1GL1A

Structure of the complex between bovine alpha-chymotrypsin and pmp-c, an inhibitor from the insect locusta migratoria
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
239
Chain Sequence
CGVPAIQPVLSGIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexation of Two Proteic Insect Inhibitors to the Active Site of Chymotrypsin Suggests Decoupled Roles for Binding and Selectivity
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords ALPHA-CHYMOTRYPSIN
total genus 53
structure length 239
sequence length 245
chains with identical sequence B, C
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gl1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gl1A01
3TJUA 5HYOA 5LPRA 2A32A 2FS8A 4ZKRU 2VH6A 4AFZA 3ATWA 1DXWA 2ZG0H 1C4V2 1T8NA 1SGEE 4X0WU 4XSKU 1EJAA 1MTSA 2ZU2A 2TGPZ 2NU0E 2FP7B 1JRSA 1Y3VA 1GHWH 3S9CA 4MNYA 4WXIA 3MH5A 5A8XA 2A7CA 5EPYA 3CENA 2BDBA 4D7FA 1GCTC 1A0LA 3KEEA 1SLWB 1GMHG 4ZHAA 1BHXB 1HJAB 4H6SB 1LO6A 1O5GH 1SGFA 2ZHEH 3SJ9A 1BRAA 3W94A 2BMGB 3C27B 3QWCH 3W95A 4UFDH 2Z3EA 1OYQA 5DP4A 3QLPH 1MD8A 4X2VA 3RXHA 1BMMH 1QY6A 4LZ4B 2BHGA 3SU3A 5JBCS 1LPGB 3A83A 1T4UH 1TNJA 4XBBA 3VXEH 1HV7A 1LKBA 1TBQH 3OY6U 4ZUHA 1GDQA 1AWFH 1AWHB 1DDJA 1TNLA 1QB1A 1E38B 2B5TB 2ZDNA 3E1XB 1OKXA 1GBTA 3FP7E 4CRBA 4DJZB 1WCZA 2NU1E 3NPSA 4I32A 2XC0A 3A89A 5JBAS 4UFGH 1XM1A 1P0SH 3AW1A 2BDIA 1SHHB 1D4PB 1HAZB 1TQ0B 1QB9A 2AMPA 3VEQB 2PWXA 1UTQA 1PPFE 2BDHA 2FESH 1IQKA 2OQUA 2TBSA 4E06H 2G4UA 2ZFQH 4CBNA 1YC0A 1V2QT 1CHOF 4NG9H 4WMFA 1GCTB 1DLKB 2KAIB 1JIMA 1C2MA 1O35A 3SU2A 3SUDA 4INHA 1NU9A 3NWUA 2RG3A 1HUTH 4VGCC 3UR6A 1RRKA 4NA7A 1LPZB 2XWAA 6GCHF 3GCHB 1ZHRA 1NRPH 1U6QA 4X1RU 1SGFG 1GI0A 1TMTH 3A85A 1OWJA 4FUFA 5C3NA 2BDYA 6LPRA 1TFXA 1O5BB 3P95A 1PYTD 1N8OB 1ETRH 3ESTA 4OGYA 3OU0A 3SV7A 1PFXC 3B23B 1TOCB 4YLQH 1BJVA 1T4VH 3A8CA 1VITH 1XXFA 4ZKOU 2ZCKP 1UTOA 2FM2A 3BV9B 2FO9A 3A82A 1MZDA 3TJOA 4X8TH 4JZEH 4IN2A 2I6SA 5TCCA 1YBWA 4TWYA 3T62A 4NIWA 2VVCA 1CQQA 1LHDH 2F91A 1HJ9A 1Y59T 4TPYA 5F8TA 4NA9H 1P02A 1C1MA 1XKBC 3OTJE 3TIUA 3LDXH 4K1SA 1YP9A 4ABGA 1YPHE 2ZKSA 3MWIU 3ZZ6A 2OQ5A 3P8OA 2VNTA 1Y5BT 1TRMA 4ZXXH 1B0FA 3ZVCA 4ISIH 3RXOA 4VGCB 1C5LH 1QQ4A 2YNAA 3RXAA 2BY6X 1C1PA 2Z9GA 4X8UH 1C1SA 2P8OB 3TITA 5ESTE 2VIWA 2CV3A 2VH0A 4XE4A 2A7JA 2ZA5A 1FJSA 2BD3A 1ACBE 4DIHH 1ELDE 1OWIA 1TIOA 1QIXB 1P2QA 3I29A 5EG4A 2WV5A 1NRRH 2QY0B 4U30A 4WY3A 3CS0A 1XVOA 2ALVA 5HXFA 3SV2H 4HFPB 4K1EA 1ZMLA 1HAVA 3UY9A 3TJVA 1QURH 3A81A 2PKAB 4I8HA 1H9LB 1HNEE 1NTPA 2GDDA 1C5OH 1KLIH 2RA0A 1ZPZA 3VGCC 1UCYK 1AB9B 2WUBA 7GCHF 3SHCH 2QV1A 4O97A 1AVWA 2A4RA 1FIZA 1KSNA 1O3OA 5EXNA 3NZIA 8GCHF 1TALA 1VZQH 5FAHA 1EOJA 3P6ZB 1P2IA 3BG4B 4J2YB 4WVPE 1EAXA 1GJ9B 2ZDVH 5CMXH 1MCVA 1OSSA 3SV9A 1UJ1A 5GDSH 2YNBA 4NFEA 5JB9S 1YPJH 2O8LA 1G3EA 2P95A 3RXVA 1O2TA 1K1JA 3RLWH 5I46H 4ZAEA 2ZWLH 1SFQB 1SGIB 2FLRH 4UFEH 3K2UA 3UQVA 1FAXA 5HMAA 1NS3A 1FDPA 3K6ZA 3S7KB 4UONA 2ZEBA 2Y5GA 2GDEH 1PJPA 4Y8XA 5K7RA 5FX5A 1O2XA 5T6DA 1KIGH 3PWBA 1EX3A 1THPB 2CGAA 3FP8E 1Q2WA 1WSSH 3SQHE 2OXSA 2BOKA 3RXCA 2FI3E 1O2OA 1FLEE 5DKMA 4Q2KA 3F68H 4NA8A 1O3AA 1GBFA 3PO1B 2J38A 4TWWA 2H9HA 5L2YH 5DP5A 2EEKA 1O36A 1AUTC 3AVZA 4FUHA 1OS8A 1MCTA 1MTNB 1P10A 3SJOA 1ZTLA 1GDNA 3SW2B 2A31A 2VIVA 1VJAU 1V2OT 3URDA 1D9IA 4J1YA 2O8TA 2P16A 5E0HA 2VJ1A 3PYHA 1S82A 1T32A 3SNCA 3NXPA 1A5IA 1L4ZA 3Q76A 3SUGA 7KMEH 1O3HA 5BPEA 2EI6A 4KKDA 4LXBH 3I77A 3TVJB 1TAWA 1SQOA 1TRYA 1G30B 2ZTZA 2HNTF 3VB5A 1K21H 2AEIH 2PW8H 4OGXA 2ZC9H 3MNBA 1ELVA 4AOQA 3U8OH 1GBMA 1GBEA 2Z7FE 3QK1A 4B74A 4MNWA 3F9EA 2ZFFH 1O2HA 4GVUA 3ZZCA 1D6RA 4QT8C 4X8VH 1Z8GA 2HNTC 3VFEA 1AZ8A 2CN0H 2ZDLA 1NPMA 1YM0A 2BXTH 2QXHA 3SU5A 3RXGA 2P93A 2ZPQA 2OD3B 1SHYA 3QGJA 1FN6A 1M9UA 2Z3DA 5L30H 3V13A 2G55A 3R3GB 1KXFA 2Y7ZA 3DD2H 1O2KA 1GI1A 1BBRK 1SFIA 3BN9A 2SNVA 1HLTH 3SNDA 2ZQ1A 1AFQB 2ZFTA 1CE5A 4CH2B 3AAUA 5FBEA 1OWKA 3BTFE 4AFQA 3B9FH 3FP6E 2P59A 3UOPA 2BLQA 1XUGA 4TPIZ 1QB6A 2BLVA 5K0HA 1ZJKA 2AGEX 1TNHA 2BOHB 4ZMAH 1BT7A 1PPGE 3ATIA 1O5EH 1C1OA 2D26C 2UUJB 3GICB 2OTVA 2JETB 1FAKH 5DJ7A 1EXFA 3SHAH 4LK4A 1EAIA 1RS0A 4I8JA 4JZ1A 1ESBA 2VGCB 4DURA 1D6WA 1LTOA 1Z8RA 3OSYA 1QJ1B 3TK6A 1EQ9A 4MPUA 2PGQB 4TY6A 1PPZA 2TGTA 2ANMH 4R8TB 2ZGXH 4LOYH 4X1SU 1NESE 3M5LA 1H8DH 4TYDA 1CHOG 2OBOA 1HIAB 4CRCA 2PV9B 1B7XB 1IHSH 4FVBA 5F03A 5A2MH 3RXPA 4FUBA 1GVLA 1O0DH 2W3IA 2D1JA 3M7QA 4DW2U 3HKJB 2M5TA 1VITG 1W0YH 2RA3A 3GCNA 1C5RA 4HTCH 2W7SA 4AG1A 1C5WB 4JZFH 5A8ZA 5HM9A 2WPJS 2O9QA 1QA0A 4LZ1H 3A87A 1W8BH 3ZVBA 1DUEA 1GG6B 1P9SA 1UO6A 1YCPK 3GY5A 2A45B 3LPRA 3M3VA 4XBCA 1SGYE 3ZVEA 1T8OA 4E7RG 1K1IA 1GMCF 1V2TT 1HFDA 5C20A 2FOBA 1SVPA 3SU1A 1GHAG 2ZU4A 5IDKA 2BDCA 5GJ4B 2GCHG 3A88A 1TABE 1V2RT 3ATMA 1AFQC 3SNEA 3MMGA 3GCOA 1KDQA 3E90B 5A0AE 1EJMA 3F9GA 1BMAA 2F3CE 4X1NU 1C9PA 1UTKA 3KCGH 2F9NA 4Q7XA 2NWNA 2OCVB 1F5LA 1ANDA 1H1BA 1P57B 1ZRKA 3HPTB 1BDAA 2SNWA 3BSQA 2VIDA 2XC4A 1GI2A 3MO6A 3PMJA 2GCHF 3LGWA 2H6MA 1AE8H 1MUEB 4X1PU 1WU1A 4M7GA 3P70B 4FUCA 4FXGH 2JH6D 3MU4A 1O3DA 4B1TA 8ESTE 1V2KT 4Y76A 2HPQH 3ZZ3A 2OC0A 1RTLA 5DG6A 4O03A 1A7SA 4JZDH 2G81E 5AHGH 1O34A 3LJOA 2ZZUH 3PROA 3VGCB 3F9HA 1UCYE 1LHCH 4BOHA 1TX6A 4DGJA 2AS9A 3ZYEA 3QZRA 2OLGA 4MPVA 1C5QA 3P8NA 1UTNA 4FUEA 5A8YA 3QX5H 4A92A 1FY1A 4AORA 1BCUH 1S0QA 2RDLA 2Y6TA 4NWLA 2OC8A 1DLEA 1ZYOA 1GMCG 2OUAA 4ZHMU 1ZTKA 1QBOA 1MAYA 1IQLA 3O8DA 1ID5H 3SV6A 1SGCA 3T5FH 1RIWC 2WYGA 1OP2A 1C5VA 2H2ZA 2GZ9A 2ZNKH 3RC6A 2FTLE 4NFFA 1NFYA 1AMHA 3KHVA 2QF0A 4O9VA 2HGTH 1LQEA 1J14A 4X6MA 1GVKB 1P3CA 4BAKB 2WUCA 4IS5A 1O3PB 3BG8A 4PROA 5FPYA 1QBNA 1CHGA 1Z8IB 2PSXA 3K9XB 4INLA 1O2UA 4BNRA 1HAXB 5AVDA 1GJ5H 1S85A 5ESBA 3GCHC 1V2PT 2F83A 1L2EA 4CH8B 2CF9H 1W7GH 1HAIH 1A3BH 1IHTH 3JZ2B 1P3EA 5H4IB 3B8JA 1FIWA 5DP6A 4YT7H 2J92A 2PLXA 3TGIE 4YOJA 3HGNA 3L6PA 1Y5AT 1F0RA 4GCHF 4OS2A 1GJ6A 3TNSA 1MQ5A 1O2MA 2FOMB 3Q77A 1NT1A 1QL8A 1ZHMA 1YLDA 2NU3E 2EI7A 3TH2H 2GCTC 3SJ8A 4Q7ZA 3BTQE 1OWHA 1L1JA 1PQ7A 2GT8A 1V2LT 4AYYB 3OY5U 1QL7A 4BXSA 1OYTH 4WH6A 2AIQA 1HCGA 1SOTA 2XCNA 3GYMA 1KXCA 1WQSA 1EP5A 3TK5A 2R2MB 1BMNH 1SI5H 4ZROA 5DP9A 5FXLA 1GJDB 1MTVA 2ODPA 3UIRA 1MKWK 2Z9IA 3E0PB 1SGTA 2QC2A 4UE7H 1NN6A 3KQBA 2G52A 4AB9A 2CF8H 3GDVA 2A4GA 2GGVB 3KNXA 3VB7A 4ISOA 3SZNA 3FZZA 3RC5A 1BTZA 1BTXA 1IQNA 1FPHH 3P17H 4Y6DA 2H9EH 1O32A 3Q3XA 1EAUA 3EDXB 4YTAA 1GGDC 6CHAB 1QRWA 2FIRH 4ABDA 1XXDA 4F49A 1JOUB 3F1SB 3T28A 4K1TA 3SJKA 1NRQH 2ZGBH 2FYRA 2Y5FA 3ITIA 1HGTH 4WWYA 1J9CH 2CJIA 1QCPA 1UHBB 1MTUA 1F5RA 3LH3A 2ZFSA 6ESTA 1MH0A 4KTCA 4ZXYH 4YO9A 1ZOMA 2STBE 4I33A 1Y3YA 3TU7H 4NIXA 4U2WA 4D9QA 2FOHA 5FBIA 4X6OA 2VU8E 1GI4A 1UTLM 3A7ZA 4UDWH 1S6FA 1ZRBA 2GZ7A 1EPTC 1FN8A 3TGJE 1O37A 1JWTA 5JDUB 1YLCA 4XFQA 1HB0B 1AB9C 4NSYA 2VVVA 3RU4T 4OS5A 4I8GA 1DWCH 1IQJA 1YGCH 1GJ7B 8KME2 3BEIB 1C2KA 1P2MA 1TNIA 3M37A 1ZHPA 1BTWA 4BAHB 1GJ8B 1GBBA 1VGCC 1GG6C 5EPNA 1KYNA 3EYDA 1SPJA 4X2XA 3P92A 5SGAE 2HALA 5F8XA 3HATH 2BQWB 2JH0D 5L6NH 3GDUA 2GTBA 2WINI 1WBGB 2B7DH 5TJXA 3TPIZ 2WPMS 1OP8A 1QR3E 1P04A 4B73A 2H5DA 4NIYA 7GCHG 5C2ZA 1OXGA 1DANH 1SMFE 1SQAA 1CGIE 2V3HH 1S0RA 3RXTA 2UUFB 5E8EH 2XCFA 1N1LA 3PWCA 1GBDA 1DY8A 1WTGH 2OINA 3OYPA 3IWMA 3UOUA 2BVXH 5GPIB 4YZUA 1O2RA 1D3QB 1S81A 1ELGA 3RDZA 1AKSA 3RM2H 1ZMNA 3QN7A 3MFJA 1LHFH 1W12U 1UCYH 4JYVH 2QAAA 4Y0YE 7LPRA 2FEQH 3RMOH 2ZGCA 1O3KA 3BTEE 2ZFRH 1QL9A 3QUMP 2G5NA 3RU4D 1FXYA 2ZDMA 3A7YA 1EPTB 1GJBB 1ZPCA 4Y11E 1L1NA 3SGBE 2WPHS 2VIPA 2AFQB 2ZGJA 3NCLA 4BXWA 1CT0E 1WQVH 1C5PA 1K28D 2ZECA 1NU7B 1ORFA 2KAIA 1P9UA 2PSYA 1O30A 3BTME 1DS2E 4B2AA 1EPTA 1O2YA 1AVXA 1CGJE 2SGPE 2GP9B 1TMBH 1SQTA 1AIXH 5A0BA 1BA8B 2FOFA 3MNSA 1HAOH 2GV6A 3DUXH 1BUIA 1EZUC 2OC7A 3QTOH 4FUJA 4YLUA 3TNTA 4B2BA 4B71A 4FUDA 3PLPA 1DWDH 4X1QU 1ANEA 3MU8A 1C5YB 1RIWB 1SGDE 1EZSC 4GLYA 1NO9H 1O3BA 4MPXA 2WV4A 4K3JA 1AFEH 5L2ZH 1BOQA 2P3TB 4XDEA 5FPSA 4DG4A 2W26A 1SLUB 3LJJA 2ZTXA 4ABJA 3T25A 3H7OA 5EQQA 3SGQE 2ZP0H 3SU0A 3UTUH 3SBKA 2I6QA 1UTJA 1W10U 3G01A 3U98H 1C1RA 2AGIX 1O2ZA 1ABJH 2B9LA 1YF4A 3AASA 1GMDG 1P2OA 3LC3A 4JCNA 1IQGA 5EODA 2FWWA 1LCYA 1P06A 2VWLA 2A2QH 1V2ST 1S6HA 1C5SA 4IGDA 1TX7A 2P94A 1O2PA 1VR1H 3L33A 4XOJA 1NROH 1Z1JA 1TB6H 2VIQA 2VWMA 2NU2E 4BAMB 5PTPA 3QTVH 1DVAH 2PKSB 4F4OC 3EE0B 2HWLB 2BD9A 2ZGHA 1GCDA 2ALPA 3A80A 3E91A 3MHWU 1THSH 1C5MD 1UMAH 3UNQA 1SGRE 1GI8B 1XUFA 1K1LA 3MOCA 3VB3A 3A7TA 3VXFH 3PLKA 1H4WA 1TOMH 1TGCA 2AERH 2VGCC 3UR9A 1MKXH 4UEHH 1XUJA 1ELCA 4BTIB 3F9FA 2G51A 1A4WH 2Y81A 3KL6A 1FV9A 2D8WA 3PTNA 1ZPBA 1Z6JH 3M61U 4XBDA 2AMQA 1SR5C 4KELA 3S9BA 1EB2A 2K1QA 3M5OA 2ZO3H 4RKOB 2CHAC 2A5AA 1LHGH 3DA9B 4CRAA 1HAYB 4FU7A 2XWBI 1IQHA 1EKBB 3MTYA 2BD7A 1YCPH 3KGPA 4CR9A 2ZFPH 1KTSB 1SGQE 1Y3WA 4AYVB 4AFUA 8LPRA 3S7HB 4JK5A 2SGDE 4D76A 3PTBA 4OS1A 2FYQA 4ZH8A 2PR3A 5GWZA 5JBTA 1DWBH 1TGTA 2XW9A 3A8BA 1QRZA 4FUIA 1O3NA 1UVSH 3FZDA 1DM4B 3I78A 3M35A 1LVMA 1TLDA 2BZAA 5AF9H 2ZIQH 3KQDA 3PO1C 1VCPA 1MTNC 3LGUA 1C2IA 2ZQ2A 2THFB 1T7CA 1Z8JB 5B6OA 5JYIA 2BX4A 3A7WA 5CHAC 4JMYA 2ZDKA 1H9IE 3RXSA 2TIOA 2O8UA 4YM9A 4O3UA 1BTUA 2J94A 1SC8U 1ESAA 3MH4A 3RXLA 5E2OA 4WF8A 1GBHA 3RXJA 1EOLA 3OX7U 5J4QA 1EUFA 1MD7A 1XUKA 2STAE 3URCA 3SNBA 2IJOB 3HK3B 5DP3A 4UD9H 4CRDA 1KLTA 3TH3H 4MNXA 2AGGX 1KXBA 1P2NA 2F9PA 1AHTH 4BANB 3ZYDA 4FU8A 4NWKA 4ISNA 1Y8TA 4CRFA 4AZ2B 2ZU5A 3D49H 4CREA 5IYTA 3SJIA 4KTUA 2BQ7B 3C1KA 1EJNA 1HPGA 1ZSKA 2Z94A 4ABHA 2P3FH 2QXGA 1FMGA 1O2LA 1F5KU 4MQAA 3S9AA 1QRXA 2C90B 1OPHB 2AYWA 3GCTG 3TH4H 1IQFA 1O2SA 2BLOA 1P01A 3H5CB 4D7GA 2Z3CA 3GY8A 1C2HA 3TK9A 3GY4A 1ABIH 3RLYH 4OS4A 1PPHE 1O5CB 2BB4A 3GY6A 1PYTC 2ANWA 4GSOA 1PPCE 3T27A 3K65B 3RXBA 1BTHH 3KN2A 1F0TA 2C8ZB 3BTKE 5T6GA 1J17T 2C8WB 3E16B 2CHAB 4TY7A 1NC6A 1O3CA 3SGAE 1YCPM 1RD3B 2A1DB 2XC5A 1P2JA 3MH7A 4JYTA 1P2KA 3BF6H 1W2KH 1Z71A 4HZHA 4H6TA 2Y80A 1QFKH 2SGQE 2QA9E 3DT0H 4AN7A 5DO4H 1HAGE 1OOKB 1C5TA 4AB8A 2UWPA 5FPTA 3BTDE 4H4FA 3A84A 4Q7YA 1L0ZA 1ZGIA 1V2UT 1YKTA 1HJ8A 2OBQA 4NSVA 5TCAA 3MO3A 1YPKH 3U8TH 5T6FA 4AGJA 2IOTA 3RUOA 3MYWA 2HRVA 1OWDA 1ZSJA 1MBQA 2QYIA 2UWLA 3EAJA 4X6PA 1IOEA 1YPEH 2FX4A 3GY3A 2TGDA 2VIOA 2ANKH 1JMOH 1DSUA 2BD8A 1S83A 1C2EA 1HXEH 5I25A 3S69A 4AFSA 2FX6A 4BTTB 4X6NA 3RXIA 3M7TA 5LGOA 1AN1E 1GHAF 1TPOA 1AO5A 3FANA 2R2WU 2Z6BD 3LGTA 3PMAB 4GAWA 2BQ6B 1E37B 1W7XH 5EQRA 1AKSB 1E0FD 4MVNA 3ZV9A 2F9VA 3ZZBA 2Y7XA 1GPZA 2NU4E 2R3UA 8GCHG 5LPEA 1B0EA 2R3YA 2BX3A 5GCHF 2SGAA 2Q6DA 2BD2A 2A5KA 4UFFH 1OP0A 3A8AA 2XBWA 1DXPA 1XVMA 3MNCA 2ZF0H 4INKA 4ISLA 2LPRA 4DOQA 2ZPRA 1O2QA 1AU8A 3ODFA 1GHYH 4SGBE 2PTNA 3KQEA 1QQUA 1W3CA 1NFWA 1C1WH 2A5IA 5C5NA 1ZMJA 2DE8A 1CGHA 1XX9A 1KLJH 2ILNA 1LDTT 1GL1A 2ZU1A 1KXAA 1NM6A 1G2MA 1UTPA 5FCRA 1N8OC 1EZXC 3GYLB 4IN1A 1O3GA 1MKWH 3LU9B 4RSPA 1AQ7A 3SUEA 1AY6H 3JZ1B 1TYNA 3PV4A 1ZTJA 1BTYA 1CSOE 1RJXB 4K2YA 3Q3YA 1C1QA 3UFAA 1L1GA 4ESTE 1SG8B 2RCEA 4A5TS 2QF3A 4WMDA 1A2CH 1V2JT 1O3LA 5GCHG 3IITA 3A8DA 1P05A 4OS7A 4D8NA 1Q3XA 2BTCE 3HK6B 2FS9A 1G36A 3QGNB 4WMEA 3U8RH 3UWIA 1O31A 4JYUH 2HPPH 4IBLH 4Y7BA 1GVZA 3GY7A 4RKJB 1CVWH 2SGFE 3MU1A 2XTTB 1ELAA 4CHAB 4A6LA 1AD8H 3EA8A 5HGGA 2BY5X 2BY9X 1UVUH 3SOSA 1H8IH 1FY5A 5EXMA 1LKAA 2LNCA 2GMTC 3UREA 2WYJA 1LHEH 1GDUA 5AFZH 5EGMA 1P03A 4B2CA 1DPOA 1EB1H 2BVSH 1S84A 2ZHQH 2D2DA 1BB0B 2DE9A 4NZQA 1JIRA 1Z1IA 2G5VA 2J9NA 5F8ZA 1V3XA 3D62A 3ODDA 3SQEE 3MNXA 4GUXA 3A86A 4Z0KA 3E3TA 1O2NA 2WPKS 2A2XH 4D9RA 4Q80A 1FPCH 1CA0C 4Z6AH 4FUGA 1ELFA 2BZ6H 1NZQH 1GI7B 3QDZB 2B8OH 1LVBA 1F0SA 1C2DA 1PQ8A 3LGYA 1D3DB 1ZGVA 4FU9A 2XNIA 2FDAA 4Y8YA 1DOJA 2PKAA 1K22H 1X7AC 1G9IE 1YYY1 3RXQA 3RP2A 2BM2A 1KDQB 1O39A 1PQ5A 1YPLH 2JH5D 3RXDA 3ELAH 1RTFB 4AX9H 4ZHLU 1O3JA 1GGDB 3GDSA 6CHAC 4A1XA 1MAXA 2ULLA 1GBKA 3E8LA 1W14U 1C2JA 1O2IA 2BY7X 4ABEA 1VCQA 4AGKA 3M7UA 1G32B 2C4FH 4MNVA 2ESTE 2FPZA 1BTPA 5J4SA 2VB0A 1O3FA 5BRRE 3RM0H 1IQEA 3L3TA 1TPSA 4K8BA 4KP0A 4WH8A 5C1YA 4WXVA 3LH1A 3RMLH 2O8WA 1A5GH 1GI3A 2HLCA 3NUMA 4X2WA 2A4OA 3O8RA 4CBOA 3LC5A 1RFNA 1D3PB 1QA7A 1YPGH 3Q3KA 2PKSC 2R0LA 1MU6B 1B5GH 3M3SA 3HGPA 1QJ6B 1RGQA 4AG2A 1K9OE 1AUJA 2FTMA 3BTWE 2ZI2H 5FX6A 3BEFB 1BRUP 1C2LA 1BRCE 3K6YA 1FQ3A 4H42U 4ABFA 1XMNB 2O8MA 1C4Y2 3RMMH 1W13U 1BBRH 1QBVH 1QJ7B 1TA2A 3D23A 3LKWA 2HNTE 1UVOA 3AW0A 4IMQA 1O2GH 3LIWA 2GV7A 4MPWA 5AFYH 2H1UA 1O5FH 1HYLA 1ETTH 3SNAA 1NFUA 4BTUB 4DCDA 3MU0A 4ZKNU 1FONA 2OC1A 2ODYB 1DY9A 2EA3A 4WJG2 1E36B 4IW4E 1CU1A 3E6PH 3U9AH 2PFEA 3SU6A 1HBTH 1MKXK 1CA8B 1WUNH 1DX5M 1F92A 4MTBA 3U1IB 4NIVA 3ZZ9A 4YOIA 1RTKA 1VGCB 1LVOA 2A4QA 3D65E 4CR5A 1VITF 2ASUB 3V0XA 1UK4A 1GWAA 2P8OC 1O33A 1MU8B 2V0BA 1EZQA 1HDTH 2F9UA 2Z9KA 1TBRH 3GISB 4Y0ZE 2C93B 1SSXA 3SO3A 3ZVAA 3PM3A 1A46H 1ZJDA 3VPKA 1GHXH 1V2NT 2XBVA 1SLXB 3SU4A 3SI3H 5GIBA 1GBLA 3BIVH 3LGIA 2QCYA 3U69H 1GI9B 1V6DA 1A5HA 1IQIA 2XBYA 1GI6A 1HAHH 1XUIA 4FVDA 2J2UA 1MBMA 1GBJA 2ANYA 2TRMA 3GCTF 1GJ4H 3EA9A 1INCA 4K5ZA 5DGJA 4GPGA 1TONA 5EQSA 1ELTA 3BG4C 1QTFA 5EW1H 4Y71A 5A0CA 2Z9JA 3UPEA 2TPIZ 1Y3UA 3P8GA 1SGNE 4HI3A 2FI5E 2CXVA 2BY8X 4Y7AA 5CHAB 1BRBE 3VB4A 2Y82A 1AE5A 3BTHE 5C5OA 1C2FA 4ISHH 1UVPA 1TA6A 2PUXB 4ABIA 4O3TA 1MMJN 3SORA 3WY8A 1E35B 1GHBF 1OX1A 1YPMH 1TGSZ 1BJUA 4IC6A 2IPHA 3RXFA 1GHBG 2EI8A 1O3MA 3M5NA 2BD4A 2ZTYA 1ZSLA 1KY9A 3ZVDA 3ZZ4A 4OS6A 1UTMA 3O8CA 3HKIB 4K69A 2FZZA 1P8VC 2JETC 2AH4X 3LOXA 3EA7A 3UWJH 1SGPE 1QHRB 5C67A 2V6NA 1CO7E 1L4DA 3UUZA 4DT7B 4CHAC 2F9OA 3DFLA 5HM2A 4R0IA 5G4BA 4B75A 1O5DH 1HIAA 3UQOA 2W5EA 2R9PA 5FHTA 4RN6A 3QO6A 4I7YH 1W0ZU 1DT2A 1TGNA 4JK6A 1JXPA 3LT3A 3RXEA 2DUCA 3SV8A 2ZCLP 5LH8A 1A3EH 3M3TA 3MU5A 1C2GA 3ZZ8A 1C1TA 1V2WT 3BTGE 2A0QB 2J4IA 1JBUH 2FOEA 2VINA 1W11U 1G3DA 2WPIS 4DIIH 1A0HB 3RC4A 4BAQB 5GXPA 2W7UA 3RXKA 2J34A 1GBCA 1A0JA 1G3CA 1UVTH 3NK8A 1F7ZA 1ARCA 3Q00A 1CA0B 4X8SH 1LQDB 1C4U2 3V12A 1GJCB 3M36A 2BVRH 3BTTE 4IC5A 4NGAH 4BAOB 1K1NA 1SL3A 4K60A 1YPHC 2V35A 3ATKA 4NCYA 1ESTA 1P12E 3MO9A 5EXLA 1TWXB 2AIPA 2A7HA 4X2YA 1ETSH 4Y8ZA 1Y5UT 3GOVB 3T29A 4ABBA 1KXEA 1P11E 2ZHFH 2UWOA 3CS7A 3F6UH 3AAVA 2Y5HA 3ZZAA 2H9TH 1O3IA 5LPFA 2XYAA 2QN5T 1SB1H 2FOCA 1PQAA 3SI4H 2VWNA 4A1VA 2EC9H 1EAWA 1TE0A 2PGBB 2H5CA 5DPAA 4Y10E 2Q1JA 2ZHDA 3FAOA 3KQCA 1O2WA 3KIDU 2FLBH 3N7OA 4MG3A 2XXLA 1Y3XA 3A7VA 2GT7A 5DK1A 3PMHB 5DP7A 3M5MA 1LMWB 3LGVA 1HXFH 1MZAA 2G8TA 1UK3A 1D3TB 1FUJA 1BITA 1TNKA 2QXJA 2ZHWH 3VB6A 3SN8A 3RXUA 1KXDA 5ETXA 4I8KA 2Z9LA 1GHZA 1C1VH 1ZR0A 4A7IB 4SGAE 2BLWA 1SOZA 2XBXA 3STJA 2SFAA 1N6XA 2C3SA 1PPEE 3FFGA 1G2LA 2HVXA 1AVGH 1CBWB 3ATLA 3O8BA 5T3HA 2GZ8A 3UNSA 2CMYA 3ZZ5A 3ENSB 2GD4B 3QZQA 2HOBA 1K1OA 2XRCA 2GCTB 1NY22 1TRNA 2YOLA 1O5AB 5FCKA 5C1XA 1HRTH 1EATA 1H9HE 3T2NA 1BQYA 1XUHA 1PPBH 4I8LA 1FNIA 1J8AA 1K1MA 5JB8S 1GJAB 2PUQH 1TGBA 1TX8A 2AMDA 5JPMH 1AZZA 2VWOA 4A1TA 2FODA 2J95A 4YOGA 1WYKA 2QIQA 4MLFB 1K2I1 1C5ZB 2C8YB 1BMLA 3TGKE 1TNGA 4YESB 1A1RA 3DFJA 2ODQA 5EOKA 3SUFA 3NKKA 3A7XA 3MH6A 3MI4A 1G37A 1KTTB 1P09A 3DHKH 1FI8A 3ZVGA 1NRNH 5ABWA 2GMTB 7ESTE 2ZCHP 1LVYA 1J16A 1CT2E 2TGAA 4KTSA 1UK2A 2UUYA 1F2SE 2BXUH 2VVUA 1CT4E 1FY3A 4U32A 1T8LA 3V3MA 1NFXA 1DSTA 4KGAA 9LPRA 3CP7A 1O3EA 2Q6GA 2QXIA 4K8YA 2BYAX 1V2MT 2FOAA 3ZV8A 1C9TA 3PLBA 2G00A 3EGKH 1ELBA 4GHQA 3P8FA 2V3OH 1N6YA 1GMDF 1THRH 1FY4A 2R0KA 1XKAC 2FMJA 1DITH 1BZXE 1QGFA 1AGJA 2Q6FA 1C5XB 2GKVE 3U1JB 1J15A 1JRTA 4I31A 1HAVB 2P3UB 1ZZZA 1WTHD 1DFPA 4DY7B 6GCHG 5JBBS 2G4TA 1C1NA 1ELEE 2BDGA 1RXPA 3ZZDA 1FY8E 1WAYB 1EP6A 1T8MA 4E7NA 1DICA 1V2VT 1F0UA 1GMHF 2BDAA 1SBWA 1T31A 1CBWC 1E34B 2F9BH 1GBAA 1MQ6A 1ANBA 1HJAC 3RMNH 3R0FA 5EU8A 2OP9A 3ZZ7A 1DUAA 5C1UA 2IN2A 1Q31A 1C5UA 1DE7H 1TPAE 5E2PA 4U01A 1K1PA 1GBIA 1C1UH 1C5NH 1Z7KA 3RXMA 1BIOA 3BEUA 2PTCE 1O2VA 1TQ7B 2ZPSA 1Z6EA 2QGRA 5E0GA 3GY2A 1HAPH 1AI8H 4YT6H 3EQ0H 4GCHG 3FVFB 3LONA 2JKHA 4GHTA 5F6MA 3KF2A 1BBRE 2GX4A 3PMBB 1A61H 1ANCA 3E0NB 4CRGA 1ZLRA 4E05H 2FXRA 1IAUA 5CE1A 4ZKSU 1TPPA 1MTWA 2PHBA 1GHVH 2B0FA 1QNJA 4THNH 9ESTA 1O2JA 1TBZH 2GVFA 4JZIA 4B76A 1TMUH 3H7TA 1S5SA 3STIA 4ABAA 5DP8A 1BHXF 3TJNA 1LPKB 2FI4E 5E0JA 4NZLA 1IQMA 2UUKB 2W3KA 2ZDAH 3V7TA 3RU4E 1VCWA 1WOFA 1G3BA 1VJ9U 3IG6B 1O38A 4DVAU 4MDSA 2FOGA 2SGEE 3ZVFA 1OWEA 1SLVB 2BD5A 3RXRA 4IMZA 4HGCA 3TLOA 3S0NA 3PB1E 1DWEH 2ZU3A 1ARBA 5A09A 4Y79A 3UNRA 2WPLS 1WV7H 1UHBA 1GI5A 4ASHA 1EASA 5EW2H 1NRSH 1FZZA 1GL0E 2C8XB 3BIUH 3T26A
chains in the Genus database with same CATH superfamily
3TJUA 5HYOA 5LPRA 2A32A 2FS8A 4ZKRU 2VH6A 4AFZA 3ATWA 1DXWA 2ZG0H 1C4V2 1T8NA 1SGEE 4X0WU 4XSKU 1EJAA 1MTSA 2ZU2A 2TGPZ 2NU0E 2WSSD 2FP7B 1JRSA 1Y3VA 1GHWH 3S9CA 4MNYA 4WXIA 2KFWA 3MH5A 5A8XA 2A7CA 5EPYA 3CENA 2BDBA 4D7FA 1GCTC 1A0LA 3KEEA 1SLWB 5EJLA 1GMHG 4ZHAA 1BHXB 2L6OA 1HJAB 4H6SB 1LO6A 1O5GH 1SGFA 2ZHEH 3SJ9A 1BRAA 3W94A 2BMGB 3C27B 3QWCH 3W95A 4UFDH 2Z3EA 3F2HA 1W0KD 1OYQA 5DP4A 3QLPH 1MD8A 4X2VA 3RXHA 1BMMH 1QY6A 4LZ4B 2BHGA 3SU3A 5JBCS 1LPGB 3A83A 1T4UH 1TNJA 4XBBA 3VXEH 1HV7A 1LKBA 1TBQH 3OY6U 4ZUHA 1GDQA 1AWFH 1AWHB 1DDJA 1TNLA 1QB1A 1E38B 2B5TB 2YMSD 2ZDNA 3E1XB 1OKXA 2L74A 5C0UA 1GBTA 3FP7E 4CRBA 4DJZB 1WCZA 2NU1E 3NPSA 4I32A 2XC0A 3A89A 5JBAS 4UFGH 1XM1A 1P0SH 3AW1A 2BDIA 1SHHB 1D4PB 1HAZB 1TQ0B 1QB9A 2AMPA 3VEQB 2PWXA 1UTQA 1PPFE 2BDHA 2FESH 1IQKA 2OQUA 2TBSA 4E06H 2G4UA 2ZFQH 3WWBA 4CBNA 1YC0A 1V2QT 1CHOF 4NG9H 4WMFA 1GCTB 1DLKB 2KAIB 1JIMA 1C2MA 1O35A 5DN6D 3SU2A 3SUDA 4INHA 1NU9A 3NWUA 2RG3A 1HUTH 4VGCC 3UR6A 1RRKA 2WPDD 4NA7A 1LPZB 4AC9A 2XWAA 6GCHF 3GCHB 1ZHRA 1NRPH 1U6QA 4X1RU 1SGFG 1GI0A 1TMTH 3A85A 1OWJA 4FUFA 5C3NA 2BDYA 6LPRA 1TFXA 1O5BB 3P95A 1PYTD 1N8OB 1ETRH 3ESTA 4OGYA 3OU0A 3SV7A 1PFXC 3B23B 1TOCB 4YLQH 1BJVA 1T4VH 3A8CA 1VITH 1XXFA 4ZKOU 2ZCKP 1UTOA 2FM2A 3BV9B 2FO9A 3A82A 1MZDA 3TJOA 4X8TH 4JZEH 4IN2A 2I6SA 5TCCA 1YBWA 4TWYA 3T62A 4NIWA 2VVCA 1CQQA 1LHDH 2F91A 1HJ9A 1Y59T 4TPYA 5F8TA 4NA9H 1P02A 1C1MA 1XKBC 3OTJE 3TIUA 4B6EA 1E1RD 3LDXH 4K1SA 1YP9A 4ABGA 1YPHE 5F53A 2YMSC 2ZKSA 3MWIU 3ZZ6A 2OQ5A 3P8OA 2VNTA 1Y5BT 1TRMA 4ZXXH 1B0FA 3ZVCA 4ISIH 3RXOA 4VGCB 1C5LH 1QQ4A 2YNAA 3RXAA 2BY6X 1C1PA 2Z9GA 4X8UH 1C1SA 2P8OB 3TITA 5ESTE 3PV5A 2VIWA 3OFND 2CV3A 2VH0A 4XE4A 2A7JA 2ZA5A 4XRNA 1FJSA 2BD3A 1ACBE 4DIHH 1ELDE 1OWIA 1TIOA 1QIXB 1P2QA 3I29A 5EG4A 2WV5A 1NRRH 2QY0B 4U30A 4WY3A 3CS0A 1XVOA 2ALVA 1SKYE 5HXFA 3SV2H 4HFPB 4K1EA 1ZMLA 1HAVA 3UY9A 3TJVA 1QURH 3A81A 2PKAB 4I8HA 1H9LB 1HNEE 1NTPA 2GDDA 1C5OH 1KLIH 4Z1MD 2RA0A 1ZPZA 3VGCC 1UCYK 1AB9B 2WUBA 7GCHF 3SHCH 2QV1A 4O97A 1AVWA 2A4RA 5FL7D 1FIZA 1KSNA 1O3OA 1WDIA 5EXNA 2QE7D 3NZIA 1TALA 1VZQH 5FAHA 8GCHF 1EOJA 3P6ZB 1P2IA 3BG4B 4J2YB 4WVPE 1EAXA 1GJ9B 2ZDVH 5CMXH 1MCVA 1OSSA 3SV9A 1UJ1A 5GDSH 2YNBA 4NFEA 5JB9S 1YPJH 2O8LA 1G3EA 2P95A 3RXVA 1O2TA 1K1JA 3RLWH 5I46H 4ZAEA 2ZWLH 1SFQB 1SGIB 2FLRH 4UFEH 3K2UA 3UQVA 1FAXA 5HMAA 1NS3A 3F2FA 1FDPA 3K6ZA 3S7KB 4UONA 2ZEBA 2Y5GA 2GDEH 1PJPA 4Y8XA 5K7RA 5FX5A 1O2XA 5T6DA 1KIGH 3PWBA 1EX3A 1THPB 2CGAA 3FP8E 1Q2WA 1WSSH 3SQHE 2OXSA 2BOKA 3RXCA 2FI3E 2JJ1D 1O2OA 1FLEE 3UB0A 2KX4A 2GJGA 5DKMA 4Q2KA 3F68H 4NA8A 1O3AA 1GBFA 3PO1B 2J38A 4TWWA 2H9HA 5L2YH 5DP5A 2EEKA 1O36A 3AK5A 1AUTC 3AVZA 4FUHA 1OS8A 1MCTA 1MTNB 1P10A 3SJOA 1ZTLA 1GDNA 3SW2B 2A31A 2VIVA 1VJAU 1V2OT 3URDA 1D9IA 4J1YA 2O8TA 2P16A 5E0HA 2VJ1A 3PYHA 1S82A 1T32A 3SNCA 3GS9A 3NXPA 1A5IA 1L4ZA 3Q76A 3SUGA 7KMEH 3F2GA 1O3HA 5BPEA 2EI6A 4KKDA 4LXBH 3I77A 3TVJB 1TAWA 1SQOA 1TRYA 1G30B 3OTPA 2ZTZA 2HNTF 3VB5A 1K21H 2AEIH 2PW8H 4OGXA 2ZC9H 3MNBA 1ELVA 4AOQA 3U8OH 1GBMA 1GBEA 2Z7FE 3QK1A 4B74A 4MNWA 3F9EA 2ZFFH 1O2HA 4GVUA 3ZZCA 1D6RA 3KYGA 4QT8C 4X8VH 3N7DA 1Z8GA 2HNTC 3VFEA 1AZ8A 2CN0H 2ZDLA 1NPMA 1YM0A 2BXTH 2QXHA 3SU5A 3RXGA 2P93A 2ZPQA 2OD3B 2V7QD 1SHYA 3QGJA 1FN6A 1M9UA 2Z3DA 5L30H 3V13A 2G55A 3R3GB 1KXFA 2Y7ZA 3DD2H 1O2KA 1GI1A 1BBRK 1SFIA 3BN9A 2SNVA 1HLTH 3SNDA 2ZQ1A 5HKKD 1AFQB 2ZFTA 1CE5A 4CH2B 3AAUA 5FBEA 1OWKA 3BTFE 4AFQA 3B9FH 3FP6E 2P59A 3UOPA 3FN8A 1VKYA 2BLQA 1XUGA 4TPIZ 1QB6A 2BLVA 5K0HA 3OEED 1ZJKA 2AGEX 1TNHA 2BOHB 4ZMAH 1BT7A 1PPGE 3ATIA 1O5EH 1C1OA 2D26C 2UUJB 3GICB 2OTVA 2JETB 1FAKH 5DJ7A 4F55A 1EXFA 3SHAH 4LK4A 1EAIA 1RS0A 4I8JA 4JZ1A 1ESBA 2VGCB 4DURA 1D6WA 1LTOA 1Z8RA 3OSYA 1QJ1B 3TK6A 1EQ9A 4MPUA 2PGQB 4TY6A 1PPZA 2TGTA 2ANMH 4R8TB 2ZGXH 4LOYH 4X1SU 1NESE 3M5LA 1H8DH 4TYDA 1CHOG 2OBOA 5CDFE 1HIAB 4CRCA 2PV9B 1B7XB 1IHSH 4FVBA 5F03A 5A2MH 3RXPA 4FUBA 1GVLA 1O0DH 2W3IA 2D1JA 3M7QA 1YWUA 4DW2U 3HKJB 2M5TA 1VITG 1W0YH 2OK5A 2RA3A 3GCNA 1C5RA 4HTCH 2W7SA 4AG1A 1C5WB 4JZFH 5A8ZA 5HM9A 2WPJS 2O9QA 1QA0A 4LZ1H 3A87A 1W8BH 3ZVBA 1DUEA 1GG6B 1P9SA 1UO6A 1YCPK 3GY5A 2A45B 3LPRA 3M3VA 4XBCA 2KR7A 1SGYE 3ZVEA 1T8OA 4E7RG 1K1IA 1GMCF 1V2TT 1HFDA 5C20A 2FOBA 1EFRD 1SVPA 3SU1A 1GHAG 2ZU4A 5IDKA 2BDCA 5GJ4B 2GCHG 3A88A 2QF5A 1TABE 1V2RT 3ATMA 1AFQC 2LP6A 3SNEA 3MMGA 3GCOA 1KDQA 3E90B 5A0AE 1EJMA 3DCLA 3F9GA 1BMAA 2F3CE 4X1NU 1C9PA 1UTKA 3KCGH 2F9NA 4Q7XA 2NWNA 2OCVB 1F5LA 1ANDA 1H1BA 1P57B 1ZRKA 3HPTB 1BDAA 2SNWA 3N7EA 3BSQA 2VIDA 2XC4A 1GI2A 3MO6A 3PMJA 2GCHF 3LGWA 2H6MA 1AE8H 1MUEB 4X1PU 1WU1A 4M7GA 3P70B 4FUCA 4FXGH 2JH6D 3MU4A 1O3DA 4B1TA 8ESTE 1V2KT 4Y76A 2HPQH 3ZZ3A 2OC0A 1RTLA 5DG6A 4O03A 1A7SA 2LELA 4JZDH 2G81E 4ACAA 5AHGH 1O34A 3LJOA 2ZZUH 1K0HA 3PROA 3VGCB 3F9HA 1UCYE 1LHCH 4BOHA 1TX6A 4DGJA 2AS9A 3F3BA 3ZYEA 3QZRA 2OLGA 4MPVA 1C5QA 3P8NA 1UTNA 4FUEA 5A8YA 3QX5H 4A92A 1FY1A 4AORA 1BCUH 1S0QA 2RDLA 2Y6TA 4NWLA 2OC8A 1DLEA 1ZYOA 1GMCG 3FKSD 2OUAA 4ZHMU 1ZTKA 1QBOA 1MAYA 1IQLA 3O8DA 1ID5H 3SV6A 1SGCA 3T5FH 1RIWC 2WYGA 1OP2A 1C5VA 2H2ZA 2GZ9A 2ZNKH 3RC6A 2FTLE 4NFFA 1NFYA 1AMHA 3KHVA 2QF0A 4O9VA 2HGTH 1LQEA 1J14A 2KCPA 4X6MA 1GVKB 1P3CA 4BAKB 4Q63A 2WUCA 4IS5A 1O3PB 3BG8A 4PROA 5FPYA 1QBNA 1CHGA 1Z8IB 2PSXA 3K9XB 4INLA 1O2UA 4BNRA 1HAXB 5AVDA 1GJ5H 1S85A 5ESBA 3GCHC 1V2PT 2F83A 1L2EA 4CH8B 2CF9H 1W7GH 1HAIH 1A3BH 1IHTH 3JZ2B 1P3EA 5H4IB 3B8JA 2KCAA 1FIWA 5DP6A 3SYJA 4YT7H 2J92A 2PLXA 3TGIE 4YOJA 3HGNA 3L6PA 1Y5AT 1F0RA 4GCHF 4OS2A 1YY3A 1GJ6A 3TNSA 1MQ5A 1O2MA 2FOMB 3Q77A 1NT1A 1QL8A 1ZHMA 1YLDA 2NU3E 2EI7A 3TH2H 2GCTC 3SJ8A 4Q7ZA 3BTQE 2J5UA 1OWHA 1L1JA 1PQ7A 2GT8A 1V2LT 4AYYB 3OY5U 5GNDA 1QL7A 4BXSA 1OYTH 4WH6A 2AIQA 1HCGA 1SOTA 2XCNA 3GYMA 1KXCA 1WQSA 1EP5A 3TK5A 2R2MB 2KCOA 1BMNH 1SI5H 3VG8A 4ZROA 5DP9A 5FXLA 1GJDB 1MTVA 2ODPA 3WWFA 3UIRA 1MKWK 2Z9IA 3E0PB 1SGTA 2QC2A 1YLNA 4UE7H 1NN6A 3KQBA 2G52A 4AB9A 2CF8H 3GDVA 2A4GA 2GGVB 3KNXA 3VB7A 4ISOA 3SZNA 3FZZA 3RC5A 1BTZA 1BTXA 1IQNA 1FPHH 3P17H 4Y6DA 2H9EH 1O32A 3Q3XA 2KZ4A 1EAUA 3EDXB 4YTAA 1GGDC 6CHAB 1QRWA 2FIRH 4ABDA 1XXDA 4F49A 1JOUB 3F1SB 3T28A 4K1TA 3SJKA 1NRQH 2ZGBH 2FYRA 2Y5FA 3ITIA 1HGTH 4WWYA 1J9CH 2CJIA 1QCPA 1UHBB 1MTUA 1F5RA 3LH3A 3OE7D 2ZFSA 6ESTA 1MH0A 4KTCA 4ZXYH 4YO9A 1ZOMA 2STBE 4I33A 1Y3YA 3TU7H 4NIXA 4U2WA 4D9QA 2FOHA 5FBIA 4X6OA 2VU8E 1GI4A 1UTLM 3A7ZA 4P00A 4UDWH 1S6FA 1ZRBA 2GZ7A 1EPTC 1FN8A 4XD7D 3TGJE 1O37A 1JWTA 5JDUB 1YLCA 4XFQA 1HB0B 1AB9C 4NSYA 2VVVA 3RU4T 4OS5A 4I8GA 1DWCH 1IQJA 4P02A 1YGCH 1GJ7B 8KME2 3BEIB 1C2KA 1P2MA 1NBME 1TNIA 3F0OA 3M37A 3FO8D 1ZHPA 1BTWA 4BAHB 1GJ8B 1GBBA 1VGCC 1GG6C 5EPNA 1KYNA 3EYDA 1SPJA 4X2XA 3P92A 5SGAE 2HALA 5F8XA 3HATH 2BQWB 2JH0D 5L6NH 3GDUA 2GTBA 2WINI 1WBGB 2B7DH 5TJXA 3TPIZ 2WPMS 1OP8A 1QR3E 1P04A 4B73A 2H5DA 4NIYA 7GCHG 5C2ZA 1OXGA 1DANH 4RI0A 1SMFE 1SQAA 1CGIE 2V3HH 1S0RA 3RXTA 2UUFB 5E8EH 2XCFA 1N1LA 3PWCA 1GBDA 1DY8A 1WTGH 2OINA 3OYPA 3IWMA 3UOUA 2BVXH 5GPIB 4YZUA 1O2RA 1D3QB 1S81A 1ELGA 3RDZA 1AKSA 3RM2H 1ZMNA 3QN7A 3MFJA 1LHFH 1W12U 1UCYH 4JYVH 2QAAA 4Y0YE 7LPRA 2FEQH 3RMOH 2ZGCA 1O3KA 3BTEE 2ZFRH 1QL9A 3QUMP 2G5NA 3RU4D 1FXYA 2ZDMA 3A7YA 1EPTB 1GJBB 1ZPCA 4Y11E 1L1NA 3SGBE 2WPHS 2VIPA 2AFQB 2ZGJA 3NCLA 4BXWA 1CT0E 1WQVH 1C5PA 1K28D 2ZECA 1NU7B 1ORFA 2KAIA 1P9UA 2PSYA 1O30A 3BTME 1DS2E 4I86A 4B2AA 1EPTA 1O2YA 1AVXA 1CGJE 2SGPE 4Q4LA 2GP9B 1TMBH 1SQTA 1AIXH 5A0BA 1BA8B 2F4LA 2FOFA 2J98A 3MNSA 1HAOH 1S6LA 2GV6A 3DUXH 4DT4A 1BUIA 1EZUC 2OC7A 3QTOH 4FUJA 4YLUA 3TNTA 4B2BA 4B71A 4FUDA 3PLPA 1DWDH 4X1QU 1ANEA 3MU8A 1C5YB 1RIWB 1SGDE 1EZSC 4GLYA 1NO9H 1O3BA 4MPXA 2WV4A 4K3JA 1AFEH 5L2ZH 1BOQA 2P3TB 4XDEA 5FPSA 4DG4A 2W26A 1SLUB 3LJJA 4HG6A 2ZTXA 4ABJA 3T25A 3H7OA 5EQQA 5C94A 3SGQE 2ZP0H 3SU0A 3UTUH 3SBKA 2I6QA 1UTJA 4ASUD 1W10U 3G01A 3U98H 1C1RA 2AGIX 1O2ZA 1ABJH 2B9LA 1YF4A 4RT1A 3AASA 1GMDG 1P2OA 3LC3A 4JCNA 1IQGA 5EODA 2FWWA 1LCYA 1P06A 2VWLA 2A2QH 1V2ST 1S6HA 1C5SA 4IGDA 1TX7A 3WW7A 2P94A 1O2PA 1VR1H 3L33A 4XOJA 1NROH 1Z1JA 1TB6H 2VIQA 2VWMA 2NU2E 4BAMB 5PTPA 3QTVH 1DVAH 2PKSB 4F4OC 3EE0B 2HWLB 2BD9A 3ZIAD 2ZGHA 1GCDA 2ALPA 3A80A 3E91A 3MHWU 1THSH 1C5MD 1UMAH 3UNQA 1SGRE 1GI8B 1XUFA 1K1LA 3MOCA 5KEDA 3VB3A 3A7TA 3VXFH 3PLKA 1H4WA 1TOMH 1TGCA 2AERH 2VGCC 3UR9A 1MKXH 4UEHH 2RDEA 1XUJA 1ELCA 4BTIB 3F9FA 2G51A 1A4WH 2Y81A 3KL6A 1FV9A 2D8WA 3PTNA 1ZPBA 1Z6JH 3M61U 4XBDA 2AMQA 1SR5C 4KELA 3S9BA 3PRDA 1EB2A 1NBMD 2K1QA 3F0PA 3M5OA 2ZO3H 4RKOB 2CHAC 2A5AA 1LHGH 3DA9B 4CRAA 1HAYB 4FU7A 2XWBI 3DSPA 1IQHA 1EKBB 3MTYA 2BD7A 1YCPH 3KGPA 4CR9A 2ZFPH 1KTSB 1SGQE 1Y3WA 4AYVB 4AFUA 8LPRA 3S7HB 4JK5A 2WZQA 2SGDE 4D76A 3PTBA 4OS1A 2RFKC 2FYQA 4ZH8A 2PR3A 5GWZA 5JBTA 1DWBH 1TGTA 2XW9A 3A8BA 1QRZA 4FUIA 1O3NA 1UVSH 3FZDA 1DM4B 3I78A 3M35A 1LVMA 1TLDA 2BZAA 5AF9H 2ZIQH 3KQDA 3PO1C 1VCPA 1MTNC 2F43B 3LGUA 1C2IA 2ZQ2A 2THFB 1T7CA 1Z8JB 2W6ID 5B6OA 5JYIA 2BX4A 3A7WA 5CHAC 4JMYA 2ZDKA 1H9IE 3RXSA 2TIOA 2O8UA 4YM9A 4O3UA 1BTUA 2J94A 1SC8U 2XNDD 3EE7A 1ESAA 3MH4A 3RXLA 5E2OA 4WF8A 1GBHA 3RXJA 1EOLA 3OX7U 5J4QA 1EUFA 1MD7A 1XUKA 2STAE 3URCA 3SNBA 2IJOB 3HK3B 5DP3A 4UD9H 3UAIC 4CRDA 1KLTA 3TH3H 4MNXA 2AGGX 1KXBA 1P2NA 2F9PA 1AHTH 4BANB 3U28C 3ZYDA 4FU8A 4NWKA 4ISNA 1Y8TA 4CRFA 4AZ2B 2ZU5A 3D49H 4CREA 5IYTA 3SJIA 4KTUA 2BQ7B 3C1KA 1EJNA 1HPGA 1ZSKA 2Z94A 4ABHA 2P3FH 2QXGA 1FMGA 3W1EA 1O2LA 1F5KU 4MQAA 3S9AA 3OEHD 1QRXA 2C90B 1OPHB 2AYWA 3GCTG 2JJ2D 3TH4H 1IQFA 1O2SA 2KCYA 2BLOA 1P01A 3H5CB 4D7GA 2Z3CA 3GY8A 1C2HA 3TK9A 3GY4A 1ABIH 3RLYH 4OS4A 1PPHE 1O5CB 2BB4A 3GY6A 1PYTC 1FX0B 2ANWA 4GSOA 4M9FA 1PPCE 3T27A 3K65B 3RXBA 1UW7A 1BTHH 3KN2A 1F0TA 2C8ZB 3BTKE 5T6GA 1J17T 2C8WB 3E16B 2CHAB 4TY7A 1NC6A 1O3CA 3SGAE 1YCPM 1RD3B 2A1DB 2XC5A 1P2JA 3MH7A 4JYTA 1P2KA 3BF6H 1W2KH 1Z71A 5CHBA 4HZHA 4H6TA 2Y80A 1QFKH 2SGQE 2QA9E 3DT0H 4AN7A 5DO4H 1HAGE 1OOKB 1C5TA 4AB8A 2UWPA 5FPTA 3BTDE 4H4FA 3A84A 4Q7YA 1L0ZA 1ZGIA 1V2UT 1YKTA 1HJ8A 2OBQA 4NSVA 5TCAA 3MO3A 1YPKH 3U8TH 5T6FA 4AGJA 2IOTA 3RUOA 1BMFD 3KYFA 3MYWA 2HRVA 1OWDA 1ZSJA 1MBQA 2QYIA 2UWLA 3EAJA 4X6PA 1IOEA 1YPEH 2FX4A 3GY3A 2TGDA 1H8ED 2VIOA 2ANKH 1JMOH 1DSUA 1E1QD 2BD8A 4FOUC 1S83A 1C2EA 1HXEH 5I25A 3S69A 4AFSA 2FX6A 4BTTB 3SZEA 4X6NA 3RXIA 3M7TA 5LGOA 1AN1E 1GHAF 1TPOA 1AO5A 3FANA 2R2WU 2Z6BD 3LGTA 3PMAB 4GAWA 2BQ6B 1E37B 1W7XH 5EQRA 1AKSB 1E0FD 4MVNA 3ZV9A 2F9VA 3ZZBA 2Y7XA 1GPZA 2NU4E 2R3UA 2K8IA 8GCHG 5LPEA 1B0EA 2R3YA 2BX3A 5GCHF 2SGAA 2Q6DA 2BD2A 2A5KA 4UFFH 1OP0A 3A8AA 2XBWA 1DXPA 1XVMA 3MNCA 2ZF0H 4INKA 4ISLA 2LPRA 4DOQA 2ZPRA 1O2QA 1AU8A 1SQRA 3ODFA 1GHYH 4SGBE 2PTNA 3KQEA 1QQUA 1W3CA 1NFWA 1C1WH 2A5IA 5C5NA 1ZMJA 2XOKD 3DSGA 2DE8A 1CGHA 1XX9A 2K0QA 1KLJH 2ILNA 1LDTT 2PP6A 2J98B 1GL1A 2ZU1A 1KXAA 1NM6A 1G2MA 1UTPA 5FCRA 1N8OC 1EZXC 3GYLB 4IN1A 1O3GA 1MKWH 3LU9B 4RSPA 1AQ7A 3SUEA 1AY6H 3JZ1B 1TYNA 3PV4A 1ZTJA 1BTYA 1CSOE 1RJXB 4K2YA 3Q3YA 3H09A 1C1QA 3UFAA 1L1GA 4ESTE 1SG8B 2RCEA 4A5TS 2QF3A 4WMDA 1A2CH 1V2JT 1O3LA 5GCHG 3IITA 1MABB 3A8DA 1P05A 4OS7A 4D8NA 1Q3XA 2BTCE 3HK6B 2FS9A 1G36A 3QGNB 4WMEA 3U8RH 3UWIA 1O31A 4JYUH 2HPPH 2HVYB 4IBLH 3PRBA 1GVZA 4Y7BA 3GY7A 4RKJB 1CVWH 2SGFE 3MU1A 2XTTB 1ELAA 4CHAB 4A6LA 1AD8H 3EA8A 5HGGA 2BY5X 2BY9X 2EY4C 1UVUH 3SOSA 1H8IH 1FY5A 5EXMA 1LKAA 2LNCA 2GMTC 3UREA 2WYJA 1LHEH 1GDUA 5AFZH 5EGMA 1P03A 4B2CA 1DPOA 1EB1H 2BVSH 3NRLA 1S84A 2ZHQH 2D2DA 1BB0B 2DE9A 4NZQA 1JIRA 1Z1IA 2G5VA 2J9NA 5F8ZA 1V3XA 3D62A 3ODDA 3SQEE 3MNXA 4GUXA 3A86A 4Z0KA 3E3TA 1O2NA 2WPKS 2A2XH 4D9RA 4Q80A 1FPCH 1CA0C 4Z6AH 4FUGA 1ELFA 2BZ6H 2HLDD 1NZQH 1GI7B 3QDZB 2B8OH 1LVBA 1F0SA 1C2DA 1PQ8A 1OHHD 5EJ1A 3LGYA 1D3DB 1ZGVA 4FU9A 2XNIA 2FDAA 1WXRA 4Y8YA 1DOJA 2PKAA 1K22H 1X7AC 1G9IE 1YYY1 3RXQA 3RP2A 2BM2A 1KDQB 1O39A 1PQ5A 1YPLH 2JH5D 3RXDA 3ELAH 1RTFB 1W0JD 4AX9H 4ZHLU 1O3JA 1GGDB 3GDSA 6CHAC 4A1XA 1MAXA 2ULLA 1GBKA 3E8LA 1W14U 1C2JA 1O2IA 2BY7X 4ABEA 1VCQA 4AGKA 3M7UA 1G32B 2C4FH 4MNVA 2ESTE 2FPZA 1BTPA 1COWD 5J4SA 2VB0A 1O3FA 5BRRE 3RM0H 1IQEA 3L3TA 1TPSA 4K8BA 4KP0A 4WH8A 5C1YA 4WXVA 3LH1A 3RMLH 2O8WA 1A5GH 1GI3A 2HLCA 3NUMA 4X2WA 2A4OA 3O8RA 4CBOA 3LC5A 1RFNA 1D3PB 1QA7A 1YPGH 3Q3KA 2PKSC 2R0LA 1MU6B 1B5GH 4RT0A 3M3SA 3HGPA 1QJ6B 1RGQA 4AG2A 1K9OE 1AUJA 2FTMA 3BTWE 2ZI2H 5FX6A 3BEFB 1BRUP 1C2LA 1BRCE 2JDID 3K6YA 1FQ3A 4H42U 4ABFA 1XMNB 2O8MA 1C4Y2 3RMMH 1W13U 1BBRH 1QBVH 1QJ7B 1TA2A 3D23A 3LKWA 2HNTE 1UVOA 3AW0A 4IMQA 1O2GH 3LIWA 2GV7A 4MPWA 5AFYH 2H1UA 3KQ5A 1O5FH 1HYLA 1ETTH 3SNAA 1NFUA 4BTUB 4DCDA 3MU0A 4ZCNA 4ZKNU 1FONA 2OC1A 2ODYB 1DY9A 2EA3A 4WJG2 1E36B 4IW4E 1CU1A 3E6PH 5C0TA 3U9AH 2PFEA 3SU6A 1HBTH 1MKXK 1CA8B 2YMSB 1WUNH 1DX5M 1F92A 4MTBA 3U1IB 4NIVA 3ZZ9A 4YOIA 1RTKA 4TSFD 1VGCB 1LVOA 2A4QA 3D65E 4CR5A 1VITF 2ASUB 3V0XA 1UK4A 1GWAA 2P8OC 1O33A 1MU8B 2V0BA 4YXWD 1EZQA 1HDTH 2F9UA 2Z9KA 1TBRH 3GISB 4Y0ZE 2C93B 1SSXA 3SO3A 3ZVAA 3PM3A 1A46H 1ZJDA 3VPKA 1GHXH 1V2NT 2XBVA 1SLXB 3SU4A 3SI3H 2KM0A 5GIBA 3PV2A 1GBLA 3BIVH 3LGIA 2QCYA 3U69H 1GI9B 1V6DA 3OAAD 1A5HA 1IQIA 2XBYA 1GI6A 1HAHH 1XUIA 1H8HD 4FVDA 2J2UA 1MBMA 1GBJA 2ANYA 2TRMA 3GCTF 1GJ4H 3EA9A 1INCA 4K5ZA 5DGJA 4GPGA 5KGOA 1TONA 5EQSA 1ELTA 3BG4C 1QTFA 5EW1H 4Y71A 5A0CA 2Z9JA 3UPEA 2TPIZ 1Y3UA 3P8GA 1SGNE 4HI3A 2FI5E 2CXVA 2BY8X 4Y7AA 5CHAB 1BRBE 3VB4A 2Y82A 1AE5A 3BTHE 5C5OA 1C2FA 4ISHH 1UVPA 1TA6A 2PUXB 4ABIA 4O3TA 1MMJN 3SORA 3WY8A 1E35B 1GHBF 1OX1A 1YPMH 1TGSZ 1BJUA 5EJZA 4IC6A 5B6LA 2IPHA 3RXFA 1GHBG 2EI8A 1O3MA 3M5NA 2BD4A 2ZTYA 1ZSLA 1KY9A 3ZVDA 3ZZ4A 2IJD1 4OS6A 1UTMA 3O8CA 3HKIB 4K69A 2FZZA 1P8VC 2JETC 2AH4X 3LOXA 3EA7A 3UWJH 1SGPE 1QHRB 5C67A 2V6NA 1CO7E 1L4DA 3UUZA 4DT7B 4CHAC 2F9OA 3DFLA 5HM2A 5EIYA 4R0IA 5G4BA 4B75A 1O5DH 1HIAA 3UQOA 2W5EA 2R9PA 5FHTA 4RN6A 3QO6A 4I7YH 1W0ZU 1DT2A 1TGNA 4JK6A 1JXPA 3LT3A 3RXEA 2DUCA 3SV8A 2ZCLP 5LH8A 1A3EH 3M3TA 3MU5A 1C2GA 3ZZ8A 1C1TA 1V2WT 3BTGE 2A0QB 2J4IA 1JBUH 2FOEA 2VINA 1W11U 1G3DA 2WPIS 2W6JD 4DIIH 1A0HB 2AHME 3RC4A 2EQNA 4BAQB 5GXPA 2W7UA 3RXKA 2J34A 1GBCA 1A0JA 1G3CA 1UVTH 3NK8A 1F7ZA 3MQKC 1ARCA 3Q00A 1CA0B 4X8SH 1LQDB 1C4U2 3V12A 1GJCB 4F48B 3M36A 2BVRH 3BTTE 4IC5A 4NGAH 4BAOB 1K1NA 1SL3A 4K60A 1YPHC 2V35A 3ATKA 4NCYA 1ESTA 1P12E 3MO9A 5EXLA 1TWXB 2AIPA 2A7HA 4X2YA 1ETSH 4Y8ZA 1Y5UT 3GOVB 2VBCA 3T29A 4ABBA 1KXEA 1P11E 2ZHFH 2J97A 2UWOA 3CS7A 3F6UH 3AAVA 2Y5HA 3ZZAA 2H9TH 1O3IA 5LPFA 2XYAA 2QN5T 1SB1H 2FOCA 1PQAA 3SI4H 2VWNA 4A1VA 2EC9H 1EAWA 1TE0A 2PGBB 2H5CA 5DPAA 4Y10E 2CK3D 2Q1JA 4TT3D 2ZHDA 3FAOA 3KQCA 1O2WA 3KIDU 2FLBH 3N7OA 4MG3A 2XXLA 1Y3XA 3A7VA 2GT7A 5DK1A 3PMHB 5DP7A 3M5MA 1LMWB 3LGVA 1HXFH 1MZAA 2G8TA 1UK3A 1D3TB 5C17A 1FUJA 1BITA 1TNKA 2QXJA 2ZHWH 3VB6A 3SN8A 3RXUA 1KXDA 5ETXA 4I8KA 2Z9LA 1GHZA 1C1VH 1QZ8A 1ZR0A 4A7IB 4SGAE 2BLWA 1SOZA 2XBXA 3STJA 2SFAA 1N6XA 2C3SA 1PPEE 3FFGA 1G2LA 2HVXA 1AVGH 1CBWB 3ATLA 3O8BA 5T3HA 3DSOA 2GZ8A 3UNSA 2CMYA 3CNRA 3ZZ5A 3ENSB 2GD4B 3QZQA 2HOBA 1K1OA 2XRCA 2GCTB 1NY22 1TRNA 2YOLA 1O5AB 5FCKA 5C1XA 1HRTH 1EATA 1H9HE 3T2NA 1BQYA 1XUHA 1PPBH 4I8LA 1FNIA 1J8AA 1K1MA 5JB8S 1GJAB 2PUQH 1TGBA 1TX8A 2AMDA 5JPMH 1AZZA 2VWOA 4A1TA 2FODA 4OM9A 5IK2D 2J95A 4YOGA 1WYKA 3FOAA 2QIQA 4MLFB 1K2I1 1C5ZB 2C8YB 1BMLA 3TGKE 1TNGA 4YESB 1A1RA 3DFJA 2ODQA 5EOKA 3SUFA 3NKKA 3A7XA 3MH6A 3MI4A 1G37A 1KTTB 1P09A 3DHKH 1FI8A 3ZVGA 1NRNH 5ABWA 2GMTB 7ESTE 2ZCHP 5HIYA 1LVYA 1J16A 1CT2E 2TGAA 4KTSA 1UK2A 2UUYA 1F2SE 2BXUH 2VVUA 1CT4E 1FY3A 4U32A 1T8LA 3V3MA 1NFXA 1DSTA 4KGAA 9LPRA 3CP7A 1O3EA 2Q6GA 2QXIA 4K8YA 2BYAX 1V2MT 2FOAA 3ZV8A 1C9TA 3PLBA 2G00A 3EGKH 1ELBA 4ACBA 4GHQA 3P8FA 2V3OH 5DSFA 1N6YA 1GMDF 1THRH 1FY4A 1KMHB 2R0KA 1XKAC 2FMJA 1DITH 1BZXE 1QGFA 1AGJA 2Q6FA 1C5XB 2GKVE 3U1JB 1J15A 1JRTA 4I31A 1HAVB 2P3UB 1ZZZA 1WTHD 5T1VA 1DFPA 4DY7B 6GCHG 5JBBS 2G4TA 1C1NA 1ELEE 2BDGA 1RXPA 3ZZDA 1FY8E 1WAYB 1EP6A 1T8MA 4E7NA 1DICA 1V2VT 2IPQX 1F0UA 1GMHF 2BDAA 1SBWA 1T31A 1CBWC 1E34B 2F9BH 1GBAA 1MQ6A 1ANBA 1HJAC 3RMNH 3R0FA 5EU8A 1E79D 4B6FA 2OP9A 3ZZ7A 1DUAA 5C1UA 2V3MA 2IN2A 2QF4A 1Q31A 1C5UA 1DE7H 2JIZD 1TPAE 5E2PA 4U01A 1K1PA 1GBIA 1C1UH 1C5NH 1Z7KA 3RXMA 1BIOA 3BEUA 2PTCE 1O2VA 1TQ7B 2ZPSA 1Z6EA 2QGRA 2WHXA 5E0GA 3GY2A 1HAPH 1AI8H 4YT6H 3EQ0H 2M2AA 3FVFB 4GCHG 5KECA 3LONA 2JKHA 4GHTA 5F6MA 3KF2A 1BBRE 2GX4A 3PMBB 1A61H 1ANCA 3E0NB 4CRGA 1ZLRA 4E05H 4FETA 2FXRA 1IAUA 5CE1A 4ZKSU 1TPPA 1MTWA 2PHBA 1GHVH 2B0FA 1QNJA 4THNH 9ESTA 1O2JA 1TBZH 2GVFA 4JZIA 4B76A 1TMUH 3H7TA 1S5SA 3STIA 4ABAA 5DP8A 1BHXF 3TJNA 1LPKB 2FI4E 5E0JA 4NZLA 1IQMA 2UUKB 2W3KA 2ZDAH 5HIZA 3V7TA 3RU4E 1VCWA 1WOFA 1G3BA 1VJ9U 3IG6B 1O38A 4DVAU 4MDSA 2FOGA 2SGEE 3ZVFA 2WV9A 1OWEA 1SLVB 2BD5A 3RXRA 4IMZA 4HGCA 3TLOA 3S0NA 3PB1E 1DWEH 2ZU3A 1ARBA 5A09A 4Y79A 3UNRA 2WPLS 1WV7H 1UHBA 1GI5A 4ASHA 1EASA 5EW2H 1NRSH 1FZZA 1GL0E 2C8XB 3BIUH 3T26A 3N99A
chains in the Genus database with same CATH topology
3TJUA 5HYOA 5LPRA 2A32A 2FS8A 4ZKRU 2VH6A 4AFZA 3ATWA 1DXWA 2ZG0H 1C4V2 1T8NA 1SGEE 4X0WU 4XSKU 1EJAA 1MTSA 2ZU2A 2TGPZ 2NU0E 2FP7B 1JRSA 1Y3VA 1GHWH 3S9CA 4MNYA 4WXIA 3MH5A 5A8XA 2A7CA 5EPYA 3CENA 2BDBA 4D7FA 1GCTC 1A0LA 3KEEA 1SLWB 1GMHG 4ZHAA 1BHXB 1HJAB 4H6SB 1LO6A 1O5GH 1SGFA 2ZHEH 3SJ9A 1BRAA 3W94A 2BMGB 3C27B 3QWCH 3W95A 4UFDH 2Z3EA 1OYQA 5DP4A 3QLPH 1MD8A 4X2VA 3RXHA 1BMMH 1QY6A 4LZ4B 2BHGA 3SU3A 5JBCS 1LPGB 3A83A 1T4UH 1TNJA 4XBBA 3VXEH 1HV7A 1LKBA 1TBQH 3OY6U 4ZUHA 1GDQA 1AWFH 1AWHB 1DDJA 1TNLA 1QB1A 1E38B 2B5TB 2ZDNA 3E1XB 1OKXA 1GBTA 3FP7E 4CRBA 4DJZB 1WCZA 2NU1E 3NPSA 4I32A 2XC0A 3A89A 5JBAS 4UFGH 1XM1A 1P0SH 3AW1A 2BDIA 1SHHB 1D4PB 1HAZB 1TQ0B 1QB9A 2AMPA 3VEQB 2PWXA 1UTQA 1PPFE 2BDHA 2FESH 1IQKA 2OQUA 2TBSA 4E06H 2G4UA 2ZFQH 4CBNA 1YC0A 1V2QT 1CHOF 4NG9H 4WMFA 1GCTB 1DLKB 2KAIB 1JIMA 1C2MA 1O35A 3SU2A 3SUDA 4INHA 1NU9A 3NWUA 2RG3A 1HUTH 4VGCC 3UR6A 1RRKA 4NA7A 1LPZB 2XWAA 6GCHF 3GCHB 1ZHRA 1NRPH 1U6QA 4X1RU 1SGFG 1GI0A 1TMTH 3A85A 1OWJA 4FUFA 5C3NA 2BDYA 6LPRA 1TFXA 1O5BB 3P95A 1PYTD 1N8OB 1ETRH 3ESTA 4OGYA 3OU0A 3SV7A 1PFXC 3B23B 1TOCB 4YLQH 1BJVA 1T4VH 3A8CA 1VITH 1XXFA 4ZKOU 2ZCKP 1UTOA 2FM2A 3BV9B 2FO9A 3A82A 1MZDA 3TJOA 4X8TH 4JZEH 4IN2A 2I6SA 5TCCA 1YBWA 4TWYA 3T62A 4NIWA 2VVCA 1CQQA 1LHDH 2F91A 1HJ9A 1Y59T 4TPYA 5F8TA 4NA9H 1P02A 1C1MA 1XKBC 3OTJE 3TIUA 3LDXH 4K1SA 1YP9A 4ABGA 1YPHE 2ZKSA 3MWIU 3ZZ6A 2OQ5A 3P8OA 2VNTA 1Y5BT 1TRMA 4ZXXH 1B0FA 3ZVCA 4ISIH 3RXOA 4VGCB 1C5LH 1QQ4A 2YNAA 3RXAA 2BY6X 1C1PA 2Z9GA 4X8UH 1C1SA 2P8OB 3TITA 5ESTE 2VIWA 2CV3A 2VH0A 4XE4A 2A7JA 2ZA5A 1FJSA 2BD3A 1ACBE 4DIHH 1ELDE 1OWIA 1TIOA 1QIXB 1P2QA 3I29A 5EG4A 2WV5A 1NRRH 2QY0B 4U30A 4WY3A 3CS0A 1XVOA 2ALVA 5HXFA 3SV2H 4HFPB 4K1EA 1ZMLA 1HAVA 3UY9A 3TJVA 1QURH 3A81A 2PKAB 4I8HA 1H9LB 1HNEE 1NTPA 2GDDA 1C5OH 1KLIH 2RA0A 1ZPZA 3VGCC 1UCYK 1AB9B 2WUBA 7GCHF 3SHCH 2QV1A 4O97A 1AVWA 2A4RA 1FIZA 1KSNA 1O3OA 5EXNA 3NZIA 8GCHF 1TALA 1VZQH 5FAHA 1EOJA 3P6ZB 1P2IA 3BG4B 4J2YB 4WVPE 1EAXA 1GJ9B 2ZDVH 5CMXH 1MCVA 1OSSA 3SV9A 1UJ1A 5GDSH 2YNBA 4NFEA 5JB9S 1YPJH 2O8LA 1G3EA 2P95A 3RXVA 1O2TA 1K1JA 3RLWH 5I46H 4ZAEA 2ZWLH 1SFQB 1SGIB 2FLRH 4UFEH 3K2UA 3UQVA 1FAXA 5HMAA 1NS3A 1FDPA 3K6ZA 3S7KB 4UONA 2ZEBA 2Y5GA 2GDEH 1PJPA 4Y8XA 5K7RA 5FX5A 1O2XA 5T6DA 1KIGH 3PWBA 1EX3A 1THPB 2CGAA 3FP8E 1Q2WA 1WSSH 3SQHE 2OXSA 2BOKA 3RXCA 2FI3E 1O2OA 1FLEE 5DKMA 4Q2KA 3F68H 4NA8A 1O3AA 1GBFA 3PO1B 2J38A 4TWWA 2H9HA 5L2YH 5DP5A 2EEKA 1O36A 1AUTC 3AVZA 4FUHA 1OS8A 1MCTA 1MTNB 1P10A 3SJOA 1ZTLA 1GDNA 3SW2B 2A31A 2VIVA 1VJAU 1V2OT 3URDA 1D9IA 4J1YA 2O8TA 2P16A 5E0HA 2VJ1A 3PYHA 1S82A 1T32A 3SNCA 3NXPA 1A5IA 1L4ZA 3Q76A 3SUGA 7KMEH 1O3HA 5BPEA 2EI6A 4KKDA 4LXBH 3I77A 3TVJB 1TAWA 1SQOA 1TRYA 1G30B 2ZTZA 2HNTF 3VB5A 1K21H 2AEIH 2PW8H 4OGXA 2ZC9H 3MNBA 1ELVA 4AOQA 3U8OH 1GBMA 1GBEA 2Z7FE 3QK1A 4B74A 4MNWA 3F9EA 2ZFFH 1O2HA 4GVUA 3ZZCA 1D6RA 4QT8C 4X8VH 1Z8GA 2HNTC 3VFEA 1AZ8A 2CN0H 2ZDLA 1NPMA 1YM0A 2BXTH 2QXHA 3SU5A 3RXGA 2P93A 2ZPQA 2OD3B 1SHYA 3QGJA 1FN6A 1M9UA 2Z3DA 5L30H 3V13A 2G55A 3R3GB 1KXFA 2Y7ZA 3DD2H 1O2KA 1GI1A 1BBRK 1SFIA 3BN9A 2SNVA 1HLTH 3SNDA 2ZQ1A 1AFQB 2ZFTA 1CE5A 4CH2B 3AAUA 5FBEA 1OWKA 3BTFE 4AFQA 3B9FH 3FP6E 2P59A 3UOPA 2BLQA 1XUGA 4TPIZ 1QB6A 2BLVA 5K0HA 1ZJKA 2AGEX 1TNHA 2BOHB 4ZMAH 1BT7A 1PPGE 3ATIA 1O5EH 1C1OA 2D26C 2UUJB 3GICB 2OTVA 2JETB 1FAKH 5DJ7A 1EXFA 3SHAH 4LK4A 1EAIA 1RS0A 4I8JA 4JZ1A 1ESBA 2VGCB 4DURA 1D6WA 1LTOA 1Z8RA 3OSYA 1QJ1B 3TK6A 1EQ9A 4MPUA 2PGQB 4TY6A 1PPZA 2TGTA 2ANMH 4R8TB 2ZGXH 4LOYH 4X1SU 1NESE 3M5LA 1H8DH 4TYDA 1CHOG 2OBOA 1HIAB 4CRCA 2PV9B 1B7XB 1IHSH 4FVBA 5F03A 5A2MH 3RXPA 4FUBA 1GVLA 1O0DH 2W3IA 2D1JA 3M7QA 4DW2U 3HKJB 2M5TA 1VITG 1W0YH 2RA3A 3GCNA 1C5RA 4HTCH 2W7SA 4AG1A 1C5WB 4JZFH 5A8ZA 5HM9A 2WPJS 2O9QA 1QA0A 4LZ1H 3A87A 1W8BH 3ZVBA 1DUEA 1GG6B 1P9SA 1UO6A 1YCPK 3GY5A 2A45B 3LPRA 3M3VA 4XBCA 1SGYE 3ZVEA 1T8OA 4E7RG 1K1IA 1GMCF 1V2TT 1HFDA 5C20A 2FOBA 1SVPA 3SU1A 1GHAG 2ZU4A 5IDKA 2BDCA 5GJ4B 2GCHG 3A88A 1TABE 1V2RT 3ATMA 1AFQC 3SNEA 3MMGA 3GCOA 1KDQA 3E90B 5A0AE 1EJMA 3F9GA 1BMAA 2F3CE 4X1NU 1C9PA 1UTKA 3KCGH 2F9NA 4Q7XA 2NWNA 2OCVB 1F5LA 1ANDA 1H1BA 1P57B 1ZRKA 3HPTB 1BDAA 2SNWA 3BSQA 2VIDA 2XC4A 1GI2A 3MO6A 3PMJA 2GCHF 3LGWA 2H6MA 1AE8H 1MUEB 4X1PU 1WU1A 4M7GA 3P70B 4FUCA 4FXGH 2JH6D 3MU4A 1O3DA 4B1TA 8ESTE 1V2KT 4Y76A 2HPQH 3ZZ3A 2OC0A 1RTLA 5DG6A 4O03A 1A7SA 4JZDH 2G81E 5AHGH 1O34A 3LJOA 2ZZUH 3PROA 3VGCB 3F9HA 1UCYE 1LHCH 4BOHA 1TX6A 4DGJA 2AS9A 3ZYEA 3QZRA 2OLGA 4MPVA 1C5QA 3P8NA 1UTNA 4FUEA 5A8YA 3QX5H 4A92A 1FY1A 4AORA 1BCUH 1S0QA 2RDLA 2Y6TA 4NWLA 2OC8A 1DLEA 1ZYOA 1GMCG 2OUAA 4ZHMU 1ZTKA 1QBOA 1MAYA 1IQLA 3O8DA 1ID5H 3SV6A 1SGCA 3T5FH 1RIWC 2WYGA 1OP2A 1C5VA 2H2ZA 2GZ9A 2ZNKH 3RC6A 2FTLE 4NFFA 1NFYA 1AMHA 3KHVA 2QF0A 4O9VA 2HGTH 1LQEA 1J14A 4X6MA 1GVKB 1P3CA 4BAKB 2WUCA 4IS5A 1O3PB 3BG8A 4PROA 5FPYA 1QBNA 1CHGA 1Z8IB 2PSXA 3K9XB 4INLA 1O2UA 4BNRA 1HAXB 5AVDA 1GJ5H 1S85A 5ESBA 3GCHC 1V2PT 2F83A 1L2EA 4CH8B 2CF9H 1W7GH 1HAIH 1A3BH 1IHTH 3JZ2B 1P3EA 5H4IB 3B8JA 1FIWA 5DP6A 4YT7H 2J92A 2PLXA 3TGIE 4YOJA 3HGNA 3L6PA 1Y5AT 1F0RA 4GCHF 4OS2A 1GJ6A 3TNSA 1MQ5A 1O2MA 2FOMB 3Q77A 1NT1A 1QL8A 1ZHMA 1YLDA 2NU3E 2EI7A 3TH2H 2GCTC 3SJ8A 4Q7ZA 3BTQE 1OWHA 1L1JA 1PQ7A 2GT8A 1V2LT 4AYYB 3OY5U 1QL7A 4BXSA 1OYTH 4WH6A 2AIQA 1HCGA 1SOTA 2XCNA 3GYMA 1KXCA 1WQSA 1EP5A 3TK5A 2R2MB 1BMNH 1SI5H 4ZROA 5DP9A 5FXLA 1GJDB 1MTVA 2ODPA 3UIRA 1MKWK 2Z9IA 3E0PB 1SGTA 2QC2A 4UE7H 1NN6A 3KQBA 2G52A 4AB9A 2CF8H 3GDVA 2A4GA 2GGVB 3KNXA 3VB7A 4ISOA 3SZNA 3FZZA 3RC5A 1BTZA 1BTXA 1IQNA 1FPHH 3P17H 4Y6DA 2H9EH 1O32A 3Q3XA 1EAUA 3EDXB 4YTAA 1GGDC 6CHAB 1QRWA 2FIRH 4ABDA 1XXDA 4F49A 1JOUB 3F1SB 3T28A 4K1TA 3SJKA 1NRQH 2ZGBH 2FYRA 2Y5FA 3ITIA 1HGTH 4WWYA 1J9CH 2CJIA 1QCPA 1UHBB 1MTUA 1F5RA 3LH3A 2ZFSA 6ESTA 1MH0A 4KTCA 4ZXYH 4YO9A 1ZOMA 2STBE 4I33A 1Y3YA 3TU7H 4NIXA 4U2WA 4D9QA 2FOHA 5FBIA 4X6OA 2VU8E 1GI4A 1UTLM 3A7ZA 4UDWH 1S6FA 1ZRBA 2GZ7A 1EPTC 1FN8A 3TGJE 1O37A 1JWTA 5JDUB 1YLCA 4XFQA 1HB0B 1AB9C 4NSYA 2VVVA 3RU4T 4OS5A 4I8GA 1DWCH 1IQJA 1YGCH 1GJ7B 8KME2 3BEIB 1C2KA 1P2MA 1TNIA 3M37A 1ZHPA 1BTWA 4BAHB 1GJ8B 1GBBA 1VGCC 1GG6C 5EPNA 1KYNA 3EYDA 1SPJA 4X2XA 3P92A 5SGAE 2HALA 5F8XA 3HATH 2BQWB 2JH0D 5L6NH 3GDUA 2GTBA 2WINI 1WBGB 2B7DH 5TJXA 3TPIZ 2WPMS 1OP8A 1QR3E 1P04A 4B73A 2H5DA 4NIYA 7GCHG 5C2ZA 1OXGA 1DANH 1SMFE 1SQAA 1CGIE 2V3HH 1S0RA 3RXTA 2UUFB 5E8EH 2XCFA 1N1LA 3PWCA 1GBDA 1DY8A 1WTGH 2OINA 3OYPA 3IWMA 3UOUA 2BVXH 5GPIB 4YZUA 1O2RA 1D3QB 1S81A 1ELGA 3RDZA 1AKSA 3RM2H 1ZMNA 3QN7A 3MFJA 1LHFH 1W12U 1UCYH 4JYVH 2QAAA 4Y0YE 7LPRA 2FEQH 3RMOH 2ZGCA 1O3KA 3BTEE 2ZFRH 1QL9A 3QUMP 2G5NA 3RU4D 1FXYA 2ZDMA 3A7YA 1EPTB 1GJBB 1ZPCA 4Y11E 1L1NA 3SGBE 2WPHS 2VIPA 2AFQB 2ZGJA 3NCLA 4BXWA 1CT0E 1WQVH 1C5PA 1K28D 2ZECA 1NU7B 1ORFA 2KAIA 1P9UA 2PSYA 1O30A 3BTME 1DS2E 4B2AA 1EPTA 1O2YA 1AVXA 1CGJE 2SGPE 2GP9B 1TMBH 1SQTA 1AIXH 5A0BA 1BA8B 2FOFA 3MNSA 1HAOH 2GV6A 3DUXH 1BUIA 1EZUC 2OC7A 3QTOH 4FUJA 4YLUA 3TNTA 4B2BA 4B71A 4FUDA 3PLPA 1DWDH 4X1QU 1ANEA 3MU8A 1C5YB 1RIWB 1SGDE 1EZSC 4GLYA 1NO9H 1O3BA 4MPXA 2WV4A 4K3JA 1AFEH 5L2ZH 1BOQA 2P3TB 4XDEA 5FPSA 4DG4A 2W26A 1SLUB 3LJJA 2ZTXA 4ABJA 3T25A 3H7OA 5EQQA 3SGQE 2ZP0H 3SU0A 3UTUH 3SBKA 2I6QA 1UTJA 1W10U 3G01A 3U98H 1C1RA 2AGIX 1O2ZA 1ABJH 2B9LA 1YF4A 3AASA 1GMDG 1P2OA 3LC3A 4JCNA 1IQGA 5EODA 2FWWA 1LCYA 1P06A 2VWLA 2A2QH 1V2ST 1S6HA 1C5SA 4IGDA 1TX7A 2P94A 1O2PA 1VR1H 3L33A 4XOJA 1NROH 1Z1JA 1TB6H 2VIQA 2VWMA 2NU2E 4BAMB 5PTPA 3QTVH 1DVAH 2PKSB 4F4OC 3EE0B 2HWLB 2BD9A 2ZGHA 1GCDA 2ALPA 3A80A 3E91A 3MHWU 1THSH 1C5MD 1UMAH 3UNQA 1SGRE 1GI8B 1XUFA 1K1LA 3MOCA 3VB3A 3A7TA 3VXFH 3PLKA 1H4WA 1TOMH 1TGCA 2AERH 2VGCC 3UR9A 1MKXH 4UEHH 1XUJA 1ELCA 4BTIB 3F9FA 2G51A 1A4WH 2Y81A 3KL6A 1FV9A 2D8WA 3PTNA 1ZPBA 1Z6JH 3M61U 4XBDA 2AMQA 1SR5C 4KELA 3S9BA 1EB2A 2K1QA 3M5OA 2ZO3H 4RKOB 2CHAC 2A5AA 1LHGH 3DA9B 4CRAA 1HAYB 4FU7A 2XWBI 1IQHA 1EKBB <