1GJUA

Maltosyltransferase from thermotoga maritima
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
636
structure length
636
Chain Sequence
MLLREINRYCKEKATGKRIYAVPKLWIPGFFKKFDEKSGRCFVDPYELGAEITDWILNQSREWDYSQPLSFLKGEKTPDWIKRSVVYGSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMMLLLPFVKSLGADAIYLLPVSRMSDLFKKGDAPSPYSVKNPMELDERYHDPLLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELADYTPPRAEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFGIITPPGFSDLINDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYGIDGARLDMGHALPKELLDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGVLNFIKKLIKVRHEFLDFVLNGKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords MALTODEXTRIN GLYCOSYLTRANSFERASE
total genus 191
structure length 636
sequence length 636
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09083 DUF1923 Domain of unknown function (DUF1923)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gjuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gjuA01
5EMYA 3ZO9A 5BXPA 5FIPA 3A21A 4W93A 2W67A 1JFHA 3MMWA 3IAPA 4GIAA 2OW7A 3ECQA 2FGZA 2O92A 3WQ4A 1NWRA 1OCQA 2WVVA 2VR5A 3WNKA 3CTTA 1HIZA 1P6WA 5I6SA 1V3IA 2GJRA 1TQSA 5C8BB 1F4AA 4NZCA 5GNXA 2OYLA 2J4GA 1I75A 1BQCA 1HXKA 4WF7A 4H8UA 1GJWA 1DP0A 1H0GA 2DT0A 2DSWA 2PWDA 1R75A 2VRQA 3SCQA 3A4XA 4HOXA 4D6HA 2GUYA 3VINA 3T0DA 1GQKA 4EK7A 1QWUA 2G3JA 5AYBA 1E55A 3U57A 4WKHA 2DIJA 3WD2A 2J79A 4JCLA 4NRSA 2JF7A 1QVBA 1UR4A 1BGGA 1KXQA 4UQAA 3K4AA 3IJ8A 4RE2A 3UG4A 5JUVA 2XFRA 3FHQA 4AMXA 1OBAA 3PZGA 2WVUA 5E0FA 2X05A 4LQ1A 4UR9A 1O7AA 3WH5A 3L4ZA 3B9EA 4KMQA 3VD4A 4GO9A 1BYAA 3WEOA 1OIMA 3DDFA 4QCEA 3VIOA 4AD1A 1FA2A 1V02A 2YBUA 3ARTA 3WD1A 4AW7A 5CLWA 4WK9A 1XYZA 4H04A 4S3JA 3BAWA 3GYCA 2O9PA 3VU2A 1SMDA 3VGBA 4PBGA 4UOQA 1E6ZA 1VFFA 1WDQA 1VBRA 4MJ2A 4LYRA 2WM0A 1FFRA 2DSZA 4PEEA 2GFTA 5I78A 1W9VA 3AMLA 5A8MA 4PMUA 4W7WA 1CGWA 1UZ1A 4D6EA 1HKMA 3CZJA 3U5UA 3EDEA 4QCFA 3T0AA 1C91A 2WSKA 3CHEA 2DT1A 1XCWA 4XZBA 2ZX5A 3VUPA 1WO2A 3OGSA 5I23A 1HNYA 2DT2A 2GJXA 2IXVA 3WBAA 4HA4A 2WZEA 1VFMA 4OOUA 3D5HA 4CUCA 4TVUA 3TTQA 1TQTA 1E6NA 4AZCB 4Z2HA 3PTMA 1FH7A 2OWXA 3AFBA 3LMYA 4ZE4A 3PZMA 5GNZA 1UD6A 1A47A 3ZR6A 2J8GA 3VMPA 3QHMA 1DWJM 3ZMRA 1LL6A 4F8XA 4BZYA 2J77A 1VJSA 4FNSA 4D6DA 2VQUA 4DM1A 3VDCA 2ZUTA 3NSMA 3VIGA 1HL9A 1ITCA 1OSEA 3AXIA 1ITXA 1W9BM 2VNCA 3GXPA 2FE0A 4JL2A 4AIEA 4OKDA 2RGMA 4J28A 5A8OA 2CEQA 4S3KA 2E8ZA 1NWSA 5A6JA 1X6LA 1PIGA 4UQDA 1E43A 2ZX6A 2XWDA 3L4UA 1O7DC 3GDBA 3EDFA 3DYOA 4NX0A 3MU7A 4P7NA 3RPMA 1KTCA 3PZOA 3K8LA 4MAVA 2V3EA 4PYSA 2D0HA 2Z1KA 1C8QA 1ZJAA 1UR0A 5EBAA 1W1PA 5IFTA 4W8BA 4UFKA 5CJ5A 4JFVA 1UG6A 2XTKA 4LYQA 4J3WA 4ATLA 2GDVA 3CUJA 2Y5EA 4MNKA 1ISVA 2GK1A 4CD5A 4U3CA 2VX7A 1EHAA 3OGVA 3THCA 5D9NA 3PZ9A 2BHZA 2XM2A 1FH8A 1JD9A 3WDJA 4EE9A 2YLLA 1VRXA 2EO7A 4MNLA 8A3HA 5BXSA 1US2A 1OT2A 2FH6A 1AMYA 3HU7A 1JIBA 4H8HA 4KRTA 1WDPA 2WBKA 4ZEPA 1WZLA 1HJSA 5LA1A 4MDOA 1EGZA 3CMJA 4L4OA 1S46A 3H54A 2J7BA 1WE5A 5A95A 2F7QA 4MNMA 4CD6A 2F7RA 4GQQA 4YHGA 2VCBA 3ZJ8A 5A6BD 2WCGA 3LPGA 4BQ2A 1TQVA 2XG9A 5A8NA 4UQCA 1CXHA 1E6RA 5JIPA 3IANA 3N04A 1G5AA 3BCDA 3BUQA 1ZBKA 1H3GA 4AD4A 3AS3A 1JF5A 3GNRA 3WUEA 3DYMA 4CKQA 2XIBA 1DWHM 5IXEA 3FAWA 2HVMA 1UD3A 1UH3A 1UR9A 3WQVA 3KLLA 1JAEA 3WNNA 3MS8A 3CBWA 2GJPA 1JYVA 2WMFA 1R34A 3L2LA 3W38A 3WDQA 1E73M 4P7LA 3MUZ1 4UFLA 3EJRA 3SUUA 2XJ7A 4D6CA 3S2CA 3WH9A 3GM8A 5ABFB 2D3NA 3L4TA 3WD0A 1Q6FA 2X0HA 4BS0A 3RILA 4B9ZA 1CBGA 3E1F1 1JNDA 3ARVA 1BFNA 5D9MA 2X2HA 1R87A 2XUCA 1V02E 5CSUA 4F9JA 5CPSA 3WY1A 4X0VA 3WIJA 2JALA 5BWFA 2BHYA 4W8AA 4MADA 1MW2A 2O9RA 4PMVA 3K4DA 3WD3A 2DSUA 3N12A 3BAXA 2UY2A 4PMZA 4U33A 3BVXA 5E1QA 1UWSA 4AZBA 3W37A 4YHEA 3VIKA 1HWWA 1TZ7A 4EANA 2X8RA 2YA2A 3AYRA 4TX8A 4DUWA 3J7HA 5FD0A 1M04A 3WL1A 3AS0A 3ZT5A 1HJUA 1VF8A 3AYSA 3HG4A 1E4NA 3MI6A 4J3SA 4EAMA 4TX6A 5ABFA 3WF2A 3CUIA 3TOPA 2CBJA 3A6OA 1BVZA 2VUYA 4D1IA 2CKRA 1GHSA 2ZWYA 3POCA 4QFUA 2AOSA 2J74A 4B15A 2VURA 5E0CA 3CUGA 3VGFA 1X6NA 4WKFA 2J62A 1NP2A 3WKZA 1GQLA 9CGTA 1HXJA 1GW1A 4CU7A 2V5DA 2A3AA 4CU6A 2Y4SA 1WB0A 2QPSA 1BSIA 3WEMA 4HZ7A 1CTNA 2D23A 4U31A 1UD4A 1DWGM 3BUBA 3VSTA 1NWUA 3CHFA 2V38A 1XH1A 3UEQA 3ZJKA 2YLAA 2VX6A 2YFOA 3AOFA 5AYIA 1KXVA 4FMVA 3TTYA 4AZ5A 4A4AA 3A47A 3FY1A 1VB9A 3VOCA 3VDBA 2YA1A 4PTVA 4U2YA 1WZMA 5I2UA 2WVSA 2G4FA 4JIEA 3VD9A 2WPGA 2CERA 2WANA 2VQTA 4CCCA 1XGZA 1UWRA 3BC9A 4PMXA 1RD6A 2OWWA 2DH2A 1VBUA 1CGVA 1E6QM 1R86A 1E5NA 1CDGA 3BLKA 4FLRA 3UESA 3I3EA 2J7FA 4ZXOA 3UR8A 1KGXA 3SCUA 3BLPX 2IUZA 4QLJA 1W1VA 2X2YA 1DHKA 4PMOA 3OZOA 3WBEA 5DT7A 5DFAA 5IHSA 4AWEA 1H49A 2XYLA 1ZB5A 5I3DA 4OJYA 5FL1A 1KBKA 3MMUA 4XB3A 2VVSA 4UTFA 1BF2A 3WMSA 2WZHA 1BYDA 3NJ3A 5GNYA 5A1AA 2GJXB 2D20A 1QWNA 2OW6A 3EBVA 1HKJA 2D1ZA 5LA2A 2Y8VA 3HG2A 4A3YA 2UWFA 1W3LA 4XZWA 1XH0A 1E6XM 1V3JA 4XX6A 4Z2KA 4TTUA 5HDRA 3MV11 2YBTA 5ABHA 2DH3A 2QF8A 5A6AA 7CGTA 4AD0A 3I3DA 4EKJA 1KCLA 1UD5A 2ZUMA 1PS3A 1KR1A 4CD4A 1ECEA 1OGGA 3CZGA 3DX2A 1TG7A 3AMGA 1E1FA 2E3ZA 3VIIA 1GOWA 1W32A 2V5CA 3BAYA 3CUFA 2EJ1A 1NARA 3G6LA 4NRRA 2ALWA 3EDKA 1HKKA 3PZIA 4PTMA 1BYBA 4M80A 3W29A 3H55A 1L0PA 2VT0A 4AYSA 1OD0A 5CXPA 4WSJA 2BFGA 5FOOA 2YL6A 3MV01 3VIFA 3OGRA 3AZSA 7A3HA 3K8MA 1J18A 3ARPA 4UNIA 1CLVA 1IT0A 3AMDA 1BHGA 4MB4A 1BG4A 2DSKA 1E72M 1PZ2A 1VFOA 1UKOA 4DUXA 2DDXA 4Z2JA 1R47A 2GK1B 1W2VA 2QHAA 2XN2A 2BVDA 1ZBVA 5LYRA 2WLYA 4RE4A 3OG2A 3H53A 5CGMA 4H8VA 5TD4A 1B31A 1HF6A 3WELA 2PWEA 2WNWA 1BAGA 3A4AA 3VGEA 4UFMA 3KL5A 2BXZA 1B90A 5CG0A 3SUTA 3EJSA 1PIFA 5I5RA 2FDMA 3NDZA 1WKYA 4AZ6A 2VOTA 1J10A 2ZICA 3GNOA 3II1A 1QNRA 4C7DA 5DMYA 4MDPA 3DHUA 1DWFM 4V27A 1FP8A 1HT6A 4FLSA 2WHJA 2J78A 1CNVA 5E9AA 4W88A 2VZTA 3TP4A 2C7FA 1SZNA 4TXEA 1UWTA 5A6KA 3VGDA 3DHPA 3PTQA 4Y7EA 3A3HA 1F4HA 4NZJA 4B3KA 3QOMA 1MXDA 1VAHA 1KQYA 4ACZB 4F9DA 3BUPA 3N11A 2DSVA 4PMQA 4DO5A 1PEZA 2Z1SA 1E0VA 4HMDA 3AIQA 3GXIA 2JE8A 3ZR5A 1HJQA 3ARQA 3NSNA 2OYKA 3VNYA 4W5UA 2WWCA 4W84A 2FH8A 2VTFA 3ARRA 1JZ8A 5F7UA 3QHOA 2CNCA 2CHOA 1UHVA 4MAZA 2WMHA 1H5VA 3SCSA 3BGAA 1BTCA 4AEEA 1MW0A 4AEFA 4HPHA 3RM8A 5FL0A 3LRLA 4LGXA 4WIWA 1QNPA 1JDDA 1V6UA 5KEZA 4AC1X 4W87A 1B3YA 4PSRA 2VJXA 4R5EA 3AMKA 4UQBA 2EPMX 1H1NA 1XSIA 2F1BA 2WW5A 4AD5A 3AISA 2DEPA 1B0IA 3APGA 3BSGA 4UFHA 3L4YA 4JKLA 2ZUNA 3AZRA 4JKKA 3AIRA 3W6MA 4DWSC 4LXFA 3HMCA 2BY3A 3BVVA 2CITA 2G8ZA 4MTVA 2Y24A 4U5KA 3AHYA 3POHA 3VDHA 5DEZA 1L8NA 2IXUA 2J7GA 2VCAA 1CXKA 4OGZA 2J7EA 2NT0A 3ZM8A 3MMDA 1W9DM 1C8XA 4DWSB 2WKGA 1E15A 3TTSA 3VM5A 6A3HA 4AZCA 3THDA 1CECA 1UH2A 2NSXA 3WDIA 3ZOAA 3FNDA 3ZIZA 2CKSA 1CGTA 3GBEA 3AHZA 3DX4A 1J9YA 1UWUA 1MQPA 1V0NA 4Z2LA 3VX0A 1EDTA 3BXWA 5BYWA 1GNXA 3PZVA 4B9YA 1KWKA 2WBGA 1OD8A 1MW1A 3CUHA 4D6JA 3VIMA 1R7OA 4W5ZA 2WVVB 2VRJA 3O2LA 3WENA 1UQZA 4GZJA 4PMNA 2FHBA 3AIVA 1FHDA 2XFYA 3IAQA 3W53A 2DPEA 3AZTA 4D6FA 4HOWA 2PBOA 4PRWA 1C7SA 1PX8A 4W85A 3RM4A 1UKTA 2XVPA 4HP5A 3S5YA 1C3FA 4CD7A 4GI6A 4H41A 3T2QA 5CSYA 4AMCA 3RJYA 3N9KA 2W63A 2W91A 4DO6A 3A22A 3BVUA 1UR8A 4BQ3A 1FOBA 2XVKA 4CGTA 1K9FA 2XWEA 3OLIA 1TE1A 4TOQA 1EH9A 4M81A 3WQ5A 2PWHA 1E1EA 1PZ3A 1QBAA 3A4WA 3BH4A 3N17A 1TUXA 1ODUA 5D4YA 1CGXA 2FGLA 4WSKA 3AIUA 1E56A 4ZFMA 3WUFA 1EIBA 1ZU8A 5A2AA 5A6BA 1HP5A 4OZOA 5GPRA 2E8YA 3WUBA 1WDSA 2V3GA 4CVWA 1CXFA 4P7OA 2VO5A 4UOJA 2QLYA 2XSAA 4JFUA 2WSPA 4GXPA 2G3IA 5A8QA 2X09A 3GZAA 1MFVA 1W1TA 1A3HA 3VD7A 5A3HA 4TVCA 4P8WA 1E3XA 1W9UA 2PC8A 3PBGA 1M01A 3GNPA 2VX5A 3W24A 1CENA 1HJXA 2MANA 1CGYA 1JD7A 1KQZA 4JFSA 1MWOA 1U33A 1JL8A 2BV9A 4WKAA 2ZXAA 2W61A 3EMQA 4PMRA 1B2YA 1M53A 3SCRA 1EO7A 3B8SA 2WC7A 2VI0A 3N13A 1Q6CA 3WFZA 2DT3A 1AVAA 5I79A 2F61A 3KZSA 1PBGA 4P7QA 2E4TA 2W62A 1W3JA 4X9YA 2DIEA 1KR0A 4KRUA 3UG3A 3UCQA 1EDGA 2X2IA 3TTOA 1TQUA 4AD3A 1GOMA 1CXLA 4E2OA 3KEHA 4H7VA 3DX3A 4ATDA 3AXHA 3TONA 2WK2A 2E9BA 5BRPA 3GTNA 3WY3A 2YL5A 3GXDA 3WSUA 5CLTA 1D7FA 2A3HA 4ATWA 1W9XA 1UZ4A 1OWQA 3VIJA 2FHCA 2JEPA 3OLGA 1KB3A 3FN9A 1Q6EA 3PZUA 2WLZA 4AIUA 4FNPA 2E9LA 3QHNA 3CZNA 2F2HA 3WNPA 3SUVA 4W7UA 1PX3A 1D3CA 3HG5A 1Q4NX 3VSUA 1MQQA 3FXYA 4F66A 1WNOA 1E4LA 2ZX7A 1AQ0A 4MB1A 3MUAA 4PTWA 3BLBA 5E6ZA 3O9NA 1ZJBA 1CYGA 1WCGA 2J8FA 3W26A 5ABEA 1EQPA 1FP9A 2ZUUA 2XVGA 2YIHA 5ABGA 1CZ1A 4FNQA 1QHZA 5BXTA 2WXDM 3VNZA 1UR2A 3EDJA 2XFFA 3WMBA 2OSYA 2EPOA 2ZUVA 3PHAA 4PUEA 1ISYA 2PWFA 1ZBCA 2G3MA 1O6IA 1CIUA 1JI1A 5A6LA 3T09A 5ECUA 2D22A 4MNJA 1NH6A 1E4MM 3QR3A 1JZ6A 2Q8XA 1TQWA 1E0XA 3PZNA 2XPKA 4LX4A 3EJTA 4D6GA 1FH9A 2JIEA 4LPCA 3GXFA 3WH6A 3ARUA 2D2OA 2J75A 2F8QA 1QOXA 3PN8A 1HX0A 3WQWA 1J01A 3AROA 1HVXA 3AXXA 5CZKA 1K9TA 2V3FA 3VO0A 1G9HA 5A2CA 1LG2A 2WC4A 3NIYA 2CETA 3SCOA 3EDDA 1VEOA 3ARSA 2X0YA 2UY3A 5GQBA 4CN6A 4Z2GA 3NDYA 1TCMA 5A94A 1KTBA 1B3XA 3CO4A 2VCCA 4AZIA 1TVPA 1KCKA 3G6MA 1GOQA 3EMCA 3KL0A 1RP9A 4UCFA 1JAKA 1QNQA 3WF4A 1EA9C 1MQRA 5I77A 3SCTA 2EPLX 3N1AA 1XSJA 1OIFA 4BA0A 1V03A 1JYNA 1UR1A 1W91A 2W92A 5BROA 2DGAA 4ACZA 1C8YA 3AHTA 2A3BA 2GDUA 3JUGA 1H0IA 1QNOA 1IZKA 1GCYA 3RIKA 3K8KA 3FAXA 5I0DA 2OLHA 1MXGA 4PMDA 1TA3A 3GBDA 3SURA 4KGJA 3LXAA 1H09A 2CESA 2XGIA 2PB1A 3CZLA 4PTXA 2PF0A 4CCEA 1LWJA 4IISA 1UYQA 1UA3A 4J3XA 3KE0A 2NW0A 3RDKA 3RJXA 5JBDA 2E9MA 3PTKA 1ISXA 3VX1A 3VDAA 3BVTA 4CCDA 1TR1A 3GH5A 5AC4A 4FNUA 5A8PA 3OLDA 2YKKA 1GJUA 1H41A 2CBIA 2J7HA 5A6SA 1JYWA 5AY7A 1HTYA 2ZOXA 1V6XA 1H2JA 1AQHA 2VR4A 1JGIA 3S5ZA 1MYRA 1NOWA 1NOUA 3F5JA 4PCTA 3UERA 2XHYA 3BCFA 1VEMA 3ZT7A 4C7GA 3K1DA 3DX0A 1V6YA 4J7RA 2EQDA 2XVLA 1EQCA 1K9EA 2F7OA 1V6WA 4C7FA 4PMYA 1ISWA 2BNJA 4RL3A 3CPUA 3T2OA 2A3CA 3WQ8A 1EDQA 5D8WA 2YL8A 5IHRA 3RO8A 1OGSA 4P7RA 2EPKX 3SCPA 1BGAA 3CZEA 2ZXQA 4MJ4A 1NWTA 2YL9A 1XCXA 1V3MA 1CWYA 2W5FA 1J12A 2BVYA 4JHOA 1QX1A 5IFPA 2VRKA 2ZWZA 1QPKA 3D52A 2JF6A 3WH8A 1E9LA 2WCAA 1C7TA 4TUFA 5IDIA 1UH4A 4X0NA 3D3AA 4CU8A 3DC0A 5D9OA 4U5IA 2XN0A 1JZ4A 3MSDA 2B31A 1NOFA 1JDCA 3LXBA 4KWUA 1JYXA 5JBEA 1GORA 4M82A 3AIEA 1E40A 4NXKA 3WUGA 3PZTA 3ARWA 3WY4A 3VIHA 1BVNP 3AJ7A 1ZBWA 3AMCA 2ESCA 3CZ8A 3DECA 2XN1A 2HISA 1QI5A 2DQXA 1G01A 3W81A 1OB0A 1LLOA 3BUIA 1VIWA 3EJPA 3LRMA 1NP0A 3ZSTA 1XD1A 4URIA 4IPLA 1B30A 1B3ZA 2C0HA 2XGBA 3ARYA 4ML4A 3W27A 5M5DA 5DO8A 3VGGA 2ZXBA 3VM7A 4JHZA 1IV8A 4DO4A 7TAAA 1B1YA 2WAGA 2GSJA 4DWSD 3WY2A 5CPQA 2CXGA 1HJWA 2BY1A 4HTYA 1JXJA 5EB8A 1V08A 3MO4A 2G41A 4M8UA 3NSXA 1UUQA 2VC9A 2F7PA 3UR7A 4PCSA 1JF6A 1B3VA 2QPUA 2WMIB 4P8VA 2WVTA 1W3HA 4AZHA 2UY4A 1MVYA 1GOKA 1KXTA 3CZKA 1E6SM 1EO5A 1WP6A 1LJYA 3IJ7A 8CGTA 4W8LA 1LL4A 3SCNA 4PUDA 3TV8A 2QMKA 3LRKA 2BXYA 3FW6A 3MUY1 4U3AA 4BQ4A 1VEPA 3L4WA 3VKKA 1QW9A 2EXOA 2PWGA 2W66A 2EACA 3A24A 2RGLA 3HN3A 5D8ZA 5E70A 1DEDA 2CCRA 4Q7NA 3I3BA 2PBGA 1SFSA 3LX9A 4U2ZA 3RCNA 3PZQA 2ZE0A 4GO8A 4JZ5A 1K6AA 2VX4A 3VILA 3WN6A 4M29A 4M24A 4GZIA 5KZ6A 2X2JA 4FNRA 4DWSA 3O6AA 2A3EA 3W6LA 1QHOA 1RPKA 3BMWA 5C71A 3AHXA 5BXRA 4GPNA 3DDGA 1C90A 3WEZA 4XV0A 4OBRA 5FKYA 4H2CA 2CYGA 3IGUA 1I1XA 2OYMA 1R8LA 2OSWA 1XV8A 1YHTA 4HU0A 2YDRA 4FNTA 1JI2A 3VIPA 4QLKA 1TA3B 3SCVA 3EJQA 3KWXA 4L4PA 1ESWA 3QGVA 5HNNA 4E8CA 1KBBA 1GZJA 2WYSA 2VZSA 1QHPA 2JFEX 1J0HA 1J0ZA 2CPUA 3QOKA 1SMAA 3OLEA 3EYPA 2D73A 4UFJA 1E3ZA 3FHAA 1XC6A 2NT1A 3CH9A 6CGTA 3VTRA 4UOZA 1VJZA 4N42A 3M6DA 4NF7A 3BMVA 3W4RA 3F5LA 1UKPA 3HJEA 2WWDA 2E0PA 2WMGA 1JZ3A 5E09A 2OWCA 2YJQA 4ZENA 3KLKA 4IUGA 1DWIM 1X1NA 2ZX8A 1Q6DA 2WZIA 5EFDA 3DYPA 1GVYA 3T08A 1UKSA 1OT1A 5CPTA 5DT5A 4UFIA 1JZ2A 1H4PA 1FFQA 3LPFA 4V28A 2BY2A 4UQ9A 1VENA 3WDRA 4A3HA 1QI2A 4ACYA 1UQYA 4N0RA 4WLCA 5M03A 3WL0A 3W82A 3CHCA 4MB5A 3CC1A 3ZJ7A 1WZAA 3NYDA 3GH7A 1HVQA 1GHRA 4ZE5A 4E4PA 1LF1A 1WAWA 1V3LA 4AMWA 1KFWA 4YPJA 4CN4A 4D71A 4J3VA 3WF0A 2D0FA 1E0WA 2EPNA 1KGUA 3AHVA 2Y2WA 1WDRA 1M7XA 3A5VA 3AIWA 1V3HA 1JZ7A 2V3DA 4JCMA 2BVTA 3EMZA 4ZXLA 3VMOA 2UY5A 4JFWA 5BRQA 1CGUA 1TMQA 2E40A 3VSVA 3ZSSA 1GUVA 2ZUWA 2EEXA 4LYPA 1BG9A 2GVYA 1G1YA 3A23A 3U7BA 3T0BA 2EBNA 4M56A 2AMGA 3LPPA 3NCOA 1J11A 1R7AA 2ZUSA 1V0MA 4MB3A 5LA0A 1CXEA 2FHFA 1XRVA 1UWIA 2TAAA 4B16A 1GQJA 2JIWA 1PPIA 1QW8A 3WD4A 1DWAM 3M7SA 1U30A 3D4ZA 3OBAA 3VPLA 1ODZA 2Y8KA 1XYFA 4DUVA 4HMCA 3KL3A 1N82A 1W2PA 2O9TA 1PX4A 3MKKA 2CIPA 1MFUA 1WZKA 1G0CA 3HG3A 1C93A 4AYGA 2BHUA 3HZ3A 4UZSA 3CIVA 3MUIA 1R85A 2EABA 5AC5A 3S6TA 3WNOA 4XUYA 3GXTA 2CBUA 3GXMA 4F79A 4Q22A 3OB8A 3WNLA 4W89A 3BVWA 3VGHA 3ALFA 2YOCA 3BUDA 4HOZA 1U2YA 3VMNA 1GOOA 5HPOA 3ZT6A 1V0KA 1LL7A 2XIIA 3RM9A 2X1IA 1KGWA 1HN1A 3WQ6A 4BCEA 2OSXA 5HOSA 1R46A 2WKLA 3CLWA 2WHLA 2WB5A 5JBFA 2QV4A 4J3UA 4JL1A 4OIFA 4JAWA 3AIBA 3SUWA 1UA7A 1SR0A 4AIOA 3CGTA 1CXIA 2F18A 1EHNA 2WHKA 4IPNB 1MW3A 4P8UA 1TVNA 4GINA 1VFUA 3WNMA 3ZQ9A 1PJ9A 5E6YA 4QDMA 3W25A 5M3WA 3U5YA 2WMJA 1T0OA 1XD0A 3UETA 1HL8A 1K9DA 4NSBA 1EOKA 3WF1A 1H11A 3WF3A 2CHNA 1HP4A 4J27A 4WJXA 4FLQA 1J0YA 1GVIA 3M07A 2VMFA 5HXMA 1W3KA 4PSPA 3N18A 5HBFA 4E8DA 1RH9A 2YDQA 3EJUA 3L2MA 1JFXA 1J0IA 3CV5A 1BLIA 1DTUA 2BY0A 4R27A 2IGTA 4OBSA 3N15A 2G3NA 3UG5A 2J7CA 1KWGA 2WMKA 3T2PA 2XVNA 1XHGA 3AQUA 3VVGA 4MPKA 4TVDA 3AS1A 3LXCA 3OZPA 4QP0A 4P8XA 4Z2IA 1WPCA 3CHDA 2D0GA 2CBVA 3MSGA 4PN2A 2VZOA 2QMJA 4IM4A 3DX1A 4AISA 3VD3A 1KXHA 4DM2A 1UOKA 4HA3A 1OGBA 3BAJA 3SEPA 5C70A 4JFTA 1HKIA 4AZ7A 1UD2A 5D9PA 1EOMA 4BQ5A 2VVNA 5CGTA 4BF7A 5HPCA 2C8NA 4OOZA 5A69A 3MANA 2YFNA 1E71M 2AAAA 5BCAA 3WH7A 4TTGA 2F1AA 3RMEA 2VL4A 4D1JA 4D72A 4QAWA 1M03A 4QLLA 1Z32X 4W7VA 3K46A 3BSHA 4FK9A 3U7VA 3OIHA 5JIWA 1YQ2A 4CD8A 1J0KA 2VZVA 1QI3A 3TA9A 1UD8A 2ZX9A 3LPOA 2J47A 2YDSA 1V3KA 1QI0A 3AI0A 2EAEA 5A2BA 3ALGA 2EADA 4GZEA 4M1RA 4AD2A 3L4XA 3W0KA 4FF5A 1W1YA 1OM0A 3GXNA 2WHMA 1JZ5A 1LQ0A 4W86A 5M17A 4GQRA 4CN1A 3BAKA 1Y7VA 3GH4A 1FHLA 2WCSA 1I1WA 4K68A 3VD5A 4KH2A 3D4YA 4AXNA 4NI3A 1HJVA 4FLOA 4V2XA 3AICA 1JG9A 3F5KA 1G94A 1BPLB 2ZIDA 1SYTA 5CQ1A 1ZS2A 1CEOA 1GPFA 1CPUA 4YN5A 3SCWA 4OUEA 2J25A 3SUSA 3BAIA 2XM1A 1C92A 4HA1A 3IJ9A 3M46A 4NXSA 3WDHA 3OA5A 1CLXA 2D3LA 3ARZA 1E4IA 1QBBA 1E6PA 4J3TA 6TAAA 1GONA 1US3A 3D50A 4GI8A 3B9DA 1B9ZA 2PI6A 1R33A 2VZUA 1B3WA 1LWHA 3L4VA 1GOIA 3F4VA 2D24A 1UWQA 2WC3A 3B9AA 4KGLA 2XSBA 1XSKA 2YA0A 3SIMA 1BYCA 1V0LA 4HZ8A 4RE3A 3D51A 4AY1A 4HPGA 4JKMA 5A6MA 3ZJ6A 1JNEA 1NQ6A 1RP8A 4HZ6A 1V6VA 5DF0A 1AQMA 3WFLA 3ARXA 2O9OA 5EFFA 2JEQA 2BS9A 1JDAA 4D6IA 1J0JA 4GI9A 1EXPA 1Q6GA 1QI4A 1TFVA 4HMEA 4HU8A 1D2KA 2ZXDA 3CMGA 3NUKA 4AZGA 4GKLA 4UQEA 3WMCA 4UZUA 1NM9A 1PAMA 1XH2A 2WMIA 1E5JA 4CVUA 2FYVA 3IK2A 1IZJA 4NZFA 3WDPP 2J7DA 1GQIA 3AS2A 1JXKA 1W9PA 2W4XA 1UKQA 5I24A 1ISZA 1LG1A 5FCZA 1E70M 3W28A 1OINA 1QNSA 4B3LA 1UASA 1ZL1A 3CZSA
chains in the Genus database with same CATH superfamily
3I75B 3MNDA 5BXPA 3ULVF 4F2TA 4NHCH 1CT8B 1OAQH 4R34A 5JU6A 4R4FL 1XYCA 2W67A 3APYA 4F91B 5AW0B 1JFHA 2XFXA 2ODHA 3KBHE 4KKNA 1KGCD 3GRWH 5DJZB 4JO2L 2DLFH 4OIBA 3NFPA 2DYPA 2Z35A 4DGYH 5F4XA 4ZMTA 4GIAA 2R8WA 3FNKA 2OW7A 1OWRM 4J2MA 2P53A 3TL5A 1VP5A 1YPFA 3SYAA 1GGUA 3ECQA 4D0CA 2CG9X 2UZXB 3P9WB 4LCQA 3UCRA 4F9LC 2FGZA 3PHQA 5DBUA 1R3HB 3K6DA 2FPYA 4POZC 1FL6B 4B50A 1RL1A 1BXBA 3SGJC 3PM6A 3ZDXE 1OCQA 1KLGB 4MCYA 3QJOA 4X4MA 5BZWA 1QKZH 4L8CB 1AFVH 4QGCA 3CTTA 4EPSA 1YEGH 4U1NA 1P6WA 2NVAA 1FYTB 5AG8A 1V3IA 1TQSA 3MLXL 4DGWC 3NIDB 3QPQD 2IQDA 3MLSL 3L5XH 3QUXB 2J4GA 2WXNA 3B7UX 2HT4D 2VUOA 4JS7A 4OD3H 1AHWA 3PDOB 3TU6A 3HA1A 3VKAA 4IOSD 3KLQA 4ZUSA 2GWGA 2YMOA 1T5WB 4N86A 1IJ9A 4Q6IB 4QXGL 4ZX3A 1LDSA 4US5D 3VCNA 3MRNA 1DP0A 2DT0A 5I30L 3MV9A 3BANA 3TEZA 3BJTA 3NXFA 2B4CL 2BS71 2XJLA 2Y7MA 1DQXA 3QVAA 4R26L 3TFKC 3QDHA 5ID1B 3M0MA 2YPVL 3TBSA 1F1DA 4OTKA 5CKGA 1XBXA 4D6HA 4DJEC 1ZKAA 5IROD 2PDLA 3VINA 5JHLL 3TJHC 3ULVC 1UUMA 1QWUA 1TZIB 2R51A 1BZ9A 2IV9A 2Z0UA 3DOSB 4OZGE 4TS6A 4XOEA 1XS2A 4H9TA 5AYBA 3U57A 2DIJA 1BEUA 3UP8A 2ISFA 2PDCA 4PMRA 4AIZB 5D1XD 4BXSV 1QVBA 2EICA 4F58L 5JXQA 1GGCH 1Q9WB 1I8LA 2BWDA 2FO1A 5ELIA 4F7TB 4ZL1A 2DIKA 3O4LD 1L9NA 2R1NA 3HJZA 1W6TA 4J3OG 1OAUL 3KPRD 2HJLB 4ZW6A 3V7AE 3GHRA 3URNA 3FHQA 3KZPA 2WVUA 3MMTA 4MUZA 2CPCA 2N7SA 4RFEA 3QUYB 4U0QB 4U0RC 5B38B 1FCVA 4WY0F 2GSEA 4IKNA 2JKTM 4M4PA 2JF1A 3TVMD 2HS6A 1NMBL 2OTDA 1EQWA 2WM1A 3IVUA 5J6SA 3GSNH 3VIOA 5JW5A 3MPGA 1FA2A 2V2WA 4Y4FA 4ZO8A 4NOBA 1V02A 5DRXA 3I02B 5IB5B 4ZMVA 3UTPE 5CLWA 1GT8A 2YBVA 3UXAA 4GXVL 4Y9MA 4Z1DA 4JG1L 5F0MB 4TV5A 1PXGA 4MWAA 5I3JA 3ARFC 1I3GL 3BSZA 5IQ7L 2CU9A 1W0WB 4HWUA 2UXTA 5KSVA 2ROXA 1VFFA 1VBRA 1I2NA 3INUL 3L2IA 5JXEC 1X8CA 1N6QH 4RDWA 5GGQH 2ITCB 4LB8A 2OEJA 1J9SA 4YHMH 2UWEE 1HESA 1Q9LB 4NLAA 2H26B 1UIPA 3HLKA 3TFBA 2Y72A 2QUVA 4WI0A 4DAGL 3I7RA 4W7WA 5DJXA 3CZJA 4BF5A 5CSZB 1ECQA 1JRHI 4FJZA 3CPLA 4DEPB 4BA8A 4FXFA 2BP0A 2VKZG 1IXPA 3S1WA 2G30A 4RNRB 5E4IA 2PGFA 4HUUA 1W3TA 2A2QT 4EUPB 2JH2A 4FI8A 3TYGH 4XZBA 3LIZL 4JZOB 3S83A 1X5LA 1HU8A 4CC1A 3N42B 1OAYH 4NBYB 2FMNA 2HVBA 1MREH 4G43B 5CFHA 3BPOC 2HXAA 3K0WA 1G67A 3VUPA 2HBXA 1KSRA 1X9QA 3ZJAA 1AQKL 2HJKA 3ARGC 4ICWA 1M68A 2IXVA 4QHRA 5E5MB 4IDJL 1S9WB 1TYEB 2IW0A 1A4KA 4HA4A 4R83A 3WJLA 4CSSA 4ZMYA 4IOIB 2WZEA 4ZR8A 4AF0A 1OTUD 7FABH 4OOUA 1LLAA 1TENA 1IGTB 5REQB 4PBVC 2GPZA 5GRUL 1ZY9A 2OMVA 3ZE1B 4YDKH 3SE8H 2OWXA 3I4KA 2B15A 2YBGA 3KLDA 2J12B 5CSSA 3KPNB 3SCMC 4PRAA 3IM1A 4X6DA 2CDEB 3IDUA 1DBTA 3ENLA 3D34A 4C6MA 4HC1A 3GI9H 1OY3B 2OI9B 2NY1C 5DVPA 3SJNA 1G7QA 4JFZH 1UD6A 3MYJA 2I25N 5KANG 4XZUB 4LIQL 3IIPA 4YU1A 4Q8BA 1RZ8A 3UACA 3LZQA 4DCQA 3F2LA 5I1GL 3U2SB 1W1IE 1RV6X 2QQNH 3U4AA 5TE6L 4LSUH 1BWWA 1DSWA 3IMWA 1DWJM 4PJ8D 2J88A 1MWAA 4NZ1A 2AXHA 1OTSD 5FGCE 5TK2A 2HB0A 4MZ8A 4Z08A 1LL6A 1MDTA 3R0NA 4BZYA 2CMRH 4GO6B 1I2OA 3MV7E 2BOBB 4L9DA 2J77A 3WHXA 3OKEA 3VXRA 1AGFA 1F45A 1VJSA 3QNYA 3NH7L 3PIQB 4FNSA 5AUMB 3QULB 4GG6B 2QAPA 2XH2A 3LS9A 3MFFB 4QJ1A 2F1EA 5H94A 2PETA 3NSMA 1OAKL 4DEUA 4ZVJA 3W70A 3IGKA 2ZRWA 1NEYA 2EKJA 5AVQB 4ZXBB 2BVPA 3AXIA 4AYBA 4ZXBA 4MMWA 4OZFA 2IAMA 1W9BM 3STCA 3GXPA 4PP1C 4YR6B 2GC7C 3DHDA 4LGPB 1U1HA 2V5YA 3QUMB 1BQRA 4OW6A 1A21A 1MHPH 4PJ5E 2UUDH 3E8UL 4R2GC 5BOFA 4CMHB 4MA7H 5AHFA 3VJ6A 3QUML 1NFAA 1VIZA 2ZJSH 3SRHA 3P4OA 2GUOB 2ZG2A 3HI6L 5CEZH 1NDMB 3ECUA 4GBDA 4XI5D 3NJGA 3ZS4A 2XOTA 5F1IA 3HVDA 3NZ8A 2ARJB 3TZVB 5IFAH 1NAMA 1PIGA 3D85D 1KLUB 4P9HC 1KJVA 2AQVA 2VFEA 3MCKA 2ZX6A 3GZKA 1I8LC 4UIKL 5I16B 1HW6A 1LOQA 2PPGA 4L61A 1K7XA 2I5QA 3FGCB 2DQGH 4BQ6A 5FUZL 3L4UA 4PLKC 4X6DB 3DYOA 4AEIH 1C29A 2DZWA 1UM6H 1LD9B 1ZE3C 3B3DA 3RPMA 3SRDA 1ALDA 5T5FA 3M64A 3B4UA 2PR4H 3L7FB 4MAVA 2D0HA 4UNUA 4GABA 1LROA 1W72B 4B9CA 1UR0A 2ZOLB 1LT8A 1Z5HA 4KHXL 5PAZA 4RJEA 4ORGA 1E3FA 5CJ5A 3LQLA 4JFVA 4B96A 3PXHA 3SQRA 3E6EA 2P5EB 4LYQA 4PR5A 1NJJA 4B41A 4BSVA 3CUJA 3HBGA 1ISVA 4HIBA 2F53D 1F58H 2VAAA 1GOGA 4OGQC 5G5DA 1IIIA 3PJSA 5I6LA 3NCMA 3O8XA 1NFBA 1JUFA 4Q9QL 3HTWA 1AFVL 1LO5A 4J4PC 3QO1A 3PZ9A 2XM2A 3OMIB 4F7MA 1JD9A 1IIKA 4PJIB 4EE9A 5LKYA 3QORA 2EO7A 4P2AA 1AZUA 2P24A 3MACL 4MNLA 5A43C 4KKBD 3WIFB 1FNHA 4WGWB 1VQTA 5BXSA 1QYGL 4TTDD 8A3HA 5CCZA 4G8EA 3JU2A 1HI6B 3MRRB 2DU2A 3CMFA 4CGUB 4O51A 2XWTA 3ZXAC 4KRTA 1KJ2A 4Q33A 3O4LB 1F11A 2V17H 4MVBD 5FF7A 5RUBA 4K2UL 1SU5A 1HJSA 4P23A 4KTEH 4YVNA 2J72A 3QWRA 1JTOA 2B5IB 2B1AH 3BT2H 3WJLC 1S46A 3V5DB 1T89C 4YEEA 4LVEA 1AGFB 4P99A 4OGYL 5AUMA 4GG6A 1I8JA 3SDDA 4Z76B 3ASOB 3MUUA 1BKHA 3N9GH 3TKFA 3IDIA 4MXVE 3DIPA 1DBMH 2LE9A 4HSNA 3KJ6L 1C16A 2AV7B 4GQQA 4LLYB 1CJYA 4NO3B 2N0KA 4RZKA 5AOLA 1PEWA 3CFBA 4PCKA 2NV1A 1C08B 1SF5A 3CDZB 5A6BD 1I9JH 4IMEA 1AC6A 1URIA 2F5BH 4NQTA 1A4JB 3JV4A 3BEWB 1TQVA 5JIPA 2XG9A 4WZHA 5A8NA 1IKNA 4W1TA 2Q8AL 3N04A 3IANA 4O4YL 3KBPA 2VABB 3ZL2A 1BFVH 1ZBKA 4AKQA 1H3GA 2A4ZA 3HOJA 3T8XA 4PRHE 1IAII 5HYIA 3KVDD 5IB1B 5FW8A 2Q9OA 5I3GA 4JG0L 4ERSH 1ADOA 3C5XA 3BW4A 4IP5A 3GNRA 3QZWB 1QNIA 4CKQA 4Z5RB 4MD5A 4UT9H 2YS4A 5KBDA 1XCFA 4MWAD 3V0WH 2QCHA 2HVMA 1UD3A 4NSKA 4FALA 5HVFB 3MR9B 3DJTA 4F2BA 1FVEB 1UR9A 2FSEB 1JAEA 4U7MA 4XVJL 4NKOB 4LPYA 3S3SA 4NO0A 3BZ5A 4JRXA 3NOIA 1UOVA 4V1XA 4OZIF 1FX6A 5EZLA 2UYLB 1XGPB 2FX9L 2WMFA 3QIWA 3OOQA 1EJ8A 2H1PH 1MI5D 5D5MF 5E0KA 2YD8A 3FO1B 5ICYB 1HKVA 1IEQA 1A5MC 1KDIA 3BO8A 3H9YA 3EJRA 4HS6B 3UXFA 2XETA 5DMIL 5FOBA 4N7QA 3NCJH 3UF9A 4N6RB 4JFYB 2EYSA 4U6VH 1X1ZA 3D69A 3C6LC 2NY1B 3A6BL 4JM2C 1OP3H 3AAMA 4MTVA 2F6UA 1MRAA 3GMQB 4MQSB 1RIUL 4XP6L 3WH9A 2E09A 2H9GB 3L4TA 3BGGA 1DSYA 3CHQA 2X0HA 4FQ1L 4BFNA 3RGTA 2I60L 4OGYH 1MREL 1NM4A 4JY4B 4CC4A 3S1VA 2FDBP 1RPXA 4X99B 1EZVY 4AG4H 4NQDD 1C12A 5D9MA 3RPTA 2O61A 4JQXA 3VOHA 4H88L 1CT8A 1OP5K 3S6OA 3MX0A 4GRLA 1ES0A 3KM2A 4DKDC 1NDGB 5DS8A 2VXQA 4QF1A 2PP9A 2B2XL 4GMTL 5I5MA 3PWIA 3QPZA 2ICCA 2QULA 4YXHH 2O9RA 1EF3A 2Y7NA 2Q3RA 1I4FA 5FM5M 3K4DA 4PMVA 3WD3A 2Y7DA 5GS2D 4DF2A 4NYLB 2QADB 1FHVA 3N12A 4O1FA 1JWUA 4N6EA 1MKFA 2C9QA 4LLQB 4NDMA 2V9QA 2UY2A 4FOKA 5AB2A 2NY6D 1FLTX 1J1PH 2D7NA 1UWSA 2R14A 3W37A 2NMSA 4TM9A 1GSMA 3VIKA 2N7BA 5GGQL 2BWGA 4EANA 3LI1A 1ME8A 1NPUA 2X8RA 5BQ7A 4H8PA 2YK1H 3AYRA 3CVCA 1ZD6A 4S1SH 4EI5C 3TGXA 1TU2A 2PDNA 3UAJA 1ZZMA 3JTBA 1XIGA 1INQA 3IBOA 1XLIA 3BPCB 4K68A 3AS0A 1JZHA 1HJUA 1G4MA 5D02A 3QG7H 4Y90A 4O9HH 2CM6A 4P46B 25C8H 2P8PB 3UH8A 1E4NA 5EH1A 3JV0A 3WIHH 4PCPA 1NCHA 3K1KC 3MREA 4J3SA 4TX6A 3KYKH 5AOUA 1NCCH 3W7MA 5ABFA 4P4RB 5IOKA 5LG6A 4M61A 4GBXD 3SKJH 1FHNA 2CBJA 4R96A 1S7SB 3NPVA 2Z7WA 3MJGX 4G8AC 1GGBH 1RJYB 5EN2B 1RH8A 3C5ZC 1GHSA 4EOUA 4FYRA 5AVRB 3EYSL 3SD2A 2J74A 1GG1A 4X61A 4YTUA 2XJKA 2DEYX 2NSMA 3CUGA 3T0EA 3UGXA 3C2AH 4A2SA 4Z1YA 1KEML 3VGAB 2J62A 4PBXA 3U6WA 3KXFD 1B4JL 4H40A 4ALDA 4PJGB 4UIMB 4ELKB 9CGTA 1AD9A 1GW1A 1H8NA 4A7TA 3KAOA 3HS0C 3IRPX 2GSMB 4N2DA 4PJ9B 1Z7AA 1YPZA 1HQRB 4PWGA 5EBLB 4EDWH 1QA9A 5KZDA 3GHBL 4CL7A 3KJ4C 4BFBD 2QPSA 2IQAA 3JW7A 3QV8A 1R3RA 1BSIA 3GUFA 5HGGS 1Z0NA 2C3XA 5DZAA 5IBLD 4U31A 1T2QH 1MFNA 3BSMA 3L5MA 2CZNA 3LEXA 43C9A 5KSBE 4M6ML 1OFDA 4DP2X 5DHXB 1XH1A 2V38A 4XMKL 3STGA 3EO0B 4YE4H 1A6UH 2QVKA 3S2AA 4KK8C 3SGDI 4YGVB 2YFOA 3SN1A 5AYIA 4B9FA 5F93C 2NNAA 3BESR 3C2YA 4FMVA 4A4AA 5GGVH 3RLVA 1OSYA 3A47A 5GS1C 3CWOX 4JDEB 3SKUD 1LE9B 1M6UA 1Y18B 1T2QL 3LGDA 1IEAB 2WNGA 2XRAL 3F05A 5F88A 2YA1A 4UT6H 4AEIL 4P05A 3JZUA 4U2YA 5I07A 1GOFA 2WVSA 4GFTB 3VD9A 3IMBA 3H9HA 1RJQA 3KWWB 3KX6A 5AW7B 1QEWA 5K1NA 4RK8A 5CC7A 2H32B 1XGZA 2JELH 1AANA 3ZY7A 2CKBH 4FS0A 4WGKA 4ZX6A 2AVGA 2FR4B 3BC9A 3GZPA 1NANI 2EH8L 3SD5A 4P57A 1DQIA 4G6FD 1II4E 1ZS8A 2X3CA 4B5NA 1A1OA 4UTWA 1F86A 3RIFK 1I31A 1K3IA 1YEDB 4KXCA 1NFDA 2E76C 1EJ7L 1Z48A 2PYFB 3UBGA 2YAHA 5T5FL 3TU9A 1EX0A 1X1OA 4B90A 4FG6C 2WQDA 4HETA 4Z7NE 5ACZB 3BLKA 4XBPA 2VYOA 4HVXA 2NX5D 3HAEB 4YHKL 1NDZA 3QRHA 3OAYK 2F54E 5KS9A 2J7FA 4FZ8H 4ZXOA 3GTIA 1Z2KA 3MCLH 4U6HA 2BSRA 1I3RA 2XPGB 3KYOA 4XI5C 1G7PB 1KGXA 4PD4K 3U4EB 1P7QA 1YN6A 3ZVVA 4YSEA 2YX0A 1LT7A 2QZ5A 4NKDA 4W6XB 5F0JB 1N59A 2X2YA 1QPQA 2G37A 4XNYH 1DHKA 4PMOA 4QS6A 4G9PA 1T20B 2EYSB 5DT7A 3L1OH 3FSTA 4WOZA 5L6YL 3HNTH 3GLAA 5CJXA 3KDMB 2AQOA 1GVSA 2FPTA 1DQTA 1MFDH 5E08L 3KPOA 3SRFA 3PPFA 1CK0H 3MJMA 4IIEA 4AWEA 1H49A 4NQQA 4UU9A 2B0SH 2C1GA 4HCLA 4WWKA 3N50A 1OZQA 3H4WA 1U8JB 3O7UA 1AGDA 2G2RB 1OGTB 3MGOA 4X83A 4JRXB 3EADA 1BYDA 3FA3A 1O7VA 1TO4A 4Y2OB 1QWNA 3S4SB 5IR1B 2OW6A 3EBVA 2NNCA 2WO4A 3D0CA 3TYEA 1L9SA 1KJ2L 2NV9A 2D1ZA 3W85A 5TE4L 3K71B 1NQKA 3C3NA 4FQCH 2Y8VA 1OE2A 4FFTA 2OMWB 3V0EA 2V30A 4MHBA 4XZWA 1E6XM 1TZHB 2BRQA 2HFFA 1RHHA 2W27A 4Z2KA 1F3JB 3SY6A 5GZOD 4QDPA 4TTUA 5EPMB 3NL3A 4ONFH 3ZFHA 4G6AD 1KBLA 4MJIE 3TO2A 3MV11 3T6WA 2ICWA 5GISL 2YBTA 4E3TA 1SM9A 3ZKND 4HPNA 2VITB 5CBJA 5JNYA 4GYJA 4ANWA 5DRZB 2JGYA 4OCSL 1DLFH 1U22A 3PNWA 4W9LC 4KERA 4AD0A 4ZA0A 5D7JC 3I3DA 4C55A 3QIBA 1CUOA 3UX9B 1KB5H 2E7FA 5K9OB 3AXKA 2JKIS 3TWYA 5DQJB 5EEVA 4X6CB 4QE1A 1I9CB 2CO7A 4KRPD 5J12C 1ECEA 2WNQA 3OW1A 4IMCA 2VC2B 3TZNA 2A1WL 1TG7A 4MAYB 3NIDF 4MYPA 4TNGA 4MVBC 1BKSA 4I5XA 1E1FA 4RZBA 3VIIA 2YKLL 1PCSA 1GOWA 1CLOL 3P9MA 1W32A 1ZP4A 4WJ5B 2EJ1A 3VWKA 2YCKX 3NR0A 4XAFA 1U3ZA 4X60A 4YL2A 1UZ6E 4KBXA 4BZ2L 4NRRA 2ESVB 2L7UA 2DI9A 4QRPA 4LSPL 5FKAA 1TQJA 1HKKA 3LQAC 3MLWH 1Y5WA 3BQUD 5CINL 5EO9A 1P1XA 4M80A 5EHFA 3TXVA 3E49A 2DQTH 5I15H 4YIQB 5BWAA 3SPVB 5B1CA 1KEGH 1RSYA 1CL7L 4HJ0D 3S8FB 1R9ZA 3RAOA 3TBVB 1OCCB 2YHGA 3NXLA 4JO8A 1HI6A 3C6SB 3GSNL 3MRRA 3K8MA 1J18A 4F20A 2IANB 5DQJA 3NGFA 2OTUB 3PWPA 2P5PA 4YHIB 3RAJL 4HJIA 1CLVA 3Q13A 4YS1A 4UOW1 3LH2L 5LKNA 3ARDA 5SX4I 4HK5A 3W2JA 4AY7A 4X7SH 4RIRA 1S9KC 1WBZA 2Y06H 1KV8A 1KBGL 4DUXA 5FJIA 3GKWL 2J8UA 1YDOA 2DDXA 1DFBH 5D7EA 4O0ZA 4Z2JA 4G7EB 3ITOA 1WJ3A 5FO8A 3H12A 5EPMA 32C2A 4QRSB 4GD0A 5BVJA 4PJDE 1T3FB 3U1SH 2BVDA 4MLIA 4L6OA 4V1YA 3BVDB 2JK5B 1YC7A 1UCBL 5IT2L 2PF6A 1OE1A 2XTSA 2ODIA 4NU7A 3FT2B 1E9OB 4KDWA 4NJAL 1OTUC 5BO0D 3EFDH 3KRBA 2OB3A 4Y2OA 5FA3A 1AD1A 4C57C 1CT5A 1HOCA 4ZPVA 3MT1A 4MDJB 1BAGA 2D3JA 3C12A 1HEJC 3M7WA 4DP0X 4R7WA 1LE5B 3MRGB 1YEEH 4YDVB 1XBVA 2E5CA 4HFUL 3N41B 1Y0LA 1B90A 3NQFA 1S5TA 5L2KE 1F3RB 3ZIYA 5I71B 3SUTA 3FCBA 1BZDA 4L4VB 5BS0E 2CXEA 1WBZB 2XYCA 1J1OH 2AEOA 2Y9RT 3CN1A 1TTJA 5FJTA 3W23A 5T1DL 2WZ5A 1RFDL 1XCQA 3CX2A 4OF8A 3LMJH 4XN4A 2CCLA 5MERB 3THMH 4AGPA 5FECB 1QU4A 2ON3A 5HWJA 4G5AA 3PWLB 1U3YA 4TQEL 4YHPB 3VVVA 2DI7A 3U2IA 1YEEL 4ETQA 1K7FA 1N19A 3OXRA 5D1QB 4FLSA 1Z8AA 3F00A 1QLRB 1NEUA 3BP6A 1U83A 4MA8L 3WNIA 2BSRB 2DQUL 2C15A 4W88A 3HW7A 4OCYH 2FL5B 2MTPA 1YEHH 4EN3C 2BODX 1YN7A 2JMRA 2Y06L 3V8OA 2DZTA 3UT0A 2NYYC 1J1PL 5HJGA 5IW3A 2FSDA 1TQBC 2KKQA 3VXNA 3W0WD 4OI8A 2A6IB 5KVMC 3HMJG 1UWTA 5T9CE 1WBXA 2VP8A 1MIML 3UJTL 4MS6A 1ZSDA 4XMKH 3DHPA 3SKOB 3VGDA 3PTQA 2KL6A 2PW2B 3OKYA 4X2RA 3MYZA 2P8MB 2D31B 2VERA 4WY7L 2NCMA 2G5BA 1W5NA 4XBMA 2XFGB 1EJVC 1AKJB 1E5CA 3FJ4A 2P5WD 3ZZQA 3Q05A 1VAHA 4JY5H 4UINL 1KQYA 3QH2A 4ACZB 5E9DA 4F9DA 2V9RA 3QJSB 2FEDD 2PPDA 3BUPA 1WRFA 3AG4B 4PJFE 2OR2A 1FZJA 5IJDC 5HPMB 4KFNA 3WO8A 4OZHE 4X6CA 3WD5H 4NIRA 1E0VA 4PUKA 1QVOB 1V54B 2GB2A 4NM8H 5D1XE 1IWBA 1GVOA 3AIQA 2EDWA 5KYUA 1XGTA 5IBUB 2JE8A 1SFDA 1OG6A 4BF9A 3M0ZA 1WKFA 4PLKD 3Q6GL 2B9BA 2XU9A 4D8OA 2DZSA 1XO8A 1RK5A 3CQJA 4HBKA 4I85A 3AHXA 3NSNA 4WUUE 3QKZA 1IGMH 2DWSA 1I82A 1PLCA 2NNXA 3LKNA 1JXDA 2WINA 2Y7SA 3KPPB 4ODSH 4WI9A 4ZUTA 3U7YH 3FCGA 4ECNA 1AMKA 2FH8A 8XIMA 1W54A 3WTVA 3FXGA 1KJ3L 2VTFA 3M6YA 3APDA 2QT6A 3IRCA 3SDDC 5AKSA 5F7UA 3FQUA 5F3HB 3QHOA 3V1HA 3C8HA 2WXLA 2CNCA 1BVKA 5CJBA 4HT1L 1HHIB 1YVLA 1HINL 3P40A 5DVKA 4I0PC 2BCKA 1CZ8H 5GRZA 2CM5A 4JFEA 4H19A 3W1NA 4UV4H 5AYYA 5C6MA 1QSFE 1F00I 1MW0A 1FG2B 3TESA 3TNNB 3B0VC 1KYFA 2BW4A 3F62A 2VGBA 1HQRA 3DNKA 5EBLA 2BMKA 5ISZE 1JRHH 5T1JA 4YYFA 5ADOH 4LGXA 2DM2A 2PYEA 4G7FA 3K6OA 3OKKA 2Q6ZA 1R3LA 5K5YA 3TYCA 5DURD 1JUKA 3DFQA 3MJ9H 3ZX1A 4K15A 4JJOA 3VXOA 4MGGA 2O26U 3OQRA 7XIMA 4B7LA 4Q2ZA 3ES6B 4PPTA 3AMKA 3KLSA 3V0HA 4X5QA 3ZZ1A 2XGZA 2XZAH 1MNZA 2W9EL 4LVDA 3SIZA 5FWQA 4GHRA 4HXBH 2EPMX 1TPXC 1FFPB 5F1NA 1X98A 2HMCA 4Z7VA 5BV7B 5E2WL 4KZDL 1CB2A 3W2KA 3G1RA 4NO0D 5GGRB 4MRBA 1RALA 1HXMA 4IXHA 4RNHA 4U3XA 2IDSA 4ZTOH 3TC7A 3TW7A 2EINB 1H5YA 1Q6OA 4AD5A 4DLFA 4YXGA 2X4RA 3LKQA 4OLUL 2JSFA 4DW2H 3N41F 1K9DA 3QIWC 3APGA 3C52A 4NKIL 4Y9AA 1WIOA 4IQDA 4TUUA 3GQFA 5BS0A 1WH0A 5DJDB 1BYNA 1U8OB 1QRQA 1P0EA 3ES8A 5L2KA 3L3GA 1SFLA 3EPOA 2AJXL 3FV9A 2Q7AA 3W1MA 2V2WB 3QPXL 3QB7C 3KBMA 2G8ZA 3NA8A 4YC2B 1RURH 4P07A 2OS7A 3MXVL 2GTQA 3MBEA 3WLIA 4DKFH 5BNKA 1CICB 3GTVA 5G4WA 2H32A 3K3QA 5CZXD 4RGMC 4A2FA 5AVVB 5B38A 1XF2A 4MD4A 1A3WA 4LUSB 4HBQA 5DK3A 3UQNA 2C79A 4A3QA 1H3WM 1COBA 2HJLA 1P5BA 3SDAB 2PR9A 3TZVD 2J7GA 3TIMA 1FL3A 3O4OB 3RR4A 4KROD 5HDBE 1FZMB 2VCAA 1VRSA 3HNVL 3IFPA 3LQZB 4JQXC 1TQCB 3EAKA 2NT0A 4H0HB 1WAAE 4A68A 3DGBA 4WDWA 3QYQA 4XZMX 4HULB 3ZM8A 4GYFA 2NNAB 1PZ5A 1W9DM 1MEXH 4GACA 4EWJA 3JUZA 5CP3A 1QJWA 1T0NB 1JHKL 4UB0L 4UDTB 3VM5A 2EYTA 4HLZH 3WKQA 5IQLA 1E15A 1YJDL 3MI2A 3QXDB 4TR9A 3HFFA 5EIIB 1X7TA 4PZVA 4HLJA 3KS5A 3EYFB 3QNZA 4R97C 2CKSA 4JG1H 2CO4A 3UO8B 3HZMB 4MGXA 3F12A 3ULVE 3TBWB 1T1WA 3KH3A 4A3RA 1UWUA 4PI2A 1MCOL 4B95C 1PKOA 4HIIA 4HS6A 3KNBA 5AYXA 4Z2LA 1T5XA 2J1XA 4C6DA 3B4NA 4LLWA 4HGWB 3CH0A 2L7EA 2LVEA 5K9JL 1NSNH 3FFCA 1GVEA 3A3WA 3LCWA 4CQ8A 4JHAH 4LRNH 4X0KA 4EVNB 1KWKA 2LR4A 1C5CH 4XN7A 5EZLB 4YEFA 2WBGA 1MZRA 2IG2L 3KW7A 4EI5B 4ODTL 4R97B 3QYCA 3VNJA 2J8OA 3IETA 3GFZA 2FVMA 3MJ8A 3IS4A 5ABDE 3B04A 1UOWA 2R29L 3SDCB 3IJYB 2VRJA 3N2BA 4NRXB 4XVEA 1SRDA 4HPOL 1A6TA 4JQIA 3EYFA 2IAAC 3QNZB 4G3YL 3WENA 1BAWA 1H7OA 1I3VA 2DICA 4KTEL 4WU7B 5AHLA 1GGOA 2NY5L 4BCZA 1SUXA 2EDFA 2XPZA 4PRWA 1FWGC 4DKFL 4P46A 4OLVH 1C9DA 2AKRB 1PX8A 4EF3A 4W85A 3DJZA 3EFDL 3EX3A 5JLZB 1MG2C 2AEQL 1UROA 1CLCA 1UKTA 1JR1A 4LASH 2E7BA 3IUHA 4QXGH 2DQFA 5JR1H 2I7SA 2XZCL 4E9QA 2AXGA 2OZ4H 5KBNC 2I1OA 1DJWA 1SMOA 2B59B 4AK2A 1JVLA 3U1SL 3W7KA 4L5FE 2X30A 2NQZA 2W91A 2GVJA 5FIEA 5FFGA 5K9XA 5KSWA 5CUSL 4M43H 3A22A 3BVUA 3IDMB 4F9PC 4MD4B 1UC6A 5CCJA 5AZEH 4LBRA 4Q0XH 4HPJA 4CGTA 3DETC 1TPC1 4JFHE 3UJIL 3HB3D 2N56A 4JHWH 4MCMA 5CHNB 4P2OD 3HKFA 3VXQA 4IX0A 4L4TE 3FQNB 5JXED 3LSOB 3BVJA 4M81A 3WQ5A 3SQMA 3MX0B 4GRLB 2CIKA 2XV6B 3O3DB 4P4KC 4GMTH 1OKEA 4GXVH 4PG9A 1AYOA 4BFIA 5IWLA 2OJPA 3EF4A 2BVWA 1ITBB 8TIMA 4NQEB 4OCYL 1PZAA 3D4GA 3I84A 3IXAB 5EL1A 5FYJU 1IXNA 3K1GA 1C5BH 1DR9A 2AGKA 5D7JB 3HHSA 4PY8I 2OT1A 4IRZH 5FM4A 3OJGA 2PO6C 1A5NC 2MNJB 3TCLA 3HZYB 3PBUA 4PJBA 4R7DB 1XH3B 1IO4C 3EJZD 2WJFA 2MNWA 1WWBX 2QPFA 1OAZH 3O6KL 3PYCA 4ZJ9A 3UYRH 3GC2A 4ZQOA 1K3ZA 3CBRA 4GKZB 1ZLVK 5JHDB 3GO1L 4OIIL 3QIUC 4AG4L 1M3UA 2G5WA 5H2BA 4J39A 4CVWA 5AW5B 1ZHBB 3FOLA 3MBEC 5D2LB 1XTMA 1ZHNA 2CGRL 4YSSA 1T80A 1TTBA 1IKFH 4WKXA 4JFUA 3ME0B 1AH0A 4HF5L 2BZNA 6ALDA 4D3CL 4C90A 1NCUA 3ZDZB 5CWSB 1RK6A 3MRCA 4R6UA 3TJLA 3WFHB 3MKGA 5DCBA 1KFAL 1A3HA 3NK4A 3VD7A 4GLRI 5FF0A 5AB0A 4F2FA 5IFJB 2BFVL 1HH9B 3PS6A 2UWEF 3M7OA 4HEPG 2FSEA 4J1UB 4O02A 4XP1L 1H7NA 3IFOB 1W9UA 3PBGA 1EUUA 3B3IB 4JDTL 5CZ0A 2ZOLA 4Z0XB 1JZGA 1PY0A 5HMEA 1CENA 2G97A 3RNQB 2MANA 1RCYA 3O2DA 2VFIA 2YK1L 2DV6A 4PJBB 4YBLC 3BPOB 3VCLB 2NXHA 2AGJH 5GSVB 2WSDA 2FJHA 4HUMB 2YXMA 3WFDL 4WKAA 5LB1A 3CLEL 3O63A 4MWAE 1SDYA 3CFJB 3HZVA 1V27A 3O6FC 3IBEA 1PL3A 3TIEB 2WOYA 1A4JA 2D4DA 3D25B 4OUIA 3I6SA 3SCRA 2HP4A 5DZOA 1ZFJA 3B8SA 4UT7H 2ZVIA 2V7NB 2WC7A 4HCGA 2C9PA 5B39G 1MUMA 1DLHB 1R2TA 3MPCA 4R0LA 3WFZA 4OM0L 4NNXA 4YVPA 4NPKA 1MCFA 2ZCHH 1AVAA 3FQNA 5I79A 4L3ED 2WY3B 2GUOA 1E65A 1PBGA 1DL3A 3FYEB 4B9KC 2NXYD 1E9QB 4RRPM 5C7ZA 3GI8H 5CD3A 4P7QA 1CFBA 2OTPA 2ZSWA 3I6GA 1W8GA 2W62A 4JN6A 4DNMA 3PWNA 2J6VA 2OCZA 3TUUA 4KZ0A 2DIEA 3E9AA 5T5NG 2BGQA 3UG3A 3UYOD 4EIBA 3ULVH 2D31A 3PQYE 4XIAA 3A64A 4NM4L 4PP1D 3WJJC 4IQLA 4B5XA 2M26A 4FXGC 4KI1A 1MCDA 5MP6L 5HMSA 3O4LA 5HDLA 4C60A 3TONA 2WK2A 2A6IA 2Z34A 2WWOA 3CHRA 2X88A 2Q8AH 5DEFA 4WENB 4UI2A 1RQHA 3GTNA 4K3EH 3WY3A 2YL5A 2BSSB 2GWNA 1OLLA 1D7FA 2O1AA 5D2NA 1TCRB 1W9XA 4JEJA 1WDDA 1OWQA 3VFOB 4YJ5A 1FTXA 1M6OA 3MBED 2JEPA 1OARL 1EMTL 1D8WA 1W6LA 4FXGB 3RUGF 1IT8A 3QHNA 5D6DA 4GAAA 4A37A 3WNPA 4I4WA 2YCLB 3FO0H 3U8GA 4IM8A 4W7UA 2X6AA 2H6PB 3O9WA 5GXBB 2R1WB 4Z3EA 4O02B 4A6YL 1R30A 1ZSXA 1FIEA 5DD6A 2FLRT 3W88A 2X4OA 3VSUA 3GDRA 5DRWB 1ET5A 1QBLL 3FO2B 3OTRA 2EIZB 1JF1B 5G4NA 1KENH 2WXKA 3EOBB 3RLSA 1Q6QA 3L5XL 4OLXL 1BD0A 4N4YB 1WNOA 3Q58A 4ZTEA 5E5MA 1DXFA 4FDWA 4R4ND 4RZCA 4GG8B 4H13C 3D9AH 4HH9B 1AO7E 3F03K 1G7LB 3ESNA 4HC1L 3ILQC 3TPUA 5H6HA 1MHHB 2IQTA 4MB1A 3CDFA 3GTTA 1TJHH 5BRZA 2HN7B 3DROA 1QQDA 1EXHA 3BW3A 4FULA 5HNUA 4K07A 4HS8L 1MHEB 4K5LA 1CYGA 4E4FA 3DFNA 3FQXA 3W26A 5ABEA 1G4RA 2PR4L 2GCYA 1MWAL 3BPNB 4QHNB 5EOTA 4D8PB 2C1IA 3MRMB 3S1XA 4QG8A 1DYZA 1H3VA 3L9YA 4AJWA 5LN4A 1FWCC 5CFAA 3RPKA 4Y0GA 4Q9QH 3IJQA 2WLLA 4NJIA 1PG7W 4DBWA 4DJDA 4W9CC 4F80A 2DYRB 2YW4A 1VFAA 3FUHA 3L3IB 3ITVA 2YIHA 3HKZA 3LIUA 3N2OA 5ABGA 1CZ1A 3W87A 2VDNL 2O6FA 2ARJA 3TZVA 3KS6A 4TL5A 4IBVA 1UP0A 2F38A 2ZZ5A 4JIHA 2RCSL 2IXQB 2QTEA 2INEA 3U2EA 4Q4KA 4Z0SA 4OZFH 3UNTA 3TO4C 1B0RA 4N2AA 4UQ2B 1C8PA 4DESA 2ZUVA 3PHAA 3NJJA 2IPUG 1RZKL 3QIWD 4TNWK 5CBAB 3QUMA 1SPQA 3BARA 3GW3A 5EKYA 4GXWA 3MV8D 1ONQB 4OZFB 5I74C 1O6IA 1HSBA 4Z78B 4K39A 4LB3A 4NRZB 3U6RA 2E59A 4OY9A 1K77A 4RGNC 3QEUA 2ESVA 3SDYH 4WW2C 4AQ1C 1NDVA 1E4MM 3QNYB 2ZSVB 3C09B 2VDPL 4WJ5A 2L0DA 5CMAA 2Y69B 3RTQB 3QG7L 4Z7QB 2G96A 1U6AL 3WIAA 3LRHA 1UFUA 1YLBB 2XY2A 3VKCA 4PJ5B 4DUOA 3SAZA 3UIZA 3T6VA 1JSYA 3O6FA 3SJVE 1MVUA 1MRFL 4X9HA 3GXFA 3OXSB 1ADDA 3W2MA 4MKVA 1A7NL 1RUML 4Q89A 1YYMH 1FFPA 2YO3A 1W17A 3M0HA 4FSAA 1HKFA 2WBJB 1BXUA 1XEDA 4JQ2A 1HX0A 4XP4L 1R24B 1P0NA 4OV4A 1KM6A 5T26A 3LZFH 1CFSA 5F7BA 3S96A 2PCFA 2BDQA 1J8SA 2AJYH 1DO6A 1EDYA 1S7WB 5CCKH 1HVXA 4I0KA 3AXXA 1H19A 5CZKA 2PDMA 1K9TA 1GSKA 4L1DA 5HWNA 4LARH 5EF0A 1RHHB 1X5XA 3H8NA 3CT2A 3OQ8A 5A2CA 2L4OA 1A4KB 5IBTH 4XD3A 2CETA 3ZU8A 3KYMA 4H7ZA 4L2YA 2Y7FA 4HIIB 1T5WA 1VEOA 2ZXEB 3RL2A 1TJGL 5HGDB 2X0YA 1ME9A 3IJIA 3WJJA 4H9VA 3LRSA 4OB5L 4WGXA 3G6JA 5T9BG 4ZUSB 1AQKH 4F5CE 2R29H 1DV7A 3JWNH 4BKNA 4OVUA 2EDMA 4HU2A 4JGUA 1KTBA 3KVJA 3ARBB 2OL3B 4WHTB 3VACA 1OCWH 4RNRA 1B3XA 2D2HA 3I2CL 2Z91B 1V5XA 5BMXA 1TVPA 3GJEB 2ZRUA 3ULSA 1WTGT 4HIHA 4Z7WB 4UDTA 2VN5A 3V5OA 2V82A 1MHCA 1P7KA 3U0WH 3EUUA 3F5WB 2UZPA 3HS0A 5ENWB 4R9XA 5GGSB 3D39E 1XLDA 3NCXA 3JQOB 2FB4H 3Q1SH 3FSAA 3VG9C 4HKZB 3L7EA 5IGXH 1QNQA 1EA9C 6REQA 3NQ8A 3QUZC 2R2HB 4ELMA 1LLZA 3FB5A 4B97A 4H1LH 1RAMA 1GTFA 3YPIA 2QQNL 2IFFH 2W8CA 4BA0A 5I0YA 1M7JA 2PDXA 5K93A 3QV9A 3S9ZA 4PRPA 3W2DH 4EN2A 4G8GE 2I57A 2WLKA 2QDEA 3MOAH 1SEBB 1W91A 1LM8V 1WFJA 5BROA 4MKSA 1HJCA 3DV4B 4FHBD 3HAEA 4ACZA 2XT1B 3AHTA 5F89B 1AXIB 2IMNA 2ICWJ 3MNMA 4DGVL 1DORA 3LBOA 1M9WA 4LSQH 2XH7A 1NEPA 3NBNA 1H0IA 3UTTE 4QJ5B 5JW5B 4OZIA 1YEDA 2CSPA 2X53A 3P2DA 3FJTA 3GHEL 1UEMA 3K8KA 3RGVC 3HGRA 3O6FD 5I0DA 1ZA6A 2OLHA 4M1BA 2XG4A 2XWZA 3KBVA 4M4RA 4EPDC 3Q3GA 4KI5E 1L3NA 4PGCA 4YK4C 1ICQA 3P3UA 4EWND 5FUCC 4C6FA 3ZLQC 4HJTA 2CESA 4KVCL 3E74A 3QCUH 2XGIA 4BI6A 4BK9A 4TSAL 4BM7A 1Q9WA 4CW1A 1RAKA 2QADC 3D33A 2JQZA 1CBVH 2PF0A 4ETQB 4CCEA 3NMEA 2ZZ3A 3S97C 1UYQA 4MZYA 3BISA 2QT3A 3QRBA 4RRPG 3B34A 2IH8A 4KV5F 4J3XA 2BO0A 3SYPA 3MUHL 2GJZB 5AQ0A 4H0IA 3RVVC 1FPTH 4ZTYA 4CEUC 5CG7A 4HKZA 3IACA 5DJCA 3TC9A 1UB3A 3EGSA 2DMHA 1TKWA 2DQJH 1P7TB 3PLYA 3F5WA 2GGEA 1YMHA 2NZ9D 3UZQA 3OKKB 2CBOA 1L7IL 1J8HD 1S3KH 1QTPA 3B2XA 1OANA 3LZRA 2WAQA 3MJYA 1HFBA 3KPRB 1JPMA 5HR7A 5G1YA 3WZ0E 1SHMA 3QJVB 1WZ1L 4LVHB 4TNVF 3O41A 1TJ2A 1W3IA 1DXEA 4CCDA 4DF0A 3GH5A 4K7VA 1CDBA 3OLDA 4HJEA 2YKKA 1GJUA 1BQGA 1JYWA 2J7HA 5A6SA 5DMJB 1IAOA 3QEQA 1T0PB 3VXPA 2D2JA 4LBUA 3WN5A 4PVNA 4NC0B 3NFSH 3WS6C 1HTYA 3FQTB 4M02A 4LFYA 3WBXA 1NCCL 3M5VA 1V6XA 4KKLC 4KQ0A 1MXSA 1BYOA 3EYQD 1T5KA 4H5SB 5DJ8A 5EZOH 1B3OA 4M7JH 5IVZA 1IC7L 5BZWB 4AJYV 3DX9A 3TBYB 4H6RA 3DGDA 3MRPB 3ORJA 1I85C 3MRLB 1P0BA 3ME3A 4RFOL 1WYJA 5T1MA 1JPHA 4B53A 3KDNA 4L4TD 3ZL1A 1NCOA 3T6QC 4BK5A 1V6YA 1AJ7H 3F7LA 3E02A 3UPBA 1DVSA 1YAIA 2V5JA 4HAGA 1X9RA 5AL8A 1YG9A 3VH8B 2EQDA 1GHFH 3CV7A 3G1SA 5FACA 1RJZA 2PYEE 2XVLA 3H3KA 1TZGL 1UM5L 2NY2D 3RX5A 4OH2A 4BK4A 1D5ZB 4FB7A 2P9RA 5FCUH 5D7LB 1G0DA 4ILDA 2V2XB 4FFVC 1DUZA 1TR7A 1ZA6B 3FU6A 4X98A 5EV7A 4CVXA 5IKCA 3DXAD 5FSDC 2QHLA 4PJEB 1V10A 3CPUA 4YCOA 2A3CA 3C8KA 3ZTNL 1YEKH 2RBLA 5L2JB 4PRHB 1NGYA 2C1PB 2PURA 5D8WA 2YL8A 5DMMA 4QRPB 1EJTC 1QR1A 4ZPTA 2DLEA 4UT9A 2E6FA 1OGSA 5L2KD 2EPKX 3WJWA 3V36A 3RBSA 3CZEA 3HCVA 5C07A 3MUJA 4JRWA 1WIPA 4PWJA 3MLZH 4QLWA 2YCEA 4UBPC 5H8UA 2G50A 3BFWA 1EEZA 2GTWA 3AB0B 2BOLA 4PRPB 1L7IH 1S3KL 3V9FA 5DT1H 1NDGA 1N7ML 3GS0A 3E2HC 3X3FL 5HYJD 1FZKA 5FYKL 1O5RA 2A2IA 4AVKA 3GIPA 5CNHA 2E25A 3W56A 2AMXA 3DESA 3ILEA 4FJ6A 3TT1L 2JF6A 4L18A 1FWBC 3WH8A 1E9LA 4ZYKA 4KJPC 4UM9D 3QDGE 2WCAA 1S7RB 1C7TA 2O5ZH 1G87A 4CJ0A 4HS3A 3O0RH 4X0NA 4HK3N 1I8UA 3HN5A 5TDPA 3RVXD 5LLIC 1X96A 3S5LG 2PRMA 3D3AA 3D87B 4S3EA 5E9NA 3CXOA 1AW1A 1J5SA 3URQA 3HOGA 4OCXH 4HB7A 3HRZB 4NP4L 1JZ4A 4FN0A 2CE6A 3BCJA 3CIWA 3D9AL 3MSDA 4BHYA 4AL8C 4UCGA 3HBPA 4G9FE 4LOEA 2NZLA 3MKCA 4JZNB 3H26A 1SY6A 5JBEA 3FT2A 4Z7NF 1KM5A 4LUIA 3MZGB 4JANA 1UUOA 3LTYA 5C2UB 3MXWH 1ZLSL 3PSVA 2ZKHL 1KN4H 3WMLA 1DSFH 4NXKA 1RIHL 3WUGA 3MLXH 4JG9A 3KPMA 4N0UE 3LEYH 3VFTB 3TYFA 4PRIA 1QLEL 4QITA 3VIHA 2QTVA 32C2B 5H37H 5XIMA 4AQLA 4D2NA 5FYJH 1M6JA 1RSCA 4HW6A 3CSFA 2J8UB 4D9LH 4ZNEE 3LN4B 3DECA 2XN1A 5DD6B 1LP9F 1O9ZA 3E9TA 5E5RB 2PXYB 4OFPA 3SE9H 1LRNA 2VD9A 3TNMB 5C0CA 3BGFB 3DO4A 3CQ0A 2Q8BL 3BUTA 1F6KA 2EUVA 3MXWL 1ZLSH 4Z7UF 2PTTA 1HYSD 3HMWH 3BUIA 1VIWA 2NXZC 3EJPA 4XCYA 1MZHA 2HV5A 4MCZA 2BCMA 3ZSTA 1RCQA 1G6RL 1PQZB 1JXFA 1YW1A 4N9CA 4URIA 1TQCC 5IQ9A 2XIJA 1Q1JL 1XFBA 4DIAA 1FSKC 3VXGA 3ML9A 2NNRA 2NX5E 4Y5VB 4JO3H 4DQOH 2WB1A 2ISWA 4HIEB 1HL4A 3ITCA 2MQCA 1FCUA 4RCXA 2EECA 4UIKH 3K4WA 2LVCA 3VGGA 3VE0A 3RZCD 1OTTD 2C91A 1KTRL 3VM7A 4ZSOE 2Z31D 1UADC 1NCIA 3RL1B 3C0QA 4F37F 5LGKA 4GKSA 3NQCA 3ZL4H 3R06A 1B1YA 2WAGA 1OAXL 4GOSA 1NINA 4ERIA 4UBDC 5GGUA 3IVKB 3WY2A 4QEHA 5J11C 2CXGA 4DWSD 1CDYA 1TJGH 1EPXA 3NSFA 4K71B 4PY8J 4TMPA 1F5WA 1P2CA 1QEXA 3CH8A 4Z76A 3CAWA 3PY2A 4HTYA 5C92A 1O6VA 2Q2LA 4L48A 2XBTA 1RULH 3W9ZA 3GVRA 2GVGA 1IXOA 1E30A 4JQIH 1QR1B 3B0UX 2IPUK 3QNFA 4NC1E 3WLBA 1C9WA 4NAMA 4Q7IA 2MPVA 2VC9A 4X8GA 5AYTA 4XMUA 4KXZI 1BG1A 2IWGA 2VLME 2R1LA 5JXEA 3FT1A 3IDNA 3THQA 5CU9A 3OZKA 3GSMA 2F7PA 3UR7A 1YE6A 1ZA3A 3ULUC 5K1VA 3EPNA 2W0KA 2WMIB 4AFYA 3QPYA 2XINA 1MFAH 4P8VA 3UZ5A 1D9KD 2WVTA 5KVFE 1W3HA 4WEVX 3CFJA 3KG5A 4AZHA 1JCJA 2QL1A 5IK3A 4LARL 4GRWB 1G9NL 4ZUUB 2B7NA 4PGBA 2UY4A 1GGIH 3EO0A 2B7OA 2PTTB 4B5UA 1ITUA 3DROB 4OJCA 5L88L 1QABA 2UZIH 3O3EB 1ELSA 8CGTA 1LL4A 1N2RA 3KR3H 4B3VA 3HI5L 3TV8A 3LN4A 1DLFL 4P3WA 5CPLA 4TQIA 2FJGB 2NY0B 3FW6A 2PLCA 2FZ8A 5E0QA 3N4AA 2MMXA 4JN8A 4U3AA 1AZRA 4BQ4A 3TQPA 1ME7A 4LVAA 1AOHA 4HPOH 1GYWA 5F7EL 5EEWA 2EXOA 4EP8C 3T0EC 1URZA 4DX3A 2X0WA 4HCRH 2DMGA 2H3XC 2NXZD 3A24A 3DURB 4LUTA 3NQAA 2RGLA 5CP7B 3ARBC 4YOKA 1BEYH 3O8AA 1ZLPA 4Y1TA 1DEDA 2G9HA 3VKDA 4Q7NA 4QRRA 4Y8FA 3VFWB 3UJJH 1SFSA 4FQHA 5C6TL 1A8ZA 4RMWA 4P2QB 5FK9B 1P5VA 3SBPA 4GSXA 4R90H 3UTSD 1Y5VA 4EF9A 1KN2L 2X1XR 3SDAD 4I1PA 2O6CA 5E7BA 1K6AA 3VILA 3FOKA 1G7VA 1WEJL 4R7VA 4P2RE 5ES4B 1I3RB 1HH6B 3KYOB 2BIOA 3U4EA 4NUMA 4I2XA 5KZ6A 3GT6A 3MV8B 1A4BA 2ZPKH 1BD2D 3NJKA 5E93A 2J66A 4MHHI 2YR3A 2A3EA 1GC1C 1FRGL 2DWEB 2IPWA 3O15A 5BXRA 4IS6A 5IVXB 1RLBA 1PCKA 2X4QB 1Q2SA 4ADUA 4J9JA 5JOFA 5AW2B 5HDBF 4BZ2A 4JB9L 4Z3IA 5FKYA 4H2CA 3U4BL 1ZLDA 3M5ZA 1JE6A 1M7PA 2EC8A 1XR8B 1BGXL 1MF2L 3SR7A 1T22A 4MMXB 4QCIA 1MJ7L 2GT9A 3MNWB 2YDRA 3V1PA 1SQ7A 3OVQA 4QLKA 3RI5F 4PJ9D 1TA3B 5FB8A 4FEMA 1E9QA 1KCSH 2BNQA 1JWUB 2XG4B 4GUCA 3QGVA 3CFUA 4KVCH 1SBBA 1LORA 5HNNA 1GZJA 2WYSA 4S3BA 2VZSA 1QHPA 4QXIA 4Z6AT 5J9PA 3N44F 5HYSA 1E8ZA 4JICA 4LCWA 2EZ0C 2ZKMX 1SMAA 2QQLH 2FWLB 2D73A 3OLEA 2ZXCA 5FCSH 4F57H 5EEXA 4PFHA 1E3ZA 3FHAA 3P4NB 5HYFA 3MBDA 3VNLA 3IMSA 3WJZA 1JNNH 3S37H 3ZRSA 3FPYA 1KYOK 3OR6B 4IPIA 1LCOA 3FSWA 3IFLL 3RUGE 1VJZA 2LAAA 2OSLB 4JUSA 1T4KB 1AR2A 2AKRA 2UY6A 1VHCA 3C4UA 3F5LA 3P5YA 4JYDA 4JPWL 2YWYA 2OI9C 4XPHH 4FQIH 3K5XA 4DNLA 1E4HA 2KZWA 4G6CA 2OELA 4LCCA 2VM9A 3LEXB 2QFPA 4YO0A 1S6NA 4YX2L 43C9B 4UIOA 3C5JA 3FUMA 4KMTH 4LPVA 3A67L 2RJGA 5BS0D 3D69B 4IUGA 4Y89A 4Q4EA 1RXLA 2CLIA 1WUNT 3QWRD 1K03A 3PJUA 3FZUD 3AU6A 2OJ1A 5C0JA 4XP1H 2GQ8A 7TIMA 2D03H 1EEQA 2ACUA 4EACA 2ADFH 3QDJD 4Z7WA 3K80A 1KFCA 1YPZB 2XTJD 4HYWA 5I30H 3L66A 4LO9A 3T08A 3AGWA 3OL2A 1NCWL 2VQ1B 4LPTA 4DERA 5ECJE 1OT1A 4HHMA 5DT5A 3FFCB 5ISZB 4HBCH 4OQTL 4UFIA 1I9IL 1SJHB 1H4PA 2DDQL 2H2PC 3PHOB 4YXHL 1LVEA 2D7TL 3QQ4A 3CIAA 4FYTA 1MO0A 5ACLA 2BY2A 3W7HA 2OX5A 1P1ZA 1YY8B 3HUJA 2BDNL 4CNPA 3LI0A 1PSCA 4UQ9A 1UWEL 3CX5K 1T1WB 4KFPA 4PS7A 1A3RL 2YGPA 2G95A 4NQVB 1NAL1 5EN2A 5HNRA 3GLCA 43CAB 4O58H 2E56A 2ZXGA 3GPEA 4K23L 5LN8A 4PLJD 3O0LA 3GUWA 3D6NA 4M61B 4WLCA 5M03A 4IHOB 2RKXA 3C08L 3RB5A 3FCPA 2F53A 4GUPB 3ZMEA 4US6A 3ECWA 4RMBA 1FGNL 2WTOA 3V75A 2P50A 5HI5C 1GW6A 3G1DA 4WFED 1CZ8L 2RH0A 3WLWD 3GH7A 1U8HB 4C56A 5EBUA 1GHRA 3QFDA 3B5GA 4E4PA 3C60C 1S7VB 5I6XC 1LF1A 2PA6A 4XVUD 1A3XA 1WAWA 1RK1B 5DZNA 2NX5A 3S3PA 3K2UH 4H3DA 3FTWA 4KNQA 3W75A 4J3VA 5FYJL 4N2GA 3N6JA 3VQ1C 3LCXA 1AG0A 2ZA3A 2IDTA 2Y2WA 1WDRA 2OO0A 3PVFA 3J07A 3NPSB 5AZEL 5FGSA 3ISIX 5DC9B 3A5VA 5CMAB 5MEQB 1I4FB 4RSYA 5DZJA 2OZ0A 4U4IA 3QZOA 3U4KA 3CX5J 1J8HE 3QARA 5EUOE 1UT2A 1XR9A 3VMOA 1DE5A 1UXSA 3KVLA 5E5UB 3QIUB 4YXKL 5EU5A 1WWAX 1HSBB 1Q1JH 2PPEA 2EE9A 3KMDA 4I48A 1GYCA 1NC2D 4PRIE 3V0WL 4DT2A 3VWKC 2WJZA 4HHPA 2V5MA 1RZJC 2OQJB 3RP1A 3VSVA 3X1GA 1GUVA 1VFTA 2PDYA 1A6PA 1ZLVH 4D8ZA 4HXAL 1SY6L 4GKNA 4S23A 1KYDA 4QEGA 3A23A 2PPAA 1SYSB 2B39A 2CC0A 4WW1B 1MCWW 4TVPL 4LEQA 2AMGA 3PXJA 4F7TA 4H6EA 5K3VA 1J6PA 2A74B 2HFGL 5JW4N 1GIGL 2BRRL 2FHFA 3F7VA 4PJIA 5IHBA 1UWIA 2QDDA 4I9XA 1CO1A 4A8NA 3ES6A 1GYLA 1HWGB 1GQJA 2JIWA 5F9JB 3LEPA 3BO8B 2OYPA 1AODA 1DWAM 4CEXC 1HAWA 1IE4A 4KKCD 3EWBX 3C5SA 1U30A 2ZCKH 3DFOA 4IZGA 2LLLA 2FT7A 4OT1L 5FWRA 3WFAA 4J23A 4OR1A 3FQXB 2UYLA 1EGJH 3W5MA 2GBVA 4KKQA 4LLUB 3SBWC 5GS0L 1LRTA 1J6OA 4LANA 4XE5B 2I9EA 2C9AA 3CHPA 3PGDA 3QQ0A 4YDMA 3Q1EA 2O9TA 1WFNA 3S1GA 1E0OB 2YC1A 1S78C 4TNWF 5DHMC 4BE5A 4DPBX 4E5XA 1TELA 2CIPA 4RLIA 1G0CA 1LEKB 2D7MA 2ZC1A 1B3IA 3HZ3A 5B39B 5E8PA 4FZEL 1NF0A 1R85A 4EF8A 4RWHA 3QNXB 1AZZC 1JPGA 4UYQA 1HIML 1FH5H 1TTAA 4FAAB 3V16A 2YEVB 5HJ3B 5I6MA 4JM2A 3WNOA 5B7MA 1UOZA 1ZRQA 2GOUA 4MASA 1ECZA 5EORH 3GXTA 3RA7L 4HNOA 3LY6A 4XAWL 3PL6C 3VOGA 1U8MB 4FQ2L 1ND0B 1MFBL 4HWZA 3WNLA 1H61A 1TTIA 4NAFA 3FN0L 1S7TB 2J57A 4W89A 1ZIAA 4NS0A 1YIXA 3ALFA 2CA3A 3LTPA 4DK3A 2ZQKA 5E8NA 1M6OB 3BUDA 1U2YA 3R7QA 1GOOA 1KB5A 2EGZA 4GBUA 3N4EA