1GJUA

Maltosyltransferase from thermotoga maritima
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
636
structure length
636
Chain Sequence
MLLREINRYCKEKATGKRIYAVPKLWIPGFFKKFDEKSGRCFVDPYELGAEITDWILNQSREWDYSQPLSFLKGEKTPDWIKRSVVYGSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMMLLLPFVKSLGADAIYLLPVSRMSDLFKKGDAPSPYSVKNPMELDERYHDPLLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELADYTPPRAEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFGIITPPGFSDLINDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYGIDGARLDMGHALPKELLDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGVLNFIKKLIKVRHEFLDFVLNGKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTODEXTRIN GLYCOSYLTRANSFERASE
publication title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 191
structure length 636
sequence length 636
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09083 DUF1923 Domain of unknown function (DUF1923)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gjuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gjuA01
3K8MA 2OYLA 1NOFA 1Q6DA 1BHGA 2BHYA 3CPUA 5I78A 1HIZA 4PMRA 4UCFA 1M03A 3U57A 2D2OA 4TX6A 4HA1A 2DEPA 1BYBA 1WZLA 3VKKA 4Z2IA 1GJWA 2G3IA 2YA0A 2FHCA 2CBIA 2DSZA 3T2PA 3AS3A 3DYPA 2J8GA 2VTFA 4C7GA 1HVQA 1ECEA 4DO5A 1R8LA 4HZ6A 4W85A 1OGGA 1BYAA 3VINA 2WC3A 1I1XA 3ZSTA 3TOPA 2YDQA 2RGLA 4Q7NA 5ECUA 3N9KA 1PZ3A 1EGZA 2PWHA 5A2BA 5HPCA 1HL8A 2F7RA 1Q4NX 1FP9A 2QF8A 2CETA 5LYRA 2DSUA 4MNKA 4RL3A 4C7DA 3AIWA 3HG4A 4W5ZA 4UQBA 5FIPA 2V3GA 1JI2A 4CU8A 1XSJA 1XYFA 3F5JA 3N17A 1NM9A 3D4YA 2B31A 7A3HA 5CPSA 2CEQA 2QPSA 3CC1A 1EDGA 2WVTA 4W7WA 4U2YA 1ZJAA 3OZOA 5A8OA 3VM5A 4W5UA 1BVZA 1GW1A 1CPUA 1XCXA 1ZU8A 1JZ3A 1OT2A 5LA2A 3VGHA 2XGIA 3QOMA 2WMJA 1UD6A 5AC5A 4ZENA 1NWRA 3EDFA 4TVUA 2X2IA 5E09A 5E6ZA 1W3KA 4OBRA 1EH9A 3LXBA 4AMWA 1TQVA 4LYQA 5A6BA 1CXKA 3OLIA 3U7VA 2VOTA 4AZ7A 3N12A 3VGDA 4BS0A 2J8FA 3T2OA 1FFQA 4W8AA 1MQQA 4AD3A 4AZBA 2XVNA 4H8UA 2VZOA 5IHSA 3MANA 3THDA 4MB4A 1YHTA 5FCZA 4UZUA 2X0HA 2QPUA 2CBUA 3OIHA 3WNPA 3BMVA 4OBSA 1KXQA 2XFFA 4S3KA 2BHUA 1TVNA 1EQCA 1VF8A 4W87A 5AYBA 1K9DA 7CGTA 1GOMA 5CPQA 3SUWA 5A6MA 1E5JA 3WQVA 2YFNA 4KWUA 2GJRA 2WXDM 2VMFA 2OWCA 1DWJM 3BUPA 3PTKA 2FDMA 2JIEA 4B9YA 5DO8A 3SEPA 1WCGA 1HXJA 1OBAA 3NUKA 2O9RA 4M80A 5KZ6A 3EJUA 3CZNA 4AZCB 1ZS2A 4GI6A 4UR9A 3DX1A 3CHDA 3DX3A 3FY1A 3WIJA 4GQQA 3WKZA 1A47A 1XH2A 2WBGA 1ZL1A 2O9TA 3KWXA 3WQ6A 3WD0A 1EHAA 5I5RA 4PTWA 1TG7A 3VGGA 1ZJBA 1W3HA 2VRKA 2CXGA 1CBGA 4AEEA 3VIJA 1IZJA 1KCKA 1RH9A 2CCRA 1W9UA 1V0NA 3VIKA 1H0GA 3F4VA 4AZHA 3VDCA 2F8QA 2J4GA 3SCPA 3AS0A 2ALWA 2PBGA 4UFIA 1BSIA 1UH4A 3POCA 3TV8A 1DWFM 1JZ4A 2ESCA 1PIGA 4ZXLA 1KGXA 1K9EA 1K6AA 4B9ZA 1AMYA 3AZTA 3EJTA 3ALGA 3BUIA 3AJ7A 2OWXA 2BFGA 1UQYA 4AZ6A 3WDRA 5E70A 4Z2GA 1KQYA 3EJPA 2EABA 2VI0A 5FOOA 2CBJA 3RPMA 3EMCA 1HTYA 1O7DC 2DSWA 1J9YA 1W3LA 3RDKA 4EKJA 5EFDA 1NOUA 1EA9C 3VX1A 4WIWA 3ZJ7A 3NDYA 1M01A 3ZMRA 1HJWA 1E1FA 1JZ6A 3VIMA 2X2YA 3W27A 1E15A 2G3MA 1OWQA 3CHFA 5EB8A 4FNTA 1GOKA 1UWUA 1W91A 4MJ2A 4UFJA 5ABFA 2ZX9A 2J7BA 3OLEA 5AY7A 3VIGA 4AW7A 1QW8A 1UQZA 5ABEA 1R34A 1E9LA 3VILA 3ARYA 3RO8A 3UR8A 4BA0A 2XPKA 4ACZA 2E0PA 3BAWA 1KWKA 1UD4A 3AHYA 1OGSA 1OIMA 1V0MA 2W67A 5CPTA 4BQ2A 3CLWA 3CUHA 3SUVA 4CD8A 3WF1A 3PBGA 3BLBA 1DWGM 1QNQA 4ATLA 2PB1A 3NIYA 1ESWA 4B3KA 3BVTA 4J27A 1GVYA 1C8XA 1NQ6A 1UR4A 1CDGA 4AYGA 3OLDA 4WSJA 1IV8A 4BZYA 2W4XA 1U33A 2Y2WA 4F8XA 3H53A 2AAAA 3VSVA 1VJZA 1XRVA 1K9FA 1W2PA 4D71A 4AYSA 4PUEA 1QBAA 1ISVA 4ZFMA 4HU8A 3MO4A 2W62A 4DWSA 1E4NA 4OKDA 1VIWA 1E1EA 1XGZA 2JFEX 1UR0A 2E8ZA 3GNOA 3AIUA 2D0FA 1KXHA 3LRLA 4C7FA 1KB3A 1CGTA 5JBDA 1LG2A 1UR1A 2DT3A 3IAQA 1NP2A 1JYNA 3RIKA 2EJ1A 1BAGA 1J0JA 2X0YA 3ZO9A 2J7CA 2DDXA 2QLYA 1P6WA 3QHNA 5D8WA 1G1YA 4D6EA 2X09A 2WMHA 2IGTA 2J7GA 2J7DA 4CCCA 3WN6A 2ZUNA 3ZIZA 1TQSA 3BC9A 3PTMA 4PCSA 3WF3A 4H41A 1JDCA 1V6XA 1EDQA 2WPGA 1BYDA 5E0CA 2BXYA 2CHNA 3L4ZA 1ISYA 3BVVA 3AMCA 5HNNA 1WZAA 1HJQA 4UNIA 1UR2A 1WDSA 1XSIA 2VO5A 1V3LA 4QP0A 3AIVA 2W66A 4D6IA 3VO0A 7TAAA 2FE0A 2OW7A 2WC7A 2FH6A 2YL8A 3TTQA 1K9TA 2W91A 1CGUA 4PTMA 4JIEA 2YL9A 5BRQA 2EO7A 3RJYA 3MMUA 4U3CA 2ZUMA 3ARWA 3MU7A 2WVUA 1JXKA 2EPOA 1UKSA 2D20A 1E0XA 1GOIA 1MQRA 4CCEA 5CSYA 1XD1A 3RM8A 4HOZA 5D8ZA 2UWFA 1V3HA 1LL7A 4UFHA 3K46A 4GZJA 4EAMA 2DT0A 3IGUA 4MNLA 4D6DA 1R46A 2DH2A 3BAKA 3VDAA 3EMZA 1LG1A 3B8SA 3CZSA 3T09A 2J7EA 1C90A 4RE3A 1V03A 5A94A 3WF0A 4PMDA 5A8MA 1UA3A 4ATDA 4UOZA 5D9MA 5FL1A 1NOWA 3II1A 1OD0A 2CKRA 3VIHA 2XGBA 3LRMA 4FNPA 1PJ9A 1V3MA 3BUQA 2D3LA 1FH8A 1V6UA 2OLHA 2A3CA 2VQTA 3MV01 2V5DA 4GQRA 4UFKA 2A3EA 4JKLA 4UQDA 3PZNA 4MNJA 5D9NA 4AIUA 4E2OA 1QWNA 3BUDA 1B90A 3I3DA 2DH3A 3A21A 3AFBA 3SCNA 4GINA 1H09A 1TR1A 4WKHA 1GOQA 2WAGA 3CUGA 3WUBA 3I3BA 2EACA 4PSPA 5HXMA 2Y8KA 1VAHA 3L2LA 2VQUA 3W24A 3HMCA 1ODZA 5KEZA 3MS8A 4BQ4A 3K8LA 1LWHA 4KRUA 1E6XM 1IT0A 4H7VA 1KFWA 1TE1A 3ZSSA 5LA1A 4OOUA 3DDGA 1SZNA 4QCEA 3BVXA 2X2HA 1W3JA 5CSUA 4XUYA 2GK1A 3BMWA 3AIQA 1QNSA 4W86A 3LPFA 4PCTA 1EIBA 2EPMX 1JGIA 4K68A 1WKYA 5EFFA 1HXKA 1ZBKA 4PTVA 3F5KA 1JZ8A 4PN2A 3L4TA 5AC4A 1Y7VA 2EQDA 1C91A 1OIFA 3VM7A 1B1YA 3LPOA 2DIJA 4UFMA 3CZGA 1VRXA 2WWDA 4MDPA 2PWFA 2ZXBA 2F7QA 1BPLB 1JNEA 1TA3B 3JUGA 3M46A 1EHNA 4IUGA 2PBOA 2ZUTA 5I0DA 1H11A 2WCGA 4NSBA 5C71A 2ZX5A 1GONA 1R7AA 5CZKA 3FAWA 1TZ7A 2FHBA 3WDJA 1J01A 2VCBA 4JL2A 2VVNA 2XVPA 3HG2A 1J0IA 3MI6A 3ZR5A 2JEPA 3BAXA 1S46A 2X8RA 5D4YA 1XD0A 2W61A 3D50A 4ACYA 1KR1A 4V27A 4NX0A 2WLYA 3GXIA 4L4OA 1W1VA 2JALA 1KBBA 2ZXAA 3GH5A 4PMXA 1W9BM 2IXVA 3MUAA 3AXHA 4HZ7A 1RD6A 2G4FA 4F9JA 1MXDA 3PZMA 1V3KA 4M29A 3WFZA 2TAAA 2YKKA 1UKTA 2J75A 1XYZA 5DF0A 3WENA 3AZSA 3TP4A 5I23A 2DT2A 3CHEA 2WMKA 4V28A 4QLLA 1WB0A 2CPUA 4NZFA 4AEFA 1BGAA 3L4YA 1Q6CA 4NRRA 1DP0A 2F18A 3SCQA 3SCTA 2VRQA 3IANA 3SCSA 3FNDA 1CXFA 3VMPA 3WELA 5A6JA 1V6WA 2G3NA 2VX4A 1EOMA 4NZJA 2Y5EA 1L0PA 1B3YA 2VCAA 4BQ3A 4M8UA 2E9LA 5A95A 4P8WA 3OGRA 3WL1A 1GPFA 3CZ8A 5DEZA 3CUFA 3ALFA 1MFUA 2ZE0A 4JZ5A 1AQ0A 2XWEA 3BAIA 5M17A 4JFSA 1CXIA 1JDDA 4AXNA 4MJ4A 4WKFA 3RMEA 4HPGA 3WQ5A 1GHRA 4MDOA 3SCOA 1JFHA 2Q8XA 4F79A 2OW6A 4JKMA 1XCWA 3W26A 3L4UA 1Q6GA 1AVAA 2GJXB 3UERA 1DEDA 5A6LA 1AQMA 2ZIDA 3WNKA 5CLWA 4PMYA 2G8ZA 4UQEA 3UG4A 3WD4A 3QOKA 5E9AA 1V02A 1V6VA 3ARVA 2VVSA 2VNCA 5I77A 4CN6A 1G0CA 2DSKA 1MW0A 2G3JA 1JNDA 3AXXA 1UA7A 3CZJA 1R47A 3ARQA 3AMDA 3VD4A 1E5NA 1VJSA 3OA5A 4D1IA 1RP9A 5BYWA 3KE0A 4M24A 5CG0A 1HN1A 2F2HA 2AMGA 1TQTA 3APGA 3HU7A 3BLKA 1JAKA 5M03A 2C0HA 4M1RA 3GDBA 1UKQA 1KGWA 3D52A 3AHTA 3N18A 1F4AA 3HZ3A 3WBAA 4TVCA 3BH4A 1LLOA 4AMCA 1UH2A 4FLQA 4QLKA 6TAAA 2WVSA 2MANA 1KGUA 4UQCA 1J10A 1TVPA 3EDEA 1GOOA 1VBUA 2BNJA 4JHOA 1HJSA 3WUGA 2WHLA 4H2CA 5JIWA 3THCA 3VIIA 1E4MM 4W7VA 2WZEA 3FW6A 4AC1X 2PF0A 3ARPA 3MMWA 2Y24A 3BAJA 4FF5A 4MTVA 1JF5A 5A8QA 4GIAA 2DGAA 1ZBCA 2RGMA 2E9BA 1E70M 4FNSA 2NT1A 4MPKA 1EO5A 5CXPA 3D5HA 3VVGA 2EADA 4H8VA 2D73A 4N0RA 4DUWA 1V6YA 1J0KA 2OYMA 1HP5A 4JFWA 2J77A 2WMIA 3NSNA 3LMYA 4W8BA 5FKYA 4W8LA 1QHPA 2XG9A 2D1ZA 5ABGA 2QMKA 3S5ZA 1E55A 3H54A 1GVIA 3RM4A 3DX2A 3GTNA 3BLPX 1KR0A 3D4ZA 3HJEA 1GOWA 4OZOA 3T0DA 3ZT6A 5E6YA 2ZUSA 4NI3A 3CZKA 1XH1A 2JIWA 1FHLA 2V5CA 2WBKA 1TQWA 1DTUA 4FNRA 3K4DA 3N1AA 2XYLA 1CGYA 3FHAA 5A6AA 4PMNA 1BYCA 4M81A 2WW5A 5A6BD 2BHZA 4NZCA 2WVVB 1QW9A 1LL4A 4W89A 4YHGA 3OZPA 1OINA 1QBBA 1BG4A 1HT6A 1KWGA 4U3AA 4EE9A 3W6LA 5E0FA 1W1TA 4WF7A 2DQXA 1NARA 4WLCA 2NW0A 3ZJ6A 2J47A 1J0ZA 3HN3A 4YN5A 1GZJA 1W9VA 4U31A 4P7RA 4E4PA 1US3A 1MW2A 1XV8A 1XH0A 1F4HA 4MB3A 4N42A 5GQBA 2UY5A 2CNCA 2OSWA 3UCQA 4OOZA 3WDQA 2XSBA 3OB8A 3AISA 3OGVA 1JZ7A 1B3ZA 1PPIA 1BF2A 1HKMA 1BQCA 3WF4A 3L2MA 3NSMA 2VURA 2WZHA 1JIBA 4GZIA 2CERA 2WM0A 1HF6A 3I3EA 2ZOXA 3J7HA 3A23A 3MKKA 2CKSA 5I24A 2DIEA 4HTYA 1ZBWA 2GJPA 3WY2A 3CGTA 2VZUA 1FH7A 1UUQA 4W84A 3ZJKA 2VX7A 1N82A 1HKKA 1HWWA 3NJ3A 5EBAA 2J25A 3T0BA 2ZWYA 3N04A 1E6ZA 3SURA 4CU6A 4PSRA 1KBKA 3ZJ8A 3DX0A 2CESA 1M53A 1UR8A 1UYQA 1PBGA 3FHQA 1O6IA 1H0IA 3POHA 4AD2A 3GXNA 2BY2A 1MVYA 3A4AA 2OWWA 3AHVA 3WH8A 3IAPA 4MB5A 1FOBA 2Z1KA 2ZUUA 2CBVA 2BXZA 1C3FA 4PMUA 3WNMA 4RE2A 1CLXA 4CD7A 2EPLX 1ISXA 3U5UA 2WNWA 1QI4A 4R27A 1J18A 5A2CA 3N11A 5BXRA 3OG2A 1E56A 4IPNB 5CLTA 3L4XA 1JD9A 5AYIA 2E40A 4JAWA 2EPKX 1E4IA 3BUBA 5EMYA 1CECA 2D24A 3SCWA 3ZR6A 1QNOA 1V3IA 3SCUA 3TTOA 3PZVA 1B31A 3AMKA 3WNOA 4BCEA 4PBGA 1PX8A 1E4LA 1LL6A 4DO6A 2BV9A 3ARUA 6A3HA 3PZTA 1UKPA 4J3WA 1PX3A 3ZM8A 3W38A 3WMSA 4JFUA 2IUZA 2XSAA 4R5EA 1E71M 4CUCA 2VX6A 1EOKA 5GNYA 3VNYA 3HG5A 4LXFA 2GDUA 3MUY1 2J78A 4ZEPA 1MXGA 4KH2A 2XTKA 2YDSA 3WH5A 3AZRA 1TUXA 3WH9A 3CTTA 1UR9A 5IHRA 3VUPA 2WKGA 2F1BA 4GZEA 3PZGA 4IPLA 3LX9A 5A69A 6CGTA 1HX0A 5GPRA 1J12A 4MB1A 5A1AA 4XB3A 4J28A 1TCMA 5BXTA 4S3JA 2F1AA 5ABFB 1FFRA 3L4WA 2GVYA 1WZKA 2Y4SA 1OGBA 2O92A 5A8NA 1GQKA 4HMDA 5JUVA 4UOQA 3UESA 4CN4A 4ML4A 1QNRA 4HP5A 4ACZB 4LQ1A 4CD4A 2WCAA 4E8DA 3CBWA 1SMDA 1W9PA 1J11A 1B2YA 1B30A 3GXMA 3VX0A 5FD0A 4E8CA 3PZUA 4AD1A 1MW3A 2G41A 2WMGA 3T0AA 3PZIA 3PZ9A 3TTYA 4HOXA 3K8KA 2WK2A 4WKAA 3CUIA 2UY3A 1RPKA 4GPNA 3A47A 1E73M 4GKLA 3EDDA 1UH3A 3IJ9A 1HP4A 1SYTA 1GCYA 2F7PA 4J3TA 1CENA 4L4PA 3DHPA 1ISZA 5DT7A 1BGGA 2A3AA 3AYRA 2WYSA 1CNVA 4QCFA 4NXKA 4DWSB 2VUYA 2XN2A 3O6AA 1GJUA 1E6RA 4J3UA 3MV11 1YQ2A 1OSEA 3UR7A 3GYCA 1D3CA 1FP8A 4CVUA 1VFMA 1E6NA 1JG9A 4P8XA 4HZ8A 2JEQA 2J79A 1B3WA 1W2VA 2VT0A 4MADA 4IISA 3AHZA 3RJXA 1V0LA 3PTQA 3WY4A 4DUXA 1VB9A 2OSYA 4FNQA 4DM1A 1U30A 2NT0A 1MFVA 2ZX7A 2EXOA 2V3FA 2ZX6A 4CD6A 3AIRA 2NSXA 1JD7A 1UWTA 1QWUA 1GQIA 4FLSA 1QPKA 1FA2A 1UD5A 4TXEA 1Z32X 1C7SA 2XN0A 1CXHA 3MSDA 1JL8A 2F7OA 4XV0A 3WQWA 4HOWA 1UHVA 3M6DA 3PZOA 2XFYA 1JYXA 4D6JA 4J3XA 2GFTA 9CGTA 2UY2A 5A6SA 2YLAA 2D0HA 1CTNA 1QHOA 3KLKA 1GORA 3BXWA 1E0WA 3WUFA 3WEMA 1UZ1A 4EK7A 3KL5A 1ZBVA 4X0NA 3KL3A 1HNYA 1HL9A 3AHXA 3W4RA 3BSGA 1JYVA 4EANA 2V3DA 1XHGA 2EAEA 3VU2A 1KXTA 3CH9A 3SUUA 4AZCA 2ZWZA 1WDQA 4AZIA 1BTCA 3WDIA 1QOXA 1WO2A 1SMAA 5TD4A 1UWRA 1CXEA 5JBEA 3ZOAA 4WJXA 3AIEA 1C93A 3FAXA 1D2KA 3EDJA 3WH6A 2FYVA 1H2JA 3EDKA 1PIFA 1W9DM 3NSXA 3AICA 5FL0A 1VFFA 3WQ4A 4PUDA 4CVWA 3KEHA 3GNPA 3GXTA 3A3HA 2E3ZA 3U7BA 4GI9A 2VX5A 4HA3A 4HMCA 3D51A 2BY3A 2F61A 2BVYA 4X9YA 1UWQA 2XIBA 1JZ2A 3ARTA 1LQ0A 2WVVA 1WE5A 4D1JA 3CUJA 2YL6A 3MUZ1 4GI8A 4P7NA 4AY1A 1VEOA 4V2XA 1JZ5A 3MSGA 3CIVA 1A3HA 1V0KA 3GXPA 1V3JA 4CGTA 1HJXA 3BAYA 3G6MA 2JE8A 2QMJA 2HISA 1OT1A 4UQ9A 4PYSA 4H8HA 2XVGA 2BY1A 3VDBA 2JF7A 1C8YA 2Z1SA 2ZUVA 2XM2A 2D3NA 1NWSA 3W0KA 5M3WA 3BCFA 1O7AA 1WPCA 1D7FA 1PAMA 2GK1B 1QHZA 3WL0A 4UOJA 3TONA 3AOFA 4FK9A 1LF1A 2YIHA 1OD8A 1GQJA 1CGXA 3PN8A 4UFLA 3DECA 1H3GA 3GXFA 3LPGA 3HG3A 2GDVA 3AROA 2FGLA 1WP6A 3WD2A 4HU0A 4JHZA 2WLZA 3ZQ9A 4QLJA 2DSVA 3WNLA 4CU7A 4JKKA 3W29A 3BVWA 4J7RA 4HMEA 1ZB5A 1G9HA 1ODUA 2ZUWA 1B9ZA 4Y7EA 5DT5A 3AQUA 3W82A 4B16A 2WCSA 3WY3A 3M07A 4FNUA 2ZICA 1V02E 1EXPA 3WSUA 3PZQA 4BQ5A 3U5YA 4UQAA 3ARXA 4D6CA 2XVLA 4HPHA 3QHOA 2YA2A 2VZTA 1CLVA 2YBUA 1UG6A 3UG3A 2GUYA 1C92A 3GNRA 5BXPA 3VD9A 1VEPA 3GH7A 4DO4A 3WBEA 3DYOA 4DM2A 5HOSA 4JCMA 3VD3A 1H5VA 1Q6FA 4J3SA 4P7QA 4Z2KA 4KMQA 2W63A 2WHJA 3DX4A 1JFXA 1IZKA 4LYPA 5HBFA 4TTUA 3O9NA 3RCNA 3KZSA 5LA0A 2BY0A 5BCAA 5A6KA 3AXIA 3IK2A 4AZ5A 4OUEA 4AWEA 1W9XA 4BF7A 1QI3A 2HVMA 1QI5A 5I79A 2DPEA 4Z2LA 3LRKA 3PHAA 1VENA 2JF6A 2ZXQA 1M04A 4LPCA 3EYPA 4F9DA 4AIOA 3M7SA 3CZEA 2QHAA 1QX1A 1GQLA 2O9PA 1E43A 3GM8A 3GBDA 3O2LA 3UEQA 1JF6A 3ZT5A 3GH4A 1HKJA 3UETA 4HA4A 2WZIA 4P8VA 4W7UA 4WSKA 4B3LA 1HJVA 2D23A 4YPJA 3VMOA 4F66A 3OLGA 1JAEA 2VZSA 2CITA 1T0OA 1KTCA 3ARRA 3VGBA 3OGSA 2QV4A 3F5LA 3A4XA 4AZGA 4TTGA 1PEZA 1KCLA 4PRWA 1UASA 1W1YA 2PI6A 2D22A 1QI0A 3WDPP 3EJSA 1J0HA 3IJ8A 4MAZA 4KGJA 1ISWA 1E0VA 3ARZA 8A3HA 2YL5A 1GUVA 1R7OA 2AOSA 1PX4A 1XC6A 1MWOA 3S6TA 3WY1A 1MYRA 1B0IA 1AQHA 4KGLA 1EQPA 2GSJA 2YDRA 1DWAM 4U5KA 1H4PA 1LWJA 3VIFA 4TUFA 1H41A 5CJ5A 1TQUA 2VJXA 2FGZA 4P7OA 1I75A 2WANA 3CV5A 3A5VA 5A2AA 3ECQA 4AD0A 1CGWA 2BS9A 2W92A 2O9OA 3LXAA 3AMLA 5D9PA 2WC4A 3L4VA 1CGVA 1NWTA 1KTBA 1ITCA 3DDFA 3FN9A 4Q22A 2YJQA 1CZ1A 3MMDA 5C8BB 2WKLA 1GHSA 4D6GA 4JCLA 4X0VA 2ZX8A 5CGMA 3WFLA 5E1QA 3CMJA 1B3VA 3S5YA 4D6HA 1FHDA 2FH8A 3SUTA 1SFSA 4RE4A 1NP0A 1CYGA 3W28A 5HDRA 4FLOA 1KXVA 4NF7A 2E9MA 4M56A 1CWYA 4ZE5A 3KLLA 1UD2A 1QVBA 1NH6A 1L8NA 4MAVA 4AIEA 3VOCA 1UD8A 1J0YA 1US2A 2OSXA 2V3EA 3A6OA 4UZSA 4JFVA 3B9DA 3W6MA 5I6SA 3AS2A 4KRTA 3VIOA 2BVTA 3LPPA 1X6LA 3SCRA 2WSPA 3A24A 1UOKA 1E6QM 1LJYA 8CGTA 1SR0A 2X2JA 4URIA 1C8QA 3B9AA 3G6LA 2PWDA 2CHOA 4PTXA 3WD3A 4LX4A 5IFTA 1E3XA 2WSKA 1G94A 1UKOA 1HVXA 2W5FA 3QGVA 2X05A 1QI2A 1MQPA 4J3VA 3VGEA 3EMQA 3VTRA 1TA3A 3IJ7A 2XIIA 5A3HA 1R75A 1KQZA 2C7FA 1VBRA 1DWHM 1BG9A 4A4AA 2YA1A 4GO9A 3K1DA 2WMIB 2VR4A 3NCOA 3W25A 3LXCA 3FXYA 2WB5A 4WK9A 2WWCA 1UD3A 1TFVA 1R85A 4DUVA 4XX6A 1MW1A 3AIBA 4JL1A 3E1F1 3VGFA 3CMGA 3VNZA 3SCVA 1EO7A 1DWIM 2C8NA 2D0GA 1E40A 4YHEA 4JFTA 3CHCA 3AI0A 3BSHA 2VR5A 3GBEA 5DFAA 3NYDA 1Q6EA 4PMQA 1UWIA 1RP8A 4A3YA 2V38A 2ZXDA 4NRSA 3WQ8A 2A3HA 2WHMA 4B15A 2EPNA 1JXJA 3AMGA 1I1WA 3VIPA 2J62A 5CQ1A 5I2UA 4QFUA 3N13A 1JYWA 3K4AA 4A3HA 1CIUA 3EBVA 5GNZA 3MUIA 5IDIA 4U2ZA 4CD5A 4W93A 3GZAA 4D72A 3A22A 4DWSC 3ZT7A 3VD7A 4TX8A 1JI1A 2XUCA 5A8PA 4W88A 1V08A 2VRJA 2XFRA 2J7HA 1VFOA 1BFNA 4DWSD 1R87A 1NWUA 5CGTA 4XZWA 2OYKA 3H55A 2VZVA 2BVDA 1U2YA 1VFUA 4FMVA 1G5AA 1WAWA 4AMXA 1EDTA 1UWSA 2IXUA 1HKIA 1X6NA 4UTFA 2YFOA 3DC0A 3B9EA 1R33A 1CEOA 5M5DA 3UG5A 2EEXA 4P8UA 4PMVA 3WMBA 3WD1A 2J74A 1WNOA 1FH9A 5ABHA 4CKQA 1HJUA 1GNXA 1WDRA 2CIPA 3N15A 3VSTA 2PWGA 1BVNP 2PC8A 3RM9A 5BROA 3W81A 4GXPA 5BXSA 2J7FA 3SIMA 1TMQA 1XSKA 3DYMA 1M7XA 4PEEA 2VCCA 4LYRA 1PS3A 2GJXA 1PZ2A 3S2CA 2YOCA 4ZE4A 5IXEA 4ATWA 3QHMA 2YBTA 5HPOA 1G01A 2E4TA 3T2QA 2XHYA 3ARSA 3TA9A 4Z2HA 2WHKA 4LGXA 4QAWA 2XJ7A 5C70A 4OIFA 3WDHA 1QNPA 5I3DA 1WZMA 3D3AA 3VSUA 5BWFA 2XWDA 3BCDA 3SUSA 2FHFA 3AYSA 1E72M 2CYGA 3OBAA 3VPLA 4XZBA 2Y8VA 4U33A 4OGZA 1JDAA 4P7LA 4H04A 5GNXA 5D9OA 1B3XA 4CCDA 3BVUA 3TTSA 2UY4A 5JIPA 4AD4A 3CO4A 1E6SM 3CZLA 3WEOA 2VC9A 3WUEA 3EJQA 1CXLA 1VEMA 1W1PA 3T08A 1BLIA 4TVDA 4ZXOA 3W53A 1W32A 2VL4A 4NXSA 1ITXA 3QR3A 4IM4A 2X1IA 3KL0A 2XM1A 3WH7A 2XN1A 2A3BA 4PMOA 3WEZA 5IFPA 1OM0A 4U5IA 4TOQA 4AISA 3DHUA 1X1NA 1DHKA 1C7TA 4PMZA 1E6PA 5JBFA 3WF2A 4M82A 2EBNA 4FLRA 4AD5A 4D6FA 1WDPA 2YLLA 1OCQA 3RILA 3EJRA 1H49A 2XVKA 5DMYA 5BRPA 3VDHA 3W37A 4CN1A 1UZ4A 3BGAA 3NDZA 3VD5A 4GO8A 1OB0A 5F7UA 2WMFA 1E3ZA 2E8YA 4OJYA 3WMCA 4QDMA 1H1NA 2DT1A 4Z2JA 3WNNA 2PWEA 1R86A 3GXDA 3A4WA 3VMNA 4MNMA 3AS1A
chains in the Genus database with same CATH superfamily
3K8MA 4MX7A 1NOFA 2HRPH 4ZNCD 1EEQA 3MLWL 1KJVB 2B4GA 4XVEA 3ZKND 2PLKA 2FATH 3VNJA 2OMUB 3AYTA 5HANA 3ALWA 1VCFA 4HWEL 2JKNA 2KPNA 3B6SA 2ZNXA 1U22A 2ZZ2A 3JVFC 2V8MA 5C2UB 2QPXA 3JZ7A 3TIEA 3C5ZB 5JW3L 5B38A 2FL5A 3TOPA 3F7YB 1MSPA 2X1XR 1FFTB 2JQXA 1EGZA 5A2BA 5GJTH 4RL3A 4FFVD 3W7JA 5B8CA 5I3JA 1EDGA 4W5UA 3B40A 2FJSA 1FI8C 5MERB 2FMOA 3PULA 4JFEA 3O3AA 4N2FA 3VVWA 1AI1H 4G8GB 1XF5B 3QJFB 4KKXA 3DTUB 4MQXC 3LN4A 2DLEA 1XBVA 1POJA 2ZZUT 1WICA 2RA1A 2BP0A 1AOHA 4KVNL 1XZ0B 3KPLA 3W22A 1HNFA 1K9DA 3ZVIA 1WS7A 2ZRWA 1PVNA 2FJUB 5SWQB 3SN0A 4GSDH 5DJ0A 1HAWA 3SEPA 1HXJA 1XB3A 1U8OB 5KZDA 4LUTB 3HUJB 2PP0A 4PJAE 2X28A 4ONGH 1JCJA 4KK9D 1IO4C 1WT5C 5AZEL 5I75B 4L8CA 3SRDA 2CCRA 4AZHA 5D2YA 3SE9L 3SGJC 4MAYA 5IM7B 1W3IA 4U3SA 1FNFA 3W2UA 4LS0A 4TVPH 1CI1A 3WGUB 3GC2A 4Z2GA 4AVIA 4BKTC 2YEZB 3N40P 3T2NH 3NQGA 2JJTA 5KJ7E 2HKFL 5EFDA 1T4KA 4IIQC 1MVUA 4BGDA 3MJ9L 3V6ZB 3VWJA 1JZ6A 3QFWA 4YVUA 5EB8A 4DEPC 2Q9OA 2ZX9A 2GK0B 4GY4A 4NT6A 3LRHA 5IESH 1A7RL 1T0PB 4M5YH 3CMOL 4MLSA 1DQQA 3MUJA 5E6ID 2VWSA 1OF8A 1FE8H 1DWGM 4I6VA 1S9YB 2V5SA 3SDCA 4MQ7B 1B6DA 1CFMA 4X2UA 3XISA 4PTUB 3G08B 4QHKJ 4Y5YA 4AVKA 4WY7L 4D7BA 1GZQA 5LDSA 2G2RA 3DURA 3O0RH 3HC0B 1A9VA 3L3OC 5CEZD 5D1QC 3BG5A 3T1FB 4JZJA 5FACA 1OW0C 3RL1A 4N2HA 4OLUL 3V5DB 4XVJH 4YTUA 1RKRA 4CCCA 3ZIZA 1Z6KA 1HJBC 3PTMA 3BGGA 1V6XA 3RF9A 4GYPA 4YHYC 3B2XA 1W6TA 3ASNB 2YQGA 1WZAA 4R7VA 4N2AA 2FIKA 2EIZA 1L6FA 4CMHB 2DMKA 2VN4A 2HROA 1UUOA 2WV8A 4WXYA 3GX9A 4ODTL 2P0IA 3CBJB 5HYEA 5TF1H 1CGUA 2HS6A 4JHAH 2YL9A 2P5PA 1Z9LA 2DTMH 1MUCA 1S9VA 3GUFA 4ZRGA 4C6JA 4QNEA 4HPYH 4UFHA 3VXUB 4AENB 1W8OA 1FHVA 4YHKH 2XZQH 5GGTL 1J87A 3B8SA 2AC0A 4XPFL 3I7QA 1TCRB 2KI6A 1WIOA 2N7AA 1PHQA 4FZEH 3ME0A 2V5DA 3O9WB 4DP2X 3OKMA 4TSBL 5T1DH 5E4EC 1EJSC 2JGQA 4OZGE 1TTFA 3TM6A 5E9DA 1TIUA 3JV4A 3QV7A 4YUEL 3JRKA 5AECA 5KEZA 4JQ4A 3DXIA 1M7DB 2C3ZA 1IT0A 4A7UA 5B39B 3SKOB 4KVCL 3JQOB 3U4EA 5EH1A 4MWFB 4UV7L 3PV6A 5HGAA 1U8JA 3VFVB 4C6BA 4QRNA 1P1ZB 3TO4D 1M9HA 4PTVA 5B1BB 3UW6A 4KKAC 4P5TA 2EQDA 3N19B 1NUDA 2H6RA 1GK8A 3Q65A 5DEFB 3DVGB 2ILLA 1YHPA 3TA4D 3JUGA 4OSUH 5LIWX 1LMKA 2QQLH 5BOOA 2PRHA 1AH0A 3HBZA 4XI5C 1TQCB 1J0IA 2JEPA 1S46A 2R1LA 1K4CB 2NW3A 3WN5A 4H8WH 1G7PB 1GOGA 2CXKA 1BD0A 3CDGA 1OSPH 5GSRB 2VDQH 3SKMA 2R27A 1QW7A 4LDLB 4H8PA 3GH5A 3S9YA 2IXVA 3ZDXB 3IMWA 4IXXA 2GYSA 4WJ5B 4KHTH 2YKKA 5FJIA 1G7IB 1R3TA 5JH2A 2R7EB 5L2KB 3TA3D 2Q09A 4I0PC 4U6TA 3DX7B 4FZ8H 5CJMA 2F7FA 3OVQA 4A8LA 4LOVA 1JR1A 2E74C 3ZRFC 5MI0B 5A95A 4TLUA 5CBIA 5DEZA 3UBXI 1AG0A 3AWOA 1FAIH 4O5LL 2QQKH 4JY4B 4AXNA 4WKFA 5F97E 3VXME 1P5UB 3MODL 4GZ7A 1JGLL 5SWUA 4NO0B 3I9IA 3ZXWA 4BI5A 3IETB 3CJJA 4RNRA 4ZO8A 1Q0XL 1B2WL 3F7VA 4LESA 1BIIB 3USZA 4YHIB 1NGZA 2Y06H 5SWSE 3SCMA 3CL6A 3SI9A 1R47A 4L9YA 4JY5L 2DBJA 3IU3A 2ZCKL 3AT9A 5IMOB 1YE4A 2DEYX 5L6YL 1A5AA 5ANHA 1QFWH 1KGWA 4QTIL 3AHTA 2UUDH 5F1IB 4G6FD 3WBAA 5IB5B 3TNNB 2VC2B 3FQUB 5DD1H 4KKPA 1ZLSL 5C0AD 4PJAF 4YDVA 4B4HA 2XWRA 2D7TL 2R2BA 1LZOA 4PJAA 2GJNA 2HPOA 4S11A 2W65A 3QORA 1IHIA 3MMWA 2OMYB 4PJBE 4M3JA 1J5DA 2ZZ3A 3BQ5A 3HE7C 3IJ6A 1D3GA 4YVNA 4LSQH 4BWTA 1BBJB 1SDDA 1G84A 3MJ8B 5FKYA 3SBWC 3LHPL 1GTNA 4ORZC 4IMKA 3L3IA 4ICXA 3B3BA 4YN3A 3FKRA 4HIXH 1JHKL 4XPAH 2PKDA 5B3NA 2SEBB 2V7NB 1CU4L 4PS7A 1DOSA 1SU5A 3EB4A 1P1MA 3BXNA 1NC2D 3T3MF 4K7PH 4P3WA 4XCYA 3OAZH 2KBGA 1A14L 4RAVB 3L67A 2V5CA 1O5RA 3SW6A 1BFOA 5KANI 2E5CA 2Z31A 5TE4L 2FLRT 3OZPA 5LBGA 1P0KA 4WUUE 3B56A 2XSKA 1TCDA 5D5MA 2MUCA 4M9PA 4UYQA 4Z1BA 3JW7A 1MW2A 3DO4A 3H0TB 4TULL 2E75C 4EDWL 4MXQC 5DK0B 3OVRA 3SDYH 2ARJB 1PPIA 3UGXA 5TDNB 4PG2A 5C0IB 3CFJB 2VZ3A 3JWOL 2VLRA 3KGSA 2BVPA 2CK0H 3VD2A 3DXAD 1LP9B 3M1CA 3T0CA 3NJ3A 2UY7A 5EU6E 1SVDA 3EGXB 1KPUA 4Q9BA 3DX0A 2VW7A 1M53A 4ZXBB 2R1KA 1MFEL 4Z3TA 4Q8VA 4AD2A 4EPBC 1TRDA 2KC0A 1C08A 1NLBL 3GTIA 1M6OB 4S1QH 1E0TA 3W2JA 4B9KC 5GGUB 1J2WA 2WNWA 3UPAA 1HSAA 3JWDL 4YK4C 4S2BA 4IHCA 3HOGA 3W11D 1O9WA 4KUZL 1JD9A 4W6WB 4UTUA 4E36A 4ZMXA 2BW4A 3P0VL 4NNXA 3FT0A 4NQSB 5AW7B 1ZCRA 4A8RA 2H8ZA 4LEOA 3PAJA 3WNOA 4DX3A 4NCC2 9RUBA 1YEFL 5B38G 1J5HA 5DWPA 1T41A 2XBDA 2KHAA 2FO4B 5GNYA 3VNYA 4OZGF 3G0SA 4NOBA 3GR4A 2ETWA 5I0WA 1G7QB 3AFLA 1CF8L 3SB3A 4YSEA 4BE6A 2GCYA 2W6RA 1LO3H 3VG0H 3EA3A 1N3NA 2CBOA 4J28A 3W2LA 3P4NA 3WQGA 5DEJA 1J9TA 1Z89A 4XWOD 4CADA 2ZVRA 4BGLA 1YMMB 4HP5A 2WYZA 3NCMA 1PSKL 1NZRA 2GTWA 2NY2C 1B30A 3W1NA 4OLWH 1G6RA 5C97A 4GKNB 1JDFA 2QQ6A 3TBYA 1FNAA 1BM3H 2DDQL 3GE7A 3NZUA 4XZIA 5ISZD 5CG7A 3SPCA 2F8XC 5JPNA 1OHZA 3KLHC 2PZNA 5I1DA 5D7SL 4XNZB 3AYRA 3TO4C 4BYHA 1YNLH 3P2BA 2XN2A 4M6UA 1KT2A 3SDAB 3RU8L 4LPYA 4YLBA 4JTRA 1PZAA 1D5IL 1IC0A 1VFHA 4YDMA 1KCUH 1GIGL 3VFOA 2BIQA 1V0LA 3PNWA 5G2HA 4FNQA 1LUCA 4S1SL 2PUZA 4B7IA 3KVQA 1J1OL 3EWZA 1LQAA 1OM9A 2EEFA 4BUHA 1UD5A 3WXWL 1WTGT 3QO0A 4FLHA 1KFJA 5L88H 2NLIA 1POKA 1TJGH 5CSBA 5LGXA 4J3XA 1SO3A 3H2PA 2NUYA 3IKCA 4GB9A 1M3JA 4TL4A 1HU8A 5DURB 4LLMA 4NOFA 1OAJA 1AGBB 2I9LA 3KOYA 4K94L 1T20B 2P8LB 3E2HB 4WNSA 3CH9A 4NZ8A 1TTUA 2H26B 3TA3C 2XX0A 4P3DA 5DI8A 2I1OA 2PS2A 4DJDA 1M5WA 3UVIA 4X7CC 5JBEA 5LAPA 4F0RA 4DKFH 2DZSA 4LLYB 1MCLA 3QPQD 1Q6QA 2J6XA 3ZJAA 1QWGA 2AKZA 4P5SA 3FSAA 1YMHA 3KPQA 2HFEA 2X5PA 4BSJA 4LF3B 1FSKB 4LHUD 4PUDA 5SWSA 4M3PA 4PG9A 3LB0A 3GNPA 1YUHA 2VX5A 2BY3A 3ULVF 4HZ1A 5HINA 4HKJB 2VDRL 3MUZ1 1NUGA 4HH9B 3EXLA 4CNPA 4XPBL 2R15A 1YYLH 1KDJA 4ONHB 5K9DA 1P7TB 4F24A 4U6VH 4LLVA 4OH2A 3SE4C 4XN9A 3GIZH 5I74C 4JTLA 2P10A 3GVQA 1QR1A 3NOYA 3PS6A 5BQ7B 4US5A 5TDOB 4FULA 2KLTA 4PZVA 5L7XL 2Q02A 1A4JA 3WD2A 2A6DA 1TVLA 3ZQ9A 4JPVH 2FWUA 4ZFQA 5FEPA 1KIUA 4HN4A 1WS8A 1HZLA 1MXSA 5DT5A 4EMZA 4B16A 2QEJA 3B9KA 5DRZB 3D39A 2H0FA 1XX1A 2ZT9C 5LKNA 1TV5A 4HQVA 5D7IB 1LDSA 4IP4A 3HZKA 5ICYA 1C92A 3GH7A 4GQ0A 3L9EA 3OAYK 4ABWA 1Q6FA 1O60A 3FDWA 4MSWB 3KTXA 2WO2B 1RSFA 2QDGA 1JFXA 5ILTL 5I19L 5D6CB 4AXKA 4LU5L 5DVKA 4DOHE 3BP5A 2KUTA 4MJIA 5T3ZE 3E2RA 4NC0B 2Z65C 1M04A 3FA3A 3KGUA 1OF2A 4F9DA 4AIOA 4OTXL 2NY3D 1ZV5A 1RUAL 4NVTA 1T5WA 1IVLA 4HA4A 1G4RA 2P52A 3QC3A 2XWJA 2NUTA 4YGVA 2PDUA 3EEZA 1F4XH 2VN5A 2Y1HA 4HHAA 4DJED 1R3IH 1PEWA 2WOQA 2X4SA 1T1ZB 4K6AA 3C8KA 2YX0A 1XC6A 4TF4A 2QVFB 3HHSA 3MVTA 3VIFA 2NWSA 3BJTA 4ZCWA 4P7OA 1I75A 4ONFH 5IFJA 4WDUA 3SHSA 2IKGA 5AFDA 5C0CD 3VXTA 5D72L 4RFNB 2JIXA 4V2BA 5TQ2L 3LSBA 1XDLA 5D1ZA 1CD8A 5F89B 4M5TA 2IDCA 1BXVA 2FLMA 4F7CB 2VFHA 5D8JH 4IMEA 5DHVA 1AIFB 1UZ8B 5AB0A 3HIJA 4DT2A 1B3VA 4JG5A 5J11B 5H94B 5CKSA 1EZSA 1ZHKA 3NJHA 1KTDB 1VZIA 1FG9C 3CFCL 4QE1A 2WJ5A 2Z9TA 5K93A 4GUQA 3U6RA 1FCCA 7ENLA 4JFVA 1TKWB 4GAJH 2XV2A 3CLEH 4YTTA 2B2XL 4MWAE 3VKAA 4NEHB 3A24A 1UOKA 3C3NA 4Y1AE 2CHOA 1KRMA 5J5DA 4YMZA 5GJPA 2YRLA 4GUGA 3EFFA 1FDLH 2EDBA 4Z5RB 1HINH 1WDWA 3S7GA 4YLCA 4A4AA 4GO9A 1FKWA 2WZTA 4JAMB 2CJUH 4A66A 1MW1A 3B05A 1F73A 1BGXH 2CAKA 1NGQL 1X5FA 3UZ5A 1SJBA 3D69A 4PMQA 1CB4A 1X7QB 1S2WA 3CH8A 2JKRM 2GABA 4Y2NA 3FXIC 3SBFA 2C4XA 5B21A 4PN6A 4K55A 4NZ3A 1JP5A 3K4AA 1I4NA 4MMZB 1CIUA 3HTLX 3KS0H 4F9LC 3B5TA 2BOGX 3LCWA 5BZDB 5MEOA 3UACA 4WFEE 3B06A 2Z92A 3CJPA 3ZTDC 4NP4L 3ML8A 2FR4A 4XWOC 3AGWA 4RZBA 4KTEH 4EACA 4JBRA 3TNBA 4M7KL 1NKOA 3B9EA 1MCNA 1KM2A 4P8UA 3ESMA 4PD4K 5DVOA 5BVJA 1IAIH 5LNRA 3JS3A 3TLRA 3RU8X 4F7MB 2R0LH 1ETB1 5A2LH 3GHBL 4NYUA 4JFDB 5E8OB 1I8LA 3MV7B 1YDPA 1W0WA 4X50A 4PWJA 5HPOA 5IJVA 3VDGA 4UV4H 5AW0B 3NPWA 4LGXA 4UQ2B 4JPQA 3S35L 3IUIA 4PLKD 1MI3A 3HLAA 1GYCA 4XNUH 1PZ5A 4XZBA 4HBQA 4U33A 4F57L 4WU5B 5GNXA 4QRQB 4L8BA 3HEIB 3Q8AA 4YSPA 1T2QL 1E6SM 3CB8A 2NRDA 2V2TA 1TZZA 5F8QC 1JGDB 3UGVA 4NXSA 4WO4B 3UO1L 3AO0A 3GMPA 3IJYA 3QQ4B 2PO6B 3KL0A 2CA4A 1EB3A 1E9OB 1NGPH 3WH7A 4PMOA 3GPSA 2PYEA 3DHUA 4QCIB 4BK9A 4KQNA 1C5DB 2OJEB 2RMNA 4L80A 1NELA 5B1CA 2C79A 1WDPA 2HTKD 4NN6B 3ZKQD 1XLEA 2V2XB 3UTSB 3NDZA 4F33A 2VENA 5A16A 2IVFC 1RCYA 2DT1A 4DHLA 3WNNA 5FB8A 1R86A 6REQB 2PDIA 3NA9H 4HISA 1UOZA 1G1CA 5FC9A 4FA6A 2DM7A 2VDKL 2IANB 4L3AA 4RWHA 5KVDE 4GE8A 4J5NA 5KSVB 1KCWA 4Z2IA 3FO0H 2PTVA 5C3LD 3S4SB 2CBIA 4HPJA 3O3DA 4JX5A 2EVFA 1LORA 2XVBA 4M1DH 2ROYA 4RZCA 4NNPH 2Q6WA 1H62A 5C2BH 5AZ2L 3ZBMA 4TQ8A 3EJZD 3SJNA 2JGYA 4ZX3A 1THCA 5F0MB 1K8CA 1K4DA 1HL8A 2QF8A 1EFXB 4NKIL 4NKOB 4F1ZA 5C09A 4MNKA 2WLKA 1H8OA 3DFNA 3QUYD 2GGEA 4JFXB 3JV6A 3F5JA 3LKOB 1UWGH 4WGWB 2CO6A 2VR6A 4NENB 5SWZD 2MIZA 1JNJA 4X6DB 1CPUA 3FQWA 2W8CA 1JZ3A 2A1YA 3DEQA 2CALA 2QVNA 2V5JA 3GT6A 4M6NH 1A4LA 1OVDA 1HXMA 4YBLC 1NIAA 3VE7A 3P3YA 1AGDB 4YSQA 4F2FA 5JW5B 1TZAA 5F2IA 2D4DA 2E56A 3RIAK 4CNIA 2IQTA 3VGDA 2BFVL 4IDJH 4W4NA 4KTYA 4YWGH 3ARFA 3MGOA 2VXSH 1UXWA 3QDJE 4AD3A 3K1GA 4XAZA 3SDDA 2UZ9A 4YXLL 4Q2ZB 2J8UE 5EA0H 1TT6A 4KK6D 2INFA 5G2NA 3BMVA 5EOCH 2CRZA 2YCLB 1DCEA 3Q1SL 1GKPA 4Y96A 4FXRA 1E5JA 1ERNA 3QIUC 3LNEA 4P4KA 3QI9A 2Z8WC 4ZUTB 1YECL 4TV3A 4NC1E 2QDDA 3EO9L 1L6WA 3AQXA 4BCYA 3WIJA 1UROA 1AR1D 2DWTA 3H26A 4RA0C 1IFHL 1FL6B 1KCZA 1NPUA 4PRPD 3FXGA 4BWWA 2PC4A 4A6YB 2H0PA 3DPBA 3FUHA 3GUGA 2VDIA 4GXUN 1PL3A 3MA7A 1K8ZA 4QRPD 2UXGA 4ODVH 1J8RA 3HVDA 2VRAA 1N26A 2RQEA 2XWBB 1I0BA 3CDZB 4JRXB 4P9HL 1HE8A 3W27A 1N5AA 3FL7A 1YTDA 4O58L 4R4BA 1Y65A 3O6MH 4PRHD 3D46A 1DCLA 4W4QA 2EC9T 3LB6D 4BA0A 5JHDB 3RJQB 2IQDA 1P48A 2GGJA 2ISFA 2QQNL 3WFHB 2QYGA 1QNQA 2WINB 3QIWA 5T33H 7XIMA 1OAXH 3L1FA 1J5OH 4KK8C 4FAAB 2BB0A 2D7OA 1IGMH 4OF3A 5DK3A 2NY7L 2AAAA 3S4TA 1I45A 4IJ3C 1MZRA 5AWNH 3Q06A 1YQVH 2YAPA 2XV0A 5E4OA 1JGUH 2H1LM 1DVFD 5LVEA 3LIZL 2YZ1A 5LBSL 3AIUA 5LWYL 4LARH 2I27N 3LQAL 4DEPB 2L8AA 1GG0A 1JYNA 2FBRA 2Z4TA 5DXYA 4PJFB 2DDXA 2Q3OA 3CPRA 2X09A 4G9FB 2BGSA 1K6QL 5E6SB 2EDRA 1F3XA 2IKHA 4U1IA 4WZ9A 3K71B 3BO8A 3FU7A 4AM0B 1FWNA 3GMRB 1W72H 3FH8A 1CDCA 4C57C 7TAAA 1AY1H 5EBGA 2Q10A 3LNIA 3OGCB 4ETQA 4NAFB 2ZUMA 3O2VL 1F4YH 4Z7UA 1E0XA 3L3OB 1GOIA 5D1QB 1F9CA 3C5SB 3UTTE 1J93A 1MH5A 1RZKC 4R96B 1IKNA 5FWQA 1KV8A 3RTQC 2Z7GA 4WY0B 3B97A 2H8XA 1PD6A 4L1LA 3EAKA 4JDVA 3EWDA 3QV9A 5C3TA 3RRQA 2QVIA 4UOZA 1BVOA 1AK5A 3DOHA 4WI0A 2FSEB 3QNFA 2DD8H 4S10A 1BF5A 2DBLL 1G9NL 4UIMA 2AK4E 3S35X 4BFKA 2JJSC 3OXSB 3BZDA 4MNJA 5AB3A 4HAKA 3APFA 1B90A 3UC0H 3L2IA 3A21A 1AA1B 4RMWA 4AEHH 3IEAA 3EWXA 3C2YA 4J2PA 4L3EB 5L4IA 3X14B 4MDRA 4RQQB 4IJCA 1JWUA 3FK4A 3LEPA 2WWNA 4UBDC 5FUCC 2XNAA 2P8PB 4TUOB 4PLKC 3U0WL 1BAFH 5EU5B 5GRYA 1G6CA 1HILB 3UZQA 1NOAA 4F58H 1T5XB 2CC0A 5LN4A 1DBJH 4BFEA 4HHWA 5L8LB 4NWUL 2GK1A 4Z7AA 2GSHA 3IF1A 3MBEA 3DX6B 5I15H 3QY7A 1QUNB 5I1GH 2FEDC 5TE7L 1RBOB 2IPKA 4PR5A 4IP5A 4N68A 2PWFA 4XP5L 2QKSA 1BPLB 3CFKA 4AEOA 1UCTA 6PAZA 2HKHL 4IUGA 4HJGB 5KVFH 3PJXA 2ZX5A 1Z0MA 3E3HA 3IDNA 1P9MA 1Y1UA 5I18L 5CWSA 5H91A 1IL1A 3FV9A 4IGBA 3ZR5A 4LP8A 2FQEA 4EVNA 2AL2A 4K71B 2JB5H 5I8EA 3G04B 4LTSA 4LSBA 4ZMOA 3EYQD 1AJZA 3MUAA 1KIPB 4PGLA 4UAOC 3QUXD 2FJKA 3H4GA 1J5CA 3CXDH 3IGFA 3L68A 5E6RB 1RZ8A 3KCWA 3TP4A 3H7BA 4JFFD 1F2QA 4C6MA 4E41B 4U05A 4B96A 1KLGA 3VKJA 1Q9KB 3BFQG 1CXFA 1TB3A 4W9HC 5FFGA 3FDKA 1AS7A 2MMXA 2PCPB 4O4YL 4F2ME 5JQHC 1BOGB 5AVXB 1JGVL 4P46C 1EDHA 2DWDA 3NGFA 1UJ3C 1AG6A 3OIXA 5HHME 4OZIF 4ERSL 3WQ5A 1HW6A 4NILA 2AXJA 4BH8B 3QUYC 3PY2A 4OZIA 2WYTA 4C91A 2CZEA 1U2HA 3QDJA 2J8UF 2V6HA 2VVSA 2EGZA 4B9GA 3DI3B 4ZPVB 3NQKA 3F3HA 3W57A 4Q9CA 2O4EA 4TNGA 3MSPA 4I0PB 1JUBA 4S39A 3LTVA 1DORA 1SFJA 1MI5B 1YVLA 1LO2H 1SPDA 2WTRA 4CJ0A 1IAKB 5LGJA 1HYSD 2X6AA 3D52A 3MPGA 3N18A 4U1JB 3LLXA 1SHMA 1QPNA 2OSLA 1OZTG 1ZS8B 2WXJA 1Z9PA 4OB5H 1HXYA 5TGBB 3G2GA 1I7UB 4HJJL 1HZKA 3WIFB 1XR9B 1EP1A 4HS8L 2ICES 2VDOH 3UTZA 2TRHA 4AL8L 3BZEB 1SY6L 4GKZB 4JFEE 5FJOA 4LV9A 3H9ZA 2Y7OA 5JIDA 2EVHA 1JK9A 1NKRA 1FYHB 3UTOA 4ZMZA 5ABGA 1LP6A 4IRJD 4GLEA 4P5KA 8XIAA 3JWOC 4EWJA 1O5XA 3D4ZA 4UB0H 3TEXA 1GOWA 3TF4A 4I5BA 3OV6A 5I6NA 4O02B 3FSZA 5FYJE 1IEIA 4B5UA 2R39A 1M56B 4GAAA 3H3PH 1T1YB 1VC4A 3HE7B 3NDOA 2BPBA 1OINA 3CDYA 1FYTE 5L9DH 2AQ1A 2QPFA 1LMIA 5HVGB 4QG8A 3HN5A 3FKKA 3CVIL 3OF6D 2ENQA 4EXAA 5DD6B 1GZJA 3LCFA 3Q37A 3QZ6A 4LLDA 3N85H 5DVPA 1DSWA 2ZZ6A 5JXAL 4JKWA 4JIHA 1ZT1B 7PCYA 3CN2A 1B3ZA 1BQCA 3L2MA 4AIBA 2DVUA 4BFIA 1N0XH 2O7QA 3MBFA 4XZUB 3BARA 5J8LA 1I60A 3KYKL 2OGYA 2QVTA 1ZBWA 1OYAA 1RK1A 1G7MB 3RPBA 4KPHH 1FH7A 2OCZA 4LEXH 4F0HA 4XCEA 2ZWYA 1C5CH 2MCAA 2CESA 1CX9A 3DESA 4NJAH 1A5CA 5H6HA 4L2LA 1NMAH 4GJ1A 4KIEA 2EJAA 3EX3A 1I2NA 5IFHH 1C3FA 4Y5XC 1ISXA 3LNHA 1TVHA 4OLZH 3K4ZA 3GHTA 2JKWA 3UWVA 3QEQA 4E9LA 2ZQKA 5TK4A 1ADQA 4FKKA 5M94B 1QNOA 3V4VB 3VFNB 4K5MA 2JJWA 3IXAB 4DO6A 2VXTL 2HT2D 4J3WA 2IUZA 3D1MC 3E6EA 3G1YA 2ISSA 5CJQL 2Z35B 5DA4A 2J78A 4ZEPA 1AZ2A 4XPGH 3VAVA 5LZLA 3ABQA 2QNEA 1RJLA 4DBSA 3AQDA 2G4EA 2G30A 4MD0A 3RWJA 4PTNA 3A9BA 4P48A 2IPWA 2JELL 4HC1H 3L5MA 4X4YA 2JI1A 4WEEA 1YTEA 4AJVA 4Z0BH 4ML4A 3EJCA 5FYLH 4F8QA 2WCAA 1EJ6A 4UC5A 4H6KA 1P7BA 1BV8A 2Q1EA 3ITCA 4AD1A 2XWZA 2WK2A 4ESKA 1F1AA 1E73M 4HNUA 4B7LA 1EXUB 4K94C 3GSOA 2XZZA 3GR8A 4NQ1A 3ZE2B 3GB7A 4NZRH 1A5OC 1CFSA 3CX5K 4U1LA 4LY4A 4R0LA 4N2EA 3F2DA 1OY3B 4LOUD 4OV5A 5CC5A 3GFUA 4LCIL 4AF0A 3GGWB 5D02A 3QGKC 1OSEA 3O4OC 4WVXA 4L0PB 2OQHA 4AITA 2Y89A 1JQXA 3ILEA 2VLJD 3UZZA 1XLJA 1AH3A 3RJXA 3NYZA 4E9VA 1IC5L 5IHLB 4HHGA 4EAYA 5ALCH 2NY2B 3M5VA 4EZJA 4IX0A 1EJOL 4YYFA 1JD7A 2PUQT 4U1GC 4DJFA 3HZMA 1OZUA 1U9KA 4Z7WA 1W3TA 1H6FA 4NZ1A 4WHBA 1I3RB 3GJEB 3KXFD 4M5SA 5DJYA 5ENWB 4PJ5A 2GFTA 3BW4A 9CGTA 4A7SA 3EYQC 3MTRA 5B3SB 3HI1B 1GORA 3WEMA 5BS0A 2EIDA 5HYQB 4RLDA 1HL9A 2DQGH 3M0VA 1YW1A 2ZWKA 1TLMA 1WDQA 3WDIA 5BU9A 3W0WD 4JQVC 3I6TA 2YBRB 3NK3A 3RFZA 3PWJA 3RGVA 3JUYA 4WO0A 2WJ7A 1CC3A 5AOMA 3TYFB 2X70A 1VYSX 4FQJL 1W9DM 4Z3IA 3GHUA 4QE4A 1AXSB 1U6AL 4ES8A 4CVWA 2ZRXA 4QRFA 3JZYA 1F1DA 4WDIB 2Y7QB 3S3SA 4EAEA 2F61A 4TLKA 1HQ4A 4PCPA 5D70H 4IBYA 2RBLA 2I26N 4XCFH 4D1JA 1PDKB 2VDMB 3TBSB 1FF5A 1FH2A 1CD0A 3OWEA 4UT7H 3W83A 2QMJA 4H8HA 3WIHL 4GXUM 2PDGA 1BZ9B 1NCGA 4LE8A 1NWSA 1H19A 4AQAA 4K7FB 2YPVL 2ZOLB 3ESUF 4Y2DC 4ZNEE 5EZLA 3IUDA 3TCXA 4UTAH 2GVEA 1XI3A 1IKFH 2YAMA 5GISL 4EN3B 2FX8L 4XNYL 4HMEA 3D47A 4NM4H 1B9ZA 1ODUA 3PUGA 4AGNA 3OMZA 4XX1G 4RPQA 4PWHA 4N02A 1G0DA 2PPAA 2DWYA 3TQVA 2EDKA 1NIEA 3FU5A 5IQ9B 2PE4A 3LH2H 2YA2A 4E38A 1KV5A 1FVEB 2DS4A 4N87A 3GNRA 1U8MB 5IQNA 4HS3A 5EUKB 2J21A 3OA3A 1T89C 1T22B 5BRZD 3F6IA 1OAZL 2GFBA 2Y5TA 4LIQL 2WHJA 3QJQB 4YHPA 1ZTXH 2HBVA 4AWEA 4RLIA 3PREA 1FYTA 3LQMA 1HKFA 4HF5H 3IJIA 3WK3A 2VE6A 4PRNB 3ECBB 5F6IC 3R79A 3GM8A 1MFMA 1KCRL 4WSKA 1HH6A 4WTQA 4YPJA 3VMOA 2X89D 4HJFA 3D3VE 3KYNA 2AEQH 4GMTL 2ZKHH 3RN6A 1F0LA 2VYRE 1T4WA 4M48L 3MRKB 4DQAA 4TSCL 4L64A 2K7PA 1J0HA 1OSZB 1RK6A 3S1XA 2CKBL 4ZTOL 1LO5A 4HUUB 4HGKC 2DLTA 3I50H 5AVUB 3MRDA 4R84A 5AUMB 3SGDI 3BWAA 3WJJC 3RHWK 4GNKB 3CK0L 5CCHE 5CGQA 4XVTL 2LLLA 4JMNA 5DLML 1RSYA 1XDTT 3T3ME 1CGSH 4YDJB 3T6CA 3L5WA 3MRQA 1KOAA 3T1WA 5DD5H 3BH9A 4S3GA 3CMJA 1HH9B 2IWGA 2FH8A 3WBDA 1NP0A 5D5ME 4Z77B 4P0DA 3MMEB 3UZEC 3NQMA 3HNSL 4WVRA 5TE6L 5GGSB 2E5DA 2PXYD 5T5NG 3CT2A 4W9LC 4KRTA 3X3GH 1YG9A 4OF8A 1X6LA 3M88A 2FQFA 3DJZA 1T04A 5FO8B 4G6ML 5JQ6H 5F2FA 1J96A 2WLLA 1FNSL 5FYJU 2YWZA 3CVCA 3H2OA 2VLRE 3EMQA 1NCOA 3IJ7A 2OR9L 5EG6C 3HCVA 3DBNA 5DJ8A 2WMIB 4GFXA 1MKFA 4PWGA 4KTDL 5LAXA 2I9EA 1S5HA 5IFAH 2ZUQC 3E1F1 3KD4A 3CMGA 3IVKA 4Y9AA 1G7LA 4DF2A 3NYDA 5DELA 1UWIA 1BKHA 1BQHB 3EADA 2A7PA 5C0DA 5D9SA 5E7FA 3ZMNA 1QPPA 4YS1A 3O6YX 5CJBA 3C0LA 1Z9SA 2VXNA 1AZBA 2X4OA 1JYWA 3KCOA 2IFGA 2ZJSL 1KACB 3UXDA 3FB5A 4C4BA 4QEEA 2LVEA 1MRDL 4JIPA 1P43A 2R8SL 4J3OH 2OYKA 2BVDA 1AMXA 3KLDA 2VDNL 4WOQA 3I9PA 3EYSH 1AANA 4P5UA 1OIOA 1J8KA 1UGKA 2ZOKB 4KERA 3FTVA 3V4LA 1WNOA 3A4DA 3APYA 2CIPA 4U10A 1S7SB 2Q7NA 1K7EA 4KS0A 3D85D 1ZSDA 5AHMA 3LBCA 2VISB 1LOSA 4C6KA 3DYMA 2VCCA 1AJ2A 1EJUC 3GFXA 4DB7A 5CLYA 5IXEA 2QADD 4PGDA 1A7NL 5C7ZA 2A1WL 3PQYE 5M2FX 4YSAA 3T4YB 2WHKA 1OALA 4QAWA 4PGCB 5C70A 3U30B 1QNPA 3HMXH 1GJIA 3D3AA 1JFQH 4Z3HA 4XCCL 3GG1A 3NJKA 4PJ6A 3HNVL 3ITLA 1ZRQA 1UB6A 3V4PA 3CO4A 3N2TA 4ZGYA 3I2CL 4S1RL 1W1PA 3CUPA 2AV7B 3ISYA 4JB9L 3BE1L 1ITXA 4CNUA 2V9QA 4YFDB 3KBVA 1ZLDA 4Z0XB 3YPIA 3PUEA 1R0AH 2A3BA 4PUMA 3VXOA 1DHKA 1Y5XA 2GGGA 3H23A 2EBNA 4O1BA 4D6FA 4G9DA 2OMBA 3EOEA 3NMEA 4MD5A 2ZWSA 2E7MA 5E2VH 5KN5A 4M7JH 3CU1A 3FPYA 2NY0C 4LFYA 5GGRA 3VMNA 1Q9WA 4MJ6A 1GSMA 2IMMA 4IFOA 5I78A 3ZKNC 3RG1C 2RFXB 2GQ3A 2G3IA 3T6VA 4NUQA 1N8WA 1PCSA 5IVOA 3LYEA 4U1KA 1NUNB 4R90L 1O5PA 4ZNEA 3FJLA 4Q9QL 1BXAA 2HT3D 2AKRB 4NQDA 4XRCA 3P67A 3FPXA 3RA7H 2Z93B 2V6AA 3MBWA 1MWAB 3IIOA 3TNOA 3MQIA 1IAOB 4O2CB 3ZYJA 1XL6A 2PR4L 4FFVC 1MFBL 3O41A 1DQLH 4DVBA 3EA1A 1KFAH 3T42A 1KG0A 4UM9D 2BIPA 3BG9A 2FZ3B 4HPNA 4RZKA 4LSSH 2PWVA 3AXMA 2HWZH 3VGHA 2XGIA 5B7EA 2WBJA 3PVFA 3IARA 1W3KA 4FTVE 4XP4H 1M05B 3GMMA 3H9HB 5A6BA 1KFCA 4XP9L 4EBQL 3VOFA 4QAIA 3ULVE 5IK3B 3QW4B 4IJRA 2FIQA 4J4PD 5JO5A 3V55A 4NQEB 1YPFA 2NQ5A 1HC1A 1U8CB 3THDA 1YXDA 1YBQA 3TN0D 2X0HA 2QPUA 1MAKA 1JERA 4F2UA 5F7WC 3GXUB 1ZTVA 5EA9A 1NBQA 1RFDL 3P4LA 1RK5A 3D3VA 3GNML 3SE3A 3L9YA 2APFA 4GI6A 4UR9A 1Q72H 1HOCA 4WV1A 4IL0A 3MV9A 1EC8A 1QO5A 1ZLUH 5C08D 5BWAA 1AO7D 4XVSH 4YBLB 2IXQB 3QR1A 4X0KA 4KK9C 3D39E 3IPBA 1GKEA 2APVA 3QDGD 2O9TA 3GZQA 4IU3A 2IEPA 4XB8A 1OP5K 2L5HA 2X6VA 4EDXA 4H9VA 1SOKA 3G1AA 1HTIA 1S3KL 2J6WA 4WK0B 1G9EA 5EOQH 4M6AA 4OLYH 3ALGA 3VZZA 3AJ7A 1I9RL 1DBTA 4XZMX 3GLDA 3QXBA 4MJIE 3GR7A 1D5BA 4GIPD 4AQOA 5D5MF 3TXZA 1A0QH 4NO2B 4F9PA 1UZDA 1GOKA 1L5GA 1W91A 2J7BA 5HWNA 4BRVA 3UR8A 2F6XA 4PGBB 4PBWD 3VXSA 1QFEA 5E6IC 4UILL 4WHYH 4JRYE 2HZGA 3M17A 1GL4B 4PJ9B 2DWEA 3RVUD 5TFSL 4UI2A 4M7LT 2G60L 1FJ1B 4APQA 1JZDC 2QKFA 4RWYL 2QCNA 1W2PA 4AYSA 2BNUB 4ZFMA 4PREB 3HAEB 4ZDHB 4W9KC 4Y16D 1R24A 5TQ0L 4DZ5A 3HBGA 3R0MA 5BJTA 3QIBD 3DFYA 4AHOA 3RPTA 3ATYA 2W1NA 1RJZA 2EIEA 4U7KA 1KYDA 1J88A 4KMTH 1EDQA 2F19L 4OD1L 2BXYA 1ISYA 4C5ZA 5EMMA 4AIZB 3KBSA 2Q8LA 3E6FA 1TPXB 1F4WH 1EL3A 3RRAA 2J88L 4IJ3B 2A0LD 1DQML 1ZLVK 1PZ1A 1HQRA 4HWZA 5D8ZA 5ECJE 4NRYB 3IGAB 1NEPA 4J6IA 1OAUH 2FTPA 3IGUA 2JV6A 4CC0A 4DVRH 1NVMA 5JOFB 1Z48A 4ADUA 5A94A 4JTIA 3N6YA 3KYAA 3UBXB 5F7EH 2J24A 2X9YA 3MMTA 3I6KB 3BN9D 3PQYA 2V7HA 1V6UA 3FO1B 1XF4A 3T8QA 3CD4A 4IFKB 4AIUA 1NFDE 1YDOA 2I32A 4Z78B 3EYUH 3AFBA 3SCNA 1M41A 4GINA 2HJPA 2WLIB 4KI5D 3NXFA 3CSGA 5I5JA 3REQA 4OGYL 3WUBA 1WHPA 2K7QA 4TMCA 3FFOA 4ELMB 2VQUA 2DZVA 5HJGA 2GJLA 4QOKA 2NX3A 4V1DB 5BUGA 3RZCD 1GOHA 1SZNA 4QCEA 2RCSH 3VQMA 2WQAA 4UTBA 4M1GL 4Q9RH 3JZUA 5C2CA 1QASA 3MJMA 4XMKH 3NWRA 3B7YA 5C07D 2PDQA 2BVEA 2O5XL 1WEJH 4YAQA 1Y7VA 5I1EL 2VP8A 1HHKB 5HYJB 3K5XA 4E2DA 5HHXH 4ZFOL 3ZL4L 2PBOA 3IRDA 5CFHA 5I1JH 3VXNB 4LPTA 3QYQA 2FHBA 3WDJA 4UANA 2VVNA 3N44F 3L7EA 5AYUH 1HZHH 2WZAA 5EC2B 1UZ6E 3FT1A 1XD0A 1S2AA 5D33A 3CG8A 3UZYA 2I69A 1Q94B 2PTYA 1OP9A 4G8GE 3LGDA 3VCCA 4JANB 5JORA 4DP9X 1H63A 1IT9H 4NQUA 4RMRA 2ZSWA 1JK8A 3AZSA 3BVNA 4ICNA 3KWWB 3IU4H 4AC2A 2PYEE 3AQYA 1B3YA 2HT3C 2AQWA 4PWEA 3NZPA 1X7FA 4JZ5A 4AT6B 1PG7L 2LABA 3ARDB 4AL8C 3NDZE 1JDDA 4MNQD 1G4PA 3HJZA 4MJ4A 4MMYA 4FTVA 4ZFZA 4MDOA 3RLHA 3MLRL 5AVQB 3W9EB 2N0KA 4KZ0A 3GVWA 4FI7A 2B0SH 4YNYA 3WD4A 3QOKA 4G8EB 3PE9A 2VNCA 2ZCZA 1FGVL 2DIKA 1F2JA 1UA7A 3IMVA 5J06A 4UTTA 2NCEA 4S1DD 1ASQA 5I17B 4XX5A 2XYCA 3IRCA 1B9BA 6XIAA 1HN1A 4CNNA 3QP3A 1SJXA 1JAKA 2GY7B 1LWRA 4R5TA 2BDNL 4QY8A 4HOMA 3TN0C 4OVXA 1CG9B 2XWCA 3H7UA 4O9HH 5C09E 3VWKD 3B3IA 3VIIA 2IADA 1FBIH 1DJXA 3SY0A 4Y4FA 3UD6A 4GFIA 3I84A 4NGHH 2CGRH 5A8QA 2CJSA 5BVPL 4XNQB 3SDXF 1IQ8A 4YR6B 2FDBP 1ZLPA 5IMKB 3SDXA 5CXPA 1FX6A 3BPNB 1KPVA 3BJSA 3UU0A 1J0KA 4ZZFA 4I77L 1PS9A 3GW0A 4EI0A 4JS3A 1QHPA 4M61A 3N6JA 4JX4A 4D94A 2CO2A 3ZU8A 3VNMA 1OC7A 3T0DA 1WD8A 1EUUA 4ZFFB 4HSOA 5DXWA 1BEYH 4RK8A 2P0OA 5E2UL 3RHGA 3B5HA 1AACA 1YUKB 4HUWA 2Y7LA 2ON3A 3U2EA 1LL4A 3N14A 4JRYA 1DVJA 3B4UA 4AAJA 2YD0A 3QUZA 4W89A 3ZWTA 1D7BA 3QFJD 4HPOL 1CICD 5ABAA 1HL4A 3ZZLA 1ZT7A 4PRIB 3UZWA 2BZCA 4JKNA 2RALA 1MO0A 3U6WA 4F7TA 2HV5A 3U9IA 5CPLA 1R5VA 4KXDA 4HSCX 2YD5A 2V68A 4MIMA 4Y5VC 3DFHA 2OSWA 3G3MA 2Z3FA 3L6FA 3SY5A 5CR1A 2WZHA 3GKWH 1I1FA 4ODUA 4HGWA 2CERA 1VH7A 4QRSB 4JN2B 5EO9B 3FQTB 4QHMB 4B3EA 1E9QA 3CLMA 1O7VA 1Q85A 4M62L 2GEQA 3WKPA 3MV8A 1XRFA 5HYFA 4XVUD 2A6JB 2GL5A 2JXMA 4Y16C 3CX2A 4X4ME 4CU6A 2L7UA 2DOCA 3KAAA 4GRLD 5FAAA 1MDLA 1H0IA 3VJ6A 1NTHA 2W9LA 3HM7A 3AHVA 2EUZA 4M19A 2VW4A 3FF8A 2AQNA 3M6YA 4Z8FL 3F85A 1KN4H 1FH5L 2I57A 3W11C 1QI4A 3KW7A 3MKGA 1GOXA 1Z44A 3OG2A 3TBBA 3OVUB 4FDWA 1SEBB 4HHMA 4N9CA 3ZE0E 1OV8A 4GUCA 3H9SD 1FL3A 1ZE3H 3EFDH 3T8VA 2PGWA 3CHRA 4GP5B 3TN5A 5HJDA 1U3HD 3PZTA 2F74A 4PJIB 4MCYB 4RISH 4C60A 4I48B 5FJPA 3GHEL 4DZ8A 2ERJC 1NFDF 4O18A 1KXVC 2EDEA 4N3TA 3VOHA 1DUZA 1NFDA 4IMDA 5CSGA 3IDJB 4KAQH 3NPSC 1VHNA 3BN9C 4Y5XB 4PUUA 3IJLA 1HX0A 2TMDA 4XX1E 5A1AA 2AJ3B 4XB3A 3CAFA 5DD0L 1EXHA 2OMUA 2AK1L 4IIGA 1DYZA 3FSVA 4RMBA 4PWKA 4F4RA 3ROLB 4E8DA 5IQ7L 4BWLA 4Z7UE 3W1LA 3C5ZA 4BM7A 4X99A 5F6HI 3N50A 4OWGA 3M47A 5DGRA 4GPNA 1YKWA 3MREB 3FRUB 1KFKA 1SYTA 4LNRB 4IQHA 2HLFD 1UBPC 4IRSD 2BNRD 4AZ8B 1QK2A 3N55A 2GBAA 1VHPA 4ZTPH 3RFAA 1UZ6F 2HE8A 5MERA 3N1MC 4BQBA 1XS2A 1KO0A 4AJYV 4G8GA 3AHZA 3GDLA 3QJFA 4Q56A 1XWVA 2ZOUA 1P6AB 4U28A 1F42A 2YGNA 2I5YL 2PDLA 2R1WB 2Y22A 1XZ0A 3AWEA 5IB3B 2RDUA 3CQQA 2IAMB 3LVTA 1W0VB 1UHVA 1J8HB 3UY7A 4QRUB 4W70A 2YLAA 3SIZA 4OZFB 5SWQA 4JEJA 1UZ1A 1SBBA 4X0NA 4GXMA 1RUQH 4AEIL 3ABZA 2DEWX 1U8OA 1MZYA 3O4OB 1KLYA 4LUTA 1WO2A 1PG7X 4WU7B 2PW1B 4JRWA 2JBMA 4P23D 4W6XB 3QPQC 1O94A 6PCYA 4N0CD 1PIFA 5JA8B 1NDVA 4U1GB 5D04C 5IM7A 2OMTB 2V5BA 3V5HB 1DVYA 1VFFA 4XMXA 3WG7B 4ZPTB 4WRHA 3KEHA 1X9UA 3MLTB 2AJZB 5ECVA 2YEZA 2WVVA 1WE5A 5JOPD 1MFCL 3SE8L 3ULUH 3CL7A 4PB9L 3TBWB 4UNVA 1QD0A 1A3HA 3V6ZA 2FQGA 3M5XA 5HDWA 4K23L 1HSBB 1WYJA 1Q0YL 4UNUA 2V63A 2JF7A 1C8YA 1I85C 3RUGE 1P7QD 4RGOL 2DVTA 3OJVC 1KNWA 3W0KA 1J48A 1RIUL 5AYTA 1INDL 4DGIL 2QF7A 4CBPA 1A9BB 3AOFA 4LVFA 4JPGA 2N0MA 5E6UB 3GW3A 3X3FH 1S9YA 2I24N 5IBXA 1JULA 3RRXA 4X4ZA 3KH3A 4PTUA 4ODXB 4OZIE 3QYCA 2P9RA 1N59B 4IICA 2RACA 3HMWH 1QNVA 1BJ1J 2QKIC 4H1ZA 2XI9A 1QYGH 5HK4A 3NH7H 3GJFH 5AN7A 3HC0A 5DBTA 4QGTA 1AODA 2OKOA 3CEPA 3OBKA 4P2QB 4TN9A 1QBLH 1AD9A 4LQFH 3QEZA 4X5WB 3T1FA 4JCMA 3UGRA 4XBGB 4UDUA 4NLHA 3V5DA 4L18A 1F6KA 1KIRB 1KFBA 1JV5B 5AYXA 4GMSH 1R9ZA 2B5IC 1LP9E 4RGMC 5LA0A 2DJMA 4Y2DB 3N25A 5GZND 2OK0H 1ZHBA 2B14A 2P7TB 2XU9A 2NY3C 3OKDB 1GOFA 1RURL 3CZEA 3GBDA 2V9UA 3O2DH 3UADA 3TH6A 5EIVA 2PCXA 2D23A 4CC1A 1VBJA 1YJDL 2VR7A 3OLGA 1Z7AA 4DJEC 5H37H 4U1HB 4C55A 4PD4J 3ES7A 1SW7A 1PEZA 1KCLA 3KW3A 2E09A 3VXUA 3SO5A 4IHOA 3IJ8A 4AENA 4JLRB 1VPQA 5G1TA 5DJAB 4MZ8A 4IJTA 1EAJA 1TCRA 5IREA 4NAEA 2MNWA 1SEQL 2PR9A 3OZKA 2P26A 3RLGA 5CUSH 2EH8L 3QWRD 3O9WA 4X4MA 4M5PA 4J12A 2N3JA 2FVLA 5IEHB 4YX2H 4HSNA 3L4VA 5F6IB 2D7PA 1CGVA 3DDFA 4ZOEA 1TYGA 2YZ5A 4FCHA 3BEVA 3G1SA 3WFLA 5I5MA 3S5YA 1YA5A 4S0TD 4FCAA 1SFSA 1M7DA 1IEWA 2E9MA 5J5RA 2DZBA 3KLLA 3ZE0F 1NH6A 5B39A 4WJEA 4MWFA 1YMME 1V5XA 2IFFL 1NMBH 5HDQH 2A73A 3C2AL 4UOW1 3VFVA 3LPPA 4LLUB 1PCKA 1FWHC 1P1ZA 2WSPA 4IIQB 2C3VB 3ESNA 2E9IA 3S9DB 2OMAA 2W60B 4PTXA 2X1UA 4FYTA 1BLNB 4LX4A 1E3XA 2ZVIA 4JO1L 3MKCA 5DEFA 3DVGA 5A3HA 3W25A 4N8PA 4OT1L 5HGGS 5EO1A 2DZTA 2W0KA 4OCMC 1L9QA 1A3ZA 3MI2A 3MROA 1X9LA 4JHUA 3VNZA 1IM3D 2LU5A 2OR7A 3VFWB 2C8NA 3OSVA 1K4CA 2TYSA 3GBEA 5CLZA 1ZPLA 1G7PA 3D2UB 3ZDXF 5GSRA 3UYCA 4FQCH 3QFGA 2J62A 4Z7UF 3CZFA 4GG8B 4WJ5A 1ONWA 4A3HA 4KNUA 4TLTA 1BJMA 3W7RA 2GJ6B 5EIIB 1XIDA 2R7EA 3IRZA 5L2KA 3QEQE 3NCBB 3VB8A 3DX7A 5CGTA 1TOXA 3LLDA 4X7SL 3KBPA 3WMLA 3VFCA 1WZ1H 1MEXL 4HJWA 5EZOL 4RNFA 3BGFC 3E7JA 4YHYB 3TIMA 2J6VA 1IAMA 3UYOD 4MUZA 3QGAC 4JY4A 2X9XA 3OG6B 3W81A 4L4LA 4A7TA 1B3JA 4NO0A 2MRYA 5JPMC 3IETA 4RH4A 5EY5A 3QHMA 2CLFA 1BIIA 3D0CA 4YHIA 4OI9A 4OIFA 3BO9A 4I9JA 3V16A 3K81A 2J6EH 3HG1B 4OIBA 3DTDA 5IMOA 1KLZA 4FXGC 2B7QA 1XCQB 3FUDA 3VCLA 1D7KA 2H0EA 5AW1B 2IKIA 3JR2A 4UNTA 3NEVA 1OHLA 4CCDA 3TVMD 5F1IA 5C1MB 5IB5A 3TNNA 3FQUA 3VFPA 1L3NA 4WZHA 1AP2B 2VL4A 5E4EB 2XN9B 5IMMB 15C8H 3T0VA 4LB3A 3HFMH 2XH2A 2OMYA 4TOQA 2G5WA 2FECL 2HTKC 2VEFA 3OR6A 1YEDA 2CLHA 5T5NF 2ICWB 2J57A 2N01B 4AV4A 2N56A 1LLAA 1QSFE 5IOPB 1BBJA 3MJ8A 4OQTL 1PZUB 4ADSA 5G1MA 5F7NC 5D2NC 5AKSA 1FCQA 1A1MB 1FWFC 1R6VA 2PETA 2QCLA 2SEBA 1PYFA 3D05A 2V7NA 4IIDA 3IPWA 1GGYA 2ICSA 1UC6A 4Z7WE 2E7DA 4TX6A 3QVAA 2A9NL 4ZW5A 3RUGF 5LIYX 32C2B 4OJFL 4PJ5E 4GT7A 3RUGA 3LY0A 5BS0E 3NABL 4I89A 2PDHA 3PHQB 3EJZC 5CO1A 3EIFA 2AEPH 3BCJA 4BJHA 3ZSTA 2YDQA 1MHEB 5HPCA 5ADOH 1REQB 3FQ4A 2NY0B 1LE9B 5BZWB 3F7PC 4C7DA 3WG6A 4DSYA 4IMLA 5FIPA 1KEGH 1U21A 4KESA 2YN5A 3CUZA 7A3HA 3H0TA 2CEQA 4ALAH 4K8EA 3P0YL 3EAUA 5DK0A 4XWGL 4ZOCA 4N0YL 2ARJA 4M1CD 2Y61A 4RMUA 3W01A 1REIA 5TDNA 3P3TA 5C0IA 4ZENA 1TQJA 4PEKA 3CFJA 4NX5A 4Z0SA 1LP9F 4J35A 5EBUA 1KIQB 3NQ2A 1LP9A 3ARGD 4JN7A 4KK6C 3EGXA 4P2OD 5FCZA 3IMUA 4ZXBA 1AL8A 3WNPA 3AY2A 1OFAA 2NY6D 3EG9B 2AJUH 1JXGA 3NFSH 2VOMA 5GZNC 3SRFA 1HIMH 2Y3AA 5GGUA 4F1SA 1XTMA 5KZ6A 4ZQOA 1NAMH 1AR1C 2BOLA 1KXTB 5EU7E 4ECNA 2VCOA 5AOLA 3CNYA 2QCFA 4NQSA 1PKYA 3C0JA 5AOIA 1ZJBA 1W8EA 1RH9A 5CGBA 3LG3A 4UFIA 5EBMB 4S0SD 1K6AA 4B9ZA 2FO4A 2GI0A 2P5WD 4HDIB 3B7RL 4GVHA 3V8CA 3LZFH 1G7QA 1LBMA 2VR2A 1O7DC 5FO7B 3UZVB 1W3LA 2FGBA 4D9LH 3U9PL 3RDKA 1G6VK 4FB7A 1M01A 5DR5L 1E1FA 5D1XD 4HXAH 1XLIA 3LB6C 3JWDC 3W7CA 1BAWA 1UQZA 1R34A 1LE5B 1JDEA 4IBUA 1YMMA 1F58H 2LE9A 3LZQA 5A8GA 4A3QA 1FO0H 5AENA 1ACXA 1OGSA 1ID5I 5AVHA 3HPXA 3K2GA 2WGXA 4BQ2A 4GKNA 3BLBA 4FQIH 3OR7B 4YWIA 1WXYA 1OCJA 4FFZA 1RJRA 4TMPA 4ZODA 1VLIA 1MJ7L 4G7YH 1EBPA 3DI1A 4WR3A 1NQ6A 2WKJA 3OLDA 4I13B 4EXQA 1EC9A 2EUVA 1JZHA 4R7NB 1A9EB 1DVFC 4PUEA 4DH2A 1MJ8H 5HJYA 3TTEA 3SDAA 3QE5A 4OGXH 1TPFA 3R25A 3F7JA 5CCKH 5DJDB 3MHUA 1NGYB 2G75B 4JFDE 4G56A 1P6WA 5D8WA 5E6IB 3GS7A 3FFCD 1XIWD 4M02A 2EP6A 1H3TA 3D9AL 3STLB 2OYPA 1HEZA 3MRBB 3NOIA 3IFNH 1A7QL 1Q6OA 4HZMA 1XSIA 3B8TA 1S5IL 3UGEA 4FP8H 3DOPA 3B3DA 3V95A 2V17H 2BSTB 2NSOA 2AL1A 3BJFA 3EB3A 1AGBA 1B0GB 1T20A 2P8LA 4WI7A 4UNLA 2H26A 1V3HA 4KF1A 4MNLA 5DK2B 1EJFA 3H56A 4LLYA 4JM2D 2E25A 2J56A 1N64L 5KYXB 2Z29A 4N9EA 4MAUL 3N40F 5G4EA 4YK4B 4LF3A 2VQTA 2A3CA 3HRZC 1P0DA 4GW4B 4X9HA 3UTSE 4UFKA 1QVOB 2A3EA 3G18A 3V5OA 1AD4A 1WBZB 3TVAA 1DVTA 3QA3A 2WP3T 1UENA 4PUNA 4S3FA 4HKJA 4PP1D 5J1TC 1WKFA 1OFEA 2OFQA 3HBLA 3BYYA 1X7SA 2ZPKH 4NYLB 3C08L 5C9RA 5D2TA 8TIMA 4ONHA 3HRPA 4KRUA 3W7QA 1P7TA 1KFWA 4PS8A 3IM1A 1N8ZB 5FEXA 3C52A 5CSUA 3S34L 2CU0A 5BQ7A 3LPFA 5TDOA 2EPMX 2HQAA 4PB5A 1NMCC 1DBKL 4JN1H 4PN2A 3KRBA 1KMGA 5HTSA 1C91A 3VM7A 1B1YA 4IMCA 2PDWA 4LSUH 1QSFA 5DY3A 5JH1A 3QARA 5DRZA 1H11A 1ITUA 3BD3A 4I1PA 4Z7WF 2RAMA 2Z1WA 3SJVB 3D2TA 3QZBA 1L7TL 1UOWA 3TJXA 1C16A 1RMFL 2WWKT 3S3GA 4OKVB 2OL3B 3N4AA 3TO4B 5D6CA 5MENB 2X0WA 3QUXC 5ITFB 3MBDA 3G3DA 1R3VA 3P2DA 1UJPA 1QLEH 2EC9U 2WTPA 3LS4H 2VRQA 1PBYA 3VMPA 5D7KE 3SQRA 2IDSA 3OGRA 4IYKA 4PB0H 2J1WA 1MFUA 1OPGL 2AJSL 2XRAH 1XGYH 4URKA 1H61A 4X5RA 3QTGA 1T1ZA 1FPTL 2XWTB 4XHQA 2KYIA 1HHIB 1JPMA 1A6TB 5B39G 1K03A 4FX6M 4LP4A 1ZVHA 2GJXB 4RSVA 2AJVL 3TA3B