1GJUA

Maltosyltransferase from thermotoga maritima
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
636
structure length
636
Chain Sequence
b'MLLREINRYCKEKATGKRIYAVPKLWIPGFFKKFDEKSGRCFVDPYELGAEITDWILNQSREWDYSQPLSFLKGEKTPDWIKRSVVYGSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMMLLLPFVKSLGADAIYLLPVSRMSDLFKKGDAPSPYSVKNPMELDERYHDPLLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELADYTPPRAEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFGIITPPGFSDLINDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYGIDGARLDMGHALPKELLDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGVLNFIKKLIKVRHEFLDFVLNGKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTODEXTRIN GLYCOSYLTRANSFERASE
publication title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 191
structure length 636
sequence length 636
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09083 DUF1923 Domain of unknown function (DUF1923)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gjuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gjuA01
5CLWA 4H8VA 2C8NA 4NX0A 3UG3A 7CGTA 2XHYA 3WH5A 4FLOA 1LF1A 1R85A 1BSIA 1JD7A 1VBRA 3F4VA 1DWFM 5BXPA 3WH7A 1W2VA 3ZSTA 3LRMA 5EFDA 1OGBA 4PTXA 2FH8A 3VIHA 2ZUMA 3WQWA 3NYDA 3S2CA 2CPUA 4AD3A 3HG3A 5I2UA 4W85A 4M24A 2OSYA 2EPKX 3TONA 1J0KA 4TX6A 6A3HA 3PZTA 1ZS2A 1V6WA 4UFHA 1GQIA 4CU7A 1WNOA 4D6FA 3AS1A 4X9YA 2XN1A 4P7RA 2OLHA 4E4PA 2BY0A 4Z2IA 3DX3A 3BAWA 2UY4A 3DECA 3GYCA 2WLYA 2XVPA 1VEPA 2E3ZA 1OD0A 5A8MA 4QP0A 1V0KA 1NOWA 5A2CA 5CPSA 3T0AA 1X1NA 4F8XA 1XYZA 4NF7A 4WF7A 2F1BA 3I3EA 3EYPA 1B30A 4U3AA 2XM1A 3MMUA 3ZR6A 4NI3A 1EH9A 3ARTA 2CEQA 4DO6A 3T2PA 6TAAA 4UZUA 2WKLA 4TOQA 3ZM8A 3AIVA 5HOSA 4AIEA 3LPPA 1HJVA 1E0VA 3WF1A 5GNYA 4WKFA 4EKJA 3AYSA 4D6CA 2J77A 3AZSA 4UQ9A 4WIWA 3SIMA 3PZOA 3BUPA 1J9YA 3CLWA 3ARYA 1C7SA 2VX7A 4AD2A 2BY3A 5HPOA 1G1YA 3U5UA 1GUVA 2W67A 3BMVA 1E5NA 5CGMA 2D20A 2CBJA 1TVNA 4CVUA 1Q6GA 2GUYA 2X2HA 3OGRA 1WAWA 3L4ZA 1ZBKA 4WSKA 1TZ7A 4GZJA 4GINA 3ARVA 4N0RA 1QI5A 2ZXDA 3W38A 5A8PA 2VRKA 4LX4A 4XX6A 2YOCA 1W2PA 2D1ZA 2XYLA 4JFUA 2XIIA 5A6MA 2D73A 1BYAA 5FCZA 1QOXA 4JHOA 5A2BA 4GZIA 1LJYA 4MB3A 1OBAA 4D72A 4F9DA 4P7NA 1GQLA 3WBEA 4P8VA 3VNZA 1JZ5A 4JIEA 2QMKA 3OLGA 2Y24A 4AZ7A 3L4TA 3N13A 4GPNA 1EOMA 3DC0A 2QMJA 1E4LA 3CUJA 3WD0A 5A3HA 2Y4SA 1UWUA 4P8WA 4DUVA 1W9XA 2XN0A 1UWRA 2XGIA 3RM4A 3BAJA 3AIWA 1E3XA 2OW7A 2CERA 3U5YA 2C7FA 1LLOA 1K9EA 3OBAA 2XUCA 3N15A 1BAGA 3A3HA 4NSBA 1XH0A 2PB1A 4TUFA 3ZT6A 1GQJA 2G3NA 5ABFA 2YBUA 1DWHM 4AD4A 3F5JA 1EGZA 1EO5A 3ZO9A 4P8UA 4GI8A 4B16A 4BQ2A 1EDTA 4PYSA 1OCQA 8A3HA 1H0GA 3IJ7A 3DX0A 2XVKA 2VO5A 3GXMA 3WN6A 1MQQA 5E1QA 4PTMA 2AOSA 3TTYA 4NZCA 3AZTA 3CZNA 3A4WA 4PBGA 1H4PA 4GI6A 4JKLA 2J25A 3VMPA 3PTMA 3AISA 1TE1A 4V2XA 4LYRA 4AZIA 1VENA 2WHLA 1FA2A 3MS8A 3WH9A 3W0KA 3WDHA 3ARZA 1SZNA 4P7QA 4J3UA 1MXDA 2Y2WA 1A3HA 3IK2A 3E1F1 1CEOA 1Q6FA 2IXUA 1PZ3A 1RP9A 2ZICA 3BSHA 1B0IA 1HJWA 2YDRA 2WVUA 2JEPA 2VZTA 2VZSA 1K9DA 1ISXA 3OB8A 3L2LA 4UOQA 1UWSA 4AMCA 2E9LA 4QFUA 3VUPA 1HKKA 3OA5A 2DT3A 2W91A 1XCWA 4ZE4A 2J74A 1K9TA 2WZEA 3VM7A 2IXVA 5FL1A 2OSXA 4DWSA 3BCFA 1N82A 4UTFA 3T0BA 3MO4A 4ZFMA 3CZ8A 1QNSA 1QWNA 3B8SA 1F4AA 4YHEA 2X0YA 3GXNA 2VX6A 2W4XA 2WWDA 2YFNA 4AZ5A 2XVLA 3GH7A 4HPHA 3WFZA 1UZ1A 2EAEA 2J8GA 3VGGA 1E40A 3VOCA 4CN4A 3ZJ8A 3WUEA 3ZT5A 3LRKA 2Y8KA 4BQ4A 5AC5A 2WVVB 5ABHA 2BVTA 1OSEA 1AQHA 1QHOA 3AIEA 1BPLB 2V5DA 3FHAA 1RPKA 2CYGA 2FHFA 1EQPA 2QPSA 3WMSA 2DH3A 3I3DA 3OG2A 3TV8A 1IZKA 2O9PA 3ALFA 4QLJA 1KTBA 4PRWA 1XD1A 2O9RA 3PZUA 2QPUA 4FNSA 3RDKA 9CGTA 1E43A 2X09A 1LG2A 4U5KA 3WF3A 4KMQA 2WANA 4LGXA 1W1PA 3B9EA 4QDMA 1M01A 3RJYA 2D0HA 2YBTA 1WDQA 5AC4A 3WNNA 1V08A 4D6GA 1QW9A 1V02A 1H11A 2X2IA 1CENA 5D4YA 1DWAM 3IAPA 5E9AA 2X8RA 1HKIA 4PMZA 3IJ9A 2PC8A 1UQYA 5DO8A 4GQQA 1C92A 6CGTA 2A3HA 2DSZA 3CHEA 3D52A 2NT0A 3MV11 4OUEA 2J4GA 3S5ZA 1NOUA 4UQDA 5JUVA 2DSUA 3W28A 3VIJA 1IV8A 1KGWA 5I0DA 2J78A 1MW1A 2GVYA 1EQCA 5BYWA 4MDOA 4Z2LA 5C71A 1VB9A 3AJ7A 3VDBA 3AS2A 1JZ7A 1UKOA 2ZX7A 5HPCA 2WHJA 3BUDA 1W9VA 4V27A 1CXLA 3VX1A 1FH8A 2XIBA 1JF5A 3CZKA 4FK9A 5A6BA 4B3KA 1NWRA 1ITXA 2VX4A 1TR1A 4AD1A 1GW1A 4S3KA 4PCTA 3T09A 3O9NA 1QI3A 3TP4A 2Z1SA 3KWXA 2WLZA 4DWSD 4TXEA 2WMKA 4EAMA 1HXKA 2TAAA 3FY1A 4PN2A 2O92A 3KL5A 1KGUA 5FKYA 4H8UA 1GOOA 4UFLA 4M81A 3WELA 2CHOA 3VIOA 3IGUA 3UCQA 5BRQA 1KXTA 3PHAA 1XCXA 4L4OA 1WP6A 1H5VA 3FAXA 1EDGA 3LPGA 2FGLA 4PMXA 3KE0A 2OWWA 2J75A 3GNOA 3RO8A 2ALWA 3A6OA 5A1AA 1OT1A 3WDJA 1D2KA 3VMNA 4R27A 1NARA 3BMWA 3U57A 3I3BA 4QAWA 3GXPA 2BNJA 4RE4A 3S5YA 4RE3A 3ZJ6A 2J7GA 1VEOA 1HP5A 5D9NA 5BRPA 3DX1A 3PN8A 3CO4A 1TA3A 1J18A 3W26A 5E09A 2OSWA 3KEHA 3FHQA 4D6HA 3PZ9A 1TQTA 1GVYA 2ZUUA 5E6ZA 1PX3A 2FDMA 3CUFA 5BWFA 1W1TA 4CVWA 2WVTA 1KXHA 2XVGA 4AEFA 4DUXA 4CUCA 1BFNA 1I75A 3VKKA 3BLBA 1JF6A 2IUZA 3WNMA 3CZJA 4FNPA 2PF0A 3ARUA 3GBEA 1ZJBA 5FD0A 3FW6A 4TTGA 1HKJA 5A8OA 1G01A 4MAVA 4CU6A 5I78A 2WMJA 1PIFA 1F4HA 1WCGA 3PZGA 2YKKA 3WFLA 1FP9A 4BF7A 1HL9A 1E6PA 3BLKA 4HOZA 2YFOA 3AROA 1US3A 3JUGA 3PZVA 4PTVA 1U2YA 2QF8A 1Y7VA 1FOBA 4RE2A 3D5HA 3U7VA 2ZX8A 3ZOAA 1ZB5A 2ZUNA 3BVTA 1CBGA 1C8YA 4YN5A 1JYWA 1W1YA 2VR4A 1RD6A 2XFFA 3QHMA 3VU2A 2VZUA 3GXDA 1FFRA 1NH6A 1XV8A 1PJ9A 2OWCA 1VAHA 5BXSA 2J7DA 5LA1A 1BHGA 3WD3A 2J79A 2G3JA 2J7HA 3WNPA 1UZ4A 2EBNA 4PMDA 4MNMA 3CHCA 1GCYA 5BCAA 2CNCA 1WB0A 2VTFA 3VIPA 4M1RA 1HL8A 1XYFA 2UWFA 1CGUA 1V3JA 3L4UA 5D8WA 3APGA 4ZXLA 4ZEPA 4CGTA 1M04A 2QV4A 3CZLA 1CTNA 4W87A 1TMQA 5CPQA 2WBKA 2XFYA 4TTUA 3WDIA 3L4WA 2V3DA 2D3LA 2WXDM 1VFOA 1CLXA 1JAEA 3II1A 1UA3A 3WUFA 2XPKA 1KB3A 3T08A 2ZUVA 4UOJA 2YJQA 1JZ6A 1GHSA 4W7WA 3VTRA 4M80A 4HP5A 4KGLA 1EHNA 4JKKA 4AEEA 4AW7A 3OLEA 2G4FA 3BAYA 4WLCA 4AMXA 4NZFA 1NWSA 3BLPX 3SUUA 4Q22A 2GK1B 1M53A 4C7FA 3A5VA 1CGTA 4HOXA 5IFPA 3KL0A 2ZOXA 2VX5A 3SCOA 1R86A 5C70A 4OGZA 1EXPA 1I1XA 1FHDA 2ZXBA 1W9PA 4QLLA 4W86A 4MNLA 1W3LA 1KCLA 2QHAA 2C0HA 3SCTA 4U2YA 1AMYA 3NCOA 3AHXA 8CGTA 4GI9A 2V3FA 3WENA 2ZUWA 3SCWA 1V3KA 3VIGA 4CCDA 3CUHA 1EHAA 2CKRA 1UH3A 3CZEA 1UASA 1C91A 5BXTA 4P7LA 1B3ZA 2XG9A 4CCEA 4AD0A 1V6VA 5HXMA 4K68A 4W8AA 5BROA 5FOOA 1UWIA 3A24A 3POCA 1XSKA 4BA0A 2DT0A 2J47A 3WDQA 1HX0A 3GM8A 3WEZA 3BVWA 2BFGA 4W5ZA 2F1AA 4X0NA 2WB5A 2X1IA 2D2OA 2J62A 4AC1X 3WF4A 1UHVA 1MQRA 1MW0A 1KWKA 1ISVA 3UESA 3BAXA 4M8UA 5KEZA 3NDZA 1XGZA 1OINA 3AMLA 3M7SA 4Q7NA 3AMDA 1ZBVA 3ARWA 4MNKA 3HJEA 2W66A 5JBDA 2WKGA 3CTTA 1KR0A 1NP0A 1UQZA 3WF2A 3EDDA 4W5UA 3VIMA 1TQUA 5A6LA 3EDFA 1NOFA 2FE0A 4MB5A 4E8DA 2VMFA 4H41A 3AMKA 1E72M 2XJ7A 4LPCA 4FNTA 1H2JA 4IPNB 4PMNA 5D9OA 1UH2A 3N9KA 3W27A 1ESWA 1WZKA 3UERA 1NM9A 2CHNA 1L0PA 3MSGA 1XD0A 3L4YA 1ODUA 2YLLA 3O2LA 1J0ZA 1J0IA 4A4AA 4MPKA 2VC9A 1FH7A 4D6EA 4Z2GA 1QX1A 2XWDA 1FHLA 2VQTA 2BV9A 1KQYA 3SUWA 1JXKA 4AYGA 3VX0A 4HA3A 5CGTA 2X2YA 3AI0A 1BGGA 3MMWA 1G5AA 3MI6A 1DTUA 1R7AA 2E9MA 4C7GA 5JBEA 2WSPA 1E4MM 1CGWA 2WCSA 2J7FA 3DYPA 3W24A 2YL6A 2VI0A 1HP4A 4AZBA 4AIOA 2CXGA 3SCQA 1AQ0A 2BXYA 5LA2A 3TOPA 4JFVA 5D9PA 4NZJA 1E6NA 1XSIA 1UR2A 1KWGA 2YDSA 2F7RA 4S3JA 4FMVA 3K4AA 1J01A 1BYDA 3T2OA 3GDBA 1BG4A 4DWSC 4W89A 3HMCA 3EJSA 4PTWA 4QLKA 2WCGA 3WIJA 5I3DA 4TVDA 3W82A 1MW3A 4UZSA 3LPFA 2VNCA 1SFSA 4ZENA 3VVGA 1ISYA 1OIMA 2OWXA 3UR7A 1WO2A 4F79A 2OYKA 4Z2KA 3F5KA 2WZHA 2CCRA 3BUBA 2HISA 3PBGA 1UD8A 1KGXA 3BAIA 3NSXA 3CH9A 3QGVA 3A47A 3DYOA 1VFMA 3KZSA 5DMYA 4H7VA 4ML4A 3UEQA 3KL3A 4PMOA 4UNIA 3BUQA 2YA1A 5FIPA 4DO5A 2WHKA 3AMCA 1EO7A 3F5LA 3VIFA 3IJ8A 1HT6A 1LL4A 3NIYA 2WBGA 3G6MA 2XGBA 1JZ2A 4D6DA 4ATWA 2ZXQA 2ZX5A 1BLIA 3AS0A 3WD1A 1K6AA 4LXFA 4PMRA 3KLLA 2WWCA 2GJXB 2XSBA 3DX4A 4WSJA 1CPUA 3WD2A 3NJ3A 1CDGA 5AY7A 1JI1A 2CKSA 4DO4A 3BGAA 2EJ1A 1YQ2A 1ISZA 4NXSA 2YLAA 3NSMA 4CKQA 1IZJA 4MJ2A 3ARSA 1RP8A 4V28A 4AISA 1V03A 1PX8A 4JFTA 3DHPA 1QW8A 2F8QA 4J7RA 1VJSA 5JIWA 3CC1A 3ZIZA 4ACYA 1MFVA 2AAAA 1HJSA 4LQ1A 1UWQA 3MSDA 4UOZA 5LA0A 4JHZA 3W6MA 1OGGA 1O7AA 2IGTA 3SUVA 3ZJ7A 5CJ5A 3HG4A 1GOQA 5HBFA 3OGVA 2ZX9A 3THDA 1MXGA 5EB8A 3AHTA 4HOWA 2GSJA 1WDRA 4BS0A 1SMDA 4OKDA 1V3HA 4HU8A 4UQEA 3VILA 3PZQA 2JIWA 1GVIA 1R34A 3IAQA 5A6SA 3ECQA 4GKLA 3WQ4A 3DHUA 2D0FA 4HA1A 3WF0A 2DSVA 3ZT7A 4ZE5A 4B9YA 3M07A 4EK7A 1QI2A 2EADA 2CITA 2ESCA 1ZBWA 3VSVA 1E0XA 2WHMA 3LXAA 1QHPA 2WVVA 3WQ6A 4H04A 4PMYA 1BGAA 1ECEA 1JZ3A 3VIIA 1E73M 2DSWA 3J7HA 3VGHA 4M29A 4HZ8A 1W9BM 5A69A 1KBBA 2V5CA 4F9JA 3N1AA 3WUGA 1W3HA 4JL1A 4WJXA 4W7VA 2W61A 3MUY1 4UFIA 1UKPA 4JAWA 5A95A 1E1FA 2FGZA 3VSTA 5A8QA 4PEEA 3D4YA 3UG4A 3SCPA 3WEOA 1QNQA 1KBKA 4CD7A 4Z2HA 2W62A 3EMQA 4U31A 3HN3A 3WY4A 1BF2A 1IT0A 2VVNA 4BQ3A 3AHZA 2GDUA 1XSJA 4UCFA 2JIEA 4ATLA 1TCMA 1QI0A 4AYSA 1E6RA 4M56A 1PX4A 4AD5A 1XRVA 4CU8A 3VD9A 1GPFA 2X2JA 3FXYA 2YA0A 2ZWZA 2E40A 4AZCB 3AQUA 2DDXA 5HDRA 2BHYA 2V3GA 4D6IA 2WMGA 1MVYA 3FAWA 2VL4A 1VRXA 3NUKA 3QHOA 4CCCA 4MNJA 1QBAA 2XM2A 3N18A 2PBGA 3D3AA 4KGJA 3HG2A 1W1VA 4KRTA 2CIPA 2A3EA 3K8KA 1VF8A 1V6UA 3CMGA 1X6LA 2J7BA 2EPOA 3POHA 1OGSA 2EO7A 1TUXA 3SUTA 4AZCA 2G3MA 1M7XA 3MKKA 4XB3A 1HJUA 3VIKA 1DWIM 3W6LA 4BCEA 1E55A 5JBFA 4WKAA 1CECA 4EE9A 1TG7A 1EDQA 1GOIA 3WMBA 3WL0A 1B3VA 4P7OA 4PUEA 4UQCA 3RM9A 2WVSA 3WDPP 1HTYA 3ZR5A 2NW0A 3EJTA 4JCLA 5KZ6A 1CXHA 2VR5A 1LWHA 5GPRA 4EANA 1OIFA 3RJXA 2FHCA 4NRRA 4WKHA 4AZHA 4PMQA 4U3CA 5GNZA 1E3ZA 1JDDA 2PWEA 5A6KA 2GJRA 5ECUA 4W93A 2E9BA 3BC9A 2EPNA 3SCVA 3GNPA 1H41A 1UA7A 1JFHA 2NSXA 4N42A 2VT0A 1JD9A 3D50A 4KWUA 4RL3A 5DF0A 5IHSA 1W91A 3FNDA 1SMAA 3TTQA 5TD4A 3VMOA 1QVBA 3NSNA 3AXIA 2NT1A 3CZGA 4J3XA 2A3AA 2WMIB 1CNVA 1JZ4A 3OZOA 3SCRA 2ZUSA 5E6YA 2Z1KA 4GO9A 3ARPA 3L4XA 1KR1A 4W8LA 1K9FA 1W32A 3SCNA 1B3XA 2VCBA 4A3YA 3N12A 2EABA 1JYXA 4XUYA 2YL5A 1CGXA 3GBDA 2V3EA 1HF6A 1LL6A 1TFVA 2CBUA 3MUZ1 3UETA 3VGDA 1H0IA 4CD5A 4E8CA 1PZ2A 3AIQA 2FHBA 5E0CA 3BVVA 2WMIA 2GJPA 3CZSA 3BUIA 3EDKA 2BXZA 1Q6CA 1XH2A 3H55A 3W29A 1B3YA 4J27A 3VDCA 4X0VA 1C8QA 2DIJA 2QLYA 4W88A 3WY1A 5F7UA 4F66A 3FN9A 1CZ1A 3QR3A 4HMCA 1C93A 5A6BD 1CLVA 2E8ZA 2BS9A 2WNWA 4U2ZA 1L8NA 4J3SA 3AIUA 1PIGA 1QI4A 1E6QM 2F2HA 2J7CA 4FNUA 2BVDA 4HU0A 1BG9A 4D1IA 2VURA 4W7UA 4LYPA 2XWEA 1E0WA 4YPJA 1S46A 1TQVA 3PTKA 1W9UA 1BVZA 4FLRA 2EXOA 4IM4A 2PWHA 1U30A 4MDPA 5IHRA 1R8LA 1WDSA 4OOZA 1QNRA 4AXNA 2WC7A 1G9HA 1H09A 3A4AA 1UKQA 1QHZA 4W84A 4HMEA 2DT2A 1PPIA 2WK2A 1GORA 1V3LA 5I6SA 4WK9A 3UR8A 1UD3A 3EMCA 1GOKA 3EMZA 3SURA 3S6TA 2DQXA 1WZAA 1GOWA 1UR0A 1QPKA 2D24A 5AYIA 5A94A 5ABGA 2GK1A 2W63A 4GIAA 1GQKA 2X05A 2VZOA 2MANA 2XTKA 5I23A 1JZ8A 1PAMA 1B90A 4AY1A 1BVNP 4UR9A 3RM8A 5DT7A 3EJPA 2A3CA 1E9LA 1E5JA 1C90A 4HPGA 1EIBA 1M03A 3ZJKA 5DFAA 2VJXA 1WZMA 3UG5A 3GZAA 1UD4A 1GHRA 4CD4A 3H54A 2Y5EA 1CXKA 3DX2A 2DIEA 4PUDA 3VD4A 3LMYA 5CG0A 3AZRA 5BXRA 2EPMX 1NWUA 3G6LA 2UY3A 5I24A 1CYGA 1DWJM 2RGMA 1JYNA 1UOKA 3MUIA 1KXQA 4AZGA 2CETA 2VRQA 3A21A 1E4NA 1GNXA 4P8XA 2VOTA 2G8ZA 3SUSA 3W81A 4JL2A 2WMFA 5CXPA 1V6XA 4W8BA 4MB1A 1YHTA 1OWQA 1JAKA 1P6WA 4JKMA 3WNKA 5A6AA 5M5DA 2EQDA 1B9ZA 1GJUA 1QNPA 3EJQA 1HJQA 2BVYA 4HZ7A 4OBRA 3CPUA 2J8FA 2YIHA 3HZ3A 1JYVA 2ZE0A 1UG6A 3WSUA 3O6AA 1JNDA 4PMVA 4FLSA 3A22A 3BVXA 4D71A 1JDCA 1VFFA 1V6YA 2V38A 1AVAA 1ISWA 2GDVA 3CBWA 1E56A 3WY3A 1UR8A 3W37A 3OLDA 1QNOA 3LXBA 4OJYA 3RIKA 4CD6A 1V0NA 1JGIA 2XVNA 2XN2A 2BY2A 1D3CA 1E4IA 4JFSA 1PBGA 1ZJAA 1FH9A 1MWOA 2Y8VA 3BAKA 4PMUA 1WZLA 4MJ4A 1H49A 4HMDA 1Q6EA 2W92A 4MB4A 4NRSA 3VD5A 3HU7A 1KTCA 1JNEA 1BTCA 3EJUA 3DDFA 4DM1A 3VGEA 4MAZA 2VRJA 5M3WA 3A4XA 2YA2A 1MQPA 7TAAA 1V0LA 2DPEA 4J28A 4D1JA 5ABFB 3AMGA 4B15A 3MV01 1E1EA 3N11A 4GXPA 4U33A 1U33A 2PWFA 1T0OA 1HJXA 1G0CA 3NDYA 4H8HA 1Q6DA 4D6JA 1MFUA 3AXHA 1B1YA 2CBVA 1J0JA 1CXIA 1UR9A 1HVXA 3CGTA 2WM0A 1VFUA 4GQRA 1SYTA 4AZ6A 5D9MA 4NXKA 2WAGA 2UY5A 2JFEX 4XZBA 1EA9C 1ZBCA 3EDEA 3VM5A 4ACZB 4OBSA 2VZVA 2JE8A 4KH2A 1V02E 5GNXA 2F61A 4A3HA 3VD3A 2E4TA 1HN1A 4B9ZA 3VO0A 4MTVA 1HVQA 1H3GA 3N17A 1ODZA 3W53A 3D4ZA 1W3JA 3PTQA 1UR4A 3WKZA 4CN6A 1R33A 2EEXA 3MU7A 1XC6A 4ACZA 1GJWA 3T0DA 2DEPA 2CBIA 3VGBA 2AMGA 2GJXA 2GFTA 2CESA 3U7BA 3SEPA 1OD8A 5ABEA 4H2CA 3RILA 1C8XA 4DWSB 1I1WA 4Y7EA 4J3TA 1J0YA 2VVSA 3AIBA 2E0PA 2ZIDA 4KRUA 3ALGA 1NWTA 4UFKA 1TQWA 1HKMA 1JDAA 1JI2A 3BVUA 2OW6A 3EJRA 1NP2A 2DT1A 3GXFA 3CMJA 1CXEA 3VGFA 4Z2JA 3CUIA 2F7OA 3SCSA 3LX9A 1WE5A 4OZOA 2BHZA 5M03A 1RH9A 5D8ZA 5IXEA 1R46A 3WQVA 4IPLA 3M6DA 1O6IA 2J7EA 5IFTA 3TTSA 5E0FA 2WCAA 3ARXA 4E2OA 1OM0A 2HVMA 3AIRA 5AYBA 2FYVA 7A3HA 4B3LA 3WDRA 4OIFA 4DM2A 4FNQA 4TX8A 1BYBA 3VPLA 1CXFA 1C7TA 5EBAA 1J11A 1H1NA 2BHUA 2G3IA 1O7DC 4PSPA 3VSUA 3BH4A 4IISA 2D0GA 1UWTA 2ZUTA 3AHVA 1PEZA 1GOMA 3QOKA 4U5IA 3CV5A 3BXWA 4IUGA 2B31A 5CZKA 1V0MA 3D51A 4TVUA 2VCCA 3T2QA 1B3WA 2DSKA 3GH5A 1MYRA 3L2MA 3K4DA 3MANA 4MADA 3GXTA 3M46A 3TA9A 3BSGA 3ZSSA 1DEDA 2PI6A 2O9TA 1UD6A 1JIBA 3OZPA 3VINA 3WEMA 2PWGA 2F7QA 3H53A 3RCNA 2D3NA 3LXCA 1E70M 5M17A 2UY2A 3AICA 1V3IA 2EACA 2WZIA 1UYQA 5CLTA 2YL9A 1UD2A 1US2A 1J0HA 2XFRA 2O9OA 1QWUA 5EMYA 3N04A 1FP8A 1CWYA 5FL0A 3WQ5A 5JIPA 1LQ0A 1B31A 3SCUA 1HXJA 3CHDA 3WMCA 5E70A 4TVCA 1UUQA 3B9DA 2Q8XA 4LYQA 1GONA 3CUGA 1HWWA 4GO8A 3VD7A 3RPMA 1R75A 1DWGM 1GZJA 3CHFA 4HA4A 3K8LA 2RGLA 5A6JA 1KXVA 4OOUA 3GNRA 3B9AA 3AXXA 3VDAA 4R5EA 1Z32X 3WH8A 5DT5A 1CGYA 3GTNA 3VDHA 3ARQA 3W25A 3AYRA 5CQ1A 2OYLA 4UQBA 4M82A 3WY2A 1UH4A 2DGAA 1MW2A 2VQUA 4J3VA 4UFJA 2WSKA 1A47A 3GXIA 3DDGA 3K8MA 4ZXOA 3EDJA 5I79A 3KLKA 3K1DA 1TVPA 1WDPA 4GZEA 2YL8A 2F18A 4XV0A 4YHGA 1LWJA 2DH2A 1UKTA 1JXJA 2WYSA 1LG1A 1AQMA 4QCEA 2FH6A 1G94A 1OB0A 1BQCA 4L4PA 1J12A 2W5FA 1XH1A 1HIZA 3AS3A 3WD4A 4FLQA 1TA3B 1ITCA 4HTYA 1E15A 3WUBA 1C3FA 2BY1A 3ARRA 3OGSA 4AMWA 1WPCA 1R7OA 4JCMA 3WNOA 4CD8A 3EBVA 4UFMA 3PZNA 2OYMA 1W3KA 5EFFA 4FNRA 2JF6A 3WBAA 1UD5A 1D7FA 3K46A 1DP0A 5HNNA 2E8YA 2ZXAA 5A2AA 3AFBA 5GQBA 2VUYA 3BCDA 3OIHA 4XZWA 3WQ8A 1B2YA 3GH4A 4HZ6A 1VBUA 1QBBA 3VNYA 1VEMA 3W4RA 1BYCA 3WNLA 3QOMA 3ZMRA 1KCKA 2G41A 2WC3A 3TTOA 2EPLX 1UR1A 3PZIA 1TQSA 3A23A 2JF7A 2ZWYA 3WH6A 1LL7A 1KQZA 4URIA 5LYRA 4CN1A 4PCSA 5DEZA 3WL1A 1SR0A 1CGVA 4BZYA 4QCFA 1E71M 2JALA 2VCAA 1HNYA 2XSAA 2JEQA 2WMHA 4J3WA 5A8NA 3IANA 1J10A 4JZ5A 5CPTA 2D23A 4AWEA 3CIVA 2D22A 2A3BA 1ZU8A 1OT2A 5IDIA 3THCA 1NQ6A 1R47A 1UKSA 1E6ZA 1V3MA 1PS3A 4ATDA 5I5RA 3OLIA 4JFWA 5CSUA 2PWDA 3DYMA 1JL8A 4BQ5A 3MMDA 1WKYA 3LRLA 3L4VA 2X0HA 3RMEA 4PSRA 1ZL1A 2WC4A 1KFWA 3AOFA 5CSYA 5I77A 1W9DM 1VIWA 1E6XM 4AIUA 3ZQ9A 1JFXA 1JG9A 1EOKA 4C7DA 2F7PA 3HG5A 3LPOA 4FF5A 2ZX6A 1XHGA 1VJZA 3PZMA 1X6NA 1FFQA 2PBOA 3QHNA 1CIUA 1R87A 3AHYA 2YDQA 4DUWA 1Q4NX 2WW5A 5C8BB 3MUAA 2WPGA 1E6SM 1DHKA 4UQAA
chains in the Genus database with same CATH superfamily
2JBMA 1XTMA 3U8GA 2IDTA 4JDTH 4PWHA 2R69L 1OP5H 2Q7YA 3ZKNC 4BQ8A 2H3BA 3W83A 1TU2A 4C6IA 2GC4C 4JRXA 5BOJA 2XPGA 4F92B 4DPAX 4P5RA 2Z7UA 4M4RA 3IRPX 3QDGA 3MHGA 2JCCE 4ZFZA 2IQAB 5I30L 4DYKA 1B0WA 3G6JE 3EFFB 1JFQL 3TBYA 4Q8WA 5XIMA 2XM1A 2BCMA 1C8PA 4YFDB 5F1SA 4Y2LA 2JQXA 4LSRL 3F2CA 5D6DC 3OTRA 3G08B 3BJTA 4OVUA 1MUJA 2VR7A 4KJYB 4ZMVA 3EWUA 3PWJB 4QSFA 1TG8A 4A7VA 3VXOA 4JAMA 1P4BL 3C4UA 4F9PC 5EFIB 4NZDA 2CBJA 3MGOA 4FC3E 3OGRA 3OP2A 1R6VA 4NIRA 1SOSA 3TO2A 2H7WA 5A8PA 1I85A 3Q94A 5CBJA 4JPWL 5ERWA 3SBWC 3TC6A 1QOXA 3H42H 1DQVA 3T0EE 4WCYH 4JUSA 3HE6C 3VNZA 1JNNH 1IEQA 2BNUB 1KPUB 3OLGA 3MRPA 1GW0A 3N13A 2EDJA 3CCHA 4IMLB 1JDEA 2K0RA 5E23A 5ALBH 4O53A 5I1DB 1F8MA 4HQQH 1E3XA 1HCFX 4NWTH 4I2XA 1TTBA 4KKAD 3L3JB 2PB1A 4OR1A 4O11A 4JMNA 1SPDA 3L1EA 1T7YA 3US1A 4Y8AA 2AEPH 3MBEA 1IIHA 2ATPA 5AG8A 4H9VA 4PYSA 3ITGA 4M7ZC 4ZBCA 4N8UA 2EDOA 3RAJH 3V2AR 4L4VB 3QJHA 2VLKD 1KB9J 4JFFE 4Y4HA 3V0IA 2CCVA 3HRPA 2Y06H 1QFWL 5CFHA 2PPGA 2BWIA 3VH8A 1P4CA 1PZ0A 1W0VA 3BSHA 3CSTA 3UADA 3QUYA 3MV8A 2E27L 4HUNB 2EDNA 1F3DJ 3W70A 1CU4L 3NK4A 1YNPA 2W91A 1OAXH 2J8UB 5B7EA 3EBAA 4EZLA 1KTDA 1K9TA 2ZRWA 4NM8H 2P53A 5FF4A 2PC4A 3QFJB 1DQKA 5DBUA 4G6ML 4ANXA 3X3FL 3B8SA 3R0KA 4XCEB 5IV2A 2NXGA 4AZ5A 4HZ1A 2PN5A 3D47A 5HGAB 3QUMB 4XTRD 1GT8A 1ITUA 3S35X 4MSWA 2FVMA 3WUEA 1U1UA 4XH2A 4Y4KA 3THMH 4X0KB 2BVTA 4NP4L 4DAGH 2R51A 3HBZA 3M64A 5KINA 1ZSDB 4RZCA 3NCWA 3IE4A 4PJGB 1X4ZA 4LAQL 3QLDA 2CHXA 4UMGA 3K6SB 2PZ0A 4G1MB 4QRBA 5IGXL 3O0RL 5L2KB 4JTFA 5EO1B 4JM0A 4MMXB 5HNUA 3KYOA 4P23B 1TTUA 3ABSA 1FI8C 3W1UA 3HPLA 3NJIA 4WW1B 1IAIH 1WDQA 2W0UA 4A3UA 3RX3A 3FTWA 4TVSa 1UQYA 3CHEA 3MV11 4A7SA 3VIJA 1QYGH 3MHUA 1QSVA 1ED3B 1MW1A 4HKZA 1TETL 3CHRA 3L0NA 4GH3A 2GJ6D 3VNIA 2B0MA 1MHPL 3LY6A 1FH8A 5A3ID 5D2NA 3H7LA 3HG0A 2YQGA 3VXMA 4S3KA 1XF5B 3VI3B 2F6AA 1ET5A 5EGRA 3F84A 3IRSA 3FY1A 4E5XA 1JWUA 1THFD 2UVFA 2X9ZA 5HMFA 4XN1A 1W8SA 1BD2A 2R1MA 1TT6A 3OIXA 4PMJA 4GOSA 5L6UA 1QT1A 1MJ7L 3FU7A 4R27A 4MJ6A 1K4DB 4X5PA 3GXPA 1RULH 3QO1B 1RUAH 3QJOA 4EXAA 1B4JL 4KTYA 3TBVB 2ICWI 5IMKB 1DL7L 3EZ4A 5CGYC 2C9VA 3P2TA 1GVFA 5BWFA 2VXTL 1TXKA 3O6FD 2DQGH 3EG9A 3OKNA 4FNPA 1L7TL 1H15A 5FD0A 3KHQA 1C5BL 2NX1A 4Z7WF 4MJIB 2F8XC 5IWLA 2AJVH 3CXFA 5HJBA 2QS8A 3VCRA 4POUB 4DKFH 1IL1B 5E6IB 1QQDA 3EEGA 5DDHA 1NL0L 4Y96A 1OAUL 5DMKA 2Z6FA 3GXDA 4EI5C 1R9YA 1MDTA 2GWNA 1XV8A 3Q6FB 1KCXA 3QUHA 3FUFA 1DIEA 2CNCA 2J57A 4KDTA 2NY0D 4YH6A 4AGOA 3TWBA 4LEEA 3UMNA 3QC5X 2JI1A 3L9YA 5FYKU 4A05A 4Z1BA 5G1YA 3CO8A 4LASL 5D8JL 4YDIH 5HHPB 3PREA 3I4KA 3I7QA 2VW7A 3EA3A 3APMA 2KMWA 2FECL 4UNUA 5FOBB 4EAYA 4BFFA 3LHWA 4Z3IA 1TKWA 2OMWB 3JUZA 1R5VA 2AAVA 3VFRB 5DSCB 1A3LH 1A7QL 5C70A 2HVOA 2X2GA 1EXPA 1VBJA 4KKCD 4LOVA 3EOTL 4K5LA 1FWNA 1KCLA 3T71A 12E8L 4MXQD 2BWDA 3LEXB 3U2OA 2O4EA 2IDFA 2VR9A 2Y7GA 2A5UA 1XCTA 3U30C 1DZBA 3X11A 1BMGA 5DXWA 2YZ1A 3SCMA 1HX0A 3ULAB 4PJHB 3BVWA 1HIML 2F1AA 1GGBL 4UIMB 2E7HA 3AUJA 2B1OA 3BOFA 1ZANH 1D5MA 3ASWA 1K8ZA 1OEPA 1HQRB 3AMDA 1XGPB 2WLNA 5B39B 3OBKA 3HI1B 1OP4A 1NP0A 1FC1A 2DQEH 3ULVH 5IFHH 3LIUA 3LKSB 2XJKA 1QLEH 4LE8A 2OSLB 1FIGL 4MB5A 4E5TA 2Y3NA 5FK9B 4AVFA 4OW6A 2C0AA 1RUQH 3QGAC 1JV5A 2CMRL 3U6RA 3VX0A 3KBSA 5GRWA 1QPRA 4KUCF 3V6FA 3ALXA 1DTUA 1TWIA 4MJ5B 2HWGA 5FDWA 1ETZB 2P47B 1BVLB 1E4MM 1SZFA 1AQ0A 1HP4A 4Z7NB 1FDZA 1HWHB 2BOCB 2ZG1A 3SPGA 3GHEL 1BYDA 2AKRA 2YBVA 3KW3A 3DI0A 4HGXA 4GOAA 3G6AB 4J39A 4OLXH 3QDGD 3OMNB 4XN8A 1P84K 3E6EA 3RPKA 3H9ZA 3F5KA 4PUKA 1SDDB 3WS3B 3QS2A 5C0GA 3HPAA 4WKZA 3KJ4C 5FYJH 5HVFB 1EGJH 4IMKC 5C09E 3AYTA 2NZ1A 3FUMA 3LNMA 4JFOB 3FSUA 4TNVK 3R25A 2QCMA 4CL7A 1ADDA 1OTTC 2YUVA 4G43A 3DIFB 4KO6A 4CKQA 1G0XA 4Q52A 3VCCA 5GS1B 4X6BB 3U0WH 5FEBA 4LLYA 1PX8A 2IH8A 5GSVA 2WQDA 3W11D 1I1AC 4PY7B 3WTWA 2FJHB 4HHLA 5GRUH 4PJIA 1E5AA 2COVD 1TSRA 2HV5A 1P7KA 2DY2A 3DGDA 4XNUL 3SO3B 1I8MB 4YHLH 2QUVA 2WUBL 1R34A 3IAQA 2VABA 5DJYB 3WQ4A 2GY5A 3OF6A 4O02B 4KI5D 4EK7A 2D9CA 1ZFJA 1HH9B 3WLIA 2MQGA 3RGVC 2G0WA 2EIZA 1GC1C 3USZA 4US5A 2OZ8A 1T20A 3E0WA 1YDOA 2BTMA 4YFLI 4XMKL 1ORQA 1RZKC 4DBUA 2JKJA 5TPWL 3TO4D 2OZNA 4YLBA 4GNKB 4PW9A 4R26L 1CDHA 3EMQA 1UFUA 4Q6IB 2HPOA 5KUKA 3KLSA 3PGCA 1UBSA 1R17A 5EOCH 3FT1A 1MLCA 1BBJA 4C4KO 1IC5H 3WIFA 4X4XA 4Q8QA 1MCLA 4K07A 3D85A 2YA0A 1UXSA 4FCHA 4MHBA 3WJZA 5CJOL 2VL4A 4KZDL 1S2VA 2AXFA 1DBBL 2FX8H 3MO1B 1N5AB 2KKQA 2A3EA 3S2LA 3GMRB 4WOQA 4KUZH 1URLA 2EO7A 3SUTA 1AMKA 1IWPA 3MKKA 3TM6A 3G5WA 4A7QA 1GW9A 4UOW1 3B9NA 1AANA 3WL0A 5LN8A 4IMAA 2CBTA 4C5ZA 1HTYA 4YJZL 4YTQA 3W9EB 2OMAA 2K4AA 2OXHA 1IM9D 1IEXA 3P5ZA 5DLLA 3O8AA 3EYQD 4JZOB 1XT5A 1HKFA 3ESVF 1V8EA 1UJ3B 3IXTB 1DUZB 5EC1A 3L95B 5D70H 5ALCH 3NOYA 3QDMB 2HVNA 4DXVA 1CW2A 4E2BA 2R82A 3N42F 1GTNA 2R9RA 5FECB 4RV8A 2XIQA 2Y7MA 1MCPL 2VT0A 1JD9A 3B3IA 1BVNT 5F3FA 5I8CA 3L3OC 4QX4A 5TD4A 1QVBA 3SYPA 3PAYA 3TQ0A 3OZOA 3HO8A 3EAKA 3FCBA 2Z1KA 4ZDHB 3SCNA 4X9BA 2XXFA 2BOLA 3N12A 4YFLF 5I16A 5CP3H 4PODA 3QWNA 3DRTA 3RWEB 2KI6A 1M2VA 1GZHA 1CFBA 1B3YA 4X0VA 2O5NA 1NIUA 2DVTA 3L3DB 1IE4A 4HMCA 1AZUA 4JTTA 3DX8B 3O15A 1E6QM 3LEYL 1OOWA 1U42A 1OE1A 5L4FA 4RZBA 4WGXA 3ATZA 4KWWA 1TPXC 2DEXX 3BW9A 4HISA 4HH9A 2VXQH 3MLUH 1KNWA 1BEYL 2J9YA 1UWXK 2RACA 1SN0A 1BD2D 4OCWL 3FUJA 3IFOB 1XZWA 4BM7A 1A50A 4Z42C 2OXGB 1GORA 3GM0A 1FGVH 2QQNH 2HVJA 1H63A 5IHHA 3ZE2B 2WJZA 4HUXB 2BO0A 2PTUA 4L4LA 3EFOA 2GK1A 1QSED 3UGEA 2W63A 1TVDA 3IDYB 5DFTA 4UB9A 1B90A 3WO4C 4HFUL 3B2DC 1GS8A 3IRZA 3QQ9C 3NGJA 3MLWH 3GZAA 5K9JH 5E08H 1CXKA 1I9RH 1RK1B 2VLKB 5I18L 4Z76B 3CHQA 3ZZLA 2C3XA 3BWSA 5F9OH 3QIWA 2AABH 5EIQA 1K70A 4AZGA 4G8IB 3RA7H 1OSYA 2G8ZA 2AP2A 4PRPD 4FEMA 4KESA 4CEUC 5DS8A 1L6SA 1Q0XH 3BV4A 4ZB2A 5E95B 1Y0LA 1CL7H 1SZEA 1HJQA 1F76A 3N3EA 2R2BB 4R53A 4AF0B 5K59F 4B0MB 2DJLA 2ZE0A 3TT1L 4FLSA 2N4IA 3LNPA 3HG1B 2W8CA 3CT2A 3MTWA 4OM0H 3IJEB 3SJ3A 5ICYA 4LCRA 4FOKA 4ZUUB 1JGIA 4JR9H 4HZLB 5ABAA 3I84A 4OIIH 1ZJAA 3L6FB 1S5HB 3ROOB 1R30A 4FFVD 3EADA 4FFZL 5INCA 5K39B 3IDMB 4OFYA 3A4XA 7TAAA 4ISVA 2E59A 1S7SB 1U5VA 4U33A 4ZB5A 1G0CA 5KVDL 4IBQA 1P4IL 5GGTH 4XBMA 3FYEB 4JG0H 3FX4A 1CL7I 1I7UA 3UTTE 1JHTA 5I0VA 4HC1A 4N3UA 3VQ2C 4GKSA 4KFMA 2WAGA 1U8OB 4RRPA 4CQ9A 4HK0B 3QA3A 1IGJA 3DNKA 3ZDZF 4LNRA 1W5MA 1AXSB 3OEXA 4CJ1A 2FSEA 2GJ6B 2XU2A 3UPBA 4QNWA 4F0SA 1IEHA 1WHOA 4MA8L 1CE1H 2CLHA 1NFKA 1XC6A 4K5PA 1GJWA 3GMMA 4S1RL 2GJXA 3U7BA 4FTVA 5JDSA 1HHGB 1T0MA 5IB2B 1YECH 4YZFF 3BLFA 1CN4A 1D5ZB 3ZO0A 1GY2A 3W7GA 5AC8A 1B2WH 3AC0A 2C1IA 1JDAA 3ELQA 1KIPB 1IT8A 3EJRA 5AVWB 2MCAA 2WZ6A 2QKSA 5D7IA 1FWCC 2QSTA 5JO5B 4E42B 4HPYL 4PJCA 5K9QI 1KB9K 3FSWA 3ARXA 1CD1B 4QGCA 3BAEH 3P8IA 3OZ9H 4FQLH 3QV8A 3IDNB 4Y5VB 4IEFB 4WW2B 1E4HA 4Q4MA 2A38A 4LF2A 3BH4A 4F7EB 1PZUB 1IT9H 1KYUA 3UC2A 2C91A 1XICA 2ADGB 2YBRA 5ICXA 3P5YA 4BI7A 4IOSA 5F6HJ 1GYLA 1QK2A 3D51A 1SEQL 2DUZA 4X7EC 2BWQA 4LSQL 4NO0D 4DVBA 2PI6A 2CUIA 2CXEA 4OHQA 4MS8C 5G4EA 3PWPE 1JVOA 3FTSA 3O63A 3MHZA 1EJ8A 3RUGB 4GUPB 5EKYA 1I7ZA 3QZWA 1V3IA 1XQKA 3E0IA 3NFPB 4OT7A 4LUSA 3DMMC 1FZOA 3MWAA 2O9OA 5LNVA 1QWUA 5EMYA 2ZYIA 1FQ0A 4UQ3B 4LPUA 3NVQA 4NZ3A 3RPMA 3O3DA 2NY0B 3CYVA 5A6JA 1RUKL 3C9NA 2E1WA 1RY7B 4QM1A 3ARQA 4UV4L 3W25A 4PJ7B 2IDUA 4KBXA 5GZNA 1KXTB 2WSKA 1FZMA 1RFDL 4MD0A 1P5BA 2XKSA 4NQTA 4Z7WE 2ZKYA 4DKEL 3BIAX 3U9PH 2X1TA 4HCIA 4UNLA 1XX1A 2H2PC 1TA3B 5JYMA 2ZUQB 4FDWA 2YN5A 4PMEA 3ARRA 5KYYA 3UP6A 2NX5D 3BPLB 2WGXA 2JF6A 3BEVB 5HNNA 4P3WA 4N85A 4YXKH 4MJHA 1NGZA 3WQ8A 2KZKA 3VNYA 1PKMA 5EORH 4NUGL 3T44A 3VG9B 5GZOA 2EIJB 4NZ5A 2VEFA 1XGQB 1ETA1 2ZWYA 3UYIA 4QAIA 5LYRA 2WLLB 4Y9MA 4BWLA 3MYJB 4V1DA 2HLAB 3KBEA 2JALA 2OMTB 3TMLA 3GZKA 3ZYOA 1RZPA 4LL4A 3ANYA 1WCBB 2X0SA 5GS2H 3FSVA 4QBXA 4AWEA 3D85D 4C56E 4QRRE 2QDEA 4R8WH 1J88A 1RQHA 5CZVH 2ROYA 2YPLA 1KTRL 3BZ4A 5ABZA 1JL8A 1GGOA 4XNMB 1FFNB 3FT4B 4JCWA 1JPHA 3P30L 4GY7A 4IGSA 5KBKA 1IWBA 5I3KA 5J12B 1WAAA 4ZFQA 4IRZA 2ON3A 4C7DA 1REQA 3VKCA 1NLDL 3AT0A 3WLPA 3GLZA 5C7ZA 2PBOA 2XPGB 4MD5B 3KBJA 1E6SM 1WWCA 1KFKA 5FEPA 5HHVH 3QB7C 1RA5A 4JBRA 5D37A 4GI4A 4UBPC 3R06B 5HNTA 3QDGB 3FU8A 3TYAA 3UDWC 1YEIL 3T8XB 2J8OA 5GGVL 3EYOB 5JXEA 2V8MA 3NQKA 3QE5A 2MQCA 1RURL 3BD3A 3TBYB 4YBQC 4HWBA 4NUJA 3BVJA 4P2RA 1Z0MA 4MLSA 3GYCA 3CLFH 1MIML 1MFNA 1MUJB 1V0KA 2R1KA 2OELA 2JLPA 1E28B 1TQBB 5KS9B 4M6NH 1Q9KA 4HAGA 4NI3A 4JAMB 1T2XA 3V6OE 2N1TE 5K1VA 4GIEA 4LWWA 1PLAA 3KUMA 1G87A 4PJAA 1NMBL 4JIRA 4DJMA 1RZJH 3MLZH 1RU9L 3NSYA 3BUPA 4AJWA 3MRIA 1KBGL 3H7BB 3P4OA 2JKNA 1XVSA 1E5NA 1DOSA 4FQ2H 1TVNA 1F8TH 1DVJA 1IXOA 2PLMA 1XMWA 1TZ7A 5BRZE 3ARVA 2N7BA 5IFJB 2ZXDA 4JPVL 2I17A 2DAVA 4EWJA 2IANA 2PPFA 2XIIA 3BJLA 1M3JA 1LJYA 2YXOA 4G7SB 1CE6B 4LEXL 4I2XB 5CJMA 2YDAA 3SZ6A 1JUFB 4BJLA 4IRSD 1E9PA 3UGVA 2QMJA 4Y16D 1ZHAA 1VSCA 5EZLB 3QNYA 1U8PA 2FR4A 2GQ3A 1IEVA 4XCCH 4AC7C 4NSBA 1ZT1A 3TO4B 2QZQA 1KFGA 5FFOA 5H2ZA 1AA1B 4MKNA 1G0YR 1KZYA 5D7JC 4X80L 2XVKA 3LM7A 2FVLA 2XIOA 4KTEH 3MCLL 4ZZ9A 2ZVIA 4OZGB 1S8DA 3OKKB 1A4LA 4RMWA 4HUVB 1S7VA 3PABB 1TE1A 4O4YL 4XVOA 4BZ1L 4POZC 5JQ9A 4DN4L 3MS8A 1CF8L 4KKBD 4I5RA 2G5RA 1ZA3A 4F2EA 4HJEA 4J3UA 3OO2A 2B7QA 4F8LA 1KTDB 4NYLA 2WXGA 5TDNA 5BO0D 4KO5A 2WVUA 5FO8B 2N1KA 4ACPA 3MGAA 3VFSB 1SY6H 4Q9RH 5IV2B 3ZTEA 4KPHH 3RKDD 1OCOB 3OXRB 2AJYH 5H37G 4NY2A 5IHZA 2Z35A 5JHDE 2PWVA 1QTYT 4IIHA 4A7GA 3ITYA 4FHBD 1VCAA 1FVCA 4NQXA 4F9LC 3SDYH 2X41A 4Q6KA 3WLOA 4KCTA 1IM9B 2VFEA 1ETB1 1V55B 1MLBA 3FRPA 3IJYB 2FIKA 4KZ0A 1J87A 3GWJA 2JV6A 2GFBA 4G2AA 3KYOB 3ULUL 3HPLB 1NFIA 4LLQA 3CB3A 2QW5A 2Q9OA 1GGUA 3ALFA 2N3JA 4UBDD 4M3KB 3PZUA 5FM8A 5ETUA 5DRZA 4U5KA 3WUWA 2Z1XA 3B9EA 1ZIBA 5DHVA 3RJYA 2DWYA 5FUCE 4V1XA 1QW9A 1H11A 4DEFA 1DWAM 5AYYA 2W0FA 4GYPC 1BAFL 1N3NA 2WNKA 3IKCB 4EUPG 2UBPC 3TZNA 3CQJA 3KVKA 2C7UA 3EIFA 2ZG3A 4FHKA 1JRBA 3HCVB 4ONHA 3KH4A 1MHCB 3BN3B 4K2UH 3RX7A 4PV1C 4F0MA 4FQJH 2O6PA 5FEZA 1ZPUA 4NN7C 1TZIB 3CN3A 1NGQH 2XIBA 4E5XB 3Q9PA 1K8YA 2XJLA 4D0BB 1ITXA 1KTNA 2QAPA 4PTDA 1BD2B 3NSDA 1T22A 3T09A 1D9EA 1QI3A 1CYXA 1OGPA 1DJGA 3FUIA 4ZQOA 3FU7B 2VWEC 3THUA 1KEGH 1T4WA 1S5TA 5TK2A 3V4BA 4OGXH 1QSEB 5HDQH 1AQDA 2V30A 3LK6A 3UWQA 4QAWA 2QNEA 3A4JA 1LHZA 2M26A 2J6VA 2ICCA 4LQFH 4GAJH 1H15B 3R8BB 3FU5A 1Z5LA 4XMXA 5EF3A 4LF3A 5AZ2L 5F8QC 2A74B 4WX2A 2VDQB 1XLHA 4HXAL 4DX3A 4Z1CA 3ZLHA 3NZUA 1ICQA 3T1GA 4M51A 1V7NH 4IKJA 1I2PA 4HOZA 3FCGA 3GI9L 4MNQA 4DP7X 4FFYA 4BFKA 2J1WA 1VKFA 4MXVF 4KNQA 4N87A 3D5HA 5FKAA 2VXSH 4LSVH 1DPMA 4RW3A 2W0LA 1MREH 1VC4A 5EU5B 4WUUE 1H7XA 3LV6A 1AFSA 3HI6L 3L54A 2EDMA 4DUOA 1Y5VA 1HG3A 3IIVA 3ARDA 2VGFA 5GSRA 4BE5A 2FO1A 4M61B 1G4TA 5BU9A 3CZLA 2VLLA 3C8DA 5GZND 2WBKA 1TKWB 2ZWSA 3HE7A 2D3LA 3FH7A 5DD3H 4K55A 4WHYG 5E7FA 4KK6D 5H91A 1G1OA 4A21A 4ZMZA 1KPVA 3VFGH 3M88A 4E4FA 2POTA 2QYGA 2WAQA 4JGMA 4LYKA 1RHHA 3REWA 4BELD 3M9YA 1XEDA 3QDJA 4XBEH 5DVNA 3DXAE 4M7KL 2XG4A 3JVFC 5E1AA 4QLLA 1W9PA 2D7OA 1XCTB 3D46A 4MNLA 1MWAL 1SUHA 3LNFA 3REQA 3MMEA 4HBCL 1V3KA 5K59E 3V0WL 4HLZG 3F2LA 3D69A 3GJFA 1JNHB 3QBTB 4GMEA 2QJHA 3LB6D 1PZSA 4CRPA 5GRVK 3B4NA 2DQHH 4AXKA 3NDYE 1PKQB 5C0FB 1KN2L 1QRQA 3ULSB 1OSPL 5ADOH 15C8H 3FEQA 4KROC 4RPQA 1X7TA 3BAXA 4BV1A 1FWSA 1KNOA 4MNKA 1ZAIA 1VLIA 2B1HL 3B8VA 3TBSB 3GZPA 4B95C 1LXMA 1TQUA 5I19H 2BP5M 1H3WM 3NRQA 1NOFA 2VWSA 2X4RA 4KZEH 3V6FB 2EKSA 2VM8A 3FVDA 5FDWB 1DIDA 3FYPA 4JM2C 1QX1A 4QXGH 3TQVA 1JPDX 4X50A 4WVXA 1P7BA 4E9VA 1YYMH 1OAQL 3ZDZE 2OO6A 1GVRA 1UOLA 3VRLF 3WFBL 5I0XA 3TN6A 4DGYH 5CJQL 3ETBJ 2DOCA 4NZJA 4ICCX 1R3HB 3GMPA 2YDSA 4NDMA 3GDBA 4YDKH 3MVIA 3FFDB 2DLHA 5C0GB 4QLKA 4I3SL 4WKZB 4NO0B 3PTDA 5KSBA 4R4FH 4MZ1A 4YZFE 1WO2A 3GPEA 4CQ8A 3BUBA 3S3CB 3KDNA 2QCCA 3A47A 3WLHA 4P4KC 3AMCA 5CSZB 3IJ8A 4TMBA 4BF5A 1S7RB 4NOFA 1BZ9B 1MXSA 3AWNA 4A8RA 5EDSA 3QCVL 2GT9A 4CQBA 3M45A 2F5BH 5J1AA 1S5WA 1CTMA 3UYRL 4LCIH 3CUZA 1I60A 2CKSA 2YCLA 3S47A 4YHNB 3TT3L 2YXMA 1ZTXL 1TJMA 1SQ7A 1NCGA 4JIPA 2GIYA 4BINA 3BLDA 1P7KB 3ORWA 4GRWF 2MPAH 4YHML 3FTUA 1OFPA 3AVEA 4ELMA 5AHIA 4X6CF 5CJ5A 4EX4A 2R29L 4HVXA 2WZMA 2XOTA 2IWGA 3AHTA 3JT2A 2NX5B 1F3DH 3RVXC 4PG9A 4XB8A 1FAKT 3CQQA 1T20B 1O9WA 4GKLA 1KUMA 3CUXA 2GBVA 3VA8A 4ZE5A 2P80D 2EADA 4HWEH 5B8CB 2E6JA 5EA0L 1QG3A 4I1NB 3LDBC 3N73A 3WG6A 1LE5B 4MAUH 4TN9A 2H0JA 3LQZA 3PGCB 5AL8A 2RQEA 4PLJC 1MLCB 5F4SA 4HUWA 1F6KA 2XGZA 4JGUA 1E5BA 3WIFB 4X4XB 2NQDA 3ATEA 1BF2A 1IT0A 3D85B 3AHZA 5FYLD 4C6MA 2AXFB 4W6WB 5F72S 1LYXA 1E6RA 3FB5B 4JE0A 5BV7B 4DOHE 4G9DA 2C34A 2CLRA 4O5LH 2ZSVB 5DX7A 2WMGA 5IB3A 1X6LA 1JZEA 1TTCA 1E0TA 3K0WA 3SPCA 4HJFA 3D2UA 1SYSA 1N59A 3QJQB 3SYQA 4CNPA 3OGCA 3W6LA 2OXHB 5I6XC 4XVUD 1Z1WA 2GKIA 2VN7A 1ZLPA 2I7GA 4P2CG 3U4BL 1PG7H 1Z3GH 1B3VA 3MRKA 2OG9A 5EC1B 4A2FA 2LTQC 3EJTA 3NEOA 2NW3A 1MNZA 4MVAA 3S42A 5CEYA 2D3VA 4AZHA 4PMQA 4MG4A 3FMGL 3NCBB 4LB3A 3UXIA 2DUXA 2Y89A 3K1KC 4N6FA 1M7DA 5E94B 4HIQA 4WKXA 3EKZA 3PWPA 2ITCA 4NO2B 2WGNB 4W93A 3CFJB 1JR1A 4ZD3H 4LVHB 4M93B 3UJRA 5TE6H 1A4KA 3D50A 3NAVA 1SBSH 4YQXL 3GUGA 1NCBH 4P5TC 1A5NC 1CNVA 3DIVA 3QORD 4Y4FA 3PP3H 2DTSA 1ADOA 1WXYA 3GBDA 4E8CA 3TPUA 2FHBA 1QWHA 5E0CA 1V51A 4PTTA 1U95B 5GJMA 4YLWA 3BPNB 4M62H 2EUWA 4W88A 3HR6A 4GVGA 1X98A 4O54A 2G4JA 5CU5A 4O0ZA 2BVDA 4R5XA 1QO3A 1BIIB 1HZHL 2YR1A 1W9UA 2GQAA 5FGSA 2DD8H 1BPVA 2FTYA 3UZ5A 3FPXA 5C55A 4PWFA 3TBWA 1FWJC 4Y16B 1EHLL 5REQA 3P80A 1M05A 1DUYA 3E5BA 5FHBL 2KUTA 4Y19D 2FX9H 3QVQA 1QTSA 2HUEA 1WCQA 4PYGA 4GT7A 3WK3A 5ABGA 3LHAA 1TJ2A 4DI9A 3MR9A 1IQ8A 1YBQA 3OSVA 1X8CA 1RCQA 1A1MA 1U8LA 5DJDB 3H12A 3P60A 3QDAA 4FXKB 5AW1B 2H4EA 3BZ5A 2IPKB 2Y5EA 3CK0H 3SY8A 1SQMA 5JMUA 3EJJX 3QDMD 5DRIA 4ZTOL 1YCSA 3EWDA 3G6LA 1A4CA 2O4MA 7TIMA 1M41A 3ZTNL 1Y0LB 1OM9A 3IN0A 1EEYB 1S2TA 3L5WB 3VAEA 2CA3A 4HX1B 1EJXC 3S46A 3PHSA 4WTWA 5LGZA 1JAKA 3W7KA 4FI4A 2PDJA 2MH4A 1CLYL 2V2TA 1N2RA 3UZVA 1SPQA 1F6AB 3AACA 2J8FA 3U7YH 4K3EH 2ZTBA 1JN6A 5ICYB 5T3ZL 4QRAA 3SHSA 3RY6C 1LP9F 2V38A 3GU1A 1IB5A 5F71A 4IKKA 3M5VA 3CV1A 3WY3A 2VDKL 4EIUA 3QKZA 5FKPA 3Q3GA 5IREA 3FO9A 3LXBA 4CD6A 3LRGA 1QO2A 3VKJA 2O6DA 1QSFA 3UYCA 1FTXA 1V7YA 5EO9A 3HU7A 1FYTE 4PEKA 1NAMB 1N8ZA 1JGDB 2I07A 3EUDA 1KFAH 5GGUB 3VTAA 5M3WA 2BJMH 1T21B 2Z9TA 1JHTB 4FYQA 5F7AA 5DD1L 1IKNC 4A3RA 1GTFA 3FB8B 3STGA 3AXHA 3ZTCC 3GHTA 5GJTH 3ZE1F 1CXIA 3CGTA 3NPZB 4Q4IA 1FO0A 2FSEB 1VPOH 2JQAA 3UTOA 4JYFA 2W79A 4TQPA 1YKWA 2NV9A 1EA9C 1KBVA 4XBKA 4IT1A 3MNWB 4FTVB 3VD3A 1HN1A 3NCCB 4BFEA 1BKHA 2YCJA 3K2KA 2OK0H 3O6FC 4NBXB 4KDWA 2VAAB 3VG0L 2Z6JA 2PYEE 3VE9A 3CFUA 4EQ2A 4JPKH 3EH2A 4W9GC 4Y7EA 2VVSA 5H8MA 4WDIB 4AYBA 2E1DA 3DIDA 1FAIH 1UYWH 4JQXC 3ZHLA 2M1KA 4JS7A 1JI2A 1Z3RA 5EU6A 3TH3T 2JJSC 3RB5A 4OZOA 2ZXCA 3N41F 4RVBA 3CWNA 4ZXBA 3HG1D 3EYFB 2C3GA 3W2LA 1ICPA 4ZODA 1SJDA 3LKPB 2CQVA 1CC3A 1LLZA 3FZUD 5AYBA 4NT6A 3KYKH 4FAAB 4KEUA 3PUGA 4X6DA 1TKKA 3B8YA 4B9FA 4UM9D 4JY8A 4MX7A 4DJDC 3VSUA 4MAYA 2WXQA 3AHVA 2DBLH 1GOMA 4AVNA 1E4JA 5J1TC 2YPVL 1I7ZB 3QZWB 3DVNA 3CN2A 2E75C 5IVZB 2E67A 4LUSB 1Q2RA 2HBXA 1DLHA 1NUGA 4KKCC 4GP8B 3CL7A 4OZIA 4MXQC 5M17A 4G7YL 3NSFA 2UY2A 1KB5A 5AZEH 2YL9A 3O3DB 1UD2A 3C9NB 3CWHA 5JIPA 2B0SH 3CHDA 4PRIE 1HE8A 1XQ4A 3NABL 3F4CA 1JQXA 5GS0D 1OQOA 3VG9C 4MFEA 4O2EA 2JB5H 3GMQB 1GKQA 3UZXA 3W7IA 4TUJA 4NRYA 5D2LA 1EMTL 2XH2A 4OF6A 4NZ4A 4OLVH 1AR1C 3SGJA 2FZNA 4J3VA 2X1OA 4ZXOA 4PG2A 3AM8C 3NN8A 5F44A 2YB1A 5KYYB 1JCLA 4KJPC 1TV3A 3EKLA 1OB0A 1TPWA 4MXVE 3UXFA 1O4UA 1IAII 3SY6A 4JZJC 4V15A 4CD8A 3W87A 4REQA 3X3GH 3QZPA 1S9VA 3K46A 5DWUH 1F2XK 3OIHA 4KCVA 2OLDA 3ARBA 5I1KH 4PMFA 2WXIA 4JO4L 4CAGA 3D18B 3M1OA 3MREB 1IGWA 1QRND 4CVZB 3W7PA 1M7IA 1U3JA 4OCSH 5HANA 2BNQE 4XP6L 2N7SA 4HT1L 2VCAA 4LS0A 5E6RB 5DJ0B 3NP3A 1HZLA 2WMHA 2JELH 3BZ4B 3MJ7A 3BEWB 1G1KA 2B7DT 5AENA 1SRDA 1N0LA 1V3MA 3DPBA 4JY4A 4IIQC 1ZEAL 4H8NA 1REQB 2FTPA 3QWRD 4JLRA 1FCBA 4EUPB 5DK3A 1XF1A 3WIHL 1TZHA 4HHMA 3AREA 1EGVA 1W9DM 4KX9A 5LUMA 2HKHH 1OK0A 5E8NB 1NIBA 3LZOA 5ITBL 4QDPA 3NPVA 3OZKA 5T1MA 1OE2A 4GABA 4H8VA 4ODSL 5AZUA 1DWFM 1ZSHA 1W8OA 1PS9A 3VH8G 4AD3A 4A2HA 2V17L 4CADA 2OSYA 3N40F 4XD4A 3JWNE 5D72L 3LBMA 3B56A 3R8GA 3LNGA 2BW5A 3NK3A 4UFHA 1H1YA 4CU7A 3TJXA 4H6RA 4P9ML 5C0EB 1U6AH 1Q9KB 4F7PA 3W0WE 3ENLA 5J5DA 1UR3M 4WUUA 1TCDA 2V6AA 2EE3A 1CLOH 4PJAB 3R10A 5F2IA 1AI1L 3CMFA 1KGCD 2XZQL 3OJDB 3ANVA 1L6WA 4DO6A 1YE6A 1F11B 3VRLE 3P4OB 1G6VK 3ABRA 2AEQL 3WF1A 2C3WA 3ARFD 3FONA 2BVOA 4LB8A 1A4JA 5CIPH 2LVCA 2N0KA 3S48A 3C87A 1KFEA 2H9AB 3VKBA 4PUWA 2LLGA 4ETYA 2R1LA 1GZQA 3QIUC 1X5KA 2A5HA 5AW4B 4Z7QF 2PD5A 3PUCA 2MCPH 2FX7H 1U8PB 2FR4B 3VFOB 2Y24A 2ARJA 1ZT1B 5IHUH 1LCOA 4L3CB 3TLRA 2A9ML 4K23H 4HWUA 4MQ7B 3TAKA 3KHDA 1MFCH 3U2JA 2EC9T 4C6NA 4AEIL 4JRXD 3KRBA 5MENA 4JDEA 2HTKC 2XUCA 3KG5A 1YPZF 3C5ZA 3VXQB 5IJCC 5KYNA 4N0UB 4IBZA 4OT1H 4RGOH 1DQML 5ADPH 2YZ5A 4GRWE 1EO5A 4GI8A 1VDGA 4HMNA 4BQ2A 2CJUH 4OIAA 2VO5A 3DX0A 1PKYA 3V5CA 2OQJA 3PPHA 4Q9QL 1SFTA 5EU3A 5CUSL 4X6CE 4ZTPH 4E5XG 4NYLB 5TDNB 4A6GA 4RZ4A 3VMPA 4V2XA 2H6OA 3C61A 5IHLB 3WH9A 5G5IA 3Q65A 4A55A 1DJQA 2Z35B 3TWCH 4WHBA 1DVTA 4FFWC 3IJLA 5FOJA 2DB8A 3GD1C 4X9FA 4NQXB 1UWSA 2E9LA 1TPFA 2VC5A 1HNFA 3VI4B 3E8UH 2W07B 3D09A 2Y22A 4CEXC 3MODH 3O7UA 2WLJA 3MVTA 4PUUA 4F48A 2GFBB 2YFNA 4G1NA 2FZ8A 4RDBA 5DT1L 1IEAB 3MNVB 2OJ1A 2WVVB 1KCUL 2V5DA 3CFKA 3WUWB 4KK9D 3UJTL 5C08E 1UOVA 3G3MA 5IM51 3FOMA 8FABA 3K6NA 3GRWH 3CXDH 3IIXA 3WF3A 1KTLB 3QORB 1W1PA 3MBED 4GKTA 5HYQB 1LRTA 3WNNA 1ZVSA 5C86A 1V02A 3BN9C 4J3OC 3VD1A 2QKIB 4PS4H 2R1NA 3IJ9A 5A6IA 5AVVB 2PO6C 3ZIMA 4I5XA 4OD3H 4OB5H 5SX5H 2J6WA 4Y4HD 2QQQA 3APCA 2D31A 4WO4C 3BUVA 3SADA 4L8DB 2ZWNA 4KRLB 4M6OH 4HLEA 1IC7L 2V82A 3ULVF 3LLXA 1T22B 2BOGX 4NJAH 2ZX7A 3MSYA 4HCLA 3QUYD 3MV8D 3WFDL 4GUIA 3C2SA 3G5YA 1DSYA 4WGHA 4KY1H 1LDPH 1B57A 3HB3C 4PCPA 3PWNB 1R3LA 5AB0A 2AQPA 2X7LB 1TR1A 4D8ZA 3A3YB 1GH7A 2EYTA 4QXUL 2G50A 5EU6D 3W6YA 5L88L 4ERGA 5CSBA 1JK8B 1AQDB 4PN2A 3KWTA 4WR3A 4Y19B 1GOOA 4RSYA 4EOUA 4F2ME 3AG2B 4N90E 4AQAA 4WI9A 3ABGA 3LS9A 4Y4KD 1TCRA 4TSAH 2EE0A 1OT1A 2DLFH 1SDYA 4DCQA 3O3EB 2WYHA 4G8EB 1W72A 5D7EA 5D9NA 3C2AH 1FORH 4XPTH 3FU0A 5DC4B 1CLKA 2VFHA 5F6HI 2YZRA 3MACL 1L9OA 1P53A 1CI5A 3CZJA 4H13C 3PFQA 1T99A 1WOBA 2PLJA 4GG9A 5LNRA 2ZPKL 1Y6KR 3TNNB 3DBXA 2Z65C 5GSRB 5B80A 4JVUA 1NJ9B 1WIUA 3TN0C 2VDPL 3CIQA 4DO7A 3MA9L 5A2LH 5IQ7H 4GYJA 1E3FA 4JJ5A 3IMVA 3GJEA 1VAHA 5BXSA 2JIXA 2NXHA 1I9IL 2G3JA 4JRFA 2XY2A 5JQ6H 5EOQH 1J1OH 3I02A 3CHCA 4GW5A 1LO2L 1Z5YD 5LGXA 3T2LA 1RLCL 5D8WA 3VXMD 2VEPA 1PO9A 1LJMA 2XFYA 4TTUA 3PFRA 1I31A 3S37X 4JFXA 2HDJA 2ZUVA 1L9RA 1JUKA 5JPMA 2XG4B 3AT9A 4K7VA 3VTRA 1TJHL 2J73A 5JPNC 4AW7A 2EEBA 2BZCA 4O13A 3MMEB 4C54A 2J6XA 4N0FA 1B0GA 3MRHB 4QG9A 5BQ7B 5DZJA 1B54A 3GJFB 3PQYE 2XYBA 1JCJA 4W86A 4P5KA 2YB4A 3LKQB 2JK5A 2FPYA 5TE7H 8CGTA 5F93C 3VXGA 2IH1B 1O68A 1A6ZB 3WFEL 1G69A 1OVDA 5T33L 4HCRH 3TCXA 5CD3A 2POZA 2XG9A 1LP9E 1MCJA 4LDOB 2PEVA 5BROA 5FOOA 4HK3N 2VDOH 2X40A 1A14L 2Z8RA 2WB7A 4JS3A 1B4EA 1UJTA 5IF0B 2Y07L 4PJ8A 1MW0A 3BE7A 3DHJA 1ZVNA 3KDPB 2D4FA 5KEZA 2PCPA 4CNSA 1EFXA 3M7SA 1A3WA 2X4RB 3HBGA 2EKSB 3ZYIA 2R69H 2WKGA 1KD0A 2GTQA 3URNA 1OG6A 1K8DA 3P9LA 2NX3A 2BRRL 4IJTA 2MTAA 3S3DB 3SE9H 1OWWA 1A1NA 1KDJA 5CFAA 1UH2A 1YIXA 3EJZD 4JYDA 1WZKA 3QYQA 3ZE1E 2YO3A 4Z2GA 3UR5A 2OLAA 3SE4C 3GMPB 3FYYA 1JFQH 4NDMB 2WLIB 3NH7L 4YIQA 4UM9B 3E1ZA 4IGBC 1GTEA 3HLAA 4Z78B 5CC3A 5D9PA 4NEHB 1JV2A 5IKCB 2NXYC 4XWGL 5L8KB 3UVAA 4W89A 2JCCA 2WCGA 2W38A 1UATA 1LLWA 1MW3A 4J35A 1INQA 4DYEA 1VRDA 3G6JA 4WWNA 1SFSA 3BIKA 5F0PB 3OKMB 1OIMA 4F79A 1P4BH 3P2DA 2WZHA 3G77A 1LRNA 1YY9C 5KBNC 3UW6A 3NSXA 3DYOA 2BP3A 3KZSA 4OFDA 2GT9B 3CAWA 4D8LA 2WKOA 3CSBA 3L3HA 2P3ZA 2WHKA 3N43B 3SCMD 1LL4A 2Z6IA 4AX6A 2IMNA 4JPWH 4ODXA 1JZFA 2XHNA 1P48A 1N2VA 3QEZA 3FBKA 1K6AA 1FVDB 1S7XB 1Q45A 1D6EA 1J86A 1CPUA 2BSSA 3UWYA 1ZLWH 4I85A 2EJ1A 5IK3A 2JKEA 4ELMB 2Z7WA 1V03A 1AD0A 1XGRA 2VDML 1CK0L 4HKXA 4J7RA 2FD6L 5GHWL 3IJSB 3OYZA 4TQHA 1UWQA 3QXWA 3T0EA 4PG9B 2IGTA 4GUGA 2CLOA 4YC2C 5E03A 3HG4A 3NPUA 4YLQT 2ZX9A 4ABWA 3RHGA 3WE6B 3E96A 3N1QC 1FRBA 5EEXA 2X4UA 4AWSA 4H88H 4QOKE 3I4EA 3ECQA 1A9EB 5MEND 4HDIB 3C5JA 2ESCA 4HJ0C 1QFWH 5FJOA 2X4QA 4HZMA 1QRNB 2XV6B 1XDTT 4IJ3C 3BWUF 4OIBA 2E7LA 3UVIA 3JYBA 4F9JA 3IIPA 1MJ8L 4OJEH 2E27H 4JL1A 3BDBA 4LCUB 5AOIA 4W7VA 1CU4H 4O4WA 4JFFA 2QVFB 4PEEA 4Z1AA 4JO2L 4U6XB 1FHUA 2FB3A 5C0ND 2ZRYA 2GDUA 3FU9A 3X3FH 4BR1A 3ILQD 5IB3B 3RX5A 4H44C 3ZXAC 3B2UC 2GBUA 2GQ9A 4PY8J 2ZZ2A 3H4FA 2KLTA 4HD9A 1FN4A 2Z1WA 2V0AA 1A02N 2X2JA 3HVDA 4PJ9C 4A3QA 1SYSB 2BHYA 1FQ9C 4LVHC 3IPEA 3OGCB 3SYAA 5IVXF 3S6DA 3PFUA 1PAZA 3BWZA 4LAQH 4IM8A 4WHTA 3MJ9A 3MRKB 3RX8A 3ZVHA 5IGXH 1QFWI 3O0RH 3RNQA 1THAA 2FZMA 4G8AC 3VIKA 4HIJA 2NW3B 4GKZA 2D2JA 1XRTA 3EB2A 3MFFB 4XD3A 4QDWA 1I2NA 2F68X 2H47C 1DE5A 3N85L 4Z1PA 4UF7C 3OF6D 1A4KB 2AK4E 5CSSA 3DKJA 3D9AL 2PWEA 1TETH 5HA7A 2GJRA 4NQDE 4US5D 3B05A 1MHPH 4IRSC 2D2GA 2YGOA 3B3DA 1W91A 3PWLB 1IAKA 5TDOA 5IJVA 3LSOA 2EDEA 4IDJH 5ID0B 5DFVC 3MMTA 2YSTA 2QDWA 5KOMC 3OOQA 3UETA 2YCIX 4P9HL 3KGTA 3ARFB 1HYSD 3O9WA 3GF8A 1OCJA 3D3VE 4J8RA 1XH2A 1B3IA 1JF1B 3W29A 3ABOA 1MJ7H 3WY1A 5F7UA 3ZZ1A 1EJOL 1EJVC 3PP3K 1UC4A 1B4JH 4OV9A 3TBWB 2HP4A 1DL7H 4YU1A 1SUXA 2IFGA 2AI0L 4E9WA 2GSEA 4KKBC 1DUYB 4Z95L 2VXTH 1EP2A 5FGBC 1UJQA 1L7TH 2Q7YB 4AG0A 4PLKC 1C5BH 4RRPG 1QHZA 1W1IE 1YBQB 1TU2B 1UGKA 2DW6A 4AT6A 4JRXB 4OU3A 3S96A 1UD3A 1SUJA 2DIBA 5KYXA 1Q3NA 3S6TA 1NCWL 3DOSA 4M4RB 3O4LE 2WB1A 1WUFA 3HEIB 3RG6A 3OSKA 1XGTA 5JXAL 1GQKA 3Q6GL 3HAEH 2APFA 3OQRA 4H4NA 1PSKL 4ZFZB 3OVPA 2C3ZA 4OKVA 4XPHL 3ESUF 4HPGA 4NYUA 5HHMD 3ZJKA 5HYJE 4HKBA 1GHRA 2GHZA 5A2IH 4GS7B 3WLWD 4HLJA 1CFSA 3C0QA 2UY3A 1CYGA 1AS7A 1FFTB 4LASH 5D8JH 3N3MA 4Z7QE 2V2TB 1N2RB 3VOHA 3R7QA 3VXOB 2Z34A 6FABH 4GW1A 1TREA 1FWGC 4FR6A 5J6SA 3GSNA 2QXWA 2QEJA 2JIXD 1Q6OA 3MGOB 1A7QH 3CPUA 2NYZA 1JYVA 5FKPB 2EDXA 3TO2B 3EOTH 1Z66A 1YPZE 4LCWE 2WQPA 12E8H 1R3VA 1HL5A 1L4IA 5ERWB 2XH7A 2CLEA 4Z7AA 3W37A 5MHSE 5EO9B 1ZZMA 1JCNA 4JQVA 3F05A 3MRPB 2BY2A 3CCHB 3SGKC 1D3CA 2Y36L 3WJLC 4IMDA 3QZWG 3CVHH 2NV1A 1KIUA 1L6PA 4MB4A 3VD5A 2LV4A 3F7QA 4TV6A 1GWJA 3S1VA 4RE0A 3MV01 3MBEB 2FECI 2ATPB 4H8HA 3R19A 1KBJA 1QSZA 3GTTA 2J21A 7PTDA 4L1GA 1J0JA 3M7WA 1SJVA 3UBHA 3TIDA 3QJHB 4ZQRA 1FIGH 1NBYA 1Q85A 4TLSA 3MRCA 4TLUA 5K9XA 2HRLA 4Y4HB 3BANA 4KZCA 4JN7A 3QIWD 4NUWA 2P45B 3VH8B 1J1PL 1W0VB 3RY5A 3I9GL 1ODZA 4R4BA 3QUYB 3MV8B 1GR7A 3WHE0 1UZ8A 4B5XA 3L7FA 3SN6N 1OD8A 5EU6B 4OTXL 3DH7A 4MMXC 3GHEH 4P23C 2QJGA 2NZ9D 5HK4A 2FEDC 3W7NA 3W1XA 2P5NA 2BP8A 1NP2A 4YHIA 4DBWA 3UWZA 4MSWB 4UTKA 4XH2B 4Y4KB 2F7OA 4X6DB 3HF3A 1RH9A 5JW4Q 3SD2A 4RFEA 4AM0Q 1JERA 3WQVA 3IPFA 5C2GA 4NLHA 4RZCB 3NA9L 3GNDA 4UTAA 2HVMA 4S1SH 2AXGA 3SB3A 3KGSA 3E02A 1TQCB 4OFYD 3OPSA 3ULVE 4P57A 5JHLL 3ZS4A 3PANA 2ZUTA 1PEZA 1D8WA 5DLML 3BXWA 3B40A 4TX9A 5DJCA 1KB5B 3LQAL 3WTSA 1W37A 3BCJA 4X9IA 3WJXA 2CLLA 3ZSSA 3GUTA 5C09A 3FGCA 2A7BA 3RLGA 3OZPA 1I8IA 4EMZA 2WBXA 4HKZB 3BIBX 3SQMA 3N0AA 1J0HA 4O2EB 1TWSA 3HGRA 3MGTA 4NRYB 5D2LB 3KTXA 5CEZL 5D2NB 2ZAHA 1CB2A 4XNUH 4C6DA 3VXMB 1ZHKA 4JTJA 2WUBH 2WQRA 2RGLA 1TYJA 3MWCA 4FTVD 1S3KL 2PCXA 3UD6A 1CD9B 3N06B 3BWWA 3R4DA 2KDYA 3GS4A 4EXKA 4GFSA 5CSRA 2XX1A 1OYCA 3T0ED 1JWUB 5CQ1A 2RJGA 3TSMA 1DFXA 3PAOA 4DKDC 3T4AA 1EF3A 2GSHA 3HTWA 1E8XA 4O2FA 4W6XB 3LTSA 5FYJE 5TPWH 3E5PA 4MJ6B 2K6YA 3FA3A 5FCUL 2KZHA 2PRMA 4R26H 3OR6A 3AO0A 5E6IC 2W5FA 5ENWA 4C4UA 1JZGA 3V8CA 4NG3A 4TQIA 1TTGA 2F8VA 1R7OA 1BVOA 1FJ1A 5LG1A 2AQRA 4PL1A 2L8AA 2KZ1B 3EG9B 3GKWL 3OKNB 1M7IB 5BZAA 2Y8UA 1B2YA 1VBUA 1QBBA 1VEMA 2DYPA 3ETBF 4IOSD 4R90H 1ES0A 5CJOH 4H01A 2NYYC 2ZCHL 1DBBH 4JFFD 2QVIA 3E0LA 4ONGL 4BSJA 5KTEH 3HURA 3BSZL 5D32A 2A83A 1QQDB 4WEUD 1I1FA 4L48A 5DDHB 3IDGA 5DMKB 3ZBMA 5J0BA 2BS71 4HHHA 1KY6A 2WLMA 5J7CC 3L8QA 5F6IB 1CR9L 2NY4D 4JLRB 3HQPA 1K3ZA 2WXLA 5DQJA 3SGEH 3BKJL 3DERA 3JZEA 2OS7A 2PWDA 3M0JA 1K7XA 3L4VA 4DF9A 5D09A 2F58L 4G7VL 1NFGA 1XB6A 3QCUH 1M3UA 1MCPH 1R5VB 4PQXA 1IGCH 3N1MC 2I5IA 3E3HA 3DPDA 5CBBA 1ZDQA 1JWMA 3S4TA 2HE5A 4LRTA 1LF1A 3DX5A 5IVOA 5FEWA 2XU9A 1CFQA 4PTXA 3E7JA 4JPIA 3S2CA 4F7PB 4M24A 3QVAA 5JUEL 3X11B 2ORBL 2E6DA 2P48B 4D6FA 1EKOA 2NR6A 4PB3A 3Q2CA 3SCMB 5GZOD 4LUYA 3LVTA 2WLYA 3SGEI 3LEYH 5A16A 2P7TA 4UANA 2CA4A 2WN3A 1NC4A 2FJUB 1S9XA 2GSIA 5BNKA 1G6RL 4V1DD 1D5MB 3LZQA 1F5ZA 1KBLA 2BVOB 1A4JB 1GMEA 4OCWH 2WKLA 1JGEA 4AIEA 1R3JA 1QLRA 4LDEB 4ZX6A 2J56A 3Q2NA 2ZCZA 1GZQB 1OWRM 3FS2A 3SIMA 2YPLD 1JV5B 1OAZL 4JTLA 1MFDL 3KLHD 4ZS7L 3U6RB 4X22A 4GQ0A 4QXTA 4XZLX 5L6YL 3WUWG 1J5OL 1XI3A 4HFUH 2G96A 3HB9A 4XISA 1GJIA 3BQ6A 5MP6L 1BYAA 3MUJA 2JVUA 1G4MA 4ZA0A 3A4FA 5A2BA 2C6QA 4MZYA 1ZTVA 5MENB 2F8OA 3CQIA 1OQXA 2AQNA 2UVEA 1JZ5A 2NY5L 5LQBL 3EB3A 2AKRB 2OEKA 1DJNA 4GPNA 5EU7C 1E4LA 2Q7NA 4XHJC 3IGSA 2ANUA 2VR2A 2ZOKA 3OAUL 4L0PB 3VOJA 2VC2B 3O3AA 5GS1C 1K02A 5JXED 1A0QH 4W4OC 2Z25A 4KFOA 5EU3B 1T80A 2G3NA 2YBUA 3NBNA 3TT1H 4P2RD 4EDWH 4BDVA 3CU2A 1EDTA 1SJMA 1OCQA 4ECLA 3CZNA 4OGYH 2E5BA 4WY7H 3OAYH 1ZJIA 4G43B 3SO3C 5D4JA 3NQBA 4ADUA 5T8IA 1P4UA 1FA2A 1KRMA 1O12A 1TZ8A 2WPBA 4LLYB 5GSVB 1K9DA 1G7VA 5AOMA 3OMAB 4YTRA 1HKKA 2NQHA 2NVCA 4PJIB 3LHYA 4PJEF 5KVDH 4D9QD 1P4IH 1OFAA 4Q6IC 3MOQA 2IAND 3CFKB 1A7OH 3P3TA 3GH7A 2VABB 2J8GA 1F3EA 4BQ4A 1TTQA 2EIZB 1IGFH 3GKFA 3GNML 2HQAA 3FCUB 4GIOA 1M1XA 2DWDA 3EJCA 1ZVSB 3WMSA 2DH3A 1UG9A 3OG2A 1FL3A 1ORQB 3NA4A 3UTTA 2WQWA 2AZAA 3SB0A 4S1RH 3US0A 4ORIA 5IVXE 3DHMA 3ZLFA 4KXAA 2VDRH 1V08A 3N44B 4Z7OF 4DWHA 2D31B 3TYBA 1BBJB 3IAPA 3DO7A 1AG0A 1NF7A 1PKOA 2PPAA 3P4MA 4M5SA 2DSUA 1UXSB 4HPYH 3GQFA 1KGWA 5TDPA 3T0XA 5HJDA 1LBMA 1AZZC 3QZMA 1UJ3C 4HS6A 4XNDA 4Z5RA 5BUAA 3LHPL 4H7CA 2BX5A 3TZVA 5LNWA 4MNHA 1C16A 4MWAE 3W1RA 1DVXA 1NWRA 3QV7A 3FHEA 5SX5K 4TXEA 4G8GE 4AUBA 3F58L 1RUMH 4DCQB 1JRCA 4LSQH 1W72B 2IEPA 2BVQA 2Y0SA 3IGUA 1MEIA 2O93L 1WP6A 3QW4B 2FGLA 3M0XA 1D7BA 4M7TA 4XPFL 3RO8A 3BMWA 2BIMA 1AGEA 1U3HA 3DGGA 1MCKA 3S5YA 4RE3A 1ZP4A 4AY0A 1KJ2L 2JSFA 1BVKA 3A0OA 5DBTA 4I9AA 3VQLA 5HHMB 1J9TA 1O7VA 4UTTA 3B3IB 5AWNL 1TQTA 5FIEA 4H1LH 2VDNH 5I8CB 2V5JA 1W1TA 2XVGA 4CUCA 1BFNA 1I75A 4BCYA 3ABMB 3SSZA 1E9IA 3MLRL 3IGHX 3VNJA 1HKJA 5F9DC 4UV4H 5I16B 4BSWA 4F7MA 1HL9A 4JJ5B 3QZLA 3AROA 3DRTB 1KOAA 3GVWA 2JIXB 1IGTA 1M2VB 4POCA 4DQOL 2DJMA 2CZ5A 4KKAC 4GW5B 2AEWA 3MHFA 3U1SL 2VR4A 4DKEH 1GOFA 1W1YA 4KVPA 3TA3A 2XFFA 1AIZA 3IDYC 2J7DA 1I9EA 2OR9L 4FXSA 3W3OA 3BW9B 2BB0A 4HH9B 5JPMB 1XUZA 4ZXLA 4Z7WA 3PE9A 4N0FB 2Z4GA 2E6AA 4NUGH 2GEEA 4UOJA 2CE6A 1XIHA 2HVJB 3HFYA 4P5KB 3K2GA 2DQJL 3MKVA 2ZJSL 3EFOB 3QEHA 2GK1B 2ADYA 3UIYA 2QCEA 1YTKA 4ABQA 3GO1L 3TPKA 5CD3B 1R6WA 3CQFA 4D8PA 2Q71A 2QHAA 5E2VL 2P8LA 4NO3A 4M02A 1EV2E 3UJSA 2ZUWA 3IUIA 5HWNA 2H41A 4PR5A 3CUHA 4AUYA 2G3ZA 2Y62A 1TPB1 3UXKA 3QIWB 4XTRC 5HXMA 5CILL 2FJKA 2I60L 4QCIA 3WEZA 2DVUA 5L4JA 2MOGA 3SDOA 4MNQD 2V9UA 5DS8B 4C56A 4QRRA 4XMLL 3RX2A 1W6TA 1FNGA 1NLDH 3M47A 1K8DB 3VXPA 1XFCA 2X1WL 3SM0A 5JW4N 1TIMA 1MSPA 3HJZA 2UY6A 3DHDA