1GJUA

Maltosyltransferase from thermotoga maritima
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
636
structure length
636
Chain Sequence
MLLREINRYCKEKATGKRIYAVPKLWIPGFFKKFDEKSGRCFVDPYELGAEITDWILNQSREWDYSQPLSFLKGEKTPDWIKRSVVYGSLPRTTAAYNHKGSGYYEENDVLGFREAGTFFKMMLLLPFVKSLGADAIYLLPVSRMSDLFKKGDAPSPYSVKNPMELDERYHDPLLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELADYTPPRAEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFGIITPPGFSDLINDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYGIDGARLDMGHALPKELLDLIIKNVKEYDPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKLPDIAEELVLPFLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLDTDPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGVLNFIKKLIKVRHEFLDFVLNGKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Thermotoga Maritima Maltosyltransferase and its Implications for the Molecular Basis of the Novel Transfer Specificity
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords MALTODEXTRIN GLYCOSYLTRANSFERASE
total genus 191
structure length 636
sequence length 636
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09083 DUF1923 Domain of unknown function (DUF1923)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gjuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gjuA01
2ZUSA 1NP2A 2ZUNA 3VIHA 2E9LA 4NX0A 2EAEA 1BLIA 3VILA 2CXGA 2XFYA 3W27A 3VMOA 1W9VA 4D6IA 2FDMA 2F1AA 4JL2A 3WEOA 3BUQA 4J7RA 1B30A 5CLWA 4AZ7A 1GQKA 2RGMA 4MTVA 3A4WA 2CNCA 2FHFA 3BCFA 1AQMA 4J3SA 2OSXA 4GI6A 1HTYA 2CBVA 2WVTA 1V03A 3LXCA 2OSYA 1TQWA 5CPQA 4PMZA 1UKTA 1UD2A 1C90A 1XGZA 1VEOA 1GOKA 2WMIB 3TA9A 4C7DA 3VIJA 1B0IA 4L4OA 1UR9A 3BVUA 4MDOA 1A47A 2W67A 4GQQA 1QI5A 3VIFA 4J28A 1JZ8A 5AY7A 4CCCA 2XTKA 3AI0A 1RP9A 2C8NA 1SMDA 1GHRA 3SCSA 5DF0A 2YFNA 4LYPA 4UQDA 3PZIA 3LPOA 3B9EA 1NWUA 4AY1A 1UUQA 2VT0A 2EQDA 1TA3A 1PZ2A 4WKHA 5I3DA 2F2HA 1UR4A 1NP0A 1BTCA 5D8WA 3I3DA 5DMYA 1J0ZA 5A8NA 1VB9A 2BNJA 6TAAA 1OINA 1WP6A 5DFAA 3M07A 3BLBA 1XYZA 4XZWA 5HPOA 4OOZA 1RPKA 4W8AA 1XYFA 2UY4A 9CGTA 2XVKA 4PCSA 2F18A 3AMLA 1TZ7A 5JBEA 1P6WA 4U31A 2Y2WA 3WN6A 1UG6A 2XFFA 1GHSA 1FP9A 3AQUA 3WMBA 3L4XA 3RMEA 1OCQA 3VIOA 3ZJ6A 4U3AA 3WQ4A 1WPCA 4D6HA 4PMNA 1PBGA 2QHAA 1J0YA 5I2UA 1ESWA 4YN5A 3K8LA 2XWDA 2CBIA 3THDA 3OGRA 3SCPA 3CUHA 4PMVA 1ISWA 3ZOAA 2VX5A 1CIUA 3RJXA 3VKKA 3SCNA 1UD8A 3HN3A 2VRQA 3BC9A 1KXHA 1ODZA 1E6PA 1G01A 4UQCA 2NW0A 3B9DA 2X2IA 1GORA 1IV8A 5DT7A 4P7NA 1U33A 3B8SA 3GXPA 4PRWA 1KWGA 4AD1A 1V02E 1FH7A 1C91A 3MU7A 2DDXA 4C7GA 1SZNA 2ZUTA 2QMJA 1BG4A 1AMYA 4QCEA 1QBBA 1A3HA 2D3LA 2VI0A 4KMQA 1UKOA 3ZR5A 5CPSA 2O9PA 1CXFA 3IJ7A 1UWSA 3M6DA 3CZKA 3VSVA 1L8NA 2OWWA 2AAAA 3OBAA 4LYRA 2ZWZA 3GH5A 3CMGA 4WF7A 3CHDA 2PWDA 1QI3A 5HXMA 4LXFA 4HPGA 3WBAA 2ZX6A 2VO5A 1CECA 1HL8A 2VCAA 1GCYA 4UQ9A 1GUVA 2O9RA 3RM8A 3IJ8A 2DT3A 3A4XA 1DWFM 4P7RA 3N12A 3VGHA 2O9TA 5I5RA 2W4XA 5A8QA 2WB5A 4DUVA 1ZS2A 1UR1A 4CD7A 2CESA 3PZVA 8A3HA 4U2YA 1DWIM 1HIZA 2X0HA 4JFTA 1WO2A 3TP4A 2W66A 2VQUA 4U2ZA 1JZ6A 1L0PA 4CN6A 4ZENA 1W1VA 1GOIA 3WUGA 1SR0A 2XWEA 1MXDA 1BGAA 3RDKA 4HU8A 2GK1A 4E2OA 5D9OA 3ECQA 3W4RA 2YOCA 5ABFA 2J25A 1KBBA 1JF6A 1JIBA 4QLJA 3A24A 1OIFA 3AZTA 3S6TA 4J3XA 2YBTA 4HA3A 2WVVA 1E40A 1EA9C 3OLEA 1XCWA 1H49A 1JD7A 1UR8A 1AQHA 4UZSA 2WXDM 3VD7A 4U5IA 3AS2A 4D72A 1BVNP 3OGVA 1CGTA 4HOWA 4AW7A 5D4YA 4A3YA 1QWNA 4HOZA 3AXXA 3FAXA 3WFZA 1B2YA 1E5NA 4XX6A 4Z2LA 1RH9A 3DHUA 1B3ZA 3K4DA 3VDCA 4PTWA 2GJRA 5E0FA 4D71A 1TG7A 2WHJA 3ARQA 4OKDA 1W1YA 1BPLB 3AS3A 1WDQA 3KWXA 1M01A 1JFXA 3RJYA 1XC6A 2EXOA 5I23A 2UY3A 2CERA 2PF0A 4WSKA 2OLHA 2J7CA 3A47A 1VAHA 1PS3A 3ARTA 1G9HA 4OBSA 4Y7EA 4AZIA 3I3EA 3T09A 4QLKA 2PBOA 1LG1A 1V0LA 3L4WA 4JKKA 5DO8A 5A8OA 5I77A 4UFJA 1B3YA 2HISA 5GPRA 5D9MA 1JD9A 4A3HA 3EBVA 2E40A 3TV8A 1HJVA 4GO8A 2OYLA 1JXJA 3L4ZA 1E6ZA 3AOFA 4L4PA 3HJEA 4Z2KA 3WSUA 5CG0A 1LG2A 2V3EA 4D1IA 1QBAA 2AMGA 4CD6A 4ACYA 4KGLA 1EDQA 3HMCA 4WJXA 3VDBA 1DWHM 2GSJA 2VURA 3GDBA 1B9ZA 3VVGA 1LL7A 2J7BA 4E8CA 1FA2A 1CEOA 4W89A 1WZKA 5E70A 1H2JA 1B3VA 4GO9A 3KLLA 3BAWA 1NWRA 4N42A 4P8VA 4FMVA 1BGGA 2Q8XA 4UQEA 8CGTA 1QI0A 4PUEA 4WLCA 3VU2A 3EDFA 2DSZA 2VZSA 4GINA 2PWGA 3CUIA 5GNYA 3T0DA 2XN0A 1F4HA 1B31A 1NOUA 1BYDA 3WH9A 4LQ1A 2GJXB 1K9EA 3NSMA 4PYSA 2WMJA 1U30A 3PTMA 3RPMA 2G41A 1G94A 3WENA 4AIEA 3PZGA 3ARRA 4DUXA 4CN4A 1EH9A 1KCLA 3E1F1 3AYRA 2F61A 1KCKA 3KL0A 4AZGA 5BRPA 2D2OA 1UQZA 2XJ7A 3VNZA 1CWYA 1E4IA 1UYQA 3HU7A 4HZ6A 1G0CA 5CQ1A 4H2CA 1CXKA 1ITCA 5M3WA 3PTQA 1QPKA 4JHZA 1S46A 5E6ZA 1CXHA 1MW3A 4OGZA 2GJPA 1TQVA 3EMZA 3VM5A 1KQYA 4JKLA 2GJXA 3VGEA 3TONA 1MQPA 3GXNA 3MUAA 7A3HA 4AYSA 4TTUA 1M04A 1WZAA 2F7PA 4W87A 4KRTA 3NDYA 5M17A 1E3XA 2WVVB 1UASA 1HVQA 4DO5A 5GQBA 1TVPA 3L4TA 2BVTA 1W9DM 2PWFA 2WMKA 1TFVA 2G4FA 3VGBA 2FGLA 3SUWA 3VOCA 4UR9A 1DWJM 1QW8A 3WQ5A 3OIHA 3FHAA 4LGXA 1K9FA 3F4VA 1KXTA 4P8XA 2WVUA 2PWEA 1W32A 3IJ9A 1ZBVA 4NI3A 2GDVA 3DX1A 3ZIZA 4GZIA 4GKLA 4MADA 1E0WA 4AZHA 4B15A 2DSWA 1IT0A 5FIPA 4UZUA 4MB4A 2D73A 2CHOA 1H11A 1H1NA 3LRLA 1DWAM 2UWFA 2MANA 2WHMA 1TQSA 3SCRA 3SCTA 1UQYA 1EOKA 3VDAA 4CU8A 3WY4A 2EEXA 1V0MA 4EE9A 2PWHA 1X6LA 3CH9A 2V3DA 1LWHA 3PZQA 2XN1A 2FYVA 4UFIA 3AHZA 5FKYA 3ALGA 2WVSA 4M24A 4MAZA 5EMYA 1WKYA 3SCUA 2J7HA 2D0HA 3KEHA 2DIEA 1FFQA 1LWJA 1HP5A 1UZ4A 1JYVA 5IHRA 4NRRA 2FGZA 1E6QM 3EJPA 2CEQA 1LL4A 4BQ4A 4AZBA 3BSGA 4JFVA 2WSKA 1KXQA 1GQIA 2Z1KA 2X0YA 3PZOA 2FHBA 3ZSTA 1K9TA 1E6XM 3D4ZA 3VSTA 4H7VA 1VENA 1B1YA 1VEPA 3SEPA 2J8FA 2BY1A 4W5UA 2VZVA 4DUWA 1ZBKA 5FL1A 1M03A 4CVUA 3F5LA 4PCTA 1CGUA 1WCGA 3MMDA 2XHYA 1QNQA 2EPOA 2YLAA 1H0GA 3F5KA 3SUTA 1WE5A 3OA5A 1NOFA 2NT1A 1PEZA 4WSJA 3WMCA 1JFHA 3VGDA 1J10A 4JFUA 1JZ5A 3ARUA 3SCQA 2BS9A 2EADA 3TOPA 4ZEPA 2J75A 2G8ZA 2W63A 3CV5A 3CZGA 1R47A 4HZ8A 4RL3A 3OLDA 3AIWA 2XUCA 3AROA 3WL0A 5KZ6A 2JEPA 4CN1A 3WDHA 1XH0A 3VIGA 2BFGA 1Y7VA 3QHMA 4HZ7A 4AD4A 3SURA 3U57A 2WHLA 2F7OA 3II1A 4AIOA 4JFSA 2A3CA 1V6UA 1JYWA 3POHA 2G3NA 2QPSA 4X9YA 3D4YA 4W85A 4AZ6A 1UA3A 3VD9A 4Z2HA 2VUYA 1MWOA 1QNRA 4TVCA 2EBNA 1YHTA 3RIKA 3S5YA 4KH2A 3BVXA 4MPKA 4DM2A 4CVWA 3W28A 1TQUA 4W86A 1KFWA 1C8XA 3BH4A 1KGUA 3L2MA 2J7DA 5FL0A 4GZJA 3WD3A 1NOWA 1OGGA 3DX0A 4RE3A 4DWSD 5HOSA 1FH8A 3NDZA 4M82A 1N82A 2QPUA 3KLKA 3GYCA 3WQ6A 1KR0A 4PN2A 1Q4NX 1UZ1A 4LYQA 1UR0A 2OYMA 1TCMA 3VM7A 1R34A 4QDMA 3THCA 4HMEA 3BAJA 2WHKA 1AVAA 1GQLA 3QGVA 3NUKA 5CXPA 4UOZA 4BZYA 5I0DA 1CENA 3T0BA 2DT0A 3DX4A 2ZX8A 3BMWA 4PSPA 1NWSA 3AS1A 3WDJA 3K8KA 1QNSA 3CPUA 4BQ2A 2OWXA 3NSXA 1J0IA 1VRXA 3LMYA 1JI2A 3HG4A 1ISZA 3A6OA 1IZJA 1EQPA 3FHQA 3PHAA 4P8UA 2EJ1A 3EDEA 1HWWA 4GQRA 3CZJA 4OZOA 2PC8A 2GK1B 4FNQA 3ZT6A 1JAKA 5ABGA 1D2KA 1H3GA 2YJQA 3WELA 3AXIA 2VX4A 3IAQA 5BXSA 1LF1A 2WWDA 4MNLA 1V0NA 5I78A 3AZSA 5EBAA 1GZJA 1W3KA 4ATLA 5E6YA 2BY2A 4FK9A 3UERA 2EO7A 2W61A 3ARWA 1JYXA 2YL8A 4M1RA 1NWTA 3CO4A 4S3JA 3N13A 3WQVA 3CZSA 5A8MA 1PX3A 2VR5A 4Z2JA 4PEEA 3GH4A 3VD3A 2NSXA 5JBFA 2IXVA 2FHCA 3OLIA 4IPNB 4MJ4A 1W9PA 2XVLA 4AZCB 2W92A 2WBKA 3T0AA 3W6MA 1WZMA 1OSEA 3DDGA 1QX1A 4R5EA 4GPNA 3GM8A 3PZ9A 2QMKA 4RE2A 3WY2A 5ABHA 3O6AA 4KGJA 4XZBA 3AJ7A 1E70M 2A3EA 4P7OA 3GNPA 2CKSA 4PMUA 2VL4A 4MNKA 4PMOA 2XVGA 5HNNA 2YL9A 3AISA 1JGIA 5A95A 1VFMA 4NF7A 3CZEA 4R27A 4UFMA 1EXPA 3O2LA 2WCGA 1R75A 1VF8A 4AD5A 1HX0A 2V3GA 3SCWA 3BLKA 1GJUA 3WDIA 5KEZA 3KZSA 4U5KA 4JZ5A 1US2A 3MS8A 4PTXA 4UCFA 2ZXBA 2PI6A 5A6MA 2X8RA 4HTYA 1I1XA 2VTFA 3PZUA 3G6LA 3CLWA 2GFTA 2WZIA 1KR1A 3DDFA 1K6AA 2DH3A 3ZSSA 3OZPA 4TOQA 5FCZA 2EACA 1V3IA 3CIVA 2E0PA 3WDQA 2XM1A 3SCVA 1E6SM 3VMNA 1KGXA 1EHNA 4FNPA 1QNPA 3WF1A 3HG5A 1D7FA 4H04A 1RP8A 4TTGA 3H54A 5GNZA 2VZOA 4CUCA 3RO8A 1TR1A 4W84A 2DPEA 4LX4A 2OYKA 3GBDA 1E4NA 4AD2A 4BS0A 2WWCA 2WKGA 3CZLA 4JHOA 4JIEA 4X0NA 2UY2A 4J3TA 3AYSA 3I3BA 3W24A 3UG4A 1E73M 1CDGA 4HU0A 5I24A 1NM9A 3EDKA 3WH5A 1CXEA 2WKLA 3CMJA 3KE0A 5E0CA 5BXPA 5A6LA 2EPKX 3W37A 2VNCA 4RE4A 3AMDA 3BVTA 3L4YA 2IGTA 2W62A 3PZNA 2BVYA 3BSHA 5HPCA 3EDDA 2ZXQA 1E9LA 3WNLA 2E8YA 1XH1A 1JZ4A 2YLLA 3ALFA 4D6DA 3MV01 2YL5A 3GXMA 3TTSA 1ITXA 3AZRA 1SYTA 2J7EA 4J27A 2AOSA 3MSGA 1T0OA 1FH9A 1OD0A 3DHPA 4TX6A 7CGTA 3WMSA 1UOKA 3GH7A 3MMWA 1HN1A 4CD4A 3O9NA 3MMUA 2D0GA 2WMFA 1GOOA 4H8HA 4K68A 1XHGA 2WZHA 2X2JA 3AIRA 1OGSA 3NJ3A 3GXDA 3UCQA 4NZCA 2NT0A 1UWIA 1MQRA 3GTNA 1BFNA 4CCDA 1US3A 1EQCA 4D6CA 1JL8A 1OB0A 4FNRA 1JZ7A 4Q22A 4QCFA 3MI6A 1UD4A 2XIIA 7TAAA 3MUIA 3LX9A 1UWTA 1XV8A 2WM0A 3UG3A 3UG5A 1W9UA 3G6MA 4DO6A 5ABFB 1I75A 6CGTA 3BVVA 2WCAA 2WSPA 1PJ9A 4W7VA 5A3HA 1E72M 3EMQA 3K46A 3BAIA 1V3MA 4AMCA 2ZUWA 5F7UA 3AMKA 3A21A 4MB1A 4UTFA 4AEFA 3ARYA 1QI2A 4MNMA 2WMGA 1EOMA 2GUYA 1V6WA 4IPLA 1R33A 4W5ZA 3W53A 3KL3A 5CGTA 2WW5A 4F8XA 1M7XA 4JL1A 3ZT5A 4OBRA 1XRVA 4S3KA 2DEPA 4JCLA 3WDPP 4U33A 3LRKA 2VC9A 5LA1A 5AC5A 2XN2A 1E43A 1H09A 4AIUA 3W25A 5I79A 1UD3A 2WC7A 3AHYA 3M46A 3EJUA 4TVDA 3OZOA 2WBGA 3S2CA 3SCOA 1Q6CA 3CHCA 1R7AA 5D9NA 5IFTA 4LPCA 5CSYA 2Z1SA 1HJSA 3BGAA 1UH4A 3CHEA 1CGXA 1V6XA 5GNXA 4B3LA 4Z2GA 1Q6FA 4HP5A 4UFLA 1W2PA 2JF7A 3BUIA 3UESA 3VDHA 2YBUA 3AMGA 3AIUA 1J0JA 1G5AA 1FOBA 3WY1A 1AQ0A 3SUSA 1TQTA 2CBJA 1QHZA 4J3WA 5A6BD 2JFEX 1OWQA 1ZB5A 3MANA 4HPHA 3LPFA 5EFDA 2XVPA 2A3HA 3W81A 4FNTA 1JF5A 3VO0A 4DWSB 4UNIA 3SUVA 1UH2A 5FOOA 1E0XA 1GW1A 2DT2A 2CPUA 1U2YA 1UKSA 5A2AA 3WBEA 2ZUUA 3CC1A 3D52A 1VJZA 1MXGA 4P7LA 1BHGA 2D1ZA 4AISA 1WDRA 1BYBA 2XVNA 3CZNA 1CBGA 1E1FA 1ZU8A 4ZXOA 1CYGA 4C7FA 1NARA 2CIPA 1UD5A 3WUEA 3D50A 3D51A 2G3IA 3UEQA 1Q6DA 1C92A 2VZTA 4V2XA 4IUGA 1E6NA 3WF0A 3A5VA 3WQ8A 5ABEA 1JNEA 2YA0A 1B90A 1FFRA 4V28A 3U7BA 3WH6A 4YHGA 4D6EA 3QR3A 3AIBA 2WZEA 1JAEA 2ZX9A 2DH2A 4FNUA 3IAPA 3ARSA 3LPGA 1FHLA 3VINA 5M5DA 3BXWA 1ZBCA 2WMHA 1E4LA 4TX8A 1R86A 4MB3A 1ISYA 1DP0A 2WMIA 1R87A 3VTRA 3T2OA 1C8QA 1O6IA 2YDQA 1EIBA 2DIJA 3BLPX 4QFUA 4AEEA 2J4GA 1J11A 1LL6A 1QW9A 1HKKA 3WQWA 2DQXA 4GZEA 3RILA 2A3AA 2BHZA 2YA2A 3PZMA 3AIVA 4P8WA 2GVYA 3WH7A 1DEDA 1W2VA 2DGAA 2Y24A 3EJTA 4CGTA 2XSBA 3WUFA 1VBRA 3K4AA 1KBKA 3H53A 3CUFA 4HMCA 4DWSC 3N17A 2BV9A 1R8LA 1W91A 4AZ5A 2B31A 3D5HA 1W1PA 5BCAA 4W8BA 1QHOA 1BSIA 3PBGA 2WNWA 1JG9A 4NXSA 2YIHA 3WNOA 2EPNA 3AMCA 4W7WA 3WIJA 2J79A 3MUZ1 1GPFA 5C71A 1KXVA 4B16A 3GXFA 1MFUA 4JCMA 3MKKA 2VOTA 4CCEA 1C3FA 1C8YA 3WD0A 1HP4A 4NRSA 2XGBA 5IXEA 3A4AA 4NXKA 1YQ2A 3H55A 3VX1A 1XD1A 5BYWA 3U5UA 3VIKA 5E9AA 1W9BM 1UKPA 2D0FA 3FN9A 2J74A 3N15A 5A6AA 3ZQ9A 3EJRA 3WH8A 4F66A 1CGWA 1ECEA 4BQ3A 5LA2A 4NSBA 3GXIA 2X05A 1UA7A 1OM0A 2VX6A 2JIWA 3MSDA 4AXNA 4B3KA 2D22A 5A2BA 1GNXA 2YFOA 3UETA 5A6KA 3W0KA 3ARPA 3CZ8A 3BUDA 3SUUA 1B3XA 2QLYA 1J01A 4Q7NA 4GI9A 1UR2A 3DX2A 2E3ZA 3WL1A 4W93A 3N18A 1EDGA 3WNNA 3BUPA 3BUBA 1XSJA 3JUGA 4URIA 4QAWA 3N04A 3HG2A 3AIEA 3BVWA 1HXJA 4WIWA 4AD0A 1FHDA 4PMXA 1VFUA 2ZUVA 2C0HA 1Z32X 3WFLA 4BA0A 3GZAA 1E6RA 1V0KA 3PZTA 1W3HA 2XGIA 4MB5A 4PMQA 1BYCA 3VUPA 3CBWA 1BG9A 3MUY1 1PAMA 4U3CA 1UWQA 3GNRA 3EMCA 1R85A 4FLQA 1EDTA 1LJYA 3ZM8A 1ODUA 1J12A 3AIQA 2F8QA 4D1JA 4F9DA 1HJUA 2X1IA 1HXKA 3U7VA 4MNJA 4BF7A 1J18A 5FD0A 2CHNA 3BCDA 4HMDA 3WF3A 5A6SA 1ISXA 2ZIDA 1TVNA 2FH8A 3RM4A 4DM1A 1DWGM 4IISA 1J9YA 5IHSA 4QLLA 2Y4SA 3UR8A 1ZL1A 4H8VA 1B3WA 3OG2A 5BWFA 3FY1A 1IZKA 1HJWA 1SFSA 1H41A 1J0KA 2CYGA 3EDJA 1OIMA 3W38A 2ZWYA 4FLRA 3WEMA 4ZFMA 4H41A 1UKQA 2VMFA 3OB8A 1OT2A 3AHTA 5A8PA 2EPLX 1V3JA 3WUBA 3VIIA 3HZ3A 4PMDA 2V5CA 3EJSA 3UR7A 3DYPA 3WF4A 1CPUA 4D6GA 5M03A 2J7GA 4TXEA 1E71M 3SIMA 2ZE0A 1GQJA 5IFPA 2VX7A 1ISVA 3WNKA 3OGSA 1WDSA 1M53A 2J62A 3LXAA 2DSUA 3M7SA 4PMRA 1Q6EA 1V02A 1JNDA 2JE8A 3GNOA 3AFBA 1UD6A 4WKAA 4CU7A 3FAWA 3BMVA 2XYLA 4M8UA 2W5FA 4MAVA 5I6SA 3N11A 1UWRA 4M80A 2BY3A 1PZ3A 3CUJA 4ZXLA 1JDDA 5CLTA 1QVBA 4GIAA 5HBFA 1W9XA 1MW1A 3QHOA 3NCOA 2F7QA 4N0RA 2W91A 3W26A 4AMXA 5JBDA 4AYGA 5C8BB 4AMWA 2FH6A 3A23A 1V6YA 1KB3A 2YDSA 3QHNA 1OD8A 1GJWA 2C7FA 1X1NA 1CNVA 3W82A 5A69A 1UHVA 1HF6A 1HKMA 2VVNA 5A2CA 4Z2IA 1CXLA 2D24A 4A4AA 1E0VA 2WC4A 5A6JA 2WLYA 3AHXA 3QOMA 4IM4A 1QI4A 3K1DA 4J3VA 1VJSA 1BVZA 2PB1A 2XIBA 1VBUA 3WDRA 1HL9A 4DO4A 5DEZA 1CLVA 1GVIA 1CXIA 4PSRA 5JIWA 1KTCA 4KWUA 1LLOA 4UQAA 2OW7A 4D6JA 1NQ6A 3GBEA 2VQTA 2GDUA 4PTVA 2D23A 2XFRA 1XD0A 1NH6A 4UFHA 4OUEA 5BRQA 1HKJA 4ZE5A 4JKMA 1E56A 2ESCA 1CTNA 1G1YA 2ZX5A 3LXBA 3GXTA 4NZJA 4F9JA 4MJ2A 2VJXA 1QWUA 3RCNA 3IGUA 1JDAA 3CTTA 4W8LA 1Q6GA 1WAWA 3DYOA 5JIPA 1E3ZA 2ZXAA 2YA1A 4AWEA 1CZ1A 1D3CA 1VEMA 3NIYA 4ML4A 5D8ZA 4FNSA 3WD1A 4XUYA 1VIWA 2BHYA 5BROA 2VZUA 5DT5A 2WCSA 3CUGA 1E55A 1XH2A 1V6VA 3AS0A 5LYRA 2ALWA 3ZMRA 2J78A 1E15A 2QV4A 3TTQA 4AZCA 1BYAA 4BCEA 4WKFA 1MW2A 3VMPA 1XSIA 1HJQA 4PMYA 5D9PA 3ZJ8A 2WC3A 2WYSA 5A1AA 1MFVA 3N1AA 1EHAA 1ZBWA 3FXYA 1PIFA 5CZKA 3BAYA 3VIPA 3N9KA 1R46A 3BAKA 2JIEA 2ZUMA 2OWCA 2WAGA 2V3FA 3NYDA 4X0VA 1WB0A 1H5VA 4ACZA 1WNOA 1F4AA 2BVDA 1V3KA 4W88A 5IDIA 3A3HA 3CHFA 1V3HA 2BXZA 1KTBA 4PTMA 1JZ2A 2QF8A 3WF2A 2V5DA 4FF5A 2X2HA 1GOQA 4OIFA 3VNYA 3VD5A 4B9ZA 5AYBA 2BXYA 2WK2A 4QP0A 4EAMA 1HT6A 3WNPA 5TD4A 1TUXA 3L2LA 1HJXA 2E4TA 1O7AA 2XG9A 5CJ5A 1XSKA 3VPLA 1PX8A 3L4VA 3AXHA 1MYRA 3QOKA 1HVXA 4MDPA 4CKQA 4UFKA 5BXTA 2CCRA 3VSUA 4FLSA 5CPTA 3ARVA 2DSKA 3J7HA 2FE0A 4M81A 1PX4A 5A94A 4ATDA 1JYNA 1EO5A 2J8GA 4EK7A 4J3UA 1KGWA 1HNYA 5EFFA 3FW6A 1MQQA 1X6NA 2F1BA 4AC1X 1MVYA 4WK9A 4HA4A 3VGGA 3VGFA 4JAWA 4CU6A 1WZLA 3ZR6A 2VRJA 3DC0A 2OSWA 1GONA 3K8MA 2WPGA 4XB3A 5AC4A 2ZICA 4CD8A 3DX3A 1BF2A 3VIMA 2Y5EA 5EB8A 2TAAA 3AICA 1QNOA 2V38A 3U5YA 5A6BA 5BXRA 3VX0A 1CLXA 2WLZA 3CGTA 2J77A 4E8DA 3L4UA 3MO4A 4DWSA 4UOQA 4F79A 5HDRA 3T2QA 3KL5A 1OBAA 4UOJA 2BHUA 3ZO9A 4TUFA 1V3LA 3T2PA 1DHKA 4GXPA 1JXKA 3TTYA 1GOWA 5JUVA 2A3BA 4OOUA 3PN8A 2VVSA 2VR4A 3BAXA 2ZOXA 2YDRA 3APGA 6A3HA 2IUZA 1HKIA 1TE1A 1I1WA 3EJQA 4D6FA 1QHPA 4V27A 4M29A 5CSUA 2YKKA 2JALA 3WD2A 3ZT7A 2UY5A 2WANA 2X09A 2OW6A 2Y8KA 1UH3A 1O7DC 1BQCA 3POCA 1EGZA 1BAGA 1GVYA 4M56A 1MW0A 2E8ZA 2D20A 4JFWA 2E9BA 1TA3B 2J7FA 2XPKA 4TVUA 1XCXA 4EANA 1EO7A 4P7QA 1JI1A 4BQ5A 2CETA 1ZJAA 4PBGA 1CGVA 2G3MA 4EKJA 1CGYA 4ATWA 1KQZA 2JEQA 1ZJBA 5C70A 2JF6A 2VRKA 2CITA 3TTOA 2F7RA 4HA1A 2J47A 3W29A 2ZXDA 1FP8A 3HG3A 3LPPA 1UWUA 3T08A 5CGMA 3F5JA 1H0IA 1PIGA 3FNDA 4NZFA 1W3JA 3DECA 4OJYA 2O92A 1E4MM 2CBUA 2ZX7A 4ACZB 4PUDA 1DTUA 1E1EA 4ZE4A 1QOXA 2XM2A 3WNMA 3ARXA 3OLGA 4UQBA 3MV11 4KRUA 3EYPA 3WEZA 3NSNA 5AYIA 3D3AA 2CKRA 2YL6A 3IANA 5E09A 3ARZA 2X2YA 1C93A 3W6LA 2E9MA 2D3NA 2Y8VA 3WD4A 2EPMX 5E1QA 4W7UA 2DT1A 3B9AA 4B9YA 1KWKA 3S5ZA 1E5JA 2RGLA 1PPIA 4XV0A 5LA0A 2BY0A 1LQ0A 4GI8A 1R7OA 2VCBA 4AD3A 2G3JA 4HOXA 2EABA 4CD5A 3AHVA 1C7SA 4YHEA 2HVMA 2XSAA 2PBGA 3WY3A 2IXUA 1W1TA 1V08A 3ZJKA 1J0HA 1RD6A 1VFOA 4H8UA 2DSVA 3LRMA 4YPJA 3RM9A 1JDCA 3A22A 1OGBA 2VCCA 3PTKA 1GOMA 1JZ3A 1TMQA 2O9OA 1C7TA 1OT1A 1H4PA 1WDPA 4FLOA 1VFFA 3VD4A 3IK2A 1K9DA 3DYMA 5ECUA 4E4PA 3ZJ7A 3WKZA 1SMAA 1W3LA
chains in the Genus database with same CATH superfamily
4PTNA 2ZUSA 1PB0A 4BCXA 1BMWA 4MA7H 1U3HD 2Q86B 2E9LA 1XIJA 4NX0A 3TZNA 4PYHA 2GQ9A 1KN2H 4P23D 2EAEA 1HHJB 1PVHA 3MLWH 4BIKA 3WSQL 4DYKA 4DP2X 5A43C 1T3FB 1BWKA 1A5CA 4ONFH 4MNGA 4YFLF 1E4HA 1VCVA 2F7IA 4KKNA 4A7SA 4PFHA 5HHNB 3ZWTA 5KVEH 5DEFA 3BEWA 3BUQA 4R96B 3ITVA 4DZBA 4DPCX 2CCVA 1RQEA 2BJML 1KXQE 2AXGA 2IF7A 3QJAA 4G6JL 2DWSA 4QRRB 2NPLX 3K13A 4JR9L 2N7BA 4R7NB 5B1JC 4AQ1B 1P0BA 4C1NA 2CNCA 6XIAA 4PJ7E 2O93L 2A99A 5AVQB 3BCFA 3GMPA 3MRHA 3W0WD 2CHRA 5D6DC 2GL5A 4GI6A 3RKDC 2YXMA 5GZNC 2HVBA 3EWYA 3UZJA 2VN4A 5DO2C 2FJGB 3TPKA 1TKWB 4Y7OC 4XC3L 4EDWL 1KCZA 5CPQA 3F62A 3OQRA 4XC3H 4PMZA 1C90A 1OY0A 1R19A 1XGZA 1X5FA 1VEOA 4NNCA 5LVEA 3OMZA 1GOKA 3TA9A 3MA8A 2FO4A 2IO5A 4PJ5B 3DKHA 3O9WD 4PMXA 3H1ZA 4NB7A 4A6YH 2ISDA 2B7NA 1ADDA 3X11B 4WDIA 5F0LB 2YKLH 1E9QB 2I07A 7ODCA 3BWUC 5F9DC 2V2TA 3K5SA 4ZZKA 1GTHA 3CU2A 4LUYA 4EWJA 3QG7H 2EDMA 1IKNC 1QI5A 4N26A 2YEZB 2P8PA 1K4CA 3O3BB 4QHMB 2GJ6E 4UDUB 1QAWA 1A7RL 3D85D 4ODXB 5AB2A 4P46C 3GNXA 1LLZA 4R4FL 3ABGA 3R4IA 5FOJA 1WBZA 3MYZA 3DPBB 4HJTA 4PB3A 3KHOA 1Q9LA 4G9FB 3RDTB 1PKLA 3IDIB 5IBLC 2EECA 4F92B 1GHRA 4NT0A 3WJSA 4Z0SA 3BT0A 4JFEB 5DF0A 3T6QC 2GKIA 4KV5E 2O0TA 3GG7A 3QAZB 2E6JA 2X4TA 4Q0XH 4AMAA 4LEQA 4UQDA 3PZIA 3BAEL 1NWUA 3GDMA 4JY9A 4AY1A 4KZCA 4DJEA 3M1OA 2VT0A 1HL5A 32C2B 4JY4B 3SKJH 2V2TB 5F0PB 3DFNA 4LAKA 3IGAB 4WKHA 1IJ9A 3WLOA 2NXYC 4P05A 3KTSA 1GGUA 1I85C 4DEPC 1FRGL 2IPKB 4WO4C 5F7DA 1UR4A 4YL9A 1NP0A 1NFGA 4BZ2L 2GSHA 3BSMA 3OO2A 2Z65C 3CCHB 3F64A 2VDPL 1FC1A 3WNJA 5I30L 1BTCA 5KZMA 1YO4A 2YLHA 2R23A 3CHXA 3I3DA 4YDNA 1EWEA 2J66A 3C86A 5D2VA 3APNA 3C2VA 2A5HA 1NMBL 1C9DA 5A8NA 3ORJA 1ES0A 5CINH 4YDIL 3NJLA 5AC7A 1MXSA 3SFWA 4NUGH 3BDYH 5KUMA 1WIPA 2O5NA 2IWEA 2FEDD 3BLBA 3INOA 3M07A 5DFAA 3L4CA 3WFEH 4NQSB 3ZZLA 1TG8A 5D7KE 3TSBA 1KM4A 4PCSA 1Q1PA 3FB5A 5IV2B 3L6FA 5LWYL 2VL5B 3UYIA 3W7NA 5JBEA 2DM3A 2Y2WA 4AQ8A 3WXWH 1WSST 1RY8A 5TPWL 4P2YA 1C5BH 4R97B 2GVGA 4RSVA 4JTDA 2P46B 5T1JA 4M9PA 4G59C 4I18B 3I7SA 3IFNH 1WPCA 3MRLB 3B05A 4IFKB 4D6HA 3SYAA 2P8MA 4HIHB 2NY5L 3QYSA 5GISH 5DK2A 4IBVA 2XDHA 3OR7B 4JDEA 2XWDA 2CBIA 3THDA 5I2IA 3E3QE 4WRHA 4TMBA 1KPRB 3D0VB 3IPWA 4PMVA 1I9IH 1ISWA 3I9GL 2P10A 3QFJB 4AXWA 3Q7JA 3DX6B 2Z34A 1Z7AA 4AITA 3ITTA 2OAAA 2WWKO 3GSQB 1SVCP 1B0RB 3SCNA 3VOHA 4X98B 5D7HA 5C7VA 5CBAB 1AW2A 4PWKA 2OMNA 2ZAGA 3EOLA 3R8HA 3T44A 1UM6H 2NY2B 2Q3AA 3UZXA 1JPMA 4UQCA 3E0IA 2NW0A 4N68A 3L6FB 1MRDH 4I1RA 5BXFA 1PDYA 3LSCA 1N7ML 1U8KB 3B9DA 3BEVB 5DMGC 1KULA 5CGYD 4BKTC 1ADOA 3AABA 1GORA 3HQOA 4I9TA 3D48R 3FB6B 4OJDH 5TK4A 4YTRA 1BEXA 4KKLD 3B8SA 3GXPA 2L7UA 4OKVB 4PUBL 5FYKD 5T1MA 3VFTA 1KWGA 2VYOA 1S2VA 2R1XB 2M26A 2XIJA 3CG8A 8TIMA 2DDXA 3K30A 1CICA 4RZCB 2Q3OA 1VFAB 4GIRA 1J87A 4QHNB 3NQ7A 1BG4A 2GUOA 4G7VH 2YLLA 3M45A 3T1FA 1QBBA 1PCSA 2D3LA 2WXFA 4UOW0 1FNGB 1G7VA 2VI0A 1IQDA 3LCFA 4CEXC 4KMQA 4IX0A 2Q1EA 3CXHJ 1KC5L 3S4SG 4ZQKB 5FKPB 1QPPA 1JFQL 2NNRA 4KRNA 2O9PA 2X2GA 1E5BA 3IJ7A 3M6DA 4J40A 3VW3H 3VSVA 2YB4A 3TCTA 1XH3B 3K6NA 3SYQA 3GE7A 4JFOB 4OGXL 7ENLA 5HJYA 1P0EA 3UGVA 2AJSL 2IWFA 3BUYB 4H0IA 3VWKA 4JFQA 3MRJB 1U8NA 3FT3B 3BPLC 4I87A 5I73C 1QO2A 1Z3GL 3T2NL 2PWDA 4KEMA 5CBBA 3G6JA 3ZDZE 3DX7B 5M94B 3AAZA 3EWXA 1VGKB 3KLAA 2C1PA 3JV0A 4GQZA 4HPGA 1IGTB 1RZIA 5L8KB 1JPGA 4RGOH 2YD6A 3FPXA 4I9MA 4LK4A 4LAUA 3W9EA 1C08B 4PIBA 4TNGA 5BV7H 3JU2A 2G95A 2VCAA 4Z1BA 2O9RA 1I9JH 5GJMA 4NFBA 2FWSA 1X98A 4WGKA 4YCOA 3VGHA 4GG6F 3EJYC 1I4FB 3IJQA 5TGBB 2PTYA 2EKJA 5K9OA 3G8RA 3N1QC 3OKKB 4GSRA 5A8QA 2WB5A 1UR1A 1TJGH 3KXFB 4G6FD 2Z4GA 2CESA 2C26A 4C56E 1T5KA 2HFFB 1U8IA 2G2RB 4MLRA 4XAZA 3MLZH 1E65A 1FL6A 1PZBA 3D39A 1P7QD 1MWAB 3DN5A 4AFYA 3EHBB 2O56A 3MNZB 3WFHA 1E6JL 3P0WA 1OZTG 5HTSA 4HUWA 3WUWA 1S7SB 3GJFK 2RACA 3L5WA 5D2LF 4GYPA 5KAQF 1GOIA 4ELMA 4RW3A 4LOUD 1RZMA 3MI2A 4QGCA 4KBPA 1AZ2A 3WUGA 1KC5H 4OGYL 1NCCH 5HHXH 1DL7H 2XWEA 1XGPA 5B38A 2QGHA 2P47B 3HPLA 1YNPA 3RDKA 2HFEB 6ALDA 1A0EA 5JMUA 4DCQA 3WTTA 2QSTA 3ZXWA 1ZOXA 2E27L 1H61A 2GK1A 1GYCA 5IIEA 3FO0L 2YOCA 4ECLA 2DWEA 4LNVA 3MBEA 4DOHB 4LOVA 3HBLA 4LLYA 1JIBA 1GS6X 1TYRA 2H3XC 3DOSB 5C0JB 1IEQA 3SYPA 1IBYA 3CFEA 5GZOD 1TWZA 4UTIA 2WP3T 3OL2A 2ZKHL 3LLDA 2VIRA 5DS8B 4H9TA 4PZVA 1PG7X 1FIGH 1LP9B 2QZ5A 1SHMA 1H60A 1JF1B 1XCWA 4K3JL 1PLGL 4LEXH 1N0XL 3IVKB 4JTLA 1YYLH 2OFQA 4FYQA 3FS9A 1H49A 2ZZ3A 5B3JF 4KTDH 1AQHA 4X0KA 5IMMA 2PPEA 5GRJH 1Q8MA 3IETB 4WDUA 5DJ8A 4UZSA 3WJJC 1CR9L 1BOGB 4KRMB 3ABLB 4HX1B 4O2CA 4S2BA 4U5IA 2UBPC 4CBZA 1KTJA 3ZDXB 3PY2A 1W72B 2APBA 4X9GA 2QHRL 3KCWA 1S7WA 4K55A 1YADA 5LUMA 2QV2A 4B3EA 1EPVA 3HRZB 3W7MA 2AJSH 1CGTA 2ZOUA 4DN3H 2RD0A 4FYRA 5H6HA 4S1SH 5TTRA 4AW7A 1G4EA 2NQJA 4IS6B 3GIYA 1G7LB 1NDMA 4QY8A 5TQLA 4XC1L 3NBNA 1O66A 4XAYA 1I85A 3MUGB 1FDJA 1U5VA 3AXXA 1F6FB 3QJFB 2RGSA 2CLKA 2HBXA 4LRIA 4H00A 2ZSVB 1QSEB 2V33A 5FYLL 1E5NA 4KITB 1XR9A 4K94H 4FTVE 4EDXB 1AGCA 3FN0L 2X89D 1H7PA 3K4DA 4K39A 3C5XA 4IM8A 3QA3B 1PZ5B 4GRLD 5BS0E 4I0PB 1HCFX 1RZKL 5E0FA 2ADYA 4URTB 3RVVD 1TPXB 3R0MA 1LEKA 2OGYA 2WHJA 3JVFC 2IKHA 2AJZB 4F3HA 4V2BA 5CCKL 1ZLEA 4Y8DC 4U6XB 3EKZA 1XC6A 1JPSH 1T4KA 2FBRA 2K4WA 4LSUH 1IC5H 4XPFL 2NRDA 1L9NA 4OZFG 2V67A 3K72B 2F54D 1NF0A 2PF0A 3MYJA 4WSKA 5AW4B 3HS0C 5DSCA 4D3CL 4Z7NF 4YZFF 2WMPA 4JN1L 3MWCA 2J7CA 3A47A 1IC4H 1XR9B 4EDXA 1J93A 1TZOA 3CBRA 3QORD 1RZGA 1PLAA 2CO3A 2PO6B 1ONEA 2ZDSA 1PHWA 4Y7EA 3UWZA 1B4TA 2OL3B 3PU7A 4APQC 1AD4A 2BG5A 4OLWH 5CG7A 2PBOA 2DQJL 3P2VA 3UPRA 1V0LA 3W1NA 4CSSA 2CJTA 3M0YA 3OPZL 4NC0B 3LOTA 3VNMA 5D7LB 3TA3C 5L7XL 5A8OA 5D32A 3RGVD 2HISA 4UQ2B 4LLUB 4I8DA 2IQDA 2RH0A 3NQBA 1AL7A 2NXHA 3RNDA 4FXGB 1D8CA 4JGMA 4P5KB 4YHKH 4ZZFA 1W1IE 2E40A 1Z9LA 3JV6B 3PREA 5FW7A 4PRPB 3ULAB 4XISA 5EORH 4U49A 5ABAA 3JZ7A 4YIWA 2X70A 3IPBA 4MAYC 5MI0C 5F3BA 2C1IA 5EBWB 3GU1A 4HU2A 5GS0D 4R3SB 4YMZA 3FQTA 3P4OB 4KJWD 5DUPL 5CEYA 3TU9A 1NGWA 2J21A 4Y5YA 4EOWL 2GHZA 1MUCA 1MZHA 3INPA 4PJFB 3HJEA 5DJZB 3QDJA 4WU7A 2YPKA 1QAPA 4I1NB 1YLVA 2PR4H 4Z2KA 3WSUA 5IF0B 3VG0L 5HDBF 3HVNA 3RWEA 4P2AA 1LG2A 4LVNC 5JU6A 3UZYA 1REIA 5I3KA 1QBAA 1JE6A 5SX5K 3BAEH 2ZZUT 2Q7YA 1RK7A 2VXUH 4TVPL 3STLB 3UTTB 1EJWC 1RIUL 4DH2A 4KRPB 1I9CB 1GTEA 3GAKA 1NFDE 5IOBA 1JZIA 1NCBH 1EGJA 3ISIX 5BJTA 3OVQA 1F8MA 1TE6A 3OKMB 2MKWA 1VA9A 2EH8H 1X7IA 1TREA 3IJLA 1MCNA 4JQIA 1LL7A 3KS6A 2W80C 1W8OA 3GNMH 3W7OA 2NDGA 4OI9A 5EN2A 5D7JA 5E70A 3CMOH 1BM3H 3CQQA 3GZQA 3QWOB 3HRZC 1NLDH 3AXMA 1RK1B 2OLDA 4GO9A 4KJQC 1ZGLM 3CNYA 3OU8A 1WV7T 1ZIBA 5JHBA 2AVFA 2XIQA 2HCVA 3DX5A 1F4WH 3TT1H 3V0DA 8PAZA 1NWRA 4IP7A 3C5JA 4KJWC 5T3XE 4NKMB 4YYFA 4FMVA 2Q8XA 2C4FU 3HAEB 4DN1A 2OTUB 4A1RA 1ET7A 8CGTA 4PUEA 5EMLA 1UT1A 4JM2C 1ZK9A 3HZYA 3V8CA 1R9ZA 2V5MA 3VU2A 3QQWA 4DRSA 1FORL 1WFNA 4TQPA 2H9AB 1CE6B 2SODB 3FOMA 3MV9D 4LUJA 3RCMA 5HI5D 3NCEB 2J8TA 1SFHA 2XN0A 1YNKH 5TDOA 2G50A 2J5LC 4OAWB 3CHSA 1KM5A 4MCYB 1BYDA 1GL4B 5CEZE 3NQ6A 3WKQA 4P2RB 3BP5B 3OKMA 5ENWA 4IMLA 4APQD 4MDJB 1G7QA 2CJUL 1HE8A 2WLNA 3CVHH 3EYUL 3NEOA 4WHYH 1GG0A 2DKMA 1F11B 4YSUA 5L2KA 4PYSA 1T1XA 4J3OH 4UTLA 1U30A 5L0QB 3SKUD 1HH6B 3PTMA 4NHUA 2G41A 1EGJH 4L8SA 2GVJA 2IAND 2ZG1A 4K8RD 1NCUA 3PZGA 1A4AA 2W0FA 3NWRA 1KRCC 3B0UX 3HC4L 2J9XA 3U6RB 5IT2H 2GQAA 4EIGB 4JX5A 1RLWA 4PS4L 2IEPA 1Q6RA 3S5NA 3GMQA 3QJRB 3ARDC 3U36B 1JNLL 1T2QH 1RSCA 1S5HA 2NCEA 2O72A 3K2UH 1R0AL 1WJ3A 3KL0A 3LSOA 1T96A 3EJZC 3GIVA 3QO1A 3QW3A 1Q6OA 1UQZA 1T4WA 5J11B 4LU0A 1DVYA 3RVVC 4RE0A 5CM1A 1Z42A 2HE5A 1P1MA 3SM0A 1SXAA 3GIZH 4H2CA 2ROXA 3KPRA 2GJ6A 3ZE1B 5JMRA 1B57A 1FWGC 5FFOA 1MUMA 4JXCA 3ARBA 1QPKA 4JHZA 4FXKA 3V6FA 5L4FA 3C8KB 4WW2B 3CB3A 2RA1A 1A7PH 1YMMD 2NYYD 2ZAHA 2R27A 4L8SB 5E6ZA 4CAGA 2W9MA 1SPDA 4P4KA 1KPUB 1CUOA 4JFFB 1YBQB 5C0FB 3VGEA 2X4NB 2ADJB 3T8VA 4DK3A 2LU5A 3NFPA 4ZB0A 2HXUA 1CIDA 3GXNA 5E6IB 5JPMA 4YE0A 2H3BA 2O1AA 5JIQA 4NAEA 5FA4A 1BVOA 1I3RB 2P9RA 3DHMA 4UTCA 1M04A 1JV5B 3V0SA 2C3XA 3TW6A 2VR6A 4M5TA 5F6HI 2A6LA 4W87A 2PYEB 3GSOB 3NDYA 1DSFL 1WLHA 4XPAL 4ORMA 2XSKA 2Z7YA 1E3XA 3CVHL 3PPGA 2WVVB 3Q6FB 4WFEE 4WI7A 4AUUA 1HVQA 1LOLA 1BFOB 2BVTA 3AITA 4FG2A 4GLRI 4ZSOA 3S36X 4CSZA 1KV3A 2C7UB 2QAPA 3IFOB 2WMKA 2Z0BA 1TETL 3VI2A 2VAAB 1GKQA 1KKRA 2P53A 3DUUB 2CU9A 1QFWL 2AQRA 2FWOB 4FQLL 5JOEA 4R7DA 3QQ3B 3HC3H 3ARGB 5H37A 4PIRF 4Z1PA 5IEKA 2FGLA 4GBDA 3B0VC 2WV8A 4LRIC 3FQYA 4RAUA 1KBGL 1S8DA 3GT6A 4GAJH 4BZ2A 3F4NA 3SN0A 4Z7VA 3BL3A 4UR9A 1QW8A 3WKYA 3FHAA 3QNXA 3WQOA 2OX5A 2WWMC 3IFLH 4MNQD 5TQ2L 4B50A 3Q8CA 2VDRB 3LH2H 3E0LA 3S0CA 1EK3A 3LH2L 2YAFA 1W32A 2YN5A 3EYSH 3ZJAA 2GDVA 3DX1A 5LDUA 1OVDA 4FL4B 1KDJA 4EUPA 1TLKA 5JW4N 2A3LA 2WSYA 4B60A 1HZHL 4OLEA 4YHOH 3QI9A 5FOBA 2E1WA 3VH8A 1T0PB 5FV1L 1FY6A 3L0GA 3GJEB 2BSDA 4TL4A 4Z0JA 3EGXB 3WFCH 1UMLA 2R94A 5HYQA 1NGYB 4IK6A 4UZUA 4HCDA 4DGIH 2D73A 3QV6A 4QE1A 4RV8A 2GBVA 2PO6C 1SJAA 3CDFA 2MANA 4LLDA 3RZCD 3RLSA 1YZZA 4FP8L 4M5YL 2QAFA 4UI2A 4G7YL 3GJFB 5IEKB 3UEZA 3ZGHA 3US9A 3UZZA 2CRMA 1AUSL 4P8QA 4OVXA 4FQXA 4ERSL 1LDPH 2B0SL 3G04A 2ENPA 35C8H 4C4BA 2MOQA 3WQCA 3LTSA 1N7MH 1R6VA 3UROR 1Y07A 2PU1A 2PWUA 2VM3A 3U46A 2FO8A 5LXGH 5EHFA 1JWSA 1LRNA 1VLWA 1XUZA 1A7PL 5FYJD 4G6KH 3IFPA 4UFIA 3ALGA 2WVSA 3H2FA 1ZSDA 4M24A 3SDXE 4E2VA 4F33A 2ZWNA 4YMPA 3RIFF 3TT3H 4EF9A 1NC4B 2DJMA 2CKBL 3Q2VA 1W8SA 5ABTA 1NTDA 2DIEA 4X80H 3VTMA 3J8F7 1NFIA 1VERA 4QYAA 1L0XA 3WKML 1KRMA 1WAAE 2W3ZA 1E9QA 4TQEH 5FJIA 2APSA 3AT0A 1UZ4A 2V17L 3O11A 4NKOA 2XETA 2HSAA 5KYYA 4M7LL 4MQSB 1XBXA 3UJSA 2AABL 1AP2A 4CJ1A 5EOTA 2DIKA 1HIMH 4XUGA 4KFOA 4DJDA 1CL7I 2Q9OA 1T8XA 4L8CA 4BQ4A 1BD2B 3HHMA 3F03K 2OXGB 4W9IC 3KPMA 1L6PA 3S42A 1LE9A 1NFPA 3MA7B 1M1XA 3IIOA 3MYPA 4O2EB 3ME0B 4JKPH 3TBCA 3S9DB 1OAKH 2OJ1A 4LESA 2DZVA 2X0YA 1FSKC 2FX7H 5HR7A 5IVXB 1AS6A 4WAFA 3MLXH 3QB7C 3QZOA 2DEWX 4XVTL 1A7QL 3WJYA 2NY7H 2DQDH 3TN0A 4H7VA 2WWNA 1VENA 4DNLA 2HRWA 2Q2LA 2HJFA 2AERT 1PDKB 1Q66A 3KBWA 3JUYA 4OTXH 2J8FA 2P52A 1EAPB 3AG1B 1UJ3C 3CQIA 2J4WH 3PJUA 2DQUH 5L88L 2Z24A 1LM8V 3CN2A 3DFQA 4I7ZC 3ZTNH 4MZIA 4WV1B 2R2BA 4L4VA 5AKRA 3B7UX 2WUBH 3KYNA 3UCDA 4IU2B 1WCGA 2WUBL 4PRNB 2XHYA 5BW7C 1QNQA 3LKSA 4ADGA 5FJTA 1S2EA 2WP3O 4TQEL 2XFWA 1H0GA 5T5FH 5LBSA 4L1BA 2WSRA 4M6OL 1AZVA 3VA8A 4A29A 1QBLH 1Y8BA 4WSJA 3STCA 3W28A 1JFHA 3HB3B 3VGDA 3FU0A 4RWYH 3KCPB 1JZ5A 3PHQB 1GVRA 5CEXA 1EHLL 4JN2B 3IJHA 4Z1CA 4P07A 3MDWA 5HDOA 4JNZA 4Z6AT 2G8ZA 4XTRC 2W63A 1ECQA 4X60A 2P5EA 3CV5A 4F9PA 3D08A 2E5BA 2WINA 1NKGA 2BIPA 2HVKB 3LS4L 3NCYS 4WFFE 1KYUA 2BHFA 2J71A 5EWIL 5LGJA 2XUCA 1DZ0A 3R12A 4Y16B 1HJBC 1MI5D 1NFAA 3W7EA 4CN1A 4B5TA 2XZAH 3S3JA 2DP3A 3BYTA 1XH0A 3O4LB 2BFGA 2ICES 1WIUA 3A4EA 2YBRB 4ZDHB 4HV8A 5H35A 5DUPH 2OJEA 3RU8X 2E6PA 4ZI8A 4ENZA 3U57A 5HPMA 1AHKA 4X98A 5C9WA 4IMCA 1J9SA 4PGLA 4HN4A 3V4VH 1A5KC 3SRKA 3ZZ1A 3II1A 2EDOA 5GZOA 4AIOA 2P5WD 3CDGB 2A3CA 4HJFA 4O10A 1DJWA 1QFHA 2G3NA 4QYOB 2XQYK 2YJLA 3FBQA 1UA3A 3TH3T 1HI6A 3SDAA 3VD9A 1TWIA 2IPKA 3F58L 4HXBL 4KK9D 5DC4B 3MZTA 1CURA 3PWAA 4AW4A 2VUYA 1P5VA 4NZ5A 1QNRA 4OKVA 4HKZA 4HKBB 2EHHA 1OGTB 2LVCA 2X4QB 2FNBA 2AJXL 2YD4A 3QQNA 2IG2H 5AOIA 5HVGB 1DFBL 4P4KD 3QULA 3S5YA 3G6JF 3FB7B 1YHTA 3UPWA 4X4XB 4MPKA 1T7VA 5C0IB 2BWIA 1AS8A 4G8IB 4R7XA 5C08A 3LHUA 3QC0A 1AO7B 1H5BA 1KGUA 1CICC 1IBFA 1Z9MA 4GIPD 4L48A 4JS7A 3P4NA 4Q6YA 4ZO9A 2XIOA 5FL0A 5LIUX 4JVPA 2VC2H 2YC1A 3WBYA 3PDOA 3O8AA 1NOWA 3VRJB 3DX0A 3O6FA 4XWOC 1CU4L 2XHNA 1A9BB 1FH8A 5I1IH 4W4OA 3RR4A 4DW2H 1HQ4A 3WS3A 3NDZA 1VD6A 1TTPA 1N82A 4WUIA 2BC4A 4K6AA 3I2CH 4E9QA 1KR0A 3JSSA 4QRRD 2IGFL 4PN2A 4LYQA 2C9XA 3S3DB 4TS6A 5AAWC 1TCMA 4XCEA 1IBZA 4R85A 1J8SA 5TH2A 2YBGA 3M43A 4HMEA 3IXTB 1ZRUA 2QDHA 1VPOH 1AVAA 2DQEL 3F6IA 2WHKA 4RLDA 4HJWA 4AWUA 1DLHA 2KLRA 3QGVA 4HHMA 4HPXA 1KZQA 4DYEA 1AIZA 4UIMB 1YEKH 5D4IA 3WE6B 2DPKA 3FTXA 4K8HA 1X4YA 5DUBA 1I1AC 2XKNB 5C09D 2QSVA 5I1JL 2CLLA 3NCMA 3OPZH 4ZW7A 3Q1SL 3ZK0A 1RPUA 4CNIB 4LSTL 1OCWH 5CNHA 2QVMA 5HHPB 1PCWA 4YNGA 2HKFH 3MV7D 5I19L 2UV3A 1SXNA 3P30H 4AG4L 2QCMA 4Z3JA 2OWXA 2Y23A 1JRBA 3R11A 1CD9B 1J0IA 2BOCB 2KERA 4OF0A 3GLCA 2BOLA 4LEOA 5D4QA 4IQLA 1DBKH 2XU2A 4DFIA 3GVRA 3CSGA 1EQPA 3JWOH 4O52A 2JK5B 2E6DA 3W7KA 2MOVA 3OZ9H 3SO3C 5K2ZA 3WU1A 3CSPA 3UZEA 2PODA 1EPFA 2QDDA 1HWWA 3LKRB 4P23C 4YK4B 5AVRB 2ZCHH 4LT9A 4DZAA 5I82A 1BRLB 1UATA 4UTBH 5HI3D 1TJRA 2GK1B 1XF4B 1V51A 1YY8B 3GSVA 5IVOA 5ABGA 3VFOB 2VKWA 5HJGA 3M0KA 2PYFA 2YJQA 1T6VN 1JZGA 4LDCA 5C3TA 1D9KC 2H41A 3GQYA 3ULVL 3AXIA 4OV9A 2WXKA 3H8NA 2EH7H 1U3ZA 1IQDB 4Z7UA 2HG5B 1LF1A 2CSPA 5CIPA 2OK0H 4I5UA 3TWBA 4KHXH 1N8IA 3GLDA 4U0RC 3QUZA 5I8EA 1LQ2A 3IU3A 3PP7A 2VSDA 5LCVH 4BH7A 1CFQA 3TBTB 2BY2A 4XIAA 2WTPA 1J5OL 4LCRA 4CL7A 5JIMA 3M0LA 4K8RC 1CTMA 4KY1H 2EUXA 4XPHL 3DX7A 4WFFD 2NXGA 4AWSA 2VWTA 1AHWB 1CT8B 4RH4A 1NWTA 1C5BL 1JPGB 4OQTA 1H7RA 5DEFB 1PD1A 3BUYA 4CDHA 4I7WA 3C60B 5A8MA 1OV8A 3AWFA 2EILB 2BBFA 4ZTXA 2NXZC 2EAWA 2RJMA 2DZSA 2QYGA 1KCBA 4P9MH 1TZIA 4DXVA 1NEZG 3GH4A 4Q4IA 3C6LC 2NSXA 4X6FA 4F7MB 5JBFA 1A9EB 1KJMA 4HUXA 4UYQA 3IDMA 4XP9L 2FHCA 2Y22A 5IESH 3OLIA 1S9YB 2CM5A 4WO4A 4BGDA 3Q65A 1W9PA 2DL2A 4PS7A 5E5LA 1CFQB 2DM4A 2HFFA 2ZXWB 3TBTA 4X7DC 1K72A 1K03A 5D8JL 3UWYA 4NNXB 2WBKA 5HGBB 2DEYX 3T0AA 3OAYH 1QRNE 1TKWA 2HG5A 4U1GC 2F15A 4UTBL 1OHZA 5HGHA 3MRBB 3LZPA 3ZIYA 3N73A 4L9XA 2E9JA 2ZOOA 3DDGA 1OAQH 1FGVL 3S9ZA 2ZC8A 2IPWA 1FG2A 2H9GA 3IACA 2BDNH 3GM8A 3HTWA 4XZUA 5JOFA 1ODAA 4KJQD 1E9PB 2AL2A 3VUAA 4XBJA 4KHTH 3S1VA 4DBDA 3WY2A 3VXMB 3QEQB 1A9EA 1EMTH 1KJMB 2WLKA 4PS4H 4KGJA 3CASA 3QXDA 3HB3C 4MVBD 2FZNA 3EG9A 1F4XL 1FP5A 4GQBA 4WHCA 5IOPA 3WJMB 4N5ED 4ODXA 2VL4A 1TTIA 2XVGA 2W65A 1JGIA 3EYOB 1A0QH 3DO7A 4M8VA 3R7QA 2ED9A 4R27A 4UFMA 3HNTH 1E5YA 3Q58A 3GIZL 1UCWA 5SX4H 5D72L 3B8TA 5PTDA 5D70H 4FI7A 4LKCB 1KM3A 4ANUA 3FTUA 4UMCA 4H8PA 1VCGA 1CVRA 3BLKA 2COVD 1GJUA 3DPDA 4NNXA 3WDIA 5HGBA 4U5KA 1PUDA 5CU9A 5HGHB 5CJMA 4L05A 3B8VA 3KOYA 1JGLH 4YSPA 5DZPA 2ZXBA 5KJRL 2A0NA 3LCLA 4HIIB 4N90D 4YL4A 1EZVY 3IETA 2VTFA 1GZ1A 4I48A 1XQ4A 3PZUA 2GFTA 3NABL 2XZQH 4QRPA 5DRWB 2F1EA 3LVEA 1LXMA 4IEFA 2ZOLA 2J6EL 3WN5B 4F2EA 1S7QA 2WZIA 2P26A 1BJ1H 5T3ZH 4MJ5A 4PS3A 4DHLA 4K9EL 3ZDWA 3ZSSA 3GMNA 4NGHH 3EJCA 5HDBE 3SE8H 1MEHA 3AXKA 5DLCA 1BXXA 4XPHH 4S39A 1UW9A 5D05A 1I45A 4I89A 5AHFA 5IVZB 3SCVA 3HZMA 2APWA 1A4CA 1JHTA 4RDBA 5D2NB 3VMNA 5KTEH 4S38A 4S3EA 1LUCB 2O6CA 5JHLL 2DZWA 4EX4A 1EHNA 4KX7A 5LHDA 2J5WA 4FNPA 3LIZL 1PL9A 3CJPA 5BU6A 3SGKA 4Y1AE 1AZZC 3WGVB 4CEUC 4LPUA 3QM3A 3WK3A 3RMJA 3INUL 4ML9A 3QORC 4J2PA 4OQTL 3IGLA 5LNUA 5DRWA 3U4BH 1X7QA 3IRPX 4E9RA 3B4NA 3LEVH 1A3QA 2YCIX 3Q2LA 1W72L 1LEGA 1KTRL 1YPZF 1IXNA 1HKWA 4F9LA 3MLVH 2IQTA 3U82B 3ANYA 1YXYA 4IFKA 3WLQA 2DQMA 1PZSA 4L3CB 4P5MA 4NLHA 3MJ9L 1H3TA 4DP6X 2MQCA 3HRPA 5ILTH 1I2OA 1TR1A 4LX4A 4PUUA 5DK2B 1GSMA 3F00A 3RWIA 1KCUL 1SUJA 4MWAC 3TYUA 3W83A 4DZ5A 1IHIA 3H8AA 5A7EA 2WKGA 1S7QB 3CZLA 1GHFH 1OGAE 4NS0A 1GHFL 1HNFA 4J3TA 1NMBH 3DVNB 3VXSA 2O61B 1TF4A 1K8CA 2O6EA 2UY2A 3AWOA 4GRLC 3UG4A 4LVOC 1AFVL 4ZMYA 2C9SA 2VMEA 1PMYA 5B3NA 5EIIA 3W5NA 1KBIA 1TJ2A 4G8FB 3E0VA 4YDLB 3WH5A 2Z31B 1CXEA 3WFEL 4ISVB 5D2NA 5LJYH 2WKLA 3QYMA 1MNUL 2OYPA 3WIFA 3N2BA 1IM9D 3OYXA 4IMKC 3DK0A 2EPKX 4X7SL 2BNUB 4HF5H 1NGZA 4X7SH 4XNAA 3B8IA 5DA4A 5FUOH 3THQA 2IGTA 2X88A 3PZNA 5D5MA 1CDBA 2BIIA 5FKAA 1NPNA 2Q2EB 3HG1A 2HLAA 5IB4B 3F7YA 1EP3A 5CBEA 4AAJA 1NCAL 3QHFL 2C9PA 4L1XA 5HPCA 1B88A 4YBQC 2X3AA 2ZXQA 3K0WA 4FN0A 1AZRA 2AXJA 4V33A 4G1EA 4QTFA 1CFMA 3DIVA 3JW7A 4Z42C 5EEXA 2R29L 2W9EL 1ZLVH 3QN3A 5REQA 5AAMC 4FSAA 4K2SA 3STEA 4QOKD 2GSGB 2NUPB 3KAOA 1X4XA 2EVIA 4P23B 4YK4C 5GGRY 4WNSA 3VFNA 3ALFA 5J3HD 3CSBA 3EFOA 4M7ZB 5BRZA 3GZPA 1ITXA 2ICEB 3BZEA 1MAML 1NDVA 1SYTA 1R3QA 1UZDA 1SYVA 3CD4A 2J7EA 3HB9A 4JBRA 3KBEA 3GQFA 4A8LA 4ATTA 2AOSA 3HUJF 4WEUD 3US1A 1KCVL 1DQQB 4GGHA 1GOXA 3NGFA 3FCSB 1AJ7H 2IAMC 4K71C 3HPSA 1XG4A 2QSCL 1M56B 4XCNB 4XXCC 4E41A 3C8DA 3QR1A 4ZGYA 1RLBA 2FQEA 4K7FA 4QXGH 2NTFA 2XTJC 3WMSA 3H2WA 1I3GL 3QUZC 2IG2L 1HN1A 1WC7A 5MERA 2RDUA 1KLUB 3U2ZA 1E50A 2RQ8A 3DOPA 4DVOA 3U4AA 4DP4X 1EFZA 1QRNA 5D6CB 3W0WB 2WIMA 4ZXBB 3FKRA 4QAIA 1G0YR 1RK1A 2NY4B 4GAFB 4H8QA 1CG9B 3WJJA 2IVFC 2YMTA 2VLJD 1AHMA 1Q9KA 4B2DD 4NRXA 2ATKB 1W72H 2E09A 4DZ8B 2RFXB 3DBXA 3O2DH 3GSNB 3BP6B 3FYPA 1WISA 3O05A 1LO0L 2V9DA 2W6RA 1HKVA 2NZIA 1ITBB 4N4PA 1R3SA 4AKQA 2BO0A 3V5CA 1J9QA 1E27A 2UZXB 4NBZB 3EXLA 5FA5A 3NYZA 1EQCA 2GIYA 4XBPA 3UMTA 3CFCL 5BRZE 4KIEA 3G08B 3TQ0A 4FNRA 3WJLA 3B2VL 5IBTL 2DLFH 4PCKA 1QT1A 2IDTA 1CFSA 2AXWA 5HI4D 4PW9A 1KCXA 1BJ1J 2PXYA 3DEQA 4GOAA 1ZTMA 5F96L 5TDOB 1OK8A 4GSDH 4LU5H 4Z18A 1C1EL 3EX2A 3RZCB 1KCRH 4DO6A 4BJHA 1KV7A 5ABFB 4X6DA 4ZD3L 3BVVA 3LNMA 2R1WA 5DD1H 2X10A 2DZXA 5JNYB 4F37K 3MLWL 4FXRA 3G6AB 1RZKH 5DY2A 4ZMWA 4S10A 5FYLD 4IFOA 5T3XD 5B7FA 1KFJA 3T78A 5C0CD 5G5IA 2QPDB 3WMLA 2F9BT 1ICQA 3BWSA 1R17A 3COOA 3R43A 3QNZA 2ZUWA 1ITQA 3BPOB 1UB6B 4XD6A 4LOEA 5I1LB 4DQWA 2DY2A 1EJSC 3C60D 3AU1B 1CCWB 1QFWM 5H4YA 4Q3MA 1B4JL 2WMGA 3O2DA 1V6WA 4IPLA 2R9HC 1I7ZB 3GJFA 3H9YA 1N4XL 4UMBA 3RFAA 5EMUA 1FWDC 1WUFA 1ZNNA 4F8LA 1AK5A 3OAUL 1A4BA 1LMIA 3QH3B 4FQ1H 4F8XA 2Y5SA 4XVDA 5D2YA 4WW2A 5FYJL 2HMCA 3SGEH 4GW5A 1UPMB 4GYKA 2VDQL 3AU0A 1S9VB 1A7NL 1WTLA 5EO9A 3RWGA 3W1ZA 1P7HL 1A7NH 5DX7A 3SCMB 1EDYA 4MWAA 2O7QA 3DTXB 5IKCB 4OF8A 4NJHA 1MG3C 3X3FH 4M43L 4ZW8A 4AVIA 3QMSA 4U33A 15C8L 1CK0H 5MENA 2VC9A 5LA1A 2OB3A 5LN4A 2CPCA 3SDDA 2XBZA 2QVIA 1MFEH 4EP8C 2VDNH 1QTWA 2Y6ZA 4GX9A 3S35H 4F58H 5IWLA 1TJMA 4QR6A 4WHTB 2VDPB 5DQ9A 4WGXA 3FTVA 1D5RA 5F4XA 3PV6B 4JM2F 4MAUL 2VAAA 2VC2B 2IH1A 3EJUA 1YEDA 1A6UL 3M46A 3R0NA 4TVDA 2YS4A 3OZOA 1MCKA 3NQAA 1LILA 5FW6A 4UV4L 3QQ3A 3S2CA 1GY1A 3SOBL 1DTNA 5I5MA 2PDMA 4G56A 5G2HA 3GSNL 1Q6CA 1DJIA 3RBGA 3N4AA 3CHCA 2QHRH 4I5BB 4MRCA 1XIMA 2YRZA 3RWFB 4BUHA 1FLTX 2CWNA 3R79A 4C90A 4Y1AB 3CLFH 1R7AA 1RUQH 3AY4C 1EGJL 1MY7A 3QJHA 1UH4A 2KS0A 2AITA 4KJYB 3CHEA 3EOOA 1L9OA 4WENB 2Y7SA 5GNXA 4HP5A 1HFUA 3GJEA 4HWBH 3BUIA 2YD0A 3K2MC 3ARGC 1C1EH 2VJ0A 4JQIL 5IHUH 3QVAA 4YSDA 1K7XA 3AMGA 4GIEA 3CFKB 1BBJB 3AIUA 3N2MA 2NOYA 2LU4A 4JZJC 4QHRA 1KYOK 2CBJA 4J3WA 2VWEE 1S39A 2YPVL 3EWCA 1PKYA 2JFEX 4FAAB 1OCWL 1PW3A 5C0DA 1FC2D 1I1FB 1M7UA 2DOCA 4L4VD 1G1CA 4AG4H 5EFDA 3VFUA 1SXSA 1OCJA 2ZWKA 4TLSA 2XVPA 3S4TA 1N64H 3C9NB 4XAWH 1HILA 3W81A 1NEPA 3WD5H 4FNTA 4LVHB 4LHUB 4RVBA 5HHQA 3HE6C 3H70A 4Y0GA 3S35L 4F58L 2YYUA 4FOKA 4IJTA 3HZVA 3EH5B 1JOIA 3KW3A 3RAOA 5FOOA 2XJKA 1DBTA 4RMVA 4QBXA 1GW1A 1XGEA 3BDBA 4UWMA 1GMEA 3JXAA 2C0AA 2V7HB 4FZIA 5A2AA 3OAUH 4UANA 3STZA 3MSDA 3ABKB 5DWUH 1NMAL 3BQUC 5E94A 2YSSA 3CC1A 3NXFA 2Y2YA 2NWRA 2POTA 3QEGL 3PFMA 2VB5A 3TU6A 4P7LA 2N0MA 2VDQH 3FTGA 1U8PB 4FFYH 1WDRA 3HIJA 1FDLL 3O3EA 2MPAH 5JXEA 1CBGA 4TSCL 4YLCA 3CV7A 3APTA 1I9IL 3VFMB 4YVPA 4JDVA 3NSJA 2OK0L 2DLEA 3H0TA 1BX2A 2JB5H 3FH8A 3ABSA 3HGOA 4QRRE 2D3JA 3LIUA 2XH7A 2WXNA 2G3IA 2IDCA 4MG4A 4PD4J 4AB4A 1SFDA 3C09B 3M7FB 4BZ1L 1C92A 1G9NH 3LXUX 5B21A 2IDFA 1U22A 5E9XA 4QTIH 5D2NE 4O2EA 4QI3A 4FERA 1JNEA 1QSZA 4NKMA 3ZRFC 3W73A 3LMJH 1IXOA 3E12A 3U7BA 4JO4L 3QR3A 2R0WH 4F8PA 2NV2A 2FSDA 2XZZA 3ZQXA 1IE7C 3ME0A 3CFQA 4FNUA 3RG1C 1AH3A 5HI3C 1FA4A 5DU7A 1MI5B 4MKSA 1ADSA 3TV3H 4LGSB 5F4SA 3ETBJ 2CW6A 1I7RA 2J73A 3ARSA 3HUJA 3MUJA 5E8PA 1P7TA 4Y90A 3P2DA 1OWWA 3RU6A 1FHLA 5JW3H 1LRQA 3H0TB 4BFOA 1FI8C 4OM0H 3K7UA 4FC3E 1E4LA 5IW1B 3S0PA 3UTOA 1XL9A 3KLSA 1R86A 3SBPA 4K0OA 3OHMB 2D2GA 2VM4A 4OV5B 1E8ZA 3HFML 2ZZ4A 2JVUA 1NC2B 2GK0B 5B7ZA 3OW1A 2Z2AA 3VTRA 1MCOH 4ODUA 4PGCB 5SWZB 1IAOA 4IRZL 4N25A 5GGRA 5B3JE 2J1WA 1UM4H 5BZDB 1Y0EA 5DURB 2EDLA 1HKKA 1W56A 2V5LA 2DKUA 4HDIB 3BOLA 5I74B 2DQXA 3V4LA 4HT1L 4MA3A 4AYEC 4OTKA 2YCEA 5HD8D 1IIGA 1U3HC 1WYIA 2JJUA 5I15L 4GZEA 4KI5D 1NGPH 2YA2A 3W7PA 3NEVA 3MBFA 2GVYA 5IJKC 4AY8A 2OODA 1VFLA 1RJZB 3HI5H 1KJ2L 1F5ZA 1W2VA 4LAMA 4US5D 1CLZL 4K3DL 4ODVL 3OHXC 2EE6A 3P2BA 4K3DH 1W5MA 2I14A 3B2XA 3QEHA 1IFHH 1GGOA 3QUML 5C6MA 5EOQL 4JPKH 4UAOB 4CGTA 4J1UB 3NA9H 4WW1B 3K4AA 1UROA 1VBRA 2Y6TE 2VLKA 2UX7A 2V8LA 3T65B 3T8LA 5DGRA 4KKAD 3T3MF 3ULSA 5BS0A 4XWOD 4AD3A 4AZ5A 4PRAB 5GISL 3GJFH 1I1AA 3F83A 4YVNA 4F7CA 4RWHA 3IV3A 2VO8A 4JUSA 4ZDHA 4C4UA 3KYOA 4EAEA 3CUPA 1T03L 3MWAA 3H9HA 1CICD 4U3HA 1TMLA 2WWOA 2HMIC 2WNWA 3WIJA 3IUHA 3LENA 5GVJA 4PJIB 4E9YA 2J79A 3TL5A 4KQ3H 1GPFA 3NDZE 4B16A 3NRPA 2HT3D 3IGHX 1ZFJA 1KIRA 3WHXB 4PJAA 4MMZB 4LAQH 2NY3D 4RDQF 2YEQA 3MKKA 3H7BA 1KM6A 4CCEA 2DQDL 1C3FA 4QMEA 5I76A 3VIFA 2J8UF 2YLKA 3ARGA 3KBFA 4R4FH 1C8YA 4DQOH 2B1HH 4OGAD 3UH8A 2F8IA 1MEIA 3URBA 2YOAA 4RBPK 4LCYB 1HP4A 4Q4RA 4J4PD 2XGBA 1MCLA 1RXLA 5LXGL 3LCXA 2OX5B 4LZKA 1JRHI 1SO3A 2HPOA 3REVA 3HV9A 3NZ1A 7PCYA 1HSAA 1LK3H 2MQ0A 3M17A 1OM3H 4U1NB 3WL9B 1RLCL 1F58H 3HHRB 3N2TA 3CEUA 3U5UA 2QGDA 5E8EA 2AK4B 3SD2A 1W9BM 4ROQA 3QG6A 3UFIA 4JGDA 2D0FA 3R8BB 2EIEA 3FN9A 5EOCH 3IVUA 4U6HB 1IBDA 1IIKA 3KYOB 2CJ3A 3M8OL 5AG9A 4JG1H 4O57A 5J5RA 5DEGB 4NSBA 1EUTA 1U8HB 2E74C 2WNKA 4P9HL 1D5BB 3BHBB 5CMAB 5DJ6A 3L23A 3UBXI 3EO9H 4PCNA 4OM1L 1I8IA 4CC1A 3T1WA 5BMFL 4B9JA 1YAZA 3DJZA 5K69A 2JIWA 3DUSA 3VXRD 4IDLA 2D22A 4LGPB 5KYUB 5JHMA 4XC1H 4HK0A 1GS8A 3BUDA 3RL2A 4ALAL 5C3LD 2OQHA 3CZ8A 1FYTE 1OSPL 2BP0A 2W38A 2V69A 3DU0A 3SUUA 3ES8A 4YDKL 5CJBA 3VXTB 4YSQA 1MCWW 4TQIA 1UR2A 2IS7A 2Y1AA 3QXAA 4UIKL 3DX2A 4N85A 5BV7L 3B2DC 4Q9RH 1FCVA 3IV8A 3BV7A 1D5XB 4R0LA 5DMJB 3KBPA 3L3IB 1EDGA 4FFZH 3ZKND 4Z7UE 2XA3A 3WNNA 3JT2A 3BUPA 3QZEA 5FHBH 4FZEL 4JFOA 3SE4A 4J8RB 3U2CA 4ZBJA 1N8ZB 1BDYA 4TV6A 4TR9A 1EHKB 4YE4L 1U8NB 3L54A 4WKZB 3MLZL 3TNNA 3E2HB 1NFIB 3BHBA 5CMAA 5I75C 1O5KA 2PCEA 2FRGP 3OG3A 3Q43A 4XBGB 4OF5A 5ESQB 4Y9MA 1F1GA 4G9DA 1S9XB 1OE2A 3HG2A 1UR3M 1F6LL 2PDJA 1HSBA 1WX0A 1BWVA 2EC8A 3VI4B 4AD0A 3T0TA 1GGBL 1XB6A 4N8CL 4F27A 3E9TA 5KSAB 2J44A 5CN2A 1T20A 2F53D 2OSLB 2ZUVA 2GGIA 1Z32X 1HYRC 1BEYH 2F58H 5E99L 3PWPB 4BA0A 4HAKA 1LROA 1E6RA 3GZAA 4QRRA 4JTEA 5DD5L 4NPJA 2VMCA 4BSWB 2XGIA 2CK0L 2ANUA 4FX6M 4PMQA 3TFCA 2NV1A 3M47A 3PP3H 4OE7A 4C1NB 1PAMA 4PODA 4C1LA 2VLRD 3GSXB 4MX7A 1UBSA 1GS7A 2AEWA 4UAOC 1A5UA 1Z2KA 2WGNB 3LBCA 1ODUA 3QSTA 3ZM8A 2AW2A 4E3VA 3AY2A 5CUSL 3UTPD 2H32A 2ZKHH 2NVAA 2G75A 5F1UA 4F9DA 1P84K 3TVMB 2GC7C 3CWGA 1E5CA 3FU3A 4GCXA 5DZVA 1J48A 1HXKA 3TT3L 1DN0B 4ZUVA 5I1GH 4KZEL 2VDNL 3NPZB 2VKZG 3W7RA 2YMXL 3M1CA 3O45A 2AK4D 4D0DA 2ISSA 5FD0A 3O0LA 3OA3A 3CFBA 4P2OD 2HFEA 4S3FA 3LHWA 3NR0A 1VP5A 3U6XS 4WDIB 4PJBF 3ARFA 4PBEA 3BPCA 4DJFD 2PTDA 5G2WA 3WUWG 1I7UB 1TVNA 3ILEA 2FH8A 4LY8A 4P9HH 2YD3A 5DD6B 2OKMA 4UV4H 3NFSL 1DWGM 1VLIA 4J2MA 3RM4A 3NZHH 4DM1A 4EPDC 1GT8A 3NZHL 1OB1B 5B38B 1YHPA 1ZA3B 4Y5YC 4ES9A 2BP8A 4ZUSB 5HVHC 3OSKA 5JA9A 2Z7KA 4GHRA 3SY0B 4XNUH 2H1PH 2X40A 2R0KL 4JFPB 4U1MB 4YXHL 5JDJA 2FB2A 3V35A 2R8SH 4U7SA 2RAGA 3FRUB 2N01B 3V0GA 5EZIH 3BRFA 5XIAA 1X5YA 2BVUA 1LJMA 4H8VA 4HPYH 5F96H 3VWJA 3H4XA 5MKGA 5EBGA 1GGBH 4N8CH 1F3RB 3SJVB 1YG9A 3E6FA 1ZAHA 4JO2L 1OK4A 1JF1A 1FCQA 2ZKXA 4LSDA 2G9HB 3PPSA 1H41A 4JQ4A 1ZVSB 4KKXA 3QORA 3AW5A 1NCDL 2LT9A 3D2UB 4S1RL 4WGHA 3MFGB 3WEMA 2ZZ7A 1KIUA 3WLBA 4AEOA 4ZFMA 3IMTA 4R6UA 4NNYA 1KXVC 3OB8A 2LR4A 5A3IC 1OTSD 2DBJA 2G3FA 1HHHA 1V3JA 1BQRA 2VXVH 3CIAA 4QHLA 4DOHE 4FA6A 5I0YA 2CXEA 2PZ0A 4XNDA 3H23A 1JNNL 3HZ3A 4JFPA 5D1ZC 3VXMA 3NTYA 1NY1A 1XIWA 3EJSA 4PMJA 3G6DH 1G7LA 1NDMB 2JI3A 4D6GA 1RCOB 2WXIA 1OE3A 3ULVH 3H3PH 4OFIA 1B4JH 4TXEA 3WJZA 4J5VA 1TZHA 4X6BB 3ZKXC 1E71M 2VMDA 2D2HA 3CH0A 4EPKA 1ISVA 5D4JA 1RBLA 3WNKA 1TVDA 4O4VA 2X1SA 3CVHB 4JFDD 3ZXAC 2J62A 3LXAA 3VCNA 3QIUB 2DQIL 1JNDA 1MCPH 2DRUA 4E42B 3AFBA 3F2DA 2ICCA 1TNMA 1FWWA 5DD0L 2TMDA 5F7AA 2XNAA 4WKAA 2VLKD 4UTAH 4GUFA 4AKPA 2XYLA 3RGHA 2DI9A 3SRDA 1DEEB 1OF0A 3MRLA 3NIFE 5LGJB 3BO8A 5I6SA 3EBAA 3I6GB 3T0EB 1UWRA 3EOBB 3P30L 1HHKA 2BERA 4HQQH 5C0RL 4M80A 1KFLA 2BY3A 1DUYA 3COTA 5T5NG 5LN8A 1T4KB 1KENH 1KUMA 2AF2A 1W0YT 2IH3A 5T1KD 2CKNA 4ZXLA 2A7BA 2IMMA 2KDGA 3I85A 4L8SC 4ADJA 1FZKA 3C6CA 4WUKL 2EDKA 2I60H 4PGBB 4X83A 2YK1L 1S2AA 2OL3A 1S5VA 3OZ9L 1LD9B 5F6HJ 1YY9D 1PVNA 1OARH 2DI7A 2W91A 4N0RA 4RZKA 3C5QA 1ZHNB 4GJJA 4C58B 3SZ8A 1PU0A 2ED6A 2P4AB 5AOZA 5T1KB 5CZJA 1Z89A 4FQXD 3SE9H 1KKOA 3OHIA 3SJVD 5AFDA 4AMWA 2FQFA 3F3HA 4HKXA 4HBCH 1D7BA 1N68A 2FH6A 1H15B 3L3DA 3LRGA 4UYPA 2GSIA 3U4EB 1PTDA 1RIUH 3JR2A 3VC6A 2VMJA 4TVPH 1FXPA 3NAVA 5AVSB 4UT6A 4UAHA 3RWIB 3C0JA 4C6IA 3PGCB 4NN5B 1VYRA 3APDA 2HTLC 3D8MA 2VCOA 2CUAA 3PUUA 4L1LA 3IDYB 1OD8A 2NUYA 2CDEA 1GJWA 4HXAH 2C7FA 1X1NA 3MGTA 3AREB 1VFAA 3KGTA 1ONXA 2PD5A 4CKVX 1U8CB 2A4ZA 5JZ7C 1HF6A 5L0QC 2VVNA 5J4MA 1CXLA 3AWEA 3LTVA 4KMLB 4A4AA 1J8RA 1I1YB 1Z3RA 1TPB1 1E0VA 5IK3A 2IPGA 2P8LB 2ZXCA 3TDFA 2E3VA 4AQ8C 4TNWF 3AHXA 3EX3A 1DE4B 2DL9A 3K1DA 1NGZB 4J3VA 1XYBA 2KAUC 3N2JA 3KLHC 4DP7X 4IOFD 2Z25A 5IB1A 4JPIA 4QKTA 2VLJE 4ZTOH 4PJIE 5BJTB 4IIGA 3VJ6A 3VI4E 3BLFA 2A7RA 1Q9WB 2TRYA 3IE9A 4KWUA 3H24A 1HWGB 1DBMH 2OW7A 3S1GA 2FL5B 1RPQA 4PRDB 1NQ6A 3G77A 2VQTA 1IQWH 1CFVH 2D23A 2XFRA 3SY1A 3ILQC 3PQYB 4GY1A 4OT7A 1P48A 4LLWA 3GKWH 1JWMB 5FKAB 2G5BA 4NT6B 5A5WA 4UFHA 2UY7A 4ZE5A 2LHAA 3NCBB 3T6XA 4JS3A 4JKMA 1B3JA 1R5VB 1ZD6A 2X3CA 3LCYA 5D7SL 3TWYA 1H50A 5REQB 4Y9GA 1AGEA 1XLAA 1EWHA 1G1YA 2ZX5A 4YTTA 2OQLA 1YMMA 3GXTA 2NX5E 2NUPA 2QGBA 4MJ2A 3TO2A 2Z64C 3ILPA 1CDUA 2E86A 4MDIB 4X5XA 5T8IA 2IJ0C 4AUJA 3BGGA 3L5MA 3RCNA 2F38A 4DJFA 2Q0ZX 3QUYA 5JUEL 5KBNC 3CTTA 4IBTA 1EBAA 3W84A 1DCEA 3EYVB 3GHSA 2CNZA 5JOPE 2QPXA 1OCOB 4APQA 1DQQA 4KV5F 4M19A 4BK9A 4HUMB 4HLJA 4P2RE 4F2TA 3UAEA 4M1GH 3NJGA 3P0GB 1S7UA 1UKOA 2NXIA 3N6YA 1GZGA 4E2BA 4XBEH 1P0SE 2EDYA 2ZZ5A 4CA4A 4CVZB 4GUOA 1FYTA 5D1QB 2AMXA 1VIWA 2A9DA 4IMGA 4GXMA 1ZV9A 3SE9L 4YHOL 5E9DA 3PS7A 4Y1SA 1AGEB 3QQDB 4ZYKA 2HRHA 2AQQA 4G6MH 4UIOA 4I90A 3MLTB 4OSUH 3O4OB 3MOAL 3CUGA 4MXVF 2EXSA 2CLRB 1O9VA 3MLYL 2FJSA 5EIQA 2H0EA 5IUCA 3B06A 1JTOA 4J4PA 2IAMB 4KI5E 4LDLB 4ZS6C 3KTCA 4JZOA 2DJ4A 2J78A 1D5IL 2QV4A 2R69H 4LAZA 5T3ZE 1Z7JA 3NQGA 3TQVA 4WWPA 4JHMA 1HOCA 1MW2A 1OTUC 4FOMA 5KANG 3E2SA 4PMYA 4ADUA 3ZJ8A 3NO3A 1XF0A 1Q94B 1ANUA 2HK1A 1OGAD 3L9RA 5FSDC 2WC3A 4OT1L 4OF7A 1EHAA 3KJ6L 5E93A 3S1WA 5CGBA 4Z23A 4RCAA 3B7SA 1ZBWA 3ENEA 3FXYA 1MJ8L 4A21A 4A2EA 2JKNA 1H19A 4TKWA 3GUFA 2ARJQ 1WA1X 3EG9B 4PJBE 5KTEL 2OEJA 2L3BA 4N2GA 3BAYA 4QRTB 4WY0B 3IKKA 4JKPL 3MMEB 3KHQA 2D69A 4HPJA 5F2MA 3GM0A 3BAKA 1FWFC 1D6VH 1MFCL 2ZUMA 2V3FA 5IMOA 2DW5A 1QPNA 3HM7A 5KG9B 3RTQC 3AALA 3AYVA 4LRNL 3W2UA 2R1MA 4XP9H 1CFTB 3QZNA 2NY7L 1EFXA 3M7OA 4YXKL 2OKTA 1KEMH 3P84A 3EH3B 2EICA 4MJIA 2G2NA 4YTSA 4IPJA 3QY7A 3ZR4A 3MLVL 3VE9A 3R94A 4JDTL 2YXFA 3FK4A 1RD5A 3K71A 2QF8A 3UC0L 5E1IA 3K3QA 4TUJA 3E9AA 3TN0C 4JRXB 3QNZB 2PYEA 3GSOA 5J9PA 4N24A 1OAQL 3P73B 4US5A 3OKNB 1DQDH 4IJBA 4TM9A 3HG1D 2XC8A 3WFCL 4UTWC 1BZEA 2Z8RA 2OQJA 1Y5XA 4NO5B 4YSCA 5IMOB 3VNYA 5GRVL 4ZFFB 1YMHB 3QXUA 1KIPA 4LLVA 5I26A 5A2KH 1RIHH 1FNSL 1RUKH 1WUNT 2VLKE 2MEJB 2BXYA 2Z93B 3EZJB 4W9FC