The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
Knots found |
|
sequence length |
153
|
structure length |
93
|
Chain Sequence |
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
molecule keywords |
LAP2
|
publication title |
Solution structure of the constant region of nuclear envelope protein LAP2 reveals two LEM-domain structures: one binds BAF and the other binds DNA.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
42
|
structure length |
93
|
sequence length |
153
|
other databases |
KnotProt 2.0: Artifct S 7.4 51 +3.
|
ec nomenclature | |
pdb deposition date | 2001-06-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03020 | LEM | LEM domain |
A | PF08198 | Thymopoietin | Thymopoietin protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 |
#chains in the Genus database with same CATH superfamily 1H9E A; 1GJJ A; 1JEI A; 1H9F A; 2ODG C; 2ODC I; #chains in the Genus database with same CATH topology 1V66 A; 5CIU A; 1ZS9 A; 1GJJ A; 2G80 A; 2KFV A; 1H9F A; 2QNF A; 2MPH A; 4BIT A; 1Y02 A; 3FLG A; 2QNC A; 1GKU B; 2W51 A; 1H1J S; 1GL9 B; 1JJR A; 1A62 A; 1JEQ A; 2KVE A; 2KVD A; 3LLR A; 1EN7 A; 2KW9 A; 2JVW A; 2ODC I; 2LD7 A; 1ZBH A; 2RNN A; 2HJQ A; 1JEI A; 1E7L A; 2WQG A; 1H9E A; 2RNO A; 1A8V A; 2KVU A; 4UZW A; 1KHC A; 1A63 A; 1E7D A; 1YNS A; 2ODG C; 2A8V A; 3L0O A; 2LC3 A; 2DK4 A; 3QKJ A; #chains in the Genus database with same CATH homology 1ZS9 A; 1GJJ A; 2G80 A; 2KFV A; 1H9F A; 2QNF A; 2MPH A; 1Y02 A; 2QNC A; 1GKU B; 2W51 A; 1GL9 B; 1A62 A; 1EN7 A; 2ODC I; 2LD7 A; 2HJQ A; 1JEI A; 1E7L A; 1H9E A; 1A8V A; 1A63 A; 1E7D A; 1YNS A; 2ODG C; 2A8V A; 3L0O A; 2LC3 A; 2DK4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...