1GJPA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 4-oxosebacic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Two Diacid Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
total genus 115
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gjpA00
3S1VA 4FNRA 4YWIA 4M7TA 4O1BA 1QR7A 4MLJA 1JVNA 3KVJA 3W86A 2FDSA 4O17A 2Z6IA 4ZQCA 1Z44A 1VLIA 1PCKA 2YYTA 4LNYA 1TREA 4MY9A 2X30A 3QQ1A 5H2ZA 1L9WA 2V9DA 1KTCA 1SO4A 3I7RA 5AC8A 5FEXA 3THAA 2TRSA 1OG0A 1B4KA 3IVTA 4TO8A 3VKJA 1JQVA 3W7EA 4O13A 3UXAA 5IBXC 2QCGA 3DGRA 5K4ZA 3A9IA 5I3KA 4CCEA 1EEPA 2WNZA 3LBCA 3DXIA 3LXBA 1YLVA 3L5AA 3L9CA 2XN2A 4O11A 4UTWC 3BG3A 2DZXA 1LBFA 3CEPA 4N9DA 1ME7A 1U5JA 2C3ZA 1LLZA 3L0NA 4ADUA 3O05A 5BNKA 4N6EA 4WXZA 3B04A 1MSSA 4LS0A 2H6RA 4JDBA 3WK3A 1X7FA 3G3MA 4JX4A 1KA9F 1OFAA 2DZPA 3LXAA 3M44A 3LRMA 3P81A 3DFSA 2DZUA 1PL9A 3G1AA 3S5OA 1YTKA 1GVFA 4MZ8A 3P7YA 1QPNA 1XBYA 2NUYA 3M5YA 1D3HA 4OT7A 5HJLA 1GOXA 1JR1A 3WJYA 2VELA 1DORA 1F7BA 4TX9A 5KTLA 3W76A 2A21A 4RJEA 1XDLA 3W7QA 3KHJA 1QCWA 3CTLA 2JBMA 1S5WA 1KTNA 2A85A 1IXQA 4LVFA 1LP6A 3G1VA 4DO6A 5G2WA 4NZFA 3B4UA 3TAOA 3EKLA 1DKWA 3TE9A 2CLIA 4BF9A 2JK2A 2ZZ6A 4HT3A 3STGA 3ZFHA 3L21A 1HTIA 1HO1A 5D2YA 1XL9A 3HG5A 4L4MA 4IGHA 3UZJA 1DHPA 3S1WA 1ADOA 4O10A 1OFQA 1GWJA 5DY2A 3C52A 2HS6A 3C3NA 3G1SA 4K7YA 2GJLA 3NVTA 1KBIA 1LROA 3LHTA 3TC7A 1FCBA 1PCWA 2WV8A 1M5WA 2QKFA 5DBTA 1VGAA 3HGJA 1AL8A 2X1TA 1Q6RA 5DN1A 3CWOX 2YGYA 1EP1A 1AW5A 3M0ZA 1OFOA 5KSWA 5FF0A 4UTTC 1JRCA 2UV8G 3FKKA 2H3BA 2WKJA 4MZYA 3W7LA 2FB2A 2BTMA 2NLIA 1H7NA 5E93A 4G1KA 3RNDA 2J6XA 3LOTA 4ZQPA 2C16A 5CZJA 3S1XA 4O53A 4FB7A 2E6FA 3UWUA 1HL2A 3TXZA 4QQ3A 3OA3A 4R34A 3ZR4A 1I45A 1L6WA 2J24A 4JGDA 2ABAA 3S5ZA 1B4EA 1XFBA 3RLVA 1EP2A 3MO7A 3NM1A 3MYPA 3LTYA 1P5BA 3LCHA 3EX4A 3NOEA 2AGKA 3DFNA 2BZNA 3KRZA 5FEPA 1SFLA 5C2XA 1H7RA 1KFKA 4WXYA 1PV8A 3QYQA 1K8YA 4MYXA 2ALDA 3GK0A 3NDOA 4JTSA 3L5MA 3LCWA 4XZ9A 5AOUA 3C2RA 3OVPA 2Y7DA 4QISA 4LRTA 5HNRA 5G4EA 2EHHA 2ZZ5A 3DI1A 3TFCA 5K3VA 2RDWA 4GJ1A 2XN1A 3HF3A 4O12A 2V81A 1H60A 3KAOA 5D02A 3G0XA 1ZFJA 4S1FA 1W5OA 1VH7A 1EP3A 4ADTA 3N9RA 1T0OA 2E5CA 2Y70A 5KMYA 2ZRYA 3TKFA 3LB0A 1IF2A 2V82A 4E2BA 2RDUA 2P1FA 3BW3A 4JTEA 2JGYA 1GT8A 3PS7A 4NT0A 1SZFA 2ZBTA 1XC4A 1GPWA 1FWRA 1GG0A 1OJXA 4X2RA 4DEFA 3VI2A 3T55A 3PR2A 5D30A 1KLYA 3O06A 3GNDA 3W75A 5HQEA 2W6RA 3FFSA 3UPWA 4MYAA 2X16A 1EWEA 5BMXA 4HNTA 1S5TA 4WQ6A 4DBDA 1QWGA 3MI3A 3P5ZA 3KXQA 3NQVA 1YXYA 4O1AA 1J5TA 2H90A 3QQ0A 1F6KA 3W7JA 4RCXA 1FDJA 2A0NA 3EX2A 5E1QA 4YL2A 5FESA 4K8HA 4CNOA 1FXPA 4O52A 4CQAA 3M41A 1TIMA 2CFFA 4HHPA 3V75A 2YDAA 4JICA 1A5BA 1ZAIA 2C18A 3C2VA 4FX6M 2R94A 3W2NA 5I3FA 4XBKA 2JKEA 3TFXA 1G69A 2FLIA 3EWZA 4LY8A 2Y62A 4O0KA 3CU2A 5F4XA 4C1LA 2GVJA 5KZDA 2QAFA 4UTWA 2Y88A 3C6CA 1BTMA 2QCMA 3ABSA 5D03A 3R8RA 3LLFA 3MHFA 2RDTA 5AHFA 1H7XA 3TQVA 1O4UA 4QITA 4RZ4A 1EIXA 2J9XA 4JNMA 2V5BA 3PULA 2CLEA 5EL1A 4N9EA 3C2FA 4FIQA 1S5VA 2H8ZA 1LORA 1W31A 4OE7A 4R33A 3MI2A 4GXMA 2A7RA 1UBSA 4LS1A 5AN7A 1YADA 1FWWA 2PURA 2Q3RA 1R30A 4GC4A 2DZSA 3W1AA 4JN6A 3YPIA 4WY0B 4Y6GA 3NQDA 4FX8A 1Z48A 3GKAA 5DY3A 3TW7A 1HO4A 2JKPA 1KM2A 4PL2A 4GUJA 1KM4A 3BLFA 3EB2A 3PUOA 1D3GA 1F5ZA 3W72A 2Y63A 3Q58A 4XKYB 1I2PA 3DI0A 5CZTA 4IUOA 3W2LA 3M7WA 1TV7A 2PRHA 5CZ0A 2QUVA 3TX9A 3MW7A 3LHWA 1FX6A 1I2RA 5LZLA 3JR2A 3M16A 2VFHA 1ZY9A 3CIWA 4QJ1A 4IMGA 4JTKA 1UJPA 1WDWA 2VFEA 1JQXA 1P1XA 5CZSA 3ZWTA 3E02A 1SFJA 3A23A 4NXSA 2BWGA 4PH6A 4NX0A 4MJMA 1AG1O 1SPQA 5KZEA 4O15A 5LKYA 3KVMA 1X8FA 1WA3A 4M19A 4GBUA 4UTJA 1VJIA 2C0AA 2VENA 4FXRA 2ZRUA 1PHWA 3EX3A 2CWNA 3LHUA 1LOSA 4YCPA 4RKAA 3FYOA 1KV8A 3NL6A 2X1SA 4JTJA 1TB3A 4UTLA 3MJYA 2C6QA 1W0MA 2FTPA 1T99A 5EYWA 3PG9A 3LTPA 5DXYA 1DBTA 1MEWA 2D73A 1H7OA 1DJQA 2KZHA 1G6CA 2TPSA 2R91A 2WQPA 1OFRA 1K7FA 3SGUA 2Y85A 3MHUA 4LVBA 1OK4A 2I1OA 1N55A 4OGZA 4Z0SA 4EIVA 3TIMA 3Q2DA 3M5XA 1G67A 2LLEA 2DZTA 4UC5A 4A2RA 2VFFA 4GUFA 5BMWA 1VR6A 3TROA 3PVFA 2DJXA 3P62A 3GXTA 2O7QA 2FQIA 1NF7A 3W1NA 1TTQA 3QMTA 3LV6A 3O6DA 1I2NA 3UYCA 3O16A 1QOQA 2X1RA 5G1YA 4LUIA 3W1UA 1FY6A 2I9EA 5CPOA 4AHOA 3TR2A 2XFWA 3LI1A 2TMDA 3KVLA 1U83A 1K8XA 2C13A 2YYUA 3N34A 3TJXA 3TSBA 4JEQA 1SW0A 2A1YA 3VFLA 5EMUA 1K3UA 2YX0A 1C9DA 5SWUA 2EGZA 1XKYA 3L65A 3B0UX 1RD5A 1GJPA 1RQEA 5EPDA 1OK6A 1A5SA 4UTIA 3W88A 1IXNA 3GX9A 8TIMA 5D04C 3U6WA 1OHLA 2B7NA 1SSDA 2B0MA 4PEKA 3UY7A 1GYNA 4FNQA 1Q45A 4IQLA 3MUXA 1RZMA 3N3MA 1LOLA 3M47A 4MUZA 1V7YA 2X1UA 1ICPA 3FJ6A 1G4PA 1JRBA 1RQBA 3PUDA 4JIPA 2OZ0A 4WY0A 3SI9A 3LX9A 4IJBA 3FIGA 4XQ6A 3WK2A 3GDRA 2VKZG 2GUUA 1LLWA 1DOSA 4UFJA 1Q3NA 5C54A 1OYCA 4XTDA 3INPA 3TAKA 3MP4A 1R47A 1KM5A 5TQLA 3LCGA 4JTHA 1KM1A 1O60A 4DF0A 3E9AA 1L6SA 5CSRA 1QPRA 3WJWA 4ONVA 2VEKA 3THQA 1F05A 2BSLA 1WOBA 4RZ5A 1XBZA 2E77A 4LVGA 3EWWA 1XM3A 2QJHA 4FNPA 1I2OA 1NSJA 2B7QA 3QC3A 4DO5A 3QEZA 3PB2A 3FYPA 5TIMA 1AW1A 3GXPA 3FOKA 2AAMA 2NX9A 4NX5A 2W79A 3GDMA 3IIZA 3DU0A 4JR5A 2CZDA 4ML9A 3IV3A 1FUYA 3TQ0A 3O15A 4X22A 3S9YA 2J27A 2VEPA 3W70A 4H6KA 2WSRA 1RV8A 1A50A 3NR0A 5F2LA 3VCRA 3K30A 5F4SA 3CC1A 2CLFA 4FX7A 2OJPA 3C4UA 4E2DA 1TRIA 4LVAA 2A6LA 4QNEA 1E51A 3W7CA 1P4CA 2ZYFA 1O94A 3P61A 5D2XA 5HUPA 1H7WA 3U2OA 3WK1A 3BK0A 4AMAA 1XI3A 3C8FA 1FDZA 4ALDA 1WX0A 3M6YA 1T96A 5D2TA 2QEZA 1UCWA 5HR6A 1L2UA 2ZZ2A 3S0CA 3W2MA 4UIOA 3NQAA 3H54A 2ATMA 3CLMA 5BRBA 2A4AA 4NUWA 1NAL1 1A53A 1UASA 4KFOA 1JUKA 4H3DA 1ZHAA 4I7VA 2WNQA 3MBFA 4QNWA 1GTEA 2E09A 3KFTA 2FPYA 5F1UA 2NUWA 2HSAA 1T8XA 5K7JA 1CI1A 3DENA 3FA5A 3G1DA 4UXDA 3OHIA 3BGJA 3PSWA 3TSDA 4LW7A 1BWKA 2TSYA 3NL5A 2EAWA 1F73A 3F4WA 4IMDA 2BX7A 5AB3A 2YFNA 5LHEA 1G7UA 1ICQA 4FF7A 2B7PA 3O1NA 4LRSA 1TTPA 1KM6A 3TQKA 1TMHA 4MZ1A 3TDFA 3G0SA 4LV9A 3UWYA 1JCYA 4JS3A 3MHGA 1EUNA 3Q94A 3OVRA 4O57A 5CGQA 3DKLA 2GQAA 5FEWA 3EX6A 2H3DA 4UUIA 4CQ8A 4DF2A 3LCLA 1NVMA 1GG1A 3GNNA 3RK8A 3E96A 4MFDA 4KFNA 3V1PA 2RKXA 4RXGA 3SR7A 2GJNA 3TV8A 1YTEA 4FHAA 3HG3A 4EVZA 1R2SA 4N6FA 3W7MA 3D0CA 1MEHA 3G18A 2VC6A 3C0JA 3SECA 4ICNA 2DZVA 3UWZA 2DZWA 4GE8A 5FEZA 3TMQA 4CCDA 3LTSA 2OMAA 3P84A 1ME8A 3MMTA 1QO2A 5HMSA 1X1OA 3KRUA 4O19A 2V2HA 2NXHA 1VQTA 4DPPA 3PSVA 3NPUA 1TTIA 4JYFA 3W85A 2P0OA 1KTBA 1A5CA 5AHNA 4LU0A 3S5YA 5F2IA 3A24A 4S2BA 3PBVA 4AF0A 3U8GA 3G3DA 4JX6A 4PCFA 4NVTA 4GUHA 1G4EA 4ZQNA 3O6CA 3LCXA 2ZCGA 1H1ZA 1KFJA 3TC6A 3W23A 2CLOA 4Q33A 4OU1A 4PC8A 4ZVJA 5L9FA 1XDMA 4JIQA 1DL3A 3S6DA 3QW3A 4N4QA 2J9YA 4CCCA 1M6JA 3NL3A 3TK7A 2CLHA 1JULA 2QCHA 4M6VA 3T4CA 1OABA 3L67A 5G2HA 2NX3A 1J4EA 4BI6A 4JXCA 4M6QA 1YXDA 1UUMA 5HWJA 2Z0IA 5J5DA 2FB3A 2P10A 3PY2A 3QH2A 3W6YA 1TPB1 5EA9A 2RH9A 4DPQA 2I14A 1WQ5A 1Z42A 1ALDA 2OCZA 1LTDA 4UFKA 4JYDA 2QR6A 5C55A 1EX5A 2HTMA 3P60A 2TYSA 2GOUA 4Y8FA 3KX6A 3M1ZA 3R89A 3NAVA 4XBSA 3MWAA 4JTUA 1YDVA 4S2CA 2ZTJA 4DXVA 1TPWA 4MIMA 2V30A 4ORMA 1OX6A 3LRLA 3G22A 3HOJA 3STEA 3DKJA 3NZ1A 3VE9A 4LOCA 1KFEA 2FPVA 3SSJA 1TPEA 1QAPA 2B4GA 5AYXA 7TIMA 3E0IA 1RPXA 3BO9A 3FS2A 1Y0EA 3T7VA 4N9BA 4UTUA 2J9ZA 5AHEA 4FNTA 1GYLA 3LCFA 3M43A 4O50A 3GVGA 2NX1A 4YMZA 3PC0A 1DQXA 3NM3A 2A7PA 3LXCA 5D2VA 2DU2A 2G97A 1P0KA 5DCDA 4IMCA 2QCFA 3FLUA 3LHVA 4K7VA 2G5WA 5GVJA 4CNPA 3WFAA 4Z08A 2ISSA 2G95A 4LC6A 3QF0A 1RQHA 3PAJA 3BVJA 4O28A 3W74A 4L4LA 3OBKA 3F1QA 3PBYA 4ZZ9A 1KFBA 2C14A 4O8RA 4UMCA 5D09A 1TJPA 2GQ8A 1OFPA 1TPDA 3P67A 4PL1A 1FWNA 2ZDRA 2ISWA 4PFMA 3JRKA 1LBLA 2ZTKA 4N2YA 3TXVA 2OT0A 4RX0A 1R2TA 1UB3A 4BR1A 4P2VA 4AH7A 1IIGA 4GFSA 3HQ1A 4XUGA 4K36A 1KFCA 4UTTA 5EKYA 3NQ6A 4Z1AA 4QSHA 5I3HA 4O0ZA 3LRKA 1TPH1 1EPXA 4LVDA 4M7SA 3H55A 3EWYA 3N19B 3N2XA 3T40A 3CT7A 2ZRZA 2RFGA 3W7PA 2W0UA 2NZLA 4XWUA 4IMFA 3ANYA 1SW3A 1LOQA 2Y61A 4PA8A 1WV2A 5D32A 2FJKA 3OEXA 2EKCA 3L0GA 4NNCA 2PRLA 1FCUA 2HS8A 4IPJA 4YXGA 5LHFA 2CLLA 5A8GA 1JCXA 3NA8A 5F4WA 3IIVA 3NL2A 3TA6A 4MLRA 3HMJG 3FEMA 1WAUA 5HWNA 1VYPX 2GPTA 1TPVA 3WK0A 2PC4A 1FBAA 3QMSA 1H62A 1JCLA 1QFEA 4IX0A 4OHQA 4OBTA 3RFAA 3KVKA 2E1DA 4AHPA 3R12A 5IBXA 1BEUA 1W1ZA 4GNJA 3GKFA 4I7WA 4RV8A 2Z1BA 4XTIA 2A2IA 3W2UA 4MY8A 4JX5A 4UTHA 2Q3OA 4HSOA 3EKZA 4KWWA 1TRDA 2AQWA 4BK9A 3S8HA 5G4WA 1I2QA 2GVLA 3GAYA 1NEYA 1VYRA 4IX2A 1DJNA 1C29A 3NQGA 3TW6A 5D05A 3P8JA 2QCEA 4DO4A 4YCOA 3QPYA 1YPFA 4D2JA 1O95A 3DZ1A 3M5VA 1GVRA 4K8EA 1AMKA 2WPBA 1QO5A 1KM0A 3NYZA 2CU0A 3NQMA 1ZCOA 2WJZA 3P5YA 4NJGA 1DQWA 1SR9A 1B9BA 4A3UA 2GVGA 3HIJA 4JTFA 1W5MA 3GIYA 5FI8A 1SQ7A 1M7PA 2VXNA 1TV5A 3AO0A 1VPXA 1VCFA 4MVAA 1O5KA 5KINA 3ATYA 2C1HA 2FIQA 4HNVA 3HGRA 3W9ZA 4AWUA 1O5XA 3PBWA 3LM7A 4TMBA 3HO8A 3W7KA 3VNDA 3STFA 5LNSA 4NQ1A 3USBA 2E68A 3G0UA 4UMBA 5DLCA 5DXXA 3EWBX 2ZA2A 2JKAA 2J88A 1SO6A 3OG3A 5HWMA 4JTLA 6TIMA 1GTHA 4PODA 1MO0A 3W84A 4N9CA 5AYZA 4MOZA 4ZL1A 5C5YA 1C8VA 2Y7FA 4TU1A 4U28A 2ZRWA 4MY1A 1LYXA 2V5LA 4Z1CA 5LSMA 1JJKA 3IIXA 4J9JA 2QF7A 1PS9A 3DAQA 1KBJA 2QCDB 1SZGA 5K4XA 3UZ5A 4JTIA 3NPWA 1SSGA 3L0KA 1Q6LA 1XUUA 2CLMA 4R53A 1VHNA 3O6YX 2Y7GA 1FQ0A 1OF8A 3BARA 3QJAA 4JY8A 1BWLA 3A5FA 1N8FA 1JUBA 3T44A 5D38A 1K7EA 1THFD 4Y96A 4O4VA 1LCOA 2IQTA 4TIMA 4HSNA 4BWLA 1W54A 2Q8LA 2Z6JA 1OF6A 2V2CA 5AHIA 3NPXA 3SFKA 3W7OA 4IPIA 3W7DA 2Y6ZA 2ZZ1A 4IXXA 3TU9A 3EXSA 5AHLA 3UWWA 4LV4A 4JD4A 3F03K 3S42A 3AJXA 4M5PA 4HNNA 4UFMA 3W71A 1MXSA 4QIUA 3BGGA 1ZNNA 1RVGA 1Q6OA 2ISVA 1TQJA 3SGZA 3PUEA 3QFEA 4GUGA 3G8RA 2YZRA 3EXRA 1OFDA 4RR4A 3SY5A 4WZHA 2ZZ4A 4I7UA 3GAKA 3M5ZA 3MI6A 1PVNA 3GXNA 3G8EA 4O14A 5LGXA 1TQXA 4WX2A 1W5QA 3A5VA 3NO5A 1V5XA 3I6RA 5CSSA 5K9DA 5I3IA 3HPXA 2YSWA 1YXCA 4HKPA 4Q32A 3ZWSA 1N7KA 4OV9A 5J5RA 2OT1A 3PF3A 4P61A 4KKXA 2VEIA 3TMLA 3W7HA 1G7VA 1W3NA 3UY8A 4LT9A 1QOPA 2EPHA 4AXKA 1YDNA 1XBXA 2FFCA 3IGXA 3KOFA 1WBHA 3H53A 4OWGA 2NV2A 4NNBA 3HPSA 4LWWA 4N4PA 2Q8ZA 2G96A 3ABQA 3NQEA 3EWXA 3WJSA 1S3HA 5K2ZA 3LHYA 4EWND 3R13A 3P80A 3QMRA 2ABBA 3DHDA 2V2DA 3CQ0A 4UTMA 1OX4A 5FF4A 1GEQA 1FCVA 2OX1A 4HPXA 1LRNA 3LDVA 4JTGA 5D33A 2X2GA 1CX9A 1XCFA 3W87A 2DJLA 1IXPA 4Y9AA 1GVSA 4R7JA 5AYYA 4Z1DA 3DFOA 1G4SA 2Z2UA 3LHZA 2E5DA 4O1CA 1FDYA 1VYSX 4GRSA 2C15A 1DV7A 1OFBA 3HJZA 4JY9A 2ZRVA 3BG5A 1FWTA 4O4WA 3DFTA 2HMCA 3C2OA 1MZHA 1K7XA 3Q37A 2ZA1A 1I8JA 2E6DA 4IMEA 2H8XA 3DFQA 4BI5A 4RXFA 3A22A 4HPJA 1LRQA 5H91A 1OVDA 3L2IA 4H4IA 1K8ZA 3LERA 1ZALA 1KFLA 3BG9A 4AF0B 1KV5A 3ABRA 3NQ8A 2QCCA 3W3OA 3OIXA 3I7QA 4DBEA 2WNNA 3UQNA 2ZQ0A 1UUOA 4YLWA 1ZENA 2DP3A 2NXGA 3WJXA 3GZ3A 1A5AA 4UNLA 2B7OA 4DF1A 3M9YA 2V0TA 4MPQA 3HGOA 1B3OA 2PE4A 1VS1A 3JS3A 5F2GA 1VCGA 3NNTA 1HUVA 2CW6A 5DBUA 1XUZA 1EB3A 2YW3A 5LNWA 1K02A 1TJRA 3LCIA 1F76A 3S1UA 1PHQA 4QM1A 4UMAA 1OFEA 4Q4KA 3N9SA 4WOZA 1YDOA 5AFDA 3MYOA 4GWEA 2BXVA 4EOUA 1LM1A 1NFBA 4JDYA 3NQCA 1JCNA 1PIIA 3IIPA 2R14A 4UFHA 4M6PA 3EEGA 4MKNA 3EXTA 4IXHA 1R46A 2A5HA 4ADSA 1OX5A 3IRDA 5AC7A 4WD0A 4GUIA 3LGEA 3F4NA 3LBMA 3W1PA 1AL7A 4UFLA 1XBVA 1B57A 1H63A 3NEVA 5CG7A 3W73A 1ML1A 3GR8A 2F84A 5BOOA 3B06A 4FIRA 3UXDA 1F6PA 1QPQA 3HB9A 5D2WA 3HG4A 3FJLA 2QDHA 3T78A 1LRTA 2ZZ7A 4AVFA 3UWQA 2ATSA 4O1DA 1IGSA 1H51A 3C2EA 4ORIA 2WOQA 3WJZA 2QCNA 2V8ZA 1W5PA 1D9EA 3GB6A 5KITA 2QJGA 4Y90A 1G4TA 3BLEA 5EY5A 3NQ7A 3NZRA 1VZWA 4IOTA 4AHQA 1QMLA 3TUUA 4RLIA 1H5YA 3LV5A 3ATZA 1H1YA 3QSTA 4ZQRA 1TPFA 3I65A 5KZMA 4WJEA 5K9CA 2CZEA 2R8WA 1TPC1 1F74A 5U4NA 2VFGA 2E6AA 3W7IA 4EF8A 2E5BA 1H7PA 3SIZA 3W22A 3IGSA 1W3IA 1CW2A 1DVJA 1H50A 5FF7A 1J2WA 3G1FA 4OV4A 1VC4A 3KRSA 2PRMA 4BWLC 3IVUA 5ABTA 1JCJA 5F2MA 1GVOA 4U4MA 4HNUA 3W2KA 4FXSA 2BLEA 2VEMA 4UNKA 2YW4A 2ZFAA 1ONRA 3O07A 4Z1BA 3E49A 3UWVA 4AB4A 5I3JA 3IIOA 1I4NA 4EF9A 4FNUA 5LNUA 4MFEA 3QPZA 4NU7A 1KW1A 2QDGA 1ICSA 4A22A 2YXGA 3C61A 3PWAA 1OYBA 3LI0A 5CPLA 4UTKA 1VLWA 2GQ9A 5DELA 4NJHA 2CZ5A 1IIHA 1M7OA 3CHVA 1FXQA 4X3ZA 3UNDA 2QAPA 2YFOA 2YPIA 1KLZA 1EA0A 3UPBA 3QM3A 4DQWA 5AHMA 4UFIA 2DORA 2YR1A 3L68A 4ZQMA 1IXOA 4KFPA 4JTTA 5E0KA 1GQNA 2QCDA 2NV1A 5I3GA 4LTSA 4DELA 1TYGA 3W83A 1VHCA 3DFPA 3P8IA 4E0CA 4TR9A 3CEUA 1EWDA 3LLDA 5AC6A 1LBMA 2WO5A 3QRHA 1VRDA 4NXKA 4PTNA 2YCEA 4FEZA 4W9TA 3W1MA 3QSRA 3W1QA 4JYEA 3N14A 5CKSA 3ELFA 3HBLA 3CM4A 1SO5A 5DCEA 3PM6A 5FF3A 1HG3A 3GDTA 3PBUA 2JGQA 1QDSA 2A6NA 4UR7A 1FCQA 3PB0A 5HUOA 4K6AA 3B05A 4B5NA 1W56A 2ZRXA 3C56A 4A2SA 4AAJA 4BI7A 4K37A 4MJZA 3W1XA 3RF9A 1SW7A 1ZAJA 3IEBA 5FF2A 3DBPA 5LNVA 2CZFA 3B8DA 4FO4A 2QJIA 4RK8A 3N73A 4WUIA 3RLUA 5IM51 3W7NA 4LUJA 3W1TA 1SZEA 1Z41A 2QUUA 3NPVA 1WYIA 1AK5A 1ZJIA 3L5LA 1L6YA 1FWSA 3W1LA 5LNRA 3R5EA 3GR7A 3BW4A 1SO3A 5K9XA 1P0NA 4O54A 5DCBA 5G2IA 3TJLA 3DHFA 4C1KA 1KM3A 1GZGA 1LDCA 3NQFA 1WXJA 1LZOA 3RMJA 4WY0F 3ABOA 3G1YA 4AWSA 3A21A 4ZQOA 2A7NA 3W7RA 3HGSA 2XN0A 3NXFA 3RU6A 3PG8A 3N2MA 4TMCA 2WSQA 1TCDA 3GLCA 4AEOA 3W7GA 2ZA3A 3DH7A 3ZS4A 1F2JA 1RR2A 1MEIA 5CPNA 5L6UA 3SW6A 2F7FA 3E12A 1X6UA 4ZMGA 4BFAA 5CPMA 1GVQA 2Y7EA 4K39A 1TO3A 4O16A 6ALDA 1AW2A 1TSIA 3GDKA 3MBDA 3QW4B 4CLMA 3CB8A 1SUXA 4LS2A 3HPZA 4K38A 5G1TA 4QAIA 3R2GA 1OX4B 1QNVA 2C19A 2NUXA 3B0PA 3SJ3A 5HINA 2CLKA 2VOMA 4POCA 3GYEA 2PCQA 1BKSA 3S5NA 3SZ8A 2VFDA 3BV4A 4UCGA 1TV8A 3FKRA 1R2RA 3EX1A 4Z0JA 1OYAA 3TCEA 4CNNA 1QPOA 1W37A 1W5NA 5LGZA 3NQ2A 3STCA 2RHGA 4NNAA 1JCMP 1H61A 3MP3A 3IVSA 5F1VA 2NXIA 5T26A 3W07A 3P82A 4AWTA 3UD6A 4A29A 2ZZ3A 4CQ9A 2QUTA 1WOAA 5HR7A 3B03A 3W2JA 3IGUA 3TNOA 4HN4A 3TSMA 4O18A 3W1RA 3NG3A 5EBUA 3B0VC 2NWRA 1K03A 2VFIA 4NJKA 3CPRA 1ZAHA 1ME9A 2QCLA 4NJJA 3VE7A 3G24A 1SU5A 1EUAA 4OQVA 2E6YA 3O8AA 2O7SA 5C6MA 5MHBA 3G1XA 2NWSA 1YYAA 4FNSA 1PE1A 3QZEA 1TPUA 3I7SA 1XXXA 3BLIA 4E38A 3TH6A 3HG2A 4RZ6A 3BW2A 3EWUA 4LC8A 4X9SA 3L66A 3OVQA 3P74A 1HFBA 1W3TA 3GDLA 5BW6A 4A21A 1Q6QA 1VCVA 4I9AA 1YPIA 5G5IA 2Y89A 1TTJA 1YTDA 3G1HA 3O63A 5HULA 4N02A 1JUEA 4HIBA 2WSYA 5A5WA 4KWVA 4IWWA 1SZNA 5TBOA 4WOQA 2FPTA 3BPWA 3I68A 2EF9A 5U7SA 1W8SA 3CIXA 1NF0A 1X1ZA 1WBJA 3NGJA 5D37A 4NZJA 4NJIA 4UR8A 4XKYA 3CWNA 3MP5A
chains in the Genus database with same CATH superfamily
4YWIA 4O1BA 4ZOBA 1RLDA 2BGQA 2Z6IA 3R79A 1VLIA 3AHXA 4LNYA 4MY9A 2V9DA 4ECLA 1W9BM 4KW2A 1B4KA 2J74A 5A1AA 3W7EA 3EBVA 3CAKA 3UXAA 5IBXC 2QCGA 1ZBKA 2PI6A 5I3KA 1UD5A 3D47A 3LBCA 4UZSA 3L9CA 3MKVA 4W7WA 2OEKA 1EA9C 3CEPA 3OLEA 1ME7A 3WD0A 1LLZA 3L0NA 1RJQA 3IUDA 1MSSA 3K1GA 4UWMA 4LS0A 3KEHA 2H6RA 5DX7A 1KGXA 4ZCWA 1KA9F 4Z2LA 3WQOA 1YTKA 2PLMA 1T5AA 1XBYA 2NUYA 1CECA 3M5YA 4GZJA 2Z4GA 5H8PA 1TZZA 3V16A 1JR1A 1EL3A 1RCOB 4TX9A 2QPXA 1N8IA 4H9XA 1J96A 2PDGA 2A21A 1WDPA 1XDLA 2D2HA 4IIGA 1IXQA 4DO6A 3WDPP 4DB7A 2W4XA 3R1ZA 3EKLA 1V6XA 4GXWA 4U10A 3VDCA 3WF3A 2V63A 2REQB 2ZZ6A 1UYQA 3STGA 1HO1A 2I17A 1V3JA 4JIRA 3UZJA 4IIFA 3EB4A 1DHPA 4CEUC 4J3WA 4KS0A 5DY2A 3SN4A 4QP0A 1UC5A 2IXVA 1M53A 1VFOA 2DGAA 3GH5A 4OFCA 3AIWA 2QKFA 1VGAA 1GORA 1AL8A 2X1TA 3DN5A 1CXHA 4ENLA 5DN1A 3FVMA 2YGYA 1Z89A 1HF6A 1AW5A 3M0ZA 1ITXA 1MNSA 5CGMA 1JRCA 2YCIX 3K8LA 3AIUA 2JEPA 5XINA 5FACA 3N2TA 3W7LA 4DM2A 4J7RA 4XD3A 4G1KA 2E40A 5M17A 1GQJA 3S1XA 1DYSA 2C16A 2Y4SA 1W1VA 1W8GA 2WVVA 3CK5A 1RP9A 4RW3A 4K68A 4L1WA 3ZR4A 2SFPA 3QKZA 2ABAA 3LA4A 3FSUA 4YVXA 1EHAA 3RLVA 2ICSA 2PF8A 2YB1A 3EDKA 5BOEA 3DFNA 1KKRA 3KRZA 4WDTA 3XISA 1SFLA 2E67A 4ZE5A 3GHSA 2WQDA 3BAYA 3NDOA 3A64A 1R3VA 3AICA 2OKTA 2DSWA 3GFXA 3URQA 5CAKA 5C7VA 3M0JA 4DUVA 5HNRA 3EB3A 3DI1A 1UIPA 1XIEA 3OTRA 4GJ1A 1DP0A 4O12A 3KAOA 4GY1A 1HP5A 1QW9A 1S2VA 3ZJ6A 4DLFA 3G0XA 2X7WA 5I78A 2NT1A 1F9CA 2Y70A 5KMYA 2CITA 2ZRYA 3LB0A 1E0WA 4BQ4A 4GJJA 1XLLA 3BOXA 2OLHA 3Q65A 3P2VA 3RDKA 3T0DA 3MB9A 1CENA 3FGCB 5LA2A 3NQBA 4JHZA 1K9TA 2X2YA 3MMWA 1D8WA 1GG0A 4CQCA 4D6IA 4NP7A 1KLYA 3O06A 2VWTA 3FAXA 3WD1A 1CXKA 4QROA 4M24A 1EWEA 1NU5A 4HNTA 3A4WA 1W1YA 2O0TA 1VEPA 3ZYZA 3UJRA 1JGIA 3P5ZA 4NRSA 3KXQA 1J5TA 3W7JA 3GZAA 5E1QA 2PWDA 3DBNA 1MXDA 3ORWA 3PK7A 1GGOA 3KTXA 4O52A 3T09A 4L5ZA 1GYMA 2CFFA 3VKKA 4HHPA 4LYQA 5BYWA 2YDAA 5E6YA 4BS0A 3ARUA 4X0VA 1ZAIA 2R94A 1EX1A 3LSCA 1ZJBA 1TWIA 2C1IA 3PTDA 3TFXA 1G69A 2FLIA 4X0NA 5D8ZA 5KZDA 1P43A 2BVWA 4GQBA 4UTWA 4W85A 3MHFA 3JU2A 2RDTA 4L56A 1H7XA 1ISZA 4PMQA 1O4UA 4QITA 1CXLA 1EIXA 3BSHA 1V3IA 4N9EA 3C2FA 2H8ZA 1T40A 1W31A 4GXMA 1UD2A 3G6LA 2OSXA 5AN7A 5BU9A 1YADA 4BKNA 5I2UA 1TR9A 4GC4A 3MZ2A 3T8QA 2DZSA 2P76A 4WK9A 3XIMA 4GQGA 5DY3A 3TW7A 1W2PA 2OZ8A 1KM2A 4HZ7A 3U4AA 2VCCA 3BLFA 3EB2A 1FOBA 3WEZA 2OYMA 2PGEA 4AD0A 3WF2A 1TV7A 2PRHA 3QR3A 3WH6A 3LHWA 1FX6A 3CUGA 3KBSA 4LBRA 4Q4OA 4GC3A 2ISDA 4ZENA 2VFEA 2J7BA 1XQKA 3ZWTA 1U1HA 1SFJA 3A23A 4PH6A 1AG1O 1P6CA 3KVMA 2YLAA 1WA3A 3DG6A 4UTJA 5CAHA 2C0AA 1J93A 4V33A 2FGZA 1ADSA 4MAZA 3WDHA 3CNYA 4IGSA 3BWWA 4JKKA 4RKAA 3FYOA 4R88A 3NL6A 3WMSA 2BY1A 3G6MA 3ZR6A 3JW7A 3DYMA 2FTPA 3H4WA 3TCSA 3OG2A 3LTPA 1DBTA 4HSHA 2D73A 1UA7A 1KBKA 1E43A 4GABA 5IOBA 2KZHA 1G6CA 4F2TA 3N13A 3SN0A 1OFRA 1K7FA 4MDPA 3T0CA 5I07A 3WDRA 4J28A 4PRWA 2PU0A 2DUXA 2VZVA 5HMFA 3VGFA 5BMWA 8XIMA 3BAXA 2QNEA 4KWUA 2DJXA 3P62A 1C3FA 4E8DA 1CLXA 1NF7A 1UH3A 3TC3A 1TTQA 2WMGA 1I2NA 1QOQA 4JKMA 4XZWA 2IPJA 5G1YA 5HAOA 5CPOA 1XF0A 3N6QA 1HL9A 1K8XA 2YYUA 3TJXA 3OPSA 4GYFA 5EMUA 3IAPA 1XKYA 1GQKA 3E5PA 5EPDA 2PBGA 1OK6A 3W88A 4JQ1A 5D04C 3PZTA 1TX0A 3GRIA 1SSDA 5C9ZA 2B0MA 1W3HA 3CMJA 5BOFA 3UY7A 1GYNA 1XG3A 4ZOEA 4XVDA 4FNQA 1TUXA 3N3MA 4IMAA 3WQCA 1O1ZA 1V7YA 3VIKA 3FJ6A 4WCJA 2QV4A 3UG3A 2OZ3A 3AXMA 2Z1KA 1A5UA 2GJPA 4FOJA 3SI9A 3LX9A 1J0IA 1DOSA 1KD0A 3B8UA 3TAKA 4GXPA 4S3FA 3WBYA 5MKGA 1XLBA 4I6VA 5CSRA 4FS9A 4OJYA 1L6FA 1T8QA 4OECA 4PB3A 2VZTA 2YL5A 3RGTA 2VWSA 5I24A 3F5JA 4W7VA 4O1EA 4QLKA 3M0XA 2WHJA 3KS6A 1RBAA 4RV3A 3PB2A 2AAMA 1U5VA 4RDVA 3VZYA 4X2PA 5E6ZA 2VX7A 3VMNA 1K1DA 3EA2A 3TQ0A 1JPDX 3VO0A 5HATA 5BRQA 3S9YA 2J27A 1TELA 3RU8X 2VEPA 1HKKA 5F2LA 2BG5A 1A50A 2WSRA 1RALA 2VGFA 1EZ2A 3K30A 4JTDA 3WH7A 1UKQA 3V0UA 2OJPA 1Q6EA 2WW5A 3C4UA 1TRIA 4LVAA 2A6LA 1OG6A 1O94A 2Y2WA 1XYMA 3U2OA 4BQ3A 4W93A 3BK0A 3IV8A 4Y9NA 4AMAA 3C8FA 4KBXA 1FDZA 4ZEPA 2WZIA 4ALDA 1T96A 2QEZA 4PUWA 1UCWA 5ECUA 3H26A 1L2UA 4ASTA 5BXPA 1PZ2A 1SJAA 3AIVA 5BRBA 3UPMA 4LX4A 3B8VA 3LENA 4UQ9A 1JUKA 4H3DA 2WNQA 4QNWA 1OCQA 1GTEA 3D3FA 1XLJA 4FMVA 2J6VA 5F1UA 4DWSC 1CI1A 3FA5A 4F2UA 2WNWA 2BHUA 2FVMA 3BLLA 2TSYA 3NL5A 2BX7A 5AB3A 5LHEA 4FF7A 3O1NA 3A3XA 4JNZA 4P7RA 4LRSA 4G8TA 1E0VA 1AA1B 5C7HA 3T9PA 1O68A 2XVPA 1G01A 4AU0A 3UWYA 2FVLA 1QNRA 2VT0A 3C5QA 3MHGA 3CV6A 3RO8A 5C9XA 1PB0A 2GQAA 2D20A 4HZ6A 5HNTA 4CQ8A 3EMQA 2I5IA 3WNKA 1FFRA 1DJHA 1NVMA 2DVTA 2GLKA 1YX1A 3AMKA 1XHGA 2RKXA 4RXGA 4MNLA 2GJNA 4YVPA 3TV8A 4EVZA 3UT0A 1EXBA 3UA4A 1UD4A 4ICNA 2VP8A 1ELSA 4B5VA 2ZX5A 4W8LA 4CCDA 3ZVHA 3MMTA 1X1OA 4XAPA 4GVGA 3VD9A 4LUTA 1UWRA 3PSVA 4JYFA 4JCMA 4XO6A 4DWSA 3NZGA 2ZX9A 1FHDA 3BXWA 1A5NC 4PCFA 2DSKA 1MDRA 3LCXA 4BF7A 1KFJA 3TC6A 3W23A 4Q33A 4Q8MA 4ZVJA 1XDMA 4JIQA 1DIEA 2VX5A 1HJVA 7A3HA 3QW3A 1M6JA 2CLHA 2OO0A 2YL6A 3T4CA 4DLMA 1YXDA 3EAUA 5HWJA 5J5DA 1EJXC 2FB3A 3S46A 4TTGA 1G5AA 5C70A 2RH9A 2I14A 1BG9A 1WQ5A 4MNJA 1GQIA 1LTDA 2QQ6A 3WO8A 5C55A 2HTMA 1H1NA 4Z2HA 3OW1A 4DBWA 3FDGA 4JTUA 4LEQA 3RR1A 3HV9A 1LL6A 4H9ZA 1R3TA 2V30A 2DT0A 3MJMA 2V3EA 3HOJA 1S1PA 3KBJA 2Y1HA 2CYGA 2XIQA 1QAPA 2B4GA 1YQ2A 5AYXA 3E0IA 1QTWA 2PWUA 3QR1A 3XINA 3BO9A 3SQLA 1GYLA 2WHMA 4O50A 4YMZA 1KCLA 2A7PA 4IMCA 2D2JA 4ZXOA 2ISSA 2XHYA 1B3YA 3CMGA 3BVJA 6A3HA 1E6QM 2FHCA 3M7SA 4O28A 4AVOA 4LBUA 4UMCA 2OYLA 5D09A 2UY5A 2G3JA 2W67A 1DJWA 1ZGDA 1UQYA 1LBLA 4F4RA 3TXVA 1XSKA 1UB3A 4XAYA 4XUGA 1QU4A 4O0ZA 1EPXA 1RJRA 3T07A 1RY0A 3WQEA 2DSUA 2NZLA 3EA1A 2YCKX 3W37A 1WV2A 3WD3A 3ISIX 3L0GA 1RBLA 1GHRA 3QGKC 3OIHA 2VO5A 2J62A 4PE8A 4IPJA 3SY1A 3SADA 3VM7A 1OT2A 4YXGA 1XIMA 1BYDA 5ABEA 4J2PA 2CLLA 5A8GA 2BGNE 3H23A 4ZB2A 2OOFA 4EKJA 5F4WA 3UW6A 5HWNA 2FHFA 2PTZA 3DG3A 4H41A 3OODA 2J75A 2PC4A 1ZJHA 3QMSA 3L4VA 3RILA 4GY7A 3V5CA 3VNLA 4OHQA 3E74A 1XPGA 3KVKA 4EP8C 3PP7A 4AHPA 5BROA 4GNVA 5CJNA 5IBXA 4I7WA 3GKFA 2Z1BA 4XTIA 1A49A 1VJSA 3WFLA 4MY8A 3B8TA 1U1JA 3EKZA 5B7ZA 1Q7ZA 2OQLA 3BE7A 3ARYA 4RNHA 3QTGA 2GVLA 4QJ3B 3WF0A 1HQTA 3TW6A 4YTTA 4AZIA 4K8GA 2QCEA 3MANA 4DO4A 3WDIA 1HKWA 1AJ0A 1LWJA 5D9NA 1O95A 3TA9A 3LMYA 1AMKA 2OVLA 2WJZA 3SN1A 4J2MA 4NJGA 4G6CA 1DQWA 1SR9A 1B9BA 2F6KA 3HIJA 3N2CA 2WCGA 4MWAE 1SQ7A 1M7PA 3F2DA 3AO0A 1VPXA 1FKXA 3FDKA 3A4XA 3ATYA 4YN5A 3SCPA 3W9ZA 3MSYA 2HE5A 2Y5SA 2NQLA 2WM1A 3PBWA 3LM7A 3IPWA 4GACA 3VUPA 2GGIA 2OTDA 1CXEA 3GS6A 3K46A 3ZT5A 1HNYA 3USBA 4YVVA 5CJMA 5DLCA 2J88A 1JZ5A 2X8RA 2XIJA 4JN8A 4MGGA 3VZZA 4TU1A 4U28A 2ZRWA 4GHRA 2X7VA 4Z1CA 6TAAA 1MUWA 1JJKA 4AMCA 1POJA 3VIPA 2QCDB 5FJOA 2F2KA 4F0HA 3E2SA 1J10A 3OHMB 3KP1A 1SSGA 3L0KA 1EO7A 1XUUA 1X7IA 3JUGA 4FOKA 4PMVA 3UG5A 1RBOB 1OF8A 2XIOA 1LJYA 3TLLA 4GX8A 2ZX6A 2GSEA 3EOSA 4C6EA 3VGBA 4IL0A 1THFD 4Y96A 4BWLA 2ANUA 2Z6JA 3DHPA 5AHIA 1NP0A 2V3FA 4WKAA 3SSZA 3EXSA 3TJIA 1JPHA 1XP3A 1A5OC 1XGEA 5DMLA 4TX8A 4JD4A 3V36A 5DMMA 3S42A 1K9DA 3BSGA 4UFMA 5GJNA 4HCDA 1Q65A 3BGGA 2FGLA 4I6KA 4PMRA 2EPNA 2WZMA 4HMDA 1RVGA 1FWJC 1PEZA 1Q6OA 1JZ7A 2ISVA 1TQJA 2I5QA 4ZO6A 3VVGA 2E7FA 4RUBA 3CQKA 2GWNA 2BHYA 1REQA 1OFDA 4G1NA 3CIVA 1KKOA 2IPGA 1N82A 3M5ZA 3MI6A 2IQDA 1YRRA 4KEZA 1Q7MA 1BF2A 2INFA 3A5VA 3VIFA 2POZA 3I6RA 5KEZA 5CSSA 3SUTA 1OBAA 1TFVA 3N15A 3UGRA 5FAGA 4BQ2A 5J5RA 1XLGA 4P61A 4DX3A 1W3NA 3AXKA 1X6NA 3IANA 4NYYA 1QOPA 1E70M 3UNTA 3GC5A 4MKSA 3MZNA 1R7OA 2WVVB 1K8CA 3H53A 5CC7A 3IJ6A 2Q8ZA 3M07A 1ZRQA 4PBEA 3V0SA 4LJ3A 3TW9A 3LHYA 1FFQA 1A0DA 3NURA 4Z2GA 4FAMA 3OLGA 1OEPA 1IHIA 4FXFA 1RA5A 3WMCA 3S2MA 2J25A 1LRNA 3LDVA 4JTGA 3CHDA 2Z29A 1V3KA 1XCFA 2I16A 4WDWA 4HBKA 4R7JA 4Z1DA 4WDXA 2CKSA 4O1CA 3GU9A 3MY9A 2E28A 2ACRA 1OFBA 4KIRA 3BG5A 1FWTA 4C65A 3DFTA 5A6JA 5B7YA 2E6DA 3PTKA 4IMEA 3CV2A 3CL8A 4DWDA 4G56A 1LRQA 4AWEA 1OVDA 5FD0A 1K8ZA 1ZALA 1XFCA 1V0NA 3WN6A 4AF0B 2QCCA 4DBEA 2BBFA 3UQNA 5LIWX 4YLWA 3PPFA 3E2RA 2WC3A 2W91A 3W6LA 1UWIA 3LZ3A 3MCOA 2OYKA 3WJXA 3BLOA 3EDJA 3TONA 2B7OA 4TXEA 2WWCA 1BQCA 1H4PA 4MPQA 1VS1A 2QW5A 3GYCA 3H7VA 1X1NA 2VGBA 1EB3A 5HDRA 1F76A 1TA3B 3ITXA 5A69A 1J12A 5BRPA 3N9SA 4WOZA 1OCJA 5FJIA 1JYXA 4EOUA 1NFBA 3UZXA 3RHGA 4EXQA 3V5FA 1LQAA 1V4YA 4WF7A 1DXIA 3EEGA 4MKNA 3EXTA 3WKZA 3CMFA 2A5HA 4TV5A 1QK2A 2PAJA 3BLDA 3B9AA 3UCDA 3GIPA 2A3LA 1Q7QA 3LGEA 3F4NA 1KC7A 1B57A 1R0MA 3NEVA 5CG7A 3VDGA 2F84A 3B06A 1KXVA 1MVYA 4WKHA 5M1TA 5D2WA 2QDHA 2B31A 2E9LA 1LRTA 2XVKA 3QOKA 4Y9MA 4DM1A 3RRXA 2ATSA 1ZP3A 1I0BA 2PD9A 4P7QA 1IGSA 3C2EA 3F7JA 4B90A 3VOCA 3IJ8A 2IXUA 1D9EA 5KITA 4Y90A 2XG9A 3UA3A 1ZUAX 3IJQA 4Q4PA 4UQAA 1VZWA 5E9AA 2VD8A 1QMLA 3ATZA 4DUOA 4ZQRA 5KZMA 1YE6A 2O9PA 2R8WA 2WZHA 2XFYA 4JTCA 1F74A 3W7IA 2ZC8A 4EF8A 3AMCA 2E5BA 3C86A 4V15A 1W3IA 5CPTA 5GPRA 2XH0A 4GG9A 4I9JA 1J2WA 1VC4A 3KRSA 3WUBA 4HA1A 4C6FA 3HZ3A 4U4MA 4UCFA 5TD4A 4B4FA 1UA3A 1QBBA 3W2KA 5ENLA 4H9TA 2ZFAA 2ALRA 4Z1BA 4NY2A 1NDZA 3E49A 1HT6A 3OU8A 4AB4A 1QHOA 3S1GA 4L61A 3TYAA 2PDKA 4V1XA 1K6AA 3BJSA 4D71A 1I4NA 4FNUA 1IT0A 3QPZA 2QPUA 1P0EA 1Z7AA 3T0BA 5BCAA 2YXGA 3SRFA 3C61A 3LI0A 3H2OA 2ASHA 2GQ9A 5DELA 4NJHA 4K1GA 3UNDA 2QAPA 1A3HA 2RGMA 4F48A 1KLZA 1W1TA 3RIKA 3L4YA 2IKHA 4ZQMA 5E0KA 2VOTA 2FTWA 1UJQA 2QCDA 4LTSA 5G4HC 1TYGA 1YBQA 3VNIA 3W83A 2VL4A 3LLDA 3VC6A 3DIPA 2WO5A 3QRHA 1PZ0A 4NXKA 5IXEA 4GKTA 3AIBA 3QSRA 4JYEA 5CKSA 3FV9A 4YTQA 1BKHA 5GQBA 3TOPA 1H0GA 3USZA 3NCOA 5FF3A 1HG3A 3PBUA 3VIHA 2JGQA 4EANA 2A6NA 4YIWA 1AODA 1S46A 1XGDA 3GH4A 4X9YA 3H8AA 1XGZA 3ZT6A 2ZRXA 3OLIA 3M4HA 2OGJA 9XIMA 4FF5A 2XVGA 1LUCA 4MJZA 3W1XA 3AUOA 3RJYA 4INFA 3IEBA 5LNVA 3DBPA 2PP3A 4IF2A 2C0HA 3E0WA 3RLUA 8RUCA 1VFLA 4H8NA 1B5TA 1SZEA 3GFZA 2ZXQA 3EEZA 3AMDA 1JZ3A 2VRJA 2VR4A 4MADA 5LNRA 3R5EA 3VOFA 3BW4A 1F61A 5K9XA 1P0NA 4GD0A 3HM7A 2O9OA 3TYCA 1H11A 1IZKA 3THDA 3NQFA 3RMJA 4WR3A 4P8WA 3CV1A 2AL1A 2XU2A 5H6HA 3A21A 4ZQOA 2A7NA 3AOFA 2VQUA 3ZLGA 3L4TA 4UR9A 2XN0A 4QTGA 1PTDA 2WSQA 1AJ2A 4F0MA 4Q6XA 3TEVA 3KTSA 5CPNA 4ZMGA 4BFAA 2D24A 2W5FA 5CPMA 4C6BA 4YYCA 5I6SA 4K39A 3REQB 3TJ4A 3CB8A 4CLMA 1UBPC 3HPZA 1OC6A 1QNVA 2VOMA 3EGJA 3GYEA 3SEPA 2CLPA 2PCQA 4IT1A 3N3TA 3EA3A 1W32A 1NDVA 2VFDA 4UCGA 1NWRA 3QZ6A 3FA3A 1OYAA 4QDPA 2CWXA 4C7GA 3NQ2A 2C1GA 1DWJM 4GY0A 4EAMA 4K3ZA 3MP3A 3SCVA 2QUMA 3IVSA 5F1VA 2GYIA 1UP3A 4AWTA 2FGBA 1YBQB 3UD6A 4A29A 4QG9A 4JIHA 1JF5A 4HMCA 4Q6JA 3AYVA 1PX4A 4J4KA 3TNOA 3UJ2A 3W1RA 3NG3A 1I60A 5EBUA 3E2VA 3B0VC 1K03A 2VFIA 4K2SA 1Q2SA 4A05A 1ME9A 2UY4A 2QCLA 4HHHA 3PZUA 3NUKA 5C6MA 1WDRA 4KT2A 1YYAA 1I1WA 1B3XA 5DANA 4GQQA 1EJSC 1DXFA 2QULA 3AJ7A 3BW2A 4X9SA 3CH9A 1HGWA 3BURA 2AMGA 3WQWA 1Q6QA 2V67A 2WMIB 4E3VA 3W25A 4GZIA 4J3ZA 1TTJA 2XINA 2J7CA 2J8TA 1JUEA 5DRIA 3WNOA 4HIBA 4PSRA 5A5WA 5HPOA 3SCQA 4KWVA 1SZNA 1ITUA 1T6MA 3I68A 3URBA 4U3CA 1YNPA 5U7SA 4L7ZA 1L0PA 1W8SA 3A13A 3B97A 1NF0A 2OXNA 5CQ1A 4ACZA 3WQDA 2NQ5A 4ILSA 5D37A 5M3WA 3NZPA 4GI6A 1MRAA 1DTNA 1C93A 3CWNA 4CN4A 3S1VA 3UCQA 1ZJAA 2WMFA 1MQQA 4WRHA 2J79A 4MM1A 1QR7A 1B3VA 1S2UA 1JVNA 1US0A 1PCKA 1MYRA 1TREA 3KDOA 1ZQ5A 1L9WA 3VD5A 3I7RA 1EF3A 5AC8A 3THAA 4DRSA 5EMMA 2PSNA 4CD5A 4AX7A 3TYBA 1F8MA 3DGRA 2VX4A 4D6JA 3R25A 3U0HA 1B90A 3LXBA 1YLVA 3L5AA 2J7EA 2PBOA 2DZXA 4LY4A 1B30A 4ADUA 4M1BA 4LAZA 3NDZA 4C91A 4JFUA 4B5TA 4QQUA 4IFKA 2A3EA 2D69A 4ZO8A 3GW3A 4FLOA 2DZPA 4NAFA 1XIGA 5EGRA 3DFSA 3G1AA 1PL9A 3S5OA 1BXBA 4MZ8A 3FNDA 1ZCCA 1QPNA 3UP8A 1KBBA 4F0RA 2Z25A 4OT7A 5MF5A 1C7TA 1O12A 1DORA 7TAAA 1F7BA 3E0VA 1P7TB 4M29A 1A80A 4Z2KA 3O6AA 3WUGA 2WC7A 3WD4A 4TVUA 5LIXX 1KTNA 4AD2A 3KP0A 1PJ9A 4NZFA 3B4UA 1IEQA 3D6NA 2ZUUA 3DC0A 4BF9A 3PPCA 4DAFA 2JK2A 1MQRA 4QDMA 3U7BA 3G1RA 1P0BA 3IJLA 3ZFHA 3OYZA 1HTIA 5D2YA 1E40A 1XL9A 3HG5A 4L4MA 1LQ2A 2GOKA 3S1WA 1QI5A 4QCEA 3C3NA 4JEJA 3RPMA 3QV7A 2H9AA 3EWDA 3LHTA 4Q4QA 1FCBA 5HBFA 4ATDA 3HGJA 4FLSA 2FTYA 2BDQA 3CWOX 2XZ9A 3QTPA 3N1AA 1EP1A 3L12A 1OFOA 5FF0A 1O6IA 2MUCA 4ERAA 4MZYA 1XICA 4D6CA 1HXJA 4Y2WA 5E93A 3RNDA 5CZJA 3CHFA 4GKLA 4O53A 4PULA 1R3SA 3CO8A 1WZKA 1XSJA 2HNHA 1GCYA 3OA3A 4U5KA 1I45A 2J24A 3S5ZA 3OP2A 1EP2A 3VNKA 3GNOA 3MYPA 1P5BA 2AGKA 1OGBA 2ESCA 2PF0A 4CN6A 1BYBA 4EWJA 5C2XA 1H7RA 1KFKA 3ME3A 3BQ6A 1K8YA 5DEZA 1HP4A 1M03A 4CN1A 2EG7A 4XZ9A 3OVPA 2Y7DA 2WYSA 4LRTA 4JL2A 1XYBA 2ZZ5A 3TFCA 2RDWA 1E4LA 1GOWA 2XN1A 2V81A 9CGTA 1XIBA 4S1FA 3QPEA 1W5OA 4XAFA 1VH7A 4US5D 1KCKA 1EP3A 3AHTA 3G77A 4ADTA 2ZE0A 1T0OA 1GKRA 4LPCA 3TKFA 1Y7VA 3ARQA 1IF2A 4AVNA 1CXFA 4S3DA 4MDOA 4KWOA 2YKKA 3WQGA 3BW3A 4JTEA 1GT8A 4QG8A 4NT0A 5BWFA 1XC4A 1GPWA 3CPGA 1MW3A 2CKRA 2PWFA 1OJXA 3HU7A 4X2RA 3VI2A 3PR2A 2VC5A 3RLGA 4P8VA 3VNZA 3M0MA 5HQEA 4MYAA 2I7GA 1S5TA 2WAGA 3MMUA 4WQ6A 3VGDA 2A3BA 3MI3A 1DJIA 1A5LC 4B9ZA 3CAQA 3I4KA 4ZB5A 2QDEA 3ZJ7A 3OZOA 1XYFA 3GFYA 3QQ0A 4NZ5A 3FYYA 1I0DA 1FDJA 1CGVA 3EX2A 1Q63A 4V28A 2WVSA 1DHKA 5AECA 4M56A 2ZOXA 3K5XA 3I3DA 4CNOA 1SMDA 4QE1A 1X96A 4CQAA 3M41A 2FMNA 1XLMA 1FP9A 3O7UA 1R6WA 2C18A 4M0XA 3W2NA 4ERGA 4XBKA 4QE4A 1OINA 1MW1A 5EU9A 1BXCA 1VKFA 4O0KA 4LBSA 1HKJA 4C1LA 2GVJA 4KCUA 2HV5A 2GSHA 3C6CA 1BTMA 2QCMA 3R8RA 2CCRA 1GZ1A 3STPA 5C8BB 3UJFA 1W9XA 5AHFA 2GWGA 1UROA 1ZP4A 1X38A 2V5BA 3SFWA 2CLEA 3EOOA 3NZQA 3TN6A 4GO9A 2XUCA 3PZGA 1DWHM 3QHOA 4LS1A 1RK6A 1IR1A 2Q3RA 1R30A 5EFDA 4Y6GA 5HMDA 1VFSA 3NQDA 3IAQA 4KCWA 1HO4A 3GXFA 2ACQA 4XD6A 3PUOA 1D3GA 1SGJA 3CL6A 3Q58A 3DI0A 3DFYA 1O5QA 3W2LA 2KAUC 1XYZA 5CZ0A 3AS1A 3JR2A 2YCLB 2YA2A 4LALA 1ZY9A 4PBFA 4A4AA 4JTKA 5HK4A 4PB5A 2BXYA 1JQXA 1P1XA 1CB2A 3VX1A 4GQRA 2Q71A 4NXSA 1V03A 2BS9A 4GBUA 2D2OA 4CGTA 1PWLA 3W6MA 2ZRUA 2PDQA 1UR4A 2CWNA 3QBUA 1MDLA 4YCPA 3LPPA 1KV8A 4YPJA 4IPNB 2WVUA 2X1SA 3GSMA 4JTJA 2BHZA 1TB3A 2ZDSA 3GY1A 2C6QA 1W0MA 5CBJA 4S3KA 3LY0A 4C6CA 1MEWA 2FH8A 4ZODA 2TPSA 4C6QA 2R91A 1A4MA 3KOYA 1VD6A 3MHUA 4LVBA 4HK5A 2GK1B 2XWEA 3OGSA 4GCXA 4Z0SA 4EIVA 2QMJA 4CD7A 3ZMRA 3WEMA 1GVYA 2FQIA 4CQBA 4QDWA 3SCWA 4CEXC 3KOZA 2ZVIA 3O16A 5CSUA 4HU8A 2QV5A 5FSEC 4B5XA 2VMFA 1NOWA 3TTOA 2CNCA 2XSAA 4HPNA 1BVWA 1Z69A 1UWTA 3KOWA 5FJTA 2QJMA 3T0TA 1JDAA 3VFLA 1SW0A 2YX0A 4JCLA 2AQOA 4L9YA 1C9DA 3L65A 3AZSA 3B0UX 4D8ZA 1HJUA 1RD5A 2BODX 4YNGA 3AHYA 3U2ZA 3GX9A 3KLLA 4U33A 1V6VA 1RY8A 1NDYA 1OIFA 3ICJA 4LAOA 4IQLA 3MUXA 1RZMA 1KFWA 1LOLA 2NQHA 3JVAA 1G4PA 4XV0A 4P7OA 1UWUA 4A8RA 2XSXA 4D9PA 3PUDA 5AZ1A 4WY0A 4ZTXA 4XQ6A 4DJFD 2DT2A 1LLWA 1E55A 2HE8A 3ZO9A 1Q3NA 1UKTA 2FVKA 3WEOA 1U22A 2DUAA 4FSAA 5C54A 4AYSA 2XZ7A 3INPA 2WB5A 5CPQA 2MNRA 3MP4A 3HJEA 3B9EA 1XH0A 1O60A 1FH7A 1TG7A 3WJWA 4ONVA 3THQA 3CQJA 3KL0A 4RZ5A 1XBZA 3WQPA 3CHEA 1UQZA 1IGWA 1CGYA 4JFWA 2XFRA 4FNPA 4ZFMA 1PYFA 1S5MA 3SAZA 1NSJA 3QC3A 5ECVA 4DO5A 3EZ4A 3ITGA 5TIMA 2CBIA 1CBGA 3E3HA 3FOKA 4AY8A 4NX5A 3LBOA 2W79A 3IIZA 2CZDA 2GDUA 4ZO7A 1DPMA 3U3HA 5IRPA 3H2CA 1RV8A 3VCRA 5KETA 4XX6A 5F4SA 3CC1A 1M1BA 2WMHA 1I9CB 3RM9A 1X97A 2J13A 4BJHA 2GUBA 3W7CA 3MA8A 2WCSA 4AY7A 1P4CA 2ZYFA 3P61A 2YCJA 4DAIA 1EDQA 5HUPA 1H7WA 1MFVA 4H9YA 3WK1A 4PN2A 1OQFA 1XI3A 1XLFA 2Z00A 1WX0A 5D2TA 3NIYA 1V8EA 5HR6A 3H4XA 2ZZ2A 4QEHA 4UIOA 2X05A 3H54A 1FHUA 3GC4A 1JZ2A 1XYAA 3HURA 3OZMA 3SJNA 2VVNA 3DX5A 1E1EA 2EG6A 3S6OA 3MBFA 2XWDA 1KRAC 2V6AA 3N25A 2NUWA 3DENA 1QBAA 4QS6A 1BWKA 4QR6A 1UIOA 4AW7A 1XYLA 2B7PA 1BG4A 3UF9A 3AU6A 1ONEA 3LQLA 4XD4A 1AZ1A 4C6NA 1PAMA 5FJPA 1ZZMA 3G0SA 2V3GA 4LV9A 3AALA 1FHVA 1JCYA 4JS3A 2QT3A 1TE6A 1EUNA 3Q94A 4CQDA 4W89A 3UG8A 5FEWA 2EG8A 4L1GA 4DF2A 3LCLA 1GG1A 2VC9A 3GNNA 4BZYA 2R1PA 8A3HA 3RK8A 4UOQA 2OO6A 4MB4A 1A3XA 3SURA 4BA0A 3V1PA 4LUSB 4HZ8A 4TOQA 2V5JA 1W1PA 4DN1A 2VCAA 4QHRA 3UWZA 2DZWA 3MTWA 3K8KA 4GE8A 1PX8A 4KRZA 4UNIA 1JIBA 3GIQA 3SY8A 5HMSA 1WCGA 3KRUA 4O19A 2V2HA 1SFSA 2NXHA 3ITVA 3P3BA 1VQTA 3H4GA 3BDKA 3W85A 1KTBA 3DEQA 4HP5A 3S5YA 5F2IA 1TR1A 3GVQA 2DIKA 3PBVA 1MNZA 3G3DA 5I0DA 4GUHA 3AHVA 2CLOA 4J3TA 4LGXA 1NWTA 4LYRA 1Y65A 1TCMA 2EO7A 3PTQA 2BFGA 3S6DA 1JL8A 3TTYA 2J9YA 4CCCA 4M6VA 1CXIA 2TODA 1XW8A 1OABA 3L67A 2NX3A 3S9IA 4M6QA 3RPTA 2GVYA 3W6YA 2J7DA 5E0CA 1RPKA 4NRRA 1R3YA 3NOYA 3H2FA 2ZE3A 4H9UA 3RPDA 5CCZA 4I5RA 1IEWA 4PMNA 3P60A 4GIRA 3KX6A 3NAVA 1HW6A 5GJMA 3VX0A 6REQB 3MWAA 4WGXA 3OZYA 2ZTJA 1TPWA 1OD8A 1YKWA 5FA5A 2ZWYA 3C0LA 3N4EA 3U4FA 3VE9A 4HPHA 1PKLA 2JE8A 3ECQA 1TPEA 5T9CE 4OZOA 3OB8A 1Y0EA 1VIZA 2UWFA 4B91A 2J9ZA 3LCFA 3M43A 4DHGA 4CD8A 4EPBC 1DQXA 1EQCA 3K8MA 3NM3A 1WDQA 2DU2A 5DCDA 3WQVA 4EPDC 1DIKA 5GVJA 3WFAA 2Y5EA 2G95A 3VU2A 2O4MA 4E5TA 1VFUA 1GK8A 4QS5A 3MUZ1 3ZVHB 3F1QA 3L2MA 3AYTA 1KFBA 2C14A 4E2VA 1FTXA 4PL1A 2ISWA 4PFMA 3OBAA 3CZ8A 1UKSA 4R85A 5D9OA 4AH7A 4MB3A 1PWMA 3HQ1A 1NJJA 4UTTA 4QRNA 4I9MA 4EPKA 4Z1AA 2QGYA 5I3HA 3LRKA 4BEUA 3N19B 3CT7A 2ZRZA 3THUA 2INEA 1TKKA 4M6UA 4IMFA 1OB0A 1LG2A 4A6GA 4HU0A 3AXXA 1LOQA 3FHQA 3VZXA 3ZQ9A 2UZ9A 3PNZA 4NNCA 4E4UA 1WE5A 2VC7A 1FCUA 4Q8NA 2R1MA 5A6BD 3NA8A 2YBVA 4B15A 3QXBA 2ONEA 2R1KA 1TVLA 3IIVA 2PCEA 2VEFA 1OIMA 3TA6A 4GMEA 3DGBA 3EMZA 1QHZA 4JTQA 3PBMA 2GPTA 1TPVA 3WLOA 1H62A 4B2DA 2WMJA 1JCLA 4A3HA 3E6EA 4OBTA 3RFAA 1HN1A 4JIIX 1E9LA 2E1DA 1CGUA 5CEWA 4W4QA 2J78A 1P48A 2OQHA 1IYXA 2XH4A 3BV7A 4JX5A 4UTHA 2Q3OA 4HSOA 2G3IA 3MUCA 4BK9A 3URNA 2GGGA 4OBRA 6ENLA 1YEYA 4GINA 2F8QA 3LPGA 4M1RA 1J0HA 1VYRA 1XR2A 4DJDC 3T4WA 5EMKA 3JZUA 3P8JA 4YCOA 1JDCA 3PZIA 1YPFA 3CUXA 2J8FA 1NWSA 4K8EA 2PWHA 1QO5A 1KM0A 2CU0A 3NQMA 1ZCOA 1JDDA 3P5YA 5A8PA 4A3UA 1M41A 1WB0A 3GIYA 5FI8A 2VXNA 1TV5A 1VCFA 2AQVA 1ECEA 4PUKA 2C1HA 1UR0A 1LT8A 4A8LA 1KRBC 3F2BA 3VNDA 1QI4A 4JQ2A 4OOUA 5FSDC 1V6TA 2ZA2A 2JKAA 1KQZA 1EDTA 1SO6A 3QV6A 2PDPA 1TVPA 1GTHA 4PODA 1MO0A 4C6IA 1XC6A 4N9CA 4PTXA 4Q8UA 5AYZA 4MOZA 1DE6A 3VYLA 1C8VA 4BHYA 3GNXA 4M80A 4IFOA 4W8AA 2QJJA 3RX4A 2NQZA 2QF7A 1PS9A 3LPOA 1H41A 4LB3A 4Z2JA 2QDDA 1Q8AA 5CPSA 3RLHA 1VHNA 3UCCA 2J4GA 4UOZA 1DJGA 1TJ1A 1N8FA 1CGTA 1ONWA 4ROPA 1G94A 3VIJA 1S1RA 3W00A 3PZ9A 1L8NA 2VYOA 5D38A 4FOUA 4TIMA 4HSNA 2PDHA 4JFSA 3WY1A 4M51A 3W7OA 1UD6A 2Y6ZA 1OT1A 5AHLA 4UQBA 1XIDA 3HQNA 1J9YA 3D5HA 1MXSA 1ZNNA 2W61A 3SGZA 3AYSA 3P6LA 1XSIA 3WSUA 2XGIA 4ZOAA 2VUYA 3QFEA 3G8RA 4GUGA 1EJRC 3S83A 3UXIA 3GH7A 2DQWA 3IJIA 2ZKMX 2DIEA 2QVNA 4WZHA 1RK5A 2ZZ4A 3KL3A 3GXNA 3GTXA 1S39A 2P8CA 3ITCA 1XINA 3ZSSA 4KWSA 1TQXA 2NLYA 1UPMB 1V5XA 2G0WA 1GOQA 1QASA 5K9DA 1EH9A 1KR1A 3HPXA 5I3IA 4DYJA 3PF3A 1V93A 1G7VA 2HEJA 1B2YA 4WHBA 1XBXA 5TF0A 5HNUA 3IGXA 3LLXA 1WBHA 4OWGA 4NNBA 2D0FA 2R1LA 2PDLA 4Q7IA 4H9MA 3WJSA 3A9BA 3R13A 4HA4A 3QMRA 4B3ZA 3LEPA 2BOGX 2V2DA 4UTMA 5FF4A 1E6ZA 3R58A 2OX1A 1AQHA 3RN6A 9RUBA 3A3WA 7REQB 1BRLA 1CX9A 1J11A 2DJLA 1TX2A 5JXQA 4PMJA 3SCNA 5AYYA 3DFOA 1VFMA 3VNYA 5JVLA 1J0JA 3BCFA 3H7UA 4GRSA 1HJXA 4JY9A 6XIAA 2ZRVA 5JBFA 2BY0A 2HMCA 4AD1A 2WM0A 3C2OA 2ZA1A 1I8JA 3DFQA 4RXFA 3UG4A 1QI2A 3B8SA 4F0KA 5I09A 2BP1A 1TA3A 1R3QA 1AVAA 4YYFA 1KFLA 2HDJA 4PMYA 3C8NA 3NQ8A 3OBEA 4HD5A 1OC7A 1UUOA 2VUNA 2DP3A 1J6OA 4AZCA 5IDZA 4IHCA 3FXGA 5A3HA 2IKIA 4UBPC 4UNLA 1WKDA 2Z1WA 3KCOA 4F9JA 5I79A 4DF1A 4GGBA 3P14A 2V0TA 3HGOA 1B3OA 3GHTA 3JS3A 2GGJA 3RITA 1XUZA 1K02A 1XDJA 3LCIA 3RCYA 3O2LA 3S1UA 1CCWB 2Y5JA 1OFEA 4RDYA 3QGAC 3WUFA 2JQXA 3VNJA 4ZR8A 1NOUA 4LANA 3ZM8A 1LM1A 2OOGA 4JDYA 3ES8A 4J35A 1JCNA 1PIIA 1IT8A 3CBWA 3B4YA 1UR9A 4DI8A 2O9RA 3WCZA 2FZBA 2H9AB 3C3UA 1JYVA 3LBMA 1XBVA 1EIBA 4AZBA 2QVHA 5BOOA 4DJEA 3BMVA 1QNSA 1QPQA 4QJ5B 1GOIA 1FKWA 2ZZ7A 3UWQA 3CO4A 4IGMA 4O1DA 1H51A 3OQ8A 1O7AA 4NZ4A 1E6RA 3VILA 3WJZA 4H7VA 3SB0A 1GVIA 3PUGA 4DWSB 2J7FA 1UMLA 2QJGA 5BXTA 2X40A 4IOTA 1Q85A 4Q4SA 1TUFA 2XIMA 1H1YA 3PN8A 3K2GA 2TAAA 2D3NA 4WJEA 5M03A 1SJBA 1TV4A 2CZEA 2VFGA 2E6AA 1H7PA 3IGSA 4QLJA 3WNLA 1CW2A 3H12A 1Y8BA 4KRUA 2O9TA 4Q22A 2VI0A 4L64A 3G1FA 1B31A 2OLSA 4L80A 3UVIA 4B9YA 3A6OA 4XK2A 4BWLC 5I03A 3CUIA 5ABTA 3GR4A 1Q2RA 2NVDA 1E6XM 2BLEA 4UNKA 3FY1A 1VBHA 3UWVA 4DZAA 1ZBWA 4EF9A 4ZOCA 5LNUA 3RAOA 5FOOA 3WQ6A 2R24A 3K13A 4KF1A 5CPLA 1W3JA 2RJHA 1QK0A 1VLWA 1VBRA 5A8MA 3R8HA 1VAHA 1IIHA 3CHVA 1WAWA 2DFAA 4RDZA 4I5XA 3D3AA 3UPBA 1E3ZA 1V7AA 1ZB5A 3G5EA 4J3SA 2E4TA 2DORA 2YR1A 4C1NA 2BV9A 4AD4A 4KFPA 4NKCA 1EC8A 3I3BA 5E0FA 3WG6A 4IICA 3AS0A 3L4UA 1DTUA 3MKCA 4HA0A 5AC6A 1LBMA 3GE7A 4MG4A 1K4GA 3N6HA 4ZO9A 4ZGYA 2X0YA 4IJRA 4FEZA 4W9TA 5DQPA 3E38A 5LA0A 3ELFA 3HBLA 3ZXWA 4IJCA 3ARTA 4IG2B 1VBUA 4QSFA 1W91A 1QDSA 4UR7A 1FCQA 1R38A 4K6AA 1FWCC 1BVNP 3B05A 4B5NA 1W56A 3ABXA 4S3EA 4K37A 4P7NA 4I5UA 4IG2A 1SW7A 2IS7A 1NELA 5FF2A 2CZFA 5HOSA 4WUIA 2XFFA 4RE0A 3CH0A 3W7NA 3W1TA 1WYIA 3AIRA 1AK5A 1Z3NA 5TNVA 1ZJIA 2G41A 1L6YA 1FWSA 3DCPA 5BU6A 2EKGA 5DCBA 5I23A 1KM3A 4L6OA 2O56A 4TX6A 4AC1X 2XM1A 4S3GA 5DMYA 1Q5MA 1UWSA 3RO6A 3LNMA 3MT1A 2DVXA 1Y5VA 3N2MA 4TMCA 2PU1A 4PFHA 4AEOA 3RYSA 3W7GA 2ZA3A 3DH7A 1GKQA 3GQYA 2F7FA 3E12A 4GI4A 1E4IA 4R9OA 2XYLA 3GTHA 3WENA 3T2PA 4B2DD 3VCNA 4M81A 4YTRA 1GVQA 2Y7EA 4H8HA 7XIMA 6ALDA 1AW2A 3GDKA 2PPGA 2HQAA 3R6IA 5HINA 2CLKA 2XH7A 2WANA 1RJPA 1BKSA 3KZSA 5JIWA 1CGWA 5A6BA 4CVWA 1R2RA 5HQLA 1QPOA 1W3KA 2ZXDA 3S2JA 1WUFA 2VDGA 2Z1XA 2WKGA 1H61A 1DIOA 4XKMA 1JAEA 2BVYA 3BAKA 1MUMA 4CQ9A 3UZYA 3AMLA 3VC5A 4U31A 3W2JA 3N12A 2IKJA 3AQUA 2VGIA 2FMOA 1UH2A 3QHNA 4O18A 5DF0A 3N2OA 2NWRA 4NJKA 4XZIA 1ZAHA 2Q01A 1NWUA 3H2MA 4AC7C 4C7FA 3LK6A 1UWQA 4GVIA 4AD5A 3NTYA 5RUBA 2E6YA 2O7SA 3IUHA 5MHBA 4FNSA 1PE1A 1VJZA 1B3ZA 2EPLX 3QZEA 3GD6A 1QWKA 1XXXA 4E38A 3HG2A 1DE5A 3IK2A 4CNSA 1Q8JA 2EXOA 1LQ0A 1HFBA 1W3TA 1WDSA 2YDRA 4DUWA 1VCVA 3A47A 2YLLA 2J47A 4US5A 1V6WA 3E5BA 1NQ6A 4G7EB 5TBOA 3UR5A 3OQEA 2PC8A 3NGJA 1XWYA 4AQLA 4WLCA 4JBRA 3KDNA 4NZJA 1UW9A 4KCTA 3RCNA 4NJIA 4XKYA 2C71A 3KBWA 1YE4A 4FNRA 4MAVA 3ARVA 3W02A 3ABZA 4DY1A 4MLJA 3W86A 2FDSA 1IEIA 4ZXLA 2EQDA 2YYTA 1HL8A 3AUJA 2OG9A 6REQA 1Y5WA 1KTCA 1SO4A 3WLSA 5FEXA 4JHOA 2TRSA 1F3TA 1OG0A 4PB4A 4CD4A 3VKJA 1C91A 1JQVA 4IP4A 4O13A 1EYEA 5K4ZA 5DT7A 3NEHA 3T42A 4H1ZA 4QAWA 4CCEA 1EEPA 2WNZA 4HN8A 5GNZA 3DXIA 2GZXA 3GTNA 4O11A 4ATWA 4D6GA 3BG3A 4DO7A 1LBFA 2QJNA 4IP5A 1CDGA 4HTBA 2WPGA 4WXZA 4JDBA 3WK3A 3R4IA 1GW1A 4JIEA 1X7FA 3G3MA 3B8IA 2PA6A 3KW3A 2W9MA 1OFAA 2ZICA 3NSNA 3LRMA 3TN3A 1W6TA 2PEVA 3GG8A 2DZUA 3KHDA 1GVFA 2HXTA 5C9WA 1D3HA 4IP7A 3WD2A 5HJLA 5F7UA 3D46A 2VELA 1SR0A 3QLLA 5KTLA 3S2LA 3W76A 3DERA 4IQJA 1XYCA 4RJEA 3N18A 3W7QA 4CNUA 1UZHA 1S5WA 2GGEA 2JBMA 2A85A 1LP6A 3G1VA 5A94A 1KRMA 4PCPA 2QHAA 3II1A 3TAOA 1WNOA 3ZJ8A 3H2EA 3WLIA 4HOZA 1AQ0A 2J77A 3WNPA 4HT3A 3L21A 4GISA 5REQA 2QZRA 4IGHA 3HA1A 4O10A 2VQTA 2XGZA 2WSPA 3VABA 3BANA 2HS6A 4PCSA 1EKOA 1NIUA 4K7YA 2E8ZA 1KBIA 3TC7A 3UGVA 5BXSA 4E4FA 1M5WA 1FWGC 3ZLFA 2PDWA 5AC5A 1Q6RA 2J8GA 4Z17A 1CLVA 2VZOA 1VIWA 5KSWA 3L23A 2XJ7A 3FKKA 4IIHA 4C90A 1M68A 1BXNA 3LG3A 1TV3A 3IACA 4A3QA 4X60A 3LOTA 4ZQPA 4FB7A 3R11A 2O55A 3BMWA 3UWUA 1EOKA 1C9WA 4QQ3A 4R34A 4IZGA 5FJJA 1HX0A 2UY2A 4JGDA 6XIMA 1B4EA 5HANA 5XIAA 4AIUA 3NM1A 3LTYA 1Q6DA 4AXNA 3LCHA 3EX4A 3NOEA 3NJ3A 5GNXA 4XZHA 2BZNA 4TVDA 2OWCA 4WXYA 1PV8A 2RAGA 2DPEA 1PTGA 3M0LA 4MYXA 2ALDA 1NDWA 1J18A 3TYZA 4RPPA 2C8NA 3C2RA 2RDXA 2Z24A 4PR4A 4WGHA 4G7FA 1EEXA 1RD6A 2EHHA 4XO7A 3WLRA 2GJRA 2NVCA 4ACZB 1JPKA 5D02A 1ZFJA 4V1YA 1A5MC 2C79A 4LF1A 3PTMA 2ZX7A 3WLQA 2E5CA 2VZUA 3H21A 1EJ7L 4E2BA 2ZADA 3AFBA 3Q67A 2PDUA 4HZMA 1EGZA 3PZQA 3PS7A 2ZBTA 2IMRA 3KL5A 3VPLA 1FWRA 1J8VA 3ALFA 4GIEA 3T55A 4KETA 5D30A 3GNDA 1P0DA 2DZAA 2P88A 2W6RA 4LAUA 3UPWA 2X16A 2BVTA 2PLKA 3SUWA 3SQSA 1RAKA 3MC5A 3GTIA 3VD7A 4JTRA 3NQVA 4JQ3A 1YXYA 3OZPA 1FVPA 2H90A 4H6EA 2YBUA 2WBKA 4KH2A 1WKEA 4K8HA 3UZWA 1J0ZA 1F4HA 4AZ6A 2W66A 5DMNA 3PNUA 4PTMA 1A5BA 1R9XA 3C2VA 1TWSA 2V38A 5DFAA 4UQDA 2JKEA 2QUNA 3F5LA 2QIWA 4QJ4B 4LY8A 2Y62A 1E0XA 3V7PA 4HJFA 2WKLA 1RH9A 2Y8UA 2X1IA 2QAFA 1VFHA 4QE5A 2Y88A 5CC3A 2WK2A 5D03A 3ABSA 3PPGA 1DQUA 1V79A 1VPQA 4Q7BA 2J9XA 4JNMA 1W9UA 1XPYA 3GUGA 1E5NA 4LUYA 1UBSA 1XD1A 3TTSA 1FWWA 3UESA 1GOKA 4C6OA 3VOIA 1HVQA 1BHGA 5H8UA 3YPIA 1Z48A 4XAGA 4PL2A 3UFYA 4IQDA 1SVDA 1JXKA 2YDSA 1WZMA 4NZ3A 4AEFA 1BSLA 3W72A 3MV01 2Y63A 4XKYB 1I2PA 5CZTA 4IUOA 1TJ2A 4GH1A 3MW7A 3MO4A 3S3GA 5TAOA 3CIWA 3CUHA 1UJPA 1WDWA 5CZSA 2PDMA 2ZUMA 2EPKX 1XCWA 2DT3A 1JCTA 3WELA 3E02A 3WH5A 2OSYA 1N8WA 3E2QA 3LD5A 2BWGA 4NX0A 1X8FA 3W28A 2GK1A 1VJIA 2VENA 2OODA 4GQ0A 1PHWA 4JHMA 4CUCA 3EX3A 1ISWA 3GO2A 3LHUA 1PIGA 1BF6A 1FA2A 1B0IA 1TWZA 1YPXA 4B92A 1S2WA 3KBVA 1T99A 2NSOA 4GIAA 1UPPA 4F79A 5DXYA 1V0KA 4Y8EA 1H7OA 8CGTA 2BNJA 1V6YA 2WQPA 3R43A 4DBUA 4C5ZA 5CBIA 3CPUA 2Y85A 3S9ZA 3TR9A 2WMIA 2I1OA 4OGZA 3TIMA 3Q2DA 1UR8A 1G67A 1EO5A 3O0FA 1E4MM 2DZTA 1JF6A 4UC5A 4S23A 2VFFA 3BSMA 4GUFA 2POTA 3DUGA 3U5YA 2WJFA 3IARA 3VIMA 3TROA 4Y9OA 3PVFA 1AH0A 4JZ5A 1CIUA 3W53A 4DWSD 2UBPC 3CZJA 2O7QA 5JBEA 5EMLA 4FI4A 3QMTA 3AZRA 3W1UA 1FY6A 5C9UA 4AHOA 2TMDA 1U83A 2C13A 3N34A 1QW7A 1C8QA 1K3UA 4BF5A 3DYPA 1TMQA 2PD5A 5SWUA 2D2GA 4FP1A 2PDIA 1GJPA 1RQEA 1A5SA 6PTDA 2WJDA 8TIMA 4MTVA 7ENLA 2B7NA 1OGGA 1Q45A 1UP2A 1F4AA 4HJWA 1E72M 3O3RA 3M47A 5HNNA 2X1UA 1ICPA 1JRBA 1RQBA 4GH3A 2CXEA 3QZAA 4QFUA 4PTWA 2OZ0A 1E6PA 3PANA 4JQAA 4IJBA 4XISA 3KWSA 3BMXA 4FK9A 3GDRA 2VKZG 2GUUA 1AD4A 4UFJA 5CXPA 1V02A 3CTTA 2VURA 4AX6A 1OYCA 4WJXA 1VENA 4XTDA 3SUSA 4D1IA 1KM5A 2ZUTA 3B40A 4JFTA 1KM1A 4DF0A 3E9AA 3AXIA 1V08A 1QPRA 5BZAA 3GBEA 4IIBA 2VEKA 3TQPA 2Y8KA 1F05A 2BSLA 1WOBA 2E77A 2ZVRA 4LVGA 1EJVC 3LGGA 2OSWA 3NFUA 1QATA 1D2KA 2AL2B 4MPKA 2BOFX 2B7QA 3NVDA 3QEZA 1XH2A 1AW1A 3MCNA 3GXPA 1C8XA 2NX9A 1LG1A 4L6HA 3ID7A 3DU0A 4JQ4A 2VCBA 3U5UA 1E6NA 2IUZA 3FGCA 1FUYA 4DJFA 3O15A 3ITLA 4P7LA 4XG1A 4P5UA 2INZA 4H6KA 3CUFA 4Q3MA 1JPIA 1TZ7A 4FR6A 4L9ZA 4P8UA 2CLFA 1S2CA 2RUSA 1CTNA 3DECA 4ZSUA 4FZIA 1Q4WA 1GPFA 4KEUA 4N0RA 4WEVX 3V5OA 2BGSA 3BQ5A 2I57A 2R9RA 1JDFA 3DC8A 1IR2A 5EMJA 5HXMA 5C9RA 4Y9PA 1KCXA 3M6YA 1BQGA 4C7DA 4RDWA 4LEFA 1VP5A 3R0DA 2O92A 1AJZA 3CLMA 2P53A 1UHVA 2A4AA 2Y24A 4NUWA 1NAL1 1A53A 4OOZA 1ZHAA 1BTCA 3TYUA 3IJDA 3RM4A 1EBGA 2PP1A 5CJ5A 4GX9A 2HSAA 4HU3A 4XAZA 4UXDA 3WBXA 3PSWA 3TSDA 1UD8A 3FX4A 1YIXA 4LW7A 1PZ3A 2EAWA 4W87A 1F73A 3F4WA 4Q4RA 2YFNA 4ML4A 1ICQA 1XLKA 2G4FA 8XIAA 5M2FX 1U1UA 1J01A 4NASA 2J7HA 4TQTA 1TTPA 1TMHA 4MZ1A 3OGVA 3VMPA 3U57A 2IPFA 3MS8A 3CZGA 4AG0A 4DUXA 3CB3A 4H8VA 3UJEA 3K4AA 4RNIA 4O57A 5CGQA 3LU2A 1Q4NX 3EX6A 2H3DA 4UUIA 1RLCL 5FL0A 4J3UA 3N6JA 2X0HA 4KFNA 2JF7A 3UXLA 3SR7A 2X41A 2VEGA 1YTEA 3LS9A 4FHAA 1X98A 4N6FA 4LAMA 1LWIA 3W7MA 1MEHA 3UR2A 2VC6A 3VIGA 1UG6A 3N9KA 4YJ5A 5CZKA 1XKJA 3P84A 1ME8A 4A35A 4DPPA 2HZGA 4IQEA 1TTIA 4LSBA 1A5CA 3TWBA 4PMUA 3A24A 3SQMA 2PMQA 2RJGA 3U8GA 2OR2A 1XIIA 3VDHA 3O6CA 1H1ZA 4D72A 4OU1A 5L9FA 1DL3A 2Q02A 4DNMA 2OEMA 4MSSA 4N4QA 3NL3A 1LL7A 1JULA 1Z8AA 3FAWA 2QCHA 4E4PA 3WLMA 1J4EA 4CKQA 2V69A 1MWOA 1UUMA 4JN7A 1HJQA 4GYKA 2JALA 4PUJA 2HROA 5EA9A 1ALDA 4UFKA 4R9XA 4JYDA 2QR6A 1EX5A 2GOUA 4Y8FA 3R89A 1YDVA 4XIAA 2GJXB 1KRCC 4DXVA 4S3BA 4HK6A 4ORMA 1OX6A 3VM5A 3DKJA 3N2BA 4H01A 2J7GA 4KRTA 1YDYA 1QT1A 2FPVA 3SSJA 2Q8XA 5FKYA 3SIMA 3IJ7A 3TWAA 1EZWA 1JGMA 5MKGB 2GQ3A 2QLYA 4MWAC 1RPXA 3COTA 3FS2A 3T7VA 3VMOA 1AMYA