1GL1A

Structure of the complex between bovine alpha-chymotrypsin and pmp-c, an inhibitor from the insect locusta migratoria
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
239
Chain Sequence
CGVPAIQPVLSGIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexation of Two Proteic Insect Inhibitors to the Active Site of Chymotrypsin Suggests Decoupled Roles for Binding and Selectivity
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords ALPHA-CHYMOTRYPSIN
total genus 53
structure length 239
sequence length 245
chains with identical sequence B, C
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gl1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gl1A01
3BTTE 3MH4A 3ZVAA 2BD9A 1LHFH 1TGCA 1SOZA 2WPJS 2Z9GA 7LPRA 1PQ5A 3E1XB 1GDNA 3B23B 2HOBA 2EI8A 3P70B 3NKKA 1C2GA 4DJZB 3SQHE 1A0LA 3VB3A 1C2MA 1O2LA 8ESTE 3I29A 2F3CE 4AB9A 3FP8E 1SFQB 1V2JT 2CN0H 1TGSZ 5DKMA 4MPXA 3UY9A 1D9IA 3ODFA 3PO1B 2XWBI 1K28D 1DLKB 4KTSA 4UDWH 2ESTE 1AN1E 4NA7A 1XKAC 4XFQA 4K2YA 2P59A 1C1WH 1C5SA 1YPKH 3GCTG 2XCNA 2XCFA 4JK5A 4K8YA 7ESTE 2ZFRH 3P17H 4X0WU 2GCHF 1EX3A 1PYTD 4CRAA 3GY7A 4OS7A 3LJOA 4Q7YA 2J94A 1P2MA 1O2VA 1ZR0A 4WF8A 1LHDH 1SGDE 3KQEA 1G9IE 1G37A 3MFJA 1O2WA 1RS0A 1AB9C 2GCTC 4JMYA 1GHBG 1O5CB 2Z9KA 3VB5A 1SMFE 1O30A 3LIWA 3H7OA 5E8EH 2V6NA 3FFGA 1FIWA 1C4U2 2H5DA 3SI4H 1CVWH 1UTLM 1PPBH 3ODDA 1P09A 3QTOH 3GOVB 3BTHE 3O8DA 1DM4B 2XXLA 4KTUA 1HAXB 3O8RA 1HDTH 3PWBA 1Y5BT 1CQQA 2ZP0H 1C1MA 1SPJA 4DOQA 1BUIA 3DHKH 1G3CA 3UWJH 1VCPA 2ZHEH 5T3HA 3RC5A 1XUHA 2OC7A 1XVMA 1V2VT 4AGKA 4TYDA 1K21H 1HGTH 1FJSA 1C5WB 1DY9A 2BOKA 3SV6A 1DITH 1RD3B 2J92A 2QXJA 4IGDA 2ZIQH 4FUCA 4INLA 4VGCB 1TMBH 2G00A 1O3IA 1TA2A 2QXGA 3TH4H 3DUXH 1TX7A 2HPPH 3F9HA 3SV9A 1YP9A 1GJ4H 2ZDAH 1GI4A 1EB2A 1O3AA 3URDA 4A5TS 1BRUP 1TPSA 4K3JA 3LH3A 1O2SA 2FP7B 3HGPA 3GISB 4DVAU 3TLOA 4B71A 1KXFA 4U2WA 2VVCA 1G36A 1IQIA 3SU4A 4E7NA 2H5CA 3W95A 5CHAC 1H9HE 3BV9B 4WVPE 1V2NT 2TBSA 1JXPA 1S85A 1V2PT 4FU8A 6CHAB 3BTEE 1PPHE 1Y3VA 1XUKA 1HYLA 2VIQA 2UWPA 5JYIA 1T8OA 1TBZH 2EC9H 2JETC 2SGDE 5EW1H 8LPRA 4OS2A 4D8NA 2PGQB 3GDUA 5BRRE 4NGAH 1MD8A 4E06H 1ELCA 4Z0KA 1V2OT 3K65B 1SLVB 4NZLA 4YT6H 1IHTH 3SI3H 2BY7X 1Z8IB 5CHAB 4IN2A 2CV3A 2VVVA 5F6MA 2PGBB 4HFPB 5C67A 1IAUA 4K69A 4DGJA 1S6FA 1AIXH 1XUGA 4O9VA 1J14A 3S7HB 5HGGA 1SC8U 2ZGHA 1V2LT 4ABDA 3TGJE 3FP6E 1P02A 1S0RA 2ZDVH 4WMEA 2OD3B 3E8LA 2PUQH 3A83A 4CR9A 2Y81A 3OY6U 1L2EA 3VPKA 2BVSH 3CS0A 3H7TA 5C1XA 1P0SH 2XC5A 1GHXH 1GI9B 1RTLA 4K1TA 3UTUH 4CBOA 3RXPA 2XWAA 1HAVB 4TPYA 2GZ9A 3L6PA 1BMLA 1Z1JA 2DUCA 4ASHA 3OSYA 1LVBA 2VGCB 2ZC9H 5JBCS 5T6DA 5A2MH 1ELGA 6GCHF 2O8MA 8GCHG 1O2NA 1QA0A 1AUTC 4UEHH 1CSOE 3TK6A 1Z6JH 1O36A 6CHAC 4FUEA 1L1JA 2J95A 1IOEA 1DVAH 4I7YH 4D76A 1HJAC 2R3UA 1C4Y2 1FY3A 1AKSB 4JZIA 4JZ1A 1HIAB 1O3DA 3B9FH 4K60A 4CR5A 4F4OC 2BD5A 4YOJA 5G4BA 4UFEH 1DWDH 2FMJA 4NWKA 1T31A 4MG3A 1H9IE 3LU9B 1FNIA 2SFAA 3OYPA 4JZEH 2GVFA 5A8ZA 5E0HA 1GJAB 1EB1H 2Z9JA 1BTUA 3MO6A 5I46H 1QBNA 3MU4A 1O2HA 2UWLA 1EJAA 1LPGB 5JPMH 4WXIA 1CT2E 4X6PA 1GG6C 5FX6A 1YPEH 3ZZBA 2QIQA 2I6SA 3MNBA 1SGYE 1J17T 1UCYK 3A7XA 1AFQC 1EUFA 1O3CA 1UVUH 2CMYA 1AB9B 1FY5A 2GCTB 4IMQA 4NZQA 4Y8ZA 3U98H 3UNRA 1GHBF 2GV6A 1A1RA 1KY9A 1E0FD 1CA0B 2C8YB 3MNSA 5DP4A 5A0AE 1P12E 1O3GA 1PPCE 1TNJA 1WTGH 4I8HA 4UFGH 3UPEA 2RCEA 3UWIA 1O5AB 2ZG0H 1UTKA 3ZZ6A 4I31A 1PQ7A 5AF9H 1WTHD 3UOUA 1J15A 4O3TA 2H6MA 4DCDA 1OWJA 3SUEA 1P2IA 3V13A 2LNCA 1WQSA 1PFXC 1HCGA 4X8VH 2BQWB 2Z7FE 3V7TA 1C5MD 1TX8A 1PPZA 1TWXB 2BB4A 1UVSH 2R2WU 3MH7A 2VINA 4K1EA 1QNJA 1WQVH 2PTNA 2G55A 1ID5H 2BLWA 5EPYA 1QJ1B 4NA8A 2ZZUH 3E6PH 1ZTJA 3E91A 1AI8H 1J9CH 4YO9A 1DUAA 1O38A 3ATIA 1Z8JB 4LZ4B 1SGCA 3AW1A 2OC1A 2FLRH 5DG6A 3F9GA 3O8BA 4CHAC 5TCCA 3TNSA 2ZNKH 4Y8XA 1OPHB 3Q3KA 1ZMNA 1NC6A 5GCHF 3MO9A 4AZ2B 1FAKH 3RDZA 5L30H 4XOJA 1NRQH 1IQFA 4O3UA 4GUXA 1XUIA 5EQRA 5ABWA 3VFEA 2FX4A 3RC6A 3M61U 1GI0A 5LGOA 1MQ6A 5J4QA 1IQHA 1BTWA 1BMMH 1DE7H 2BDHA 1GJ7B 3SGQE 1GBAA 1P06A 4GAWA 2FEQH 2BZ6H 1CT0E 5CMXH 4CBNA 4ZHAA 1ZSLA 3S9AA 1ANDA 3GCHC 3EYDA 1CHOF 1S82A 4GCHF 3BG4C 3A84A 1Z1IA 1OS8A 2VH6A 3LGUA 2OCVB 3SJKA 4DY7B 1GI6A 1MZDA 2EEKA 5DP3A 1LTOA 2C93B 1HNEE 1PQ8A 1O2QA 3BIUH 2VWLA 1GGDC 3QGJA 3BTME 1U6QA 4FUIA 1GG6B 1A2CH 2ZO3H 4Q7XA 4AN7A 1C1VH 2BYAX 4ZAEA 2PW8H 1L4ZA 1GHYH 5LH8A 1EAXA 2BQ6B 1C1RA 3KQCA 3MOCA 4E05H 2XNIA 3A7ZA 5C2ZA 1F0RA 2BDAA 1OSSA 1LVOA 1ESTA 1ELDE 2YOLA 4ZHLU 2PKSB 5JBTA 2AYWA 1O3NA 3EA8A 2WV4A 1TRYA 2B0FA 1ABJH 1OYQA 4INKA 5FPSA 1BTZA 3SV8A 1SHHB 3TK9A 3KNXA 3SORA 4BTUB 4ISHH 3ZVBA 4Z6AH 5EW2H 3RXJA 1NRPH 1SGRE 1AFEH 4X1PU 2LPRA 1N8OB 2P8OB 3TGIE 1TOCB 2B9LA 1ESAA 2WUBA 4B2CA 2STBE 1ZHRA 1ZJKA 2XW9A 4LXBH 5EU8A 1A0HB 2C8XB 4FU9A 1AWFH 1YLCA 4ZUHA 1AGJA 2F91A 1AE5A 4A1XA 4FUJA 1MCVA 1C2EA 1WYKA 4FXGH 1HAYB 1MMJN 3EAJA 1XUJA 2FM2A 2ZHDA 3G01A 4A1VA 1BRAA 5IDKA 1O3LA 3QO6A 3HPTB 2O8UA 3W94A 4F49A 3SO3A 2ZTZA 1KLJH 4GPGA 3RXIA 3M37A 3DT0H 3LOXA 3AASA 4IW4E 1SG8B 2QXIA 3RU4E 3M5OA 1HBTH 1N6YA 2F9OA 1C5PA 1TOMH 1GJDB 1RXPA 2GMTC 5AFYH 5C1YA 1NY22 1Y3YA 2ZDNA 2ALVA 3ZVEA 2ZFSA 3PMJA 5L6NH 3FANA 1JIMA 2G5VA 3P8OA 1E38B 1UK2A 3FAOA 3A7VA 1MTVA 1G3BA 3RXTA 1DDJA 3UOPA 1LDTT 4FUGA 3RM0H 4AGJA 1F0UA 4Q80A 4MNWA 4MNVA 5EQSA 2VIPA 4CRBA 4YOIA 5A0CA 1F5RA 3GDSA 1A3EH 1SSXA 1EZUC 1DY8A 8GCHF 1CT4E 3Q00A 4GVUA 2HLCA 2IJOB 3QWCH 2FOMB 1A0JA 5JBBS 2HNTE 1C2LA 2BM2A 2P16A 1MAXA 4NIXA 1CBWB 3MYWA 2BD8A 5CE1A 3T2NA 1FY1A 1KSNA 1ZTKA 3PO1C 3QTVH 2HNTC 1XUFA 1ARCA 3IG6B 1MTSA 3A87A 3LDXH 1D6WA 1EJNA 1NFYA 3M5NA 2D26C 3SJ9A 1HAOH 1BMAA 3CENA 3ZV9A 1IQGA 3L33A 2FZZA 3SUFA 1FIZA 2G81E 2D1JA 4IC6A 4ZHMU 3ZZ8A 3OY5U 1JMOH 2QC2A 4AG2A 2TGAA 3TH3H 4HI3A 5T6FA 1UCYH 2P95A 3RXQA 1O2JA 1AZ8A 1K1IA 5ESBA 1ZGIA 1SLUB 1HAHH 1GBBA 2VVUA 5FPYA 2JH5D 1P2KA 2AEIH 1OWKA 1VGCC 3LGYA 3PMHB 3ATKA 4VGCC 1C2HA 1KXDA 1O3BA 4U01A 2QXHA 1UHBB 4YZUA 3VB4A 5JB8S 1QJ6B 5IYTA 4RSPA 2OINA 3BG8A 3N7OA 3ELAH 4X8SH 4NWLA 3WY8A 3AAUA 4JZDH 4KTCA 3FVFB 4OGYA 2BLOA 4TWWA 2ZGBH 3M7UA 2BX3A 2BD2A 1SBWA 4MLFB 4Y7AA 1OKXA 3U69H 2O8TA 5DO4H 1ACBE 5FXLA 4X2YA 5FBIA 3TPIZ 1GHAF 3ZZCA 1FY4A 2TRMA 2ZKSA 3SU5A 4JCNA 1C4V2 3BTDE 1V2WT 2QV1A 1J16A 5TCAA 1SGEE 1QRXA 2OXSA 1JIRA 2J38A 2FDAA 1QHRB 1O3EA 3S69A 2C90B 1ELVA 1MD7A 1MKWK 1SGIB 1DPOA 3BTFE 4NCYA 4ZKNU 2G51A 1THRH 3ZYDA 3RU4D 2R0LA 1S84A 3A81A 1HV7A 2BVRH 5F03A 2A1DB 2NU4E 4IC5A 3UREA 1EOLA 2ZTYA 1ZHMA 2SNVA 1QL8A 1UMAH 1YBWA 4X6NA 1FI8A 2W7UA 1YLDA 4OS1A 2VWNA 1HXFH 2F9NA 5T6GA 1BHXB 2BD7A 3MU1A 3MTYA 5GCHG 1EKBB 1P01A 4X1RU 1FV9A 1P2QA 2WYJA 3A86A 3DFJA 3BSQA 1BIOA 1SGQE 1Z8GA 2VIDA 1KXAA 1LMWB 4ISNA 1ELBA 3IITA 1ETTH 2PSXA 2BLVA 1C1PA 1G32B 5DK1A 1YCPH 3KHVA 5B6OA 4AYYB 4Y10E 1THPB 1P10A 5E2OA 3RXRA 2KAIA 1HAIH 1T4VH 2ZCLP 1RJXB 1O0DH 3KN2A 3PYHA 2FIRH 4WMFA 3U9AH 4AORA 3A7YA 4LK4A 2OQUA 3HKIB 1Y3WA 2H9HA 1DWCH 2FI5E 1EPTC 4HZHA 1GBCA 4SGAE 1TGBA 1B0FA 1HRTH 1S81A 1CU1A 1O3PB 1FDPA 1GCTB 1HAPH 1ZPBA 1HPGA 1F92A 2A7CA 2EI6A 1CHGA 4FUFA 3D62A 2UUYA 2WPIS 2ZU4A 2ZTXA 2UWOA 3NZIA 1C5LH 1JRSA 3EA9A 1GHVH 2CF8H 3BF6H 4MTBA 1GVLA 2ODYB 2GZ7A 1RIWC 3Q3YA 1OWIA 1ZHPA 5DP9A 3TJOA 3AAVA 4Y79A 3VB7A 5E2PA 3P8FA 2B7DH 1NTPA 4K5ZA 1P05A 4CRCA 4I32A 3B8JA 4JYVH 4B2AA 3NCLA 1NO9H 3UR6A 2ZHFH 4U32A 3DFLA 2XBXA 1EAWA 3SJIA 2FESH 4FU7A 3UR9A 2J2UA 2Y5HA 2A4GA 2GX4A 1FN6A 2JETB 1O3KA 2P8OC 1QL7A 3H5CB 1DXWA 3SBKA 1HJAB 1FPHH 1TNIA 1NRNH 1V2MT 4YOGA 1AFQB 1DWBH 1FY8E 3GCOA 1NS3A 1C5YB 1UHBA 4NIWA 2ANMH 5EXLA 1F5KU 1IQLA 5HMAA 4LOYH 4YLQH 1IQMA 3RP2A 4WY3A 1O31A 1CGHA 1MKWH 4X2VA 3MU5A 4OS5A 5GDSH 4JK6A 1EZXC 1P2NA 4GCHG 1C5TA 2W3IA 3VGCC 3KEEA 4O03A 3RXSA 1ZZZA 3ENSB 1GBIA 1Q31A 1NT1A 2ZDMA 4TWYA 3RXUA 1QQ4A 2M5TA 1LVYA 4BAMB 1BITA 4ISIH 1KYNA 1BTYA 1O3MA 2GD4B 3QZRA 1C5VA 1ZRBA 1TX6A 4BTTB 1O2PA 3D23A 1WV7H 1T8LA 3JZ2B 2A31A 1Y5AT 1C1OA 1GJ6A 3PMAB 1IQKA 1YM0A 1C2JA 1Z6EA 3LC3A 2BTCE 2FTLE 5DP8A 2XTTB 2CJIA 3TJNA 5C20A 1QFKH 5EOKA 3SOSA 3BTGE 3A8BA 1TYNA 1AD8H 1RIWB 3UQVA 1T8NA 5A0BA 1KXBA 5FCRA 1DS2E 3UUZA 1FN8A 1GDQA 1O3FA 1QTFA 1FXYA 1P11E 3K2UA 1Z71A 1LHEH 1O3JA 3P92A 4CHAB 2PR3A 1E36B 3FZDA 3HATH 4DIHH 1O2GH 2GT8A 2NU3E 4ZKOU 2I6QA 1C5XB 1GHAG 1OYTH 1EZQA 3VEQB 3BEFB 3UIRA 2VIOA 1ELFA 5JBAS 5AHGH 1TRMA 2EA3A 1HAGE 1QIXB 1E34B 1P3CA 1BDAA 4XE4A 1SFIA 3NWUA 4X1QU 4X6MA 1GMDF 1HJ8A 4ZH8A 2CF9H 1LCYA 3QX5H 2OTVA 3RXVA 3SQEE 1P3EA 1GBMA 5ESTE 1YF4A 1SR5C 3SW2B 4WH6A 2A2QH 1ZSJA 3E0PB 4Y0ZE 3SUDA 1BMNH 2ZCKP 4FUHA 4FUBA 4UD9H 2C8WB 4ABIA 5F8ZA 1A3BH 1UTMA 2A7JA 2NU2E 2CHAB 1YYY1 4DT7B 5LPFA 1BTXA 1GBKA 4WJG2 1O2MA 1DLEA 1K9OE 3BTWE 2SGFE 1XXDA 4H6SB 1YC0A 1C2DA 3D49H 1C1SA 1AVXA 1MTNB 2BLQA 4CRFA 5FPTA 3LONA 2ZA5A 4TPIZ 2ZU5A 3F68H 3MO3A 3ZVCA 2ZCHP 2A0QB 4U30A 2FOAA 1P9UA 1DX5M 3SGBE 4YM9A 1GBHA 1O32A 1SGTA 1SHYA 2VB0A 3ZVGA 1ZGVA 4H42U 1GBEA 3RXLA 2BDCA 3EGKH 1O5DH 1YPLH 3SU0A 1ESBA 4IBLH 4JYUH 3LC5A 1AZZA 1GMCF 3E3TA 3RLYH 1V2UT 1GVKB 1KTTB 1L1NA 2ZGJA 2ZFTA 1O2XA 1FONA 1YPMH 1ANBA 4GLYA 3L3TA 1CBWC 2WPMS 3OTJE 2GV7A 3HKJB 2CHAC 1G2LA 5L2YH 5K7RA 2D8WA 4NFFA 3MH6A 4DW2U 2A4RA 2VU8E 5DJ7A 3PMBB 1NRRH 1P03A 2BDYA 1VCQA 1MTNC 5EQQA 1Q2WA 2F9VA 1K1OA 1NFUA 3MU0A 1ETRH 2F83A 3TGKE 1OP0A 1H1BA 2XC4A 2ZDKA 4ZROA 1QQUA 1OOKB 2H1UA 2QCYA 1D4PB 3HK3B 4I33A 1M9UA 2FXRA 2OC8A 1ELEE 3K6YA 4MPVA 5F8XA 2ZU1A 2BZAA 1KLTA 4Y8YA 1W14U 2Z3DA 3QK1A 1IQJA 2ANYA 1O2TA 1UTNA 4AFQA 3MMGA 2UUJB 3KF2A 4JZFH 1VCWA 1H4WA 2OUAA 4TY6A 1T32A 1K22H 4BAKB 5AFZH 2YNBA 4Y0YE 3KCGH 3SU6A 2FWWA 2VJ1A 1D3TB 1C5UA 1NFWA 3SGAE 2FO9A 1OWHA 1V2KT 1YPHE 1TPPA 1WUNH 1O33A 3SU1A 3ZZDA 1BBRK 4IMZA 3TIUA 1Y8TA 1MAYA 4AX9H 1F5LA 3KQBA 1F0SA 2G8TA 4MNYA 1HLTH 1WCZA 1C5OH 2FYQA 3PLBA 4R0IA 1A5IA 1C5ZB 1GI3A 1QJ7B 2HGTH 3QLPH 1NRSH 1ARBA 1N8OC 2ANKH 1W0ZU 3LGVA 1C5RA 2ZFQH 1GMHF 3Q76A 2AIQA 3M35A 4BXSA 3BEIB 1A61H 2W5EA 2XRCA 3GY5A 1LHCH 1MU8B 1SGPE 2NU0E 4AOQA 2FOFA 2QY0B 2GZ8A 4BANB 3SNDA 2OLGA 5EODA 4JYTA 5L2ZH 1VITG 3RMMH 4ABEA 4RN6A 2B5TB 1K1LA 3M3SA 4Y6DA 2ZHWH 4Y11E 1O2KA 1XX9A 2O8WA 3LGIA 1WBGB 1LPZB 1C2KA 1MBMA 2BXTH 2HNTF 1KIGH 1UK3A 2BMGB 2A5IA 4UFFH 1BZXE 1DXPA 1KLIH 4QT8C 1MTUA 2ULLA 3GY3A 3S9CA 2P94A 1B5GH 1ZPZA 3SV2H 3AW0A 1HAZB 1CA8B 2THFB 1HAVA 1NZQH 3EE0B 1MKXK 2AMDA 2A4QA 5TJXA 2ZQ1A 3UNQA 1GMCG 2AMPA 1QL9A 4ABBA 2K1QA 1W10U 5F8TA 1FZZA 1BRCE 2AMQA 1A7SA 1BA8B 2ZI2H 1A4WH 1ZOMA 4BNRA 2Y82A 1O2UA 1DICA 5FHTA 3NK8A 4KELA 4Q7ZA 1SLWB 3E90B 4X1SU 4X6OA 4AFZA 2QF0A 2V0BA 3M7TA 2ILNA 3GY4A 3BN9A 4K1SA 3UQOA 2Z9LA 3GY8A 2ZQ2A 4KP0A 9ESTA 3R0FA 4OS6A 5EGMA 3DD2H 1TNLA 5C5OA 3BTQE 1A46H 1PPFE 3QN7A 2G4UA 3M36A 3VXFH 2G52A 3ZZ5A 4B2BA 5HM9A 5K0HA 2BD4A 2FYRA 1RRKA 1MCTA 1CO7E 1O2OA 1CGIE 1P04A 1GBLA 1W13U 3LKWA 2AIPA 2AERH 3RXAA 3GICB 1C5NH 1SQAA 5DGJA 5EPNA 1ZRKA 1H8IH 1UVTH 4ISLA 3BTKE 1BTPA 3U8RH 1A5GH 4M7GA 3ZYEA 1GCDA 3QUMP 4RKOB 3RLWH 2JH6D 2STAE 2BDGA 1MU6B 1GBFA 1GWAA 1BOQA 2ANWA 3PLKA 1ANCA 4BOHA 1K1JA 2R2MB 3KL6A 3CS7A 1EASA 3M3VA 3ZZAA 2H9TH 5E0GA 1HIAA 1F7ZA 4D7GA 1BBRE 4ABHA 5FCKA 2UUFB 2Z3CA 5A8XA 1ZSKA 1V3XA 1XKBC 1L4DA 5LPEA 3STIA 2Z3EA 1QR3E 2OBQA 2P3UB 4WH8A 4WXVA 1W12U 3MHWU 1TMTH 3QGNB 1WU1A 1BT7A 3SNCA 2FLBH 3GDVA 3URCA 3A8AA 1UTQA 3I77A 3M5LA 2SGAA 4NSYA 3UNSA 1V2ST 1GMHG 2GDEH 2ZU3A 3MNCA 4MVNA 1BTHH 3T26A 4NA9H 2FOHA 3SJOA 2H2ZA 1MBQA 2BDBA 1CE5A 2HVXA 4XDEA 1ELTA 1FQ3A 1TALA 3EQ0H 2WUCA 1XVOA 2PKAA 2WINI 2RA0A 1TQ7B 1RTFB 1GI2A 4ABJA 4ABGA 1SOTA 4BAOB 4MPUA 3M3TA 3V12A 1K2I1 1ABIH 1ETSH 2J9NA 2ZHQH 1IQEA 1HJ9A 1QRWA 5DP6A 1SQOA 1TNKA 2PKAB 4ZKSU 2Z6BD 4Y7BA 3U8OH 1G3DA 3PV4A 5SGAE 5FX5A 1S5SA 1RTKA 2ZFFH 2FI4E 3LGTA 2J4IA 2OP9A 4CRGA 1BBRH 4A92A 3T5FH 3MU8A 4I8LA 1OX1A 3PWCA 1GPZA 4UFDH 2FS8A 5GIBA 2PWXA 1CA0C 3A7TA 3STJA 4FVDA 5FAHA 4AG1A 1TBQH 1YPJH 3KGPA 1B0EA 4RKJB 2ODPA 3OX7U 1E37B 1TB6H 2BY9X 1O2YA 3A7WA 3TITA 1SQTA 2AGEX 2FOCA 1VZQH 4YLUA 5GJ4B 1AVWA 3V3MA 1J8AA 3U8TH 1ELAA 4YT7H 1QB6A 2FI3E 1ZYOA 8KME2 1G3EA 3RXDA 2PFEA 1SL3A 1GMDG 1LO6A 2A4OA 3QZQA 2VGCC 4X2XA 3A82A 3EA7A 1LKBA 2W26A 4CRDA 1P2JA 1D3PB 1C1TA 1ORFA 3SHAH 2A5KA 4KKDA 2VH0A 4BAQB 4X2WA 5EXNA 2HPQH 4B1TA 1V2QT 2SNWA 1RGQA 3PLPA 5C3NA 1PYTC 1IQNA 2QA9E 3MWIU 5A8YA 2WV5A 1GJ5H 2XYAA 3LGWA 4FUDA 3TJUA 1DOJA 2BY6X 1O34A 2BY5X 1PQAA 1TMUH 1UVOA 4WMDA 1Y5UT 1AHTH 1MTWA 1GI1A 1AKSA 1AE8H 1D6RA 1O5FH 2ZPSA 3A89A 3RXFA 1DSUA 3SNBA 1PPEE 4AFSA 2QGRA 2WPLS 1C9PA 3TU7H 3Q3XA 2QYIA 3Q77A 3ZZ7A 1O2IA 1SGFA 1GDUA 2XC0A 3GCHB 3T25A 1SVPA 3PTBA 2IN2A 1A5HA 5EG4A 3GY6A 3RC4A 1GCTC 2BHGA 1QBVH 1O39A 1SI5H 1TNGA 1GJBB 4YTAA 1S0QA 4CREA 1GJ8B 4E7RG 5JB9S 3SUGA 2GT7A 2NWNA 3TK5A 1NROH 3HK6B 4ZKRU 3A8DA 1YCPM 2C8ZB 3EDXB 3RMNH 3S7KB 3TVJB 5JDUB 1TAWA 4GHQA 1YPHC 2EI7A 3S9BA 4DG4A 5PTPA 1UCYE 2C3SA 1DWEH 1TABE 3QDZB 1W7XH 1O3HA 2Y5FA 4THNH 1Y3UA 2G4TA 2ALPA 1BJUA 1T7CA 1QB9A 1UJ1A 5DPAA 1HB0B 1LQEA 1RFNA 3NXPA 1VR1H 3RXGA 4NIVA 1O5GH 4Y71A 4O97A 3F6UH 1WSSH 5HM2A 3SHCH 1AWHB 6LPRA 4Q2KA 2OBOA 2GGVB 2FS9A 1FPCH 3LJJA 2A5AA 2DE9A 1T8MA 3KQDA 2PLXA 3KIDU 2HALA 1QURH 4H4FA 1C1UH 1UVPA 2R3YA 3I78A 5BPEA 1MH0A 2J34A 2KAIB 1WAYB 4XBCA 2TGTA 1TLDA 1GL1A 1GI7B 2BOHB 2C4FH 5ETXA 1MQ5A 1LPKB 1AY6H 4NFEA 1Q3XA 1UTOA 3GYLB 2XBVA 1P57B 2FPZA 2DE8A 3ZVDA 2YNAA 3GCTF 4BXWA 1W7GH 2Q1JA 1BHXF 2O9QA 4A6LA 4AB8A 4D9RA 4XSKU 3SNAA 1D3DB 3RXCA 1EPTB 2Z94A 3HGNA 3TJVA 2OQ5A 2PHBA 2F9UA 1N6XA 1XXFA 2RA3A 4BTIB 1W3CA 1VITF 2Y7XA 3RXMA 1DT2A 2AGIX 2PUXB 3K9XB 4GHTA 1HUTH 1PJPA 2GDDA 3ATMA 3NPSA 1KDQB 1AQ7A 1FUJA 3PB1E 1DUEA 1YPGH 1HFDA 3PTNA 1X7AC 1QB1A 1TRNA 3F9FA 2O8LA 1MZAA 3O8CA 1Z7KA 2SGPE 3SU2A 1TONA 1Y59T 3JZ1B 4KGAA 4ISOA 2SGQE 2NU1E 1K1PA 4R8TB 4FVBA 3GY2A 1SLXB 1KDQA 7KMEH 1OP2A 1O35A 1NN6A 5GPIB 1LHGH 2R0KA 2Q6FA 2R9PA 2TIOA 5DP5A 3ZZ3A 1TGNA 1H8DH 3M5MA 4GSOA 2BVXH 2BD3A 1GHWH 4OGXA 1B7XB 2FX6A 1C5QA 3U1JB 3RUOA 1AU8A 3A85A 3S0NA 1S6HA 1MUEB 2Y6TA 1N1LA 5GWZA 1T4UH 1WOFA 9LPRA 1V2TT 4K8BA 2V3HH 1FLEE 3NUMA 6GCHG 2AS9A 3FP7E 2Y80A 3UFAA 1TE0A 2QN5T 3RXBA 1NM6A 4AFUA 3BIVH 1ZJDA 1Z8RA 7GCHG 1EATA 3DA9B 5DP7A 2V35A 1P2OA 3PROA 4LZ1H 1E35B 4D7FA 2Y7ZA 3LT3A 4MPWA 2BX4A 2F9BH 4YESB 3ZV8A 3LH1A 4D9QA 2PSYA 2XBWA 3A88A 1O3OA 4ZXYH 2ZPRA 2IOTA 4CH2B 2A45B 4UE7H 1F2SE 1BRBE 1THSH 1TGTA 1GBJA 1W11U 1OWEA 5HYOA 2ZWLH 1YGCH 5A09A 2XBYA 2FOBA 2Q6GA 2TGDA 1EJMA 5E0JA 3E0NB 1F0TA 2VWMA 4I8KA 1EOJA 4XBBA 5LPRA 4B74A 3RMOH 1AUJA 3P8NA 4OS4A 1INCA 1BJVA 1O2ZA 1O5EH 2A32A 1Y3XA 1OP8A 1FAXA 4J2YB 1GJ9B 1GVZA 2ZU2A 1QBOA 2FOGA 2Z9IA 1NU9A 4NG9H 2BY8X 1JRTA 2ZDLA 3P95A 1DSTA 1UTPA 3F1SB 3F9EA 4X8UH 1AO5A 1C2IA 4NIYA 1GBTA 1L0ZA 3RM2H 1VITH 2FODA 3RXHA 1W2KH 4A7IB 2AFQB 3ZZ4A 1TA6A 1TNHA 3PM3A 3MI4A 1O37A 4INHA 1D3QB 1TPAE 2VWOA 1QY6A 3T29A 1NESE 1NFXA 1ZPCA 2JKHA 1TPOA 3A8CA 5HXFA 2CXVA 3SN8A 1ZTLA 1TFXA 1UTJA 2RDLA 1CHOG 4SGBE 3BG4B 2ODQA 2GCHG 2B8OH 1LVMA 1OWDA 1TBRH 4MQAA 5FBEA 2PV9B 1KTSB 2ASUB 1QRZA 2TGPZ 1GI5A 4UONA 2Q6DA 1EPTA 4AYVB 1ZMJA 2CGAA 2UUKB 1W8BH 1SGNE 1C2FA 3A80A 1QGFA 2FTMA 3ZVFA 4CH8B 1S83A 1G2MA 2TPIZ 3RXKA 3SZNA 4B73A 4BAHB 1LQDB 4DIIH 2A7HA 2G5NA 1TIOA 3GCNA 4NSVA 4X1NU 3T62A 2A2XH 3K6ZA 1JWTA 1UO6A 1GBDA 1O5BB 3BEUA 4Y76A 1L1GA 5AVDA 5GXPA 4A1TA 1BQYA 3M7QA 1EAIA 2W7SA 1IHSH 1OXGA 1W0YH 3VB6A 2WPKS 1CGJE 3V0XA 1NU7B 5C5NA 1QCPA 1XM1A 3TH2H 4B75A 1JOUB 6ESTA 2ZGCA 2ZEBA 2OC0A 1AMHA 7GCHF 3SNEA 2RG3A 3T28A 1BCUH 4WWYA 1G30B 2GKVE 1PPGE 1MKXH 1KXCA 2ZECA 2VIVA 2F9PA 1SGFG 5H4IB 3AVZA 1JBUH 4IS5A 2VIWA 1EQ9A 5J4SA 1V6DA 2FOEA 4I8JA 1BB0B 1H9LB 1K1MA 1YCPK 2VNTA 3D65E 2H9EH 1C1QA 1HXEH 1YKTA 2V3OH 2P3FH 1EP6A 1XMNB 3LPRA 1VJ9U 2PKSC 1GL0E 1P8VC 2ZFPH 1GI8B 3IWMA 2QF3A 4HGCA 1UK4A 4X8TH 3SV7A 4B76A 2GP9B 1O2RA 2ZPQA 1EP5A 3T27A 1ZLRA 1DFPA 4ZXXH 1EZSC 2W3KA 2ZF0H 2WPHS 3ITIA 1C1NA 1TQ0B 1GGDB 1NPMA 1V2RT 4ZMAH 3FZZA 2IPHA 2Y5GA 3RXEA 4TY7A 1P9SA 1VJAU 1FMGA 2JH0D 2ZGXH 2GTBA 4H6TA 4MDSA 3RMLH 1DANH 4I8GA 5EXMA 1EAUA 2AGGX 1C9TA 5C1UA 3CP7A 3ESTA 3MH5A 3ATLA 3P8GA 3ATWA 1AVGH 3RXOA 2D2DA 2BQ7B 1GJCB 1LKAA 3GYMA 4PROA 1QA7A 2QAAA 2HWLB 2BXUH 4DURA 4ABAA 2AH4X 1GHZA 2GMTB 4ABFA 5I25A 1ZMLA 1VGCB 2PTCE 3P6ZB 3ZZ9A 3RU4T 1K1NA 3R3GB 3C27B 3TNTA 3VXEH 1EXFA 1SB1H 2P3TB 4MNXA 4HTCH 3MNXA 4IN1A 3OU0A 2SGEE 4XBDA 2P93A 4J1YA 1ANEA 1KXEA 3SJ8A 4ESTE 2HRVA 3U1IB 2BDIA 3SU3A 3VGCB 3C1KA 2WYGA 3E16B
chains in the Genus database with same CATH superfamily
3BTTE 3MH4A 3ZVAA 2BD9A 1LHFH 1TGCA 1SOZA 2WPJS 2Z9GA 7LPRA 1PQ5A 3E1XB 1GDNA 3B23B 2HOBA 2EI8A 3P70B 3NKKA 1C2GA 4DJZB 3SQHE 1A0LA 3VB3A 1C2MA 1O2LA 8ESTE 3I29A 2F3CE 4AB9A 3FP8E 1SFQB 1V2JT 2CN0H 1TGSZ 5DKMA 4MPXA 3UY9A 1D9IA 3ODFA 3PO1B 2XWBI 1K28D 1DLKB 4KTSA 4UDWH 2ESTE 1AN1E 4NA7A 1XKAC 4XFQA 4K2YA 2P59A 1C1WH 1C5SA 1YPKH 3GCTG 2XCNA 2XCFA 4JK5A 4K8YA 7ESTE 2ZFRH 3P17H 4X0WU 2GCHF 1EX3A 1PYTD 4CRAA 3GY7A 4OS7A 3LJOA 4Q7YA 2J94A 1P2MA 1O2VA 1ZR0A 4WF8A 1LHDH 1SGDE 3KQEA 1G9IE 1G37A 3MFJA 1O2WA 1RS0A 1AB9C 2GCTC 4JMYA 1GHBG 1O5CB 2Z9KA 3VB5A 1SMFE 1O30A 3LIWA 3H7OA 5E8EH 2V6NA 3FFGA 1FIWA 1C4U2 2H5DA 3SI4H 1CVWH 1UTLM 1PPBH 3ODDA 1P09A 3QTOH 3GOVB 3BTHE 3O8DA 1DM4B 2XXLA 4KTUA 1HAXB 3O8RA 1HDTH 3PWBA 1Y5BT 1CQQA 2ZP0H 1C1MA 1SPJA 4DOQA 1BUIA 3DHKH 5CDFE 1G3CA 3UWJH 1VCPA 2ZHEH 5T3HA 3RC5A 1XUHA 2OC7A 1XVMA 1V2VT 4AGKA 4TYDA 1K21H 1HGTH 1FJSA 1C5WB 1DY9A 2BOKA 3SV6A 1DITH 1RD3B 2J92A 2QXJA 4IGDA 2ZIQH 4FUCA 4INLA 4VGCB 1TMBH 2G00A 1O3IA 1TA2A 2QXGA 3TH4H 3DUXH 1TX7A 2HPPH 3F9HA 3SV9A 1YP9A 5FL7D 1GJ4H 2ZDAH 1GI4A 1EB2A 1O3AA 3URDA 4A5TS 1BRUP 1TPSA 4K3JA 4ASUD 3LH3A 1O2SA 5C94A 2KCOA 2FP7B 3HGPA 3GISB 4DVAU 3TLOA 4B71A 4HG6A 1KXFA 4U2WA 1K0HA 2VVCA 1G36A 1IQIA 5EJZA 3SU4A 4E7NA 2H5CA 3W95A 5CHAC 1H9HE 3BV9B 4WVPE 1NBME 1V2NT 2TBSA 1JXPA 1S85A 1V2PT 4FU8A 6CHAB 3BTEE 1PPHE 1VKYA 1Y3VA 1XUKA 1HYLA 2VIQA 2UWPA 5JYIA 1T8OA 1TBZH 2EC9H 2JETC 2SGDE 5EW1H 8LPRA 4OS2A 3DSOA 4D8NA 2PGQB 3GDUA 5BRRE 4NGAH 1MD8A 4E06H 1ELCA 4Z0KA 1V2OT 3F3BA 3K65B 1SLVB 4NZLA 4YT6H 1IHTH 3SI3H 2BY7X 1Z8IB 5CHAB 4IN2A 2L74A 2CV3A 2VVVA 5F6MA 2PGBB 4HFPB 5C67A 1IAUA 4K69A 4DGJA 1S6FA 1AIXH 1XUGA 4O9VA 1J14A 3S7HB 5HGGA 1SC8U 2ZGHA 1V2LT 4ABDA 3TGJE 3FP6E 1P02A 1S0RA 2ZDVH 4WMEA 2OD3B 3E8LA 2PUQH 3A83A 4CR9A 2Y81A 3OY6U 1L2EA 3VPKA 2BVSH 3CS0A 3H7TA 5C1XA 1P0SH 2XC5A 1GHXH 1GI9B 1RTLA 4K1TA 3UTUH 4CBOA 3RXPA 2XWAA 1HAVB 4TPYA 2GZ9A 3L6PA 1BMLA 1Z1JA 2DUCA 4ASHA 3OSYA 1LVBA 2VGCB 2ZC9H 5JBCS 5T6DA 5A2MH 1ELGA 6GCHF 2O8MA 8GCHG 1O2NA 1QA0A 3DCLA 1AUTC 4RI0A 4UEHH 1CSOE 3TK6A 1Z6JH 1O36A 6CHAC 4FUEA 1L1JA 2J95A 1IOEA 1DVAH 4I7YH 4D76A 1HJAC 2R3UA 1C4Y2 1FY3A 2WPDD 1AKSB 4JZIA 4JZ1A 1HIAB 1O3DA 1UW7A 3B9FH 4K60A 4CR5A 4F4OC 2BD5A 4YOJA 5G4BA 4UFEH 1DWDH 2FMJA 4NWKA 1T31A 4MG3A 1H9IE 3LU9B 1FNIA 2SFAA 3OYPA 4JZEH 2GVFA 5A8ZA 5E0HA 1GJAB 3KQ5A 1EB1H 2Z9JA 1BTUA 3MO6A 5I46H 1QBNA 3MU4A 3SYJA 1O2HA 2UWLA 1EJAA 1LPGB 5JPMH 4WXIA 1CT2E 4X6PA 1GG6C 5FX6A 1YPEH 3ZZBA 2QIQA 2I6SA 3MNBA 1SGYE 1J17T 1UCYK 3A7XA 1AFQC 1EUFA 1O3CA 1UVUH 2CMYA 1AB9B 1FY5A 2GCTB 4IMQA 4NZQA 4Y8ZA 3SZEA 3U98H 1GHBF 3UNRA 2GV6A 1A1RA 1KY9A 1E0FD 1CA0B 2C8YB 3MNSA 5DP4A 5A0AE 1P12E 1O3GA 1PPCE 1TNJA 1WTGH 4I8HA 4UFGH 3UPEA 2RCEA 3UWIA 1O5AB 2ZG0H 1UTKA 3ZZ6A 4I31A 1PQ7A 5AF9H 1WTHD 3UOUA 1J15A 4O3TA 2H6MA 4DCDA 1OWJA 3SUEA 1P2IA 3V13A 3OEED 2LNCA 1WQSA 1PFXC 1HCGA 4X8VH 2BQWB 2Z7FE 3DSPA 3V7TA 1C5MD 1TX8A 1PPZA 1TWXB 2BB4A 5C0UA 2HVYB 1SKYE 1UVSH 2KR7A 2R2WU 3MH7A 2VINA 4K1EA 1QNJA 1WQVH 2PTNA 2G55A 1ID5H 2BLWA 5EPYA 1QJ1B 4NA8A 2ZZUH 3E6PH 1ZTJA 3E91A 1AI8H 1J9CH 4YO9A 1DUAA 1O38A 3ATIA 1Z8JB 4LZ4B 1SGCA 3AW1A 2OC1A 2FLRH 2V7QD 5DG6A 3PRBA 3F9GA 3O8BA 4CHAC 5TCCA 3TNSA 2ZNKH 4Y8XA 1OPHB 3Q3KA 1ZMNA 1NC6A 5GCHF 3MO9A 4AZ2B 1FAKH 1COWD 3RDZA 5L30H 4XOJA 1NRQH 1IQFA 4O3UA 4GUXA 1XUIA 5EQRA 5ABWA 3VFEA 2FX4A 2JIZD 3RC6A 3M61U 1GI0A 5LGOA 1MQ6A 5J4QA 1IQHA 1BTWA 1BMMH 1DE7H 2BDHA 1GJ7B 3SGQE 1GBAA 1P06A 4GAWA 2FEQH 2BZ6H 1CT0E 5CMXH 4CBNA 2KZ4A 4ZHAA 3F2HA 1ZSLA 3S9AA 1ANDA 3GCHC 3EYDA 1CHOF 1S82A 4GCHF 3BG4C 3A84A 1Z1IA 1OS8A 2VH6A 3LGUA 2OCVB 3SJKA 4DY7B 3FOAA 1GI6A 1MZDA 2EEKA 5DP3A 1LTOA 2C93B 1HNEE 1PQ8A 1O2QA 3BIUH 2VWLA 1GGDC 3QGJA 3BTME 1U6QA 4FUIA 1GG6B 1A2CH 2ZO3H 4Q7XA 4AN7A 1C1VH 2BYAX 4ZAEA 2PW8H 1L4ZA 1GHYH 5LH8A 1EAXA 2BQ6B 1C1RA 3KQCA 3MOCA 4E05H 2XNIA 3A7ZA 5C2ZA 1F0RA 5DN6D 2BDAA 1OSSA 1LVOA 1ESTA 1ELDE 2YOLA 4ZHLU 2PKSB 5JBTA 2AYWA 1O3NA 1H8HD 3EA8A 2WV4A 1WXRA 1TRYA 2B0FA 1ABJH 1S6LA 1OYQA 4INKA 5FPSA 1BTZA 3SV8A 1SHHB 3TK9A 3KNXA 3SORA 4BTUB 4Q4LA 2YMSD 4ISHH 3ZVBA 4Z6AH 5EW2H 3RXJA 1NRPH 1SGRE 1AFEH 4X1PU 2LPRA 1N8OB 2P8OB 3TGIE 1TOCB 2B9LA 1ESAA 2WUBA 4B2CA 2STBE 1W0JD 1ZHRA 1ZJKA 2XW9A 4LXBH 5EU8A 1A0HB 2C8XB 4FU9A 1AWFH 1YLCA 4ZUHA 1AGJA 2F91A 1AE5A 4A1XA 4FUJA 1MCVA 1C2EA 1WYKA 4FXGH 1HAYB 1MMJN 3PV5A 3EAJA 1XUJA 2FM2A 2ZHDA 3G01A 4A1VA 1BRAA 5IDKA 1O3LA 2IPQX 3QO6A 3HPTB 2O8UA 3W94A 4F49A 3SO3A 2KFWA 2ZTZA 1KLJH 4GPGA 3RXIA 3M37A 3DT0H 3LOXA 3AASA 4IW4E 1SG8B 2QXIA 3RU4E 3M5OA 1HBTH 1N6YA 2F9OA 1C5PA 1TOMH 1GJDB 1RXPA 2GMTC 5AFYH 5C1YA 1NY22 1Y3YA 2ZDNA 2ALVA 3ZVEA 2ZFSA 3PMJA 5L6NH 4I86A 3FANA 1JIMA 2G5VA 3P8OA 1E38B 1UK2A 5C17A 3FAOA 3A7VA 1MTVA 1G3BA 3RXTA 1DDJA 3UOPA 1LDTT 4RT1A 4FUGA 3RM0H 4AGJA 1F0UA 4Q80A 4MNWA 4MNVA 5EQSA 2VIPA 4CRBA 4YOIA 5A0CA 1F5RA 3GDSA 2EY4C 1A3EH 1SSXA 1EZUC 1DY8A 8GCHF 2JJ1D 1CT4E 3Q00A 4GVUA 2HLCA 2IJOB 3QWCH 3KYFA 2FOMB 1A0JA 5JBBS 2HNTE 1C2LA 2BM2A 2P16A 1MAXA 4NIXA 1CBWB 3MYWA 2BD8A 5CE1A 3T2NA 1FY1A 1KSNA 1ZTKA 3PO1C 3QTVH 2HNTC 1XUFA 1ARCA 3IG6B 1MTSA 3A87A 3LDXH 1D6WA 1EJNA 1NFYA 3M5NA 2D26C 3SJ9A 1HAOH 1BMAA 3CENA 3ZV9A 1IQGA 3L33A 2FZZA 3SUFA 1FIZA 2G81E 2D1JA 4IC6A 4ZHMU 3ZZ8A 4ACAA 3OY5U 1E1QD 1JMOH 4Z1MD 2QC2A 4AG2A 2J97A 2TGAA 3TH3H 4HI3A 5T6FA 1UCYH 2P95A 3RXQA 1O2JA 1AZ8A 1K1IA 5ESBA 1ZGIA 1SLUB 1HAHH 1GBBA 2VVUA 5FPYA 2JH5D 1P2KA 2AEIH 1OWKA 1VGCC 3LGYA 3PMHB 2CK3D 3ATKA 4VGCC 1C2HA 1KXDA 1O3BA 4U01A 2QXHA 1UHBB 4YZUA 3VB4A 5JB8S 1QJ6B 5IYTA 4RSPA 2OINA 5KGOA 3BG8A 3N7OA 3DSGA 3ELAH 4X8SH 4NWLA 3WY8A 3AAUA 4JZDH 4KTCA 3FVFB 4OGYA 2BLOA 4TWWA 2ZGBH 3M7UA 2BX3A 2BD2A 1SBWA 4MLFB 4Y7AA 1OKXA 3U69H 2O8TA 5DO4H 1SQRA 1ACBE 5FXLA 4X2YA 3F0OA 5FBIA 3TPIZ 1GHAF 3ZZCA 3WW7A 1FY4A 2TRMA 2ZKSA 3SU5A 4JCNA 1C4V2 3BTDE 1V2WT 2QV1A 1J16A 5TCAA 1SGEE 1QRXA 2OXSA 1JIRA 2J38A 2FDAA 1QHRB 1O3EA 3S69A 2C90B 1ELVA 1MD7A 1MKWK 1SGIB 1DPOA 3BTFE 4NCYA 4ZKNU 2G51A 1THRH 3ZYDA 3RU4D 2R0LA 1S84A 3A81A 1HV7A 2BVRH 5F03A 2A1DB 2NU4E 4IC5A 3UREA 1EOLA 2ZTYA 1ZHMA 2SNVA 1QL8A 1UMAH 1YBWA 4X6NA 1FI8A 2W7UA 1YLDA 4OS1A 2VWNA 1HXFH 2F9NA 5T6GA 1BHXB 2BD7A 3MU1A 3MTYA 5GCHG 1EKBB 1P01A 4X1RU 1FV9A 3AK5A 1P2QA 2WYJA 3A86A 3DFJA 3BSQA 2J98B 1BIOA 1SGQE 1Z8GA 2VIDA 1KXAA 1LMWB 4ISNA 1ELBA 3IITA 1ETTH 2HLDD 2PSXA 2BLVA 1C1PA 2OK5A 1G32B 5DK1A 1YCPH 3KHVA 5B6OA 4AYYB 4Y10E 1THPB 1P10A 5E2OA 3RXRA 2KAIA 1HAIH 1T4VH 2ZCLP 1RJXB 1O0DH 3KN2A 3PYHA 2FIRH 4WMFA 3U9AH 1E79D 3A7YA 4AORA 4LK4A 2OQUA 3HKIB 1Y3WA 2H9HA 1DWCH 2FI5E 1EPTC 4HZHA 1GBCA 4SGAE 1TGBA 1B0FA 1HRTH 1S81A 1CU1A 1O3PB 1FDPA 1GCTB 1HAPH 1ZPBA 1HPGA 1F92A 2A7CA 2EI6A 1CHGA 4FUFA 3D62A 2UUYA 2WPIS 2ZU4A 2ZTXA 2UWOA 3NZIA 1C5LH 2W6ID 1JRSA 3EA9A 1GHVH 2CF8H 3BF6H 4MTBA 1GVLA 2ODYB 2GZ7A 1RIWC 3Q3YA 1OWIA 1ZHPA 5DP9A 3TJOA 3AAVA 4Y79A 3N7DA 3VB7A 5E2PA 3P8FA 2B7DH 1NTPA 4K5ZA 1P05A 4CRCA 4I32A 3B8JA 4JYVH 4B2AA 3NCLA 1NO9H 3UR6A 2ZHFH 4U32A 3DFLA 2XBXA 1EAWA 3SJIA 2FESH 2KX4A 4FU7A 3UR9A 2J2UA 2Y5HA 2A4GA 2GX4A 1FN6A 2JETB 1O3KA 2P8OC 1QL7A 3H5CB 1DXWA 3SBKA 1HJAB 1FPHH 1TNIA 1NRNH 5GNDA 2GJGA 1V2MT 4YOGA 1AFQB 1DWBH 1FY8E 3GCOA 1NS3A 3N7EA 1C5YB 1UHBA 4NIWA 2ANMH 5EXLA 1F5KU 1IQLA 5HMAA 4LOYH 4YLQH 1IQMA 3RP2A 4WY3A 1O31A 1CGHA 1MKWH 4X2VA 3MU5A 4OS5A 5GDSH 4JK6A 1EZXC 1P2NA 4GCHG 1C5TA 2W3IA 3VGCC 3KEEA 4O03A 3RXSA 1ZZZA 3ENSB 1GBIA 1Q31A 1NT1A 2ZDMA 4TWYA 3RXUA 1QQ4A 2JJ2D 1LVYA 2M5TA 4BAMB 1BITA 4ISIH 1KYNA 1BTYA 1O3MA 2GD4B 3QZRA 1C5VA 1ZRBA 1TX6A 4BTTB 1O2PA 3D23A 1WV7H 1T8LA 3JZ2B 2A31A 1Y5AT 1C1OA 1GJ6A 3PMAB 1IQKA 1YM0A 1C2JA 1Z6EA 3LC3A 2BTCE 2FTLE 5DP8A 2XTTB 2CJIA 3TJNA 5C20A 1QFKH 5EOKA 3SOSA 3BTGE 3A8BA 1TYNA 1AD8H 1RIWB 4ACBA 3UQVA 1T8NA 2KM0A 5A0BA 1KXBA 5FCRA 5KEDA 1DS2E 3UUZA 1FN8A 1GDQA 1O3FA 1QTFA 1FXYA 1P11E 3K2UA 1BMFD 1Z71A 4P02A 1LHEH 1O3JA 3P92A 4CHAB 2PR3A 1E36B 3FZDA 3HATH 4DIHH 1O2GH 2GT8A 2NU3E 4ZKOU 2I6QA 1C5XB 1GHAG 1OYTH 1EZQA 3VEQB 3BEFB 3UIRA 2VIOA 1ELFA 5JBAS 2J5UA 5AHGH 5HIZA 1TRMA 2EA3A 1HAGE 1QIXB 1E34B 1P3CA 1BDAA 4XE4A 1SFIA 3NWUA 4X1QU 4X6MA 1GMDF 1HJ8A 4ZH8A 2CF9H 1LCYA 3QX5H 2OTVA 3RXVA 3SQEE 1P3EA 1GBMA 5ESTE 1YF4A 1SR5C 3SW2B 4WH6A 2A2QH 1ZSJA 3E0PB 4Y0ZE 4F55A 3SUDA 1BMNH 2ZCKP 4FUHA 4FUBA 4UD9H 2C8WB 4ABIA 5F8ZA 1A3BH 1UTMA 2A7JA 2NU2E 2CHAB 1YYY1 4DT7B 5LPFA 1BTXA 1GBKA 4WJG2 1O2MA 1DLEA 1K9OE 3BTWE 2SGFE 4YXWD 1XXDA 4H6SB 1YC0A 1C2DA 3D49H 1C1SA 1AVXA 3UAIC 1MTNB 2BLQA 4CRFA 5FPTA 3LONA 2ZA5A 4TPIZ 4AC9A 2ZU5A 3F68H 3MO3A 3ZVCA 2ZCHP 2A0QB 4U30A 2FOAA 1P9UA 1DX5M 3SGBE 4YM9A 1GBHA 1O32A 1SGTA 1SHYA 2VB0A 3ZVGA 1ZGVA 4H42U 1GBEA 3RXLA 2BDCA 3EGKH 1O5DH 1YPLH 3SU0A 1ESBA 4IBLH 4JYUH 3LC5A 1AZZA 1GMCF 3E3TA 3RLYH 1V2UT 1GVKB 1KTTB 1L1NA 2ZGJA 2ZFTA 1O2XA 1FONA 1YPMH 1ANBA 4GLYA 3L3TA 1CBWC 2WPMS 3OTJE 4TSFD 2GV7A 3HKJB 2CHAC 1G2LA 5L2YH 5K7RA 2D8WA 4NFFA 2AHME 3MH6A 4DW2U 2A4RA 2VU8E 5DJ7A 3PMBB 1NRRH 2LP6A 1P03A 2BDYA 3WWBA 1VCQA 2RDEA 1MTNC 3ZIAD 4FETA 5EQQA 1Q2WA 2F9VA 1K1OA 1NFUA 3MU0A 1ETRH 2F83A 3TGKE 1OP0A 1H1BA 2XC4A 2ZDKA 4ZROA 1QQUA 1OOKB 2H1UA 2QCYA 1D4PB 3HK3B 4I33A 1M9UA 2FXRA 2OC8A 1ELEE 3K6YA 4MPVA 5F8XA 2ZU1A 2BZAA 1KLTA 4Y8YA 1W14U 2Z3DA 3QK1A 1IQJA 1H8ED 2ANYA 1O2TA 1UTNA 4AFQA 3MMGA 2UUJB 3KF2A 4JZFH 1VCWA 1H4WA 2OUAA 4TY6A 1T32A 1K22H 4BAKB 5AFZH 2YNBA 4Y0YE 3KCGH 3SU6A 3N99A 2FWWA 2VJ1A 1D3TB 1C5UA 1NFWA 3SGAE 2FO9A 1OWHA 1V2KT 2LELA 1YPHE 1TPPA 1WUNH 2EQNA 1O33A 3SU1A 3ZZDA 2XOKD 1BBRK 4IMZA 3TIUA 1Y8TA 1MAYA 4AX9H 1F5LA 3KQBA 1F0SA 2G8TA 4MNYA 1HLTH 1WCZA 1C5OH 2FYQA 3PLBA 4R0IA 1A5IA 1C5ZB 1GI3A 1QJ7B 2HGTH 5EJ1A 3QLPH 1NRSH 1ARBA 1N8OC 2K8IA 1W0ZU 2ANKH 3LGVA 1C5RA 2ZFQH 1GMHF 3Q76A 2AIQA 3M35A 4BXSA 3BEIB 1A61H 2W5EA 2XRCA 3GY5A 1LHCH 1MU8B 1SGPE 2NU0E 4AOQA 2FOFA 2QY0B 2GZ8A 4BANB 3SNDA 2OLGA 5EODA 4JYTA 5L2ZH 1VITG 3RMMH 4ABEA 4RN6A 2B5TB 1K1LA 3M3SA 4Y6DA 2ZHWH 4Y11E 1O2KA 5B6LA 1E1RD 1XX9A 2O8WA 3LGIA 1WBGB 1LPZB 1C2KA 5EIYA 1MBMA 2BXTH 2HNTF 1OHHD 1KIGH 1UK3A 2BMGB 2A5IA 4UFFH 1BZXE 1DXPA 1KLIH 4QT8C 1MTUA 2ULLA 3GY3A 3S9CA 2P94A 1B5GH 1ZPZA 3SV2H 3AW0A 1HAZB 1CA8B 2THFB 1HAVA 1NZQH 3EE0B 1MKXK 2AMDA 2A4QA 5TJXA 2ZQ1A 3UNQA 1GMCG 1QZ8A 1QL9A 2AMPA 2K1QA 4ABBA 2KCPA 1W10U 5F8TA 1FZZA 1BRCE 2AMQA 1A7SA 1BA8B 2ZI2H 1A4WH 1ZOMA 4BNRA 2Y82A 1O2UA 1DICA 5FHTA 3NK8A 4KELA 4Q7ZA 1SLWB 3E90B 4X1SU 4X6OA 4AFZA 2QF0A 2V0BA 3M7TA 3UB0A 2ILNA 3GY4A 3BN9A 4K1SA 2L6OA 2Z9LA 3UQOA 3GY8A 3VG8A 3OEHD 2ZQ2A 4KP0A 9ESTA 3R0FA 4OS6A 5EGMA 3DD2H 1TNLA 5C5OA 3BTQE 1A46H 1PPFE 3QN7A 2G4UA 3M36A 1YWUA 2G52A 3VXFH 3ZZ5A 4B2BA 5HM9A 5K0HA 2BD4A 2FYRA 1RRKA 1MCTA 1YY3A 1CO7E 1O2OA 3H09A 1CGIE 1P04A 1GBLA 1W13U 3LKWA 2AIPA 2AERH 3RXAA 5HIYA 3GICB 1C5NH 1SQAA 5DGJA 5EPNA 1ZRKA 1H8IH 1UVTH 4ISLA 3BTKE 1BTPA 3U8RH 1A5GH 4M7GA 3ZYEA 1GCDA 3QUMP 4RKOB 3RLWH 2JH6D 2STAE 2BDGA 1MU6B 1GBFA 1GWAA 1BOQA 2ANWA 3PLKA 1ANCA 4BOHA 1K1JA 2R2MB 3KL6A 3CS7A 1EASA 3M3VA 3ZZAA 2H9TH 5E0GA 1HIAA 1F7ZA 4D7GA 1BBRE 4ABHA 5FCKA 2UUFB 2Z3CA 5A8XA 1ZSKA 1V3XA 1XKBC 1L4DA 5LPEA 3STIA 2Z3EA 1QR3E 2OBQA 2P3UB 4WH8A 4WXVA 1W12U 3MHWU 1TMTH 3QGNB 1WU1A 1BT7A 3SNCA 2FLBH 3GDVA 3URCA 3A8AA 1UTQA 3I77A 3M5LA 2SGAA 4NSYA 3UNSA 1V2ST 1GMHG 1FX0B 3F0PA 2GDEH 2ZU3A 3MNCA 4MVNA 1BTHH 3T26A 4NA9H 2FOHA 3SJOA 4XD7D 4Q63A 2H2ZA 1MBQA 2BDBA 1CE5A 2HVXA 4XDEA 1ELTA 1FQ3A 1TALA 3EQ0H 2K0QA 2WUCA 1XVOA 2PKAA 2WINI 2RA0A 1TQ7B 1RTFB 1GI2A 4ABJA 4ABGA 1SOTA 4BAOB 4MPUA 3M3TA 3V12A 1K2I1 1ABIH 1ETSH 2J9NA 4DT4A 2ZHQH 1IQEA 1HJ9A 1QRWA 5DP6A 1SQOA 1TNKA 2PKAB 4ZKSU 2Z6BD 4Y7BA 3U8OH 1G3DA 3PV4A 5SGAE 5FX5A 1S5SA 1RTKA 2ZFFH 2FI4E 3LGTA 4TT3D 2J4IA 2OP9A 4CRGA 2QF5A 1BBRH 3U28C 4A92A 3T5FH 3MU8A 4I8LA 1OX1A 3PWCA 1GPZA 4UFDH 2FS8A 5GIBA 2PWXA 1CA0C 3A7TA 3STJA 4FVDA 5FAHA 4AG1A 1TBQH 1YPJH 3KGPA 1B0EA 4RKJB 2ODPA 3OX7U 1E37B 1TB6H 2BY9X 1O2YA 3A7WA 3TITA 1SQTA 2AGEX 2FOCA 1VZQH 4YLUA 5GJ4B 1AVWA 3V3MA 1J8AA 3U8TH 1ELAA 4YT7H 1QB6A 2FI3E 1ZYOA 8KME2 1G3EA 2WZQA 3RXDA 2PFEA 1SL3A 1GMDG 1LO6A 2A4OA 3QZQA 2VGCC 4X2XA 3A82A 3EA7A 4M9FA 3KYGA 2M2AA 1LKBA 2W26A 4CRDA 1P2JA 1D3PB 1C1TA 1ORFA 3SHAH 2A5KA 4KKDA 2VH0A 4BAQB 4X2WA 5EXNA 2HPQH 4B1TA 1V2QT 4XRNA 2SNWA 1RGQA 3PLPA 5C3NA 1PYTC 1IQNA 2QA9E 3MWIU 5A8YA 2WV5A 1GJ5H 2XYAA 3LGWA 4FUDA 3TJUA 1DOJA 2BY6X 1O34A 2BY5X 1PQAA 1TMUH 1UVOA 4WMDA 1Y5UT 1AHTH 1MTWA 1GI1A 1AKSA 1AE8H 1D6RA 1O5FH 2ZPSA 3A89A 3RXFA 4OM9A 3PRDA 1DSUA 4B6FA 3SNBA 1PPEE 3OAAD 4AFSA 2QGRA 2WPLS 1C9PA 3TU7H 3Q3XA 2QYIA 3Q77A 3ZZ7A 1O2IA 1SGFA 1GDUA 2XC0A 3GCHB 3T25A 1SVPA 3PTBA 2IN2A 1A5HA 3PV2A 5EG4A 3GY6A 3RC4A 1GCTC 2BHGA 1QBVH 1O39A 2JDID 1SI5H 1TNGA 1GJBB 4YTAA 1S0QA 4CREA 1GJ8B 4E7RG 5JB9S 3SUGA 2GT7A 2NWNA 3TK5A 1NROH 3HK6B 4ZKRU 3A8DA 1YCPM 2C8ZB 3EDXB 3RMNH 3S7KB 3TVJB 5JDUB 1TAWA 4GHQA 1YPHC 2EI7A 3S9BA 4DG4A 5PTPA 1UCYE 2C3SA 1DWEH 1TABE 3W1EA 3QDZB 1W7XH 1O3HA 2Y5FA 4THNH 5KECA 1Y3UA 2G4TA 2ALPA 1BJUA 1T7CA 2WV9A 1QB9A 1UJ1A 5DPAA 1HB0B 3NRLA 1LQEA 1RFNA 3NXPA 1VR1H 3RXGA 4NIVA 2J98A 1O5GH 4Y71A 3OE7D 4O97A 3F6UH 1WSSH 5HM2A 3SHCH 1AWHB 6LPRA 4Q2KA 2OBOA 2GGVB 2FS9A 1FPCH 3LJJA 2A5AA 2DE9A 1T8MA 3KQDA 2PLXA 3KIDU 2HALA 1QURH 4H4FA 1C1UH 1UVPA 2R3YA 3I78A 5BPEA 1MH0A 2J34A 1W0KD 1WAYB 2KAIB 4XBCA 2TGTA 1TLDA 1GL1A 1GI7B 2BOHB 2C4FH 5ETXA 1MQ5A 1LPKB 1AY6H 4NFEA 1Q3XA 1UTOA 3GYLB 2XBVA 1P57B 2FPZA 2DE8A 3ZVDA 2YNAA 3GCTF 4BXWA 1W7GH 2Q1JA 1BHXF 2O9QA 4A6LA 4AB8A 4D9RA 4XSKU 3SNAA 1D3DB 3RXCA 1EPTB 2Z94A 3HGNA 3TJVA 2OQ5A 2PHBA 2F9UA 1N6XA 1XXFA 2RA3A 4BTIB 1W3CA 1VITF 2Y7XA 3RXMA 2KCAA 1DT2A 2AGIX 2PUXB 3K9XB 4GHTA 1HUTH 1PJPA 5IK2D 2GDDA 3ATMA 3NPSA 1KDQB 3EE7A 2YMSB 1AQ7A 1FUJA 3PB1E 1DUEA 1YPGH 1HFDA 2YMSC 3PTNA 3OFND 1X7AC 1QB1A 1TRNA 3F9FA 2O8LA 1MZAA 3O8CA 1Z7KA 2SGPE 3SU2A 1TONA 1Y59T 5F53A 3JZ1B 4KGAA 4ISOA 2SGQE 2NU1E 1K1PA 4R8TB 4FVBA 3GY2A 1SLXB 1KDQA 7KMEH 1OP2A 1O35A 1NN6A 5GPIB 1LHGH 2R0KA 5HKKD 2Q6FA 2R9PA 2TIOA 5DP5A 3ZZ3A 1TGNA 1H8DH 3M5MA 4GSOA 4ZCNA 2BVXH 2BD3A 1GHWH 4OGXA 1B7XB 2FX6A 1C5QA 3U1JB 3RUOA 1AU8A 3A85A 3S0NA 5DSFA 1S6HA 1MUEB 2Y6TA 4FOUC 1N1LA 5GWZA 1T4UH 1WOFA 9LPRA 1V2TT 4K8BA 2V3HH 1FLEE 5CHBA 3NUMA 6GCHG 2AS9A 3FP7E 2Y80A 3UFAA 1TE0A 2QN5T 3RXBA 1NM6A 4AFUA 3BIVH 1ZJDA 1Z8RA 7GCHG 1EATA 3DA9B 5DP7A 2F4LA 2V35A 1P2OA 3PROA 4LZ1H 1E35B 4D7FA 2VBCA 2Y7ZA 3LT3A 4MPWA 2BX4A 2F9BH 4YESB 3ZV8A 2IJD1 3LH1A 4D9QA 2PSYA 2XBWA 3A88A 1O3OA 4ZXYH 2ZPRA 2IOTA 4CH2B 2A45B 4UE7H 1F2SE 5C0TA 1BRBE 1THSH 1TGTA 1GBJA 1W11U 1OWEA 5HYOA 2ZWLH 1YGCH 5A09A 2XBYA 2FOBA 2Q6GA 2TGDA 1EJMA 5E0JA 3E0NB 1F0TA 2VWMA 4I8KA 2RFKC 1EOJA 4XBBA 5LPRA 4B74A 3RMOH 1AUJA 3P8NA 4OS4A 1INCA 1BJVA 1O2ZA 1O5EH 2A32A 1Y3XA 1OP8A 1FAXA 4J2YB 3OTPA 1GJ9B 1GVZA 2ZU2A 1QBOA 2FOGA 2Z9IA 1NU9A 4NG9H 2BY8X 1JRTA 2ZDLA 3P95A 1DSTA 1UTPA 3F1SB 3F9EA 3FKSD 4X8UH 1AO5A 1C2IA 4NIYA 3FN8A 2WHXA 1GBTA 1L0ZA 3RM2H 1VITH 2FODA 3RXHA 1W2KH 4A7IB 2AFQB 3ZZ4A 2QE7D 1TA6A 1TNHA 3PM3A 3MI4A 1O37A 2W6JD 4INHA 2F43B 1D3QB 1TPAE 2VWOA 1QY6A 1WDIA 3T29A 1NESE 1NFXA 1ZPCA 2JKHA 1TPOA 2KCYA 3A8CA 5HXFA 2CXVA 3SN8A 1ZTLA 1TFXA 1UTJA 2RDLA 1CHOG 4SGBE 3BG4B 2ODQA 2GCHG 2B8OH 1LVMA 1OWDA 1TBRH 4MQAA 5FBEA 2PV9B 3F2FA 1KTSB 2ASUB 1QRZA 2TGPZ 1GI5A 4UONA 2Q6DA 1EPTA 3FO8D 4AYVB 1ZMJA 2CGAA 2UUKB 1W8BH 1SGNE 5T1VA 1C2FA 3A80A 1QGFA 2FTMA 3ZVFA 4CH8B 1S83A 1G2MA 2TPIZ 3RXKA 3SZNA 4B73A 4BAHB 1LQDB 2WSSD 4DIIH 2A7HA 2G5NA 1TIOA 3GCNA 4NSVA 4X1NU 3T62A 2A2XH 3K6ZA 1JWTA 1UO6A 1GBDA 1O5BB 3BEUA 4Y76A 1L1GA 5AVDA 5GXPA 4A1TA 1BQYA 3M7QA 1EAIA 2W7SA 1IHSH 1OXGA 1W0YH 3VB6A 2WPKS 1CGJE 3V0XA 1NU7B 5C5NA 1QCPA 1XM1A 3TH2H 4B75A 1JOUB 6ESTA 2ZGCA 2ZEBA 2OC0A 1AMHA 7GCHF 3SNEA 2RG3A 3T28A 1BCUH 4WWYA 3MQKC 1G30B 2GKVE 1PPGE 1MKXH 1KXCA 2ZECA 2VIVA 2F9PA 1SGFG 5H4IB 2V3MA 3AVZA 1JBUH 4IS5A 2VIWA 1EQ9A 4F48B 5J4SA 1V6DA 2FOEA 4I8JA 1BB0B 1H9LB 1K1MA 1MABB 1YCPK 2VNTA 3D65E 2H9EH 1C1QA 1HXEH 1YKTA 2V3OH 2P3FH 1EP6A 1XMNB 3LPRA 1VJ9U 2PP6A 2PKSC 3WWFA 1GL0E 1P8VC 2ZFPH 1GI8B 3IWMA 2QF3A 4HGCA 1UK4A 4X8TH 3SV7A 4B6EA 4B76A 2GP9B 1O2RA 2ZPQA 1EP5A 3T27A 1ZLRA 1DFPA 4ZXXH 4RT0A 3F2GA 1EZSC 2W3KA 2ZF0H 2WPHS 3ITIA 3CNRA 4P00A 1C1NA 1TQ0B 1GGDB 1NPMA 1V2RT 4ZMAH 3FZZA 2IPHA 1YLNA 2Y5GA 3RXEA 4TY7A 1P9SA 1VJAU 1FMGA 2JH0D 2ZGXH 2GTBA 4H6TA 4MDSA 3RMLH 1DANH 4I8GA 5EXMA 1EAUA 2AGGX 1C9TA 5C1UA 3CP7A 5EJLA 3ESTA 3MH5A 3ATLA 1NBMD 3P8GA 3ATWA 1AVGH 3RXOA 2D2DA 2BQ7B 1GJCB 1LKAA 3GYMA 4PROA 1QA7A 2QAAA 2HWLB 1KMHB 2BXUH 4DURA 4ABAA 2AH4X 1GHZA 2GMTB 4ABFA 5I25A 1ZMLA 1VGCB 2PTCE 3GS9A 3P6ZB 3ZZ9A 3RU4T 1K1NA 3R3GB 3C27B 2QF4A 3TNTA 3VXEH 1EXFA 1SB1H 2P3TB 4MNXA 4HTCH 3MNXA 4IN1A 3OU0A 1EFRD 2SGEE 4XBDA 2P93A 4J1YA 1ANEA 1KXEA 3SJ8A 4ESTE 2HRVA 3U1IB 2BDIA 3SU3A 3VGCB 3C1KA 2WYGA 3E16B 2XNDD
chains in the Genus database with same CATH topology
3BTTE 3MH4A 3ZVAA 2BD9A 1LHFH 1TGCA 1SOZA 2WPJS 2Z9GA 7LPRA 1PQ5A 3E1XB 1GDNA 3B23B 2HOBA 2EI8A 3P70B 3NKKA 1C2GA 4DJZB 3SQHE 1A0LA 3VB3A 1C2MA 1O2LA 8ESTE 3I29A 2F3CE 4AB9A 3FP8E 1SFQB 1V2JT 2CN0H 1TGSZ 5DKMA 4MPXA 3UY9A 1D9IA 3ODFA 3PO1B 2XWBI 1K28D 1DLKB 4KTSA 4UDWH 2ESTE 1AN1E 4NA7A 1XKAC 4XFQA 4K2YA 2P59A 1C1WH 1C5SA 1YPKH 3GCTG 2XCNA 2XCFA 4JK5A 4K8YA 7ESTE 2ZFRH 3P17H 4X0WU 2GCHF 1EX3A 1PYTD 4CRAA 3GY7A 4OS7A 3LJOA 4Q7YA 2J94A 1P2MA 1O2VA 1ZR0A 4WF8A 1LHDH 1SGDE 3KQEA 1G9IE 1G37A 3MFJA 1O2WA 1RS0A 1AB9C 2GCTC 4JMYA 1GHBG 1O5CB 2Z9KA 3VB5A 1SMFE 1O30A 3LIWA 3H7OA 5E8EH 2V6NA 3FFGA 1FIWA 1C4U2 2H5DA 3SI4H 1CVWH 1UTLM 1PPBH 3ODDA 1P09A 3QTOH 3GOVB 3BTHE 3O8DA 1DM4B 2XXLA 4KTUA 1HAXB 3O8RA 1HDTH 3PWBA 1Y5BT 1CQQA 2ZP0H 1C1MA 1SPJA 4DOQA 1BUIA 3DHKH 1G3CA 3UWJH 1VCPA 2ZHEH 5T3HA 3RC5A 1XUHA 2OC7A 1XVMA 1V2VT 4AGKA 4TYDA 1K21H 1HGTH 1FJSA 1C5WB 1DY9A 2BOKA 3SV6A 1DITH 1RD3B 2J92A 2QXJA 4IGDA 2ZIQH 4FUCA 4INLA 4VGCB 1TMBH 2G00A 1O3IA 1TA2A 2QXGA 3TH4H 3DUXH 1TX7A 2HPPH 3F9HA 3SV9A 1YP9A 1GJ4H 2ZDAH 1GI4A 1EB2A 1O3AA 3URDA 4A5TS 1BRUP 1TPSA 4K3JA 3LH3A 1O2SA 2FP7B 3HGPA 3GISB 4DVAU 3TLOA 4B71A 1KXFA 4U2WA 2VVCA 1G36A 1IQIA 3SU4A 4E7NA 2H5CA 3W95A 5CHAC 1H9HE 3BV9B 4WVPE 1V2NT 2TBSA 1JXPA 1S85A 1V2PT 4FU8A 6CHAB 3BTEE 1PPHE 1Y3VA 1XUKA 1HYLA 2VIQA 2UWPA 5JYIA 1T8OA 1TBZH 2EC9H 2JETC 2SGDE 5EW1H 8LPRA 4OS2A 4D8NA 2PGQB 3GDUA 5BRRE 4NGAH 1MD8A 4E06H 1ELCA 4Z0KA 1V2OT 3K65B 1SLVB 4NZLA 4YT6H 1IHTH 3SI3H 2BY7X 1Z8IB 5CHAB 4IN2A 2CV3A 2VVVA 5F6MA 2PGBB 4HFPB 5C67A 1IAUA 4K69A 4DGJA 1S6FA 1AIXH 1XUGA 4O9VA 1J14A 3S7HB 5HGGA 1SC8U 2ZGHA 1V2LT 4ABDA 3TGJE 3FP6E 1P02A 1S0RA 2ZDVH 4WMEA 2OD3B 3E8LA 2PUQH 3A83A 4CR9A 2Y81A 3OY6U 1L2EA 3VPKA 2BVSH 3CS0A 3H7TA 5C1XA 1P0SH 2XC5A 1GHXH 1GI9B 1RTLA 4K1TA 3UTUH 4CBOA 3RXPA 2XWAA 1HAVB 4TPYA 2GZ9A 3L6PA 1BMLA 1Z1JA 2DUCA 4ASHA 3OSYA 1LVBA 2VGCB 2ZC9H 5JBCS 5T6DA 5A2MH 1ELGA 6GCHF 2O8MA 8GCHG 1O2NA 1QA0A 1AUTC 4UEHH 1CSOE 3TK6A 1Z6JH 1O36A 6CHAC 4FUEA 1L1JA 2J95A 1IOEA 1DVAH 4I7YH 4D76A 1HJAC 2R3UA 1C4Y2 1FY3A 1AKSB 4JZIA 4JZ1A 1HIAB 1O3DA 3B9FH 4K60A 4CR5A 4F4OC 2BD5A 4YOJA 5G4BA 4UFEH 1DWDH 2FMJA 4NWKA 1T31A 4MG3A 1H9IE 3LU9B 1FNIA 2SFAA 3OYPA 4JZEH 2GVFA 5A8ZA 5E0HA 1GJAB 1EB1H 2Z9JA 1BTUA 3MO6A 5I46H 1QBNA 3MU4A 1O2HA 2UWLA 1EJAA 1LPGB 5JPMH 4WXIA 1CT2E 4X6PA 1GG6C 5FX6A 1YPEH 3ZZBA 2QIQA 2I6SA 3MNBA 1SGYE 1J17T 1UCYK 3A7XA 1AFQC 1EUFA 1O3CA 1UVUH 2CMYA 1AB9B 1FY5A 2GCTB 4IMQA 4NZQA 4Y8ZA 3U98H 3UNRA 1GHBF 2GV6A 1A1RA 1KY9A 1E0FD 1CA0B 2C8YB 3MNSA 5DP4A 5A0AE 1P12E 1O3GA 1PPCE 1TNJA 1WTGH 4I8HA 4UFGH 3UPEA 2RCEA 3UWIA 1O5AB 2ZG0H 1UTKA 3ZZ6A 4I31A 1PQ7A 5AF9H 1WTHD 3UOUA 1J15A 4O3TA 2H6MA 4DCDA 1OWJA 3SUEA 1P2IA 3V13A 2LNCA 1WQSA 1PFXC 1HCGA 4X8VH 2BQWB 2Z7FE 3V7TA 1C5MD 1TX8A 1PPZA 1TWXB 2BB4A 1UVSH 2R2WU 3MH7A 2VINA 4K1EA 1QNJA 1WQVH 2PTNA 2G55A 1ID5H 2BLWA 5EPYA 1QJ1B 4NA8A 2ZZUH 3E6PH 1ZTJA 3E91A 1AI8H 1J9CH 4YO9A 1DUAA 1O38A 3ATIA 1Z8JB 4LZ4B 1SGCA 3AW1A 2OC1A 2FLRH 5DG6A 3F9GA 3O8BA 4CHAC 5TCCA 3TNSA 2ZNKH 4Y8XA 1OPHB 3Q3KA 1ZMNA 1NC6A 5GCHF 3MO9A 4AZ2B 1FAKH 3RDZA 5L30H 4XOJA 1NRQH 1IQFA 4O3UA 4GUXA 1XUIA 5EQRA 5ABWA 3VFEA 2FX4A 3RC6A 3M61U 1GI0A 5LGOA 1MQ6A 5J4QA 1IQHA 1BTWA 1BMMH 1DE7H 2BDHA 1GJ7B 3SGQE 1GBAA 1P06A 4GAWA 2FEQH 2BZ6H 1CT0E 5CMXH 4CBNA 4ZHAA 1ZSLA 3S9AA 1ANDA 3GCHC 3EYDA 1CHOF 1S82A 4GCHF 3BG4C 3A84A 1Z1IA 1OS8A 2VH6A 3LGUA 2OCVB 3SJKA 4DY7B 1GI6A 1MZDA 2EEKA 5DP3A 1LTOA 2C93B 1HNEE 1PQ8A 1O2QA 3BIUH 2VWLA 1GGDC 3QGJA 3BTME 1U6QA 4FUIA 1GG6B 1A2CH 2ZO3H 4Q7XA 4AN7A 1C1VH 2BYAX 4ZAEA 2PW8H 1L4ZA 1GHYH 5LH8A 1EAXA 2BQ6B 1C1RA 3KQCA 3MOCA 4E05H 2XNIA 3A7ZA 5C2ZA 1F0RA 2BDAA 1OSSA 1LVOA 1ESTA 1ELDE 2YOLA 4ZHLU 2PKSB 5JBTA 2AYWA 1O3NA 3EA8A 2WV4A 1TRYA 2B0FA 1ABJH 1OYQA 4INKA 5FPSA 1BTZA 3SV8A 1SHHB 3TK9A 3KNXA 3SORA 4BTUB 4ISHH 3ZVBA 4Z6AH 5EW2H 3RXJA 1NRPH 1SGRE 1AFEH 4X1PU 2LPRA 1N8OB 2P8OB 3TGIE 1TOCB 2B9LA 1ESAA 2WUBA 4B2CA 2STBE 1ZHRA 1ZJKA 2XW9A 4LXBH 5EU8A 1A0HB 2C8XB 4FU9A 1AWFH 1YLCA 4ZUHA 1AGJA 2F91A 1AE5A 4A1XA 4FUJA 1MCVA 1C2EA 1WYKA 4FXGH 1HAYB 1MMJN 3EAJA 1XUJA 2FM2A 2ZHDA 3G01A 4A1VA 1BRAA 5IDKA 1O3LA 3QO6A 3HPTB 2O8UA 3W94A 4F49A 3SO3A 2ZTZA 1KLJH 4GPGA 3RXIA 3M37A 3DT0H 3LOXA 3AASA 4IW4E 1SG8B 2QXIA 3RU4E 3M5OA 1HBTH 1N6YA 2F9OA 1C5PA 1TOMH 1GJDB 1RXPA 2GMTC 5AFYH 5C1YA 1NY22 1Y3YA 2ZDNA 2ALVA 3ZVEA 2ZFSA 3PMJA 5L6NH 3FANA 1JIMA 2G5VA 3P8OA 1E38B 1UK2A 3FAOA 3A7VA 1MTVA 1G3BA 3RXTA 1DDJA 3UOPA 1LDTT 4FUGA 3RM0H 4AGJA 1F0UA 4Q80A 4MNWA 4MNVA 5EQSA 2VIPA 4CRBA 4YOIA 5A0CA 1F5RA 3GDSA 1A3EH 1SSXA 1EZUC 1DY8A 8GCHF 1CT4E 3Q00A 4GVUA 2HLCA 2IJOB 3QWCH 2FOMB 1A0JA 5JBBS 2HNTE 1C2LA 2BM2A 2P16A 1MAXA 4NIXA 1CBWB 3MYWA 2BD8A 5CE1A 3T2NA 1FY1A 1KSNA 1ZTKA 3PO1C 3QTVH 2HNTC 1XUFA 1ARCA 3IG6B 1MTSA 3A87A 3LDXH 1D6WA 1EJNA 1NFYA 3M5NA 2D26C 3SJ9A 1HAOH 1BMAA 3CENA 3ZV9A 1IQGA 3L33A 2FZZA 3SUFA 1FIZA 2G81E 2D1JA 4IC6A 4ZHMU 3ZZ8A 3OY5U 1JMOH 2QC2A 4AG2A 2TGAA 3TH3H 4HI3A 5T6FA 1UCYH 2P95A 3RXQA 1O2JA 1AZ8A 1K1IA 5ESBA 1ZGIA 1SLUB 1HAHH 1GBBA 2VVUA 5FPYA 2JH5D 1P2KA 2AEIH 1OWKA 1VGCC 3LGYA 3PMHB 3ATKA 4VGCC 1C2HA 1KXDA 1O3BA 4U01A 2QXHA 1UHBB 4YZUA 3VB4A 5JB8S 1QJ6B 5IYTA 4RSPA 2OINA 3BG8A 3N7OA 3ELAH 4X8SH 4NWLA 3WY8A 3AAUA 4JZDH 4KTCA 3FVFB 4OGYA 2BLOA 4TWWA 2ZGBH 3M7UA 2BX3A 2BD2A 1SBWA 4MLFB 4Y7AA 1OKXA 3U69H 2O8TA 5DO4H 1ACBE 5FXLA 4X2YA 5FBIA 3TPIZ 1GHAF 3ZZCA 1FY4A 2TRMA 2ZKSA 3SU5A 4JCNA 1C4V2 3BTDE 1V2WT 2QV1A 1J16A 5TCAA 1SGEE 1QRXA 2OXSA 1JIRA 2J38A 2FDAA 1QHRB 1O3EA 3S69A 2C90B 1ELVA 1MD7A 1MKWK 1SGIB 1DPOA 3BTFE 4NCYA 4ZKNU 2G51A 1THRH 3ZYDA 3RU4D 2R0LA 1S84A 3A81A 1HV7A 2BVRH 5F03A 2A1DB 2NU4E 4IC5A 3UREA 1EOLA 2ZTYA 1ZHMA 2SNVA 1QL8A 1UMAH 1YBWA 4X6NA 1FI8A 2W7UA 1YLDA 4OS1A 2VWNA 1HXFH 2F9NA 5T6GA 1BHXB 2BD7A 3MU1A 3MTYA 5GCHG 1EKBB 1P01A 4X1RU 1FV9A 1P2QA 2WYJA 3A86A 3DFJA 3BSQA 1BIOA 1SGQE 1Z8GA 2VIDA 1KXAA 1LMWB 4ISNA 1ELBA 3IITA 1ETTH 2PSXA 2BLVA 1C1PA 1G32B 5DK1A 1YCPH 3KHVA 5B6OA 4AYYB 4Y10E 1THPB 1P10A 5E2OA 3RXRA 2KAIA 1HAIH 1T4VH 2ZCLP 1RJXB 1O0DH 3KN2A 3PYHA 2FIRH 4WMFA 3U9AH 4AORA 3A7YA 4LK4A 2OQUA 3HKIB 1Y3WA 2H9HA 1DWCH 2FI5E 1EPTC 4HZHA 1GBCA 4SGAE 1TGBA 1B0FA 1HRTH 1S81A 1CU1A 1O3PB 1FDPA 1GCTB 1HAPH 1ZPBA 1HPGA 1F92A 2A7CA 2EI6A 1CHGA 4FUFA 3D62A 2UUYA 2WPIS 2ZU4A 2ZTXA 2UWOA 3NZIA 1C5LH 1JRSA 3EA9A 1GHVH 2CF8H 3BF6H 4MTBA 1GVLA 2ODYB 2GZ7A 1RIWC 3Q3YA 1OWIA 1ZHPA 5DP9A 3TJOA 3AAVA 4Y79A 3VB7A 5E2PA 3P8FA 2B7DH 1NTPA 4K5ZA 1P05A 4CRCA 4I32A 3B8JA 4JYVH 4B2AA 3NCLA 1NO9H 3UR6A 2ZHFH 4U32A 3DFLA 2XBXA 1EAWA 3SJIA 2FESH 4FU7A 3UR9A 2J2UA 2Y5HA 2A4GA 2GX4A 1FN6A 2JETB 1O3KA 2P8OC 1QL7A 3H5CB 1DXWA 3SBKA 1HJAB 1FPHH 1TNIA 1NRNH 1V2MT 4YOGA 1AFQB 1DWBH 1FY8E 3GCOA 1NS3A 1C5YB 1UHBA 4NIWA 2ANMH 5EXLA 1F5KU 1IQLA 5HMAA 4LOYH 4YLQH 1IQMA 3RP2A 4WY3A 1O31A 1CGHA 1MKWH 4X2VA 3MU5A 4OS5A 5GDSH 4JK6A 1EZXC 1P2NA 4GCHG 1C5TA 2W3IA 3VGCC 3KEEA 4O03A 3RXSA 1ZZZA 3ENSB 1GBIA 1Q31A 1NT1A 2ZDMA 4TWYA 3RXUA 1QQ4A 2M5TA 1LVYA 4BAMB 1BITA 4ISIH 1KYNA 1BTYA 1O3MA 2GD4B 3QZRA 1C5VA 1ZRBA 1TX6A 4BTTB 1O2PA 3D23A 1WV7H 1T8LA 3JZ2B 2A31A 1Y5AT 1C1OA 1GJ6A 3PMAB 1IQKA 1YM0A 1C2JA 1Z6EA 3LC3A 2BTCE 2FTLE 5DP8A 2XTTB 2CJIA 3TJNA 5C20A 1QFKH 5EOKA 3SOSA 3BTGE 3A8BA 1TYNA 1AD8H 1RIWB 3UQVA 1T8NA 5A0BA 1KXBA 5FCRA 1DS2E 3UUZA 1FN8A 1GDQA 1O3FA 1QTFA 1FXYA 1P11E 3K2UA 1Z71A 1LHEH 1O3JA 3P92A 4CHAB 2PR3A 1E36B 3FZDA 3HATH 4DIHH 1O2GH 2GT8A 2NU3E 4ZKOU 2I6QA 1C5XB 1GHAG 1OYTH 1EZQA 3VEQB 3BEFB 3UIRA 2VIOA 1ELFA 5JBAS 5AHGH 1TRMA 2EA3A 1HAGE 1QIXB 1E34B 1P3CA 1BDAA 4XE4A 1SFIA 3NWUA 4X1QU 4X6MA 1GMDF 1HJ8A 4ZH8A 2CF9H 1LCYA 3QX5H 2OTVA 3RXVA 3SQEE 1P3EA 1GBMA 5ESTE 1YF4A 1SR5C 3SW2B 4WH6A 2A2QH 1ZSJA 3E0PB 4Y0ZE 3SUDA 1BMNH 2ZCKP 4FUHA 4FUBA 4UD9H 2C8WB 4ABIA 5F8ZA 1A3BH 1UTMA 2A7JA 2NU2E 2CHAB 1YYY1 4DT7B 5LPFA 1BTXA 1GBKA 4WJG2 1O2MA 1DLEA 1K9OE 3BTWE 2SGFE 1XXDA 4H6SB 1YC0A 1C2DA 3D49H 1C1SA <