1GJPA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 4-oxosebacic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Two Diacid Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
total genus 115
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gjpA00
1A5AA 2TRSA 1T96A 1OG0A 4PL1A 6TIMA 3P62A 4JIPA 3MHGA 1KTBA 3MI2A 1VYRA 3P8JA 2ZRZA 1TQXA 3P7YA 1G7VA 4A21A 1TJPA 5K9XA 4IPIA 1TPFA 4HNVA 4LVFA 4QJ1A 3A9IA 3W1MA 2V30A 1H61A 2RDWA 3DXIA 1OFDA 3EX6A 3B0PA 2E5BA 2A4AA 2X30A 2B0MA 4K7YA 4HNUA 4GWEA 2ABAA 1LORA 3P60A 4OWGA 3E9AA 2QCFA 1Q3NA 5AC8A 8TIMA 3DBPA 4WOQA 4I9AA 1YPIA 4O1BA 2C18A 4CNPA 4UTHA 2OZ0A 1JCXA 4CCCA 5A5WA 4Y8FA 1BWLA 3S6DA 1OFQA 3I7QA 4N9BA 5CPOA 4FB7A 3OG3A 4ZVJA 3W71A 3NR0A 1O4UA 3N3MA 2X1SA 4OV9A 2EGZA 3TJXA 4RJEA 3G3DA 3CWOX 3IV3A 2ATSA 5EA9A 3N9RA 2BLEA 4C1LA 2A6NA 3DFSA 1OYAA 1KTCA 1TPEA 3DFNA 2PC4A 3IVUA 4X9SA 2Y88A 1FCVA 2QJHA 4A22A 1G69A 2GVJA 2NXHA 2Z1BA 4UTUA 3HQ1A 5IM51 1GTHA 1L2UA 4CNOA 4RLIA 2A6LA 3WJSA 2DZWA 3O6YX 1RQEA 4P61A 3VCRA 3AO0A 1NF7A 4JTTA 4UTMA 2A0NA 2Y85A 3N9SA 1HFBA 3PB2A 5HUPA 5DLCA 1W3NA 3M5YA 4IGHA 3BG3A 1I45A 1F6PA 4ORIA 2YPIA 4QISA 4ZL1A 1EX5A 4JTGA 1YYAA 3FKKA 3DU0A 3LHUA 1RR2A 3LLDA 1TQJA 4NU7A 2CZEA 3STCA 4IUOA 1L6WA 3M9YA 1Z41A 5T26A 3CU2A 3HG5A 2QCDB 1PVNA 4N2YA 1HO1A 4JGDA 5BOOA 1KFKA 4A29A 1K8XA 4O13A 4YCPA 3FJLA 4N6FA 1SO5A 4JNMA 4AVFA 1R2RA 2DJXA 1SO4A 5C2XA 2ZA1A 3PS7A 5LNWA 1UB3A 1S5WA 3CHVA 1LOSA 1DQWA 3CIWA 4NJGA 3L5AA 1PHQA 3PUEA 1JCMP 1I2QA 2X2GA 3UY8A 1G4TA 2BSLA 2V5BA 4P2VA 3BGGA 2TMDA 2CW6A 3Q94A 2Q8LA 3L5MA 4LC8A 3ZWSA 4NT0A 4LS1A 4CLMA 3MHUA 4TMCA 1QMLA 4UNLA 2B7PA 3W07A 4O50A 4GUGA 3PUOA 3W70A 3W7EA 1XKYA 4JEQA 4EF9A 3A24A 3NXFA 4N6EA 3VI2A 2YW3A 3STFA 1SSDA 5K4ZA 4EF8A 1Q6OA 3S8HA 3YPIA 1K7XA 3U2OA 1TRIA 2QCNA 4NNAA 2Y61A 1TPC1 2W6RA 3CT7A 4NZFA 5KTLA 1NFBA 3DFPA 2VFFA 1JRCA 4JYEA 2YSWA 3E0IA 4RXFA 4X3ZA 3W76A 1QAPA 4JTFA 3LTSA 5EPDA 3EXTA 2I1OA 3STGA 3WJZA 3W74A 3PR2A 1FX6A 4PH6A 3C0JA 3MJYA 2GPTA 4FXSA 4M19A 5E1QA 4BK9A 3UWYA 3G1DA 3Q58A 1XM3A 4CQAA 3GVGA 5DBUA 3W72A 1OJXA 2OT0A 3GYEA 3NOEA 3DKJA 3W7MA 1JQVA 4D2JA 2YR1A 3LBCA 1TO3A 3T40A 3LI0A 3KVMA 2WV8A 4WY0A 2DP3A 3HIJA 4UFKA 3R5EA 3B04A 1AW1A 3C2VA 4O53A 4NNBA 2QKFA 4ALDA 2QUUA 1I2OA 2WNNA 2ZZ3A 4O57A 5G2HA 3ZR4A 3R12A 2GQAA 3O63A 3HO8A 1B9BA 2GJNA 1IXNA 1GPWA 5D33A 4NJKA 3UZJA 3IIZA 4ADTA 3BLIA 4FIRA 1YPFA 5F2IA 1JR1A 3O07A 3BV4A 4MLJA 3NQ8A 2ZRUA 1N7KA 2X1UA 5J5DA 3BW3A 5CZ0A 5BMXA 2JBMA 2PRHA 3PWAA 2YW4A 4NXSA 3C2RA 4S2BA 3NL2A 4IWWA 5CSSA 4KWVA 4UMCA 3SFKA 1A53A 2ISWA 1QOQA 3KVKA 1RPXA 2ZRWA 1QWGA 5G5IA 5F4SA 2CLEA 3LCWA 5K2ZA 5CG7A 4ZZ9A 1AL8A 3BG5A 1YTDA 3DHDA 3H55A 1FCBA 4JTUA 2DZUA 1W56A 4JIQA 3GKAA 1TTIA 1KBJA 4AF0A 3HJZA 3P80A 3WJWA 4ZQPA 3TA6A 4QITA 5H2ZA 4IX0A 3A21A 2OMAA 3TXVA 3GDRA 4GBUA 1EWEA 4IXXA 4JS3A 1ZAIA 2QJIA 1S5VA 1A5BA 1FY6A 3KFTA 1C29A 2J27A 1TPVA 3GK0A 1FQ0A 3QW4B 4BI6A 4FEZA 5CZSA 5MHBA 1HL2A 3G1HA 4K38A 1HO4A 4RX0A 3JR2A 1KFEA 1JJKA 2VFDA 1SW3A 3F4WA 3PSWA 3G24A 3LXAA 5K7JA 3L2IA 1ZNNA 4MYXA 3SJ3A 1SW0A 3EWUA 1GVFA 1YLVA 1F73A 2E09A 3TR2A 3L21A 4LVBA 1MSSA 4LVDA 4WY0B 1OK6A 5G2WA 4JTKA 1F6KA 1C9DA 1SZEA 3H54A 3TC7A 2PRMA 3NQGA 3NQVA 5CGQA 2CZFA 3GXPA 1M5WA 2YYTA 1ICQA 3N14A 4UFIA 5G4WA 1CW2A 3PAJA 1KFBA 4RK8A 4YWIA 4K7VA 5F2GA 3WK3A 4Z1DA 3DH7A 4HN4A 2VKZG 2C6QA 1XDMA 2DZVA 1AW5A 4JN6A 4JTHA 4XBKA 3SI9A 1ML1A 1H62A 1G6CA 1EP3A 2QCGA 4JD4A 3O05A 4NXKA 1VYSX 1VGAA 3QC3A 2ZZ2A 1QCWA 3PBVA 3FA5A 5HR6A 5C5YA 2C16A 2VFHA 3C61A 3GDKA 2OCZA 5EBUA 3P67A 4O19A 3T4CA 3IGSA 1X6UA 2A2IA 5CPMA 3GXTA 1XCFA 4I7VA 4CNNA 4FNQA 1F7BA 4WXZA 5K4XA 4GRSA 3RLUA 4KFOA 5D02A 2DZTA 4MY8A 4ZQOA 3OIXA 2VXNA 3KRUA 1QPRA 4DPQA 4I7WA 1ZY9A 3L67A 1J5TA 3QYQA 4ONVA 3TIMA 4HPJA 4DF0A 5BMWA 2NXGA 3LHTA 3QM3A 1ME7A 1JCJA 3KOFA 1OFRA 3BK0A 1FBAA 3QMSA 4RZ5A 1R2TA 4DXVA 4N4QA 4NJHA 1K02A 5F4XA 2Y70A 2WSQA 5LNUA 3A22A 5AHFA 3OVPA 1XBXA 3INPA 3MWAA 1P4CA 4XUGA 3BO9A 3CEPA 3UD6A 4G1KA 4MJZA 1A5CA 3MI6A 2CLHA 2TSYA 4IXHA 1VLIA 4RKAA 4MZ8A 1CX9A 1VYPX 1WOBA 1THFD 3VKJA 5H91A 1O5KA 3N73A 1KBIA 1FWNA 1KLYA 3OBKA 4CQ8A 1IIGA 1ZENA 2FB2A 1TTJA 3TFCA 1VPXA 1ICSA 3RNDA 2Y62A 3GIYA 1J2WA 3TAKA 1MO0A 3KRSA 2AAMA 4A2RA 4PEKA 3W1AA 1WV2A 2EF9A 1H63A 5CKSA 1YTEA 5G4EA 4Q4KA 4BI7A 2CZDA 2E5DA 3DAQA 4FNTA 1FWWA 3UWWA 1E51A 1S3HA 3G0SA 2B7QA 3G8EA 4Z1CA 3EWBX 3UWVA 5I3IA 1R47A 2FFCA 3OHIA 4K37A 2JGQA 1Q6QA 2CLKA 4DPPA 4OT7A 2FDSA 1VR6A 5I3HA 3UYCA 1KFJA 4NX5A 1UASA 1GVOA 3CIXA 3PBWA 2J9YA 1IGSA 3G0UA 3R8RA 3EKLA 4TR9A 2QJGA 3TROA 1HG3A 2ZZ4A 1SW7A 1JCLA 3N19B 4ZQNA 4TIMA 3LCLA 3LHZA 2C19A 1L6YA 3VFLA 5ABTA 2ZFAA 4RCXA 4AAJA 1GVRA 2WSYA 4DO4A 1PE1A 3N2MA 5D2TA 1RVGA 1H7PA 1FWTA 4O0ZA 1DORA 4EWND 3NA8A 4IX2A 2YYUA 1O60A 4LWWA 2RDUA 3QH2A 3HPSA 3F03K 2PURA 3DHFA 4BF9A 2QCDA 4MY9A 3DI1A 3W7CA 1A50A 4N4PA 1VRDA 2BXVA 2XN0A 4FX7A 3M41A 3QSTA 3TC6A 5TBOA 3VE7A 1K03A 3W2UA 1B4EA 2CFFA 2NV2A 4AB4A 1C8VA 4GFSA 3TSMA 2H8XA 4UNKA 5A8GA 5KSWA 2RH9A 3THQA 3BG9A 4H3DA 1DQXA 2QEZA 3PF3A 4IMCA 4LV4A 4UMBA 3C6CA 1W31A 3ATZA 2PCQA 2ZA2A 3IGXA 4MFDA 3MBFA 1PCKA 4WY0F 2NX1A 5G1YA 2BX7A 3NPWA 3GX9A 1WOAA 1HUVA 5D04C 3HGJA 4UMAA 4O54A 4O52A 3KXQA 4UTKA 2FTPA 1QDSA 3LDVA 1IXOA 5D2WA 3NG3A 1KV5A 1TRDA 1UUOA 5C54A 2HMCA 2ZZ5A 3C2OA 3L0KA 1MXSA 5DY2A 3HMJG 1J4EA 3DFOA 3M5ZA 1YXDA 3NQCA 4MIMA 4N9DA 2F7FA 3TSDA 2P0OA 3TNOA 2NV1A 1FWSA 1D3HA 3M5XA 3GAKA 3TU9A 1EB3A 1W1ZA 1LROA 3FLUA 3TCEA 2ZRXA 1LRQA 4BWLA 3W7IA 4QSHA 3GDMA 4E2DA 3ATYA 2FJKA 5D38A 3GDLA 1XBYA 5AYYA 4AHPA 1KTNA 5EL1A 3PY2A 3W1XA 3QSRA 1R30A 2E68A 5HWJA 2DZPA 4R33A 3D0CA 2ABBA 5DY3A 4AWSA 3HGSA 2A21A 3LHWA 3BW2A 3LHVA 4AHQA 1BEUA 5KZMA 3GXNA 3I6RA 3NPVA 3FFSA 3VE9A 2JK2A 2QR6A 3M6YA 3B06A 3ZFHA 3GB6A 3W3OA 3TSBA 4XKYB 3HBLA 3E12A 1P1XA 4JYFA 5LNRA 1X1ZA 1M7PA 3NEVA 4UTJA 2YCEA 3GKFA 5AC6A 3W7NA 1KM3A 1H7XA 2R8WA 3RLVA 3HGOA 2NZLA 1GJPA 4K8HA 1RQHA 4UFJA 4LVAA 1MZHA 2LLEA 3SGUA 5LHFA 4UTLA 2Y7DA 3P81A 1D9EA 4LVGA 3LCIA 1KLZA 3O6CA 3ZS4A 3NQFA 4UTIA 1VC4A 3CEUA 5EMUA 1Z48A 4QQ3A 2PRLA 4S1FA 3TDFA 4CCDA 3EB2A 1YDNA 1F74A 4JTLA 7TIMA 3LHYA 3BVJA 2G5WA 3UPWA 2NUYA 3HOJA 1KA9F 3PB0A 1W3TA 4U4MA 4O1AA 5FF4A 1FCQA 4LRTA 3PBUA 1XC4A 3EWYA 2VFEA 5FF0A 2O7QA 1I2NA 1VH7A 2H8ZA 2CLFA 3K30A 2V9DA 1YADA 2Y6ZA 4ADSA 4LUJA 3GAYA 1F2JA 1JRBA 3CC1A 4IMGA 3TXZA 5KZEA 4FXRA 2E6FA 3W7PA 2V8ZA 3ABRA 3DZ1A 5AFDA 4BR1A 3G1AA 4N9EA 4I7UA 5IBXA 1W37A 1WDWA 2BWGA 3W87A 3I7SA 4QAIA 1D3GA 3BLEA 4CQ9A 2VENA 3TE9A 2CLLA 3TV8A 2WSRA 2G96A 5HMSA 2C3ZA 4C1KA 5FEZA 4QNEA 4HT3A 2CZ5A 4R34A 3NVTA 2DJLA 2C0AA 3S1XA 3EXRA 5DN1A 1TTQA 3T55A 3G1SA 3NL3A 4S2CA 3KAOA 3W7RA 2FPVA 2Y63A 3G1XA 4XTDA 3VNDA 5KMYA 3EX4A 1PV8A 3EWZA 3QFEA 1TSIA 4MVAA 4MY1A 4B5NA 4GUIA 3WFAA 2HSAA 4HKPA 4E2BA 2VFIA 1T0OA 2VOMA 4YLWA 3ZWTA 3HF3A 2YZRA 2J88A 2YXGA 5LNVA 2NWSA 3SGZA 3PG9A 4XZ9A 3U6WA 1B57A 5LZLA 3RF9A 3S5YA 3NQ2A 1F5ZA 1UBSA 5FEXA 1NAL1 3UXAA 5AYXA 1M7OA 2ZCGA 2HS8A 3LTPA 1I8JA 4NUWA 1ONRA 3TK7A 3TW6A 4MPQA 5I3GA 3LRLA 4UTWA 3TFXA 1TV8A 4IOTA 4LC6A 2WOQA 3T78A 1Z42A 3QZEA 3BPWA 3LX9A 1ICPA 5BRBA 2G95A 4JICA 1O95A 1H1YA 1YXYA 3EX2A 2BTMA 3RMJA 5C6MA 2HS6A 1Y0EA 4NQ1A 2ZZ1A 2JKAA 1TCDA 1OK4A 2H90A 2Z6IA 1GTEA 1LRNA 3C3NA 4LUIA 5EYWA 1FDZA 2H6RA 4O14A 4TX9A 2A7NA 4JX6A 4FIQA 3TQVA 5GVJA 1XFBA 4M7TA 2ALDA 1YXCA 1LOLA 4MFEA 2QAPA 1X7FA 2OJPA 5TIMA 4K39A 3MP3A 1L9WA 3QMTA 3MP4A 5AHIA 1I2RA 3USBA 5DBTA 3HGRA 4FNRA 3LV6A 4Q33A 3NQEA 1FDJA 1JQXA 1B3OA 5D09A 3U8GA 2GVLA 4KFNA 2WNQA 4HPXA 1XI3A 3UWUA 1KV8A 4YCOA 4EIVA 3NAVA 4HNTA 2QCCA 1IF2A 4WXYA 4ZQCA 5AHLA 1DJNA 3O1NA 1SR9A 2AQWA 2WKJA 3OVQA 5HR7A 2A7RA 4DQWA 3GR8A 3P5ZA 1VCVA 3P84A 1TPWA 2FPTA 1QO2A 1ZAJA 4UC5A 4WQ6A 2V0TA 3N2XA 1GEQA 4E0CA 2NWRA 3LCHA 4TU1A 3W73A 4U28A 1P0KA 4HSOA 2GVGA 2YDAA 1P5BA 1KW1A 1QPQA 1H5YA 2YFOA 5HINA 2CLMA 1AW2A 2J9ZA 4JDYA 3S1VA 3S1UA 2H3BA 4AWUA 3C56A 5HULA 2J24A 5EY5A 4LU0A 4WZHA 2OT1A 1TPUA 3LTYA 4K8EA 5BNKA 1B4KA 3O16A 2ZZ6A 4ML9A 2JKPA 3STEA 2I9EA 2Q3RA 4LY8A 4UIOA 4WOZA 3V1PA 3R13A 5I3KA 1ADOA 2X1RA 4MKNA 4UR8A 3CLMA 4MZYA 1PCWA 1GVSA 4DF2A 4XQ6A 4ZQMA 3LRKA 5L6UA 5D30A 4FNUA 1LOQA 1DOSA 4O1CA 2NLIA 1GT8A 1BKSA 4LS2A 4OBTA 4AMAA 1O5XA 3RU6A 3SIZA 3CB8A 2Z2UA 2J6XA 1V7YA 3SR7A 1FDYA 2R14A 4Z0JA 3HB9A 4H4IA 2EKCA 4Y90A 3IVSA 1OFAA 3M0ZA 3UNDA 2OX1A 3S5ZA 1N55A 3FEMA 2A85A 3ABOA 3WJYA 3O15A 2WO5A 1EEPA 4GE8A 2XFWA 4N9CA 4AH7A 3C4UA 4IQLA 3G1VA 5D2VA 1LYXA 1SSGA 4MLRA 3FIGA 3ABSA 1SUXA 2FIQA 5AHMA 2Q8ZA 2GQ9A 3LI1A 3W7LA 3ABQA 3L0GA 3SSJA 3MP5A 1JUEA 3LXBA 3W2LA 4GC4A 1UCWA 4O12A 3EEGA 5F1UA 1ZALA 3G1YA 1OX4B 1Q6LA 3TAOA 2JKEA 3NL6A 2QCHA 2QCLA 3UWZA 1LCOA 3GR7A 1K7FA 1TPH1 3JRKA 4RXGA 1EP2A 2X1TA 3LBMA 1TV7A 3OA3A 2XN2A 4O8RA 1WA3A 3IIVA 2QAFA 3CM4A 4XTIA 3HPZA 2VEIA 2E5CA 1XUZA 1OX5A 1WQ5A 4QIUA 1FXPA 1YDVA 2ZRVA 3L66A 3IVTA 5KITA 1WYIA 1GOXA 3EKZA 1SO6A 1JCNA 3Q2DA 3QJAA 4CCEA 1R2SA 3W7HA 3FKRA 1OF6A 3MBDA 1NF0A 2FPYA 1PL9A 4DELA 2W0UA 2ISSA 5K9DA 4PCFA 4WUIA 2DORA 1MEHA 2YFNA 4ZMGA 1IIHA 4PODA 3B0VC 4M6QA 4UR7A 2A5HA 1TMHA 2ISVA 1QPNA 5LHEA 2DZSA 1NEYA 2EHHA 1M6JA 3S0CA 1RV8A 1H7WA 4PA8A 3S1WA 2HTMA 1QR7A 3GNDA 4K6AA 4JDBA 2D73A 4LT9A 3QPZA 1X8FA 1XDLA 1TIMA 1TPB1 2EPHA 3E96A 6ALDA 1W5PA 1GG1A 4XKYA 1VZWA 4KKXA 5F1VA 1DV7A 1FWRA 1LBFA 5LGZA 2WPBA 4Y96A 4IJBA 1LRTA 5FI8A 2ZDRA 4JTSA 3S42A 3A5FA 4R53A 4JTEA 2R91A 1QO5A 3LERA 2VELA 3W9ZA 5LNSA 5E93A 4GXMA 4PTNA 4LS0A 3W7QA 5CPNA 2ZYFA 1KM1A 3LV5A 4MUZA 4O17A 2QCMA 5DXYA 2QCEA 5KINA 3QRHA 3L5LA 3WK1A 1QPOA 1IXPA 1JULA 1KM4A 3SY5A 4DF1A 1G67A 5G1TA 3A23A 3W1PA 4HSNA 4LRSA 1GWJA 1NSJA 3LXCA 3NZRA 4IMFA 1ALDA 3F4NA 1LLZA 3I65A 4FHAA 3CWNA 4BWLC 4LNYA 3W7DA 2RHGA 3DENA 3V75A 3NQ7A 4NNCA 4UFMA 4XBSA 4HIBA 3PBYA 4RR4A 5TQLA 1A5SA 5EKYA 5HWNA 3JS3A 4NJIA 1LBMA 3T7VA 1PS9A 5FESA 5AYZA 5J5RA 2FB3A 3B0UX 5AN7A 2C15A 4ICNA 1I2PA 1AG1O 1LLWA 3CPRA 2NX3A 2V2DA 4DEFA 2V81A 1XUUA 3UY7A 3GDTA 1Q6RA 1OABA 3DFQA 1GYNA 1K7EA 1SZFA 4OV4A 5CPLA 2NX9A 2KZHA 4XWUA 3W2JA 2P1FA 2VC6A 1VHCA 3RK8A 2Z6JA 3TKFA 3ANYA 5HUOA 3FYOA 1TTPA 1L6SA 2DU2A 3MYOA 4IMEA 5U4NA 4UFLA 1SZGA 2F84A 2V2CA 3E49A 4FX6M 1O94A 1K8YA 3Q37A 3IGUA 1GZGA 1K3UA 3NM1A 4O15A 3MUXA 4HNNA 1SO3A 1OFPA 2YGYA 4MJMA 3P74A 4Z1BA 5KZDA 2G97A 2GJLA 3NL5A 1NVMA 4KFPA 3T44A 1LZOA 4JX4A 4NX0A 4M6PA 3W2MA 3QPYA 4OE7A 4EOUA 3PSVA 4ADUA 2E77A 3W6YA 3G1FA 1EIXA 3THAA 4GUJA 1VCFA 3L0NA 3M1ZA 1VQTA 1H7NA 2ZTJA 1MEWA 4L4MA 5G2IA 3F1QA 3E02A 4WJEA 1EPXA 2ATMA 4LV9A 3NPUA 1Z44A 4JTIA 2UV8G 4PFMA 4RZ4A 5SWUA 4Z0SA 2RFGA 3MO7A 5DCEA 3L65A 1TV5A 4PL2A 3UZ5A 3W2NA 5I3FA 2B7OA 2A1YA 5HQEA 2VEKA 5IBXC 3PC0A 3W1QA 1LP6A 3PVFA 4O4WA 3WK0A 2QF7A 1DJQA 5E0KA 3W7GA 1SZNA 1W5NA 1EUAA 5LKYA 5CZTA 1W54A 2O7SA 3W88A 1VJIA 3TQKA 1XBVA 5FEWA 3IRDA 3HG2A 2E6YA 4TO8A 1WBJA 1W8SA 3FOKA 4ORMA 3W7JA 5F2LA 3W1NA 4H6KA 1XL9A 3IIOA 3O06A 2XN1A 4BI5A 3M43A 1W3IA 3L9CA 1OFBA 2BZNA 1UUMA 1KFCA 4GUHA 4DO6A 1U5JA 3M47A 4M7SA 4JYDA 1OX6A 4GUFA 3AJXA 5FEPA 1SFLA 1QFEA 4M6VA 3SW6A 3UQNA 5HNRA 3DGRA 1KM0A 1ZFJA 4O0KA 3IEBA 3MYPA 4NJJA 4L4LA 4LW7A 3NM3A 2E6AA 3G22A 4UTWC 1WX0A 2C13A 1PHWA 4O11A 1HTIA 3GZ3A 3TMQA 5C55A 2QUVA 2WNZA 5LSMA 4GJ1A 3MHFA 3W75A 3S5OA 2ZBTA 2B7NA 1ZAHA 3QEZA 3S9YA 4JR5A 4UFHA 3PUDA 1EWDA 1G7UA 1H7OA 1V5XA 2QUTA 3UXDA 3NQAA 2GOUA 1JCYA 1BTMA 4X2RA 3O6DA 4A3UA 5AHNA 2YX0A 4UCGA 1VCGA 2DZXA 4EVZA 4FF7A 4UTTC 2VEPA 5D32A 3W1RA 3W7KA 4E38A 3KHJA 2C1HA 1AL7A 1W0MA 3QQ0A 3QW3A 1RZMA 2GUUA 2VFGA 5D2YA 3M44A 1WXJA 2A7PA 3W84A 3KRZA 1OFOA 5HWMA 3MW7A 5DCDA 3GLCA 1GQNA 3P61A 2I14A 1TJRA 4LTSA 4QNWA 4X22A 4Y6GA 3G8RA 4RZ6A 4YL2A 4NZJA 1H60A 3N34A 1KM6A 3W1LA 3CQ0A 2RDTA 4UTTA 3DI0A 4N02A 5K3VA 5DXXA 1YTKA 4OHQA 2V5LA 4BFAA 3EXSA 1AMKA 1FXQA 1VLWA 3LLFA 2CU0A 5AC7A 5CSRA 3LOTA 2Q3OA 3LM7A 1OVDA 1W5OA 4MZ1A 1OHLA 5AB3A 4JXCA 1G4SA 3LRMA 2Z0IA 3B05A 3G18A 1QOPA 3BGJA 2J9XA 1H51A 3G3MA 4IMDA 1H1ZA 1KM5A 4FO4A 1WAUA 3P82A 4LOCA 3TW7A 4JY9A 1SU5A 5I3JA 1ZCOA 3W7OA 1KM2A 4JY8A 2QDHA 3NPXA 1AK5A 3I7RA 1F05A 3C52A 3QF0A 4GNJA 4TMBA 5F2MA 5AHEA 4Z08A 1P0NA 5D03A 3C2EA 1ME8A 3B8DA 2CWNA 4O10A 4YXGA 4Z1AA 3P8IA 4AEOA 3TQ0A 5DCBA 3O8AA 4ZQRA 1DKWA 3TH6A 2Y7EA 1OX4A 3A5VA 2NUXA 3KVJA 4YMZA 3HG4A 2CLOA 1TREA 4QM1A 3MI3A 1VS1A 3QQ1A 4FNPA 2WQPA 4AWTA 3NO5A 4UUIA 3M16A 3NYZA 3PG8A 1EA0A 5L9FA 1MEIA 3PM6A 1UJPA 2VEMA 1F76A 3FYPA 3TJLA 3QMRA 4IPJA 4WX2A 3FS2A 4M5PA 3IIXA 2H3DA 1RQBA 2ZRYA 1ZHAA 2NUWA 1LM1A 3BW4A 2P10A 3R89A 1H50A 2AGKA 2C14A 3M5VA 1DBTA 4O18A 5F4WA 2PE4A 1TB3A 3W1UA 1GVQA 2Y7GA 3LCGA 4O4VA 1EP1A 4AXKA 2E6DA 2ZQ0A 3BLFA 4OGZA 4K36A 5HJLA 4A2SA 2X16A 3WK2A 1ZJIA 4DBEA 1YDOA 2GQ8A 3PULA 1RD5A 1TYGA 4OU1A 3W85A 2B4GA 4DBDA 4AHOA 1R46A 5K9CA 4R7JA 1T8XA 3LCXA 1Q45A 3DFTA 3NDOA 3NZ1A 4AF0B 2RKXA 1FUYA 2ZA3A 1SQ7A 3P5YA 3B03A 3HPXA 3NGJA 1W5MA 1OF8A 4JX5A 3M7WA 1JUBA 5DELA 4OQVA 3WJXA 1JUKA 2Y7FA 5CZJA 2NXIA 2EAWA 1OYBA 3W22A 2CLIA 1OFEA 1QNVA 3KVLA 4KWWA 2TYSA 1G4EA 3MMTA 4UXDA 4Q32A 2IQTA 4O16A 3BARA 2QDGA 2ZZ7A 3C8FA 1W5QA 2E1DA 1DHPA 2R94A 3FJ6A 1BWKA 3EWXA 1LDCA 4PC8A 1FCUA 1DVJA 4FNSA 4WD0A 3C2FA 3LB0A 3LCFA 3GNNA 1U83A 2Y89A 3OEXA 5D37A 5D2XA 3W2KA 3NQ6A 1TPDA 1VHNA 3LGEA 3S5NA 3B4UA 1SFJA 4POCA 3UWQA 3KX6A 1PIIA 2FQIA 4FX8A 1H7RA 1GG0A 1S5TA 2W79A 3L68A 4NVTA 5FF2A 5FF7A 3RFAA 3SECA 3EWWA 3W86A 5FF3A 3EX3A 5LGXA 1XBZA 3R2GA 1LBLA 1I4NA 1JVNA 3I68A 3G0XA 3NNTA 3IIPA 4MYAA 3W23A 4Y9AA 1SPQA 1XXXA 2V2HA 3SZ8A 5U7SA 3W83A 4RV8A 1IXQA 2WJZA 3NQMA 4JTJA 1WBHA 1G4PA 5D05A 4O28A 3CTLA 4O1DA 4DO5A 5BW6A 1ME9A 1T99A 2TPSA 3H53A 3TUUA 3ELFA 2V82A 3DKLA 4J9JA 3TMLA 3W1TA 1CI1A 1GYLA 3NQDA 1DL3A 2ZTKA 3OVRA 2FLIA 3TX9A 1OYCA 4W9TA 1LTDA 3HG3A 1K8ZA 4HHPA 1EUNA 5AOUA 3EX1A 4MOZA 3UPBA 1KFLA 2JGYA 1N8FA 1X1OA
chains in the Genus database with same CATH superfamily
2DT1A 1TWIA 1P1MA 2HWGA 2VO5A 1V02A 4A3HA 1OWQA 6TIMA 4BKNA 3HM7A 2BV9A 2VT0A 3MHGA 2EO7A 1VYRA 1K4GA 3CQKA 1KKRA 1TJPA 3B8SA 1V8EA 4IPIA 3IPWA 1HP4A 2YL8A 3DXIA 3UR2A 3GVVA 4QX4A 2NQLA 1XRFA 1IEVA 1V3JA 2P3EA 4AZCA 1V02E 2ABAA 1LORA 4W7VA 4JAWA 1V7AA 3KEHA 2BODX 3WNOA 3E9AA 4AZGA 1XH1A 4WOQA 3IUDA 4IIEA 3PZTA 2C18A 4UTHA 1B3XA 3ANUA 2HVOA 1JCXA 1TMLA 3BSMA 4WHBA 3I7QA 1OT2A 4FB7A 3OG3A 1V3HA 3NURA 1KCKA 4W86A 1US2A 3KOXA 3N3MA 2OWXA 3TJXA 1ELSA 5LA0A 5EFFA 1RJRA 2H9AA 3CBWA 1YRRA 1TR1A 3REQA 1UD4A 1CWYA 1TPEA 4E8CA 1AQMA 2CC0A 1A5LC 3EZ4A 2VD9A 2GVJA 2NXHA 1H1NA 1AVAA 1BRLB 3ZR5A 4R9XA 1L2UA 5A6MA 2F6XA 4NAEB 3WJSA 2QYGA 1RQEA 3AU2A 3VCRA 3AO0A 4GY1A 1NF7A 4UTMA 1XH2A 1YNPA 2Y85A 4HYVA 2RUSA 1XGEA 2GGEA 3T2PA 1HFBA 3PB2A 2BXZA 5EMYA 3UR7A 3KCOA 4ZL1A 1EX5A 5B80A 2BHYA 3FKKA 3LHUA 1JZ6A 1VFUA 1TQJA 1J10A 2XYLA 5EMJA 3UESA 3BLLA 3QGVA 1C93A 2WHKA 1HO1A 1Q4NX 4OBSA 4JGDA 2E3ZA 2I5IA 5BOOA 1FWFC 1DTNA 3CL6A 4L6HA 1SVDA 3TCSA 4O13A 3T42A 4N6FA 3GUGA 1SO4A 3PS7A 1UB3A 1S5WA 4QGCA 4ZEPA 1TZZA 4Z2GA 1MDRA 4AD5A 4BEUA 4AZCB 1G4TA 2V5BA 3VIPA 3BGGA 2TMDA 1NWTA 1CXEA 1A5MC 3ZWSA 1BYBA 1TCMA 4LS1A 4O50A 3W7EA 1XKYA 4JEQA 4EF9A 1UKOA 2V69A 3STFA 4DY1A 4YTUA 4L9ZA 2J7BA 3MPGA 1SSDA 2HZGA 1ZTVA 3QN3A 1Q6OA 3S8HA 4JQ1A 1K7XA 1PKYA 3WEMA 4PTDA 1XV8A 4NNAA 3MA8A 2Y61A 4FOKA 3E2RA 1J0ZA 1WUEA 3CT7A 1NFBA 3REQB 4JYEA 3E0IA 4RXFA 4DO7A 4IQDA 1EZWA 3FX4A 2ZVIA 3ZR6A 1RY8A 3STGA 6TAAA 3LUTA 2XM2A 1G01A 3F2DA 5CPTA 3R0UA 4FXSA 5E1QA 2WNWA 3UWYA 2J7HA 4V15A 5DBUA 4MPKA 1XC6A 2PLMA 3K5XA 3GYEA 3TEVA 4J3WA 3LBCA 4ZE4A 3T40A 1AA1B 2VZTA 2QW5A 3VCCA 4PUUA 3QV7A 3HIJA 2W62A 4MNKA 4F2BA 3AMKA 3HQOA 3R5EA 3B04A 2EPLX 2PDMA 4I6VA 2Y24A 1VF8A 1XICA 4O57A 4US5A 3LLXA 4QE5A 5HA7A 3EPNA 2CZVA 1GPWA 2BG5A 3RCMA 1HKKA 2PDCA 3HU7A 3BLIA 4FIRA 4KCWA 4LAMA 5DO8A 4G7EB 1YPFA 2XINA 4ROQA 4FS9A 4XZMX 4AVNA 4J40A 3LQLA 1JR1A 1ZUAX 1JDEA 2YCKX 3BV4A 3LD5A 4JHOA 4A3YA 2J6VA 4H8NA 5D9NA 5CGMA 2ISWA 1BAGA 1EL3A 3VGGA 3TN5A 3MU7A 5K2ZA 1Q6DA 4ZZ9A 3HTWA 3BG5A 3LQGA 3DHDA 1UKTA 1ONXA 4H01A 1BXBA 3RO8A 4JTUA 4JIQA 4KH2A 3GKAA 1TTIA 4C1NA 1XD0A 2XUCA 1E71M 1A4LA 2YCLA 4GBUA 1SZRA 3BGAA 1ZAIA 2QJIA 4IXXA 3E2SA 1FY6A 3KFTA 2J27A 1GJUA 3QC0A 1F3EA 2VGBA 4BI6A 2FVMA 4X63A 1UD5A 3TTYA 4K38A 2VRKA 4UZSA 4RX0A 1QRQA 2PD5A 1KFEA 5FAGA 5AYIA 1SJDA 1GOKA 3MVTA 5K7JA 5AKQA 3WH6A 4I8YA 2ZUMA 2PTDA 3WBWA 5FJJA 2Z1WA 2BP1A 2G3NA 1UIOA 3C5QA 2V68A 3H54A 2PRMA 3NQGA 3KBJA 1BG4A 1M5WA 1UR0A 4GY7A 4KBXA 2VGFA 3N14A 3NZGA 5IDZA 4OOUA 1CW2A 4HOWA 2ALRA 3QR0A 1LG1A 4RK8A 4YWIA 5BWAA 1ODZA 4XAGA 4K7VA 1L2QA 5F2GA 5I09A 4HCLA 4NY2A 4RDYA 5ECVA 4C6FA 3SI9A 3VABA 4AY7A 4B15A 4NXKA 1CCWB 3Q65A 1VYSX 2GGGA 4XZNX 1VGAA 3WELA 4IFKB 2WVVB 4PSPA 2WJEA 2OZ3A 2DIEA 5EB8A 2XJ7A 1R8LA 3GDKA 3GY1A 4O19A 3T4CA 4JCMA 1DIDA 4WXZA 5I7GA 3RLUA 2BDQA 3DERA 2OPJA 2D22A 4QG9A 3RJYA 1GOWA 1X98A 1YKWA 1V08A 2BOEX 1R3RA 4HN8A 5BMWA 3WENA 1EQCA 3SBFA 3LHTA 1WDPA 3KOFA 3V35A 4NI3A 3IK4A 3F2BA 2WPGA 2OFJA 1K02A 1HJSA 2Y70A 4F79A 4AZIA 3A22A 4RW3A 5AHFA 1QU4A 1XBXA 3BXWA 3INPA 3MWAA 2YXOA 3DIPA 4XUGA 3VX1A 4GYKA 1QHPA 2GL5A 4DUXA 2TSYA 3CL7A 1VLIA 4RKAA 1W17A 5TF0A 3AROA 2WZIA 1TX0A 1VYPX 1C90A 2V6AA 5H91A 2PB1A 1O5KA 3G6MA 3N73A 1KBIA 1KLYA 3FV9A 4B5UA 3WSUA 4F8XA 1R3WA 4W8BA 5FACA 2RJGA 4GI6A 3BJTA 4NZCA 4F9DA 5CKSA 2PDXA 5G4EA 4BI7A 3U48A 1N8WA 4FPSA 4C7FA 1U30A 4XV0A 3B9AA 3UWVA 5I3IA 1R47A 3MTWA 2VVNA 4K37A 1AZ1A 1X6NA 5I3HA 1Q85A 1KFJA 2VC9A 3SM0A 1ISXA 4UQBA 1GVOA 3CJPA 3PBWA 1P43A 3UA3A 4TR9A 2QJGA 5KETA 5LYRA 2ZZ4A 3T81A 1GOIA 2GVYA 1KWGA 1G1YA 2WM0A 4TIMA 1L6YA 2XGIA 2ZFAA 4RCXA 3I3EA 2V38A 4DO4A 5D2TA 2OGYA 1H7PA 1DORA 4EWND 4IX2A 2YYUA 1UR3M 4RV3A 3UG4A 4B9ZA 2PURA 3DHFA 5BXPA 4JEJA 3EOSA 2Y2WA 2HISA 2MANA 3SAZA 1GOQA 4IH3A 4H9UA 3M41A 3QSTA 4R85A 1ZCCA 1WZLA 4AB4A 1C8VA 1XJBA 4BJHA 5TAOA 2A3HA 2RH9A 4H9ZA 4YTSA 1J18A 2Z28A 1M53A 3U2ZA 3URAA 3IGXA 3MBFA 4DIAA 3CUFA 4WY0F 2NX1A 3K8MA 5G1YA 1UUQA 4TVUA 2B31A 3NPWA 3GNPA 1WOAA 1FOBA 1ITCA 4XD4A 1PJ9A 4O52A 3KXQA 2JFEX 2FTPA 1QDSA 3LDVA 3EKGA 2WXDM 4AD1A 1KV5A 1WE5A 1TRDA 1UWRA 1UUOA 2X2YA 1MXSA 3VDBA 1XIDA 1YXDA 3GM8A 1PZ2A 2F7FA 4IJCA 3TSDA 1F61A 1FWSA 2NV1A 5ECUA 3GAKA 2GQ3A 3WNPA 1W1ZA 3S6TA 3FLUA 2ZRXA 5KZ6A 3W7IA 4H6RA 4XX6A 3RU8X 3VIGA 3PY2A 2ZX5A 3W1XA 4CNUA 2E68A 3KZSA 5I07A 1ZGDA 2FGZA 2D0GA 3OIHA 4IGSA 3UJRA 2C8NA 3BW2A 3HA1A 1X7IA 1V0LA 1PTAA 4HMNA 5KZMA 3GXNA 3I6RA 3VE9A 4DN1A 2ZUVA 3NUKA 3ZFHA 3GB6A 3JZEA 4GH3A 3W3OA 2QMJA 2EPMX 1HGYA 2XIMA 4ECLA 2WMHA 4IT1A 2EJ1A 2IKJA 1XINA 3NEVA 4W7UA 1S2CA 2QHAA 2Z1KA 2R8WA 3RLVA 3AZRA 1GJPA 1M01A 3BSGA 4K8HA 3UWEA 4UFJA 1WB0A 4LVAA 2FMNA 1MZHA 3PANA 1RUSA 4A3QA 3CUGA 3PZIA 4UTLA 5A69A 3OZPA 1DE6A 1PDZA 1CXLA 4UTIA 4UQDA 3VXGA 3CEUA 3CK5A 4GFIA 4LB3A 3CAVA 3RM8A 4GY0A 2PRLA 4JTLA 7TIMA 2NQ9A 3BVJA 3KHDA 1MVYA 3WH7A 1FH8A 4G56A 1W3TA 4D6GA 3EEZA 5FF4A 3PBUA 3MUCA 1XC4A 2XVPA 3EWYA 5FF0A 4OECA 2O7QA 3GXDA 3IGHX 3BOLA 4GI4A 4Y7EA 1YADA 2Y6ZA 1OIFA 4NHVA 4K1WA 1V51A 2OEJA 1BYCA 1QI2A 1QVBA 3CC1A 1XIBA 2XFRA 3TXZA 4J2MA 2V8ZA 3DZ1A 4FALA 4BR1A 3W01A 4I7UA 3WDHA 5CGTA 3W87A 4PCNA 3BOXA 4CQ9A 2CLLA 1MYRA 2G96A 5CSYA 2VUYA 4QNEA 1W3LA 3W82A 1V3IA 2O4MA 5CXPA 4ZOCA 2DJLA 3GNXA 2C0AA 5DMNA 1RLDA 3E0FA 4XO6A 4P7QA 3W7RA 2DT3A 5KMYA 1F4HA 3BCDA 3KCLA 3QFEA 1TSIA 2VVSA 3D3FA 1UWTA 2GSHA 2YBVA 2YZ5A 4KQNA 5T91A 1QI5A 2NWSA 3PG9A 1AJ0A 1O5RA 1B57A 5LZLA 3NQ2A 1F5ZA 5FEXA 4Q8OA 2ZCGA 4PMDA 3ZM8A 5FJTA 1ONRA 3TK7A 4S3FA 4UTWA 1CBGA 1BTCA 3VAVA 3IUIA 1DJIA 3H2FA 2INEA 2VEGA 4LC6A 3T78A 2QDEA 3SCRA 3QZEA 2XFYA 1YXYA 2FHFA 3EX2A 4GYPC 1EPVA 2BTMA 4TTUA 2HS6A 4GQQA 4NQ1A 4UWMA 2JKAA 2H90A 2Z6IA 5EYWA 3BV7A 3LNMA 3TWAA 4RNIA 1Q6EA 5GVJA 4H00A 4F66A 1BGAA 3WMLA 4M7TA 1YXCA 2FGLA 4D1JA 3F2CA 1AJZA 1B5TA 4J7RA 1X7FA 5TIMA 1R3TA 3BWWA 3D5HA 2JEQA 2Z7KA 3NSXA 3USBA 2A3EA 5DBTA 2J7DA 2XG9A 4GGBA 4PR4A 1J96A 1FDJA 4B4HA 2V5KA 2WNQA 3PZOA 7CGTA 2WM1A 3TA9A 5LA2A 3MMUA 2QJMA 3UZXA 1ECQA 4MSSA 4WXYA 1JPHA 3GTFA 4M81A 4NZ1A 2AQWA 5HR7A 3GR8A 3IK2A 1X1NA 3CTTA 4JHMA 1LJYA 2BVTA 5CBJA 3AS1A 3KWXA 5FJRA 1DXIA 1BF6A 4WQ6A 1GEQA 3TYEA 4FLSA 2GUYA 3EB3A 3W73A 3HFTA 4HYWA 3H4WA 4LQ1A 2Q71A 4ATLA 2YDAA 1P5BA 2VR5A 3HV8A 4ERIA 2CLMA 2J9ZA 3S1UA 2WMGA 2ISFA 5HULA 1FKWA 4ATDA 2PBOA 2O56A 4L56A 3GTHA 4K8EA 5BNKA 1M3UA 3O16A 2AL2A 3AXKA 4X0VA 1E1CA 4ML9A 1JPMA 3IANA 2Q3RA 4UIOA 3R13A 3WQ5A 5I3KA 4UR8A 4MZYA 4C6LA 4CNSA 1GVSA 4XQ6A 3PNUA 3W25A 1E4NA 2ANUA 3TTOA 1DOSA 1PX3A 1LQAA 4AMAA 2Z2UA 3TJ4A 4CGTA 3GFXA 2R14A 3DBNA 4Y90A 1JAKA 1RP8A 1CTNA 3KP0A 3RPTA 3U2EA 3FCPA 4HP5A 1R86A 2OX1A 1JPDX 5BRQA 1E0UA 4WJXA 1XIJA 3S5ZA 3FEMA 2A85A 3CZ8A 4EANA 4N9CA 4KCTA 3SY8A 4AH7A 4BCEA 4IQLA 4MLRA 3FDGA 1FWBC 4AISA 3FIGA 5G1MA 3HN3A 5AHMA 1VRXA 3H2AA 2GQ9A 3LI1A 1LWIA 2AQOA 3UG5A 1Q6CA 5ABGA 2XFFA 3L0GA 4PMYA 1JUEA 2QXWA 3RPDA 1KNWA 3W2LA 3GU9A 2DSUA 3SCWA 3CUIA 3G1YA 2JKEA 3NL6A 1TPH1 3JRKA 1EP2A 2X1TA 3OA3A 3GNRA 4XTIA 3D47A 2VEIA 2RAGA 1NARA 4I90A 4QIUA 4ML4A 9RUBA 3AFBA 1UR2A 2ZRVA 3N4FA 5AVNA 1WYIA 3VKKA 4IIDA 4HZMA 2ZWYA 1SO6A 2JEPA 3LGDA 3W7HA 3FKRA 5IOBA 3SRDA 4PB4A 2W0UA 2FTWA 3HQNA 2VRQA 4WUIA 4ZMGA 2FZNA 4PODA 1EJWC 3V18A 2ISVA 3WDQA 2QLYA 1QPNA 3T0TA 3EPMA 1M6JA 1TVLA 1RV8A 2VNCA 4JDBA 2D73A 4LB4A 3LGGA 3ITVA 1XDLA 1TPB1 6ALDA 3GIPA 1QI4A 1UH3A 6ENLA 3CUJA 5CPSA 2YL6A 3FW6A 1TG7A 1UH2A 5FI8A 2ZDRA 1V4YA 2QV5A 4JTEA 2R91A 3LERA 3PWIA 1DXEA 4EXQA 3IJ7A 3AIRA 5HOSA 1MQQA 2ZYFA 1KM1A 2QNEA 5M2FX 4MKVA 4O17A 3MSYA 5DXYA 1IXPA 1J79A 1G67A 5G1TA 4PCSA 4D6IA 4W8AA 4HSNA 1NSJA 3FN9A 4UQ9A 3N25A 1OY0A 2BVYA 2PSNA 1R3YA 1E4IA 2HJPA 3GQYA 4IQJA 4XAPA 4DYJA 4JTRA 3NQ7A 1JNDA 4EXAA 3KL3A 3TZFA 1BVNP 2GGIA 1R5YA 5J5RA 1PS9A 1EXBA 4ICNA 1I2PA 1AG1O 1LLWA 3OGSA 4W4QA 2NX3A 2V2DA 4G8TA 2V81A 1DEDA 1DTUA 2QUNA 3XINA 4A8RA 3UY7A 5MKGA 4GHRA 4OV4A 3OHMB 5CC5A 1V0KA 2KZHA 1MWOA 4UQEA 4XWUA 3TKFA 4AD2A 1HJXA 3ANYA 5HUOA 4ZSUA 4O8AA 3MYOA 2WANA 4OBRA 4MF4A 3IAPA 5U4NA 4PCTA 8A3HA 1K8YA 4PTWA 3IGUA 1GZGA 5JVLA 1K3UA 3MUXA 4HTYA 1SO3A 4AC1X 1ZP4A 1X6LA 3KS6A 4XZHA 3QKEA 5KZDA 3DG3A 3HURA 2DSZA 2L5HA 8XIAA 3BLOA 4KFPA 3RIKA 3W2MA 1W1B1 1BQCA 2E4TA 4EOUA 3PSVA 4ADUA 4RE3A 1UZHA 2WKGA 3VIHA 2OSXA 1EIXA 5H8UA 3THAA 2QPSA 4DZ5A 2XISA 4JFWA 2BY3A 4HQVA 1RBLA 3E02A 1TELA 1VBUA 1MW2A 4LV9A 1DHKA 4HU0A 1Z44A 4JTIA 5SWUA 4Z0SA 2CHNA 3L65A 2CIPA 1QTWA 2E7FA 5I3FA 2A1YA 5IBXC 2G4FA 2QF7A 4IQEA 2CESA 4QAWA 5CAHA 5JMUA 3W7GA 1M9HA 2DEPA 1EUAA 3GUWA 5CZTA 2WHJA 1W54A 4HHMA 4CQBA 4ZO8A 3DHPA 4UBPC 1V6XA 3KL0A 5MKGB 2E6YA 2YXXA 1QNOA 4C6IA 2HEJA 3RX4A 4AZ7A 2CERA 5F2LA 3SRFA 3SN0A 2XN1A 4WR3A 4KGLA 5JBFA 5E9AA 1U5JA 3SO7A 3NZPA 1EJVC 1SJCA 3M47A 2HXTA 3CZEA 1OX6A 1UD3A 4GUFA 2VC7A 2IPGA 4M6VA 3TC3A 3A6OA 4QEEA 5E6YA 1R7AA 1SFTA 4L4LA 4LW7A 3NM3A 2E6AA 3USZA 3VDCA 5AZ0A 1DIOA 3AMGA 3GU1A 4DWDA 4UTFA 4KWSA 2VX5A 9XIMA 1QPKA 3MB9A 4O11A 2XH0A 1HTIA 3ARRA 5CLTA 5T9BG 3R7MA 3WDPP 1XHGA 4Z2LA 1RVKA 2Y8VA 4NP7A 4IUGA 3V3WA 5HMEA 3T0BA 3E2QA 4ZOBA 3UXDA 1IWPA 2GOUA 1JCYA 1F8MA 1MUMA 2HBXA 2WZHA 3R8GA 4H7CA 5FIPA 4PFHA 1KBKA 1W2VA 2PDNA 2OGJA 5C7HA 1FWJC 3K4AA 1RZMA 2VFGA 4ATWA 4GVIA 4Q8WA 3CO8A 2OKTA 2REQA 1W2PA 3MW7A 5DCDA 3GLCA 1MZRA 3P61A 1AMYA 4YL2A 3VILA 1W3HA 1KM6A 2W61A 4N02A 1FRBA 1TWZA 1YTKA 1VFFA 3EXSA 3OPSA 3DUGA 2CU0A 5AC7A 2J47A 3KS5A 2PTWA 3LOTA 3CPUA 2Q3OA 3LM7A 1OVDA 3K4WA 5AB3A 3C86A 3LRMA 4XBJA 2BNJA 3BGJA 3ARQA 5HBFA 3E0WA 4ZBCA 4QBXA 3T2OA 1SU5A 1A0EA 2VWSA 1R9ZA 3I3BA 2WMFA 1KM2A 4DX3A 4W7WA 1RK5A 4DJDD 5IDIA 1VFMA 3GR4A 1IV8A 1R9XA 2R82A 1JDCA 1P0NA 3C2EA 1M68A 3ENLA 4E3TA 2VEFA 2VI0A 4IFOA 4O10A 1FA2A 2Z26A 3TQ0A 3BQ6A 3O8AA 4ZQRA 3TH6A 1OX4A 4BF5A 3A5VA 1UYQA 4LEQA 3NJ3A 4YMZA 2DW6A 3HG4A 3KLLA 3MI3A 2YBUA 3NO5A 2ZICA 3M16A 1K9DA 1EA0A 2VGGA 3PM6A 4PUWA 1UJPA 3KBSA 3FYPA 5HNTA 3QPEA 1TA3B 1W9VA 2DZAA 3QMRA 4G5DA 1D8WA 5EMMA 3ES8A 3WX7A 2H3DA 1EIBA 1W9PA 1RQBA 4XZWA 4EPDC 1LM1A 1H50A 3VC5A 5F4WA 4QLLA 3STPA 3W38A 3MCNA 4PUJA 1HL9A 4WCJA 1FFRA 1TJ1A 3IS4A 3CB3A 3BLFA 2WMIB 1KXTA 5HJLA 1UMLA 1XCWA 3OODA 1YDOA 4KCVA 4N42A 3O0KA 1PWMA 1B0IA 3BAIA 1LQ0A 4IJRA 3ZXWA 1KQYA 4AHOA 4F0RA 3DFTA 4AF0B 2IMRA 3VA8A 2FHBA 1FUYA 1SQ7A 3P5YA 3R11A 4H19A 5CBBA 4A4AA 5CCZA 2EG6A 3WJXA 1JUKA 5DMLA 3DCPA 2EAWA 4A8IA 4KT2A 3KVLA 4KWWA 3LG3A 1G4EA 4HJWA 4Q32A 3B0YA 4EKJA 3TVAA 3VD4A 1SFSA 1FHUA 1WPCA 3L4WA 5IFPA 3WIJA 1ZJHA 1W5QA 2DY3A 1Q2RA 1DHPA 1OB0A 3N9KA 1HVQA 3WMCA 2YOCA 1EYWA 1LDCA 1H41A 1QI3A 1MFUA 4PUEA 2OZ8A 4WD0A 3QTGA 2PS2A 2A3CA 1CLVA 3WH8A 1VJSA 5D2XA 1U83A 2Y89A 1C7TA 2GLKA 1S3TC 1HIZA 1TPDA 4QFUA 5C0QA 3S5NA 3B4UA 1TX2A 3UWQA 3N2BA 1B2YA 3PPFA 5JXQA 1HJQA 5FF3A 1EC8A 1NY1A 3ICJA 5LGXA 2HE8A 3IJQA 4IIHA 1XLJA 3W28A 3BICA 1XSIA 4O1EA 4TVCA 3GXFA 3VOGA 4LBUA 4I9JA 4QDPA 4MB1A 3URNA 3A64A 1ZZMA 2GOKA 1T99A 2UBPC 2DIJA 4RZBA 4RDZA 4H8VA 4HOXA 4PUDA 1GYLA 3E1F1 1DL3A 3ZVHA 5DT7A 1A5NC 1Q8AA 2XSAA 4LPCA 4DWSB 4L1WA 3L4UA 4URIA 4HHPA 4M1RA 4U5IA 3O7UA 1N8FA 4LJ3A 1JGIA 2OQYA 3AICA 3SUUA 4Y9MA 1YEYA 1PZ3A 3P0WA 1TZ9A 2AKMA 3P62A 1UMYA 2HE5A 3MI2A 4X61A 1TQXA 3P7YA 4HNVA 3UCDA 3A9IA 3W1MA 5CJNA 2PGRA 6PTDA 1OFDA 3U57A 1KXVA 1PDYA 3JU2A 1XLCA 1JD9A 4NKCA 5AC8A 4O1BA 3OJGA 1U1JA 2GGJA 2OZ0A 5GJNA 3DEQA 1BWLA 1OFQA 3SY1A 3H12A 4ZVJA 1O4UA 3WG6A 2BMBA 1U2YA 1E73M 2X1SA 2V63A 1UKQA 4GXPA 1NJJA 4RJEA 3CWOX 2C1IA 2ATSA 4JOMA 3N9RA 5EA9A 3QGKC 3WY1A 2VQUA 3DFNA 4KPLA 2PC4A 3GHSA 3IVUA 1K9FA 2Y88A 1FCVA 1XRVA 2QJHA 2Z1BA 3S47A 1Y5WA 4C5ZA 3BJSA 3P3BA 4Z2KA 1GTHA 2JE8A 2VYOA 2A6LA 2QZRA 3UP8A 1CLKA 4HCDA 4JTTA 3VCNA 2CBIA 1GVYA 1IWBA 2I5GA 3ZVHB 3TTSA 1W9XA 3E2VA 3BG3A 1EDQA 1I45A 1YBQA 3EGJA 4ORIA 2YPIA 3A13A 3M64A 2FDMA 5FCZA 3KLKA 5A8QA 1F6YA 3WQEA 3LLDA 3VINA 4NU7A 1T6MA 1L6WA 4YYCA 1Z41A 3VYLA 1PVNA 4DLFA 4GACA 3BLKA 3QXBA 1JFXA 1DP0A 4A29A 3FJLA 4C5YA 1SO5A 4PBEA 4GZEA 1JIBA 2ZA1A 3F4DA 4ZR8A 3QY7A 1LOSA 1DQWA 2OXNA 4NJGA 3L5AA 2FZDA 1I2QA 3EMQA 2X2GA 3UY8A 3VGHA 3WN6A 3AYVA 3GW3A 3SCNA 3ITTA 4CD7A 4XB3A 5BXSA 4C6OA 1CXIA 3A24A 2ISDA 3VI2A 4WDXA 3C0LA 4Q8VA 4TV5A 3V0UA 3U2OA 1TRIA 2VZSA 1GQLA 1KGXA 4EWJA 2VFFA 1RALA 1JRCA 3AZSA 2YSWA 3BCFA 3AYSA 3RITA 1XLLA 3GU2A 3WJZA 3PR2A 1FX6A 4PGLA 1QHZA 3C0JA 4GOAA 3Q58A 3P14A 1TE1A 3W27A 3RJXA 1XLKA 3W72A 1OJXA 1IZJA 3NOEA 3DKJA 2YA2A 2X40A 3TN6A 1JQVA 1KRMA 4D2JA 3OZYA 3A3XA 2PTYA 3LI0A 1KXHA 4D6CA 2ZUNA 3ZSSA 2WV8A 3QHOA 4WY0A 2DP3A 3DOPA 3VD9A 4DBSA 4H9MA 2PCEA 8RUCA 1EJRC 4ZGYA 4UFKA 3WUEA 9CGTA 3H7RA 1LUCA 2QKFA 2QQ6A 4NNBA 4ALDA 2QUUA 4LF2A 4AC7C 2E9LA 1TMQA 3H24A 5G2HA 3V1HA 3ZR4A 3O63A 3HO8A 1JD7A 1QXLA 4XK2A 1Q13A 1IXNA 2WBGA 3FVDA 1JPKA 4NJKA 3UZJA 3IIZA 4DYKA 1DWGM 1BYAA 1W9UA 1FFQA 2GYIA 3W81A 5F2IA 2XIIA 3WBXA 4ZTYA 3W02A 4J1OA 1ZBCA 4MLJA 1JZ7A 3PPGA 1W1YA 2ZRUA 2XSXA 2UY4A 3BW3A 5BMXA 2PRHA 3APGA 3PZGA 3C2RA 1JYNA 2Z7GA 3NL2A 4H8UA 3R4IA 5CSSA 4S39A 4H9VA 1QBBA 3KVKA 1QWGA 3ID7A 5G5IA 2CLEA 2PGWA 1YNQA 2DW7A 2CWXA 2OG9A 4X2PA 3CUHA 3LSBA 3H55A 3QFWA 2PWDA 1E1EA 4W88A 1W56A 2EPOA 1KBJA 3EWDA 3E3HA 1R7OA 3HJZA 3P80A 4HNLA 3WJWA 1GK8A 2EPNA 4GZIA 4A6GA 3H4GA 4GX9A 4E4PA 3BANA 4Q7NA 4JIRA 1ESWA 2W4XA 1S5VA 3CNYA 1K8CA 1C91A 2ON3A 3EOUA 3SCUA 3WQOA 4NG3A 5CJ5A 4UCFA 2J62A 3T0CA 4GIYA 3IRSA 4FEZA 3VTRA 5MHBA 1UG6A 1MNZA 3WUBA 3I6TA 3RAOA 7PTDA 1JJKA 3E5BA 1SW3A 3F4WA 4U10A 3CGTA 3G24A 3LXAA 4PB3A 3L2IA 3SJ3A 3DC0A 3GG0A 3WFLA 1YLVA 4LVBA 4WY0B 3TYBA 4JTKA 2YDRA 1F6KA 2OLHA 1PBGA 5EGRA 1LUCB 3BH4A 3GC2A 4LUSA 4CQDA 3AXMA 2CZFA 3GXPA 3S6OA 3BSHA 5BWFA 5G4WA 2DZBA 4MNLA 1ZQ5A 4F0SA 4Z1DA 4DJEA 1E3ZA 3IJIA 3UETA 2C6QA 2DZVA 2PWFA 2GK1A 1ODUA 1ZB5A 4HBKA 1G6CA 4MDOA 3O05A 4XVEA 1U33A 3QC3A 3VOIA 1IEQA 2D3NA 3FA5A 4Q22A 4HZ7A 4EXBA 5HR6A 3H8AA 1OSEA 1GW9A 2VFHA 3RM4A 4ERGA 5EBUA 1JXKA 3RCYA 3IGSA 5CPMA 1RBAA 2Q09A 2DH2A 5DFAA 1XRSA 1A3WA 5K4XA 2ZE3A 2W66A 4KFOA 2CITA 5FJOA 1UD6A 3OIXA 4DPQA 1OGBA 4I7WA 1MQPA 4D1IA 1HL8A 1GKPA 4DHGA 1A3XA 4HU4A 1W1IE 1J0IA 2FZBA 2EPKX 4RZ5A 4DXVA 4NJHA 3DX5A 2FGBA 4GI8A 4B2DD 5LNUA 1ZBVA 2ZVRA 2NQ5A 4J3XA 3UD6A 1IZCA 4MJZA 4LAZA 2CLHA 4EPEC 3AS3A 2G4JA 5C8BB 3TLLA 3PZ9A 3EA2A 1EO7A 4J4KA 4H7VA 1ISZA 1THFD 2CHRA 3DECA 1XGZA 3OLEA 3TZNA 1KR1A 1XP3A 1VIWA 2CBJA 4CQ8A 2INFA 4AZBA 2PODA 1IIGA 1L8NA 2EJAA 3QZ6A 2FB2A 3TFCA 5DRIA 2Y62A 1MO0A 5E6ZA 3BDKA 2PD9A 4QRNA 4V27A 3FNDA 4PEKA 1WV2A 1Z8AA 1JGMA 1H63A 5LXEA 3UG3A 2QF8A 1VFOA 4ZSTA 4J3VA 3NO3A 4FNTA 1E51A 2PBGA 2GVEA 2BVDA 2Z1XA 3G8EA 1HZYA 4LH8A 4Z1CA 3EWBX 2JGQA 2ZE0A 1E6ZA 3FA3A 3CIXA 3TLQA 1MUWA 3MANA 3G0UA 5E0FA 3WNKA 3AMLA 2OYLA 1BF2A 1EZ2A 3N19B 3UXLA 3LCLA 3IJ6A 2C19A 2VX6A 3VFLA 1ZP3A 1P6CA 1XLIA 3FY1A 1EQPA 3SURA 4WGHA 3NA8A 2XVGA 1O60A 4LWWA 1E0XA 3SRKA 2GSEA 3F03K 2QCDA 4D6JA 4X9YA 4LAUA 3WMSA 4N4PA 3UR8A 3OBAA 4C6KA 4FX7A 1K03A 2CFFA 2NV2A 4UNKA 5A8GA 1Q65A 3F7JA 3PF3A 4IMCA 1W31A 1KCXA 3DGBA 4M82A 1UIPA 1PCKA 4BF7A 3GTIA 3E38A 1ZL1A 1A5UA 2ZUSA 3MWCA 4UMAA 1MNSA 2V5JA 3TYZA 4UTKA 1XLDA 2PP0A 1A3HA 3UZWA 1V3MA 5D2WA 1JZ4A 3NG3A 5A95A 2YIHA 4ZOAA 2ZZ5A 3L0KA 4FOJA 5DY2A 1KR0A 3HMJG 3P6LA 3M5ZA 1DIKA 3NQCA 4N9DA 1D3HA 3M5XA 5IHRA 4ZOEA 1HW6A 1UR1A 3TU9A 2GDUA 1EB3A 1WKEA 2G41A 2P53A 3CYJA 3TCEA 4BWLA 2D0HA 3N2OA 1CXHA 1KTNA 5EL1A 1DWFM 1R30A 2DZPA 1HX0A 4JBRA 1KGUA 4NSBA 3RX2A 4CKQA 1LQ2A 2X05A 5DY3A 2OTDA 3S2MA 1CYGA 1BPLB 3LHVA 2MNRA 3FFSA 2JK2A 2QR6A 1S38A 4MWAA 1L0PA 3E12A 5LNRA 1X1ZA 4QSFA 3UT0A 2YCEA 3U0HA 1F8IA 1PEZA 2AAAA 1H7XA 2BOGX 1LL7A 1R85A 2NZLA 3PAOA 2TODA 4BQ2A 1KCLA 1N8IA 2VR2A 2AL1A 1Q7MA 1XFCA 3O6CA 3ZS4A 4MWAE 1VC4A 2G3JA 2CXEA 5TNVA 3D6NA 5EMUA 2C1GA 3GC4A 1UQZA 4S1FA 3CWHA 3S2NA 1YDNA 3LK6A 1F74A 2IPWA 2PP1A 3OGVA 4HNOA 5RUBA 2B81A 4QXIA 2VJXA 1VD6A 3HOJA 3PB0A 4U4MA 4V1XA 2QPXA 5DRCA 3OGRA 2D69A 1ZJBA 1I1XA 3MS8A 1NDYA 3DC8A 4L65A 1RY0A 1UP0A 2OOGA 4QJ4B 2CLFA 2BY2A 1VBRA 3PK7A 1GOMA 2V5DA 1KFWA 2DFAA 4C6QA 3A3WA 4LUJA 3GAYA 2YL5A 4Q7BA 1JRBA 2FHCA 3HZ3A 2EEXA 3TR9A 3R1ZA 3ABRA 4NAFA 5AFDA 1WDWA 4OUEA 1XH0A 3I7SA 5AY7A 3F5LA 5FKYA 4YN5A 4C1KA 5A6LA 4HT3A 3GZAA 3JZUA 2CZ5A 4R34A 1KXQA 1SMAA 2BVWA 5DN1A 1TTQA 3ZLFA 3WF0A 3T55A 3U7VA 4S2CA 2Y63A 2OLSA 3GIQA 4PMOA 1VIZA 3EWZA 2BHUA 4HA3A 4MY1A 4GUIA 3WFAA 2HSAA 4HKPA 4NL1A 4XAFA 3AWNA 3SQSA 1OC6A 3S9ZA 3SGZA 3VGEA 1NFPA 4DJFC 4L9YA 4ZB2A 3WQPA 4PULA 1UBSA 4GINA 4ERAA 1JI1A 1M7OA 2HS8A 3LTPA 2AOSA 2I7GA 3TFXA 5A2BA 3UEQA 1IT0A 4DYEA 2WOQA 2PF0A 2F2KA 3BPWA 3LX9A 5BRBA 4HA4A 2G95A 2F9RA 2BY0A 3POHA 4TQTA 3QVQA 5C9UA 2EG7A 3RMJA 3AMDA 1MW1A 2FH6A 1GTEA 1W6TA 2H6RA 4HMDA 4O14A 1B3ZA 4ACZB 4TX9A 1SM9A 3TQVA 5FSEC 1MDLA 1FWEC 2WWCA 4MFEA 2QAPA 2OJPA 4GYPA 5M5DA 1ZU8A 3QMTA 1EOMA 1GONA 2FFIA 3LV6A 4LALA 2HPMA 1IR2A 3KM8A 2XSBA 3L4YA 1B3OA 5D09A 2ESCA 3U8GA 4KFNA 4HPXA 4YCOA 4EIVA 4F48A 4BZYA 4HNTA 1C8XA 2VGIA 3SEPA 3MCMA 1EBGA 3SUSA 2X0HA 3O1NA 1QNRA 1J93A 2A7RA 4DQWA 1JL8A 1VCVA 1TPWA 1V6TA 2OELA 1ZAJA 4UC5A 2OR2A 2SFPA 3KUMA 2V0TA 3NYDA 3WKZA 4OIFA 4FMVA 1YE4A 3LPOA 3QQWA 2PWVA 2WCGA 1F3XA 4TU1A 4IZGA 4HVXA 2GVGA 1QPQA 3ITYA 5I78A 3LU2A 1AW2A 4JDYA 3S1VA 2H3BA 4DZAA 2J77A 3A4WA 4QR6A 4GQ0A 2ZZ6A 3EAUA 4ZO7A 2QUMA 2AKZA 4LY8A 3WQ6A 4WOZA 3ITLA 1P0EA 1ADOA 1CB2A 3CLMA 2W3ZA 4WDTA 1NOFA 5L6UA 1QJWA 1P0BA 4GISA 4FNUA 3KOYA 1LOQA 1B3WA 4PZVA 1O5XA 3RU6A 1JZ3A 1XF0A 3SR7A 2AQVA 1FWDC 3HB9A 4H4IA 4JL2A 2VZOA 4IPLA 4AX6A 1OFAA 4JFSA 3M0ZA 3SIMA 3M4HA 4B91A 1N55A 1P7TB 4AWEA 3PFMA 2IQ0A 2WO5A 3O15A 4S38A 1JYWA 3C4UA 3G1VA 1LLOA 1E70M 4UQAA 1PKLA 1OD8A 3ABSA 1ZBWA 1UD8A 1SUXA 5I0DA 4C6BA 3MZ2A 3OW1A 4G2DA 1XYBA 4RNFA 3ABQA 3SSJA 1HKJA 4Q4OA 3WBYA 1DWIM 3LXBA 1QW9A 3UF9A 1UCWA 4O12A 5F1UA 5I6SA 4S3GA 4C7DA 1NDWA 3UXKA 2VD8A 3TAOA 2F6KA 2CKRA 2QAFA 3CM4A 4IIBA 4DUWA 3CAWA 1OX5A 3HMCA 1YDVA 3L66A 3K1DA 3LM3A 4RNJA 1GOXA 2P8CA 3UZYA 1JCNA 4RE0A 3QJAA 1W9DM 1R2SA 2DT0A 1OF6A 3MBDA 4CD5A 1PL9A 2E1WA 3VU2A 4JN8A 1Z9AA 2ISSA 3K13A 5K9DA 1YNYA 2YFNA 5LIUX 2KX9A 1IIHA 3GTXA 4H2CA 3UJSA 1HJUA 1GYMA 1XCXA 4FLOA 1NFGA 1E0WA 1J6PA 5I03A 2EHHA 1CXKA 3N6HA 1FHLA 1LG2A 3S1WA 2CCRA 4LT9A 3QPZA 4E2OA 1X8FA 1TIMA 3NDYA 4CN6A 3VZYA 4XKYA 4KKXA 4MJ2A 2DUAA 5F1VA 1JZ8A 2WPBA 4Y96A 1K6WA 4IJBA 2E8ZA 3A5FA 4I5XA 4EP8C 1TFVA 5F7UA 2VELA 1V93A 5LNSA 3W7QA 5CPNA 2WVUA 1Y7VA 1O66A 1ONWA 2R6OA 1P6BA 3P93A 4M3PA 5KINA 1GHSA 3WK1A 1JULA 1IZKA 4V1YA 4KIRA 5BZAA 4LRSA 4HYRA 1UWAA 2A3LA 3I65A 3BURA 1EJUC 3W7DA 4QG8A 4TX6A 3IJLA 5E0CA 2A79A 4GX8A 4NNCA 4UFMA 2BBFA 4XBSA 1NP2A 3IJ9A 4MAVA 3PBYA 1Z32X 4RR4A 3VMPA 3VOJA 3JS3A 4NJIA 1LBMA 2OKOA 1NDVA 2NT1A 4IISA 1PIGA 3CPRA 3OBEA 1XUUA 5H6HA 1CGWA 7A3HA 1GYNA 1OCQA 3EA1A 5GNXA 2R1NA 2Y1HA 1F07A 4P8WA 3AXHA 1A0DA 1XIMA 1VHCA 2WHMA 4LYQA 1MMFA 5XINA 3FYOA 4MGGA 1RD6A 2FVKA 1DJWA 3WF1A 4UFLA 3SCSA 4P5UA 2F84A 2R9RA 3E49A 4B3ZA 1O94A 2J66A 2FYMA 4V33A 2PDFA 1C3FA 3ME3A 3N17A 4S3KA 4IHCA 1UJQA 2GJLA 3IJ8A 1NVMA 4JKKA 1LZOA 3M6DA 4M6PA 1EJSC 2TAAA 1ZPTA 4DNMA 4PMNA 1VFTA 1CLXA 2FMOA 2PLCA 2OSWA 3ONBA 3RM9A 4TOQA 3V7PA 1BD0A 3GC5A 1MEWA 4L4MA 3A9BA 4OOZA 1JDFA 4KETA 3V5OA 1AD1A 2PF8A 3NPUA 3AXXA 4RZ4A 1HNYA 3RO6A 1HQTA 2RFGA 2VZVA 4PL2A 5LIYX 2POZA 5DX7A 3GVWA 2Y5JA 1Q6FA 5HQEA 5HPCA 2VEKA 1E9IA 1KRBC 3UU0A 4PUMA 3WK0A 2CYGA 3SADA 5LKYA 3ABXA 3LMYA 2O7SA 2WW5A 1IYXA 1G5AA 1TUXA 4GVFA 4TO8A 2H9AB 4D8ZA 3LYEA 3H2OA 3PTKA 3IIOA 3O06A 3LMZA 4BI5A 1GHRA 1K1DA 3L9CA 1KFCA 2D0FA 4DO6A 2WJDA 3VIFA 4HOZA 2WMKA 2UZ9A 3UGRA 2QGHA 5FEPA 2ZXDA 4Y9NA 3SW6A 3UQNA 2C91A 1ZFJA 4O0KA 3HPAA 4NZ3A 3MYPA 4MNJA 3QLLA 2EKGA 3G22A 5ABHA 3T8LA 4HU3A 1F4AA 3MSRA 4UTWC 4QCEA 2NSOA 5C55A 2QUVA 3F4CA 5LSMA 4YHEA 3W75A 3S5OA 2B7NA 4MHBA 2EQDA 4F2TA 4CCZA 1ITXA 3PUDA 1H7OA 1SR0A 5HNUA 3KBVA 1J8VA 1BTMA 4X2RA 5BXTA 3SCQA 5AHNA 4X60A 4K8GA 2J8TA 1VCGA 3LNPA 2Z2AA 3W1RA 3W7KA 4E38A 1XG3A 5I23A 2QMKA 3M0IA 3GVRA 1EJXC 1XPYA 4C90A 3QBUA 4NASA 1GQNA 2I14A 1TJRA 4LTSA 4QNWA 1RP9A 2OODA 4Y6GA 4NZJA 4OFCA 2INZA 1H60A 4B5TA 4PN2A 2V5LA 4HNCA 3QGAC 4BFAA 1E15A 4W93A 3AQUA 4MZ1A 1OHLA 2QIWA 4CN1A 2Z0IA 3B05A 1EH9A 2WQDA 3G18A 4K3ZA 2WAGA 3VUSA 1REQA 3M07A 1H51A 1TKKA 3WBAA 1KM5A 4FO4A 3TW7A 4JY9A 4CNTA 1KCZA 4F0LA 4GPNA 3NPXA 1AK5A 3C52A 3G6LA 3QF0A 4TMBA 4W87A 3W6MA 4QROA 3GG1A 3QY8A 3B8DA 1EFZA 3P8IA 2OQHA 4F0MA 1BVZA 4FXJA 1DKWA 4L7ZA 2DUXA 4P8UA 5C2GA 1IEIA 1Z7AA 5FA5A 2W9MA 1VS1A 1AJ2A 2WQPA 3UXIA 3MKVA 4UUIA 1B3YA 2PTZA 3LN3A 5M3WA 5L9FA 1F76A 3TJLA 1AH0A 4WX2A 3FS2A 3MUY1 3IIXA 3PNZA 3P0XA 5A6BD 3B4YA 3HPFA 4RDVA 4QCFA 3BW4A 3CZLA 1FHVA 5HNNA 2P10A 1XISA 1E55A 5BRPA 2ACSA 1XYZA 4O18A 3PTDA 3OZOA 2G37A 1TB3A 3CZKA 2Z00A 1GVQA 2DIKA 3CHDA 2D24A 4MADA 3T09A 1EP1A 2EBNA 4H2HA 4OGZA 1JZ5A 1E9YB 3MY9A 4A2SA 4W5ZA 1CGXA 2OX4A 4DBEA 2GQ8A 1UH4A 3LZ3A 4S3AA 3NVDA 1L8PA 1WDSA 4JQ2A 3DHUA 4DBDA 1HJWA 1BXNA 5A6SA 4JQ4A 4E5TA 1J0HA 3W00A 4C1NB 3NGJA 1W5MA 8XIMA 2D3LA 3M7WA 2YCLB 3MDWA 4OQVA 3DYPA 1UR4A 1UA7A 3AHTA 1OYBA 3W22A 4IPPA 4HHHA 2CLIA 4YJ5A 2IQTA 3KRBA 4F9JA 4AX7A 2QDGA 5J04A 2PDWA 4NYYA 3VNZA 2R94A 3FJ6A 1J5SA 2QVHA 3CIVA 2ADAA 3ZZ1A 3PZMA 4PC8A 1XIGA 1I1WA 6XIAA 1IR1A 1UZDA 5D37A 4CU7A 3OEXA 3VM7A 5CJMA 3LGEA 4U2ZA 4POCA 2P76A 2FQIA 5C70A 3UA4A 4GYJA 1GG0A 2W79A 1MRAA 3L68A 3EWCA 3W86A 3ARUA 1UWUA 3H23A 1XBZA 4D6HA 1KC7A 1VFSA 3I68A 1EOKA 1J0JA 4MYAA 4KMQA 4B4FA 4Q4SA 3SZ8A 3FYYA 5U7SA 1VFLA 1IXQA 2AMGA 4O28A 3CTLA 5BW6A 1ME9A 3FAXA 3OB8A 2DVTA 1OZMA 3L7RA 1W1PA 3TMLA 3K2GA 3CMGA 1CNVA 2ZTKA 3OVRA 2FLIA 3TX9A 1OYCA 3HG3A 4XKMA 5AOUA 3EX1A 3PZVA 4GK8A 2J13A 3UPBA 2GSJA 3TYDA 1A5AA 2HK1A 1S2TA 2WZEA 3CV6A 1US3A 1T96A 2OEKA 4PL1A 3VZXA 1C92A 5IRPA 1KTBA 1G7VA 4A21A 2XIJA 2V30A 3EOLA 2PDIA 1H61A 2RDWA 2O9PA 4AW7A 1D7FA 3EX6A 3B0PA 1CT5A 1YMYA 4K7YA 4HNUA 4AFYA 4LX4A 1ISYA 3BMXA 4GCAA 5REQA 2BASA 1FKXA 4M29A 5A8MA 2IS7A 4YTQA 2E8YA 3N6JA 4HJFA 3AUJA 5LIKX 4HU8A 4PE8A 4Y8FA 3VM5A 4N9BA 3BMWA 3W71A 2ZOXA 4OV9A 2EGZA 2ZC1A 1PXGA 2NVDA 3EB4A 2CBVA 3DFSA 1E6XM 1KTCA 2WZMA 1IWAA 4X9SA 1OQFA 1CECA 2YLLA 3AMCA 1J6OA 3KCJA 3MKCA 3TJIA 4P61A 2A0NA 5FD0A 3OTRA 1KD0A 1UWIA 5HUPA 5DLCA 3M5YA 3CQHA 1F6PA 3M0XA 4JTGA 3V0TA 2RJHA 4GNVA 3R79A 1RCQA 3STCA 4IUOA 3M9YA 4V28A 4TXEA 3CU2A 3HG5A 1XYLA 3WL1A 3B8WA 4REQA 2YJQA 4R88A 4JNZA 4KEUA 4XZBA 2YB4A 1KFKA 1RBOB 1K8XA 4YCPA 4JNMA 3SRHA 1VP5A 4AVFA 3VNKA 2Z4GA 5C2XA 3GSMA 3H2EA 2OLAA 4BQ5A 1RAKA 4FR1A 1PHQA 2VCAA 1V0NA 3P2VA 3WLIA 2BSLA 3MV11 3N12A 4QDMA 2Z29A 3Q94A 2CW6A 1ONEA 4X0NA 4LC8A 1E6NA 1TV4A 3MHUA 1QMLA 2B7PA 4GUGA 1DWJM 3W70A 3CYVA 3NXFA 4N6EA 2YW3A 9XIAA 5I2UA 2O0TA 3A4XA 4KIEA 4EF8A 1EYEA 2J7CA 4JQAA 2W6RA 4NZFA 3ITXA 3DFPA 2Z1VA 4NI8A 3GG8A 1TZ7A 1KB3A 1H3GA 3QR3A 4X3ZA 3MUZ1 3W76A 1MW0A 3R94A 3LTSA 4XUYA 3EXTA 3W74A 4GZ7A 2NVCA 3MJYA 1BWVA 2GPTA 7ODCA 1XM3A 1R87A 3ZVIA 4CQAA 5B7YA 3EYPA 2YBTA 3W7MA 2PTXA 2YR1A 2X1IA 3JVAA 2C79A 1DIEA 3L2MA 1TO3A 1S1PA 3KVMA 1FHDA 3NDZA 1ECEA 3B9NA 1FWAC 1M41A 1X39A 2DT2A 1PB0A 1I2OA 2WNNA 5FSDC 2PU0A 3R12A 2GQAA 1IEXA 4REQB 3S1GA 1TWWA 2GJNA 4GJIA 4K68A 4ADTA 4FI4A 4A8NA 4B9YA 4O1FA 5LA1A 3AIUA 3GHTA 3VGBA 3WF2A 1IT8A 1N7KA 1F3WA 3WEOA 5CZ0A 2YA1A 2YW4A 4NXSA 2Q6ZA 3CAKA 4S2BA 4IWWA 1XYAA 4UMCA 1ZSXA 3SFKA 1A53A 3AHYA 1W91A 1RSCA 1QOQA 1RPXA 2ZRWA 4F4RA 5F4SA 4L9XA 1AL8A 3BCJA 2BFGA 4JFTA 2HPIA 3PTQA 2DZUA 4D8AA 1K70A 1JF5A 4ZQPA 1I6NA 1LT8A 2WB5A 4QITA 5CBIA 5H2ZA 3A21A 2OMAA 4JS3A 3AWOA 1A5BA 5H8MA 3DN5A 1C29A 1TPVA 3GK0A 4L5ZA 3QW4B 4QJ5B 5CZSA 1ISWA 3G1HA 1HO4A 4BQ3A 1N82A 1TR9A 3JR2A 3DESA 2VC5A 1R6WA 2DQXA 4I5UA 4MYXA 4LANA 2BGQA 3EWUA 1GVFA 2E09A 3TR2A 3L21A 4QEHA 1MSSA 1OK6A 3TYCA 1W3JA 4C6DA 1C9DA 1SZEA 3TC7A 2JF7A 3UYIA 4ZFCA 5ABFA 3NQVA 1PX4A 5CGQA 1GUVA 2E9BA 2YYTA 4UFIA 2OWCA 3SFWA 3PAJA 1KFBA 1D3CA 3WQCA 4YU1A 4LYPA 4LEFA 4PRWA 2ACRA 1EF3A 1M03A 1XDMA 2D1ZA 4JTHA 1F3TA 2ZX6A 4QDWA 1H62A 1EP3A 4DWSC 4JD4A 2VDIA 4J3UA 3B8IA 4AIEA 3DG7A 2ZZ2A 3ZIZA 1QCWA 3PBVA 3WO8A 3C2YA 1JCTA 3HQPA 4V2XA 3VD5A 5C5YA 2C16A 4ZODA 3KBNA 3P67A 1XCFA 5CPQA 4I7VA 4CNNA 4FNQA 1F7BA 1RXOB 3UJ2A 1Q6GA 5D02A 2DZTA 4MY8A 6REQA 2VXNA 1QPRA 1LL4A 3QYQA 4DI9A 4S3BA 2OYMA 4DZIA 4ONVA 3JW7A 4JTDA 2FZ9A 2NXGA 3QM3A 1XYMA 3RRXA 1JCJA 1F9CA 1V6VA 1OFRA 3BK0A 1FBAA 3QMSA 3W29A 1JPIA 1I0DA 3VNYA 1XLMA 2Y5EA 5F4XA 3C3UA 4WKFA 1UBPC 5ABEA 3WLSA 1E56A 5IHSA 1JYVA 1UWQA 1P4CA 3UJFA 3CS2A 3CEPA 2QJJA 1A5CA 3TOPA 1XYCA 4PMUA 3ZMRA 1WOBA 3VKJA 5BYWA 3ALGA 1C8QA 4AIUA 1DJYA 1XLGA 3TQPA 2CXGA 4S23A 2FZMA 3R0DA 1X38A 3M0JA 1ZENA 2A3BA 3ZOAA 3WLLA 1VPXA 1CXFA 4U3AA 3GIYA 5EBAA 2AAMA 3A4JA 3L4VA 3VOFA 1JAEA 4AEEA 4EPBC 1YTEA 1PYMA 4JTAA 4BS0A 4Q4KA 2CZDA 2E5DA 3R8HA 4GG9A 3SUWA 3N4EA 1S3HA 3G0SA 2HCVA 1US0A 5G4HC 3OHIA 3GBEA 3FJNA 2CLKA 4DPPA 4OT7A 2FDSA 1K77A 1OG6A 2CHOA 1UASA 4UQCA 1BRLA 3JUGA 2VL4A 4XAYA 1IGSA 4NAEA 3M7SA 3EKLA 1TV2A 2AL2B 5E09A 2E0PA 1E1CB 4I9MA 1SW7A 2GJXA 3UVAA 1XYFA 5HDRA 3M0HA 1BHGA 3GNOA 3XIMA 2X0YA 3OQ8A 2A3AA 3N18A 1XRTA 4CVUA 4AAJA 1GVRA 4NZ4A 1UOKA 2WSYA 3N2MA 2J7EA 4PSRA 2VCCA 1H11A 4O0ZA 3VKAA 3M0LA 2XDFA 1Q5MA 1UA3A 2RDUA 3QH2A 3HPSA 4BF9A 4MY9A 2PPGA 4R9OA 3WLHA 2VRJA 1YW1A 2BXVA 3TC6A 4ENLA 3LEPA 3VE7A 3W2UA 3TNBA 1XIEA 3TSMA 2H8XA 5KSWA 4YVVA 4EAMA 3THQA 4AXNA 1DQXA 2QEZA 1D8CA 2PDBA 1BG9A 1I60A 4UMBA 3QV6A 3ATZA 4QS5A 2WK2A 1V6WA 3B40A 2BX7A 3THDA 4GNKB 4LYRA 2PDJA 3GX9A 5D04C 3HGJA 3ITOA 2QT3A 1GQIA 1IXOA 1VPQA 4DJDA 2PFHA 2HMCA 2PA6A 4DXXA 3N13A 2ODOA 3DFOA 5I02A 2OU4A 3AHXA 4FAMA 3WDIA 5JH1A 2PWGA 3RXZA 1E6QM 4MIMA 2P50A 3EDFA 1EXPA 3NZQA 3TNOA 3S3GA 5D4YA 3MMWA 1LL6A 4ILSA 1LROA 2WVSA 4JCLA 2ZXQA 3PHAA 1LRQA 4IL2A 4HA0A 4QSHA 3GDMA 3SDOA 4YVPA 4E2DA 1O5QA 2FJKA 3GDLA 1XBYA 4AHPA 2WSPA 2GJXB 1HGWA 3N2TA 4MB4A 4IP5A 1HVXA 3D0CA 1KKOA 5I5RA 2ABBA 4AWSA 3PFRA 2A21A 2OO6A 4GCXA 3U4AA 4WSJA 4XG1A 3WZ0E 4AHQA 3Q45A 3NPVA 1GKQA 2IKIA 3B06A 3BQ5A 3CPGA 3EMZA 1XLEA 3TSBA 1B90A 3WNLA 2WLZA 4UTJA 3PBGA 5HQMA 4WDWA 5AC6A 3IJDA 2ONEA 3W7NA 4GVGA 3HGOA 3N15A 3UW6A 1QT1A 3MO4A 2GWNA 1TJ0A 4G7EA 3M0VA 4ZB5A 3SGUA 5LHFA 1U5HA 1D9EA 3LCIA 4Y9OA 3NQFA 2HQAA 5HAOA 1P6WA 4EE9A 1XLAA 3RMEA 1XS2A 4CCDA 3MC5A 3EB2A 1XW8A 3LHYA 1ZS2A 2PDQA 2NUYA 4S3CA 4O1AA 1RK6A 3WLNA 2Q02A 1E40A 1MXGA 1JF6A 3VMNA 5JU6A 1Y5XA 4GI9A 5LIXX 4MTVA 2XGBA 4ADSA 1OADA 6CGTA 3B9EA 4C6NA 5HATA 2VM8A 1F2JA 1OC7A 1J0KA 4IMGA 5BROA 5DMYA 4FXRA 3BE7A 2E6FA 5HMDA 4RE4A 4KWUA 4PTMA 3G1AA 4N9EA 4M80A 1LWHA 3ZSTA 4QAIA 1D3GA 1GOOA 4D71A 1WO2A 3S2LA 2VENA 2WSRA 2BGNE 4JFUA 4MJ4A 1HXJA 3SSZA 5FEZA 1JDAA 1R3VA 3OQEA 1X97A 5H8PA 3S1XA 3WH5A 3PJUA 3G1SA 2V3DA 3B8VA 4XTDA 3VNDA 2YKKA 3WCZA 5FAJA 2I16A 1PV8A 4XD5A 4IPNB 4MVAA 4B5NA 3UR5A 3SN1A 3AAMA 1T0OA 3GHRA 2VOMA 3HF3A 2CEQA 2RGMA 5LNVA 1Y65A 1W1VA 3U6WA 1CIUA 5CQ1A 3RF9A 4LSBA 3BC9A 1NAL1 4I3GA 5AYXA 5CSUA 1I8JA 3TW6A 2D2OA 4IFKA 2ZWZA 3VGDA 2WVVA 5AC5A 1TV8A 4INFA 3VO0A 4IOTA 1Z42A 3ZT6A 4FF5A 1EA9C 1CGTA 5HQLA 4JICA 1O95A 1H1YA