1GKEA

Rat transthyretin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of rat transthyretin at 2.5 A resolution: first report on a unique tetrameric structure
pubmed rcsb
molecule tags Transport protein
molecule keywords TRANSTHYRETIN
total genus 22
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1gkeA00
4IKKA 1THCA 3M1OA 3ESOA 4PWFA 5JIDA 3CFQA 3SSGA 4Y9EA 3NESA 2QGEA 3BT0A 2IGLA 2TRHA 3CXFA 3DJTA 3NEOA 4YDNA 5EZPA 5HJGA 3CN1A 3GLZA 3DJZA 4PM1A 4TNFA 3P3RA 3NG5A 4PVMA 1FH2A 1DVQA 1KGIA 4WO0A 1TFPA 4AC2A 1IIKA 5L4IA 2ROXA 1E4HA 2FLMA 4TL5A 3CN0A 4WNJA 1Y1DA 1BZDA 5JIMA 5E23A 3DO4A 4PWGA 2QGCA 3DK2A 3KGSA 1SN5A 3CFNA 3GS4A 3IMRA 3HJ0A 2F7IA 4TQHA 1G1OA 1IE4A 3ESPA 4MASA 4TNEA 5FW8A 4L1SA 2GABA 4I85A 1X7TA 3FC8A 5AL0A 1GKEA 3IWUA 4IKJA 4DETA 3B56A 4Y9CA 1ICTA 5TTRA 2PABA 5L4MA 3CN3A 3CN2A 5EN3A 1QABA 4HIQA 3KGTA 3Q1EA 4IKIA 4FI6A 4TLTA 4PWKA 3IMVA 5BOJA 4PMFA 3IMSA 5E4AA 2G9KA 3IMWA 3TCTA 1DVTA 2B15A 1DVUA 2NOYA 2G4EA 4N85A 3CN4A 1DVZA 1E5AA 4TKWA 4QYAA 5AL8A 3P3UA 5CNHA 5K1NA 4TQPA 5A6IA 4HISA 2G4GA 3U2IA 4N87A 1DVYA 3P3TA 4TNGA 4D7BA 1OO2A 4TLKA 3DGDA 4QXVA 1QWHA 4IK7A 4DERA 4ACTA 4PVNA 5JIQA 3CBRA 4Y9FA 4ABUA 5AKSA 1BZ8A 2G3ZA 1TTAA 2G5UA 3GPSA 2H0EA 5FW6A 1SN0A 4WNSA 4ANKA 1FHNA 1TTCA 5CLYA 5L4JA 4I89A 3DJRA 5CLXA 3W3BA 5FO2A 4AC4A 1F41A 2H0JA 4MRCA 3GRBA 2B14A 1SN2A 3IMTA 5DEJA 3NEEA 1SOQA 1TTBA 1ETA1 2GPZA 3I9PA 5AYTA 4YDMA 2H6UA 5IHHA 2QGDA 1U21A 4PWEA 4DEUA 2B77A 1TSHA 3NEXA 2QPFA 4ABQA 3DIDA 3IMUA 3KGUA 4PVLA 4N86A 4DEWA 1ZCRA 4ABWA 1DVSA 5FW7A 5CR1A 3A4DA 3BSZA 5L4FA 1IIIA 3U2JA 1BZEA 3GRGA 3FCBA 1ZD6A 4TQIA 3GS0A 5E4OA 4HJTA 4PWIA 3D2TA 1TYRA 5AKVA 1RLBA 4TQ8A 3A4EA 1BMZA 2G3XA 2WQAA 4IIZA 4Q14A 5CM1A 1ETB1 3I9IA 2G2PA 1IJNA 1X7SA 3QVAA 4ABVA 4PWJA 3OZLA 2F8IA 4TLUA 4QRFA 3IPBA 1DVXA 5CN3A 2QELA 4PWHA 5K1JA 4IKLA 1KGJA 3I9AA 4FI8A 4I87A 4TL4A 4FI7A 1TLMA 1F86A 4L1TA 4PMEA 4Y9GA 2B9AA 2H1XA 5CLZA 1GKOA 3GS7A 4HJSA 4TM9A 1TTRA 2H0FA 3TFBA 1TT6A 1TZ8A 4IK6A 3A4FA 3D7PA 3IWVA 2TRYA 1Z7JA 3CFMA 3P3SA 5AKTA 4MRBA 2ROYA 2H4EA 3DJSA 1BM7A 1THAA 2QGBA 2B16A 3ESNA 3IPEA 4HJUA 4TLSA 3OZKA 4Y9BA 5DWPA 4KY2A 3DK0A 4DESA 1E3FA 2FBRA 3CFTA 1SOKA 2G2NA
chains in the Genus database with same CATH superfamily
1G9NC 4PJBE 1EGJH 1HFUA 4KBPA 3MBEC 5D7LB 4GFTB 4XO4A 4AYSA 4Q6IA 1JDDA 5IB4A 2GIMA 3LMJH 1J1PL 5HDOA 2GJ6D 4UI2A 3LMJL 5E6ID 5EORH 5HHQB 3QHZH 2V5RA 1URLA 3ME0B 3GXPA 3LIZL 2VNCA 4NQDB 5GGUA 3KHOA 2BOBB 4HBQA 1INDH 4X6CA 5IHUL 2VABA 1WAEA 2YZ1A 3H2QA 3NRFA 1RIUH 2IH1B 3W82A 2GSGA 3KYKL 4F1ZA 3GDBA 2GABA 1VEMA 2XVGA 3NTCL 4KZEH 4PJCB 3MBED 2P5WB 1GGYA 1GZPA 15C8H 3VD3A 5I6XC 1FLRL 3V0FA 1XSOA 2Q87A 4OSUL 2ENYA 1NOLA 2CBPA 5DLMH 2XICA 5KS9F 3UBXG 3ZGHA 2VRKA 4I7ZC 3EFDL 1SEBA 4RMWA 2XTLA 3CC5B 4JM4H 1FC1A 1SYSA 2EKSA 1CFTA 2L0DA 1A4KB 3AABA 2ESVE 1OP5H 2YIHA 2VL4A 1KJ2A 5IB3A 4W68A 2QV4A 2WXOA 1N0LB 2OR8A 4W9DC 3L95B 5IB5A 2FLRT 1KTBA 1PZ5A 3POHA 3ULUF 2WSKA 1OP3K 3AS1A 3V9EA 4WO4D 4K7PL 5A6MA 3IVKA 3C2AH 3D12B 3C08H 3PAYA 4PIRF 1W0VA 4MSWA 3MI6A 3MXVH 3RHWK 4OCWL 4IOIA 3CVHB 1T1WA 4FD0A 2Q2EB 3MUZ1 5M7QA 3WENA 1BQLH 2EACA 3BDBA 3JVGC 1QBMH 4M4RA 3Q6FA 1GMIA 3GZKA 4O2FA 1RIHH 2EE3A 1JK9A 5DC9B 3UP6A 3C6EA 3FCBA 4HIIB 1TQBC 3SDYH 1QFWI 2VGLM 1IBYA 3KPMA 4YDVA 2FIKA 5GSRA 4F24A 2GHWB 5BV7C 1NLBL 1YY8A 1WVZA 3WKPA 1WV7T 1KN4H 3QIWD 2X4PB 4LBAA 4QOKE 4RWYL 1R9FA 1KGCD 1KN4L 2BW4A 2J20A 4RMTA 5F0MB 1YY8B 1MAML 2GJ6E 2QELA 4ZUTB 2ED7A 5FCUL 3ZQXA 4L8DA 1J5OL 1TQWA 1GKOA 4HCRA 2WKOF 1A9BB 3LOWA 1U8CB 5JW4R 3T0BA 3B1TA 2DPKA 2I9TB 1A25A 2UYLB 3EJZD 2L3BA 4P23C 4S1QL 2PTUA 3S2AA 4HG4K 3HFFA 4S11A 1S5HB 3F7QA 3FT1A 1E9QA 3L3DB 4Y9BA 3UH8A 2Y5TA 5HYSG 4AM0B 3QAZC 2WTOA 3QFGA 2ZYIA 3GFUA 2XVKA 4U6HA 1CFSA 3KPSE 4KUCF 1R3HA 4JRYE 4WJG3 1IBFA 2O6EA 3AADB 4ODBD 3V52L 2WMPB 4DO4A 2H8PB 1AR1C 4JGJA 2HTKC 1Z66A 3FF7A 3TBCA 4EOWL 5EEUA 3NFNB 3HNTL 4Q58C 3GJEB 4AXWB 2C9AA 4GIAA 1LGVA 1EZUA 1T66D 3F2LA 2EVJA 1FGNH 4IS6B 2R7EA 3EDDA 2AP2A 4L4VB 4EUPG 1R5WA 4HIXL 1P6FA 3GGWA 4N8CH 3N40P 5HBBA 2UZIL 4HZLA 3B2DC 1PX8A 4JZJA 2NY6C 4F20A 3H9SD 5DA4A 3FCTA 3KM1A 5E4AA 4FFZL 2JELH 1JAEA 4JCMA 3SDAA 2AEIT 1XCWA 4PD4J 3JWOC 4LOVA 1AHWC 4QYAA 1EEZA 4N28A 4Z95L 2UXVA 4G6JH 5FM4A 1MAMH 4X6DE 4ECNA 5K1NA 1U9KA 3QFJA 1CD1A 2XI9A 1DVFA 1OAJA 4LHUB 4PCYA 2D4DA 3RG1C 5KTEL 3WO3B 4MNHA 2QVKA 1V10A 1ZT7A 5LCVL 4X5XB 4EAEA 3OLGA 3L4CA 1KEGL 3NRPA 1S9KC 1I9IL 1KCVH 4PG9B 4QRUB 4X2UA 1HESA 5IQMA 4P2QE 1A4KA 2IALB 4F7TB 4XPBL 5IOPB 3V95A 1TZIB 4XPBH 2VN3A 4CADB 1C12B 5D5MA 5INCA 3AWFA 3DVGA 1L6XA 5E0QA 4BA8A 1YEIH 4BDVB 3DRQB 4G7YL 3MJ9A 5I30L 4EUPB 4A7TA 3L5XL 5FUZL 4XC1L 5JYMA 4XP5H 3L5XH 2MCMA 1YZZA 3QA3B 4PUBL 4X6CF 3LB6D 4RAHA 3OLEA 3H7LA 1AS8A 3MLWH 2Q8AL 3S5LG 4DTGH 4X7TB 2J12B 4I2XE 1DEEB 3P0VL 2IBBA 1AIFA 1QZ1A 1TOXA 3TGXA 3DC0A 2E8YA 3SPJA 1JZJA 5TDPB 2R0KL 1AGFA 1LVEA 4ZDHB 1MFMA 3SO3B 4WFHE 1BVLA 5FDWB 2M1KA 1CICA 1Z5LA 4XNYL 3U0PB 1MELA 3KPMB 4FI7A 4XB7A 2A9NL 1KY7A 1OGTB 2OMYA 2Q3AA 3GXTA 2FNWA 3U0PA 3S4SG 1TG8A 5T8IA 5JPNB 2H0FA 3B1UA 3BUDA 3REWA 1ID5I 3AQDA 4NS0A 5EU6D 2AJVL 3AG1B 3EFOB 4RMQA 4KOCA 5AW6B 1J9TA 4RQQA 3BP7B 4NZRH 3RAJL 4EQ3A 2YUXA 4RA3A 3UAJA 2W9EL 4Y2OA 1DLHA 3NRQA 4Y2OB 1FG2A 4GO6B 5E4IA 2D9CA 4OCMC 5DUJA 4RMBA 4NRZA 5DHMC 5ID0B 1NCAH 4MQ7B 5IJVA 2JJTC 4M7JH 1NFKA 5I5RA 4QT5B 1CXKA 3MRBB 2JKRM 4JFHE 3OKMA 1A2YB 4Z7VE 3MACL 3TPKA 3KMDA 2IEPA 3L4TA 2NTFB 2FATL 4YK4B 4A66A 2MKLC 4GKSB 2HT4D 2KZ1B 4L4VD 1KBVA 2WBWB 2WXIA 3CVIL 2BSEA 3QQ9D 4GKSA 3RVXD 5ICYB 1N8ZA 3QQ3A 1K5WA 4QF1A 4JY5H 3V4LA 3AW5A 3WFCH 1IM9A 4QF1B 3EJYC 5HDQL 3HNSH 3U0TB 4KI5D 4WUUA 4EIBA 4FQLL 3AVEA 2Y6SD 5D7KD 3QQ4A 1CF1A 2JSFA 5JHDE 3CFJA 3MMEB 1O6SB 1RP8A 4PS3A 3QQ4B 2Y3NA 3AB0B 3WKML 1NIBA 3CFDB 1KB9K 3CUPB 4R5TA 2DLIA 5F7DB 3JBG7 4OM0H 5EOQH 2Q6WB 3V0WH 4D9QD 2DY2A 1CE1L 3OAWA 2ZCLH 4K7FB 3VWKA 4FA8A 5T5FA 4IOSA 2NUTA 3ZIMA 4U1MA 4HGWB 4YDJB 1DJYA 3HMXA 3MVSA 1OAZL 2NUTB 4WHYH 1Z3RA 4IMKC 1XAKA 2MQ0A 4AVJA 2XA8H 4JAMA 1HXKA 2VDRH 4NQEB 4WI7A 5IHHA 5LKNA 2MOGA 2HFEB 1T0NB 4G1EA 4L3EE 3VTAA 4JFED 2WBJA 3WU1A 1I1YB 5EF3A 4JO3H 3E80A 3JXAA 1S5IH 1TETL 5IW6A 5DS1A 2GQHA 2WCGA 3I75A 5TF1H 5DD0H 4DK3A 3K5SA 3PWPB 3FU0A 3E1F1 1DBAH 3SGKC 2HVJA 1QACA 2JIXA 5KVGE 2PLTA 2VLRA 2X5PA 5FS5A 2HMIC 3D48R 3UZQB 2AQSA 3IEAA 1ETB1 5DJ0A 1NAMB 2YPKA 4NQCB 1KTDA 3BESR 4AMKH 1YEJL 5KYXA 1IT9H 3BKYH 4ES8A 5LBSH 3UZVA 1LP9A 2WBJD 2QPUA 1CGVA 3BJ91 1K8IA 1XGTA 5SWZA 3SDXE 3MXWH 3ECUA 3D69B 4O51B 1RURL 2KI6A 2ZKWA 2WUBL 4TSCL 4JFZL 3EJPA 5GGRB 1AMXA 2D0HA 1FL3A 1YO4A 3TA3A 4ZAKD 2O6FA 2K4WA 2BVUA 5CO1A 4NI3A 5CWSB 4AE1A 4Y9EA 4F7PB 4NPJA 4N1CA 3FO1B 2ATAA 1NL0L 1WA2X 3BUQA 5ETUA 3GSOB 4FQJL 4PM1A 3FQRB 2FSEB 3U36B 3IN0A 4KRPC 2HT3C 2PCPB 4GQ9H 1WFUA 5B21A 5HY9B 3DMMD 5JIPA 2IWFA 3PWLA 4K5PA 4TVPH 3O0LA 4Z7VA 5JIMA 3VQ1C 1TKWA 3H9YA 3RVWD 1DBML 4PJEB 3CVHL 5AW9B 1U8IB 5E7FA 2VERN 1I3UA 1T1XA 2ZOKB 4NHCH 5F44A 1YHPA 3PG2A 2XG5B 1BW8A 1SVZA 3CQFA 4J6RL 4JFOA 4F2FA 4KRPD 1J0HA 4UNUA 1R3KB 2E6PA 2FSDA 3BGFB 4GBXD 4J2QA 1N4XL 4TYUA 5EC2B 2KERA 2YWZA 4J3WA 4PB0H 3FU3A 4NN7C 3RP1A 5I73C 4MJIE 4NGHL 3L17A 3RFRA 3TEWA 1LK2B 3DDFA 4L4TD 4K2UL 1Y7VA 2N56A 1OT1A 1T0OA 2L7QA 4N1HB 4TF4A 1M3JA 3GK8H 4AH2B 4DIXA 1HIMH 2A73A 1TCRA 4ZO6A 2DQUL 3HN8A 4AH2A 4M9PA 3GPSA 3ROLB 1MRCH 1T21A 2I60L 3I50L 4POYA 2FQEA 3HG2A 3FQ1A 1SLVA 3QO1B 4OFIA 3S97C 1LDPL 3B3IB 5KSUA 1WWAX 1FFPA 2D3NA 4OZHB 4HU8A 4ALAH 3DO7B 5I1JH 1CXFA 1EHXA 5EU6E 4IRZH 3Q05A 4EIZC 5EUKB 4NUGH 5E2TH 3EJQA 4P4KC 2XV2A 5MERB 3NP3A 4MDJA 3TZVD 1YSOA 4YDLB 4OGYH 2XG4B 3ZDWA 5E08L 2P26A 1PU0A 2O6DA 4HX1A 5DZOA 3RURA 3T6XA 1IBHA 3TNMB 3LKPA 1FNLA 3OHXC 4RAUB 2EDLA 3C09B 5HJDA 4BIKA 3VXUD 4OFYA 1JERA 2AERT 2X4OB 4DVBB 3G6DH 4K5LA 1AO7A 4HVBA 4UZGA 4CJ1A 3OQRA 4JPWL 3WG7B 2C9QA 5D7EA 4WU7B 2Y6TE 2DQJL 2W95A 1WQVT 4FCAA 3KYOA 4J3OF 1YAIA 2OMVA 4KY1H 3ALXA 1BHGA 5FDYA 2X9WA 3ESNA 3ZE0B 5IR1B 2VSMB 5JR1H 5E5UB 2I69A 5GIRA 4IKNA 3OSVA 2Y5EA 4PTTB 1PCXA 2C4XA 4X6BA 2A9NH 1YUHA 1R33A 2FECL 1N70A 2VDNB 4WCYH 4IJ3B 2CD0A 2P7TB 4GLRI 1MRFL 4Q9QL 3BC9A 3MFGB 3MR9B 1I7UA 4AITA 4XRCA 2X0VA 1G0XA 4H26B 4IIQB 2I60H 3I50H 4D8PA 2VQTA 5EUOF 3SY6A 2DMKA 3PDGA 1KTKE 5FHAH 2L7UA 3SPGA 2DD8L 3AQXA 4L1HA 4YHIB 3H3BC 5LCVH 5GSVB 1I1AB 3MBWA 5FGCE 3WXWH 5I1LA 4ZYKB 3OX8A 1A4CA 1YEKL 4XB3A 2CM6A 1BIIA 3QNZA 2W88A 6TAAA 1ACYL 5I8EB 4OTXL 1RH8A 3DETD 3BUTA 3QQXA 5H35B 3OX8B 4FRWA 3DMMB 1KPVB 3MUHL 4RISL 1EDYA 4L37B 3O45B 5HI5C 3NJHA 4CKQA 3KWVA 2OL3B 1JHTB 1EO7A 2BM3A 2FJSA 4HJJL 4PLJC 4OIIH 5IF0A 3OWRA 1KYOJ 4WVRA 1GSKA 3GI8H 1EERB 1A0QH 3D3VA 4OJAA 3WN6A 4XP4H 4HPYH 4Y4HC 3SY0B 1D2OA 3DGDA 1R3KA 3HHSB 1WC7B 2IDTA 2NR6C 1XZWA 2Y72A 1JUFA 5FF6A 4X9FA 2EDMA 1X7QB 1JUFB 4GQZA 1FSKB 1ADWA 4FG2A 3FU7A 1ZT1A 4GEIA 1S9WA 2VDOB 2J1YA 4JDZA 3GUTA 2VXUH 4OLUH 2AQ3A 1VGKB 3MACH 4A6YB 3PGFL 4LLDA 5BRQA 2ENJA 4Y16A 3KDPB 1JN6A 1ZLVH 4AQAB 4G7RB 4BINA 3UTZB 1KB5L 1G6RA 4LLDB 2P8PB 1GC1L 4ZT1A 4HOXA 5G4OA 2NNAB 1OVZA 3BPCB 1UZ6E 2MJWA 2VW6A 3KXFD 4W9JC 4PJGB 4WWKB 1JVOA 1RK0B 5CHNB 4ZO8A 1OF0A 1CDCA 1RK7A 1SQ2N 2BO0A 2WLLB 2NY2B 4K3JH 4W93A 1XF2A 5FR3A 4F8PA 1XD0A 3RIFF 2DLHA 2Y1VA 2WQUA 3C60B 1AKJD 3CZLA 4L8SC 4Z5RB 4Z7OB 1BJ8A 1BPVA 3FT2B 4YR6A 1BVNT 1Z2KA 4Y89A 5C3IA 3QUXC 2VL5B 5C92A 5F3BA 6CGTA 7TAAA 3I6LD 1T83C 2VXVL 4FZEH 3WKMH 4PGJA 3LKNA 3DBXA 2W91A 1N59A 4UF7C 2IAND 4CMMB 3FCSB 3CFUA 4YHYC 4BFIB 4I18C 3RLSA 5DD6B 4LKCA 4QJ5B 1ORSB 3MRKB 5E9DE 2Y3AA 4BHUI 1BQHG 1A1OA 1I1FB 3MUGB 1J5HA 1VFAA 3ZYJA 1NANI 2BC4A 4WV1B 4YDIL 3TA4D 3N2JA 4K71C 4ATTA 2RCSH 2VE6B 2FAUA 3U6RB 3OKDB 3OZ9H 3RL2A 3T4YB 2DMCA 4MAUL 1H8LA 1NGWA 4K7PH 4WGVB 3HUJA 2P43B 5AYUL 1UCBL 4YDZA 3MKGA 3GBDA 2DKMA 1T0PB 2VXUL 2WLIB 4JX0A 4ONHB 4TTDD 1AD9A 1KELL 4U1HB 2W0FB 4P3CL 3BYTA 3KPNA 3EO1B 4ZOAA 2FE0A 2ZD0A 2OCFD 1FVEA 3NK4A 2P4AB 4HIQA 3ZE1F 1F4YL 2ZWNA 5EZLB 1NAKH 32C2B 4ZPVA 4X4MA 4P9ML 1KJ2L 2B5IB 1BQ5A 3BGFC 2BNUA 3PDOA 3L54A 4KK8C 3SB3A 5JW4Q 1NCHA 1WYJA 4KROD 4RDQF 5B7MA 3OSKA 3PDOB 3P4LA 3AWEA 3QRGH 4X7SL 3TEXA 4X7SH 2YR3A 3VNZA 5H35A 3QUYC 4LLQA 4XX5A 5ICZA 1HDMA 5E7BA 4GG8B 1WAAA 1CT8B 2HLAA 5AB1A 1YG9A 1BJ1H 1YVLA 2A6IA 4UTBH 4A2GA 3S88H 4ES9A 3RGVA 2H0EA 3LRMA 4YL4A 3VFPA 3T2LA 5CZRA 4Q4IA 2HUHA 4HJ1A 1XXFC 5GSRB 4WW2F 4QXWA 1ZA3B 4KKAC 3LIZA 1I9JH 4EEEA 5EFIA 1AHWA 2Z7YA 5JHAA 1T2QH 2VUOA 1CWVA 4TPRH 3ZKNC 4AJYV 4F7KA 2OZ4H 3RU8H 3I9GH 4ZMVA 2FGZA 3G5VA 4FA6A 4JFZH 2DIAA 3D39E 2EEBA 1RQ5A 5FGRA 3MLPA 2KPWA 1P5VB 2K9FB 4NIKB 3ULUE 3RY4A 3MA9H 3KPSA 4XNUL 2VM9A 5AVWB 2HH0H 1INQA 5CEXA 1I7ZB 2I5YH 1RXLA 1YMHA 1ED3A 1DVXA 3GSNB 1JZ5A 1EH9A 2NYKA 2X0UA 1GYWA 2Y5TB 4FQHB 2A1WH 2K6WA 4G8GD 4BZ1L 3S4SB 2AXFA 2ZYHA 1I4FA 3FO9A 3WHXB 3WYRA 1C8PA 1QHPA 3KLLA 2AXFB 3FO9B 4OGYL 5LB1A 1R3HB 1RJYA 4UQ3B 4DVRH 5BVJA 2P80A 1KWKA 1UUNA 3EJYD 1L9NA 2OZ4A 3KPPA 2BS71 2X1QA 3BE1L 1ZHBA 2XU9A 2ZJSL 4BE6A 5HHOB 5MEQB 5FEBA 1PNDA 1AI1L 1BWMA 2CCLA 2IBZX 5FA4B 5JIDA 3GJEA 4CKVX 5E24E 2G75A 1ZHNB 3M07A 1RHHA 4AYFA 4LBEA 2G75B 4F8TA 5EEWA 5CSBA 1LEGB 3IDYC 5I82A 8PAZA 4LBEB 3H9HA 4LKCB 4JR9L 1LK3H 1PCSA 2ATPA 1I53A 5K9QG 4YOKA 4P5TB 4DGVH 4V1DA 3HS0B 1INEL 4M48H 1ZLSL 3RVUD 2AXJA 1NCUA 3QZMA 5I16B 1KLUA 4U1IB 4X4YB 3HS0A 1PDKA 5TK4A 2NY1C 4OI9A 5JOPE 3GDCA 4Y9CA 1ICTA 1MFNA 4Q4EA 3VYPA 4X4YA 1GIGL 1XB8A 2EUXA 3UG3A 1F90L 1OGAD 4PHXA 4RDBA 1ZT7B 3HC2A 5C0IB 1QNZH 3LS5H 3IKKA 1Q9LB 4PJAA 2J2ZA 4TN9A 5HI3C 3DBSA 1UATA 4TKWA 3RJOA 9CGTA 4ANWA 3RNKB 2Z31D 2ED9A 5I0VA 3S3JA 2R2EB 4IRZA 2Z31A 5KYUB 4MCNA 4HP5A 4K55A 5E5RB 4XBGA 5CZXD 4OLZH 2VLLB 3KXFE 2Y7OA 4E9QA 3GZOA 1KJ2B 4C4KO 4NP4H 4QY8B 2A7BA 3QDMB 1CE6A 3V5DB 1GY1A 5K39A 4AYGA 1VKXA 3GBMH 3NIGE 4JM2B 4NQDD 4GJTB 2HRLA 4YAQB 4XI5D 3T65A 2OK0H 3BE1H 2EUZA 1SOQA 1Q0XH 1TTBA 2SEBA 4XH2A 2C7UA 3QDAA 4HPYL 3VGGA 5I0WA 1PZ2A 5DK2A 3ZT7A 4XH2B 4P59L 5DEZA 3MRLB 4UIKH 3UGXA 4IBYA 3MOBH 5CZXC 1IBGL 1T6BX 3H54A 4JGMA 3ZDYB 1JZGA 5L4FA 3N1GC 3GLDA 4X5WB 1ZAGA 4P4KB 3S96B 4ELMB 2IH3A 2EJ1A 2Y0SA 1UWXH 2AJXL 5AW7B 35C8H 1I7RB 2W80C 1MH5A 1PZDA 3B2VL 1S7TB 3G5XA 2WB7A 5LBVA 5HHPB 4EE2A 1N7ML 3OD3A 1GS8A 4UOW1 4X8JA 4XPAH 3G5VB 3FB8A 4XMKH 4XC3H 2DEWX 1M53A 1MZYA 1VGEL 2HTKD 4R8WH 1OWWA 2V5TA 1T5WB 5IIEB 2B1HH 3RWJB 5IVOA 4LSTH 1NLDH 3B2XA 1DP0A 2BSBA 2Z8WC 4YDLC 3IE9A 3ULSA 3UTOA 3HRZB 5GRUL 1AQKL 2YBGA 4AYEC 4DQOH 1DBKH 1E4KA 4GRWB 5BMFH 4PREB 5AVYB 3S4SA 1MIMH 3DIVA 4HPOH 3M1OA 2WXQA 4HWZA 3ULSB 4Q6IC 1D5MA 4A55A 2B7DT 4MYWB 3TESA 3CLEH 4Y2DD 1WG3A 3DJTA 3HLKA 3TT1L 4FKHA 4H0HB 1B2WL 3K0YA 4DF9A 2XVBA 1MWOA 3HC4H 1PZCA 5CD3B 3UROR 1MFVA 4M56A 3WIHH 2LFEA 1ADQH 1F1DA 1C5DA 3CE1A 3E6FB 2ESVB 4GW1B 2JKNA 3FQUA 2XQYK 3FT3B 5D2NC 3VFOA 1OAKH 4M7KH 1BQRA 2JJWA 2Q3ZA 4ORGA 5AFAA 4RGOL 5DMIL 3M86A 2PW1A 1F3DJ 5C0NC 3QAZB 2FWOA 1KIPB 2Q9OA 4RSVA 4Y19D 1IBGH 2J4WH 4Y2DC 4JVPA 2YPLD 1CVSC 2IMMA 2V8LA 5E94B 4ANXA 4MLIA 5JOFA 1O7VA 2N7AA 5SX4I 1F45A 1A6TA 3PHOB 1DBBL 5D8JL 3QZPA 4JZJB 4POZC 4R2GC 3FB6B 3FN9A 3D25B 4DP0X 4EUPH 1YEHH 4ONFH 1JPST 1USZA 1NC4B 1ADQA 1OSPH 2R59A 5ID1A 1DJZA 4O2EA 5GS3A 2BRQA 3BAKA 4QXVA 2LAGB 2HFGL 4M1GH 2QR0B 4PBDA 2C9SA 3SDYL 4UBDC 5C09A 5T3XD 4G6AC 3L13A 4P9HH 4UQBA 1PZBA 1HHHB 4AC4A 4OJFL 3T0WA 2FIRT 4WK2B 4F7TA 3K5RA 4NZUH 5CINL 3AROA 1LMKA 5BMFL 4KHXH 3QZBA 4UANA 2HJLA 2CMRL 3ZRSA 4JFEE 3VRIA 3VJ6A 1A7OH 3EJCA 3FT4B 4N8UA 3CLEL 1MJ8H 1NGQH 1PKQB 5DJ0B 4EUPA 5CJOH 2OMZB 4X8XA 1SOSA 5C71A 3K6FA 2NYYC 3U0WL 3HS9A 4W9HC 1UGKA 2L7JA 4PW4A 4IU3A 5T3ZH 4L1DA 1SFDA 1NFDF 4E5XG 5T1LD 5HHME 3RDTB 1V54B 1QEWB 3QIUB 4JKKA 4I48B 1T89A 1SJHA 4PV9B 1AGFB 5K1JA 2NY1B 2FX8H 1JVKA 4P46D 5HDLA 3C5ZC 1KT2B 2V17L 5DMKA 2DQTL 5D4JA 2X4RA 1ZVSB 4GAAA 2A2QT 2QBWA 4ZTOL 4Z9KB 1M1XA 3V8OA 1OPOA 1FYHB 1ZDSA 2BX5A 2ZSWA 2AQNA 5ES4B 3B9KC 1R3JA 4GOSA 3ZPDA 1HQRA 1QYGL 4J3UA 5I26A 1ACZA 1O7DC 5DR5H 1JZ7A 4M00A 3QP3A 1U2YA 3HC0B 2JQZA 1SHMA 2PPDA 3SDXB 4BZ1H 3BPLC 3W9DB 3VFMB 4JFYB 2XWTA 3KXFA 2MNUA 5CBAA 3TXAA 4Z7WB 2XWTB 2Y7QB 1NUNB 4HH9A 1A6WH 4WSGA 2DQFB 5B39B 1BYOA 2G3MA 4LEEA 5IB1B 2GTWB 4OZIA 1YC8A 3ASNB 3HE7C 4B97A 3FKUS 4G6JL 4L3CB 1LDPH 2R1WA 4F9LC 2R69L 1YNTB 3BLKA 4BZ2L 3TH4T 3DPBB 2NTFA 4J3OC 4YHNA 3JTBA 1UH4A 3V6BR 4TS6A 2YHGA 2LLLA 2BNRB 4P5SA 1SF5A 4MB4A 4POUB 1MWAH 4GRWE 4JHAL 5F9JA 1NCCL 2GB2A 1FIGL 2RR3A 5I0XA 4PJ8B 2ZKHH 2XBTA 1AANA 3MO1A 4GKOA 1IM9B 5L0QB 4AZ8A 3HE6A 1UHVA 1FPTH 3ZJAA 1KG0A 4KZ0A 5TQ2L 2R8SL 1ZGLA 4DOHB 3NJKA 5J6HA 2QLYA 5DFVC 2GJ6B 3A6BL 4J6RH 1A3RL 2Z7WA 2PO6B 4EOWH 1OD9A 3OL2A 3GMPB 1A3RH 1EHKB 3EYVB 3K91A 2CKBA 4OLVL 4S0SD 2DYSB 4ZAKA 4UMGA 5E6SB 5EPMB 3VH8G 1NKOA 2ENQA 4PB0L 4OLEA 2OSXA 5B7EA 4BFRA 4X42A 1FGNL 1UWGH 5B1JA 4DGVL 3SOBH 2A6JB 5C09B 3MV8D 4O02H 3G08B 3MROA 1X5LA 4RWHA 4BCZA 1QFWH 4PJCE 4IRSC 3IDXH 1ZCRA 5MEPB 2R39A 3ABZA 1JBJA 3GRGA 2BP5M 1RUKL 1CXEA 2NT0A 4JFDE 4JUSA 1GAFL 5DF0A 5CFHA 3VFWB 3GGWB 3QDHA 3RPIA 1JOIA 1B3JA 5E0FA 2WK2A 2X7LB 3DUHA 3PV6A 3FULA 2J21A 4WTZG 2VAJA 3ZZQA 5J89A 4YBHA 4WZ9A 3LQAL 3HR5B 3QEQE 3HA0A 3KBEA 4HEME 1JNNH 4FNLL 5IQNA 5GIRB 5KVMC 5MI0B 1J0IA 2VR5A 1NCAL 2WKGA 1UJ3A 2VN6A 5C0DA 3MNZB 1KYOK 4JDEA 3WHE1 2Y1ZA 3IWVA 3VH8B 3OB8A 5C0DB 3DVIA 1R0AH 3LHPH 3W2DL 4X5XA 4M93B 3O6LH 3N6YA 1I3GH 1RPQA 2ICEC 1T1ZA 3CFQA 1FL3B 3TA3B 2EH7L 2XPZA 3ULUH 3MYZA 2Q76A 4J6IA 4R8WL 3QQDB 1KOAA 12E8L 1LYQA 4F7PA 5JUEH 4H20L 4TUKH 1QNZL 3LS5L 4AV5A 1CDUA 3FQRA 4HFUL 4ZW3A 1ZEAH 2MHAB 3QEUB 4ZNEE 1DBKL 2X42A 3SDXA 2WZ0A 3CCHA 2V0AA 4WUUD 4PVBA 4XGZB 2OMUA 2OL3A 2O1AA 2MWCA 1A3LL 4PJEA 4OLUL 3NFSH 5HSFA 5H8DA 2DWDA 1NGZB 3B56A 4KPHH 5L4MA 1FV1A 1KB5H 4NFBA 5D2LF 4PJBA 3RHWF 2Y7QA 4DP2X 2VDKH 5B3JE 1T1XB 1ERNA 2K7QA 2MQCA 4XMKL 4P57A 3D34A 3CVIH 1JDCA 2PYED 3PL6A 4BSWB 1ZVNA 4GXUM 3C6LC 3T4AA 1XBDA 1CD0A 4PI2A 3T04D 1S9YA 1I8MA 5JLZB 2PYFB 1M71B 3IGLA 3NTCH 2A0LC 4PQXA 5FO8A 3KJ6H 5AOZA 2OW6A 4UNIA 1ONQB 5IJBC 2XZAH 1CU4H 1HL5A 2WWKT 3BP7A 2OJ1A 4B0MM 2X4NA 5DJZB 1REIA 1ONQA 1WWBX 4Z3EA 4TUOB 4LSQL 4XAKD 4A2HA 3VE0B 1DQMH 3LZRA 2D3VA 3IGAB 2P24A 3TBYA 1F4XH 1F4XL 5E8OB 1QO3A 4G5AA 1JPTH 1FZMB 3A22A 4H0GA 1ZS8B 3FTSA 2AK4A 3GD1C 4JO2L 4MA1B 4Y4KC 5MEOB 1OM3L 1PSKL 2AEPH 3LY6A 5EPMA 1X3DA 3PL6C 3FTGA 5PCYA 5JHDA 3GSNH 5BJTA 1H8SA 1U3HC 4XNXH 1UEYA 2XN9E 1KB3A 4RGND 4J3VA 3N04A 3I02B 3PGCB 4YL9A 3C2AL 1PIGA 4F7MB 2DQEH 1MDTA 2K9UA 4W70A 3CFBA 2DWEA 5LG1A 4YK4C 1T4KA 2GBUA 3BPLB 4ZS6C 3DX7A 4AQ1B 3FONA 4BUGA 4U6XB 4PJGE 1FORL 1XGQB 1ND0A 2WSDA 1CGWA 3MRKA 3K1DA 4X0NA 5SWSE 1JFQH 2IPTL 5D70H 1JWMA 1JFQL 1YEEH 2IPTH 2J6EA 3M17A 3WE1A 4AEIL 5LDSA 4TOYL 2ROYA 4JRXE 2OBGA 5GS2D 3VFRB 3RDJA 3P69A 3EYOB 2NY0B 2M8XA 2YMXH 3QZWB 2R0LH 5EV7A 3S37H 4FE9A 2ETWA 4YSQA 1TUPA 1XTMA 3T0EE 3G6JF 3QRGL 3ARDA 1U8QA 4CBZA 1B4JL 2XBDA 2HT2D 4D0CA 5CEYB 3BIKB 3QIBC 1Q0EA 4RNRA 5HI5D 4NENA 2UUDK 4CBPA 3KPNB 4HXBL 1E5YA 1NL0H 4OFDA 4XN2A 4PJ7E 3BGMB 1T1YB 4Y4FD 5F89A 5D7LE 5EUOB 5EZLA 3VFNB 3VM7A 4JFFA 4C57C 3VD2A 3GXDA 1UZ6F 1JPTL 3SE9H 3JV5A 2PXYA 2Z92B 3PWPA 3MGOA 5IHZB 2XZCL 3CQPA 3M1CA 1Q9OB 5ESAA 1T7ZA 2YGNA 3LRGA 3CZGA 5FUZH 4B27A 4CN1A 1BBJA 3QCVH 2MQ3A 4MA3A 3ASOB 4X5QA 1MFBH 2WVVB 5T5NG 4N68A 1DVTA 1F3JB 1Q72H 1T5KA 3O11A 2J5LC 1W6LA 2XWZA 2NY0C 4GXVL 2R2CA 3QPQD 4X9BA 3S2CA 1NCTA 4L1BA 4XVJH 5E2VH 3HNTH 3ZUNC 2JCCA 2ICCA 1UM6L 3FTXA 4IHOB 3OHXB 1H6UA 5G55A 2BMKA 4P3CH 5D1QC 1XH3A 4UM9D 5KYWB 3ARUA 2DI9A 1ZA3A 4KFMA 3JV4A 1WUZA 4G6FB 3ULVH 3DETC 1CO1A 3WNJA 2MPAH 4CGUB 1NM4A 2ZUXA 3LXUX 3HBPA 5DRNB 5FW6A 1S9YB 1I8MB 5DRWA 2J88H 4P5KB 1QUPA 3UTPD 3TFKD 3BRGC 4LESA 3LVTA 4XP6L 3CBKB 3Q2LA 4G7QB 4YDMA 1RIVL 5F9OH 1XIWC 3LRSB 1D5ZB 2UZXB 4BA0A 3KR3L 3REVA 3SDCB 3BAIA 4PI0A 5EZOH 2W07A 3OTTA 4DKFL 1LP9E 2EXTA 1XV8A 3EOYG 4FQHA 4PGZA 1OAXL 4PJXA 5KZCB 2R9HD 3LSOB 1FVDA 1EXUA 1KUMA 4S1RH 1K2DB 2WWKO 5FO7B 2GTZB 2V3DA 3B7SA 1KXQE 2VDMH 3TEYA 3QR2A 4JLRB 1S7SB 2AQRA 3HAEG 4N6QA 1WD8A 1LE9A 5BJTB 3ML8A 4FQPA 5IB2A 4N1EA 1LE9B 1EHLH 2BIPA 3PGCA 4N0RA 1MCWW 1FZJB 5ERWB 3QYNA 2WLYA 4L3EA 4K73A 1BF5A 2R69H 1JZ3A 1WCBB 4NAJA 5HYEA 3MRNB 3P77A 3JTTA 4WWPA 3O9WA 4QHPA 5ACZA 5I1JL 3NEOA 4OFKA 1U8PB 4NM8L 3M17B 4TNFA 3C2SA 1FH2A 4PV8A 3JYBA 1U3HB 3B3IA 4KXAA 4IQHA 4WV1A 2EVHA 1AFVH 2Y4SA 3MLRL 4WNJA 3CFCH 4EZKA 5I0YA 2GK0B 3MRFA 3VQMA 1BP3B 2VDQL 4KROC 4MBRA 3VFTB 1JMZA 3PYCA 2F54B 5AVZB 2XA8L 4MD4A 3MJWA 4LZKA 2YFNA 3LN9A 4H8WL 4HS6A 1D5BA 2BSTB 3KEDA 4I1PA 4FAAB 4NKMB 3GHBH 4LOUD 2X2IA 4LPVA 4JY6B 3SYOA 3QNXB 2AJXH 5DD0L 3S5LB 3VXTB 1TZGH 3KS0H 3QK0A 2PYEE 2B3IA 3BSZL 3K6DA 4BFGA 3K6SB 4ZUVA 4Z78B 5KYYA 3F6JA 3HIZA 3KH4A 1OAUL 1XQ4A 4W9CC 3MV8A 1R34A 3KYOB 4XPAL 4HDIB 5GHWL 4Z0XA 3QUYA 2AABL 1HSAB 3FF8A 2Z34A 1GS6X 5HYSB 3MRLA 4Q6YA 3PCYA 4ISVA 4MVBD 3ET9F 3MLVL 4KTEL 3IJSB 1NFDB 2I07B 3RGVB 2H2PD 1RAMA 3BJLA 2EABA 4LB8A 3N0AA 1YY9C 3ASWA 1U0QA 4JRFA 1YEGL 5LAXB 4PJIF 2OMTA 4EBQH 3L3OA 3DVNA 3FNKA 5HYQA 2KUTA 2AK4E 2FHCA 2W9DL 1CZ8H 2FGWH 1A9EB 1RZJC 4MX7B 3U30C 1TQVA 4ABWA 4KK5C 1WITA 4IMKA 4KDVA 5E6IB 4P5KA 1FNAA 4Y1TA 3EHBD 3M46A 4PGEA 4DZBB 4WIQA 5F3FA 4TVPL 3CX2A 4PGEB 4D0DB 3TH3T 2VZVA 2B2XL 3NMEA 5E9NA 5C6WH 3DV6B 3P9WB 3EGSA 2P44B 4L37A 3OPZH 2FJFA 2LLNA 3GJFA 3OB0H 3IJYA 4HWUA 4JO4H 2NSQA 1BZ9A 3X1BA 3GBLA 3FQTA 4ZD3L 1TLMA 5CLZA 4HWZB 4Q6KA 3TEZA 4B7LA 4JO3L 1FFQA 4KI1A 4E41D 5I6LA 1IC4L 3A4FA 1S7SA 2BNQA 2J3SA 2DICA 4HC1L 4HKXB 1LO0L 5DK0B 4HC1H 3KAAA 3O6MH 2BNQB 2B3RA 1YUKB 1AQDB 1TTUA 5I75B 2AJZA 4ELDA 1CN4A 5T3ZD 1YAZA 3RIKA 4HETA 2AVGA 1TU2A 4JG0H 3T1FA 4JRXB 3BFWA 4OY9A 1G4MA 1KIPA 5DZNA 3QXDA 4PRIA 5JQIB 3LS4L 3KZ8A 1BF8A 1MJUH 4X6DB 4UDUA 1ZTXH 4P9HL 4ZNEA 2KLSA 4N0FA 1A6TB 4RA0C 4LDEB 4I9WE 2Z35A 1DUYB 2UWEE 2QPSA 2MCG1 1SQMA 2CPCA 4NQVA 5D2NA 4HC1A 1NGQL 1S6NA 3HG1A 3FSWA 5D55A 4EDXA 2W9DH 5D7HA 4HK0B 4PY8I 3KGTA 5F7NC 3CDGA 3CLFL 2D7MA 3U0WH 1XBRA 4FJZA 3BT2H 2FWSA 4XI5C 2FNBA 4WEMB 1E4XL 4DT2A 2DI7A 3HG5A 2LAAA 4HV8A 5AB2A 1K5NB 3NCXA 4I0KA 4BRVA 3ARRA 2QZQA 5KEZA 1TPXB 1UFUA 1JHLL 5EOTB 5DRXA 5KN5B 3OM3B 2B39A 3GSNL 3COOA 1MUJA 4R96B 1IX2A 2FBJH 4TQEL 1I8IA 4J3OH 4JRYB 1IAMA 5CZVH 5C86A 2VN5A 5ECJE 3NFPA 1RUPL 5GGSA 3LNIA 1UGNA 4OLVH 4QHUA 2OI9C 4CW1A 2QHRH 3NT0A 2YKKA 3MXVL 4Z7NE 4KUZL 1HYSC 2DAVA 3WNIA 1H5BB 1OHZA 1ET7A 1OSPL 4FJYA 1O9WA 4P2RD 4M5TA 2GAZA 1ANUA 4O02L 4PJCA 4YSPA 1U93B 3KBPA 2HG5B 2ZKYA 3GZPA 3MV01 4NC0B 1CGUA 3MGTA 4A7VA 4MJIB 1BFOB 3GHPA 1PQZB 3EJZC 4U6YB 5D1QE 3VD1A 2WLHA 2OTUB 5C0FA 1AGCA 4WWID 3SKOA 1I9RH 2X4RB 1QX1A 2WQAA 1SYSB 2EKSB 4IIZA 3SKOB 4YMPA 5HVWA 5IBLD 1YEFL 1AI1H 4KHTH 3N1MC 2O72A 1OTSC 3WS6C 1MH5B 3E3QC 4CVWA 1R3JB 4G9FD 3S3PA 5DTFA 3DX9A 2EVIA 1CICC 5AW1B 3WEOA 1H3GA 2YLHA 3L3HB 3S36H 3SO5A 4P4RB 3GSUA 4FMFA 2B0SL 1KSRA 1B4TA 3KNBA 5CP7A 2WTRA 3GM0A 2JKXA 4UQEA 2WTRB 2N4IA 4K5MA 2O30A 5HYJD 1I3GL 3SJVA 5HYJA 2XN9B 3WS3A 4EZLA 3GYRA 5B38B 1YNTA 4DEPC 3QIBB 4G42A 5J12B 3CSPA 3LEVL 5I5MA 5GRVL 3LEVH 1MHPL 1DQDL 5D1ZC 4JPWH 5SWZE 2YXFA 2OJEA 4ZTOH 1AQDA 2FIKB 3N5AA 3P0VH 5I2IB 5AW8B 1AO7D 3KGSA 5L8JB 4UAOB 5CMAA 2ESVA 3UYOD 1IEAB 1K4CB 3D06A 4JKMA 3CPLA 3MLSH 4QKXB 5IFAL 4F33B 4XN5A 1K4CA 5TTRA 4NZTL 1H6EA 3WNKA 2NX5A 1BCIA 4YUEH 2DYRB 3IDXL 4QGTA 2A83A 4YE4H 1KG0B 4RAVA 3I74A 3RTQD 2BY2A 2BNQE 1UKTA 2XYBA 5FUOL 1RUKH 3DJ9A 5I8KL 4RAVB 4PRHA 4CU6A 2UYLA 5J4MA 5HVFB 5I17A 2CBQA 1N5YL 4IOFD 5D2NB 1V7NL 1EDQA 1YEFH 2FT6A 4DGYH 2AQ1A 1NIEA 5BVJB 2CKBL 3R06A 2J72A 5F0PB 1JGDB 3U9PL 2AK1H 3EYUH 4DK6A 4ZUSB 4ZSOE 3JWDC 4PJ5A 1OAQL 4UT9A 2GIYA 3NA9H 4OTXH 5MEQA 3KW8A 3S34L 4JJOA 4RFEA 2O61B 4M7JL 2YUWA 3IDJA 2IDSA 4O5LH 1P4LA 2V6HA 3CZEA 3VB8A 3VSTA 4OJEH 4YQXL 1R1CA 1DSFH 3N44F 3NFNA 3F62A 2ZKHL 2ZG1A 4LP5A 4PY7A 4OGAD 1J12A 3V0DA 5INDA 2X40A 4TVSa 1VCAA 4L23A 3B9VA 4Q6IB 2DM3A 4PLKD 1R5WB 3PNWB 1KBGH 1R5VB 3BVXA 4LL1A 2VR7A 5IVXB 4OKVA 5TQ0H 5GGUB 1TYRA 4W9EC 1R3LA 2GBTA 2HA1A 2ADFL 3IPFA 3SDDB 3LNFA 5KSAD 1OM9A 4XPFL 1MF2L 3IXTA 4HEPG 3QIUA 2W59A 3WS6A 3F83A 3ABMB 5C0AE 1CXLA 4JZOA 4PRBB 5DMGD 4KNSA 1U8LB 1C5CH 2ZXBA 3QCUH 4GEJA 1E27A 5BO1L 1P2CA 3QCUL 2DIJA 4MZRA 5EORL 2HKFL 1U36A 2EO9A 4KTDH 4LCIL 4Q74A 5AL0A 1QSEA 3K4AA 3T5WA 3OGCB 3SCMB 4WNQB 2Z91A 1NCDH 2J5WA 3KW7A 1CE6B 3CVBA 2NT1A 4Z0BH 3V5DA 4OT1H 1AD0A 1TJXA 2ZQKA 3SSGA 4GS7C 1M7IA 5GGQL 3TA3D 1KXVA 5F9WC 4D9RD 3T65B 3KNBB 1EAPA 3PHAA 4W9KC 5CP7B 2FO4A 3FTZA 2NDGA 4MNQB 3F12B 4LSPL 5DD5L 1W0VB 5AOKA 5JNYB 3WIHL 1IE5A 4LPWA 2WQSA 2OTWB 5HHVH 2B20A 2HX8A 1S7RB 3VYNA 2XZQL 1ZLUH 4KJPC 1RFDL 1CICB 1Z5LB 4H25A 4K15A 4XNMB 5T1KD 3I3BA 3SJVD 5DFVD 3N42F 1NIDA 1JK9B 3OAUH 4LAQH 3MJ6A 1J8HA 3SGEI 4H25B 4XNMA 5JPNA 1G7JB 5IROA 3GIVB 3K2IA 5HDQH 2G5BA 1CDHA 2NZ1A 1HL8A 1AE6H 3CSBA 4XVOA 1V7MH 2XWRA 1ITCA 3D2UB 5GGTA 5CKAA 5A6IA 4LEOB 5EDXA 2QSCH 2EIKB 5IW1A 2IOOA 4UUJA 4DPRA 3HBZA 1VLXA 4XX1E 3S8WA 1AC6A 5AAWC 5KVGL 4UDTB 2GT9B 2MPAL 2D7OA 2C3HA 4XP1L 1UWXK 4P2QB 5KS9E 1R5IB 4RBPK 4AVIA 4OJFH 1NICA 4U6HB 4JMXA 3CLWA 4RFOL 4XMZA 4NO5A 2V7HA 3MBEB 1QW9A 4FQXB 4KO7A 2A9MH 5IMMA 3QXAA 4N86A 3IDJB 3DROB 4ONGH 4TNWK 2I7SA 3KPQB 4R83A 1WFMA 4FXKB 3TBTB 4R4ND 3FONB 2BP0B 3QEQB 2H32H 2TSAA 2YA2A 2BS9A 3KPQA 1DFXA 4U1NA 1Q1PA 3PXHA 5F7MC 2F58L 4B5ZA 4G7VH 1N68A 4ENZA 4WUUB 1FO0B 1FFTB 2WM0A 3DKHA 1P9MC 1E4XH 3PNWA 2P8LB 2E47A 4L4VA 3NSCA 3SD5A 3MMEA 5CP3A 5IESL 2DWTA 5A2JH 5J06A 1KGJA 4BK5A 3U2SB 4P3DB 1MHCB 1MRDL 2HT3D 1A3QA 4GRLA 4MMZA 4OZ4B 3U2SA 4TPRL 1X4XA 3PPSA 4L3AA 2OR9L 1I8LA 1PD1A 1GGIH 4J3SA 2V2TA 5DT1H 2FEDD 2L04A 2X70A 1RVFL 2V2XB 4NN6B 1UQSB 5AAPA 3QFJB 2O5YL 3VXUB 1T6WA 4EI5A 1XCTA 1UOLA 5AZ2L 3UTSA 3LQZA 4ZBJA 5BVPH 4J1UA 5CN1A 3HG1D 2I27N 1UM5L 1I8UA 4I2XB 5HYJE 1X6NA 4QXUH 4X80L 2ZXEB 3VI3B 3NG5A 1WZ1H 3VI4A 5DJXA 2VLKE 3VI4B 3KLSA 1GL4B 1NPUA 3ECWA 4NSKB 5A16A 5I8OH 3QYCA 3SE8L 2DKSA 3FU8A 3TCLB 3BH8A 4KTGA 4QHKI 1Q0XL 2XN0A 1G0YR 3UJTH 2XY2A 4JQIH 3RKDC 3EH5B 3D5OF 1MVUA 1HL9A 4M8QA 4MNQA 4Y19E 3AGWA 3HZMA 1NCWH 1RI8A 1DQDH 1DHKA 3Q1SH 5ESVB 5TDPA 4PJBB 1G7MB 1G7PA 1LP9F 1MCJA 3HZMB 4WI3A 2VO8A 1R24A 1BVLB 5ESVA 1DQJA 2B5IC 3EDJA 3QG6A 5FM5O 4E42B 5F6IB 3CZUB 4JM2D 3FB5B 3ETSA 1M9WA 5FKAA 3L4XA 3QJQB 4L8SB 2ENPA 3FDWA 4JDVA 3T2OA 1HXMB 3HZYA 2PYFA 3FO1A 2J7LA 1MI5E 3EOBB 1U8HA 4OIFA 1GTFA 2YLKA 3P4OA 1E6OL 1VADA 1WFOA 2GBVA 4NHUA 3VI3E 3TV8A 1QFHA 2P5EA 1JD9A 1GIGH 4UQ9A 1IFRA 3HC0A 1LM8V 1N5AB 3QULB 4X5RA 2WGXA 1E30A 4PHZA 4B7IA 4BH7B 3E9UA 3TYFA 4NRYA 4QTFA 1WIPA 4OZIB 3WY1A 3SOBL 3EW3B 3OKMB 4C55A 4PJ9D 2YBRB 3NA9L 2R2BB 3Q5YA 5IV2B 4IYKA 3ALWA 4YZFF 4MQ7A 4LHJB 3VXSE 5IJVB 2AJSH 1Q4NX 2E7HA 3ECBB 4L4VE 1WA1X 3QHTC 5BO0D 1F6AA 1ZHKA 1B6DA 2FB4L 2VDQH 5AOJA 3FU6A 5T5FH 3JVGA 4HS3B 3WUWG 4M7ZB 1MLCA 5TE4H 3LD8C 3LIUA 2ZJSH 4PGCA 1TFHA 1TCMA 3GKZA 3QUXB 4QJ3B 3QUZB 2X4TB 2W0PA 4R0LB 4L1TA 3DX7B 4AQ1A 5D7KE 4M1DL 1OWRM 3JTTB 4H8WH 3Q1SL 3IDMB 3CV5A 3M6DA 4ADIA 1QRND 2YAEA 1S9XB 1TZGL 1D9KB 4PBWD 4XCFH 3U0TA 4HKBB 5E4EB 1HT6A 3HE7A 3MLSL 4HUMB 4KY2A 3F7PC 3TNNA 4HKBA 5EULV 3QO1A 4K7FA 4OZ4A 3NCBB 2PO6A 1IARB 2DLFH 3EYVA 2OMWA 1Y18A 3FS9A 3LKRB 1HKLH 4TNVF 1NC2B 3U7YH 5MENA 4HALA 3WTWA 2EYTB 4BKLB 2DH2A 2PF6A 2AI0H 5CIPH 4EMZA 4FTVE 2AI0L 1IIKA 1CGTA 4MD4B 1EZLA 1CFBA 3BVNA 1F58L 2MEJB 1P7HL 1F58H 4QXGL 4JFEA 4RLDA 5D6DC 3HUJE 3BGMA 1UENA 3AZUA 5JDSA 1IC0A 5CBEB 2DWSA 1RZPA 3V4PL 2WUBH 2W0LA 1IKFL 3C75A 3CC1A 4DQOL 2Z1KA 4U0RB 2OKMA 3OAZK 4XTRC 5DJXB 1I1YA 3QS2A 3PWVB 3QB7C 4LEXH 2QADD 1IM3B 3ABGA 4B41A 3I75B 4D0BB 1BEYL 1EGJA 1OXYA 3X1GA 4IKIA 3SPIA 2YEZB 3FUFA 3PJLA 2CRMA 4HWNA 4YBLC 4YHOL 3TCTA 3CPUA 1R0AL 2G4EA 1S7UA 4LGPB 2H0PA 3C8HA 3L8QA 3OMZA 3GBML 1M1SA 4JY4B 1PNCA 4G1MB 2VW7A 3WY4A 3G6AA 5DHVB 3UXFA 5KVEH 2A77H 2RAMA 5SWZB 1U95B 3LJ3A 1A4JB 1RZKL 4YPGB 4ZD3H 2E59A 4JO4L 2QADC 4HQQH 2ZSVB 1XGUB 3TWCH 5KYWA 1DJGA 4NLAA 4NBZB 2F19H 4HAGA 4J8RA 4E9WA 5IG7A 1E4WH 5IQ7L 4GG6E 1JGLH 2EDTA 4XE0A 2ZTBA 1EEYB 4M3JA 2Y7LA 4H1LH 3QG7H 1OT4A 3N9GH 4KKLD 2AKRB 1HXYA 5DHVH 5C2BH 4DP9X 3LZFH 1HXYB 5I6KA 3D51A 4R7NA 2FWLB 5C0AA 1QQDB 4B5EA 1LEIA 1NA8A 1ZE3C 2PPEA 5D1ZD 1BZ9B 5FCSH 2TAAA 5C0AB 5K9QI 1U8NA 1Z5YD 2IADA 1CLOL 5D2LE 2V33A 3F05A 1FV1B 3D4GA 5AW4B 3CNKA 1HWHB 2X1XR 3SDDD 3HNSL 5D6CB 3RWCA 2E4FA 3QORC 1B3IA 1NBZB 4JFUA 3SY0A 3K6OA 4TL4A 4H1LA 3ZXAC 2ID5A 2XLLA 4IDLA 5BZDB 4H8VA 3U48A 5EU6B 4M6ML 2ICES 4NUPA 5C6TH 3ML9A 3TC9A 2EIZB 3LN4A 4LNRA 1BZOA 2B16A 4R7LA 2O6PA 2VISB 2OXGB 2DMBA 1IGTA 2VISA 3ULUD 2OMBA 3C9NB 3IKCA 1LD9B 3FTWA 4ZPTA 1MCIA 3O9WB 5HJGA 1S9XA 4WFFE 5D1XA 2HVBA 2FX8L 3SBWC 5J7CC 4AZUA 5LO7A 1WHPA 1JCKA 3SE3C 1CTOA 2IPUG 2N01B 3G04A 3SZ6A 5TPWL 3A4AA 1ZSDA 3EO9H 1KNOA 1WEJH 4H8UA 3FT0A 4I0PD 2VERA 2ZP8A 2VLRD 4HUNB 1W72L 1DN0A 3CGTA 1GJUA 5EIIB 1MHHB 3DSNB 2Y69B 3WHE0 4JG5A 3MV9E 1I8IB 4PJXE 3TO4A 3TCXA 3N44B 3B8SA 1AO7B 5ECGA 5C8JA 4M9OA 3O2DA 3TO4B 2IAMB 5D1ZI 4RMUA 4ZUVB 3CTTA 4Z78A 3P11L 2H32A 3NJIA 5DXWA 1PZSA 2YK1L 1KIRA 5DMGC 2V4LA 2QVFB 2AJUL 2R0WL 3UGEA 2BP8B 4PRIE 1F1GA 4L48A 4N5EC 1MI5D 4QR7A 1MNUH 1FYTE 4DN3L 4OB5L 5DD1H 3ULVL 5CSGA 1NDMA 1M3IA 1GGBH 3NDZE 3LDBB 4M6OL 1L5GB 4OIIL 4ZMZA 3IJSA 3KDMB 4G8GE 2YAOA 1DVFC 4JFVA 1Q1JH 5BZXA 5D7LD 3CX5K 1A0QL 3DX6A 3K8KA 3NEXA 4AV4A 2R8SH 3Q2VA 1EHLL 1IFGA 2F18A 3O2DH 1GA2A 1OARL 2JCCE 2AXGB 3ESVF 5ENWB 1MHEB 1OOWA 2EYRA 3BH9A 1W91A 3Q6GL 1FF5A 4IIQA 5DO8A 1Z5HA 1NMCC 5DTFB 1VF5C 2ITCB 3RTLA 3CZKA 1AOHA 3A4EA 3GSRB 4NQCE 3U6XS 5BVPL 2ITCA 4N2KA 5GRWA 5I9QB 3AM8C 5IJKA 1UJ3C 4WRLA 1PEWA 4FMVA 1JZ4A 4U1KB 1UWGL 2J55A 5JORB 4HD9A 1F3JA 3OKNA 3RVXC 2H1XA 3ARBA 4L8CA 1JGIA 4XMWA 4NT6A 5LGJA 3KWTA 4W4NA 1QLEL 2UY7A 3HG0A 1AGBA 2UUDH 3DX8A 3MLRH 2NQCA 4Z3FA 3CFMA 1YEWA 3MOAL 2EEAA 5KW9H 1NBCA 4CJ0A 3V7AG 1AKJB 3BN9C 3L9BA 3MLXL 4MXQD 2ZUUA 2H6PA 4M5ZL 3AREB 1CB4A 4A2DA 3UO1L 1BZQK 4QO1A 1SLXA 2EDKA 3RWHB 4GP4B 5DJCA 3T0EA 4BZ2H 1LQBC 3U9PH 4XMPL 1NGYB 4WV1C 3VXNB 5AZEH 2BVOA 2XXGA 3R7RA 4NM8H 2YA1A 4JRXA 5TD4A 4WHTB 5KBKA 3RWEB 4Q9BA 2P8PA 4EXKA 3LHPL 3W2DH 3SCMD 2PKDA 3H0TA 1PVHA 1JWSA 1XIWB 2WNXA 3WNMA 3DUUB 4RGNE 5EBWB 2BINA 4KX7A 4BV1A 5CEZH 1X5XA 2C3XA 1EHNA 1GCYA 4M1DH 3RRQA 2R2HB 4BZ2A 4XCNB 3CDGB 3T6VA 3MRQA 1R3IH 5TQ0L 5CD5D 1IFHH 2F2HA 2VL5A 2WLLA 3FRUB 2YAMA 2QLVB 4LSTL 4N85A 5I74C 4XCNA 1NMBH 1FG9C 4WFEE 4X98B 3WLBB 1CCZA 3C60A 1M7UA 4ODHH 1P4LB 2HUEA 3CU7A 2WO4A 2E27H 2XQYA 3F6IA 4PRDB 1XL4A 3EGDB 3T9WA 1EVUA 1MHHA 5FYLH 2ARJA 1JE6A 5INDB 5IFHL 4AYFB 4BFIA 4FHJA 2J6WA 3EGDA 3KYAA 4FNRA 1MUJB 4R96A 3P73A 3R8QA 1ETJA 1I7TA 3NAAH 2W5PA 1FAIL 3UBHA 1G9MH 3WTUA 1CLYL 2N3JA 2VTFA 2K0RA 5T3XH 5HDBF 1SN2A 2JI3A 3E8UL 2OQJB 4F8LA 4FQ2H 3ZDZB 1F56A 4S0TD 4TTDC 3OPZL 5DVKA 4KXZH 1UXMA 5ICXA 3FBKA 2EZ0D 1IAIH 3WXWL 4PW3A 5FIEA 4K3DH 3PREA 5AKRA 1RLWA 3ARYA 4HH8A 4XO5A 1OSYA 3FQXB 4JDTL 1E8XA 1JGLL 2W0FA 1DBBH 5D8JH 1D2PA 4HS8L 1YPZA 2WXPA 3QJUB 4IIQC 1CBJA 1G0DA 5TH2A 4P2QD 3WFZA 1FL6A 1YEHL 3BFQG 2X28A 4ONFL 3PXLA 1AZRA 4QHLB 3L1GA 4H8PA 3II3A 4QRRB 1YECH 4ADGA 3HMXH 4E9YA 3PS6A 4Y88A 3QUYD 3ZE2E 1LILA 3V4PB 4PJEE 3QH3B 4PP2B 1QR1B 32C2A 4MCZA 4NDMB 1AVAA 3QCVL 3Q7JA 1W16A 1QSFA 5K33A 2GI0A 1JF1B 3JZYA 4OZGB 5E9DB 3IVKB 1XCQA 4NB7A 4AMWA 4YAQA 4TSCH 5IROD 1XF3B 1SDYA 4EBQL 5HVGB 2LR4A 4M3HA 3F6LA 4DP6X 3VFPB 4F91B 5F71A 3ZKXC 4K0OA 4WY7H 5F6HJ 2TRHA 4WSJA 1NFDA 4KPHL 2C9PA 4JL2A 4RZKA 4V1DE 2NW2A 4NZFA 5I1DB 3FQWA 4NYLA 2BFVH 2EUVA 1FRGH 2HTLD 2VN4A 1DDHA 1AHWB 1YEEL 5I9QC 3QNYB 4NYLB 1VZHA 4X6EA 1FQ9C 2UXGA 4XVSH 2NLJB 4FHKA 1J0KA 1S7TA 5E4EC 1I85C 2HLEB 2VDRL 1NGYA 4X6EB 4YDVB 1KMGA 4JJ5A 1ZJBA 2XTJD 4Y4KD 2UXFA 3X3FL 3C5SB 4DAGH 3VG9C 1MY5A 2N59A 3DWTA 4WTZA 2ZE0A 4AYMC 1PPIA 5SWQA 4D0DA 3QC5X 4BKTC 1RZJH 2UV3A 3BZDA 5T33L 2BWDA 1WGOA 3RWFB 5DGRA 1LO0H 5AW2B 3H9SE 1N4XH 2B59A 2ODHA 1A22B 3MCLL 3RWJA 3IJ9A 1OV8A 1L6PA 2VLKD 1I4FB 1UXLA 3ZO0A 3HRZA 5F6HI 4L0YA 1YMHB 5TGBA 2I9TA 4U7KA 2WXGA 3D33A 2ORBH 4Y1AB 2KZKA 1XH2A 3P9LB 3PJSB 3KYNA 4H88L 4XWOC 2GFBA 4K94L 3IFPB 4N24A 2WTPA 4DPAX 2WWMC 2RFXB 3QI9D 3V0AC 1YJDC 2P47B 5CD3A 1JHKL 4R4BA 2NXZC 4LP8A 4PJHB 5CLXA 1SFHA 4RFEB 1RVFH 1QR4A 3FQUB 4AUYA 2AXHA 5DT1L 1Q72L 4CVZB 1RZFH 2GPZA 3HB3C 4LVOC 4MJ5A 5K93A 2AMGA 2Q3XA 4QWWC 2VMEA 5H4YA 1ZLDA 1MJ8L 3QGVA 1G7LB 1RV6X 2QPFA 4DO6A 4HD5A 1TNNA 4ZUWA 3OF6A 3IYLW 2MSPA 3IRCA 3KG5A 3MOQA 5JQHC 4PWIA 1ES0B 1FNFA 5ICXB 1Y1UA 2BWIA 4FL4B 2X4QA 2VLMD 1HH6B 1SXZA 2AGJH 2CWRA 1Q1JL 4HK0A 5CM1A 2ZWSA 3Q5OA 5BRPA 2YN5A 2CA3A 3PE9A 1FJ1B 4XP6H 1I1RA 3HPLA 1UQSA 4I87A 1KLFA 2FUTA 4J3OG 1AO7E 2WC7A 1B0IA 4XVTL 4QRUA 2R2EA 1R46A 4XWGL 2Y7NA 3ORJA 3IN2A 3BKJL 3KLDA 2K45A 1KYFA 1T3FA 1CFTB 4XCYB 3EO9L 2CIIB 4PSPA 2A6KA 3O6FB 4OGZA 2BPBA 3OB0K 4K2UH 5KSAC 4XBGB 3DRQA 4HZAA 1HK6A 2MOVA 4BFKA 5A16B 4F9PA 5GRJH 4YUEL 4FQ1L 3VVWA 4F58H 4CADA 1BF2A 1JTOA 1PKQA 1SGKA 2YSSB 3UBXB 3V4VA 3GUFA 1MRFH 4Q9QH 2XXFA 1XCQB 4WO0A 5ADPL 1BG1A 3TV3L 2FWUA 4NOFA 4QTIL 4FP8H 4QXGH 1G7MA 1G7PB 4J39A 1NLDL 1T1WB 2V5MA 4GW4B 1MFAL 5L7XL 1ZPUA 3N0PB 3MRJA 1UM6H 2EDFA 2I5YL 3F01A 2XBZA 1JIBA 3A6CL 4LEXL 4X5WA 4KKNA 3G5XB 2WXLA 4JKNA 3H53A 4PPTA 4N5UA 4PYHA 1YMMD 4GMTH 4JN2B 4B9FA 4HIPA 2VW4A 3ATEA 3QUMH 1PZ3A 1XH1A 4FXTA 2VQUA 5JDJA 2I9LA 2XKNA 4LRIA 4JFFE 3X12A 3CFCL 1SY6L 2F6AA 1HQRB 1KFAH 4Z7UB 3AMLA 4JHWL 2BIOA 5CZKA 4Z95H 1TVBA 1WICA 3H2WA 4KDTA 1CK0L 3VI3F 5K69A 1DN2A 1CI3M 1JPGB 2ARWA 4DKFH 1WBYB 4U1SB 4AENB 2NNFA 4YN3A 5LG6A 1O5PA 3D4YA 2V7NB 3FO2B 3T0VA 3KLKA 1SHXA 1VPOL 2EYSB 3GRBA 3MRBA 3HI5L 4E0RB 3L45A 5GGVH 5E8PB 5KVDH 4LOEA 1ZWIA 3OR7B 1DSFL 1XMWA 4IBVA 3QT2A 3PAUA 3HAEA 5I71B 1MCSA 3K4ZA 1MCDA 3FT3A 5EBLB 1FC2D 3HAEB 1F97A 5GPRA 3MCYA 1FNSH 1CL7L 1Z0NA 4LDLB 3LHAA 3QUZA 4BFOA 3P54A 3ZTCC 4Y7MA 5EEVA 1QHOA 3D09A 3FW6A 2F68X 4KTEH 5CLTA 4V2BA 3L9EA 3UO1H 2P5ED 2G2PA 2GYSA 3BCDA 3NIGF 3HE6C 3O6FD 3LD8B 4MDIB 1FZOA 3H6AA 4IRJD 3EYUL 4KNTA 5E94A 2AW2A 3SYQA 2NY3C 4L8BB 3VX1A 3IU3B 3L6FA 5EN2B 1KC5L 4L8BA 3LKRA 5GGTL 3ZOAA 3HC4L 2AJSL 5EN2A 3F84A 3R06B 1NMCB 3ZE2B 3SPHA 5TE7H 1FJ1A 3WDHA 3LH2L 1GW0A 3OAYH 1EFXD 4QRPD 3VWKB 3UJJL 3CU1A 1IB5A 1FHGA 4MNHB 4G5ZL 1DUZB 2HN7B 2GG1A 3US0A 3NESA 5IQLA 2WYIA 1GR7A 2DBLH 3GWJA 4AYID 1PG7L 2O4EA 3LEYH 3NCYP 1CK0H 2ZCKL 4I2XA 4DCQB 1R3IL 1AG0A 2HPTA 4BUQA 1OTTC 2NSXA 5IQ7H 3FT4A 3LRLA 1C12A 1JWUA 4HMCA 2DQIL 1DZ0A 2FEDC 3DVGB 2F1EA 2HJLB 3S5ZA 2SODB 9PCYA 4HIHB 1Z9PA 4NAMA 3VXQB 4XZUB 4KRNA 1KXQA 1K4DA 3GTNA 4JY4A 3RTQA 3ZKND 3O3AA 1TNMA 3F7VB 5EO9A 5C2BL 3E2HB 5K9OA 5KVGH 2EDRA 3NZHL 4M8QB 2AABH 2NNXA 3BX7C 3VWJD 3ARWA 2R1YB 3UAEA 4GW4A 4X6FA 4HK3J 5HGAB 1AXTL 4ZMXA 2R83A 4P2OC 4ZDHA 4AKOA 3AXLB 1V8HA 1JNHB 1AE6L 4X99B 1AQKH 4G9DB 3V0VA 1F02I 5CJXA 4Q0XH 3CFIC 4L8SA 4JZNA 1QWHA 3VD4A 3V5HA 5ETUB 5T33H 3KE0A 5KWYC 4JN1L 4S1SL 3RX5A 1HZKA 5CWSA 4L1LA 2WLMA 2EC9T 3ISYA 5FLVA 3MCLH 2HKHH 3FRPB 1FUNA 2ZCLL 2BFVL 1TITA 4NC1C 2AQQA 4YDKL 2J73A 3TH2T 4UQAA 5LBSA 1Y0LB 5FO9B 4PTUB 4OUUB 1NGZA 1RKRA 1F11B 1MRDH 1P9MA 2AV1B 1HOCA 3K2UH 2N0MA 4HEMA 2PR4H 4NHCL 3L4VA 2JTYA 5KSVB 3Q6GH 1W9XA 2WNWA 1BLNB 1HEZB 3H3PH 5C08D 1E42A 2GVYA 5CGYC 1JV2B 3ECVA 4WI5A 3RGVD 3WFBL 3VXRA 5E2VL 3QORA 3IDGB 3PQYA 1G7JA 2XV0A 4DPCX 1ILUA 2R15A 4HS3A 3V6OE 3QORB 4JO5A 1YCSA 5ICYA 1RMFL 4PJ8A 3QUXA 3WAKA 2NPLX 3GK8L 4EI5C 2X12A 1G7QA 4PGDA 2VXSH 3ZHNA 4YHZH 4O00A 1TZ8A 3APFA 1LO5B 4K23L 4ELMF 1HHKA 1Z9SA 5HI3D 1MG2C 3QDJE 5GS0D 3WN5B 2J8UA 1X5GA 3CIQA 5ILTL 1I1AC 5E8OA 3SIKA 1HNGA 1J8HD 3BVWA 2NZIA 3ZN6A 3TNNB 3A67H 2K8MA 1JGEB 4Y2NA 1P84K 1DSYA 2R0WH 3BOVA 4EN3B 4TULH 5EIQA 2Q6WA 4PVMA 4HXBH 2AK1L 4IGBC 2J8UE 2Q86A 2JCWA 3OF6D 2JKTM 4J7RA 1ASQA 3ZTEA 1MWAL 3DGGA 4DN3H 2HKHL 3AU0A 4FFWD 4ICXA 3ZL1A 4A37A 3QPQC 1KDIA 3F5WA 1M6UA 4S1RL 4JQXC 4F7MA 4JAMB 4WENB 3ULAB 5TE6L 4YDKH 4G8FB 5JDSB 2DQHH 2IBZY 3FK3A 5HHOD 4I4WB 2DQHL 2PUQT 5I8OL 1VIWA 3STZA 2PWGA 4LSSL 5C8JB 4P49A 5DMJB 4X4XA 3B2UC 3BRFA 4YHPB 3QI9A 3KPTA 3B83A 4LRNH 1KPUA 2J44A 2OI9B 2M26A 4XE5B 3UTPE 2G9KA 4N2FA 5CUSL 5FFOA 2B15A 3EZJB 1AYOA 1KCLA 3UZQA 3VFRA 3IK2A 2JJTA 5AZ2H 2V5SA 4HUWB 4BQ9A 1V3MA 4YFLI 4OZIE 5JIKA 1KTDB 2OMVB 1WEJL 4GS7B 3TN0B 2ZCZA 3MV9B 1KLGB 1UT2A 2YAPA 2X9YA 3HLAA 3W9EA 1F4HA 1BVKB 3UYPB 5BV7H 3B2UD 4ODXB 5AWNL 1XCTB 5DJYB 1FH5L 3UTSB 4Y5XC 3TJPA 3ZZSA 1K72A 5GRYA 5F89B 2HYMA 5I19L 5DJYA 1QWUA 1SXCA 3T8VA 1T80A 3OXRA 4QRPB 3JT0A 4U0RC 1T1ZB 3X14B 4Z7QB 1ZDQA 4MNGE 5F7EL 3SGJC 3FU5A 2XCMC 1L9SA 4C47A 1S8DA 3KPRB 2COQA 2CRIA 4WW1B 1NBYB 5D1XE 1YEKH 4JRWA 2QMJA 3DRTB 1F3RB 5DVOA 1OP5K 4IRZL 3L2MA 2X3BA 5J56B 1LEIB 4OZGF 3LPWA 3CCHB 4Z3GA 2J56A 1UWYA 3RDTD 3RZWA 1IGML 1CS6A 1A21A 3VRLE 2ZKMX 4HSCX 3TN0C 1L0PA 3HMXL 2K7PA 3DXAE 3CSYB 3S3DB 5GHWH 1JV5B 3T6ZA 3JV0A 1L6ZA 4WAFA 5EOCJ 3HHSA 4HJSA 1S46A 1B9ZA 3QDMD 4N2BA 3FB5A 2P3YA 3RPKA 3MRRB 3UTTD 3ETBF 4DNLA 5JLZA 5EC1A 3T2NL 4G6KL 2FH8A 2Z0UA 3KM2A 4HFUH 4R2GD 5B1KA 3WY2A 3EOBA 3QXVA 4C56E 4K5NA 3P4MA 2X89A 4TUOA 3A47A 2BZ7A 3RBSA 4ESKA 1TPXC 4UOW0 3WE6A 1JD7A 2F7PA 1OAYL 4I9XA 2D3LA 2YO3A 3CMOL 4IJ3C 1DLFH 3DJZA 3A6OA 3IKCB 3ULVD 3MLZL 3RVVC 3ROLA 4W4OA 5D1XB 1IJ9A 4C83A 5EBWA 5EU3A 1BZDA 1G6RB 3T0EC 3TBWA 3W11D 4E41E 4KKPA 3IJEB 4I3GA 3AWGA 3E8UH 3U9UA 2IXQB 4Z5RA 2PWHA 3MRGA 4HUKB 4PJ7F 3DO7A 4FYSA 8FABA 1KNOB 5FUCC 5FOJA 3X3FH 3D18B 2X6UA 5FYLD 4PRDA 3CZNA 1A02N 1JSYA 4RGMC 3MREB 1TQSA 3MLYH 3GSXA 1G94A 3QFDB 3RPBA 1Z0MA 4BWUA 3R0NA 4JHZA 3MREA 5BW7C 2DLFL 1GOHA 4K8RD 3ELQA 4NKOA 1BYNA 1IGFH 5IJKC 1UA6H 3U4EB 4AL8L 3QUZC 4LMQE 1KPUB 2JQAA 3SE9L 4D9QE 4I0CC 2CIKA 2F08A 3FUDA 1MFUA 5DD6A 3VWJA 1WF5A 5C0GB 5JXED 1KBGL 3WIAA 1EZSA 5LBSL 1XGPB 5AEAA 1H9VA 2X88A 4CSZA 5K59E 2BVEA 5C3LD 3K81A 1HWGB 1OGAE 1WFIA 4TV3A 4X7EC 3KEHA 4KHXL 3GSWA 4LCVA 2CA4A 1E4XI 2F54A 2QGDA 1A8ZA 1EQWA 4ODXA 4BQCA 2IPKB 3U46A 2P7TA 3U6XA 4JFEB 1UXWB 4KDTC 3IBOA 4JFFB 3DX6B 3IF1A 4QMEA 2CQVA 3MLZH 2DIEA 3EYQD 4H26A 1HC1A 1SDDB 2FJHB 2J8UF 1NCGA 2WGNB 5EOQL 1A47A 5FGSA 4D9LL 3OG6B 3NP4A 2DWXA 1JGVL 2ZZUT 3RWGA 1WS8A 2B08A 3R19A 5F6IC 1Q9OA 1IM3A 1XEDA 4R5XA 1CGXA 1H3XA 2DV6A 4QGYA 4JGNA 2X87A 2JJSC 5DSCB 2CM5A 1IVTA 5I8EA 4HULB 4GSDL 2D3JA 1IQDA 3KLAA 4MMXC 3H9ZA 2NW3A 4QNPE 4Z7WF 3DGCR 3H3PL 4NUJA 5LGJB 2BMKB 4GG8A 1NAMH 2W65A 4X8CA 4LVNB 2E8ZA 3DX8B 2YS4A 3INOA 4WFGD 2B4CL 2ZOOA 1DJWA 3OC8A 4S1QH 1B88A 4KXCA 2WVTA 4G7VL 1THCA 4OFVA 4RRPA 1J0YA 4OCXH 1TJMA 2IQAA 4J8RB 3SQBA 2CLZB 1IO4C 5J3HD 4LQFH 4MFHA 3MRIB 4GUPA 2HFGH 5AD0B 2W0KA 3SKNB 4GUOA 1BECA 1KV7A 4K23H 1WT5A 4B9JA 1G7IA 3K6NA 2PR4L 4NKQB 5EFIB 5FA3A 4AKQA 4CSTA 3L3GA 1HAWA 3BUBA 4NNYB 4J12A 5JMOC 4FQIH 3OZ9L 4J8QA 3FUEA 4NNYA 1J05A 2FYYA 2YSTA 3JZ7A 4A6YA 4A63A 3MHZA 1MFAH 3T0DA 4J28A 4UQ2A 4WJ5B 1EXUB 5D7IA 1JWSB 4I0PB 2WANA 3DTXB 1ZLEA 5F1KC 1MI5A 3S36L 4KMTH 1AP2A 4PJXB 2HPOA 3PWPD 3NN8A 3D52A 4HG4J 1OTUC 5IVNA 1NEZB 3ZHLA 2HJKB 3HB3B 2JFCA 2P80D 5TE6H 2ARJQ 2YJQA 3I84A 1CLZL 4PRNA 2JTDA 5I1EH 3OG4B 2A5UA 2OXHB 4LSSH 1CMOA 1OCZB 3W39B 4RVBA 1S7VB 2YD3A 2EO1A 4A6YH 4OF6A 2DYPA 4Y9FA 3WIFA 4HHWA 5D1XC 2WYZA 2ARJB 3DV4A 4KU1A 2VKXA 3ZE1E 4L3EB 2ZOWA 1ZHNA 3SQOL 1BGXH 1S9VB 4M61A 2VJ0A 4NBYB 5IBLC 3RKPA 1JTPA 5T5NF 2JJVA 3IB4A 1XGRB 3BZFB 2BRRH 3BUIA 1CBVL 1Y6MR 5LUMA 1RZ7L 4YHMH 4PWEA 4NWUL 5I1GL 4HUVB 5I30H 4RX4D 1G87A 2IDCA 4FLOA 5IFJB 4FGMA 3SDAD 3G04B 5I16A 4APQD 2VZOA 4NBXB 2OJZL 2R0ZL 3GSQB 5D1XD 3PWUA 2EP6A 3VCLB 1JJUA 1RZ8B 2CXKA 1MFBL 2VXQA 3I9GL 3WOVA 4HLEA 3RVWC 4J4PA 1F4WL 5IEHB 1OKEA 3GMNB 1F4WH 5D7SL 4QOKD 3D39A 3GT6A 4WLCA 4NO3B 4QLWA 3WO4B 3CHOA 3F7LA 1DFBH 5EIIA 4TULL 4ZMNA 1QSEE 5DRXB 1BG9A 4OLZL 2EDEA 1WZLA 3EYFA 1FCGA 2BSRB 2IAMA 1KC5H 4N3TA 1H9DA 3S34H 3C8KB 3WFHA 2GKIA 2YSSA 4ZX5A 3UBXA 5IEKB 4MRBA 1KXVC 4NQSB 1IGIH 3VXMB 3N41F 1BMGA 2X4UB 4XXDB 3VRJA 4L5FH 4XHJD 1QFWM 2VXQH 1E50A 2LVEA 5EOCL 4H8WC 4FXLA 3FAWA 5DURB 3P3RA 4FABH 2A6IB 4OUOA 3CVHA 5JUEL 3GJFH 4WFFD 4AW7A 4GG6B 1SYVB 1QLEB 3D0VA 3FOLA 5I6PA 4DK5A 2DQJH 2OAAA 2VO5A 4LIQH 1UUSA 1JMXA 2YOAA 1KPRA 2WKOA 4HIIA 3VXMD 1J9RA 5IFAH 3AG2B 2AQPA 1EA9C 3EOTH 3O8XD 2D31B 3X11B 3ZW3A 1SJEB 1U8OA 3STBA 3ZHFA 2G60L 1IM3D 4WTXA 4Z23A 5HHPA 2AV7B 2R27A 4LVHC 4JG0L 3TZVC 5AVSB 1T5WA 4A04A 1YYMH 3EF4A 1UM4H 4MD0B 4L3ED 1XT5A 1OY3B 2A9BA 1PY9A 2ENSA 5FGBA 3TLRA 2FYVA 1A9BA 5K1VA 5DVMA 1U8CA 2DEYX 3M1BA 5E56A 3V0JA 1ETZB 1Q9KA 1EHAA 4Q0XL 3WUWA 5AZEL 2OL3H 3HI1A 5A2IH 4Z1PA 4LFHD 1BEYH 1PKQE 2EE0A 1HU8A 3FFCD 4OM0L 4KV5E 3KPPB 4XPTL 2R4SL 1J48A 1C5DB 4XPHH 4CAGA 2HCZX 3W39A 2WIMA 5HHOA 3JV6B 2PCXA 5TE7L 1UA6L 4WI8A 3BVTA 3ZKSD 1NBVH 1KFAL 1CG9B 5KJ7E 1UD5A 1LTXA 2J6EH 5IMLB 2WPGA 2WAHA 1HE8A 3A4DA 3UL4A 4MDIA 4B53A 5JXAL 3LEXB 3LEYL 2E6JA 3PUCA 4KRLB 1PG7X 4AVKA 2VZSA 4NQVB 2QT6A 4K3DL 1TMCB 1ECZA 2H2SD 3B2MA 1FWXA 5EDSA 4HZLB 1T22A 3IAPA 5C0BE 2BVQA 3X1FA 5HHMD 4M7ZC 3OQ3B 4FN0A 2XNAB 4KUZH 4MA7H 2WOYA 1D7CA 4IKLA 2XUWA 4Z7NF 4LLUA 3QXTA 1RZ8A 4GI6A 5BUGA 3LZFL 1KN2H 4F15B 3WTSA 2E7LC 1QNIA 1TQTA 1ZANH 3B3BA 4NO3A 1G9EA 1J8SA 1KGUA 4FQ2L 4YZWA 2DMHA 4LVOB 3ENEA 1C1EL 3BZ5A 5E1IA 3MJ8B 4WFGE 1L9QA 4N9GB 1RPUA 1AZVA 2XYCA 1IILE 2X3CA 3IRZA 3SZKC 5C08A 5D1QB 3E2HC 2XWBA 2J43A 3Q5TA 1JCVA 1NINA 2XZAL 5D1QA 2OMZA 1V55B 2AJUH 2XVLA 4NQSA 4WW2B 3QDGE 1QVOA 4K9EC 1KTJA 4FQJH 4X6CB 4XXDA 2R29A 1MEXL 5CJBA 5CFAA 1T89C 2ZICA 4OB5H 2WLKA 4PWGA 3STLA 3X3GH 2GSGB 2VLJA 1ZOXA 1QG3A 4FC3E 2NZ9D 1BYPA 4JFXB 5HI4C 1PIFA 3WCYA 3V6OA 1A7PL 2P5WA 1EO5A 3CSGA 3QPKA 3ILPB 5F7BA 2VLJB 5JW3H 5HGAA 3NIGB 1DBMH 4RGOH 5DMIH 1SYVA 2J6EL 3CK0L 1T4WA 3KBHE 5C2UB 4R9HA 1RJLB 4NN5C 4U7MA 4DGWC 2IH3B 1KPRB 1T7WA 1U8LA 2FBJL 4U6YA 1RZIA 4UU9A 5C0CE 5J11C 4GINA 4W6WB 1T04B 2EDQA 4P3WA 1DVUA 4LSVL 4IGBA 1DVZA 1PL3A 5C7XH 3C08L 1MCNA 2GJZA 1U8OB 3ZMRA 2F8XC 5HI4D 1G9NL 4PRHE 4YXLL 5JOEA 3FB8B 3JYCA 5JQ6H 4PVNA 1O9ZA 3LYRA 1QBML 3L1FA 3EG9B 4GKNB 5H37A 1EBAA 2GUYA 3VU1A 5AWNH 1AKPA 5F96H 4JM0A 2VLKB 5C7ZA 2VDMB 4L18A 2QTEA 3DX0A 5ACMA 4H1LG 4B6ZA 5HYJB 4E0RA 5B39A 1SF3A 3SE3A 4DAGL 2BCKA 1F4AA 3A67L 3FUNA 3O3BA 3L5HA 4YO0B 4ZOCA 3RVTC 4TNWF 1ZD6A 3EO0B 3ZUCA 4ATWA 3CD4A 2PTVA 5DQDL 1B0RB 1PZUB 2B0SH 4E5XB 1HWWA 1J18A 3Q43A 4XXCC 3VA6A 5C6TL 4R7DB 4ZXBC 1X44A 4NXSA 4YGAB 4OZFB 4OCXL 4LLWB 4P04A 1IJNA 4GB9A 1VZGA 3HE6B 3Q8BA 4OLWH 4LEOA 2F8IA 4DSYA 1E9OA 4LDCA 5F7AA 3U4AA 4PRHB 4XP5L 1OARH 1T83A 2EEFA 1JGEA 1WT5C 1FNGA 1L9OA 2JB5L 3MRMA 4IK6A 3ES6A 1J0JA 4LSVH 3CFDA 1DJSA 3UOAB 4PJ8C 1RZFL 1QTYT 1UA7A 3MRMB 4X9HA 4ZUSA 3WFEL 4BCYA 1ZKAA 3M8OL 2VSDA 4O2EB 4OCRL 2N7SA 1YNKH 4NQDE 4W1TA 2O61A 3IMBA 2KS0A 4Y0GA 4Q2ZB 4FTVD 1NGPH 3VD0A 1DO6A 2A1WL 4QRTA 4ZRGA 4I4WA 1N64L 4LASH 4N8VB 3MJ9L 3DXAD 3GMRB 4M4PA 3P2BA 1JZEA 1GPOL 1R47A 4CU8A 4Z8FL 4NPYA 1G6RL 3NJMA 5AUMA 2NQ3A 4I13B 4XNQB 2Z4TA 1IKNA 1A6VL 4ZMAT 1X5KA 1QRNE 1ZS2A 4NPYB 4PY7B 1R5VA 3VNYA 4MMYB 3MOAH 5KW9L 4A7SA 1KCRH 3F00A 4OCLC 3IDIB 5HHQA 2XIIA 5DS8B 3D39D 3KR3H 3CN3A