUQH 1K1NA 3SJIA 4CBNA 5HYOA 2ZFQH 2D26C 4BOHA 2BZ6H 1FMGA 5FX6A 1WTGH 4ABJA 3RXAA 1ZZZA 1O32A 1HAOH 2FEQH 1OS8A 1NT1A 4X6PA 1V2MT 2QY0B 7LPRA 4K8BA 1BMLA 2PKSB 3AAUA 1BBRE 3UREA 4FXGH 1EZSC 1GJ6A 1AE5A 3UOPA 2QGRA 5TCCA 2A5IA 2PGQB 3SGBE 1C5SA 1H9HE 4GHTA 3A7YA 1KLTA 3M3SA 1GPZA 1MQ5A 3KQCA 4Y0ZE 4RKOB 1UTJA 1KTTB 4AFQA 1GI1A 2VWNA 1EAIA 2W3KA 1EKBB 1P2MA 1C2LA 1ZGVA 2A7HA 3MU1A 3S7HB 1AZZA 1SLWB 1Y3VA 2VWOA 3QTVH 4DT7B 4DG4A 3T5FH 1YPMH 2PKAA 1GDUA 4MPVA 3TLOA 1AN1E 1ANEA 4WH6A 5JDUB 3UNQA 4LXBH 3RM0H 2H5CA 2Y6TA 2BOKA 2SFAA 4IMZA 2XBYA 3P8GA 1CT0E 1GGDC 1BB0B 2WPHS 1LPGB 2ZZUH 2Y82A 1D3QB 1OXGA 2BY6X 4WMDA 1C5TA 1GJ4H 1C2IA 3KGPA 4BTIB 1W0ZU 1F2SE 1P03A 2OLGA 3VB7A 5G4BA 3TNTA 1GI5A 3A80A 1AIXH 1IQKA 2VIPA 1OYTH 2D8WA 4RN6A 3DHKH 3QLPH 3HATH 1F5RA 2GP9B 4INHA 2GMTC 4ABHA 2HNTE 4WH8A 4JZ1A 2OBOA 5T3HA 3BTEE 4LZ4B 2FDAA 1A3EH 1O2PA 1K1PA 1TIOA 1XKBC 4X8UH 3ZYDA 3W94A 3NZIA 1UTLM 2TGAA 1QRXA 1RS0A 3GDSA 1IQNA 4JZIA 1SBWA 2BVXH 3SHAH 1UTQA 1NN6A 2SNVA 1XMNB 2ESTE 1G2LA 2BD2A 4TWWA 1P2OA 3SJ9A 4CRBA 1SI5H 1O3EA 1N8OC 2IPHA 2J4IA 1YPHC 1GG6B 3RMMH 1SGPE 2BX3A 1IQEA 2FODA 1H1BA 2O8LA 2C8ZB 1YPKH 3FZZA 4AOQA 4QT8C 2FOFA 6ESTA 1JMOH 2WPJS 2WYJA 2ZHWH 3A8AA 3PMBB 3RXSA 1F0SA 2P59A 2BXUH 5A8XA 3UWJH 2XCNA 1FPHH 5AF9H 3A85A 3M7UA 1T8NA 2PFEA 3GY8A 1CQQA 1TX7A 4J1YA 5FPTA 1V2ST 3VGCC 1GI6A 2VJ1A 1RD3B 3ZZ3A 1TA2A 3STJA 4K60A 4VGCC 1GJBB 2GV7A 2WPLS 2VVCA 1L2EA 1LPKB 3FANA 4Y11E 3D62A 4PROA 4CHAB 3H7TA 2FLBH 1YCPH 1J17T 3LKWA 3SV6A 5CHAB 2QIQA 1LVYA 2FI4E 1ZJDA 1QL9A 2TGTA 3F9GA 2ZDAH 1GBDA 3U1IB 2H5DA 1QJ6B 3ZZ6A 1FUJA 3AVZA 1O3LA 1S83A 2ZC9H 2ZCHP 1K9OE 4GUXA 4R0IA 3T2NA 1O3JA 1XKAC 1O3DA 3PB1E 1L1JA 5DP8A 1AUJA 3GCTG 2FM2A 1V2LT 2J38A 5F8XA 1LVBA 4ISOA 1C1SA 5GIBA 1D3TB 3E90B 3SJ8A 1QNJA 1EJNA 1LHFH 4WJG2 5GDSH 1YPJH 3ZZ7A 1BRAA 2ANMH 3KN2A 4UEHH 4NA7A 2HVXA 3MH4A 4TWYA 3VGCB 3SV2H 2BY8X 3KL6A 1GWAA 1O3KA 2Z3DA 4NIWA 3TVJB 3S0NA 2OUAA 3TK6A 3T29A 3QTOH 1S84A 3CS0A 5A0AE 1BTZA 1UTNA 1UVPA 5IDKA 3A89A 2C90B 4ZMAH 2A7CA 1DLKB 1GHBG 1Z8IB 2ZDMA 4X6MA 1OWEA 1Y3WA 2GD4B 4DIHH 1TRYA 2CJIA 4H6SB 1MAXA 1AU8A 1K28D 3S69A 1P3CA 2THFB 4AFZA 1GG6C 2ZHDA 1T8OA 2HLCA 2ANWA 3MNSA 4ABDA 1DY9A 1HNEE 1W11U 1OWDA 3KCGH 4WVPE 2W7UA 4I33A 3BV9B 3TH3H 4DOQA 3MO3A 1TNLA 1NRQH 5ESTE 3TU7H 5DG6A 3RXTA 1GI0A 1K1OA 2Z6BD 4IMQA 2VGCC 2J94A 3F68H 3RM2H 2SGAA 4NFEA 4WF8A 4INKA 4WWYA 1MCTA 1E0FD 7GCHF 1MAYA 1ELFA 4J2YB 3RLYH 1TPSA 3SV9A 4UONA 5L2YH 1KXCA 4JZEH 4ABEA 3FZDA 4MTBA 1WU1A 4XSKU 3NK8A 3N7OA 1TGCA 5F03A 1UCYK 4YO9A 3EA7A 1LO6A 1LDTT 2C8YB 1DLEA 8GCHF 5L2ZH 1DXWA 1A4WH 1EAXA 1IQJA 2F9OA 2STBE 2SGFE 2PGBB 1TBQH 3LGTA 3SJOA 5EW2H 1C5XB 1V2NT 5DP5A 3SGAE 2ODQA 2JH6D 1HJ8A 3FP8E 4I8GA 4MVNA 1G3BA 1ESBA 3KHVA 2ZGHA 1UMAH 1K21H 3PTBA 5DKMA 2XNIA 2XW9A 1DXPA 2VH0A 4KKDA 3U8RH 2STAE 4FUIA 5GWZA 1TRNA 2F9VA 4GCHF 1HXEH 3AW1A 3ESTA 4K3JA 5AFZH 1PYTD 1U6QA 3GCOA 1IQLA 2ZU3A 3GYLB 3VB5A 1QTFA 1L4ZA 4Y8XA 1TALA 2XWAA 1E35B 4R8TB 4YM9A 2ZU5A 2ZQ2A 1TNGA 5LPFA 4BAKB 4O3UA 3L33A 3P95A 5DP6A 1MTVA 1LKAA 3CP7A 1LHDH 3TGJE 5JBBS 2ZEBA 1INCA 5I25A 1AB9B 3PO1B 1P01A 2Y5FA 2EC9H 1O2HA 5EODA 1CHGA 1O34A 2G00A 5HGGA 5EQSA 4Y0YE 2AIQA 2XBWA 2O9QA 1O2JA 1BBRK 3VFEA 1YM0A 1G30B 1ZPZA 1EXFA 3IG6B 2JETB 3EA9A 3BEFB 1XUFA 4GSOA 1VGCC 3RC4A 2Z7FE 2ZPQA 2VIWA 2ZFRH 3FVFB 4BTUB 1EPTB 1SR5C 4X2XA 2BXTH 2UUFB 1C4U2 1XXDA 4XBCA 1EZXC 1O37A 2XBXA 1GMCG 1S0QA 1Z8JB 3E1XB 2VIQA 2HPPH 3M5LA 1RJXB 4BANB 2QA9E 2J9NA 4NZLA 3STIA 3U9AH 2GDDA 2Z9KA 3GY6A 4OS4A 2AGEX 4XBBA 4ABBA 1XUJA 5EQQA 4NSYA 3LGUA 3SNBA 1V2VT 1QBVH 1MMJN 1AB9C 3PO1C 1YPLH 2OXSA 2K1QA 1Q3XA 1O5DH 1DFPA 3SN8A 2ZQ1A 3MMGA 5GXPA 1GBIA 1ID5H 1P11E 3URCA 4I8LA 2ZTYA 2RA3A 1KXFA 1W0YH 2H2ZA 4LOYH 3H5CB 4X1QU 2Q1JA 1T8MA 2FOAA 1HV7A 1P9SA 1A5HA 1F0UA 2B7DH 1SOTA 3GY3A 2FP7B 3QX5H 3DUXH 4NIYA 1FY1A 3RDZA 2PUXB 4ISNA 3FAOA 1QRWA 4LZ1H 3GICB 1IAUA 1ZR0A 1YKTA 2P3UB 1GBHA 2AGGX 1EX3A 3BN9A 3KIDU 3LT3A 2BYAX 4IGDA 4NGAH 3RU4E 1CGJE 1GDNA 1KSNA 3SHCH 2V3HH 1ZPCA 3SOSA 1Z6EA 5C1YA 3BIVH 1G36A 3BG8A 1CHOF 4ZUHA 3VXEH 4DIIH 4HFPB 1LVMA 1OPHB 1TBZH 2ANYA 3L3TA 3M7QA 4FU8A 1TONA 3GDUA 5L6NH 1Y5AT 1QFKH 2SGDE 3M7TA 2I6SA 1M9UA 1KXAA 3T62A 1VCQA 2Y7ZA 3RXVA 2OBQA 5EXLA 3KQEA 1AUTC 1C5UA 3AAVA 3ATMA 2ZIQH 3NWUA 4AGJA 1IOEA 5K7RA 2M5TA 1GBAA 4FUBA 1TX6A 1BRCE 1PQ5A 1Q31A 4X1RU 4Y8ZA 3BIUH 3CS7A 3TK9A 3UPEA 2ZU1A 4BAOB 3I77A 1SOZA 3ZVGA 1TWXB 2BLOA 1YBWA 2FOBA 3TJOA 1HAPH 4I8JA 3HKJB 1ARBA 3FP6E 5FPYA 1WOFA 5E0HA 1J16A 3OTJE 1AFQB 1THSH 1C1WH 1CSOE 4INLA 1WQSA 1FY5A 3PWCA 1NTPA 3LH3A 2FTLE 1L4DA 5C67A 1O3AA 1C9TA 1GBLA 3MU8A 1EZUC 1OSSA 4AORA 4OGYA 3TPIZ 1AHTH 1MKWH 1TMTH 1EAWA 4X2VA 3PYHA 2BDIA 1TMBH 4IW4E 2YNAA 4OS2A 3URDA 1AGJA 7GCHG 1BUIA 1PPHE 1O0DH 1ZTLA 3A7TA 1SLXB 1HIAB 4DGJA 5FX5A 1P2JA 1EPTC 4NWKA 5E2OA 1P04A 3A82A 1O5GH 1ETRH 1Y5BT 2ZGJA 1UJ1A 3P17H 3SJKA 4AN7A 3VB6A 1F5LA 1NZQH 5BRRE 1GJ8B 1GVKB 1MTWA 2H6MA 1NRRH 1QB1A 1GHBF 2J34A 4E05H 3HGNA 4Q80A 1O3HA 4ASHA 1SLVB 2FO9A 1C5ZB 3RXMA 1QIXB 2V3OH 4I8KA 5B6OA 2A1DB 1C2JA 1ELCA 1QB6A 3A86A 1O3BA 4CR5A 3O8RA 1A46H 1W14U 1FZZA 3MOCA 2UUJB 4B2BA 1TPPA 3MNXA 1O2IA 1HFDA 1ABJH 2P95A 4YTAA 3T25A 2CMYA 5EG4A 1CBWC 1RTFB 1EB2A 3ODDA 3FFGA 1S0RA 1FXYA 2GKVE 1FN6A 4Y6DA 3OX7U 2VIOA 2AYWA 1O2NA 4ZXYH 2PHBA 3S9BA 3CENA 1O2OA 2JH0D 3BEUA 1XUKA 1TGSZ 4ZHLU 2GTBA 1SGFG 5A0CA 1C4Y2 1O3GA 1Z8RA 2ZA5A 3P8NA 3R0FA 4B74A 2O8TA 3HK3B 1PQ7A 3GCTF 1MTNC 1WSSH 3BG4B 1HJ9A 1NY22 2AGIX 2Q6DA 3MH7A 1CU1A 5EPYA 1GMDF 4Y8YA 3M3VA 2G4TA 2BD4A 5EXMA 4DVAU 2TGDA 1UHBA 2DUCA 1BJVA 2OINA 2CHAC 4WXIA 2LNCA 4B73A 2OC0A 1HGTH 1Y8TA 2HRVA 1A0JA 2LPRA 4CH2B 2Y80A 2ANKH 1B5GH 2BLWA 3GCHC 3ZZDA 4CBOA 2OC8A 4UFEH 1OYQA 1EASA 1L1NA 2IOTA 2J2UA 1O5FH 1WBGB 1GHWH 2JH5D 3ZVFA 3B9FH 2WINI 4KGAA 1JOUB 4WXVA 5J4QA 3LONA 1MQ6A 1LKBA 3T26A 4MNYA 3VB4A 2HNTC 3F9FA 1ZMJA 2G5VA 4HGCA 2I6QA 1IQHA 4YOGA 5LGOA 2PTCE 2BD9A 1HAIH 3RXRA 1SB1H 2ZFTA 2ZU4A 1XUIA 4ZAEA 1LQEA 1C5YB 3Q00A 4ZKOU 5EGMA 2FI5E 2VH6A 1GHAG 3PLBA 3SUDA 3UY9A 1OP0A 1JIMA 1SGDE 5EPNA 2GZ7A 2BY9X 1PPCE 4UD9H 2ZCLP 1SQAA 1A3BH 1RFNA 1KDQA 1W3CA 4H42U 2BY5X 1DVAH 2F9BH 4ESTE 1ZHRA 3UIRA 1PQAA 4AYVB 2BLQA 3ZVCA 2FYQA 3PROA 1K22H 2FX6A 2ZGBH 9LPRA 1P05A 3BTQE 3ATIA 2Z9JA 1F0RA 1MTSA 3EDXB 4IC6A 1L1GA 3TK5A 2ZDLA 3QGJA 1DUEA 5GPIB 2ZGXH 3P92A 4BAQB 2XC4A 4JCNA 2TRMA 1ZMNA 2A4OA 1TB6H 3Q3KA 4CRCA 1RIWB 3A8DA 4NIXA 2BLVA 2VNTA 3EE0B 1V2JT 2ZFPH 3U8TH 4X8TH 1DWCH 2P94A 2CN0H 4O97A 5FCRA 1AFEH 1NRSH 1ZSKA 1TE0A 3A87A 4FU9A 1TGBA 4A1TA 4AG2A 1YCPK 3AW0A 2QYIA 3M36A 1Y59T 5DP3A 2QN5T 1D3PB 2WV4A 4ZKNU 1KDQB 1ELAA 1RXPA 1RTLA 3A8BA 1VZQH 2CXVA 1KLIH 3E0PB 2GT7A 1J14A 1JXPA 1EATA 5A0BA 5JB9S 2YNBA 1GBKA 2OD3B 1KIGH 3F9HA 1CA0B 1ELEE 3DT0H 1YF4A 3GCHB 2BD7A 1MH0A 1P06A 1O3IA 2AFQB 3MHWU 4VGCB 1CT4E 5AHGH 2A0QB
chains in the Genus database with same CATH superfamily
1RTKA 3E3TA 1S5SA 4XD7D 4FUDA 2CHAB 4TPIZ 5A2MH 1FJSA 8GCHG 1HJAC 2PKAB 4A1VA 4ABAA 2GX4A 3SQHE 3DSOA 1MZAA 2OTVA 2WV5A 3KF2A 3RXCA 2Z3CA 3SI4H 1BTHH 5I46H 2PSYA 1O2SA 2AH4X 1SC8U 4NZQA 1ANDA 4AFUA 3AASA 3ZZ5A 1A0HB 1XUGA 5GJ4B 1PPZA 1CA0C 2FTMA 3ZZ9A 1P12E 4YLQH 1W7XH 4Q2KA 1O2TA 2OQ5A 2R3UA 4RSPA 1BQYA 4GCHG 1N6YA 2AS9A 4OS1A 2QCYA 4M7GA 1O2GH 2EI6A 3NRLA 2PV9B 1OP2A 4X8SH 4YT6H 5DK1A 2FS8A 1SHHB 1B0EA 5EXNA 1ZHPA 1HB0B 3ODFA 2ZHEH 1EJAA 1YGCH 1DOJA 1P0SH 2BDYA 3ENSB 3EA8A 3SGQE 1G37A 1C5RA 3LGYA 4FUHA 5JYIA 3DSGA 2BB4A 5C2ZA 2W3IA 4I8HA 3PRBA 2FOHA 1HPGA 2F3CE 1SSXA 5EW1H 1W0KD 6GCHF 4UDWH 1OWHA 3SUEA 1ZYOA 2ZCKP 3OY5U 3E0NB 2PR3A 3PMHB 1UTMA 4KELA 1O5CB 2A4RA 1O33A 2XRCA 3UR6A 2PLXA 3TGKE 2A7JA 4OS7A 2EI7A 2WYGA 1V2PT 3VG8A 9ESTA 1ELBA 1YLDA 5EU8A 3UR9A 1O5BB 2BVRH 2FWWA 1CGIE 4K2YA 1UVSH 1GHAF 1RGQA 1QQ4A 1PFXC 4KTSA 3QZRA 1S6FA 4XBDA 1F0TA 1HXFH 1UVUH 4WY3A 1GCDA 3Q77A 3RP2A 1QJ1B 5LPEA 3EGKH 1EJMA 1GJAB 2A4QA 4KTUA 3FKSD 3JZ1B 1ABIH 3RXOA 1C5VA 4CREA 3V0XA 2FMJA 7KMEH 5HMAA 2FOGA 2VINA 4Y79A 1SGFA 1VCPA 2VB0A 1CVWH 4O3TA 2XC5A 2PTNA 2Z9GA 3N7EA 4K1SA 2B0FA 1NFXA 1C1NA 1RIWC 2SNWA 3LJOA 4UFFH 1CA8B 2QE7D 4FUFA 5J4SA 3A7VA 3LU9B 2CF8H 4E06H 3SNDA 1OKXA 3RMOH 1E37B 2PKSC 3NUMA 1C9PA 1TGTA 1JWTA 2ZO3H 4WMEA 1O2WA 1DX5M 5HM2A 3BTDE 2FOCA 1AD8H 1EB1H 4AG1A 4B2AA 2GCHF 1NROH 6GCHG 4ISLA 1TABE 1W2KH 5EJ1A 1CGHA 1FN8A 1IQIA 5CMXH 2WPMS 3HKIB 3QGNB 1GHVH 5C20A 4JZDH 1MZDA 4AFSA 3RXIA 1UK2A 2EI8A 4MNWA 2BD8A 2HPQH 1GI9B 3SU5A 3KQDA 2Z3EA 1AVWA 1T4UH 1PJPA 3ATKA 3GCNA 2BQ6B 4F49A 1C1PA 1GHZA 6CHAB 2BQ7B 2R0KA 1DWEH 1O3PB 1O2YA 6LPRA 1YLCA 4X0WU 3BSQA 4U30A 1GJ9B 4U01A 1ELVA 1E34B 1MU6B 1NC6A 3RMLH 4K8YA 1Z1JA 2QC2A 3U98H 2HNTF 1AVXA 1O2QA 2VIVA 1Y5UT 1DS2E 4RT1A 1QR3E 1QBOA 3U1JB 1ZSJA 3MTYA 2Y81A 5CHBA 1C5QA 4SGAE 2BZAA 1SQOA 1GJCB 3PLPA 2UWLA 2BHGA 3OU0A 2W5EA 1O3NA 1Y3XA 2P3TB 4OS6A 1GMHG 1V2OT 1V2WT 1NS3A 3RXEA 1C5WB 3SU2A 2CK3D 1KLJH 5E2PA 4OGXA 1XM1A 2SGEE 3VB3A 2ZGCA 2ALPA 1ZOMA 3ZVBA 3ZV8A 4ZROA 1AO5A 5FBEA 1YLNA 2QXJA 2XTTB 2GMTB 4MG3A 3RXPA 8ESTE 3SQEE 4Z0KA 3RXDA 4CRDA 2VU8E 2XWBI 1EOJA 4ZHAA 1QQUA 1Z8GA 5FL7D 1TQ7B 4ZXXH 4X2WA 2P8OC 3ELAH 3PV2A 1A7SA 1FONA 3E91A 2P16A 1TQ0B 4X6NA 3LC3A 1GJ7B 1QY6A 1J15A 1D6RA 4AB8A 1H4WA 3QZQA 1BZXE 1HJAB 1OHHD 2ODPA 5FXLA 1TMUH 1VCWA 3TNSA 1T31A 3RXKA 3BTTE 5FPSA 1P9UA 3W95A 1N6XA 2P93A 3LDXH 3RU4D 2GCTB 1YPHE 3A8CA 4Y76A 1A5GH 1TOMH 2GCHG 4DCDA 1TFXA 1EAUA 1BMMH 1BTWA 2JETC 4X1PU 3T27A 4FETA 3MNCA 2YMSD 1A1RA 3D49H 3BTHE 1O2XA 2BMGB 5JBTA 1NPMA 1SGRE 2JKHA 3ZYEA 1V2UT 3PTNA 5T1VA 1SL3A 1HYLA 4TY7A 4D7FA 1MD7A 1AZ8A 3IITA 3I29A 2D2DA 5GCHF 1GVLA 5F8ZA 1GMHF 1PQ8A 1LQDB 1VITF 4IS5A 2G51A 1MTUA 1DM4B 1EPTA 1QBNA 2R9PA 3O8BA 1BBRH 1TPAE 1YPGH 4HG6A 2WPIS 3QK1A 4MDSA 3U69H 1ARCA 1VITH 4B75A 5C1XA 4NSVA 2ODYB 4CHAC 1P09A 2OQUA 1BHXB 1C1VH 3OTPA 4ZKSU 2OC7A 2FS9A 3QDZB 5CHAC 1UK3A 4THNH 5ABWA 1AI8H 1WUNH 1ZMLA 4JYVH 4DW2U 1V2QT 3RXFA 1SGQE 1YYY1 1GDQA 1GI7B 3M5MA 3SO3A 5DO4H 2SGPE 3TH4H 1FLEE 2Q6FA 3DFJA 1KXBA 2AHME 3MU4A 1O2KA 1LPZB 1MBQA 2Z9LA 1ZRBA 4FU7A 1NRPH 2BD5A 2C8WB 1DSUA 1GJDB 1TBRH 2XNDD 3UQVA 1O2ZA 1THRH 1TRMA 2D1JA 2A2XH 1O35A 2Z94A 3MWIU 6CHAC 2O8WA 1QA7A 1BA8B 4X8VH 4NFFA 2ZP0H 4YT7H 1HLTH 2F9UA 2IJOB 2ZDVH 1P57B 3K2UA 1SGNE 4YOJA 1Z1IA 2RDLA 2ZKSA 3SZNA 1O2UA 2NU2E 2R3YA 1SGTA 5PTPA 2J95A 1DICA 1ANBA 3L6PA 5JBCS 4XRNA 1E36B 1Q2WA 1S85A 2W7SA 3S9AA 3MQKC 1FY8E 4GPGA 1GHXH 1KXEA 5AFYH 3BEIB 4U2WA 2G55A 1AWFH 1HAHH 3UNRA 4F48B 2R0LA 4IN2A 5DP4A 1ZGIA 1GBMA 2VWMA 2KCOA 2VIDA 1ELTA 4XDEA 3RXQA 1F92A 1GL0E 1A61H 1FY3A 3BTGE 4Z6AH 3PM3A 4NG9H 2A5AA 4TY6A 1GBCA 1HAZB 3F6UH 3KQ5A 1K1LA 3GYMA 1J9CH 3E16B 1MCVA 1BMNH 1CBWB 1O2RA 4B76A 1DANH 2TBSA 3R3GB 3M37A 2A5KA 2XYAA 3E8LA 1V2KT 3P6ZB 2B5TB 4JYUH 2TIOA 4CH8B 2ZF0H 4D9RA 3BTFE 2CV3A 1O3FA 2BM2A 1G3DA 2SGQE 2BQWB 1QRZA 1NM6A 4CR9A 2DE8A 3M35A 1HRTH 2HALA 1C5PA 1DT2A 1A0LA 4Z1MD 4A7IB 3LGVA 3LJJA 3K6ZA 2HWLB 4E7NA 2ULLA 5K0HA 5DP9A 2ZWLH 1CHOG 4B2CA 1SGYE 1B7XB 3U28C 2GT8A 3MO6A 1C2KA 2GV6A 1HCGA 2JIZD 2R2MB 3OYPA 1C2EA 4NCYA 1O3CA 3SUGA 2KX4A 4I32A 1LCYA 1EOLA 2NU3E 1UTPA 3P70B 4MQAA 4AZ2B 2QF0A 2BX4A 3A81A 1C5LH 1EP6A 1KXDA 1O5EH 4B1TA 1WQVH 4E7RG 3HPTB 2QV1A 4TSFD 1AKSA 2F43B 1H8DH 2WPDD 3Q3YA 4MPUA 5HKKD 3GDVA 1GL1A 3TH2H 2AMPA 5T6DA 3P8FA 4ZHMU 3RXJA 1NFUA 1UCYH 4GAWA 4CRFA 1NRNH 3BTME 1FPCH 3ATLA 2H9EH 2PW8H 4XFQA 1UO6A 1C2HA 1O30A 3EAJA 1UTKA 1HBTH 3NPSA 4X1SU 4AGKA 1O5AB 1TNJA 1NO9H 3RXLA 2RFKC 4Q7XA 4TT3D 1BT7A 4YESB 2BVSH 5BPEA 2ZI2H 1QHRB 2A31A 3A7WA 3DA9B 1C2FA 1T32A 1C4V2 3MO9A 1C1RA 3V12A 1H9LB 3SNCA 2ASUB 8KME2 1BJUA 4ISIH 4A92A 5EQRA 1DWBH 2UUYA 2WUBA 3M5OA 4X2YA 1L0ZA 1MKXH 1SQTA 2UUKB 5JPMH 5C5OA 2CGAA 2C3SA 1QURH 2ZFSA 4CRAA 1W13U 1AMHA 5C1UA 3ITIA 4UE7H 4FUJA 2FX4A 1ELGA 1DITH 1GI8B 1GHYH 3K9XB 4U32A 3K65B 2F83A 1HAYB 1QL7A 2P8OB 1ETSH 5LPRA 1H8IH 2Q6GA 1C2DA 2QF4A 3MNBA 3KYGA 3A7ZA 2QF3A 1UHBB 3E6PH 1XXFA 3MFJA 3LPRA 5C0UA 3RXHA 2UWOA 1SGIB 4ZCNA 2EEKA 1MD8A 2XCFA 1JIRA 2UWPA 2Y5HA 3EQ0H 2BOHB 1EUFA 1WV7H 1GCTB 4FUEA 4NWLA 1MABB 1EFRD 1LVOA 4K69A 3BTKE 1H9IE 4A6LA 1LTOA 5L30H 4UFDH 4YZUA 2WZQA 2AERH 1W12U 2ZDNA 2ZFFH 1MBMA 1GMDG 1W8BH 1NESE 2TPIZ 3TJNA 3MI4A 3GY4A 1FNIA 1SFQB 1W10U 1UK4A 3QUMP 2O8MA 3LC5A 1P8VC 1C2MA 1O31A 1COWD 2AMQA 4WMFA 2ZTZA 5DPAA 2V6NA 2G52A 1T7CA 1NFYA 2C8XB 1ETTH 3A84A 2RDEA 1XX9A 4D76A 3T28A 1D9IA 1GBTA 4F55A 1TX8A 2RG3A 3F0PA 3Q3XA 3C1KA 1P2KA 3PV4A 4H4FA 1MTNB 3LIWA 1O39A 1KTSB 1THPB 5A09A 7ESTE 2F91A 3UUZA 4X1NU 3SV8A 1HUTH 5C5NA 3ZZBA 1BCUH 1Y3YA 4GVUA 2C93B 2NU0E 1K1IA 1V6DA 2L6OA 2O8UA 3OFND 2PWXA 1G32B 1VKYA 1BTUA 2Y7XA 1AVGH 5AVDA 1O38A 4H6TA 3FOAA 3MU5A 1EP5A 1UVTH 1SHYA 3QN7A 2H9TH 4YXWD 3SV7A 2WHXA 3C27B 1TLDA 2WPKS 3K6YA 3ZZCA 1F7ZA 1O2VA 1FIZA 1FI8A 2RCEA 3A88A 3UOUA 1P2QA 2NWNA 4NA8A 1DDJA 4BTTB 1O3OA 3UNSA 3SU1A 1V2TT 4OS5A 4ACAA 4AX9H 1UCYE 1IQFA 3PWBA 1ORFA 1Y3UA 1O3MA 4I7YH 1QJ7B 1K0HA 4B71A 1VJ9U 1FQ3A 1ZRKA 4FUCA 3TGIE 4BNRA 1TOCB 3UFAA 3ZIAD 5LH8A 1P10A 1D4PB 1WAYB 3GY2A 1C1OA 3HGPA 1QA0A 2H9HA 2GZ9A 2ZHFH 1MUEB 3MH5A 2QF5A 4JYTA 1G3EA 2FZZA 3ZZ4A 3KNXA 4TYDA 3W1EA 1OP8A 2FPZA 2NU4E 1E38B 4X6OA 1BDAA 1BOQA 3O8DA 3RC6A 3RXBA 2G4UA 3DSPA 1C5NH 2JJ2D 1W7GH 3F2FA 4IN1A 1A5IA 3EYDA 3S9CA 2XC0A 3IWMA 1GBBA 3RMNH 4FVBA 1BMAA 5ESBA 1DUAA 1ZSLA 5FAHA 1ANCA 2BDAA 1NU7B 2BY7X 2A45B 1JRTA 2QXHA 1G3CA 2BTCE 1PPBH 4JK5A 3DCLA 4ABFA 5DN6D 3V3MA 2CF9H 3VEQB 4SGBE 3UTUH 3SU3A 2F9PA 1C2GA 1X7AC 5HXFA 3TITA 1MKXK 5C0TA 1LHCH 3BG4C 5ETXA 1N8OB 1QL8A 2GGVB 2BDBA 3FP7E 3ZVAA 1HIAA 1TNIA 3HK6B 1P02A 4NIVA 3TJVA 1G2MA 1S82A 2ILNA 4F4OC 1P3EA 3RUOA 1WCZA 4GLYA 2XXLA 5F6MA 4D8NA 1ZTKA 2FOMB 4GHQA 1CT2E 4HZHA 1IHSH 2V35A 3V7TA 4CRGA 2H1UA 4YOIA 3D23A 1B0FA 1YWUA 5T6GA 3A7XA 2W26A 3LOXA 1YC0A 1T4VH 1JRSA 1KY9A 1WTHD 3BF6H 4HTCH 3BTWE 4MLFB 4IBLH 1VR1H 1TA6A 2W6JD 3JZ2B 3I78A 1TNHA 1SPJA 4MNXA 4ISHH 1XVOA 1EZQA 1GMCF 1K1JA 4TPYA 3UQOA 1C5OH 1Z7KA 1ESAA 1C1UH 3ZV9A 3ZVEA 2VWLA 1TNKA 3PLKA 5TJXA 1BMFD 2R2WU 4ZH8A 5EJLA 1S81A 3ZZ8A 4D9QA 1IHTH 4DURA 1F5KU 2AMDA 2Z9IA 2QXIA 5E0JA 1ZTJA 1SGCA 2BDCA 2ZU2A 3D65E 1QGFA 1A2CH 2ALVA 1PPFE 2XBVA 3FO8D 5DGJA 1CE5A 2KAIB 1ZLRA 2FLRH 2XOKD 4JZFH 3OEED 2L74A 1AE8H 2TGPZ 1SMFE 1C1MA 5JB8S 2J92A 3B23B 5A8YA 1ACBE 2P3FH 5FBIA 4D7GA 2C4FH 4AB9A 3ZZAA 1P2NA 1XUHA 1ZJKA 2ZG0H 3FN8A 4A1XA 3F1SB 3MYWA 1SFIA 4I86A 1D3DB 1QB9A 1V2RT 1HAVB 5EIYA 1NU9A 4FVDA 3VXFH 3MU0A 1EQ9A 1DSTA 4Y7AA 2BDGA 4K1TA 2GDEH 4Y71A 5CE1A 3G01A 3RLWH 4Q7ZA 4AC9A 1NBME 3RXUA 1ESTA 4Y7BA 1O36A 3RC5A 2F4LA 5TCAA 2HGTH 3SU0A 1GI2A 3SBKA 2KCYA 3KEEA 3A83A 2ZPSA 1LHGH 5SGAE 2GVFA 2ZHQH 3SU4A 3O8CA 4MNVA 1DE7H 1RRKA 1GBEA 1BHXF 2ZECA 4RKJB 1D6WA 1VJAU 1SG8B 2FOEA 3LH1A 1TYNA 1BRBE 3GOVB 2A2QH 2VVVA 2VBCA 1AY6H 2AEIH 1BTPA 2GCTC 5HM9A 3F9EA 2G8TA 1BTYA 3WW7A 2FIRH 2V0BA 4K5ZA 4Y10E 2OP9A 1OWIA 4DY7B 1VGCB 2OCVB 5GCHG 3GISB 5T6FA 2IJD1 1UVOA 2G5NA 1Z6JH 1GBFA 3LGWA 5HIZA 2FI3E 4JMYA 5C3NA 5GNDA 5C17A 2FXRA 5E0GA 2A32A 1PPGE 2K0QA 1QZ8A 1DPOA 3DD2H 1MU8B 1TPOA 2DE9A 2ZNKH 3GY5A 3SNAA 3M3TA 2IPQX 1FDPA 2QXGA 3ZVDA 1FV9A 4BXWA 4XOJA 3QO6A 1BRUP 4MPXA 4K1EA 2RA0A 1TGNA 3M5NA 3NCLA 4BXSA 1LHEH 4BAMB 4YLUA 5DJ7A 5E8EH 2YOLA 4ZKRU 1OX1A 2F9NA 1FY4A 1AQ7A 2G81E 1ZHMA 3MH6A 2ZDKA 1C1TA 3QWCH 1YPEH 1GJ5H 1WYKA 2EA3A 1HDTH 4I31A 3SI3H 1O2LA 3U8OH 3P8OA 4ABIA 2FYRA 1K1MA 4BAHB 3SU6A 3LGIA 1BITA 1GI4A 1AKSB 2WUCA 3GY7A 4O03A 2OC1A 2A4GA 1DY8A 1O2MA 5IYTA 5FCKA 3VPKA 2VVUA 1HAVA 3PMAB 2BDHA 1C1QA 4JK6A 4ABGA 1N1LA 1IQMA 4MPWA 1FIWA 1GBJA 1LMWB 3H7OA 5H4IB 3RU4T 1FAKH 4KTCA 4DJZB 3SW2B 5EOKA 4IC5A 3NKKA 2J98A 1SGEE 4O9VA 1FAXA 5DP7A 1AFQC 1PYTC 1OWKA 4Q7YA 2VGCB 1C5MD 1V3XA 5F8TA 3ATWA 4KP0A 2KAIA 1BTXA 1XVMA 2BD3A 3SNEA 1TAWA 3UB0A 1ZPBA 1NFWA 2Y5GA 3PMJA 1OOKB 2GZ8A 2NU1E 4ACBA 3OSYA 2AIPA 1T8LA 5JBAS 3TIUA 1AWHB 4XE4A 1SVPA 3Q76A 1PPEE 1VITG 2PSXA 1GGDB 2HOBA 3M61U 1GCTC 3V13A 4AYYB 2B8OH 5FHTA 1YP9A 3DFLA 1CO7E 1IQGA 1YCPM 3UWIA 1S6HA 1QCPA 3OY6U 4UFGH 2FESH 3KQBA 1GVZA 1J8AA 1K2I1 1DWDH 1Z71A 4NA9H 1OWJA 2ZTXA 4HI3A 1P2IA 3SUFA 4LK4A 3RXGA 3B8JA 3NXPA 2B9LA 4A5TS 5A8ZA 1SLUB 1HAXB 1KYNA 2ZPRA 4FUGA 1JBUH 1ELDE 2QAAA 3WY8A 3F2GA 3TJUA 3SORA 8LPRA 1UTOA 3S7KB 1GI3A 1HAGE 1G9IE 3N99A 1BIOA 1MKWK 2IN2A 2PUQH 1K1NA 3SJIA 4CBNA 5HYOA 2ZFQH 2D26C 4BOHA 2BZ6H 1FMGA 5FX6A 1WTGH 4ABJA 3RXAA 1ZZZA 1O32A 1HAOH 2FEQH 1OS8A 1NT1A 4X6PA 1V2MT 2QY0B 7LPRA 4K8BA 1BMLA 2PKSB 3AAUA 1BBRE 3UREA 4FXGH 1EZSC 1GJ6A 1AE5A 3UOPA 2QGRA 5TCCA 2A5IA 2PGQB 3SGBE 1C5SA 1H9HE 4GHTA 3A7YA 1KLTA 3M3SA 1GPZA 1MQ5A 3KQCA 4Y0ZE 4RKOB 1UTJA 1KTTB 5C94A 4AFQA 1H8HD 5KECA 1GI1A 2VWNA 1EAIA 2W3KA 1SKYE 1EKBB 1P2MA 1C2LA 1ZGVA 2A7HA 3MU1A 1SQRA 3S7HB 1AZZA 1SLWB 1Y3VA 2VWOA 3QTVH 4DT7B 4DG4A 3T5FH 1YPMH 2PKAA 1GDUA 4MPVA 3TLOA 1AN1E 1ANEA 4WH6A 5JDUB 3UNQA 2YMSB 3F0OA 4LXBH 3RM0H 2H5CA 2Y6TA 2BOKA 2SFAA 4IMZA 2XBYA 3P8GA 1CT0E 1GGDC 1BB0B 2WPHS 1LPGB 2ZZUH 2Y82A 1D3QB 2JJ1D 1OXGA 2BY6X 4WMDA 1C5TA 1GJ4H 1C2IA 3KGPA 4BTIB 1W0ZU 1F2SE 1P03A 2OLGA 3VB7A 2M2AA 5G4BA 3TNTA 1GI5A 3A80A 4B6EA 1E1RD 1AIXH 1IQKA 2VIPA 1OYTH 2D8WA 4RN6A 3DHKH 3QLPH 3HATH 1F5RA 2GP9B 4INHA 2GMTC 4ABHA 1NBMD 2HNTE 4WH8A 4JZ1A 2OBOA 5T3HA 3BTEE 4LZ4B 2FDAA 1A3EH 1O2PA 1K1PA 1TIOA 1XKBC 4X8UH 3ZYDA 3W94A 3GS9A 3NZIA 1UTLM 2TGAA 1QRXA 1RS0A 2J5UA 3GDSA 1IQNA 4JZIA 1SBWA 2BVXH 3SHAH 1UTQA 1NN6A 2SNVA 1XMNB 2ESTE 1G2LA 2BD2A 4TWWA 1P2OA 3SJ9A 4CRBA 1SI5H 1O3EA 1N8OC 2IPHA 2J4IA 2J98B 1YPHC 1GG6B 3RMMH 3H09A 1SGPE 2BX3A 1IQEA 2FODA 1UW7A 1H1BA 2O8LA 2C8ZB 1YPKH 3FZZA 4AOQA 4QT8C 2FOFA 6ESTA 1JMOH 3CNRA 5EJZA 2WPJS 2WYJA 2ZHWH 3A8AA 3PMBB 3RXSA 1F0SA 2P59A 2BXUH 5A8XA 3UWJH 1FPHH 2XCNA 5AF9H 3A85A 3M7UA 1T8NA 5B6LA 2PFEA 3GY8A 1CQQA 1TX7A 4J1YA 5FPTA 2LP6A 1V2ST 3VGCC 1GI6A 5F53A 2VJ1A 4ASUD 1RD3B 3ZZ3A 1TA2A 3STJA 4K60A 4VGCC 1GJBB 2GV7A 2WPLS 2VVCA 1L2EA 1LPKB 3FANA 4Y11E 3D62A 4PROA 4CHAB 3H7TA 2FLBH 1YCPH 1J17T 3LKWA 4M9FA 3SV6A 5CHAB 2QIQA 1LVYA 2FI4E 1ZJDA 1QL9A 2TGTA 3F9GA 2ZDAH 1GBDA 3U1IB 4RI0A 2H5DA 1QJ6B 1WXRA 3ZZ6A 1FUJA 3AVZA 1O3LA 2W6ID 3WWBA 1S83A 2ZC9H 2ZCHP 1K9OE 4GUXA 4R0IA 3T2NA 1O3JA 1XKAC 1O3DA 3PB1E 1L1JA 3PV5A 5DP8A 1AUJA 3GCTG 2FM2A 1V2LT 2J38A 5F8XA 1LVBA 4ISOA 1C1SA 5GIBA 1D3TB 3E90B 2V7QD 3SJ8A 1QNJA 1EJNA 1LHFH 2WSSD 4WJG2 5GDSH 1YPJH 3ZZ7A 1BRAA 2ANMH 3KN2A 4UEHH 4NA7A 2HVXA 3AK5A 3MH4A 4TWYA 3VGCB 3SV2H 2BY8X 3KL6A 4DT4A 1GWAA 1O3KA 2Z3DA 4NIWA 3TVJB 3S0NA 2OUAA 3TK6A 3T29A 3QTOH 1S84A 3CS0A 5A0AE 1BTZA 1UTNA 1UVPA 5IDKA 1S6LA 3A89A 2C90B 4ZMAH 2A7CA 1DLKB 1GHBG 1Z8IB 2ZDMA 4X6MA 1OWEA 1Y3WA 2GD4B 4DIHH 1TRYA 2CJIA 4H6SB 1MAXA 1AU8A 1K28D 3S69A 1P3CA 2THFB 4AFZA 1GG6C 2ZHDA 1T8OA 2HLCA 2ANWA 3MNSA 4ABDA 1DY9A 1HNEE 1W11U 1OWDA 3KCGH 4WVPE 2W7UA 4I33A 3BV9B 3TH3H 4DOQA 3MO3A 1TNLA 1NRQH 1H8ED 5ESTE 3TU7H 5DG6A 3RXTA 5DSFA 1GI0A 1K1OA 2Z6BD 4IMQA 2VGCC 2J94A 3F68H 3RM2H 2SGAA 4NFEA 4WF8A 4INKA 4WWYA 1MCTA 1E0FD 7GCHF 1MAYA 1ELFA 4J2YB 3RLYH 1TPSA 3SV9A 4UONA 5L2YH 1KXCA 2EY4C 4JZEH 4ABEA 3FZDA 4MTBA 1WU1A 4XSKU 3NK8A 3N7OA 1TGCA 5F03A 1UCYK 4YO9A 3EA7A 1LO6A 1LDTT 2C8YB 1DLEA 8GCHF 5L2ZH 1DXWA 1A4WH 1EAXA 1IQJA 2F9OA 2STBE 2SGFE 2PGBB 1TBQH 3LGTA 3SJOA 5EW2H 1C5XB 1V2NT 5DP5A 3SGAE 2OK5A 2ODQA 2JH6D 1HJ8A 3FP8E 4I8GA 4MVNA 1G3BA 1ESBA 3KHVA 1E79D 2ZGHA 1UMAH 1K21H 3PTBA 5DKMA 2XNIA 2XW9A 1DXPA 2VH0A 4KKDA 3U8RH 2STAE 4FUIA 5GWZA 1TRNA 2F9VA 2YMSC 4GCHF 1HXEH 5IK2D 3AW1A 3ESTA 4K3JA 4Q4LA 5AFZH 1PYTD 1U6QA 3GCOA 1IQLA 2ZU3A 3GYLB 3VB5A 1QTFA 1L4ZA 4Y8XA 1TALA 2XWAA 1E35B 4R8TB 4YM9A 2ZU5A 2ZQ2A 1TNGA 5LPFA 4BAKB 4O3UA 3L33A 3P95A 2JDID 5DP6A 1MTVA 1LKAA 3CP7A 1LHDH 3TGJE 5JBBS 2ZEBA 1INCA 5I25A 1AB9B 3PO1B 1P01A 2Y5FA 2EC9H 1O2HA 5EODA 1CHGA 1O34A 2G00A 5HGGA 5EQSA 4Y0YE 2AIQA 2XBWA 2O9QA 1O2JA 1BBRK 3VFEA 1YM0A 1G30B 3SZEA 1ZPZA 1EXFA 3IG6B 2JETB 3EA9A 3BEFB 1XUFA 4GSOA 1VGCC 3RC4A 2Z7FE 2ZPQA 2VIWA 2ZFRH 3FVFB 4BTUB 1EPTB 1SR5C 4X2XA 2BXTH 2UUFB 1C4U2 1XXDA 4XBCA 1EZXC 3F2HA 1O37A 2XBXA 1GMCG 1S0QA 1Z8JB 2K8IA 3E1XB 2VIQA 2HPPH 3M5LA 1RJXB 4BANB 2QA9E 2J9NA 4NZLA 3STIA 3U9AH 2GDDA 2Z9KA 3GY6A 4OS4A 2AGEX 4XBBA 4ABBA 1XUJA 5EQQA 4NSYA 3LGUA 3SNBA 1V2VT 1QBVH 1MMJN 1AB9C 3PO1C 1YPLH 2OXSA 2K1QA 1Q3XA 1O5DH 1DFPA 3SN8A 2ZQ1A 3MMGA 5KGOA 5GXPA 1GBIA 1ID5H 1P11E 3URCA 4I8LA 2ZTYA 2RA3A 2HLDD 1KXFA 1W0YH 2H2ZA 4LOYH 3H5CB 4X1QU 2Q1JA 2GJGA 1T8MA 2FOAA 1HV7A 1P9SA 1A5HA 1F0UA 2B7DH 1SOTA 3GY3A 2FP7B 3QX5H 3DUXH 4NIYA 1FY1A 3RDZA 2PUXB 4ISNA 3FAOA 1QRWA 4LZ1H 5KEDA 3GICB 1IAUA 1ZR0A 1YKTA 2P3UB 1GBHA 2AGGX 4P02A 1EX3A 3BN9A 3KIDU 3LT3A 2BYAX 4IGDA 3OEHD 4FOUC 4NGAH 3RU4E 1CGJE 1GDNA 1KSNA 3SHCH 2V3HH 1ZPCA 2PP6A 3SOSA 1Z6EA 5C1YA 3BIVH 3SYJA 1G36A 3BG8A 3PRDA 1CHOF 4ZUHA 3VXEH 4DIIH 4HFPB 1LVMA 1OPHB 1TBZH 2ANYA 3L3TA 3M7QA 5CDFE 3KYFA 4FU8A 1TONA 3GDUA 5L6NH 1Y5AT 1QFKH 2SGDE 3M7TA 2I6SA 2J97A 1M9UA 1KXAA 3T62A 1VCQA 2Y7ZA 3RXVA 2OBQA 5EXLA 3KQEA 3OAAD 1AUTC 1C5UA 3AAVA 3ATMA 2ZIQH 3NWUA 4AGJA 1IOEA 5K7RA 2M5TA 1GBAA 4FUBA 1TX6A 1BRCE 1PQ5A 1Q31A 4X1RU 4Y8ZA 3BIUH 3CS7A 3TK9A 3UPEA 2ZU1A 4BAOB 3I77A 1SOZA 3ZVGA 1TWXB 2BLOA 1YBWA 2FOBA 3TJOA 1HAPH 4I8JA 3HKJB 1ARBA 2KCPA 3FP6E 5FPYA 1WOFA 2KR7A 1J16A 3OTJE 1AFQB 5E0HA 1THSH 1C1WH 1CSOE 4INLA 1WQSA 1FY5A 3PWCA 1NTPA 3LH3A 2FTLE 1L4DA 5C67A 1O3AA 1C9TA 2HVYB 1GBLA 3WWFA 2WV9A 3MU8A 1EZUC 1OSSA 4AORA 4OGYA 3TPIZ 1AHTH 1MKWH 1TMTH 2KM0A 1EAWA 4X2VA 3PYHA 2BDIA 1KMHB 1TMBH 2KZ4A 2YNAA 4IW4E 4OS2A 3URDA 1AGJA 7GCHG 1BUIA 1PPHE 1O0DH 1ZTLA 3A7TA 1SLXB 1HIAB 4DGJA 5FX5A 1P2JA 1EPTC 4NWKA 5E2OA 1P04A 3A82A 1O5GH 1ETRH 1Y5BT 2ZGJA 1UJ1A 3P17H 3SJKA 4AN7A 3VB6A 1F5LA 1NZQH 5BRRE 1GJ8B 1GVKB 1MTWA 2H6MA 1NRRH 1QB1A 1GHBF 2J34A 4E05H 3HGNA 2EQNA 4Q80A 1O3HA 4ASHA 1SLVB 2FO9A 1C5ZB 3RXMA 1QIXB 2V3OH 4I8KA 5B6OA 2A1DB 1C2JA 1ELCA 1QB6A 3A86A 1O3BA 4CR5A 3O8RA 1A46H 1W14U 1FZZA 3MOCA 2UUJB 4B2BA 1TPPA 3MNXA 1O2IA 1HFDA 1ABJH 2P95A 2LELA 4YTAA 3T25A 2CMYA 5EG4A 1CBWC 1RTFB 1EB2A 3ODDA 3FFGA 1S0RA 1FXYA 2GKVE 1FN6A 4Y6DA 3OX7U 2VIOA 2AYWA 1O2NA 3UAIC 4ZXYH 2PHBA 3S9BA 3CENA 1O2OA 2JH0D 3BEUA 1XUKA 1TGSZ 4ZHLU 2GTBA 1SGFG 5A0CA 1C4Y2 1O3GA 1Z8RA 2ZA5A 3P8NA 3R0FA 4B74A 2O8TA 3HK3B 1PQ7A 3GCTF 1MTNC 1WSSH 3BG4B 1HJ9A 1NY22 4OM9A 2AGIX 2Q6DA 3MH7A 1CU1A 5EPYA 1GMDF 4Y8YA 3M3VA 2G4TA 2BD4A 5EXMA 4DVAU 2TGDA 1UHBA 2DUCA 1BJVA 2OINA 2CHAC 4WXIA 2LNCA 4B73A 2OC0A 2KCAA 1HGTH 1Y8TA 2HRVA 1A0JA 2LPRA 4CH2B 2Y80A 2ANKH 1B5GH 2BLWA 3GCHC 3ZZDA 4CBOA 2OC8A 4UFEH 1OYQA 1EASA 1L1NA 2IOTA 2J2UA 3F3BA 1O5FH 1WBGB 1GHWH 2JH5D 3ZVFA 3B9FH 4Q63A 2WINI 4KGAA 1JOUB 4WXVA 5J4QA 3LONA 3N7DA 1W0JD 5HIYA 4P00A 1MQ6A 1LKBA 3T26A 4MNYA 3VB4A 2HNTC 3F9FA 1ZMJA 2G5VA 4HGCA 2I6QA 1IQHA 4YOGA 5LGOA 2PTCE 2BD9A 1HAIH 3RXRA 1SB1H 2ZFTA 2V3MA 2ZU4A 1XUIA 4ZAEA 1LQEA 1C5YB 3Q00A 4ZKOU 5EGMA 2FI5E 2VH6A 1GHAG 3PLBA 3SUDA 3UY9A 1OP0A 1JIMA 1SGDE 5EPNA 2GZ7A 2BY9X 1PPCE 4UD9H 2ZCLP 4B6FA 1SQAA 1A3BH 1RFNA 1KDQA 1W3CA 4H42U 2BY5X 1DVAH 2F9BH 4ESTE 1ZHRA 3UIRA 1PQAA 4AYVB 2BLQA 3ZVCA 2FYQA 3PROA 1K22H 2FX6A 2ZGBH 9LPRA 1FX0B 1P05A 3BTQE 3ATIA 2Z9JA 1F0RA 1MTSA 3EDXB 4IC6A 1L1GA 3TK5A 2ZDLA 3QGJA 1DUEA 5GPIB 2ZGXH 3P92A 4BAQB 2XC4A 4JCNA 2TRMA 1ZMNA 2A4OA 1TB6H 3Q3KA 4CRCA 1RIWB 3A8DA 4RT0A 4NIXA 2BLVA 2VNTA 3EE0B 1V2JT 2ZFPH 3U8TH 4X8TH 1DWCH 2P94A 2CN0H 4O97A 5FCRA 1AFEH 1NRSH 1ZSKA 1TE0A 3A87A 3EE7A 1TGBA 4FU9A 2KFWA 4A1TA 4AG2A 1YCPK 3AW0A 2QYIA 3OE7D 3M36A 1Y59T 5DP3A 2QN5T 1D3PB 2WV4A 4ZKNU 1KDQB 1ELAA 1RXPA 1YY3A 1RTLA 3A8BA 1VZQH 2CXVA 1KLIH 1E1QD 3E0PB 2GT7A 1J14A 1JXPA 1EATA 5A0BA 5JB9S 1WDIA 2YNBA 1GBKA 2OD3B 1KIGH 3F9HA 1CA0B 1ELEE 3DT0H 1YF4A 3GCHB 2BD7A 1MH0A 1P06A 1O3IA 2AFQB 3MHWU 4VGCB 1CT4E 5AHGH 2A0QB
chains in the Genus database with same CATH topology
1RTKA 3E3TA 1S5SA 4FUDA 2CHAB 4TPIZ 5A2MH 1FJSA 8GCHG 1HJAC 2PKAB 4A1VA 4ABAA 2GX4A 3SQHE 1MZAA 2OTVA 2WV5A 3KF2A 3RXCA 2Z3CA 3SI4H 1BTHH 5I46H 2PSYA 1O2SA 2AH4X 1SC8U 4NZQA 1ANDA 4AFUA 3AASA 3ZZ5A 1A0HB 1XUGA 5GJ4B 1PPZA 1CA0C 2FTMA 3ZZ9A 1P12E 4YLQH 1W7XH 4Q2KA 1O2TA 2OQ5A 2R3UA 4RSPA 1BQYA 4GCHG 1N6YA 2AS9A 4OS1A 2QCYA 4M7GA 1O2GH 2EI6A 2PV9B 1OP2A 4X8SH 4YT6H 5DK1A 2FS8A 1SHHB 1B0EA 5EXNA 1ZHPA 1HB0B 3ODFA 2ZHEH 1EJAA 1YGCH 1DOJA 1P0SH 2BDYA 3ENSB 3EA8A 3SGQE 1G37A 1C5RA 3LGYA 4FUHA 5JYIA 2BB4A 5C2ZA 2W3IA 4I8HA 2FOHA 1HPGA 2F3CE 1SSXA 5EW1H 6GCHF 4UDWH 1OWHA 3SUEA 1ZYOA 2ZCKP 3OY5U 3E0NB 2PR3A 3PMHB 1UTMA 4KELA 1O5CB 2A4RA 1O33A 2XRCA 3UR6A 2PLXA 3TGKE 2A7JA 4OS7A 2WYGA 2EI7A 1V2PT 9ESTA 1ELBA 1YLDA 5EU8A 3UR9A 1O5BB 2BVRH 2FWWA 1CGIE 4K2YA 1UVSH 1GHAF 1RGQA 1QQ4A 1PFXC 4KTSA 3QZRA 1S6FA 4XBDA 1F0TA 1HXFH 1UVUH 4WY3A 1GCDA 3Q77A 3RP2A 1QJ1B 5LPEA 3EGKH 1EJMA 1GJAB 2A4QA 4KTUA 3JZ1B 1ABIH 3RXOA 1C5VA 4CREA 3V0XA 2FMJA 7KMEH 5HMAA 2FOGA 2VINA 4Y79A 1SGFA 1VCPA 2VB0A 1CVWH 4O3TA 2XC5A 2PTNA 2Z9GA 4K1SA 2B0FA 1NFXA 1C1NA 1RIWC 2SNWA 3LJOA 4UFFH 1CA8B 4FUFA 5J4SA 3A7VA 3LU9B 2CF8H 4E06H 3SNDA 1OKXA 3RMOH 1E37B 2PKSC 3NUMA 1C9PA 1TGTA 1JWTA 2ZO3H 4WMEA 1O2WA 1DX5M 5HM2A 3BTDE 2FOCA 1AD8H 1EB1H 4AG1A 4B2AA 2GCHF 1NROH 6GCHG 4ISLA 1TABE 1W2KH 1CGHA 1FN8A 1IQIA 5CMXH 2WPMS 3HKIB 3QGNB 1GHVH 5C20A 4JZDH 1MZDA 4AFSA 3RXIA 1UK2A 2EI8A 4MNWA 2BD8A 2HPQH 1GI9B 3SU5A 3KQDA 2Z3EA 1AVWA 1T4UH 1PJPA 3ATKA 3GCNA 2BQ6B 4F49A 1C1PA 1GHZA 6CHAB 2BQ7B 2R0KA 1DWEH 1O3PB 1O2YA 6LPRA 1YLCA 4X0WU 3BSQA 4U30A 1GJ9B 4U01A 1ELVA 1E34B 1MU6B 1NC6A 3RMLH 4K8YA 1Z1JA 2QC2A 3U98H 2HNTF 1AVXA 1O2QA 2VIVA 1Y5UT 1DS2E 1QR3E 1QBOA 3U1JB 1ZSJA 3MTYA 2Y81A 1C5QA 4SGAE 2BZAA 1SQOA 1GJCB 3PLPA 2UWLA 2BHGA 3OU0A 2W5EA 1O3NA 1Y3XA 2P3TB 4OS6A 1GMHG 1V2OT 1V2WT 1NS3A 3RXEA 1C5WB 3SU2A 5E2PA 1KLJH 4OGXA 1XM1A 2SGEE 3VB3A 2ZGCA 2ALPA 1ZOMA 3ZVBA 3ZV8A 4ZROA 1AO5A 5FBEA 2QXJA 2XTTB 2GMTB 4MG3A 3RXPA 8ESTE 3SQEE 4Z0KA 3RXDA 4CRDA 2VU8E 2XWBI 1EOJA 4ZHAA 1QQUA 1Z8GA 1TQ7B 4ZXXH 4X2WA 2P8OC 3ELAH 1A7SA 1FONA 3E91A 2P16A 1TQ0B 4X6NA 3LC3A 1GJ7B 1QY6A 1J15A 1D6RA 4AB8A 1H4WA 3QZQA 1BZXE 1HJAB 2ODPA 5FXLA 1TMUH 1VCWA 3TNSA 1T31A 3RXKA 3BTTE 5FPSA 1P9UA 3W95A 1N6XA 2P93A 3LDXH 3RU4D 2GCTB 1YPHE 3A8CA 4Y76A 1A5GH 1TOMH 2GCHG 4DCDA 1TFXA 1EAUA 1BMMH 1BTWA 2JETC 4X1PU 3T27A 3MNCA 1A1RA 3D49H 3BTHE 1O2XA 2BMGB 5JBTA 1NPMA 1SGRE 2JKHA 3ZYEA 1V2UT 3PTNA 1SL3A 1HYLA 4TY7A 4D7FA 1MD7A 1AZ8A 3IITA 3I29A 2D2DA 5GCHF 1GVLA 5F8ZA 1GMHF 1PQ8A 1LQDB 1VITF 4IS5A 2G51A 1MTUA 1DM4B 1EPTA 1QBNA 2R9PA 3O8BA 1BBRH 1TPAE 1YPGH 2WPIS 3QK1A 4MDSA 3U69H 1ARCA 1VITH 4B75A 5C1XA 4NSVA 2ODYB 4CHAC 1P09A 2OQUA 1BHXB 1C1VH 4ZKSU 2OC7A 2FS9A 3QDZB 5CHAC 1UK3A 4THNH 5ABWA 1AI8H 1WUNH 1ZMLA 4JYVH 4DW2U 1V2QT 3RXFA 1SGQE 1YYY1 1GDQA 1GI7B 3M5MA 3SO3A 5DO4H 2SGPE 3TH4H 1FLEE 2Q6FA 3DFJA 1KXBA 3MU4A 1O2KA 1LPZB 1MBQA 2Z9LA 1ZRBA 4FU7A 1NRPH 2BD5A 2C8WB 1DSUA 1GJDB 1TBRH 3UQVA 1O2ZA 1THRH 1TRMA 2D1JA 2A2XH 1O35A 2Z94A 3MWIU 6CHAC 2O8WA 1QA7A 1BA8B 4X8VH 4NFFA 2ZP0H 4YT7H 1HLTH 2F9UA 2IJOB 2ZDVH 1P57B 3K2UA 1SGNE 4YOJA 1Z1IA 2RDLA 2ZKSA 3SZNA 1O2UA 2NU2E 2R3YA 1SGTA 5PTPA 2J95A 1DICA 1ANBA 3L6PA 5JBCS 1E36B 1Q2WA 1S85A 2W7SA 3S9AA 1FY8E 4GPGA 1GHXH 1KXEA 5AFYH 3BEIB 4U2WA 2G55A 1AWFH 1HAHH 3UNRA 2R0LA 4IN2A 5DP4A 1ZGIA 1GBMA 2VWMA 2VIDA 1ELTA 4XDEA 3RXQA 1F92A 1GL0E 1A61H 1FY3A 3BTGE 4Z6AH 3PM3A 4NG9H 2A5AA 4TY6A 1GBCA 1HAZB 3F6UH 1K1LA 3GYMA 1J9CH 3E16B 1MCVA 1BMNH 1CBWB 1O2RA 4B76A 1DANH 2TBSA 3R3GB 3M37A 2A5KA 2XYAA 3E8LA 1V2KT 3P6ZB 2B5TB 4JYUH 2TIOA 4CH8B 2ZF0H 4D9RA 3BTFE 2CV3A 1O3FA 2BM2A 1G3DA 2SGQE 2BQWB 1QRZA 1NM6A 4CR9A 2DE8A 3M35A 1HRTH 2HALA 1C5PA 1DT2A 1A0LA 4A7IB 3LGVA 3LJJA 3K6ZA 2HWLB 4E7NA 2ULLA 5K0HA 5DP9A 2ZWLH 1CHOG 4B2CA 1SGYE 1B7XB 2GT8A 3MO6A 1C2KA 2GV6A 1HCGA 2R2MB 3OYPA 1C2EA 4NCYA 1O3CA 3SUGA 4I32A 1LCYA 1EOLA 2NU3E 1UTPA 3P70B 4MQAA 4AZ2B 2QF0A 2BX4A 3A81A 1C5LH 1EP6A 1KXDA 1O5EH 4B1TA 1WQVH 4E7RG 3HPTB 2QV1A 1AKSA 1H8DH 3Q3YA 4MPUA 3GDVA 1GL1A 3TH2H 2AMPA 5T6DA 3P8FA 4ZHMU 3RXJA 1NFUA 1UCYH 4GAWA 4CRFA 1NRNH 3BTME 1FPCH 3ATLA 2H9EH 2PW8H 4XFQA 1UO6A 1C2HA 1O30A 3EAJA 1UTKA 1HBTH 3NPSA 4X1SU 4AGKA 1O5AB 1TNJA 1NO9H 3RXLA 4Q7XA 1BT7A 4YESB 2BVSH 5BPEA 2ZI2H 1QHRB 2A31A 3A7WA 3DA9B 1C2FA 1T32A 1C4V2 3MO9A 1C1RA 3V12A 1H9LB 3SNCA 2ASUB 8KME2 1BJUA 4ISIH 4A92A 5EQRA 1DWBH 2UUYA 2WUBA 3M5OA 4X2YA 1L0ZA 1MKXH 1SQTA 2UUKB 5JPMH 5C5OA 2CGAA 2C3SA 1QURH 2ZFSA 4CRAA 1W13U 1AMHA 5C1UA 3ITIA 4UE7H 4FUJA 2FX4A 1ELGA 1DITH 1GI8B 1GHYH 3K9XB 4U32A 3K65B 2F83A 1HAYB 1QL7A 2P8OB 1ETSH 5LPRA 1H8IH 2Q6GA 1C2DA 3MNBA 3A7ZA 2QF3A 1UHBB 3E6PH 1XXFA 3MFJA 3LPRA 3RXHA 2UWOA 1SGIB 2EEKA 1MD8A 2XCFA 1JIRA 2UWPA 2Y5HA 3EQ0H 2BOHB 1EUFA 1WV7H 1GCTB 4FUEA 4NWLA 1LVOA 4K69A 3BTKE 1H9IE 4A6LA 1LTOA 5L30H 4UFDH 4YZUA 2AERH 1W12U 2ZDNA 2ZFFH 1MBMA 1GMDG 1W8BH 1NESE 2TPIZ 3TJNA 3MI4A 3GY4A 1FNIA 1SFQB 1W10U 1UK4A 3QUMP 2O8MA 3LC5A 1P8VC 1C2MA 1O31A 2AMQA 4WMFA 2ZTZA 5DPAA 2V6NA 2G52A 1T7CA 1NFYA 2C8XB 1ETTH 3A84A 1XX9A 4D76A 3T28A 1D9IA 1GBTA 1TX8A 2RG3A 3Q3XA 3C1KA 1P2KA 3PV4A 4H4FA 1MTNB 3LIWA 1O39A 1KTSB 1THPB 5A09A 7ESTE 2F91A 3UUZA 4X1NU 3SV8A 1HUTH 5C5NA 3ZZBA 1BCUH 1Y3YA 4GVUA 2C93B 2NU0E 1K1IA 1V6DA 2O8UA 2PWXA 1G32B 1BTUA 2Y7XA 1AVGH 5AVDA 1O38A 4H6TA 3MU5A 1EP5A 1UVTH 1SHYA 3QN7A 2H9TH 3SV7A 3C27B 1TLDA 2WPKS 3K6YA 3ZZCA 1F7ZA 1O2VA 1FIZA 1FI8A 2RCEA 3A88A 3UOUA 1P2QA 2NWNA 4NA8A 1DDJA 4BTTB 1O3OA 3UNSA 3SU1A 1V2TT 4OS5A 4AX9H 1UCYE 1IQFA 3PWBA 1ORFA 1Y3UA 1O3MA 4I7YH 1QJ7B 4B71A 1VJ9U 1FQ3A 1ZRKA 4FUCA 3TGIE 4BNRA 1TOCB 3UFAA 5LH8A 1P10A 1D4PB 1WAYB 3GY2A 1C1OA 3HGPA 1QA0A 2H9HA 2GZ9A 2ZHFH 1MUEB 3MH5A 4JYTA 1G3EA 2FZZA 3ZZ4A 3KNXA 4TYDA 1OP8A 2FPZA 2NU4E 1E38B 4X6OA 1BDAA 1BOQA 3O8DA 3RC6A 3RXBA 2G4UA 1C5NH 1W7GH 4IN1A 1A5IA 3EYDA 3S9CA 2XC0A 3IWMA 1GBBA 3RMNH 4FVBA 1BMAA 5ESBA 1DUAA 1ZSLA 5FAHA 1ANCA 2BDAA 1NU7B 2BY7X 2A45B 1JRTA 2QXHA 1G3CA 2BTCE 1PPBH 4JK5A 4ABFA 3V3MA 2CF9H 3VEQB 4SGBE 3UTUH 3SU3A 2F9PA 1C2GA 1X7AC 5HXFA 3TITA 1MKXK 1LHCH 3BG4C 5ETXA 1N8OB 1QL8A 2GGVB 2BDBA 3FP7E 3ZVAA 1HIAA 1TNIA 3HK6B 1P02A 4NIVA 3TJVA 1G2MA 1S82A 2ILNA 4F4OC 1P3EA 3RUOA 1WCZA 4GLYA 2XXLA 5F6MA 4D8NA 1ZTKA 2FOMB 4GHQA 1CT2E 4HZHA 1IHSH 2V35A 3V7TA 4CRGA 2H1UA 4YOIA 3D23A 1B0FA 5T6GA 3A7XA 2W26A 3LOXA 1YC0A 1T4VH 1JRSA 1KY9A 1WTHD 3BF6H 4HTCH 3BTWE 4MLFB 4IBLH 1VR1H 1TA6A 3JZ2B 3I78A 1TNHA 1SPJA 4MNXA 4ISHH 1XVOA 1EZQA 1GMCF 1K1JA 4TPYA 3UQOA 1C5OH 1Z7KA 1ESAA 1C1UH 3ZV9A 3ZVEA 2VWLA 1TNKA 3PLKA 5TJXA 2R2WU 4ZH8A 1S81A 3ZZ8A 4D9QA 1IHTH 4DURA 1F5KU 2AMDA 2Z9IA 2QXIA 5E0JA 1ZTJA 1SGCA 2BDCA 2ZU2A 3D65E 1QGFA 1A2CH 2ALVA 1PPFE 2XBVA 5DGJA 1CE5A 2KAIB 1ZLRA 2FLRH 4JZFH 1AE8H 2TGPZ 1SMFE 1C1MA 5JB8S 2J92A 3B23B 5A8YA 1ACBE 2P3FH 5FBIA 4D7GA 2C4FH 4AB9A 3ZZAA 1P2NA 1XUHA 1ZJKA 2ZG0H 4A1XA 3F1SB 3MYWA 1SFIA 1D3DB 1QB9A 1V2RT 1HAVB 1NU9A 4FVDA 3VXFH 3MU0A 1EQ9A 1DSTA 4Y7AA 2BDGA 4K1TA 2GDEH 4Y71A 5CE1A 3G01A 3RLWH 4Q7ZA 3RXUA 1ESTA 4Y7BA 1O36A 3RC5A 5TCAA 2HGTH 3SU0A 1GI2A 3SBKA 3KEEA 3A83A 2ZPSA 1LHGH 5SGAE 2GVFA 2ZHQH 3SU4A 3O8CA 4MNVA 1DE7H 1RRKA 1GBEA 1BHXF 2ZECA 4RKJB 1D6WA 1VJAU 1SG8B 2FOEA 3LH1A 1TYNA 1BRBE 3GOVB 2A2QH 2VVVA 1AY6H 2AEIH 1BTPA 2GCTC 5HM9A 3F9EA 2G8TA 1BTYA 2FIRH 2V0BA 4K5ZA 4Y10E 2OP9A 1OWIA 4DY7B 1VGCB 2OCVB 5GCHG 3GISB 5T6FA 1UVOA 2G5NA 1Z6JH 1GBFA 3LGWA 2FI3E 4JMYA 5C3NA 2FXRA 5E0GA 2A32A 1PPGE 1DPOA 3DD2H 1MU8B 1TPOA 2DE9A 2ZNKH 3GY5A 3SNAA 3M3TA 1FDPA 2QXGA 3ZVDA 1FV9A 4BXWA 4XOJA 3QO6A 1BRUP 4MPXA 4K1EA 2RA0A 1TGNA 3M5NA 3NCLA 4BXSA 1LHEH 4BAMB 4YLUA 5DJ7A 5E8EH 2YOLA 4ZKRU 1OX1A 2F9NA 1FY4A 1AQ7A 2G81E 1ZHMA 3MH6A 2ZDKA 1C1TA 3QWCH 1YPEH 1GJ5H 1WYKA 2EA3A 1HDTH 4I31A 3SI3H 1O2LA 3U8OH 3P8OA 4ABIA 2FYRA 1K1MA 4BAHB 3SU6A 3LGIA 1BITA 1GI4A 1AKSB 2WUCA 3GY7A 4O03A 2OC1A 2A4GA 1DY8A 1O2MA 5IYTA 5FCKA 3VPKA 2VVUA 1HAVA