1GJUA

Maltosyltransferase from thermotoga maritima
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
636
structure length
636
Chain Sequence
MLLREINRYCKEKATGKRIYAVPKLWIPGFFKKFDEKSGRCFVDPYELGAEITDWILNQSREWDYSQPLSFLKGEKTPDWIKRSVVYGSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMMLLLPFVKSLGADAIYLLPVSRMSDLFKKGDAPSPYSVKNPMELDERYHDPLLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELADYTPPRAEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFGIITPPGFSDLINDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYGIDGARLDMGHALPKELLDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGVLNFIKKLIKVRHEFLDFVLNGKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords MALTODEXTRIN GLYCOSYLTRANSFERASE
total genus 191
structure length 636
sequence length 636
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09083 DUF1923 Domain of unknown function (DUF1923)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gjuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gjuA01
1HKKA 3TA9A 3OLEA 3VGGA 4AD5A 1A47A 4LYPA 1CDGA 4PBGA 2DIJA 3KWXA 1BGGA 4PRWA 1CGXA 3AIUA 5JBEA 1UR4A 3WF1A 2BXZA 5DF0A 4AZCA 1GQJA 3NCOA 1JZ8A 1JDAA 1XCWA 3SCOA 1NWSA 1QVBA 2FHBA 3M07A 1JNEA 4J3WA 4GO8A 4PCTA 1E1FA 1ITXA 3ZIZA 4PMNA 1Q6EA 1JXJA 3WF3A 4BA0A 1DWFM 1EDQA 3AJ7A 3CTTA 3AMLA 2VMFA 4FNRA 2UWFA 4QDMA 3CGTA 1C92A 3L2MA 2OSXA 3EJUA 4GQRA 2J47A 2PB1A 1IT0A 1V6YA 2DQXA 4NI3A 5A6LA 1CXKA 1PX4A 4IUGA 1LWHA 2BHYA 4WKAA 4PSRA 3S2CA 2JIEA 1W3LA 3AISA 1XGZA 2CBJA 4GPNA 4W86A 2YLLA 4HPHA 1K9TA 1ODUA 5EMYA 4QLJA 2WHMA 3ZMRA 1ZB5A 4KGJA 5M03A 1HJUA 1SZNA 2JALA 1V02A 3PZOA 3S5ZA 4R27A 5A6JA 5EB8A 4U2YA 1BLIA 1NWUA 4DWSD 2G3MA 4LGXA 4UTFA 1JI1A 1GNXA 4P8VA 4GZIA 1HL9A 3AQUA 1TG7A 5IFPA 3EJRA 1CTNA 4RE2A 2WZIA 1Q6FA 1ZL1A 5GQBA 3W81A 2OSWA 3SCWA 1WNOA 2WMKA 4M81A 1CYGA 3L4YA 1R46A 2ZUUA 2VCCA 1XH0A 3WDQA 4D6EA 3ZO9A 4OUEA 4U5KA 2BY0A 1KWKA 2ZOXA 1BYAA 1KXTA 3PZIA 4HMEA 3HG3A 1UR9A 4FLQA 4AMWA 3CUIA 4URIA 3MO4A 2ZX9A 1GPFA 1XD1A 4UQDA 1V0LA 3WENA 4MJ2A 3ZJ6A 4MDOA 4GI8A 2FGZA 4BQ4A 3IANA 7A3HA 5TD4A 2OYLA 4UFJA 3AHVA 3POHA 1BQCA 1HF6A 3LRMA 3WUFA 4TOQA 1XC6A 2ZX7A 1HJWA 1DWIM 5E70A 1M7XA 2GDUA 1JYNA 5D9MA 1YQ2A 3U57A 3FHQA 4NZCA 3WSUA 3T2PA 4W93A 2YFOA 6A3HA 1TMQA 3VGBA 2GFTA 3HJEA 4HPGA 1QBBA 1UYQA 4UZSA 4HU0A 1OT2A 3AIWA 1W9DM 1XHGA 3OLGA 5IHSA 4BF7A 3W38A 1OGSA 3BGAA 5AY7A 3VPLA 1Y7VA 1W3HA 3VGEA 1H11A 4HOWA 3ZR6A 1DWAM 4MTVA 1GQIA 1VEMA 2D24A 2PBOA 3K8KA 1QPKA 2F18A 5C8BB 3VNZA 1E55A 2VZUA 1XYZA 3N13A 2WANA 1OINA 1QOXA 4H41A 3QHOA 3ZM8A 1B1YA 2VCBA 3MMUA 1GVIA 1GJUA 2GJRA 4AIOA 3T2QA 4X0NA 2A3HA 4JKMA 3VSUA 4HP5A 1TFVA 3SCPA 1TQUA 3N17A 1VJZA 5IHRA 1HX0A 3UETA 1MQPA 1V3HA 2ZUNA 3SUSA 1AQ0A 3AZTA 4JHZA 4AMCA 1OD8A 4OOZA 3N11A 3ALFA 3ALGA 1CLVA 4JIEA 1UQYA 5A6AA 2BY2A 2QMKA 3RMEA 1PIGA 2PWHA 2C7FA 4PMZA 3CZGA 3ZT5A 3MUIA 3MMDA 5DO8A 3CO4A 3AROA 1WPCA 4E2OA 3W29A 3EJSA 7CGTA 1KGUA 2VT0A 1QI2A 2WLYA 1BHGA 4JFUA 5DT7A 3SCNA 4FNQA 4TUFA 3CC1A 2AOSA 2UY3A 3VD3A 2GK1B 3WDIA 1IZJA 4UQBA 4QCEA 1HP5A 5CG0A 3A21A 2EJ1A 5I3DA 3WUEA 2CBIA 3W53A 1WDQA 1AQMA 3CHEA 4WLCA 2A3AA 3CHDA 1SMAA 1UUQA 3QGVA 3GYCA 1QX1A 1HIZA 2CYGA 8CGTA 1GVYA 5CSUA 2UY5A 3A5VA 3GXIA 1BAGA 5CZKA 2JEQA 1E4IA 3ARZA 2A3EA 1UZ4A 1GOOA 4EAMA 2JE8A 5I79A 1M03A 2WKLA 3CUFA 3KEHA 3VMPA 5FKYA 1W2VA 4XZBA 5A8PA 2WNWA 3BH4A 3WL1A 1R85A 1D2KA 2XFRA 4XZWA 5I24A 2J62A 3ZSTA 1T0OA 3RJXA 4MJ4A 2J7EA 2FH8A 3MV11 1BVNP 1H2JA 3W25A 1W32A 4AC1X 2PWGA 3WBEA 1NWRA 1EO7A 3W28A 4ZXOA 1W9PA 1UKOA 4M29A 4DUWA 2EXOA 4NZFA 4NF7A 2GUYA 3CH9A 3VMNA 4BCEA 1XSJA 1KQZA 2GJXA 3M7SA 2YA1A 2XGIA 2WVVB 4PMDA 1TQWA 3VO0A 3EDJA 3FNDA 2TAAA 2ESCA 1LJYA 3RJYA 4AD2A 4C7GA 2BS9A 2XFFA 3VIKA 1WAWA 2F1AA 3K8MA 4HOZA 2OWCA 3KLLA 4UFHA 3WMCA 2XN0A 4BQ5A 4CCCA 1MQQA 4PMVA 1KR0A 1J18A 4CD8A 3W82A 2FHCA 3CZ8A 1OGGA 4W84A 2XVKA 1V3JA 3GDBA 4H04A 5A2CA 3GXNA 1NH6A 4A3HA 4JCMA 2IUZA 2XVLA 2DSKA 3F4VA 4N0RA 3ZT6A 1E5JA 2ZWYA 1QW8A 1C8XA 1K9EA 3AFBA 2ZUMA 1NOUA 4EKJA 1V3LA 2WBKA 3NYDA 3AOFA 1JDCA 5A8MA 3FAWA 3WQWA 5A95A 1Q4NX 4DWSB 5E0FA 4WSJA 3UG5A 1JZ4A 4L4PA 1EO5A 4ML4A 4FNPA 2WW5A 1QW9A 4PTVA 2FYVA 2MANA 2VR4A 1LL4A 4PEEA 1U30A 1V3MA 4IISA 4E8CA 2E9LA 3BAYA 2J7CA 4J7RA 3BMVA 1JDDA 3O6AA 3E1F1 1PBGA 2EEXA 5HDRA 1BYCA 3LXBA 2EACA 3D4ZA 3DX1A 1WDPA 1UQZA 4V2XA 3WBAA 1E6ZA 1UD5A 4CVUA 1B3XA 2Q8XA 1J11A 2GSJA 2CPUA 2WAGA 2Y8KA 5FCZA 3LPOA 2WHLA 4FF5A 1E6XM 2D20A 4JFSA 2DSVA 1B31A 2X8RA 2E9MA 2BVYA 3S5YA 3WUBA 1H1NA 1E4MM 1RH9A 1ESWA 4DM1A 2UY4A 4JZ5A 3EMQA 2D1ZA 1QI4A 4UOQA 1GW1A 1GOIA 5BCAA 5DMYA 2CBVA 4AWEA 4ZE5A 1BVZA 1JFXA 4UFKA 5HXMA 3MMWA 1V3IA 4P8WA 4FLOA 1VFOA 3WH9A 1QWUA 3U5UA 3CZEA 2J77A 2CITA 4KGLA 1R7AA 5BRPA 3NSMA 3WY1A 2D3LA 4W89A 1E5NA 2F7QA 4XX6A 4CD7A 1OGBA 3S6TA 3WIJA 4LQ1A 4AZHA 4YHGA 1CPUA 4M8UA 5CLWA 3CUGA 3WH5A 1PPIA 4LX4A 2ZUSA 1HN1A 3BAWA 1UA7A 3PZTA 4CD4A 4Z2KA 3WDHA 1E4LA 2X0YA 1B3VA 1BTCA 1UWQA 2F8QA 3LMYA 1CXIA 3MSDA 3WMBA 1XH1A 2YDSA 3AS0A 2V3DA 2BHUA 2XUCA 3WQ5A 2ZIDA 4ACZA 1JFHA 2XWEA 4PMYA 3LXCA 4ZEPA 4M56A 2G3JA 2VZTA 4J28A 3OZPA 1V0KA 3L4XA 2CERA 2DIEA 3AZSA 3AHTA 3JUGA 2V5CA 2F7RA 3WL0A 5D9NA 1TQSA 3WEZA 4CGTA 2XIBA 3VM5A 3KZSA 3ARPA 5I2UA 1VFFA 2CKSA 1KFWA 1Q6DA 4ZENA 1KCLA 1VF8A 3WD3A 5A6SA 1C3FA 3LRKA 3PZGA 3DYPA 3CZSA 4AZGA 2W5FA 2YLAA 5KZ6A 3W37A 1B9ZA 1V08A 2VZSA 2V3GA 2WLZA 5LYRA 1M01A 3AYRA 4KH2A 3CLWA 5EBAA 1E4NA 3M6DA 3T2OA 4GINA 4RE3A 1BPLB 3IK2A 4D72A 5JUVA 1J10A 1WP6A 4OIFA 2D23A 2EPMX 3A3HA 5A3HA 1WDRA 4AD4A 4H8VA 3TTSA 4Z2GA 1UWUA 5M17A 2YKKA 2WMIA 1E70M 3WH6A 2ZXQA 1LL7A 2AAAA 1Q6GA 3CHCA 4AIUA 2Y24A 5DT5A 3WFZA 2XJ7A 4TVUA 3VILA 1J0IA 3VUPA 2VRQA 4K68A 4UQ9A 1FA2A 1W9BM 2CEQA 2GVYA 2YL6A 1HKMA 1DWHM 3OGRA 1DEDA 4M82A 1E72M 5CPTA 1UH2A 4ATDA 3WF2A 5BXSA 1UH3A 3OIHA 2BY3A 9CGTA 1GOWA 1JI2A 2D0FA 3WD1A 1E71M 1QWNA 3AIBA 4CCEA 3ARWA 1DWJM 4ATLA 1SMDA 1W91A 2FH6A 2E3ZA 3L4UA 1LG2A 3GNRA 3HZ3A 4DUXA 1RP8A 1PEZA 1NOFA 1R8LA 1ZJBA 2WVUA 3A24A 2NT1A 3OGVA 4MNMA 5E6ZA 2WVTA 1LLOA 4W8BA 3WH7A 1E6QM 4X9YA 4OOUA 2VQUA 1UWSA 1AVAA 4HOXA 1ITCA 1WDSA 4UNIA 1NM9A 2WMFA 3THCA 3GM8A 3TTYA 1XRVA 1H41A 1QNPA 2WXDM 4W8LA 2J25A 3LX9A 1QNQA 1R87A 3W4RA 3KL0A 4JAWA 3OGSA 2GJPA 1E0WA 3K4AA 1HL8A 3OZOA 3LPGA 1W2PA 1CGYA 3W27A 3VD9A 4J3UA 1VFUA 2ALWA 1CGVA 5AC5A 2NW0A 1BFNA 4AYGA 3WNKA 1IV8A 4F9DA 5M3WA 3BUDA 1UD4A 3OBAA 4W7VA 1EOMA 2BXYA 3VDHA 3BCDA 3KE0A 3EJQA 2WC4A 3PBGA 2G8ZA 4KWUA 4NSBA 1ISVA 2PWFA 2WPGA 5A6BD 4B3KA 3N18A 2BHZA 4UFMA 3ZR5A 3VU2A 5FIPA 1US2A 3POCA 4MNKA 3L4TA 4D6FA 2XVNA 3B9AA 2J7BA 5CPQA 3AHYA 1UKQA 3EDFA 1V3KA 3VIPA 2FGLA 1EOKA 1CZ1A 1E1EA 5FL1A 1RP9A 5A69A 1R75A 1X6NA 1UOKA 4MDPA 4JCLA 4F9JA 5ECUA 1CXHA 2D0GA 4FNTA 1ISWA 2X05A 3VSTA 3SCVA 5E9AA 2DT1A 5CXPA 2XN2A 3AXIA 3D5HA 1QI3A 3AYSA 3F5LA 1JYWA 3T0DA 1VEPA 3ZJ8A 2WKGA 4C7DA 3N12A 3ECQA 1BG9A 3W6MA 1J0HA 2V3EA 1UKSA 5I0DA 3CZJA 3BXWA 3QOMA 1HKIA 5CLTA 3SUUA 4HTYA 2WC7A 2WMHA 2OWXA 2BVTA 1CXEA 5FL0A 5ABFB 2W67A 4AZ6A 4D1IA 2J78A 3N9KA 1RD6A 2XTKA 4GXPA 4E8DA 3PTQA 4PCSA 1W3KA 3O9NA 2JF7A 3L2LA 4D6JA 1HJSA 1MXGA 3WMSA 4U33A 1VB9A 4IPNB 1BSIA 1J12A 3BUBA 1KWGA 3WDJA 5D8ZA 1GCYA 1UD3A 1UR0A 3AS1A 1ISYA 2WM0A 4AD3A 3CIVA 2QLYA 4B16A 2XSBA 2XSAA 2XPKA 1MYRA 4AMXA 5M5DA 3TP4A 1G0CA 4W8AA 3VD5A 1SYTA 3SUWA 4CN6A 3W24A 2EADA 1OD0A 3SCQA 5E0CA 2J75A 1WZMA 2FHFA 5AYIA 1MQRA 3AMDA 3VX0A 4TVDA 3J7HA 5CGTA 4V28A 3AZRA 2OW6A 3VIJA 3WQVA 3ZOAA 3K4DA 1UKTA 3DDGA 4Y7EA 1O7DC 3GXMA 3HMCA 2PC8A 1FOBA 3GZAA 1HXKA 2EPLX 4WKHA 1AMYA 3VD7A 5LA2A 4CU7A 2J74A 1N82A 2O9OA 3VIFA 1JL8A 4PUDA 4AZ5A 2WB5A 2JF6A 4BQ3A 4DO5A 3BSGA 2D2OA 1J0YA 4UR9A 5A6BA 4MPKA 1VJSA 4F79A 3GXPA 1RPKA 3A22A 2Y8VA 4MADA 5A8OA 1TCMA 3WNOA 2J7FA 4U5IA 4TX8A 3NDZA 3DHPA 3OB8A 1DHKA 1JGIA 1EGZA 4ZE4A 1C8QA 4GO9A 1ZU8A 3WKZA 4D6CA 2XM1A 5JBFA 1VFMA 1B2YA 1KGXA 4U3CA 3H55A 1JZ6A 2G41A 4H8UA 2OYKA 1E6NA 1UD6A 1ECEA 2ZX5A 2EQDA 2WZHA 3QR3A 2J7HA 3LRLA 4NZJA 3DYOA 5EFDA 1VENA 1JYVA 4JFTA 4UZUA 4R5EA 5FOOA 2JIWA 1ZBWA 1FFQA 1UR2A 1LQ0A 1GORA 1V6VA 3QHNA 2W62A 3IJ7A 2D22A 1MXDA 1R7OA 4PYSA 2DEPA 3CBWA 2YDRA 3ARQA 3APGA 3PTKA 3WQ4A 3MSGA 1J0KA 4CU6A 1JZ5A 2BY1A 4QCFA 4GIAA 2GJXB 4KMQA 2VC9A 2E4TA 2WVVA 5DFAA 3I3DA 2DSWA 2PWDA 1W9UA 2ZX6A 1TQTA 4J3VA 1B3ZA 1XV8A 2Y4SA 2X2JA 4A4AA 3VNYA 3WEMA 4FK9A 2PI6A 4F8XA 5BYWA 4NX0A 3FHAA 2QMJA 3G6MA 1O7AA 3KLKA 3EBVA 3AIQA 2YDQA 2CXGA 4D6DA 3ARTA 3ZT7A 3B8SA 1FHLA 5A8QA 4NRRA 2F61A 2VRJA 4UCFA 3AMCA 3GXFA 1J0ZA 3VVGA 4J3XA 2Z1SA 1ZJAA 4MB3A 1TQVA 1EHNA 2QV4A 3CZNA 3WELA 3CHFA 4ACYA 3WF0A 5ABHA 1G9HA 4FMVA 3TV8A 3GTNA 4MAZA 4HMCA 2ZXAA 2NT0A 4TTGA 4JFVA 3GH7A 4ZFMA 4WJXA 1KTCA 1H5VA 4XUYA 1SFSA 4UFIA 2J4GA 3UCQA 4EK7A 1DWGM 3WNMA 1GOMA 2YL8A 3AXXA 3VDAA 4AYSA 4DWSC 1GUVA 1WE5A 3ARYA 1OM0A 2DSUA 1H49A 3WN6A 1EDTA 3WQ6A 4D71A 3DX3A 3EMCA 3IAQA 2CESA 1HTYA 3WH8A 2YBTA 3EDEA 1C93A 3VGFA 4UQAA 1UD2A 3VDCA 2V3FA 1MFUA 1FH9A 4H7VA 1EQPA 4W7UA 4GQQA 4HA1A 2Y5EA 5I77A 2JFEX 2VTFA 2OYMA 2RGMA 2Z1KA 3U5YA 3MKKA 2ZICA 4H2CA 2EPNA 1X1NA 4P7RA 2DGAA 1JYXA 3AI0A 1W1TA 4PUEA 4FNSA 1XD0A 2QPSA 4HA4A 2G3IA 5D4YA 3RILA 3PZUA 2XYLA 1US3A 1UHVA 2XWDA 2X2IA 3EDDA 3ZJ7A 2X1IA 2F2HA 2OLHA 4KRTA 4WF7A 1E6RA 2YA0A 4J3TA 1U33A 3AICA 3SCUA 1B0IA 3ZJKA 3SUTA 5FD0A 3DX2A 3AS2A 1MW3A 4X0VA 5E1QA 1ISXA 1W1PA 5AYBA 1EQCA 4JL2A 1OIFA 2JEPA 1HJVA 4M1RA 3MUAA 3EMZA 3WNLA 3DHUA 3IJ8A 4J3SA 4HZ7A 2X0HA 3DDFA 4E4PA 4H8HA 3B9EA 1E9LA 2A3BA 5I6SA 2YOCA 3MV01 1GOKA 4CUCA 2J8FA 2O9TA 1QNSA 3OA5A 2YJQA 2VURA 1EA9C 4BS0A 1UKPA 2C0HA 3ZSSA 3H53A 3IAPA 3WDPP 1Q6CA 4B9ZA 2DSZA 2VX7A 4FNUA 1TA3B 4MNLA 1KXVA 1FP8A 3ARUA 2DT3A 2O9RA 3SCTA 1JF5A 3RM4A 3UR7A 3UEQA 1UWRA 1KBKA 1QNRA 1PX8A 2X2HA 3DECA 1MW1A 2IGTA 3WD0A 2OW7A 4AIEA 3HG2A 4P7OA 3HG4A 1GQLA 2WWDA 2G3NA 4JL1A 1DP0A 1FP9A 1KB3A 1HWWA 1UH4A 3SCSA 1M04A 4QFUA 4RE4A 2OSYA 1TE1A 4AZIA 1XCXA 4AZCB 3HG5A 2W61A 4OJYA 3K1DA 5A94A 1CXFA 1JD9A 1J9YA 2YL5A 4V27A 2VZVA 5CSYA 3L4WA 3BUIA 3IJ9A 2ZXBA 1L0PA 4IM4A 3G6LA 4IPLA 2WHJA 2WMIB 1O6IA 3BMWA 4RL3A 3D50A 3BLPX 1LG1A 3ARVA 1V6UA 3RO8A 2VZOA 4AD0A 1H0GA 1CGWA 5C71A 2CIPA 3CUJA 4L4OA 1E56A 1ODZA 3IGUA 2D73A 1HJQA 1HKJA 1K6AA 2E8YA 2CCRA 3N04A 1CECA 2D3NA 3FW6A 4M80A 2DT0A 4LPCA 1CNVA 3CMJA 4W7WA 1XSKA 4B9YA 1G1YA 3II1A 1QHOA 5D8WA 1NQ6A 2XN1A 2O9PA 3RM9A 1E0VA 2C8NA 2WCSA 2XHYA 5HPCA 3U7VA 2NSXA 5BROA 4KRUA 4PN2A 1W9XA 4WKFA 5BXPA 2WYSA 2E9BA 1CLXA 4TXEA 4BZYA 1AQHA 1A3HA 1E15A 1GZJA 1G01A 4DO4A 3L4VA 4OBRA 3MUZ1 1UASA 3VOCA 4F66A 5A2AA 1NOWA 5EFFA 1GHRA 1B3WA 4PTMA 3PZNA 1E6PA 2XGBA 5D9OA 1QBAA 3CUHA 3UG4A 4NRSA 1IZKA 1CIUA 5BXTA 2VOTA 1WCGA 3ARXA 4P8XA 3M46A 3AMKA 3FXYA 1J0JA 2GK1A 2VVSA 1OCQA 4S3JA 3VGHA 1BF2A 1CWYA 4CCDA 5IXEA 3F5JA 1YHTA 3BVTA 1W3JA 2CNCA 3RPMA 1XYFA 4ACZB 4YPJA 1W9VA 3N15A 2F7PA 4MB1A 1OT1A 4DO6A 3AXHA 3LPPA 2YIHA 3A4AA 1C91A 4P7NA 4S3KA 4C7FA 2ZWZA 1WKYA 3FN9A 3GXTA 1BYDA 1PAMA 1VRXA 3FY1A 2FE0A 2F7OA 4AZBA 4GKLA 1J01A 1GHSA 1E73M 4W85A 3MANA 2EO7A 5I5RA 1SR0A 2VNCA 5BRQA 5F7UA 1V6XA 1ZS2A 4AXNA 2ZUTA 3T0AA 2BVDA 2X09A 3HN3A 1OWQA 3ARSA 3A47A 3K46A 3BVUA 4W88A 1UZ1A 1UWTA 3UERA 2WCAA 4P7QA 3SIMA 3T0BA 1FH8A 1MWOA 4HZ8A 4QLLA 5E09A 4TVCA 1EHAA 4JHOA 5AC4A 5HNNA 2VX5A 1JG9A 4U2ZA 3GH5A 3D3AA 2VR5A 3SEPA 3NUKA 2QHAA 1KCKA 3PZQA 3OLIA 4UFLA 3ZQ9A 1C7TA 3BVXA 2EPKX 4JKKA 3VDBA 1P6WA 4U31A 1QHPA 4TTUA 3OG2A 2YL9A 1CGUA 1PX3A 1WO2A 1GONA 1FH7A 3CZKA 1V6WA 4P8UA 1LWJA 2QF8A 1WZLA 2CHOA 3BSHA 2E8ZA 4AY1A 3DYMA 3H54A 3BUPA 3CV5A 4AEEA 1E0XA 2VX4A 1I1WA 2WBGA 1E3XA 4BQ2A 3D52A 1XSIA 5HOSA 2VO5A 1B3YA 2YFNA 4B15A 1BG4A 3WD4A 4HZ6A 1V03A 1G5AA 3QOKA 3UR8A 3EJTA 3EJPA 5A2BA 1NARA 4N42A 5ABFA 2EABA 3NDYA 4GI9A 1ZBKA 1CGTA 3CPUA 4FLRA 2WSKA 3BC9A 1VAHA 1C7SA 2VX6A 4B3LA 1JD7A 2AMGA 2DH3A 4HA3A 1W1YA 2XVGA 1TZ7A 4TX6A 1KXHA 2HVMA 5BWFA 5C70A 5BXRA 1QHZA 2RGLA 3A4XA 3NJ3A 1JZ3A 1LF1A 1EXPA 4UOJA 3RM8A 2VRKA 2B31A 2PWEA 2DT2A 2E40A 4P7LA 2WMJA 5D9PA 1UR1A 2ZX8A 1VBUA 3WDRA 3MU7A 3I3EA 5IFTA 1QI5A 3EDKA 1R33A 1VEOA 1QNOA 2WVSA 1WB0A 3W6LA 2BV9A 2ZUWA 3VIIA 4CN4A 2PBGA 5CJ5A 1E3ZA 4W87A 4MNJA 4UQCA 1MFVA 1C8YA 3AIEA 1EDGA 3T08A 3DX4A 4JKLA 4LYRA 5DEZA 2XG9A 3GBDA 4CD6A 3BLBA 2G4FA 4W5UA 1OIMA 4Z2JA 1PZ3A 2D0HA 2VUYA 4UQEA 3LPFA 1HXJA 5A6MA 2Y2WA 1HJXA 2W4XA 3B9DA 4LXFA 2DDXA 4PMRA 5GNZA 7TAAA 1OB0A 3QHMA 1TVNA 4AZ7A 3PTMA 1JXKA 4W5ZA 5LA1A 3KL3A 2F1BA 4MB4A 3HU7A 3U7BA 3L4ZA 3THDA 1HNYA 5ABGA 3BUQA 1U2YA 4A3YA 2FDMA 5A6KA 3W0KA 1L8NA 1K9FA 4GZEA 1PZ2A 2EPOA 5CQ1A 3UESA 1CBGA 2XFYA 4M24A 3VIOA 1V0MA 4PMQA 3BAKA 4Q7NA 1H0IA 2CKRA 5I23A 1D7FA 3VSVA 1E43A 3WD2A 2WCGA 1JAEA 1PS3A 1ZBVA 3PZMA 3WNPA 5HPOA 2O92A 3NSNA 1MVYA 4HU8A 1H09A 3WQ8A 2BNJA 2WHKA 2QPUA 8A3HA 1BYBA 4J27A 4Q22A 3GH4A 2WK2A 1JIBA 2WZEA 2XIIA 4Z2LA 3D51A 4XB3A 1K9DA 3TONA 2YA2A 5GPRA 4D6HA 3GNOA 3AHXA 4CVWA 1MW0A 3A6OA 3AIRA 4MAVA 4JFWA 3F5KA 2VVNA 3TTOA 3SURA 3VD4A 3BVVA 1G94A 2XM2A 2X2YA 1DTUA 3VIHA 4GI6A 1TUXA 2J7DA 1E40A 3VINA 3BLKA 1CXLA 5A1AA 5KEZA 1F4AA 2EBNA 2CETA 2V5DA 2VJXA 1KXQA 4CD5A 2BFGA 4AD1A 1GQKA 4HMDA 4D6IA 5GNYA 1B90A 2WSPA 4DWSA 4LYQA 2XVPA 3AHZA 5JIWA 1F4HA 4OKDA 3PZ9A 4PMXA 3ARRA 2A3CA 3RCNA 4EANA 1UD8A 2J7GA 3A23A 2EAEA 4CU8A 4D1JA 1KTBA 4PMOA 2IXVA 4FLSA 4QLKA 1UR8A 1OSEA 2W66A 4D6GA 2CBUA 3TOPA 1V02E 3AS3A 5JBDA 1B30A 1UWIA 1KQYA 1R86A 1NP2A 1MW2A 1EH9A 2VL4A 1D3CA 3A4WA 1JZ2A 4XV0A 1JAKA 3DX0A 4DM2A 3K8LA 5JIPA 3T09A 3BAIA 1GOQA 1NWTA 3MUY1 3WF4A 3O2LA 2ZE0A 3RDKA 4NXKA 2W92A 3AIVA 1PJ9A 2E0PA 2J8GA 6CGTA 3SCRA 3AMGA 2CHNA 2V38A 5LA0A 1KGWA 4YHEA 3VMOA 4NXSA 4AW7A 1FFRA 3PZVA 1NP0A 3MI6A 3VKKA 5I78A 5CPSA 5IDIA 4ZXLA 5HBFA 2WC3A 2YBUA 3N1AA 4PSPA 1HT6A 1UG6A 1QI0A 4DUVA 3GNPA 1ISZA 3DC0A 1H3GA 3WY3A 1Z32X 4ATWA 3I3BA 3WUGA 3VGDA 3RIKA 5CGMA 3NSXA 1CENA 1BGAA 4UOZA 4QAWA 1HVQA 1PIFA 1VBRA 2W91A 3MS8A 1JF6A 4MB5A 4OBSA 1I1XA 1KR1A 2PF0A 4CKQA 1H4PA 3LXAA 3BAXA 3VTRA 4GZJA 1TR1A 1WZKA 2WWCA 2ZXDA 4PTWA 3D4YA 1UA3A 4WIWA 1HP4A 4OGZA 1R34A 6TAAA 3CMGA 3BCFA 4WK9A 3PHAA 1JNDA 3VIGA 2UY2A 3WY4A 5ABEA 1X6LA 3SUVA 2W63A 1KBBA 1W1VA 4AISA 4PTXA 3FAXA 1EIBA 3GBEA 3WEOA 2GDVA 1I75A 2J79A 2VI0A 3VM7A 2DH2A 1ZBCA 1CEOA 1XH2A 4PMUA 3GXDA 4U3AA 2VCAA 1JZ7A 1HVXA 3WFLA 3EYPA 4Z2HA 1R47A 3VX1A 2VQTA 5A8NA 1TVPA 2WMGA 4WSKA 3TTQA 1S46A 3VIMA 4CN1A 5GNXA 3KL5A 1TA3A 3WY2A 1V0NA 4EE9A 3CZLA 1C90A 5E6YA 1E6SM 1GJWA 1LL6A 3WNNA 2DPEA 3BAJA 3NIYA 2HISA 1M53A 2IXUA 1WZAA 3UG3A 3PN8A 1FHDA 2OWWA 4OZOA 2ZUVA 4AEFA 4YN5A 4Z2IA 3BVWA 3OLDA 1OBAA 1VIWA 3W26A 4QP0A
chains in the Genus database with same CATH superfamily
3SE4A 4BV1A 4KK9C 4LLQB 3OLEA 1RVFH 3AU1A 4ERSL 1YYMH 3U9UA 4L4VD 5E8EA 4WO4A 4PBGA 5IEKA 3TC6A 3UGRA 3TNOA 2DIJA 4KXCA 4BZ1H 2W3ZA 4GSQA 5D38A 4PRWA 2XV6B 3QEUA 4AX7A 4RWYL 1D2OA 1M2VB 2I60L 3UZVA 5BO0D 5TQLA 1WAAA 3OVUB 2WPBA 2IPKA 4WW1B 2O55A 3WF1A 1UT9A 2IAAC 4HUMB 4QRTA 1KLYA 3GMLA 4RXFA 5DF0A 4DBSA 4HSNA 1DBKH 3NCOA 2CCLA 2I26N 3W70A 3G08A 4NPYB 2HAZA 5IHZA 4X6CB 3KS5A 1JZ8A 5MHBA 4MA8H 1YNKL 2Z91A 3JV6A 1RZMA 4C91A 5HVGB 4NJ9H 3NZQA 2E7BA 2NXZC 2ZSVA 3Q8EA 4XI5D 5GS0C 3H2NA 3H2EA 1IJNA 4QAIA 2E6PA 2Z0IA 4XSMA 4GY0A 4L3CA 3D2UA 1BWVA 2EYRB 1HKLH 3N2BA 2JB5H 3W2KA 3ZIZA 1HE7A 3EYQC 4EF8A 1IVLA 2AJYH 3DUSB 1Q6EA 2CGYA 4BA0A 1AJZA 4JQIL 2PCYA 4J1UA 3NJMA 1LLWA 4H7ZA 3K2UL 4AQLA 3AJ7A 2YUXA 3P73B 3EEZA 4UTWC 5JW5B 3OJVC 3IYLW 4WFFD 4PJAA 3U6XS 5F9WB 4KDTC 3F2DA 1PZSA 2J55A 2HFFA 2OSXA 3DXAA 1MVUA 4WENB 3OPUA 1X6UA 4RRPM 1VA9A 1LL1A 4Y9BA 5CBEB 1JRBA 2J47A 2OELA 3PWVA 3PUCA 5EBUA 3M0KA 3UBXG 5EMMA 1G7QB 1A7QH 4K8EA 2F08A 1BQUA 2OI9C 4RMVA 1AGDA 3RTQC 1PKQB 3EFOA 3QZBA 4NI3A 3JYCA 2DW5A 5A6LA 1OFQA 2HWZH 3FQRA 3W2DH 2IOIA 3P3YA 2IMRA 3CK5A 4ABVA 2HP4A 4OI7A 3UNTA 1PV8A 2BHYA 4REQA 1EAQA 4PSRA 3GTVA 3S2CA 3AISA 1IC4H 2B59A 1DE4A 1QBMH 1UQSA 4YSSA 4HJGA 5F1KC 4HCIA 5F3HB 4G1KA 3HMXH 4HPYH 2NZ9C 4AWJC 2WBXA 3DHMA 3KGUA 4F33A 4FOMA 2G3FA 3H7VA 4M8VA 5C2CA 2DMBA 4Q58C 4N4YB 5EMYA 1QSFB 5AAMC 1DSFL 1F8IA 2E7DA 1JFQL 4B5NA 5GS1A 2N7SA 1XIWB 3A4JA 4LUYA 1DYZA 1YDVA 2UX7A 3ZMRA 4KGJA 1HJUA 1QRNB 2ZOTA 1L7IH 4MAYD 3HUJB 5AVTB 2PGFA 3EG9B 5IB5B 3OKOB 3BP6A 5A6JA 1NUGA 4WK0B 4LP8A 1PF3A 5EB8A 1P0DA 1T6MA 1NWUA 4XCNA 5L0QB 4LGXA 4LF2A 3BESR 4X4MA 2B8OT 2X28A 1YEIH 3G1DA 1AZZC 1JPHA 3K6SB 3SYCA 3G1AA 1J8HE 1FZOB 1NCHA 4NOBA 2VITB 1UACL 3C5JA 3SDDA 5IFPA 2DLHA 43CAB 3N19B 3LYEA 2O6PA 4IJ3C 4J5VA 2PRHA 1EUTA 3TK7A 1Q6FA 1ZL1A 4MZ1A 2Q6ZA 1DJSA 3SCWA 1WNOA 1T1WB 3PYCA 1OAXH 3E80A 4KTGA 7PAZA 4LBRA 4KQ0A 2HE5A 1Q6OA 3B2VH 4LU5L 1AGBA 1CYGA 3H9SB 4OLUL 5C0EA 1R46A 4ZMGA 5FESA 3GD6A 3U1QA 1XH0A 3GPEA 4K15A 3ZO9A 1EZVX 1YZZA 2VISA 4A29A 3B2UD 2DQEH 4Q33A 2BY0A 4TYUA 2F54D 2QQLH 4HJSA 3U4BH 3HRZA 3PWJB 3V95A 5ANHA 5JIMA 5MERA 1BYAA 1KLZA 3HPXA 5CO1A 3PZIA 5DMLA 3AY4A 1JPFA 1VFBB 3Q5YA 4ZTYA 1TTBA 3TLLA 4PR4A 4X9BA 3QZPA 4OIAA 2GGJA 3EWUA 3UCCA 5CHNA 3MO4A 1QPXA 1E0UA 1INEH 3LHUA 3QDGD 2NZ9D 1EO8H 1XD1A 2ENJA 2Z7WA 1P7TA 3ZFHA 3WTUA 1I8IA 3SGDH 3VYLA 5IT2L 5AB3A 4S1FA 1JVNA 2CLLA 4QHKJ 2MH4A 3N44F 4OCLC 4NRXB 4CVXA 3W71A 2WM1A 3RX5A 4LL4A 2HT4D 4HPJA 4KPHH 5TH2B 1HTIA 7A3HA 3DX7B 4DERA 3MXWH 4MWAD 4WY0B 3QQ3B 1RIVL 1P0KA 4KF1A 4UFJA 4ZAKA 1WA0X 4PMJA 1AFSA 4HNLA 4MA7H 3POHA 4LIQE 3CCHA 5AHIA 2ZTKA 2XKNA 1BQCA 1V8EA 1V7NL 5BRZE 3EXLA 1RVFL 3DO4A 4PJEE 2BIIA 4D9LH 2EDHA 1BFTA 2JF1A 4QRQA 4G82A 3OVRA 4IIEA 3WLLA 2XWJB 4BZ1L 4LGPB 2B4CL 1GVEA 2FZ3B 4P5KB 3BSZH 1ZENA 5HHOB 1DFXA 3H42L 4ALDA 3D39A 4NEHB 5D2NA 2R69A 3FOMA 4RFEB 5DQJA 3W9DB 1HJWA 3R4RA 3DFPA 2FEJA 4FG2A 5EU5A 3S36L 2VWTA 1F5ZA 5FSDC 1AD9A 1S7RB 4LLWA 4OGAD 5EBWA 4WGKA 1FVEB 2R1WB 4PCPA 3GSQA 1QNZL 4NZCA 1Z9MA 3W56A 4Q8WA 4ZXBC 4JTCA 4PRID 3QPKA 2NOYA 3F5WA 4W93A 1TMQA 2CPCA 1UCBL 1W5NA 2PTUA 3IF1A 5FYKD 5HD8C 3MKVA 3W00A 3HJEA 3A64A 3G3LA 1E5CA 4H9XA 3U7YH 4Q6IA 2EC9U 2UWEE 1IEAA 3BKMH 3MQIA 4AXWB 4B97A 3B1UA 4PTTA 1OYBA 2EDFA 2OJ1A 4KOCA 5I2IB 7FABL 2Y1HA 1BXBA 3KBJA 3WIHL 3W7JA 3AUVA 4IFRA 4XXCA 3KWTA 3KCOA 5GGUB 3IJLA 3P9WB 4ZUWB 4GG8A 2E68A 1SFDA 1AW5A 3X14B 4K94L 3UPAA 3HA1A 1F13A 5T1LA 3DOPA 5IHSA 4Y4FD 1KENH 3PNRB 4NQVA 4ZQMA 4E2BA 5GSRA 5I15L 2GY5A 1S9XA 4GMTL 1BF8A 3VGEA 2A5HA 3TQ0A 1UJ3A 4C58B 3CFNA 5AVXB 5H2ZA 1CFVL 4OUOA 4R3SB 4WNQB 3R8HA 2IADB 4ZS6D 1KYDA 3BWAA 3QIBC 4KBXA 3WD1A 3AREA 1TRIA 2J8UE 3LZFH 4E68A 2V0AA 2BVOB 1Z9PA 2X0WA 4OF7A 4NRYB 5INCA 2OU4A 3QHZL 2OM5A 3FH7A 3LEVH 3EYQD 5DD5L 2A1WL 5RUBA 4MHHI 3VQ1C 3MMEB 3ELAT 5D4QA 4BWUA 4JFEB 2FSEB 3K5RA 4HDIA 3V0TA 5C8BB 4ZAKD 4XCFH 4L6OA 4E9WA 3U4EB 2VDGA 3N13A 4XMPH 3KDNA 4EMZA 3SY1A 3KXFB 4PJFF 1OW0C 1ZHLA 1FWDC 3WIIL 3FFCA 4QY8B 3ZM8A 3O8XB 4JRLA 4MQXD 2JMRA 5HGDB 5L8KB 3H2FA 1GVIA 4BI7A 3IVKB 3MA7A 5E7BA 2ATSA 4ZDHA 4OVVA 2BSTA 4X0NA 5INDB 4JKMA 4HP5A 4CQAA 1BFOB 4UB0L 3IXTA 4ZSTA 4C6OA 1YECL 1YMMB 5FUZL 1N2RA 3LRSA 3UETA 1JZFA 1MQPA 1V3HA 2ZUNA 4O4YL 1QSEA 4PB0L 5AVWB 1LT8A 4PRNB 1AQ0A 5DVNA 4N9CA 1JRCA 1JERA 5F9DC 4EWND 2WXIA 4JHZA 5IW6A 5DY3A 4AMCA 3QWNA 4YSEA 4PVBA 3MRQB 1XIDA 5F96L 1FGVL 2Z6FA 4HEME 4XBMA 1TJIL 1H3PL 3N11A 1SHMA 1A1MA 3ALFA 1OM3H 5ID0A 3CMFA 3TIDB 3LHVA 3ZHDA 3UTSD 3ZL1A 1FHVA 2O5XH 2H6OA 3RMJA 5C1MB 5A6AA 3OZ9L 2BX7A 1A8JH 1AO7B 3QDMD 1GEHA 4TO8A 3RMEA 5GZOA 1KELH 2ZDSA 3UO1H 3C0LA 1MZHA 4WEMB 3QEQB 8PAZA 3MMDA 4I2XB 4QG8A 3ULVH 3AROA 2QKFA 1NFPA 2W9EL 2YCLB 5DD1L 2VT0A 3D4GA 4P2QB 1FN4B 4AENA 2WLYA 2Z8SA 2CHXA 3KM8A 3BDXA 1SQ7A 5D93C 4LUSA 2QNEA 3SCNA 3AAZB 3D0VA 3L5LA 4BBWA 1A2YA 1VADB 2WLKA 3WI9A 3PK7A 4EP8C 4LSPL 3QKZA 1V93A 4TUFA 2G96A 4UAOB 3SY6A 2WJ7A 2M1KA 3PF3A 1A7RH 2W0FB 5F0LB 3TF4A 3V6OE 1BZ9B 5TE4L 2UY3A 4HNNA 3VWJC 2QGDA 9RUBA 3H3PL 4XBEL 4KRPB 4I0PA 1NC2B 4TUOB 2W60A 3WDIA 2APTA 2AKMA 4AMAA 1FFOA 5CG0A 4GJJA 2OJEB 3NRFA 4X8CA 4IDLA 5DYOB 1CIDA 3D3VD 5HHPA 4Z7OE 5FA5A 4LDLB 4FL4C 1Z66A 3CN4A 4HSQA 5EPMB 5I6XB 3CHEA 2OZNA 1RKRA 4YC2C 3UP8A 3VWKB 3KBHE 2MEJB 4NHUB 1S9YA 1UUQA 1VLXA 3QGVA 4FG4A 4FXRA 1IJ9A 3QC5X 1TU2A 3IDYB 2NSMA 1ELSA 3M64A 3VJ6B 3WAKA 3MRLA 5FACA 3VUSA 4XPGL 3A5VA 3ZBMA 2UY5A 4HIIB 3VD1A 3SPVB 3U1PA 1E8XA 1J5IA 1IT8A 3FO2A 1XBVA 3B83A 5DC0A 5KSAA 2PYFA 1KBIA 2HJFB 4IBUA 1WWBX 4RH4A 5GS2D 3IRZA 4ZD3L 2IWFA 3NJFA 4M6OH 1GOOA 1KC5L 1UZ4A 1GY1A 2AP2A 3GDMA 1A02N 4FEMA 3ABSA 4EAMA 1W8OA 4F80A 4PUJA 1FCBA 1YX1A 3KUMA 2WZMA 2DZSA 2JE8A 2CNYA 2ZF8A 5EZOL 5FLUA 2GTWA 1FNLA 2HX8A 2WKLA 1A14L 4HV8A 2AK1H 4FKEA 4I18A 2WZPD 3OB0K 3CUFA 3QZEA 4C6IA 5FKYA 2BFVL 4KJYA 4DCQB 3RGBA 2D2GA 1QOKA 4ADUA 3BH4A 3GMNA 2WNKA 5CILL 2X9ZA 4FYSA 1I2OA 3WL1A 5EFIB 3T2NH 4JD4A 5B3JE 4P49A 4C6FA 1DIEA 4U05A 1CBJA 4YVXA 4G9FD 2PAJA 5IHUH 5I24A 3LNHA 4HJ0D 1AR1B 3DFHA 4XR8C 2RHGA 1LO0H 4UT6A 2ZXCA 4Q6JA 3EGDB 1FZMB 1V7ML 4AZ8A 4MSSA 3W73A 2EXTA 1HQTA 1G7LA 1W32A 4WD0A 2HMCA 3JTBA 4MFEA 1U92B 3QARA 2GHWB 2FEEI 5H6HA 4A68A 4DW2L 1N7KA 4XD3A 3BEWA 3JWOH 1NCWL 3PWNB 4K7PL 4ZXOA 3H22A 1O4UA 4XG1A 2VDPB 3SE9L 1K3UA 3CXOA 3EX2A 3KPTA 5DD5H 3VXME 3X3GH 1NF7A 2OJPA 2GGGA 4R7OA 4MIMA 4ONHA 4Z95H 3MRCB 2J72A 4H20L 1JUEA 3B4UA 4QKXB 3MREA 4DUWA 1QFHA 3B5GA 4ZMQA 1GVQA 1ZCCA 4H6QA 2EDXA 3BZEB 2WYZA 2BP3A 4KKCC 1J5DA 1XXFC 3CJJA 1BAFH 4NZFA 4QNPF 3DROB 4PJXE 2HWGA 4NF7A 4AIBA 1M7IB 3GU2A 4DSYA 1A5KC 5D72L 3GK0A 3T55A 4XBPA 4AE0A 3ALXA 3V0FA 1ZTMA 4D8LA 5JPMC 3OKEB 3E2HC 3QFDB 3VRIB 1TQWA 3GSNL 3VXQB 1TO4A 3W1ZA 1BFVL 3OODA 2ITCB 4KROB 5JXED 3FNDA 3Q2DA 4JN8A 5CAHA 4I3RL 3MV7B 1XW8A 3E0LA 3RJYA 1OQOA 3HC0A 1LUCA 3AO0A 3BT2H 4KVCH 1F90H 2GTZA 2I9LB 2VC2H 1BQLL 3QUYA 5LAXB 4DN3L 5KUKA 3QIWD 3E0FA 3O6CA 3FFDA 1HQRA 1WEJH 5HHQA 5FKPB 2Q87A 1GTNA 1WAWA 3LV6A 3P30L 1DVFB 2F1AA 1KLFA 3BE1L 1TTIA 5E8OA 3SGKC 3IJHB 4A7GF 4ZQKA 5H8MA 2NNAA 4GUFA 1I7TA 1YNTB 2BNRD 3HNSH 2OV0A 5FYKU 1BECA 1X4YA 3ZIYA 4UOW0 4ZZ9A 1U41A 2GAZA 3I6SA 5K9KA 1YEYA 5JDSA 3V35A 1AXIB 4AHOA 3QEQE 1ADOA 2P1YA 3MA8A 1J18A 1B2WH 5LXXA 2FHCA 3CZ8A 3K72A 1TMLA 4P2VA 1ONRA 3T6QC 3U79A 3GDBA 3B6SA 1U8JA 4H04A 5A2CA 1HEZB 2YGYA 4NJHA 3IU3B 4LDOB 2O7SA 1AE6H 2R1MA 4JCMA 4OZGE 1UUOA 3N1MC 5IHBA 5C07A 3C56A 4UTJA 1KTRL 5ABDE 1YEHL 1C8XA 4DPPA 1TZAA 4YBLC 4HS6B 4LCCA 4IGMA 4DZAA 5KJ7E 4EKJA 3LS9A 3HVDA 3M0XA 3LSOA 5EU3A 1V3LA 2K8MA 2WBKA 2YMOA 1DLHA 3O2WL 3NCYS 4JKNA 1ZY9A 4OJAA 3TZVB 4B0MB 1Z5HA 2RAMA 1Z48A 3V4VA 3HFML 3QDMA 1EAPB 1T1ZA 2BW5A 1HHIB 4KZ0A 4WU5A 2ZOLA 3VH8A 2JI2A 3C2OA 3CS2A 4WUKH 4HKJB 3VRJB 1BVOA 1THFD 1Q8MA 4WSJA 2JK5A 3JRKA 1IEIA 5DZNA 3UG5A 5IQNA 4JFHD 2ZCKH 2NX3A 1P6CA 2P8MA 4ERSH 4ML4A 2DWEB 4MLIA 4UTWA 3TBSB 2WW5A 1JOIA 1QW9A 3ZDXF 4PTVA 3Q1SH 4KDTA 3UJSA 4L7ZA 3NCEB 3RAOA 2YXMA 2MANA 1I3GH 3GBLA 3AAMA 2I60H 1AGFB 4PEEA 3LZOA 4M7ZB 2F53B 3NG5A 1U30A 4U1IB 5E2WH 2YPIA 3B0PA 3C3NA 3FH5A 3WJZA 5H1WA 1ICPA 4DYKA 2DDQL 3SDXE 3LQLA 5TF1H 4IISA 4FG6C 2E9LA 4AM0B 4FFZA 3RTQA 4HK0B 1LE5B 3BMVA 2ATKB 5TK2A 1R9FA 3FUKA 1HIMH 4X5XB 1NCAH 4OLXH 5CP7A 2D2JA 1CICA 4V1DE 3SZ8A 1BYCA 5H8UA 3D4ZA 5DN1A 4KJWC 4HS8H 1JVKA 2R2BA 4JN6A 2AJYL 3UTTE 4CVUA 2DB8A 1LBLA 2Y5QA 2Q8XA 3MJMA 1KIPB 1IXPA 4DJFC 4OJFL 1DCEA 2CPUA 1ED3B 2GKIA 4YDLB 1YYLH 1VHPA 3R13A 4LWWA 1FY6A 4LARH 3OKDB 1C29A 3NIDF 2CLMA 4OJEH 2XSXA 4YHLL 4FF5A 5KZEA 3W1AA 4CNIA 3UP1A 1SJBA 2B7OA 1G6VK 2NX9A 2OQYA 4X8JA 1IEXA 3MRHA 3N2CA 4A22A 4FTVD 1N64H 4IIDA 3VNDA 4AX6A 1RK5A 3R0DA 2HRPL 5AZEH 1VKFA 5DCEA 4W9DC 3S5YA 2DLTA 4FXGB 1G9NC 3BQUB 1SXCA 1D8CA 4TMBA 3QQ9D 5BO1L 2DL2A 1UOLA 2GGEA 3ZTDC 4LBUA 1JCTA 1WCBB 2HWZL 1R3HA 2C1OA 1AL7A 3C6LD 1VYSX 3DUGA 2OFQA 3QQDB 4NFDA 3RL2A 2VLRB 4FCHA 3EMQA 2AW2A 1QI4A 1JNJA 4WFEE 2JFCA 3U46A 3L1GA 2EYTB 1JXDA 3S36X 3FJNA 1SW7A 4G1NA 2NUWA 1S7VB 4FX7A 2K3TA 4AEHH 1M7JA 1V3IA 4P8WA 4GIRA 5D5MB 2VFEA 1HI6A 2N1TE 4ATTA 2H2PC 5B8CC 1FCVA 1NCTA 3WH9A 2P50A 4Y1AD 1QSZA 1O7VA 5HVHC 5C7XH 4XE5B 1X7QA 1XFBA 3CZEA 4YSTA 2CRZA 5GRXG 3BE7A 3BJFA 1L7IL 3LV3B 5A3IC 4S0SD 3RUBL 1JGEB 4EN3C 3QZ6A 2FL5B 1E5NA 2F7QA 4UUJB 4UM9D 4XX6A 2WLNA 4CD7A 1OGBA 2F7FA 4LQ1A 3L5IA 3KOXA 1IGMH 3HE6A 3FYYA 1LNUB 3KYMA 4NNXB 4PJHB 3MOAL 2WQDA 3Q9QA 1S5MA 3CUGA 3QRGL 1HN1A 4BWWA 5BPPA 2CKBH 2EIDA 4GVIA 3QDGB 1PQZA 2AJSL 3OO2A 4DJMA 3LKRA 3MWAA 1OK6A 2VGLM 2X4TB 3A67L 4G7FA 4Z2KA 1L6GA 4Z7WF 4CD4A 1E4LA 3TXVA 3LEYH 1T2JA 3MLVL 2LLNA 2FX7H 2KERA 3OWRA 2XV3A 5IMMB 4KI5F 1GZQB 1MRCH 3T44A 3MSYA 1MRFH 1EGMA 4ILSA 2QUTA 3VAEA 1IFHL 1XH1A 3BYTA 4GBXA 2V3DA 5HJGA 4J1OA 4WSHA 4NY2A 3KDMB 4GRWB 1AO7E 4QOKD 1EHLL 2Y5SA 4ACZA 2XWEA 3DFSA 4PMYA 1Q1JL 3LXCA 1KGIA 4FHBD 3U7WL 1GK8A 3B8VA 2WNGA 4ZEPA 4AI7A 1DZBA 2KQMA 2VZTA 4MA3B 3MB9A 1B2WL 3Q43A 5EZPA 3L4XA 3WEAA 2XLLA 4RGNE 3DBXA 3AZSA 2BNUA 2VLKE 5HPMA 1TJMA 1GKQA 3JUGA 4WK2B 1MI5B 3WNIA 2ESVB 1TQSA 3IEAA 5E6SB 3M1BB 5HY9A 4UIOA 3WEZA 5I3JA 1FYTE 5I17A 3W3OA 2XIBA 3MLYL 4S1RH 1Q45A 1BD2B 3ARPA 5IT2H 5I2UA 5FI8A 1UXMA 3MLWL 4NCC2 4RX4D 2NRDA 4ADJA 4L1BA 1QK2A 1A4MA 2EIZA 1H6UA 3BIKB 1JHKH 1QSED 4H44C 3LN4B 1QBLL 3EFDH 5F1OB 4CADA 4DKEH 4ZXBA 1VF8A 3GY1A 1PNDA 4XVJH 1AGCA 3WQCA 3T5WA 4HEPA 3VFOA 4EOUA 5A6SA 4MD4B 5DJ2B 2VR7A 5H37A 1YEKH 3E6FA 1SO5A 1AZVA 1N4XL 1OGTA 15C8H 1YPZA 4PB4A 2QVNA 3ATEA 2UVEA 1WFUA 3W7KA 4NIYE 3WHE1 2W88A 1YUHB 4MCZB 1O6SB 1PY9A 3H4HA 4XXCC 1G4MA 3EOSA 4H13C 4LLDB 3W37A 1WUNT 2BSCA 4FJZA 4PJ5A 5E2UL 4B41A 1B9ZA 3VZZA 1P4LB 3EZ8A 2APWA 3B7RL 2V3GA 5KZCD 3D69A 4F20A 1O1ZA 3AYRA 4YSUA 2V67A 1KCSL 4UM8A 4KK8D 1U1JA 1NU5A 2QVFB 4JN1L 4AT6B 3NQ7A 4RE3A 1I8LC 1LP9F 3IK2A 3L08A 1IIKA 4ODSH 5BW6A 4I5RA 5K9DA 2D23A 2AQQA 1JULA 2PDKA 1F3DH 1WDRA 4YHNB 3EW3B 1PLGL 1FZJB 3ELQA 1PL3A 3N1QC 4H8VA 4R0LB 4D0CB 4ZI8A 2HT3C 1KB5L 2G5WA 1ZVHA 3UJFA 4KI5D 1ZCOA 3K1GA 1UZ8A 3I85A 2OMXB 7FABH 4XNYH 2CWNA 4P23B 4X83A 3VB8A 1E3FA 2QF7A 3VXUE 3BPNB 5IG7A 5FYKL 4XQ6A 2AAAA 3CHCA 4R33A 2KZKA 4OCRH 3MRBA 2HRPH 1XF5A 1FDLH 3NJNA 4XH2B 4DYJA 2VDRH 1JWUA 5I15H 3AZUA 4PY7B 2PDXA 3GIYA 4O8RA 1SXNA 3DURB 4HCRA 3F7RA 4K68A 1HHGA 3VUPA 5BO1H 2H90A 2G4GA 4L1TA 2NY2D 5H4ZA 2WZTA 4K7PX 3VNJA 5IHZB 1JPIA 1TVBA 1KG0B 2Y7LA 2XZCL 2V0TA 3JV6B 2IQ9H 1W9BM 3I9AA 3TJPA 2WIIA 3KPPA 3DK0A 1MNUH 3HPZA 4G9PA 1JFXA 3QZAA 4BFIA 1GYCA 1UXLA 5FK9B 3WIAA 5F7AA 1NDYA 5JPNC 5HYIA 5JZ7D 4IWWA 4FNLL 4Z78B 1ZXKA 2B08A 1XYAA 3BPLC 2W07A 1DEDA 4F2TA 3OWEA 2XACC 3H2QA 4M82A 5AW0B 3MQTA 5D2LE 5CIPH 4IEFA 4IMLA 5AKTA 2DQCL 4HETA 2HRHA 5C7XL 1WZ1H 1MNSA 3WF2A 2HE8A 1U8OB 4R9XA 3DXAB 5KW9L 1PB0A 4ODXB 3NJKA 1URZA 3V6OC 4HZLB 3BV4A 1F1DA 2MOGA 3UZZA 2DUZA 1R5IA 2C9XA 5BNKA 2BP8A 2MNJB 1GOWA 3ROOB 1W3TA 2XSKA 4FKHA 2WINB 1P2CB 3CSBA 4M5TA 3CPLB 1HH6A 1U8LA 2H9GA 3JWOC 4XN8A 3RB5A 3U4KA 5I8CB 5L6YL 2VWSA 2J44A 5IB4A 5JOFB 3G04B 4E8GA 4X7CC 3TN0C 1U95B 5CBAB 1AD4A 4CCEA 1DWJM 4ATLA 1E65A 3LTPA 3A67H 1UB6A 4ERIA 5FO9B 4RISH 2J27A 3OAZH 4PUNA 1RUSA 1SMDA 4KZEH 1ET5A 4G3YL 1ZSDB 4F33B 2MNWA 1R6WA 4NB7A 5CD5C 2H26B 1UOWA 4BSWA 2X6VA 5F96H 3S3GA 1X9LA 5DJCA 4XAFA 3NM3A 1Q2RA 1PEZA 3ECBA 4YYFA 1ZJBA 5E9NA 1GOFA 1EJ8A 5ADPL 2QDVA 5DJXB 1D5BA 5EEXA 4G1EA 5SX4I 3A24A 4L8CB 3EYFB 3O45A 4RX4A 4EXPX 4MNMA 4PJXF 2O5XL 4A39A 1LLOA 2A38A 2Q7AA 4ZMTA 2O7QA 3D3VB 3UYOD 1GGUA 1YMHA 3EG9A 3Q8FA 4X9YA 1E6QM 4OOUA 3OGCB 3UBPC 3HI6L 2VQUA 2VDNB 1YEDB 2XZZA 4MNGB 2JTYA 4HOXA 5I8EB 3CFDA 2OGYA 3ABGA 4RFNB 2R29L 3PY9A 1NM9A 4P4KC 4AITA 3ZTCC 5G5DA 2EDOA 2A4ZA 4HSCX 5CJQL 3VI3B 3MLYH 1VLWA 2X4PA 4F7MB 4GKNA 2IVFC 5ESAB 4X7TB 4I3SL 4PJDA 2YMXH 3MRIA 1QNPA 2PPAA 4N26A 5KSAC 4FQHB 3HI5H 4A21A 2OR9L 2J25A 4V1DA 5IBUB 1RPUA 5E95B 1GW0A 3LBCA 4JFZH 4F24A 4PJGB 4JAWA 4O12A 3OGSA 1YEKL 3GMPA 3H9SE 1XRFA 4QHLA 3UTPE 5FGRA 5SWZE 3WK2A 1BBJA 5C6PB 3M17A 1OD9A 1Q3NA 4XP5H 1F05A 5CC5A 4BSVA 4JDTH 3MVIA 1YAZA 3VD9A 4DAFA 2B31A 3T4YA 2JQAA 2ALWA 2FK9A 3VI4B 3HE7B 3KYNB 4IHBA 4JZJB 4M93C 2DLFL 2ZNWA 3EFFA 4TL5A 4AYGA 4F37K 4IIBA 2VSCA 3LKPB 1ORSB 4WHTA 3VXMA 3WNKA 3HLKA 4P9ML 5ECGA 4NKOA 4NO2A 5J9PB 5M3WA 4JDVB 4PJBB 4V1YA 4UIMB 3JSSA 1OE1A 3BUDA 4GYFA 4CQ9A 3P0YH 3OBAA 3OMNB 1A3QA 2CG9X 4IRZH 4DKAA 4W7VA 3FKUS 2QSQA 3UR5A 4ODSL 3WJJA 4ZD3H 3NL3A 3TIMA 3RDTB 3CVIH 2WC4A 3PBGA 2DS4A 1J5HA 1E7VA 4KRPD 3M0IA 4PRPB 3LU2A 2HT2D 1KTJA 3OJDB 4QPEA 3PNUA 3HG1D 5HTSA 3RJDA 2ITDA 2J2ZA 2YUWA 1HL5A 3RU8H 1WH0A 1O6VA 1AXSB 2BHZA 4NYYA 4EI6A 1GIGH 3PPCA 4W6YB 1YCSA 3NQAA 3SOTA 2BSDA 4FR1A 2Y23A 4MSWA 5FYJL 4D6FA 3IFOA 1A66A 3W1LA 3AT8A 5IRPA 4EXKA 4OCRL 2VJ0A 5CR8A 4TNVF 4E0RA 3VOIA 5CM1A 1F41A 2ZQKA 4XTRC 5DK3A 2Z1WA 5CPQA 1I8MB 1LROA 2L7QA 3IFPA 3K7UA 1XDLA 2GJNA 1CGSL 4ODVL 2E47A 5EOCL 1EOKA 3H0TB 2WZ6A 2XG4B 1R19A 2P4AB 1RP9A 4HF5H 4PRHA 4TNWF 4YO0B 3L0GA 3W2MA 1X6NA 5ABZA 2GDQA 1BZ8A 1JE6A 3AU1B 1MNUL 5SX5K 3UGXA 4ZMVA 4RV8A 1QRND 5ECUA 1CXHA 1J5TA 5C6WH 3NL6A 3TA6A 3O11B 4WRLA 1A6VH 2ZJSL 4H20H 2X05A 4E42A 3VSTA 3JWNG 4JVWA 4PVNA 3SCMD 3SCVA 3O4OC 5E9AA 2WV8A 5D7EA 1OAQL 1V6TA 5I02A 3D5HA 1QI3A 4YIQB 4YN3A 3AYSA 1RZIB 5HJYA 3NESA 2AJVH 3U36B 1JYWA 1M6JA 4LP5A 4MD5A 1NDVA 3NO5A 3QDGE 2HS8A 1M57B 2P8PB 4YEEA 4HYVA 5GRVK 3WUZA 1KEMH 2H2PD 1PZUB 3E0IA 5DBUA 3H9HB 3O0FA 2YAFA 2ZP0T 3DUSA 1J0HA 1EZWA 3W6MA 3A4DA 4DN3H 1UKSA 3CZJA 3U0WL 4Y7MA 4JTQA 1XXDC 3CHOA 4LB8A 2ENYA 3T0EC 4DGVH 1DQLH 1JK9B 4DI8A 4HTYA 5EA9A 2V5LA 3O6LL 5I1HH 1JQXA 1PWLA 1R9YA 2WMHA 2DV0A 4LSQL 2OWXA 1NMAL 1S5HA 1V8HA 2BVTA 5FL0A 2Q7NA 2R9HC 2PP0A 4RE0A 4D1IA 1O7DE 5LZLA 3WGVB 3QIBB 5EY5A 3BOFA 4OZFH 2FSEA 4HDIB 2J4WL 3PTQA 1W3KA 2IH1A 3NQGA 4JRYE 3JZUA 3TYBA 3QG7H 3ZDZF 1MXGA 3WMSA 2LLGA 6FABH 1IAOA 2BBFA 1IM3B 3S35X 3HFTA 3MC5A 4NKDB 4U6TA 1A9BB 4M02A 3ITTA 1K8XA 5K39A 1AE6L 4PS7A 1TYGA 5DRCA 1J12A 2XINA 5L4FA 1Z9SA 3BUBA 3UXKA 3WDJA 1LEIA 1SR9A 3WFHA 1GCYA 1JCYA 1S5TA 2V6HA 1Z69A 1UQSB 2AITA 1UR0A 4UNKA 3VOJA 2Y2YA 1H8NA 3L3JA 3DX6A 4JRYD 1SSGA 3WEBA 2IKIA 5F2LA 3DX9A 2L4OA 2QLYA 4KJQD 2R29H 2YXFA 2BSTB 5DEGA 3LNMA 1HDMA 5TQ0H 1IKFL 4TX9A 3MODL 1TTAA 5HDBF 4WHYH 4RFOL 4AGOA 1NDZA 5CS7A 2GQ3A 2J79A 1FNHA 2X4SB 3GSRB 4AMXA 4OTXH 5GS1B 5I1IL 1DXFA 4GYKA 5M5DA 1LJMA 4U6XB 2VFDA 4DJDD 2P24A 1KBJA 4IBQA 4LPXA 3KYKH 1OARL 2AXFA 5I8KL 5I8OH 5KVFL 4LC6A 2ZCKL 4MCNA 4PW9A 1K4CB 1VLIA 1UC6A 3TDFA 4RW3A 3FU6A 5E0CA 1JPDX 4JM2D 1HH9B 1ZJIA 3UZWA 3MA9H 5REQA 4UV7L 4LCIH 5DTFA 5FAAA 1FL6A 2VEKA 3F7VB 1H15B 5FCUL 2PDCA 4D6DA 1XICA 1P0NA 4IRSA 3VFNA 4JFOA 1OZQA 2PWVA 3RWCB 3JWNC 2XQBH 1Y18B 3VIJA 1YY8A 3ZOAA 2MMXA 4S1DC 3DDGA 3ULVE 4ORGB 3HS0A 2ZOKB 3GXMA 4Y7EA 4LSSL 5IVOA 3SI9A 2EINB 4AV0A 2YCLA 3ITOA 4P9MH 3V9EA 3T2LA 1CI5A 2C3ZA 1AMYA 3PJXA 5F6HI 1BQGA 5SWZA 4LUSB 3AU6A 3H9SA 4L9XA 1IE4A 5GGQH 4QQ3A 3VDGA 1NICA 3BDYL 5K1JA 1JL8A 2JELH 3TT3L 3CQPA 4GAFB 4P2YA 2X4QB 3W88A 4PJBF 4BQ3A 3HRZB 3PWJA 2IAMC 3T0XA 3URNA 1A3ZA 2EXWD 4F0RA 5LNSA 1UFUA 2VABB 1AA1B 1K03A 4NHVA 4RZCA 4BI5A 5A6BA 3IVUA 3QUML 3PJUA 4PCFA 3X12B 4GG9A 4LCVA 4TS6A 4XC1L 3BP4A 4XXDB 4ZS7H 4F79A 4CVZB 1XC4A 1DJQA 2QLVB 3V52L 5EPMA 1VPXA 2UZXB 4ISVB 2OMYB 5ITBL 1ZA6A 3A22A 1W3IA 2ZADA 3M5XA 4BQ6A 3H9YA 5K9QI 3GDKA 4P0DA 3DI0A 4RNIA 3RO6A 2YEZA 1RJYA 1E50A 2PF6A 3IJEB 4U5IA 3R8BB 4FHKA 2CU0A 1IFRA 1BJ1J 2VXVH 2Y06H 3QUXC 4U1LA 3CYVA 3M0MA 3CIWA 1F3DJ 1DHKA 4YSQA 1UWAA 3FB5B 2HCZX 2CWXA 2ZP9A 5BU6A 4GO9A 1B9KA 4ILDA 4K5OA 1UA6L 3KLSA 1PDKB 3QJHA 5CZXD 4U1KA 2J1XA 4GUPA 2VH5H 4A05A 2RALA 3GSVA 1K70A 4LHUA 2DQTH 3QUKA 1U1HA 1XQ4A 2G5BA 1MFAL 1XIIA 4MNQA 5B4MD 2BWDA 3U0PA 2DIKA 5HP5A 1OD7A 1DJZA 3H55A 2BSSA 1K2DA 1FX6A 1XCTB 5TAOA 4H8UA 1F2XK 4OFIA 2OYKA 3CH1A 2OB3A 1EXUB 4V33A 1JCMP 5B7ZA 4JPIA 3U2IA 1HZKA 5DJDB 2NVDA 3UC0L 1E4KA 2FBJH 3QRGH 2ZBTA 3JUZA 4KK5D 4N2CA 3UC2A 4G8TA 2OGJA 3R0UA 5G1YA 3KWSA 5GXBB 5BMFH 4XN5A 4Y16C 4CC0A 1TV5A 3BPOB 4CA4A 3DHFA 5EFDA 4WCYL 4G71B 2WXNA 3SZ6A 4JY4B 1NBCA 1D3HA 4FFYA 5F9OH 4UZUA 3RWEA 3D05A 2JIWA 4PTTB 5SV3A 2X9YA 2H2SD 2WBJC 1FFQA 1MRCL 3DV6B 4HD5A 3I9GL 4KXBA 1UR2A 2ABAA 4LAZA 1LQ0A 5DVOA 4K1GA 2DKUA 3O6LH 5I1HL 4O4VA 1I1FB 3CVCA 4UNLA 1IFHH 1XWVA 4ZUWA 4GG6E 4O10A 2ADYA 1SQMA 5FJUA 2JLLA 5KSVB 3O6DA 1J1PH 2I69A 4C54A 1CLCA 2DW7A 2YDRA 3ILPB 4YNYA 3ARQA 3WQ4A 4L18A 2MQ0A 4CU6A 1YEFH 1Z89A 3IARA 1Q38A 4KVNL 2R91A 4ZQOA 2QZ5A 1VCVA 2GJXB 2R51A 4ZW3A 1DV7A 1U8PA 4TIMA 5IM7B 5IW1A 2CR6A 3MFGB 5DFAA 3KPOA 4NYLB 4BFEA 5E24E 2DSWA 2BINA 1W9UA 2ZX6A 5KYUB 3C5ZB 3V4VH 5HVFB 4FF7A 1AQFA 2GGHA 2OKTA 4A2RA 1VZGA 5IJVB 3PR2A 5DK2B 3GMOA 2AEQH 3HC0B 2QKIC 1JRHI 4N9GA 3M1ZA 2PI6A 2GY7B 3X17A 3QJUB 3G6MA 2QMJA 2WKOF 3KYOB 4M6NL 5FJRA 4H8PA 4L1HA 2CXGA 2F8IA 1C9WA 3G1VA 1TQBB 4YLWA 3SKJH 5DD6B 3CQHA 4Z1BA 2PXYB 4OCMC 4DFIA 4Z5RB 5B1AB 3IIPA 4IZGA 4B5XA 1VDGA 1AQKL 3BLOA 4JG0L 4J5NA 2A73B 1OYCA 4NRRA 1FWWA 8FABB 4PCKA 4NC1C 5EOTB 1RAKA 1RY8A 5SX5H 5LWYL 2IGFH 5ANMB 2ACQA 1EDYA 5K9JH 5E2UH 1LT7A 4CILA 1LLZA 4DTGH 1U8JB 2NTSP 5B1BB 3FLUA 1XL6A 4WJG3 4E3VA 5I3GA 1BD2D 1E9OA 4XAZA 3CZNA 2E86A 2BG5A 3EYOA 4JN1H 1RZKL 4WUIA 5LCVL 3EHBB 1QSEB 4BEQA 2KUTA 4NJ9L 4EXAA 3N0AA 3GO1H 3IU4L 4QXGH 1XF2B 2TSAA 4PMFA 3MZTA 4MAZA 3TV8A 3E8VA 1RV6X 3MT1A 1HCZA 1BIIA 2ENSA 1DLHB 4P57B 4EVZA 3K81A 4NM4L 1HHIA 4BJLA 4IU3A 4M43H 3K2UH 4YBLB 3DMMA 3LCGA 4XUYA 1HYSD 3GUTB 4UFIA 1GS7A 3TT3H 4JBSA 4RMRA 1IYXA 1Z3GH 3FT3B 5BZXA 1E4WH 2BCKB 4MASA 2VZ3A 2EYRA 2NLYA 1AQDA 4M8RA 2HBXA 1MAML 2AK4E 4P2QD 4Y9FA 4ZFFA 1IAKB 1UURA 5HYQA 1NJJA 3DXAE 3AXXA 2MOVA 4KZDL 1GUVA 2FTYA 1WE5A 5JW4Q 4DWSC 1Q66A 4XTRD 1OM0A 2BGSA 4IMAA 3STPA 3N4FA 4JAMB 3WN6A 1EDTA 5TIMA 4DNHA 1XR9A 4HS3B 4PJCF 5D9SB 4PULA 1FJ1B 1EEYA 2E9GA 1KJ2L 5E7FA 1OP3H 4OV5B 2Y70A 2VLKA 3H6OA 4WJKB 2ZWSA 3EDEA 4K23H 5E6IA 1LEKA 4E9QA 1FVCA 3CDZB 2IQ9L 4N9OB 1C93A 2EJAA 4DB7A 5IGXL 1NC2D 1RA0A 3HB3B 4AQZA 3M0JA 3U83A 3VCRA 1UD2A 3IMUA 2CO4A 2V3FA 3QVAA 4F2ME 4PFMA 5FLVA 5HJLA 4X6EB 3KCWA 4H7VA 4F3FA 3V4UH 4ZQPA 3RZCC 4KNTA 1I0BA 3P74A 2ZC1A 1DQVA 2GFBA 2LFGA 2WQXA 4HXBL 2JFEX 3T1GA 4C6EA 2X6MA 5AALA 3T8XA 3O0LA 2DYRB 1F6AA 2EXWC 3MKKA 1G9EA 2BIOA 1DE4B 4NRZA 1A3XA 1ECQA 2C9AA 3R8RA 3AXLA 5GHWH 5F3HA 3AI0A 5JNYB 4PUEA 3AFLA 3K4WA 3G6DH 4Q9RH 1EDHA 2PR4L 5JUEH 3SPVA 4HK6A 1KB5A 4LUJA 2FMOA 3RILA 2HS6A 1R3HB 5BMXA 1US3A 1BXXA 4WZ9A 1NDMA 2PCXA 1WUEA 2WSRA 3MBWB 5F1IA 1F0LA 1NC4D 5DGQA 4OQ1A 4KKZA 3VXUA 3WLSA 3IDGB 3VG0H 5I00A 4OIIH 2OLHA 3QIWA 4P59H 4WUUB 5I74C 3D85B 4TULH 4KRTA 2HJLB 3CXHJ 4QHKI 4WF7A 1E6RA 2QR6A 5F7MC 4J2QA 2XXGA 4D3CL 4J3TA 3LM3A 4AEIL 1IGTA 3ABZA 4JFXA 3S35L 3H2AA 3KPNB 4XWUA 4DP0X 1B0IA 1J1OH 4GSDL 4YBHA 3ZJKA 2NXYB 3ZHFA 3PGFL 2VITA 5FD0A 1VCBC 3TVMC 1OF2B 1D7BA 5CC7A 1MW3A 1ZAGA 1PBYA 1RH8A 3NP4A 4DP5X 4X0VA 1MN4A 5E1QA 3OAZK 2V2TA 1ISXA 1WAUA 4NZRH 4Y9AA 1EQCA 5HINA 4M51A 1J9SA 4QQUA 3GSNB 2H3KA 1AG0A 9PCYA 9XIMA 3ZKMD 3VXSB 2JEPA 2DMCA 4JR9H 2R24A 1IX2A 4BH7B 2OX5A 4RK8A 3HHRB 4J23A 5GVJA 5BOEA 1B3JA 3O3EB 5EEWA 1DN0A 2BZ7A 2FTAA 3WQDA 2X0HA 5GGTA 4DNMA 2DI7A 1PVHA 4CNSA 1FF5A 1S8DB 4LNCA 3W7HA 4KETA 1YJDL 2GK2A 5T1DL 1KFBA 4FFVC 4LL9A 3NWRA 1GVSA 2G3XA 1JCLA 1GOKA 5JHLA 4G8FA 5HR7A 4IOFD 2O9TA 3B2PA 3CXDL 2YJQA 4OB5H 1MCWW 5I66A 4PJ9C 4LV9A 3QO0B 4C1NB 4YL2A 2OLAA 2NYKA 2BM3A 1F76A 3SKJL 4BFFA 2C0HA 3GI8L 3H6AA 1T99A 2G60H 3GBNL 3BKYL 1VJIA 5AWNL 3WDPP 4C6NA 4NRXA 3V5HA 1EJXC 2OMWB 1SY6H 3QK0A 3TH4T 4OM1L 5JHMA 4Y9OA 3RITA 3TCSA 5TH2A 1NELA 3NGFA 3R0MA 4XUGA 1DVFD 2W65A 1WAAF 4FNUA 3ZE1B 5AB1A 2QV5A 4L4TB 4IMKA 1NIEA 3SO3B 2O9RA 25C8L 3TFKD 4YCPA 2QCMA 5K2ZA 1MH5B 5KS9B 4EI5D 4IMDA 3G5YA 4PJFE 5A7BA 4AXKA 1MDAA 1PX8A 3MJGX 2FCBA 2JXMB 3GT6A 4TVPL 3SDAB 2F9RA 3DECA 3C2VA 4MKSA 1D9KC 2F19L 3IU4H 5FO7A 3NIGF 4ZW8A 1S9VA 2OW7A 1I7ZA 2QJMA 3JTTA 4AIEA 4WDWA 2I24N 3RVVC 4Q8OA 3LHZA 1SEQL 3L21A 4PVLA 1JGLH 3WE6B 3F4CA 4MVAA 3K72B 3SOBH 2EP6A 4EQ3A 2B7DT 4XISA 3L3DA 2QR0A 3HG4A 2O5ZH 2VWEE 5D1ZI 1CS6A 1HKWA 2G3NA 1TVHB 2QQNH 3IJSB 4KK6D 3IS0X 3HR6A 1LO4H 3S96A 3ZS4A 5KG9B 4KUZL 3L45A 3TCTA 2NQCA 3FCTB 5EF0A 4AFYA 1Z3GL 3BURA 2A77H 5E8EB 4WI2A 5E4OA 4MS8D 1MAMH 1EVTC 1MI5D 1J9CT 4HS6A 4V2BA 3I6RA 3MUXA 4Y5XB 1M2VA 3U1SH 2K6WA 1DQKA 2OSYA 1M04A 2DOCA 4U1MA 1CB4A 3RLSA 1O68A 2OTWA 4ROQA 1E2VA 3GMLB 1CE6A 1M3JA 5AZ2L 1EFXA 3F7JA 1XS2A 1E4XI 3V4VB 2QDHA 4GH3A 1YYML 4KT2A 3JV4A 5D1XA 2W61A 3UJRA 3KDOA 1AYRA 3GM0A 3KW7A 4K23L 4OJYA 2GUUA 1N59A 4F27A 5BJTA 4RR4A 1JD9A 4NQVB 1TETH 1WGVA 2UWEF 3ZWSA 3KPMB 5JHDA 4L3CB 5IF0B 5D7KD 1A6VL 3MYJB 4I0CC 3HZKA 1RUQL 3KOZA 4FXFA 1E0TA 3QW3A 3PGDA 4MA8L 4Y1TA 3EZJB 2ZXBA 2VP8A 1YDYA 3VTTA 3MO7A 4WXYA 3NT0A 4BUQA 2V69A 3FTWA 4IPLA 3HI1B 3P4OB 3PFQA 4PJAB 5D1ZD 5F9JA 2NWRA 2XKSA 1LE5A 4M7SA 3D50A 3BLPX 2D7MA 5IG7B 4KK8C 5C6TL 3H2WA 2HFFB 3D46A 4L23A 4PH8A 4AYBA 1BV8A 4HFUH 4JQIH 5IOPA 4EXBA 4NQCB 3RHWF 1NKOA 3SE4C 2AZAA 1XB8A 4OIBA 3NZGA 4NQSA 5DJ8B 3EYSL 4O13A 4OFKA 3QXDB 5DWPA 3CV1A 2PR4H 4NQED 2CLZA 4RIRB 4WAFA 1MPAH 5FA3A 3UGUA 2CIPA 2X41A 2FX9L 3GSUA 2HJKA 3SE3C 3O2DH 4Z3EA 2J24A 4N9EA 1X7TA 1MHCA 4LNYA 1TTRA 4HIHA 1DJGA 2F58H 3WJLC 1DJWA 2WIIB 3IDXH 3OAUL 3IGUA 1E56A 3IIVA 4LSRL 4QE4A 2YRLA 4AWTA 2Z3FA 4NQDD 1UMLA 1N0XH 4HUUB 1KEGL 3P67A 2E8YA 3IVKA 1PIIA 1XIFA 3RIFK 1BA9A 1ZLWK 1Q6LA 4N1CA 1G7JA 4AK2A 1Q9WA 3UMNA 4FULA 4BY3A 1BYOA 3O4LA 3CMJA 2XWBA 2BS71 2IANE 2NY3D 3CUPA 3UX9B 3L5AA 1XLJA 4W68A 3V7MA 3BFQG 1TE6A 5HYSB 2RR3A 2XC8A 3GSMA 5JPNB 3GB7A 1KPVA 1R5WA 4ODXA 3QUMB 2F15A 3NIGE 3T9PA 3DFTA 3UO1L 4QSHA 4X80L 2BCMA 3SRKA 2FO4A 1JF1B 2WCSA 2H3NA 4HN8A 5HPCA 4E0CA 3EBGA 5C5YA 3GSWB 5FJOA 2QGBA 3E3HA 2J1ZA 2NSXA 4F1ZA 1P4IH 1MCSA 3S88H 1MCFA 1Z7JA 1RK6A 2WYSA 3MRNA 3TR2A 1KMGA 1LORA 2BLFA 1E15A 1LQBC 3WN5B 1GZJA 3NFNA 3QC3A 3UY8A 3SQOL 2GIXA 3MV9B 4HG4J 2EE0A 2A6IA 3QGAC 2R0LH 3OQRA 2ZZ7A 4OBRA 3MUZ1 4JQAA 5KOVC 1UASA 2O0TA 3PSVA 3CJPA 2NV1A 4U4MA 1NOWA 3QDJB 3RPDA 1TFHA 5C0IB 4Z7WE 1ETB1 1OK4A 5EFFA 3WBXA 1FN4A 1OTTD 5BQDA 2LTQC 3BN3B 3GI8H 1NFAA 3C2YA 5KS9E 1T80A 1CBVH 3PP4L 1TMCB 4YSDA 1MUCA 4F37F 4J2PA 1PQZB 1QBAA 1NM4A 4X6CE 4NRSA 3OC8A 1IZKA 1CIUA 2YD5A 4RNHA 5T1JA 1GKEA 4P3DA 4Z23A 2A21A 2REQB 3EWXA 2AANA 1G0YR 4P3CH 5KN5A 1J0JA 3STFA 2BMKB 1H51A 2QSCL 4H4NA 1XF4A 3BP7B 4Y5YB 4NL1A 1BF2A 1SYVA 3RVUD 5T3ZH 2FTWA 4QTFA 1J8KA 2PW1A 3PNWB 3C6EA 2VFGA 1I8IB 2RH0A 1DDHA 1LK2A 2KLRA 3BVTA 4X7DC 1OFRA 1YHTA 4HAFA 3PGCB 4S0TD 4O1CA 4IHOB 2GYSA 2H32A 3U4FA 4AVFA 1US0A 5E1IA 4RFNC 4YPJA 3ERXA 4P2OC 1G4EA 1W9VA 2YRPA 3GRGA 4MB1A 5E1GA 3V6BR 1TIWA 1B4JH 3TYFB 3WLBB 3CFBA 3PBVA 3MRLB 1OT1A 1TNNA 4R7WA 2VDQB 4KPLA 3F7YA 2JKWA 2YIHA 2BNUB 5HPMB 5J04A 4JHWH 4M5ZH 4P7NA 1BBJB 3NIGB 1PYFA 1TREA 4DYEA 3DI3B 4N2OA 4ZS7L 4A2LA 4QCIA 2ZWZA 5H8PA 1ADQL 1FXQA 2P80A 1WKYA 4QTHB 3RNQB 1IEBA 3GXTA 1PAMA 1YEEH 2ZG2A 4KPHL 5PCYA 2PTVA 5ESVA 4JTUA 1A6UH 1GCFA 4JFPA 1K8ZA 4ZODA 4M5YH 4LNRA 2G5RA 1IGJA 2PGRA 4GLRH 3MSRA 2HFEA 3Q01A 1MG3C 1P84J 1V7MH 5I5RA 4Y1SA 1TO3A 4LLWB 1U5JA 2ZZ2A 3TZFA 1ZS2A 4KY2A 1BF6A 2EKCA 3NQCA 2APBA 1MCLA 3LDBB 3AY4C 3EJZD 3QJSB 2XTSA 3HN3A 1NCWH 5D7LA 2PO6B 3FN3A 3IMVA 5C09E 1EHXA 4LBEA 4UZGA 4CBPA 3X3GL 3DERA 2GUOA 4KRMB 4YHOH 1DE6A 2PYED 4JPSA 4HFWA 3T65A 2WCAA 3PQYB 4M62L 4X6FA 3GDCA 3E49A 2ITDB 2J2ZB 4PRAB 3ZTJH 5JOEA 3NQEA 3V75A 5EUOE 3V2AR 4NNAA 1TPXB 4DPCX 2QCDA 2DICA 3RP1A 4NKIL 1S9WB 2J20A 4GKOA 1PZ1A 3INUL 4D9QE 3KCJA 1RZFL 1X9RA 5HNNA 1RIHL 2EDRA 4N24A 3ZTEA 3D0AA 4I7WA 1U8KA 3K2MC 1NDGB 3IMTA 3VQ2C 2VX5A 3G1SA 4X4YB 1ETA1 1NGZB 3IJYA 1YMYA 3GH5A 1QLRB 3GHBH 3JBG7 3D3AA 1S9XB 2P44B 1MF2H 2QVTA 1FE8L 4DVRL 3ROLA 1EAOA 3PG2A 3U30C 1S38A 5MF5A 4AGMA 1F90L 2VC2L 2YPVA 3E5PA 4UFLA 2QKIA 3UZEA 5AZ1A 1Z0MA 4KAQH 4XBPB 2E76C 3UJTH 3AREB 4PG2C 1OF6A 3VFPA 2PN5A 4JPWH 3TL5A 4RMSA 2PDJA 4N2FA 4U31A 3MI3A 5EU9A 1LWIA 2N01B 4DEPC 4TTUA 5FFOA 4ICWA 3A9BA 2D4FA 5EU6E 4U1HA 2YL9A 4WQ6A 3SN0A 1PX3A 1SDDB 3IETA 4XGZA 1WO2A 2EXYC 2I25N 3CZKA 4NJAL 4QO1B 3VWKD 1I9RH 3Q1EA 4UXDA 1HHGB 1LWJA 2XJLA 5IR1A 4Q97A 2DQJH 3FRPA 1GSKA 1QFUL 3PWUB 3CFJB 2QCGA 5LIXX 2K9UA 3N2MA 3E2SA 2Y6SC 1Q9KA 3TBTA 1ZHLB 1YN6B 4AEEA 1N8WA 5I1GL 4X5QA 5FDYA 4C56E 5IVNA 2WUCL 2VX4A 4EIUA 4PFHA 4RAVB 5E2JA 3ZKMC 3SDXF 1D9EA 3G5ZB 4H26A 1Q1PA 4JE4B 4JRYB 4A55A 4BQ2A 5IQLA 2X30A 4OZHA 4AVIA 1IC7L 4XMPL 4QXUH 3CT2A 3NURA 3V6FB 2CIKB 5CZVH 4AE1A 2I9TA 3WD4A 4B15A 3O2WH 4FOKA 1SVZA 3D87B 2ZA3A 1JK9A 1G5AA 3SPCA 2QEJA 5AOMA 4IEFB 5C07B 1I2NA 4QF1B 1J2BA 1W6LA 3EJPA 4EOWH 1TQCC 5A2BA 3UAFA 1DYSA 1L6YA 5GRUH 2MWCA 1DQIA 1AQKH 4LCCB 3BH8A 3WQFA 4G6AD 3IBEA 5C9ZA 4L9YA 1R5IB 3SQSA 4FLRA 2K6ZA 4MG4A 3OHIA 1PFOA 1TENA 3BC9A 1C7SA 2X1SA 2DEXX 5FUZH 4XNQB 1BF5A 2WO3B 1IM3A 1NPUA 1SJCA 1JD7A 2H9GB 2YQGA 1HH6B 1HUVA 1F4YH 2AKZA 1TZ7A 4Q6KA 4TX6A 4MCYA 4MJ5A 3EWYA 1KXHA 4XVDA 5BWFA 5J0BA 4P04A 1PNCA 2ZKXA 3GEWB 3LTYA 1OAYL 2IBZX 2EH7H 1M9HA 2PCFA 2EVGA 4ESKA 3R5EA 3DX6B 1KJMA 2WLHA 5KTEL 2AKRA 1UZDA 1JZ3A 4ANUA 3R10A 2R56L 1ZSDA 1LF1A 1PKNA 1EXPA 3DAQA 5DFVD 4JPKL 2EF9A 3RWJB 4MCMA 4LDEB 5DJCB 1RY0A 3EX4A 1FWFC 3MP5A 2F5AL 1L6ZA 4Z7QF 1F3XA 1NEZG 4NM4H 1MJ8H 5AG9A 2CM6A 3V0WH 4HC1H 1QP1A 2ZX8A 2V5JA 2P24B 2BHFA 1VBUA 5I5MA 5CP7B 5IBLD 5LLIC 3JZ7A 3DIFA 3MO1B 4YHLH 1ZGLA 4OR1A 2P5NA 3EWBX 3I3EA 3B8IA 3MU7A 1MUWA 3EDKA 5AYZA 3R79A 3CEUA 2R2BB 4GQZA 3FTGA 3O41B 4Y4HA 3SBQA 1IWAA 4PA8A 3W22A 3HNTL 1LO2H 1RBLA 4GCAA 3V0VA 5HYFA 5DTFB 2CGZA 3DG6A 3BGFC 1DLFL 3CUZA 2GSMB 5CJ5A 1E3ZA 1QFWI 4IRSB 5HI4D 3VFRB 5DZLA 5DI8B 1A4LA 3FDKA 2V2XB 3GUGA 1UEYA 2R4RL 1YSOA 2Z00A 5CKSA 1ZJHA 1C8YA 3VI4E 1S7WA 4U6YA 5HJ3A 5TDPA 4PGLA 3UZXA 2ZSWA 3WS3B 3TUUA 4QNPE 2ARJQ 1THCA 5LJYH 2AHIA 1Z6JT 3PL6B 3BARA 1OSPH 1X1OA 3E3QE 4R5TA 3TV3H 3V4UL 4IK6A 1I0DA 3L65A 4DGYL 1J9QA 3BLBA 3FNKA 2P8LB 2W9LA 4Z2JA 2D0HA 3L5HA 4OCNC 3BWUF 1E4XL 5LGXA 4YHOL 2Q1EA 2UXGA 3LPFA 4MAUH 1CI1A 2EYTA 3RURA 5A6MA 3HE7A 3KYNA 4D7BA