1GL4B

Nidogen-1 g2/perlecan ig3 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
89
structure length
89
Chain Sequence
PIMVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NIDOGEN-1
publication title Structural Basis for the High-Affinity Interaction of Nidogen-1 with Immunoglobulin-Like Domain 3 of Perlecan
pubmed doi rcsb
source organism Mus musculus
molecule tags Basement membrane
total genus 21
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gl4B00
2R2CA 4HXBL 3TYFB 4PJBF 3M1BB 4JPKL 3K74B 5GS0D 1A4KB 1PFCA 1FYTA 1I8KA 4KK6D 1BZQK 1KLGA 2DJSA 1I4FA 1CDIA 4WWKB 2DLIA 5GS3A 4G3YL 4CW1B 1QSFE 1FC2D 4ZFFA 4M7KH 5CJOH 3SDXE 4XPTL 4YAQA 3QUZA 5HYQB 2PXYC 4X7DC 3MJ7B 1CLZL 1SMOA 1F90H 4JRXE 4PJBB 1IC7L 5E2TL 3NVQA 3DGGB 5EBWA 3N85L 5ID0B 3P2TA 2XZAL 1DVFB 5DHYB 3BEVB 3HZKA 5I71B 4B41A 3N1MC 3SDAA 2E8YA 5KBNC 3AMLA 2XNAB 3FQXB 1A0QL 3RVWC 4EQ3A 2G75A 2P5WD 4RWYH 3HC4L 1UENA 3FFCE 1NCBH 4RMQA 5ACLA 1MCJA 5IBTL 3ULUF 5IW6A 1QR1A 4NHUA 2R1WA 3LRHA 1A7RL 1J11A 5F7EL 3CVHA 1U6AL 4Z95L 3DYMA 2R0ZH 3S36X 2IPUG 1CG9A 3TF7C 3C60B 4N9GA 4OD3L 4JFQB 4N8VA 5B3JE 4U6VH 2R2EA 3D1MC 3DVNB 1AHWB 1JCKA 5DRXB 4HH9B 5FUCC 4GKSA 5CJQL 3J8F7 4WEUD 1QBBA 1HYSC 3L1OL 5T1KD 2XQBH 1O0VA 4EDWH 2CUIA 5E2VH 1J1XH 5IW1A 1AGDA 4XBEL 3FB6A 1ACZA 3CXDH 1MREH 2X4UA 4PJ7E 4ZTOL 2EH7L 1VGEL 5JIKA 2BSSB 3BVNB 1T21B 3GSVB 1AQDB 1LD9B 1S7WA 1OLLA 2YPVL 1U8LB 4NM8L 5ERWB 4GLRH 3I6GB 4OLWH 5TFSL 5LJYH 1YMHB 2DQHL 3ARFB 5C86A 4OZIA 4NUGL 3V4UL 3VFGH 1OTUC 3H7BA 3R4DA 4MA7L 5TF0A 1KPVA 4YIQA 1UACH 3BEWA 2BX5A 3IGAA 4RNRA 3U0TB 2VABA 3GO1L 4P2OA 3HE7C 2P8LA 5GRXG 4LSTH 1YN6B 1IZJA 1WGOA 3ROOA 1I7TA 5ETUA 4XCFH 4WV1B 5SWSE 3U36B 2FZ3B 2VXSL 3DROB 1M7IA 3I6LD 4AG4H 4OB5L 2NR6D 4EKXA 4XP4L 3AS0A 2UZIL 5JTWA 2JTDA 1SQ2N 3QQ9C 4WEMB 2E6PA 5DJAB 1MIEH 3HNTH 4NZTL 1BVLA 1T66C 4PUBH 4B0MM 4F57L 4U3HA 1NL0L 1X5AA 4J6RH 5HI4D 3V5HB 1TCRA 2VISB 4ZFOL 1NCAL 1EGJA 4WTZA 4CDGC 3QCTH 4LOUD 3X3FL 1WFNA 4TULL 3QEQA 3VFNB 5E08H 2NW2A 5IB3B 4L29B 1IGML 1IKNA 1EO8H 4FFVC 3WD5L 4GQPH 1BD2A 3GMQB 2HJLB 2YKLL 4JPKH 4JVWA 3RNQA 3UCRA 3IVKA 4R96A 3ME0A 1BHGA 4G3YH 4JZNA 3ECBA 3B9KB 4NKDA 3MRFA 1PEZA 1RZFH 2JCCF 3FONB 3QP3A 5L2JA 2MMXA 4XPTH 2HYMA 1RK0A 2ZNXA 5D72H 4Z0XA 4AEFA 5IT2L 1RZKL 3PP4L 2ORBL 3GSNB 1AGCB 5HGDA 3UTPD 1PG7W 5JNYB 4Z7WF 1CLZH 1ZHLA 4MMXC 3U6RB 2CKBB 1HHJB 1IC7H 5E2TH 5HD8C 3I75B 1LO2L 1OWWA 2V2WA 3N85H 3SJVA 2XZAH 5AYUL 1K4DA 5A2LH 4W68A 3NCFB 2VB5A 4C56B 3OKEA 4GRLC 4ZFZB 4K07A 1XR8B 2JCCB 2EDQA 1N0XL 4YHYB 4LDLB 1A0QH 3T0AA 3HC4H 2P5WE 3V5KA 5I16B 1DN2A 4Z7WB 4V2CB 4N0FA 1T7ZA 5F7EH 4OFYA 1H0DA 1ZHBB 4KPHL 1RPQA 2IGFL 3FB7A 4NNXA 3VXQB 1KIRA 1OOAA 1VFUA 5BS0D 5CJQH 1MCWW 4RFOL 4MA1C 1KTDA 1GZPB 3L1OH 2CR6A 2KZWA 4XBEH 2EYTA 3EOTL 3GI8H 4CN6A 1S7UA 5EWIL 3MGAA 4ZTOH 3ET9F 2EH7H 5EO9B 2Z31B 3UTSD 3FOLA 2Z35A 2YPVH 3L9RB 1KYOK 4NM8H 4W6WB 2ZKHL 2JB5L 5D5MA 4PR5B 4MXQC 5TFSH 1Z9MA 2DQHH 1TJGL 4LGRB 5JLZA 2IADB 1KJ3L 2OTWB 3DX6B 4NUGH 3V4UH 5E4EB 4TSCL 5DEGB 4JAMA 1HHIB 4C55A 4MA7H 1S9XA 1N7ML 4XVUD 4ODHL 4JM4L 3RWIB 3RRQA 1S7TA 1FO0B 5FB8B 3OKNA 2GCYA 3GO1H 4QHMB 4OZHF 1BM3H 4EI6A 3GBML 3IDMA 1PQZB 1OPGH 1CQKA 4AEEA 1AO7A 5AD0B 1RZJL 4Y4KB 3I6LE 2F74A 4OB5H 3E8UL 3IDUA 2V9QA 4N0CC 2FR4A 2ED8A 4R7NB 1K8DB 4N9OB 4XP4H 5HSFA 4Y4HC 4K9EL 1LEKA 2UZIH 1MH5A 3WXWL 2R0LH 4QRTB 4WFFD 3MR9B 1SVZA 5DRWB 4F37K 5BV7B 1FYTD 3MBEB 4ORGB 2W0FA 4KGLA 1MIMH 4NZTH 4E41A 4F57H 3HMXL 2DI7A 1NL0H 3QHZL 2C3HA 1PAMA 3O2VL 3G9VA 1JGEB 3PF2A 1KCUL 4NKOA 4LEOA 4DN3H 5EC1B 1NCAH 2FBJL 4WFHD 1FFOA 3T4AA 2FX7L 1OT1A 2MOVA 3X3FH 4UT6H 4HS8L 3FOMB 5GHWL 3C2AL 4L5FL 1BIIB 2CRMA 1JUFA 3MO1A 5CBAA 4HS3B 2DI8A 1CL7I 5ALBL 1R5IB 3RGVA 3EAKA 3CVIH 3WD5H 2G9HA 3T2NH 1I7UA 3SDAD 5FKPB 4MAYB 4P46B 3OGCA 5HDBE 5GRUL 1LEGB 1DEEA 5CJBA 1NFDB 1QYGH 1DQQB 2ICES 4ONHA 5ITFB 2ZUYA 4JFDA 4M61A 3O11A 1XZ0B 1OAKH 3HUJF 1T3FB 3K46A 5GSVA 2Y5EA 1EEYB 2QKIB 5J8OA 2VQ1B 1Y6MR 5F9WB 1F5WA 3JZ7A 1RZKH 3L3IA 3PP4H 3TNMB 3T8XA 3VXSB 1MUJA 1HOCB 4X5XB 3UTPE 3L7FB 2ZUQC 4BFGA 5IB1B 3DRTB 5FFLA 3O0RL 2OMNA 5L2KB 4TPRH 5CAYB 3TJEL 5D70L 1FFNA 2IANB 5DURB 3HB3C 3MOAL 2PYEA 4UQ3A 1N0XH 5C09B 2P46B 1FNLA 3HE6A 1HQ4A 1G1YA 2EICA 2I9LB 4ELKB 3V95A 3IJHB 1CGUA 1ZA6B 3OKDB 4JHAL 1TPXC 4QRPA 3TBTA 1WWAX 4PV8A 3U9UB 1FL5B 5DVNA 3RL2A 3HHRB 3MXVH 4HLJA 4NQDA 5C6TL 4LMQI 5EA0L 4F7CA 3ULVF 2IGFH 1DLFL 5INDB 1MJJA 4ZUWB 1FDLL 2DLTA 5D7LA 2ITCA 4RBPK 2WIIA 5BS0E 4KUCD 3TNNB 4RFOH 3PWLB 1MAKA 1NBZA 2VDQL 3IFNL 4O2FA 3MRIB 5FCSH 1MRFL 3E2HB 3IDNB 1H8SA 3FQTA 3M07A 1CL7H 2H9GA 3UTSE 5C70A 2JB5H 2HT3C 5CP3H 4U6YB 3FT4A 4MA8L 4PLOB 1FPTL 4MQ7A 1QEWB 1OL0A 5GGRA 1P7KB 3TJHD 1S8DB 2XWBB 4GKNA 4JN1L 4PBXA 4TSCH 5DD6A 1VFOA 1EMTH 1KPRB 3KPMB 4GBXB 4U1JA 4KTEL 4ODHH 4XBPA 2AEQL 1FVEB 1UZ8A 3KPRA 1Z6JT 3D48R 2FH6A 1BOGA 5IK3B 3GBMH 4M8VA 2NZIA 4Y5XA 1EXUB 1B4RA 1T83C 3ESVF 2B39A 1DBJH 1G7LA 2FJGB 1OP9A 1RZJH 3WNKA 3IDJB 1WBYA 3EGSA 3B5TA 1BD2D 3IKKA 4M7LT 5JW4N 2X70A 4K9EH 4I4WB 3HLAB 5JOFB 3SE4C 4O58H 1G7HB 4N1EA 1FYTE 3STZA 3RHWK 3IRZA 3C5ZC 4ZUVA 4JY4A 2EXYD 3HMXH 1CVRA 2W65A 4P2QB 5DJ6B 4ZXBC 4DFHA 4EUPG 2X7LA 4WU5A 3BOVA 4BFIB 1PKQB 4O2EB 1KCUH 3PGFL 1Z9LA 4LVNC 1YEFL 1DQJA 1MFAL 1HWGB 1UXWB 1QLFA 3VGAC 4WFHE 2PF6A 2ESVB 4Y1AA 2ADGA 4LMQE 2IAMB 2XG4A 3K2UL 1NGYB 1QSEA 1TZHB 4HS8H 4NQEB 3SJVD 5GHWH 5IESH 1S78D 4OUUA 4QRSA 3PHQA 3FT2A 5C0FA 4JRYB 3ZYIA 5ALBH 4DUXA 5BMFH 3SGKC 3VGHA 5GRUH 3DV6B 4BQ8A 3F7QA 2FEDC 5DJ8B 4KVCH 3G6JF 2VLMD 5BOZG 4PJIF 3FZUD 4EJ1C 2W9DL 1I75A 5FYLH 5GRVK 1AD0B 4X7TB 1CDJA 1XF3A 5DK0B 3WUWG 3MV7B 3BZ4A 3LOWA 1DUYA 3MV8A 3QAZB 4Q74A 5I9QB 3H9SB 5CEXA 1OGAD 1U8QB 4LP4A 3VRJB 4XBGA 4IMLA 3O0RH 4JFEA 3LVEA 3G6JB 4XTRC 5D70H 3GMRA 3QEUA 5HYJB 3MOAH 4Z8FL 5D7JB 2LE9A 4NO5B 3U7WL 1UB6A 5I76B 4NQXA 1MCHA 3T0ED 1RSFA 5J12B 2HKHL 3D69B 4PJDF 2Y23A 3SQBA 4JHBA 4OZIE 4ZOEA 4K23L 5C6TH 3WSQH 2G2RB 1D9KC 5TE7L 3AXLA 4MS8D 1XGUA 1FDLH 5E8NA 3IDXL 1TTFA 1T1ZA 3P9MA 1CD1A 4Q6YA 4WEBL 2VR9A 2F53B 2VDQH 4H26B 4BM7A 5I8EB 5TE6L 3IFNH 1OP3H 3DO7A 3K8MA 4ZAKC 3PUCA 5BW7C 4XMLL 4KTDL 3ULUL 5HYFA 3O3DB 5EFIA 5C0RL 5BZWB 4AIOA 4GG8A 2NNAA 2AV1B 5HY9A 15C8H 5GS2H 1H15A 4KQ3L 4EQ2A 1Z2KA 2AW2A 3F5WA 3UAJD 4PJXF 1MLBB 3BH9A 4PJAB 2XTJD 4KC3B 4UDUA 5CIPH 5FGBC 4KTEH 4TUJA 4M8QA 4E41D 5JW4M 2AEQH 4R2GC 3NCJL 1B0RA 1YQVL 1HE7A 3CFJA 1UC6A 4UTAL 4CKVX 1A2YA 3UYOD 4RFEA 3ZKXC 4RMVA 4WHYH 4GAGL 1KJVA 2BHYA 4PJXB 2NY4C 1WC7A 3ARDC 2A73B 1JZ2A 1YN7A 2Y1VA 1K2DA 1AXIB 5T3XD 2IF7A 1N8ZA 2IFGA 4LAQL 3RGVD 4LSUL 3SDCC 5I19H 1BD2E 3JBG7 1UM6L 4R7DB 3O3AA 1F3DJ 2X41A 3BQUD 3U46A 4X9BA 2J4WL 2VQUA 5FAAA 3EOAA 4JFDD 3QUMA 1BZ9B 1JWSB 2W9EL 4UIMA 4K3HA 2L0DA 4K3DH 2BVQA 3PGFH 5KSBA 1MFAH 1YECH 3UYPA 1A7NL 3PIQB 4BKLB 4AQOA 3VH8B 3MJ8A 4PJCE 1KGCD 5HI5D 5KS9A 3HAEH 3SJVE 5MEPA 4XZUA 3QIWB 2V2TA 3KHQA 1OAYL 1VFBA 1R6VA 2DTSA 4QWWD 2NY0C 1N5AA 2PYED 1E28B 4PP2A 5B39A 4MDIB 5FUZL 1E0OB 3F7RA 3VI4E 4G6MH 4FQ2H 4Y5YB 1H5BB 1AH1A 4TVPL 1WEJL 5I1KH 4YQXL 4ODBD 1YC8A 2H6PA 4BH8B 5F21B 2VLME 2W9DH 1BZ7A 2GY7B 5DJCB 4UNVA 4PD4J 3D39D 4KU1A 3AREC 3GSQB 4NQDD 5IOPB 2IC2A 3SE9H 1SJEB 3PL6B 1ERNA 1P2CB 3BIKA 1VB9A 4U6XB 2KQMA 5D7LD 1T7VA 3KDMB 2VL4A 1JN6B 1QD0A 2XI9A 4PTTB 2PNDA 2Z8VC 3NIGF 1YDPB 1ND0B 1WWBX 3MRRB 4P4KC 4QRRD 4XNQB 2CKBL 1VGKA 4MCZA 5DMYA 4Z8FH 1A6AB 3KLHC 3VMOA 3U7WH 1U95B 2EDOA 2VL5B 2HKHH 3N1FC 3ILQD 4PRDA 3T0EE 1SM3L 1DBKH 3L3OB 4N5EC 2OZ4A 1YUHA 1DBAH 5J3HD 1KTRL 4M02A 2QQKL 2G5RA 5KN5A 2R8SL 3N1QC 4K23H 4JFXA 4W6XB 1F8TL 4AIXA 4PS4H 1NC2A 3SKUD 3KAAA 4YH6A 3SO3B 1C08B 3KPRD 1RZGB 5FGSA 2X1XR 1I1FB 2DBJA 4YZFF 3QA3B 4LVEA 4WEBH 2Q87A 3REVB 4TTGA 3CZFA 2NYYD 2ZJSL 1O5DT 3HTLX 4DTGL 5TE6H 4CNIB 1UJ3C 1T2JA 1U2HA 2BOBA 2LAAA 2ZOLA 5K9KB 3WFBH 4XMLH 4KTDH 5ACZB 5F6IC 4BSWB 3G04A 4BYHA 3WFDL 1IGCL 3MGTB 2CK2A 4KQ3H 1R3KB 2NLJA 2MNUA 2KL6A 4JQIL 4U1IB 2W92A 5C0EB 2XTJE 5GZND 3V0WL 1WSST 4E41E 1OSZA 3NCJH 1YQVH 1WWCA 3WN5B 1FNAA 4UTAH 1UXSA 2ZSVA 4RAVB 4LNRB 1BBJB 4NQVB 3O45A 3MNZB 4Y1AD 1KXTB 1OAQL 3QDJA 5JW5B 1EHLL 1HEZA 4HKJA 3HPLB 3LEXB 4AT6A 5GSRB 3PWJB 4WW2A 5HPMA 4HIIA 5D1QA 5H37G 5BVPL 4LAQH 5T3XE 3KS0H 4HXAL 4V1DA 1NBYA 1UM6H 3LN4B 3TM6A 3BPOC 5IWLA 1BAFL 2VAAB 4GUPB 1R5WA 5EZJA 3X17A 2J4WH 4FN0A 3U2SB 4JFDE 1XF2B 3CDGB 1ZLSH 4RAUA 4X6DB 3KPNA 4YPGA 3T65A 2DOCA 5T1MB 1Z0MA 1LEIA 1CT8A 3MV8D 1A7NH 3RTQA 1HNFA 1WF5A 4Y2OA 1JWUB 3CMGA 2DQFA 4RGMC 3QCUH 1KIQA 2GY5A 5C07B 1KGCE 4HFUL 1KLFA 5HGBB 1NDGA 1NLBL 3PWPA 1H3PL 5CKAA 1BFOB 3EYVB 3QUKB 1G7QA 1LP9F 4AH2A 4KKBC 2PYEE 5FUZH 2NY2C 5FYJL 2NXZD 3MACL 4XCNB 1JL8A 1WEJH 3D3VA 3MRCA 4M7JH 4YQXH 3CCHA 2AXHA 2RAMA 1HHHA 4P4RB 4WIQA 2IMMA 3SBWA 1VFAA 2HFTA 5AUMA 1T0PB 2VN7A 3EOBB 2OSLB 3D39E 4NQDE 2RB8A 5DDHB 5L7XL 5IQ9B 3S5LB 4IRJA 2F58L 5IB2B 3WCYA 2FLBT 1WCBA 5IP4A 3DPBA 2HTKC 3HG1B 3TGXA 1LP9B 3SDDA 1HKFA 5D7LE 3RL1A 2Q7NA 3F7VA 5EUOB 2Z92B 4BUHA 4Z78B 3PP3H 5IFHL 4NJ9H 2FGZA 4X6CF 3MLRL 4JREC 1NH6A 2AJVL 4GG6A 5FEBA 2PW1A 3UJTL 3S88L 5J13C 2CIIB 4QRRE 1P9MA 1JPGB 3KNBB 1FGNH 4DVBA 4H0GA 3RVUC 4LF3A 2B4CL 3IJYA 4DZBB 5I1EH 1CK0L 5C7XL 1DQTA 3S37H 2QQKH 5L9DL 1JIBA 3SCMB 4X6CB 3T3PE 4ELMF 1EHXA 1F8TH 5F9DC 5HVHC 4K3GA 3JXAA 2DQUH 4FFWC 2XPGB 4XH2A 4KAQL 3KPRE 1F13A 4J3XA 1WTLA 1E4KC 2ZJSH 4DTGH 2FSEB 3GNML 4S11A 3WE6B 5FO9B 3ZDYF 3SGEI 4CVZB 1OSPL 2WANA 1K4CA 2NY6D 2EE6A 2IWGA 3OHXA 4H5SA 3TBSB 4YHNA 4PJHB 1OB1B 4ELMB 2NW3B 1ZHKB 5CWSA 5GRZA 2DYPA 1KN2L 4ZFOA 1KNOA 1S9VA 1RJLB 5LVEA 5FHBL 3DVFA 2C1OA 1EFXB 4ZO6A 2P49B 3ULVL 2CDGB 4MZ3A 4IRSC 5ICXA 3RWHB 2PO6C 5HHMB 4GW4A 3V0WH 1YMMA 2DKUA 1F4YL 1KG0B 1XR9B 2Y06L 1NKRA 2Y7QA 4F37F 3MRJB 4Y88A 4Y1AE 2R2BB 1BF2A 3C6LA 1OAQH 5IMMB 3SO5A 2UWEE 1QSEE 2X4QA 3JV4B 3WUZA 2E7MA 5BVPH 4YDIL 1CFVH 5GRJL 3WHXB 4HXAH 4MMZC 4OD1L 1BAFH 1UH4A 4N8CL 3O2DL 2BVPB 4NCC1 4UAOB 5FM5O 1FG9C 3QPXH 3IDGB 3B2UD 1T22B 4ISVA 1L0XA 1QBAA 4KZDH 3T0WA 1QP1A 1P4LB 4D8PA 2ENSA 3QDGB 2HFFA 3MV8E 1AFVH 3QZWG 4R4BA 4Z7OF 3BUYB 3FFCB 4NC1E 5FOJA 4LAJH 5D1XC 4PFEA 5F1OB 2GITB 3RVXD 5KJRL 1BFVL 1YNTB 8CGTA 1XCQB 4K94C 1E6JL 2R1XA 2OQJA 1H3PH 2OP4H 4WI8A 4YDKH 5AAWA 4FQPA 2CH8A 3ARPA 2GAZA 5D93C 1L7TH 5FYJH 3JWOH 4HJGB 5D8JL 3MACH 5GGQH 4P57B 3AU1A 1JFQH 3VFTA 2UYLB 4U4BA 1N64L 3VWJB 3CXHJ 3UPAA 3U0PB 1NSNL 2VO5A 3LKOB 3DJ9A 3NACL 4Y4FB 1UG9A 3BPNC 1YEDA 1D5ZA 3IXAA 4PJ7B 4GW1B 3H3PH 1U0QA 3KPOB 1MNUL 4L3CA 4JO4L 1A5FL 4KKAC 2CMRL 2YD7A 4A6YH 2HFGH 5CP3A 1J18A 4J1UB 1CFBA 4CADA 4XPGH 5IFHH 3GKZA 4PPTA 4CU6A 5JZ7C 3MLRH 3NTCL 4WUUA 3S98A 3UJTH 3S88H 2YZ8A 3K2MC 2XA8L 4U1NA 1R3HA 3U4AA 1S5HB 3DV4A 2B4CH 4HUUB 3I3BA 4UIKH 5J4MA 2APXA 2AJXL 4KMQA 4YHML 5IBLC 3OAYH 3B9EA 1U41A 1CK0H 3EKCA 1J0HA 1NBVL 3BPCA 5C7XH 5K93A 3O4OC 4NQSB 3UYRL 2C3GA 1A1OA 2PTTA 1XH3B 5FA4A 4C4KO 3MRDA 4H88L 3P4OB 2YD8A 1IQDB 1DSFL 3H2WA 4KAQH 1YYMH 4KJWC 3TEUA 2F54B 2PYFA 4YFLF 3GNMH 3IXTA 3HS0A 5I75C 3DX8A 1ES0A 1YEJH 3QWOB 4YJZL 3FCTB 4ETYA 3C8KA 1F6AB 3SOBL 4XNMB 2FX8H 4NJAH 4XP6L 1QLRA 2GTWB 3DUUA 1S7VA 2QR0A 4V1DD 3MRQA 4HIXL 2AXGB 2FYYA 2HWZH 3B6SB 5FHBH 1YEIL 3BSZL 3OAZK 4N1HB 5BQ7A 4ENEC 5IFAL 2DN7A 1KV3A 3C5SB 4K8RC 4U2YA 4NP4H 4ZYKB 1F4YH 1YJDC 2GFBA 3QNYB 4FNLL 1AD9B 5F7NC 2Q6WA 2GK0B 1ZGLB 1GJIA 4QHUA 2OR7A 1ZEAH 5F1KC 4KK6C 4YWGL 3PGCA 3TIDB 2YWYA 3JVGC 3VWKA 2DM3A 5KS9E 4X9HA 3A67L 2D7MA 4HC1L 1A6WL 2VKXA 3PWPD 5EU6D 4YDIH 3OKOB 5GRJH 1BEYH 3IETA 4YDVA 4GS7C 1RZ7L 1MCIA 2G5BB 1YEKL 3QEGL 4OD1H 2XACC 2DWEA 5FGRA 1I8MA 3D3VD 3O2DH 4KROB 2H2PD 1I85A 2AXFB 1FVCB 2LU4A 4Y8AA 5HDOA 1MFNA 2HT4D 1KSRA 3MRKA 4I48A 4IRJD 4M03A 1CGVA 5E6ID 1LE5A 4JFPB 3SDDD 5GS1B 1U8MB 4V2BA 5EC2A 2O61B 3NCYP 4KQ4H 4DK6A 1UCBH 1QFOA 4OBRA 2DICA 4L4VA 5KJRH 2VIRA 3QUYD 1BFVH 3GI9L 1CIDA 5JPNA 3RWGA 1E6JH 5BJTA 3T1WA 2CLRA 4FTVB 4IRZL 1KT2B 3GMOB 4JG0L 3O41B 5CD5D 5F7KC 2DQGL 4MCYA 1PVHA 1M05B 1WV7T 4U1LB 1RIUL 2OL3L 4XX1G 1NSNH 4OCSL 4R6UA 3HR5A 3NACH 3FO9B 5T1KB 4NN5B 4JFFA 2DLFL 4R97C 2A6DA 2VQTA 4JO4H 1A5FH 5LCVL 3HZYB 4PTUB 2OMBA 1UB5A 2E5EA 4FQ1L 5KSAB 3L5WA 3NTCH 2FJHA 3UJIH 4ZD3H 2XWJB 1E4JA 3GSRA 2XA8H 4UB0L 3MCLL 3ARGB 3MFGB 3OX8B 5T5NF 1JZ7A 2DYPD 1MCBA 2AJXH 3K4AA 1J5OL 4U7SA 4YHMH 4APQB 2VH5L 3LDBB 2W60B 4HUKB 1NBVH 4HBQA 4XP1L 1X6LA 5DRZA 3UYRH 1A6VH 5MENA 4JPIB 2MCPL 4IHOB 4KRPD 2NR6C 1BQHB 2IJ0C 5KVMC 3GRWA 5HDQL 1D5MA 1BPVA 3RKPA 1Y18B 1DSFH 5ADOH 4C83B 1KFAL 2ARJA 3S96A 1LGVA 5JIHA 5K59E 1J88A 5D9SA 2WLYA 4WW1B 3NIFF 2O5XH 3C6LD 3QDMA 4Z5RB 1CXEA 4YO0B 1CFNA 4CJ0A 2CXGA 4MJ2A 1AR2A 1ZXQA 4EUPA 4UU9B 1RAMA 2AKRB 5HI4C 3STLA 1IRAY 5IM7A 3GGWB 4TNWK 4HIXH 4V1DE 4LLWA 1YEIH 3BSZH 4OLZH 4RA0C 4LOUC 2PTUA 5JHDD 3ZDZE 3RUGE 2EKJA 2P8PB 4G9FB 2EIBA 3UO1H 5IFAH 3FRPG 6FABL 3ZE2E 1AIFB 4L8DB 1JYVA 2WBKA 3P9WB 3G6DH 3L5XL 4FNLH 1GZQB 1JHTA 3UROR 4G6FB 5IF0B 2OXHA 1QOKA 4GKZA 3U4EA 1I7ZA 3WUWA 4NZRL 4HIEA 1QKZL 4HC1H 3PWPE 5EU6E 2ZWLT 5IW3A 1YNLL 1RZ7H 2GEEA 1YEKH 3QEGH 1Z0NA 4EI5B 3SQOL 1T5WB 4P3DA 3O3BB 4AIZA 5TH2B 2P44B 4MA1B 1U58B 1CDYA 3D3VE 4R0LB 5HYQA 4L3EA 4IIQA 3RA7L 3KS0J 3MJ7A 1ZV5A 4UINL 4PJBA 4Z7UE 2QHLA 4KXZH 5J9PA 3DGGA 3H9HB 1OQOA 1DVFA 4UQ2A 3FO2B 5IG7A 4LCCC 1QRNB 4I0PB 5F96L 5L0QB 5IMKB 1EZVY 3O4LB 3T0DA 4IRZH 1KCKA 3TVMB 4JG0H 4WUUD 4GG6E 2AS5M 4UT9L 1TJHH 3QXVA 5J06A 1U8KB 2DQGH 3ZHLA 1MCCA 4Y0GA 7FABL 2HLAB 1JYXA 4KKLD 5DWUH 3C60A 4NYLB 1U3HB 2I60L 5IVZB 2LFGA 1NJ9B 2DBLL 1EAJA 4XCEA 4M1CC 4X8XA 5IHZA 1HNGA 3BGFC 3K8LA 1KJ2H 3DVNA 1AHWA 4HH9A 4WNQB 3I2CL 1TNMA 4ZQKB 4JFHD 5LCVH 2X9XA 5EU3B 4XNUL 1FZMB 2WUBH 4GAJL 5GGSA 5F72S 4S1SL 4MB3A 1G7IB 1T21A 3GSVA 1KULA 1AQDA 3S5LG 5H2BB 1BWMA 4RDQG 5ERWA 3BIBX 2F9BT 3I6GA 1E6OL 3W9EB 4H8WL 3ARFA 3MCLH 4OF8A 4ESKA 1MJ7L 4NQCA 3WS6A 4CL7A 2VH5H 4LRIA 3V6OA 4D0CB 1FE8L 3DIFB 5CEZL 1NGZB 1JPTH 2P7TA 3U0TA 4ZPVB 1H9VA 1R3JA 2UY7A 1ZTXL 1FV1B 1YN6A 3MOBL 5HDQH 1G9NC 2ADFL 5SWZD 4PJEF 5EO0B 2ZCLL 4YHOH 4DGIL 2CR3A 1TVBA 5ENWA 5DFWH 1XGQA 2NY7L 3QFJA 1MHEB 1KCSL 1W72B 5ELIA 3VWKD 4LPVA 4LLMB 3NMEA 4KV5F 3QCVL 3OG4B 2R1YA 3BUTA 3RDTB 3TA3A 4QKXB 5DJAA 4PJEB 1D6EB 3QUZB 2V5TA 5KVGL 3TZVD 9CGTA 3WFHA 1EJOL 3M17A 3BPLC 3P4MA 1FZOA 1T0NB 4L1HA 6FABH 3DRQB 3O9WB 5C0JB 3SDAC 4X0KB 2UUDH 1IAIL 4NZUH 4XP5H 2R29L 4HFWB 5F71A 1WWWX 4E9LA 4Q9QH 4ODUA 1C5BL 2YS4A 3GMQA 4L4VD 2HJLA 3H6JA 4HSQA 5IW6B 1QR1B 4NHUB 4NZRH 3QIUC 25C8H 1QKZH 5F7DB 2NZ9D 3QJFB 5DD0L 2CDFB 4NC0B 1MJ8L 3QWQB 2DQIL 1HWHB 3BKML 2W0KA 4N9GB 1YNLH 4YHKL 3UDWA 1WVZA 4FQHA 5L8LB 5DQDL 2YD6A 4HPYL 1MLCB 5E24E 5DQJB 1FBIL 1C5CL 3W0WB 4HCRL 4GKSB 4OIIL 2AEWA 3GSNA 3RA7H 4XPFH 4UINH 4JFFD 2CKBA 3SGDI 1AGDB 3VXTA 1IM9B 1SMAA 4XPBH 2X4UB 1HK6A 3FL7A 4JZJA 2ZUXA 3MUGA 4C56A 5AG9A 4ZFZA 1N3NA 1E27B 1S7WB 1V5JA 4X5WA 1XR8A 2JCCA 5F96H 2R0WH 4QGYA 1C12B 4YHLL 1NPUA 4Z18A 3T2OA 4UT9H 4Z7WA 4WUUE 3UC0L 3H7BB 2VSCA 7FABH 1KPVB 1IGTA 3BEWB 2YBRB 3IGAB 4RNRB 1AKJA 2ERJB 2I60H 2VABB 4P2OB 2DBLH 3ZYOA 1ZOXA 1QA9B 4O5LH 1YNKL 4HDIA 4U0RC 4LEXL 3GSXA 1P7QB 3OSKA 4QXGL 4WRLA 3ROOB 3LPFA 1S7XA 3AM8C 1I7TB 3I2CH 5ETUB 3VA6A 2HA1A 4AEIL 3B2VH 4JFHE 1M7IB 2VDNL 5DT1L 4MJ5A 4RGOL 1A4JA 3FHAA 1A3QA 3ULSB 1HQRA 2FB4L 4GAJH 4L8SA 3CMOL 1S9KC 1K3IA 3ZE0E 4CVWA 4S1SH 4RX4D 1IC1A 4GAFB 3AROA 3QDMD 5CGTA 1RIHL 2DQTH 3TCLA 3L9RA 1UKTA 2YRZA 4M7ZC 1EVUA 5ABDE 5DGQA 4PJ5D 1RU9L 1INEL 1MJ7H 1HHIA 5J11C 6CGTA 4MAUL 4OT1H 1FE8H 4PLNC 5J1SC 3QQ3B 5I1IL 5FB8A 4U33A 3DVGA 1QUNA 4DEPC 1GVIA 4NNYB 3BISA 4HUXA 3QEQB 2JIXA 1JNNH 2IPUK 4QLRA 3DX9A 1PQZA 5GZOD 2NW2B 5SWZE 2H32H 2D7QA 4DGIH 1JRHL 5FKAA 5AD0A 3IFPB 1KCSH 1RZ8A 1MCSA 4IS6A 2EXYC 3IVKB 4R96B 1K8DA 4XWOC 4DOHE 4OZHA 4ODWA 3ECBB 4NKDB 3MRFB 2CK0H 4ORGA 5L2JB 1FGVH 4OCWL 4WWKD 3UTQB 1RK0B 4Z0XB 1MAJA 1N5YH 5HGDB 2DM2A 1ZHLB 1S78C 1A6PA 3D25A 5D96C 3V0VA 5DFTA 2V2WB 2EC9U 1CF8L 3VGFA 1K4DB 4QTIL 1CFSB 2ATKA 2JKXA 1IAIH 1DVFD 4XMKL 3U1SL 2R29H 4LIQL 2VDML 4LBEB 1NANH 1C5BH 5SX4H 5FO8B 3FZUC 5IHBA 4L4VE 4MAYA 4OI7A 1JPSL 1Z3GL 2I9TA 5DD0H 1MJ8H 4AJ0A 2DQIH 3BKMH 5I2IB 2COQA 4YHKH 1KPUA 4L9LC 5DQDH 1J7VR 2D9CA 1T3FA 4HPYH 4NNXB 1KIRB 4PG2C 5DUML 3BZFA 4JQVC 4DZ8B 3C60D 3V52L 5D5MF 1EAPA 2QKIA 3X14A 2CLZB 4F7MA 1C5CH 4G8EB 3QXDB 4G8GB 4R90H 4HCRH 3B8YA 3WMSA 3HNSL 1KTDB 1HOCA 4NC2B 4X5XA 2EDHA 3CFBB 1NDMB 3FO1A 1U8OA 4JKPL 3OV6A 4JFFE 5E00B 5IB1A 3LH2L 2L7JA 3E1F1 2DDQL 5ILTL 5L2KA 3T0EC 3ULUD 4Z7VE 3DVIA 2C4FU 1ED3B 1FN4A 1MSPA 1FNHA 2IANA 3HUJA 4AYFA 3P40A 3FOLB 3KYOA 5D5MB 3V4VL 3LMJL 2WBJA 1WIUA 3H9ZA 5JLZB 5HI3D 2I9LA 4MS8C 4ELKA 4K7FB 3IJHA 1ZA6A 5F88A 3S6CA 3OKDA 5CGYC 5BXFA 4YHPB 3UC0H 2ID5A 3IB4A 2BY3A 2VZ1A 2CO7B 3U9UA 3ARFD 1G9MC 3I50L 4U7MA 3QHFL 1S7TB 4OLXL 3OKNB 5IUSA 2GCYB 1I9IL 4DGVL 4JPVL 5INDA 4BFEA 3DI2B 4ZUWA 4LEXH 3B83A 4M6OL 3IDMB 4QXGH 1F97A 1BECA 4AEIH 1AO7B 1IGJA 1QLEL 5DT1H 4RGOH 1IAMA 3U30C 2FR4B 3CMOH 4NRYA 2GSGB 1MI5B 1JV5B 5EOCL 3IDNA 5ITBL 2H2SD 4L8BA 1MH5B 2NXYB 2XTJC 3QDME 1NEZA 4Q6IC 4XNYL 4Y8DC 3WKNA 3CSGA 1RU9H 4UNTA 4PJ5E 5CILL 3VFSB 3O6LL 1S8DA 2XWBA 1G84A 4GW5A 4OCYL 4MAUH 1KPRA 4GBXA 4LKXA 2OI9B 4LEOB 3VMPA 5I1IH 1FVEA 3MRLB 5EH1A 1T03L 1L0YA 3T4AB 5DS8A 3KPQB 5IK3A 1BF8A 2NY3B 3RGVC 5C0DA 3LQZA 4OGXL 5E6ZA 5IQ7L 1P6AB 1RIVH 4Y16A 1EXUA 2D0HA 3IDYC 2G9HB 4KJPD 1JRHH 2FJGA 5A2KH 3BQUC 4TVPD 3DNKA 2C3VA 2D7NA 2R4RL 1DEEB 3VDCA 3GJEB 3MUJA 3NGBC 5CS7A 4LVOC 3GHBL 2Q8BL 5IMLA 4I4WA 3O11B 3HLAA 5JOFA 1AGFB 5A43C 1PZUB 3EZJB 2GTZA 1IGIL 1G6VK 3GFUA 3LIZL 4KDTA 4X4MA 2FEEI 5C3TA 2X4TB 1AGBA 4LLAA 4X98B 5DJ6A 1JZ5A 1M4KA 4KVNH 4O2EA 1CLYL 5LQBL 4Z7QE 1F2XK 2V5RA 1HXMB 5ESAA 2E9WA 2DQDL 2GUOB 3CFIC 3IKCA 1UXWA 2JELL 2WW8A 4R8WH 4QTIH 5GXBB 3BAEL 4MD5A 4PJBE 1PBYA 1N6VA 1TZHA 3MLUL 2PN5A 5CINL 3T1FB 3U1SH 5FDWA 3PWUA 4LIQH 4C56D 3HE6B 1MHCA 1QFWL 4QRPB 3RZWA 1JPSH 3CZJA 4XHJD 1Z3GH 5DK3A 3RL2B 1B0WA 2AEPL 5TDNA 5DJ8A 3LRSB 3THML 3ARYA 4NQDB 4Z6AT 4KHTH 5B38A 5JQHC 3V52H 3OJ2C 4X7TA 5D7LB 2EO1A 2D03L 2ITCB 3MV7A 3VXNB 1BLNA 3H9SA 1P4IL 5TDOA 2P4AB 1NBZB 2PETA 1U8QA 1J0JA 4JKPH 3VRJA 1CXLA 4U1GC 5ILTH 4U0QB 3E0GA 3ILQC 3ULUE 3G6JA 5GJTH 5T3ZD 1A02N 4PJIA 3MLXH 2DLGA 5J3HC 3VA2C 5D7JA 5JOEA 1E4XL 3KYKL 4RWHA 3QXTA 4DGYL 3I50H 4XBPB 3QHFH 4U3XA 4OLXH 4KHXL 2EO9A 3OKYA 3QPQD 2BNQB 1UZ8B 2G2RA 4NQCE 3KPRB 1I3GL 4NWTL 1BOGB 3V6OE 4LARL 2G60L 3NOIA 4Y5XC 5HJ3B 2CUMA 1TTGA 1NKOA 4QO1A 3GSUB 2MHAB 2BZDA 3V0AC 3BFOA 5D7IF 2FLRT 3GSOB 2DL2A 5DD5L 4GOSA 4PJDA 3DSFH 1X3DA 1QLEH 4H26A 1K6QH 4JLRB 5I8EA 3MLSL 3EGSB 3OAUL 5F7WC 4H1LH 1CGYA 4Y4KD 1A21A 3T77B 4PBVC 2X70B 5ITBH 2I27N 3I02B 3QFJE 5BZWA 4HJ0D 5GZNC 3STZB 2AV1A 4XNYH 4ZUVB 5CILH 4OSUH 4JY4B 2JJTC 3ARBA 3KPTA 3O6LH 4OFDA 5LGJA 4OCYH 1VADB 5BZDA 4X99A 3BT2L 3HN3A 1Q0YH 1QLFB 1T03H 2ADGB 3EYSL 1MFCL 1N26A 1WBXA 1QSEB 1J9CT 5EBMA 5EG6C 4F58L 4RZCA 3RBGA 4QRSB 3PHQB 4OGXH 2C1PB 4ZO9A 5CGMA 3BP5B 3MLVH 4GRWH 1FP5A 4PJXA 3WDIA 3RU8L 3FB5A 1EO7A 1V7ML 4TVPE 3U7AA 2E7LC 4HT1L 2APVA 3RP1A 3E6HB 8FABA 4MAYD 4P46D 3GHBH 1NQBA 2DIJA 1R24A 5DUBA 1Q9KB 4L3AA 3LIZH 1XF3B 1KEMH 3BZ4B 1BZ9A 4M1GL 4NC1C 3MV8B 1JWSA 1LNUA 5CEXB 2YPLA 4KK8D 3TYGL 2EECA 4ZUSA 1FH5L 3VXSD 4JFEB 1IKFH 2JELH 1UWGH 3PIQA 3BAEH 3VH8A 3JUZA 4HHAB 3GMRB 4WCYH 1N2RB 3QEUB 3MLUH 2NXZC 4XVJL 4YX2L 5L2KD 5CINH 4BQCA 7CGTA 3QIWA 5TDPA 5DLML 1UB6B 2OL3A 4C56E 2IAND 5DURD 4O4YL 3D0LB 1OP5H 2JCCE 1QFWH 4MDIA 2QQLL 5EOQL 2VXTL 3MFFA 2X1PA 4Y5YA 5IVXA 5J7CC 4G6JL 5T1LA 1R3IL 3M8OL 3K80A 3OGOE 3PABB 3THMH 4Z7WE 4DVRL 4S1DD 3AXLB 1OF2B 1UWEL 1J0YA 4LFHG 1PLGH 1SJHB 2D03H 2DQEH 2Z91B 5IOPA 1SJEA 3P9MB 3PL6A 4NT6B 1CD1B 4OQTH 1ODAA 1P4IH 4P99A 4U6XA 5T5FH 3VFPB 3KWWA 3KDMA 4X9FA 4KUZL 4N8VG 3DO7B 4LGPB 4JFYB 3D18A 1AXSA 1WCQA 3DXAB 1ND0A 3MRRA 3NPZB 5T3ZE 1I8IB 4PJGF 4XNQA 5EFIB 5JO5A 3TO4B 2NNAB 1E4XH 1KCLA 3ULVD 1FNFA 2XZCL 4PJ9A 3KYKH 4F9PA 1IC5H 1TQBC 3BH9B 4FABL 1SYSB 2O5YL 4UDUB 4M8QB 3MUY1 5I8OL 1ZA3A 1L9MA 1B0RB 1FO0H 4KHXH 1I3GH 2D3VA 3B4NA 5H37H 4PJGB 4GBXD 1SBSL 5C0BA 4Y2DB 4LARH 3TT1L 1A2YB 2AI0L 3CNKA 4ZOAA 2FL5B 1JMXA 4HKXB 5TJWK 1QVOA 1C08A 1RZGA 5EORL 1I1FA 2YRLA 2P47B 3JTSB 3NCBB 3QA3A 1KJVB 1TVHB 5DD5H 2NY6B 3IFOB 3KPPA 3MA9L 2F8VA 1WC7B 2P45B 3MLSH 3WDHA 1HINL 3ARSA 1K2DB 3OAUH 1N8ZB 2AJSL 1IGYA 1OAXL 5ACZA 4BSWA 4NFDA 3O3AB 3EDJA 3S8WA 1R3LB 1ONQB 5DR5L 5B3JF 3U46B 4CUCA 3JTTA 43C9B 4Z0BL 2APFA 1X5YA 1C16A 4OZHE 3UZEA 1R3KA 2HTLD 4UIMB 3W39A 1BGXL 2BVQB 3WLBB 2BRQA 1T2XA 5KVEL 2OS7A 4FFYL 5KSBB 4P2QD 2E6JA 2X40A 4OLUL 4CBPA 1MFCH 3MJ8B 2A6KB 1BBJA 4LNRA 4F58H 1IBGL 2M1KA 5MEPB 4PP1D 3MNZA 2ESVD 4XZUB 2SEBB 4Y7MA 1WQVT 5SX5K 2GJZB 3WJLC 2FX9H 4UV7L 3BKJL 3RU8H 1V7MH 3HC3L 4JRYD 1MFDL 4BQ9A 5K9OA 3B2UC 2YPKA 2ZCHH 1X5GA 1Q8MA 2VAAA 1J0KA 2V17L 1J0ZA 5AZEL 4O02L 1NFDE 3H42L 2E8ZA 3A6OA 5I15L 1I1YB 4M1GH 2YHGA 5JW3H 4ZTPL 4JO3L 4HWBL 4NGHH 3PQYA 3RVXC 3MV7D 3LPGA 3TYGH 4GSDL 1FH5H 3H9SD 3VXSE 1VKXA 5JW4Q 1JWUA 1TQCC 1U42A 3ZHKA 1AQKL 5EZLB 4YX2H 5C07A 1VGKB 5IROA 5L2KE 1F42A 2E9JA 4AEHL 3PHOA 5HGBA 3LB6D 4FFZL 1Q94A 4OZGF 1IM3B 4O4YH 2IANE 3CK0L 1WLHA 3HUJE 1A7OH 5D7JD 2OLDA 2QQLH 1YUHB 4WI6A 5EOQH 5I73B 3R0NA 5KN5B 3T09A 3M8OH 3FN9A 2QLVB 4P5KB 5FM4A 1NC2B 1QHPA 3EOBA 3E6FA 5DDHA 4PRBB 5IB2A 3VXPB 4OZGB 1LP9A 2X44D 3H3KA 4XB8A 2APWA 4KUZH 3VFRA 5C0CA 2Z92A 2P42B 4JVPA 4Z78A 1X4ZA 4G5ZH 1J1PH 2B5IC 2BOBB 3NABL 2F53D 2ZOLB 1X5LA 3S4SA 3MBXL 2Q3AA 4F15B 4RGNB 2H8PA 4WO4C 2CIIA 1CFTA 3RWFA 1JPGA 3KNBA 4BFBD 1NGPL 2XZCH 3O6KH 1MPAH 3ULVE 4DZBA 2NCMA 4JDTL 4XPAH 3HI1A 3MROA 1HH9B 3JV5A 4FABH 2MPAL 1XEDA 4NNPH 3FFDA 3ARBD 5I8OH 4LVHC 1OSZB 3MX0A 4X6CA 4KDWA 2EDTA 4YXHL 3QIBB 1SBSH 1UXSB 5DK2A 3TT1H 2WNGA 2Z9TA 3KJ4B 2AI0H 4TN9A 3K81A 3O45B 4J3OC 4JEGB 4C57C 2XPGA 5KOMC 3QDJB 4WW2C 4HKJB 3DLQR 4AT6B 3FB8A 5HPMB 4HIIB 1HINH 3GJFA 5D1QB 5JHLL 1MF2L 3VE0A 2AJSH 1A6ZB 1Q38A 1NBYB 3TBSA 4ELMA 2ZUVA 1ZHKA 4D9QD 1R5WB 3LEVL 5EZJB 2AERT 5AAMA 4Z0BH 2FO4A 1EFXA 4RAUB 1HIML 4LQFL 3KPNB 2PR4H 1BGXH 2I5YL 3RWHA 4X4ME 1LEIB 1YYLL 2DQCL 1CT8B 4FFYH 1JHKL 5JDSA 4ERSL 3RTQB 2DM4A 1KG0A 4UBDC 3G5VB 1XIWB 1PKQE 2DQFB 3CUPA 4YBHA 1NDGB 4HH8A 2ESVE 2VNCA 2R2BA 4MGXA 5KW9L 2DAVA 4QGTA 1G7QB 3CGTA 3JV4A 3BKJH 2WWMD 3QIWD 12E8H 2H2PC 1MFDH 2DJ4A 2EDWA 4JRYE 4BJLA 1F58L 1KC5H 4HCRA 3MRCB 5CLTA 1GOFA 2HT4C 1I1AC 1F6LL 1VFAB 2V17H 4J4PA 4IRJC 4P2YA 2OR8A 5E6IC 1ZMYA 2L7UA 4O02H 5LWYL 2BVPA 5I15H 4MNHA 5M94B 3IDGA 3HCVA 4ZTPH 4JO3H 3LD8C 3BP6A 3SDDB 3TLRA 3QUYC 4WUKH 5A2FA 3MV7E 1IGFL 5LXGL 3PL6D 3QDGA 4LHUA 5JOPD 3H9SE 5CD5C 4OIAA 3BUYA 3NBNA 1AQKH 4Z7NE 3TN0B 2GITA 2AJYH 4AEHH 1CBVH 5CJ8A 3F7PC 3G6JE 4IJ3B 4LF3B 1TETH 4FFZH 3CK0H 1MWAL 3MSPA 2OXGA 4J3TA 4WU7B 4P57A 2X4PB 5E8DH 2Y72A 4DJMA 3VWJA 2HAZA 3SE3A 3U0PA 2J12B 3O6FA 3LKOA 4S2SA 4GW1A 1EA9C 3KPOA 4OJFL 4RFNB 5C0BD 4NN6C 1MCLA 3NPSC 2O93L 1QR4A 4HAFA 4J1UA 1PEWA 1K4CB 3S9DB 5I74B 3NABH 1D5BA 1OAZL 2XIDA 3MBXH 2LTQC 3OHXB 1XGRA 4PJDE 4C4KT 1FRGL 2YUWA 4YHNB 2DYPB 5EIVA 4ZFOB 1KNOB 1S5HA 4XXCA 2UZYB 2C1OB 4KRPC 5GISL 3QG7L 2HVKA 4Y19B 4OZ4B 1FNSL 5ICXB 2MPAH 3DURA 1YMMB 4I3GA 1XH3A 2W38A 4I9WD 4YXHH 2Y7QB 5FA3A 5C0ND 4EOWH 3C6LC 1CDCA 2FHCA 4GMTH 3P4OA 4G7YL 4KGJA 1CN4A 2F54A 4D3CL 3OPZL 3DUSA 4BH7B 4NRXA 3B3IA 3IJSA 1MF2H 3QWOA 4CJ1A 4GKOA 1DQDH 3RVVC 3CFKA 4PJXE 5TF1L 4XNMA 2QSTA 2GTWA 2PXYA 4D9QE 2BJML 2AXGA 4OV5A 1AXTH 3BRFA 2P8MA 2W07A 3B6SA 2VXVL 2H3NA 2J5LB 1JJUA 2ARWA 2I5YH 3HMWL 1YYLH 3ZKMD 1JHKH 1H3TA 4D8PB 3TBVB 4JR9H 2OK0L 4P5MB 2HN7B 4CMHC 1ZVSA 4M9OA 2EDBA 1AD9A 2Y5TA 4H0HB 2GK0A 3I6KB 1P84K 4XMPH 1NCTA 1N4XH 5CD3B 1YY9D 4S10A 4WI2A 2AGJL 2R1XB 2OQJB 4I0CC 3EO0B 5C07D 1MCPL 2GAZB 4ZFGH 2BSED 4HIJA 3PXJA 1F58H 3OKOA 3VFTB 3T4YA 3P11L 1FL3A 2G5BA 1AI1L 3Q1SH 1NUGA 3O2WL 5CUSL 4OKVA 3CC5A 5LWYH 1QRKA 4ODXA 2QADB 3IXAB 4XNZB 1FVCA 2DMKA 2C4XA 3AAZB 1BBDL 3Q5OA 5GGSY 3UBXB 2HKFH 3VXOB 3QR2A 4M48H 4FZ8L 4M6NH 5JOPE 3RWEB 5B22A 3CFDA 5C0CD 4KKLC 3EFFB 4W6YB 5FCUL 2WWKO 3O41A 1MWAH 5I0DA 5CEZD 3G5ZB 2WINB 3BPCB 3OJDA 3HE7A 2ZUTA 3AY4C 4JPWL 4HPOL 4U1LA 1I1CA 4HKBA 2GIYA 1A1OB 3LN5A 4YC2B 3VFOB 1AP2A 3SCMD 3NIGE 4OLVL 4H1LA 3LEYH 5I18L 3RX8A 4OJFH 4OI9A 5C0BE 2PYFB 3FN0H 3IAGC 2E7BA 5DEZA 4P23B 4FQJH 5EZOL 1T7WA 1ZT1A 2N7BA 3V4PL 5F9JA 3DX8B 4PY8I 5A2JH 1ES0B 5E5MB 5KSAA 2Z4QA 1FRGH 2XWJA 1U8JA 4OCRL 2QR0B 4KK9D 4X4ZA 1T6WA 3MRQB 4NWUH 3L7EB 1F02I 2FYYB 2W9LA 3ARGA 3NFSL 2AAVA 3KHOA 2OBGA 4PB9L 5GISH 4YBLC 2LV4A 4I18C 5BQ7B 1A7PL 3QNZA 1FNSH 1VEOA 1EFXD 5I1GL 4JKLA 2VUOA 2GFBB 3ZKQD 4IHOA 4NN7B 4I9WE 4LDOB 3QQ4B 2Q6WB 2J8OA 1BQHA 1UADC 4JM2F 1QG3A 1IQWL 1HXYA 4JO2H 4G7YH 3VWKC 4C83A 4D3CH 2XY1A 5KVDL 4DOHB 1JNJA 4LLVA 2RQ8A 5CBEA 1NMBL 2PCPB 3W5MA 1INDH 2LABA 4UU9A 3BKCL 2AKRA 3IETB 4YDVB 3TZVC 3TP4A 4JM2B 2ICWJ 5CJOL 2BJMH 2DWEB 2CQVA 1KENL 3G5YA 4QRQB 1A6UL 1JYWA 3TBWB 5B3NA 1F90L 2RCSL 3QXUA 2JB6A 3HMWH 3MRKB 4OUOA 1GHFL 4GRLA 4P9HC 1LE5B 5LBSH 4GMSL 2R0KH 4X6DE 2OK0H 3PQYE 5EC2B 3QDGD 4PY7A 2VIRB 1OARL 1FLRL 3QSKB 3VDBA 5BJTB 2AGJH 4P3WA 1G0DA 4WI7A 2EE3A 2KZ1B 4D9LL 1NCBL 1MCPH 5C07E 4K94L 5DJXA 1EFQA 4PYGA 1XFPA 1CU4L 2OYPA 3WS3B 1DQML 5B8CC 1S7SA 1UM5H 3P11H 4P59H 4EI5A 1AI1H 1NAML 4FOMA 4U6VL 5ALCH 3O3BA 1X9QA 2PUQT 3O2WH 5TH2A 1U58A 5B39G 3DMMC 1JGDB 1REIA 3VWJD 2A6DB 1DZBA 2DD8L 2E9BA 2XQBL 5FECA 3RVTD 5E2VL 1J1XL 4EN3C 4U3CA 3BGMB 5EULV 1ZSDA 5IEHB 1QNZH 3FO2A 1LP9E 3L5WB 3PDOA 2HFEB 1QRNA 1JZ8A 1DJSA 5C0CE 5IEKA 4I0PA 3EUUA 5FCUH 5DJ0A 5L8JB 3O4LA 4RMRA 2ICEB 4P0DA 3VFGL 5E70A 4JO1H 1J87A 4JHWL 2GW5A 2HLAA 5CEZE 2VOTA 4R4NC 4JPWH 3ZHDA 4HPOH 4NYLA 1U3HA 3KPSB 4HMCA 3PHSA 5DRZB 1NJ9A 5MENB 3MTRA 5JR1L 4P5TB 4LSTL 2XRAH 4PJCF 4OLVH 4YR6B 4HWUA 2FIKA 4LU5L 4X6CE 4XCFL 5I18H 4ZQKA 3EYQD 3S96B 4BELD 5EU3A 2GHWB 4MJIA 3BMVA 5EZOH 3BJLA 5F97E 4D94A 1HI6B 3V4PH 2F54D 5J6GA 4DKAA 4RCAA 4POZD 3STLB 5H2BA 4FQCH 3F62A 2AK4A 4OCRH 1YC7A 4PUBL 4X80L 4PJHE 4ELME 4PB9H 2PXYD 4EEEA 3UEZA 1KCRL 1EHAA 2I26N 5FYKU 3SHSA 3HAEB 3KR3L 4D0CA 3DIFA 5TQ2L 1TMCB 1A14L 4XC1L 1NGZA 4N5UA 2WV3A 3L5IA 4X4YA 2HJFA 1Z5LA 2J6EA 1UKQA 4ZNEA 4K8RL 2YD4A 3ZDYE 1FV1A 3T0XA 2ATPA 1KF9B 1P7HL 1JHTB 1YJDL 1IQWH 3LKQA 3WIHL 5EO0A 1BVZA 1DUZB 2VZOA 4GKZB 3OXRA 1I7ZB 5KVDH 4HIEB 3V6FB 5FK9A 1MHEA 4WWKC 4WTWA 1W72A 1NMBH 1RUAH 1NFKA 4KFZC 3BKCH 4LLMA 5A2IH 3MNVA 43CAA 3QI9B 4WDIB 1WISA 1NLDL 1JYNA 4P3DB 4HZAA 4AIZB 1RZFL 4MX7A 3RDTA 1KENH 3C09B 4PJEA 1D6EA 5D72L 1JTOA 4HEME 1FLTX 1EJ6A 1A6UH 4L3EB 3O3EA 4IIQB 5D2NB 4KROD 1JZ4A 2RCSH 1DVFC 3EJJX 2ENYA 2HMID 5J9PB 1GHFH 1T0NA 5I71C 4YK4B 3DRQA 3DETD 4UQ2B 4GMSH 3O9WA 4OZFH 5C0JA 1D5IL 5IG7B 5A16A 4X0KA 1HCVA 3MCG1 5IHLB 2DMCA 3QDGE 1FG2B 1OARH 1FLRH 4Q9BA 4LLDB 4HFWA 1LMKA 2YD2A 3PWVB 4NZDA 4D9LH 3VFUA 4OI8A 4K94H 3C60C 1SY6L 5F7DA 4XWGH 3QJFA 1CU4H 3RPKA 5IV2B 2CDFA 4FTVD 4K3EL 4CDHA 1F3JB 1DQMH 4YFLI 1AHWC 1XCTA 4XCEB 3HE7D 5IHZB 1NAMH 5IJVB 1A8JH 1MLCA 3RIFF 5DQJA 2VLJA 4Q9CA 5DUPL 1EPFA 4Z7OE 3W0WA 4HMEA 1QBMH 4C58B 2DD8H 2VLLB 4F80A 5I1CH 1IM9A 3GM0A 1TTUA 4G42A 3GI8L 2WLZA 5DD3H 5GGSB 3L95A 5I6XB 5ANMA 4HEPG 5F3BB 1EVTC 2J1KA 4KI1A 1E27A 3ARFC 5IB5A 3NA4A 1T6VN 3X11A 5KSAD 1C12A 5E94A 4YEEA 3V6OC 3KYNB 1U8NA 4JHWH 4NQCB 5ICZB 1GAFL 2D7OA 2UUDK 3MNWA 4OFKA 3ARGD 2EDFA 2YBRA 2P7TB 2A83B 4APQD 1KB9J 1R3JB 5JMOC 5JR1H 2M2DA 1QA9A 1AC6A 1BM3L 1G7MA 1T83A 4JFZH 3GDBA 1P7QA 3JWDC 4WV1C 2VE6B 1FNGA 1AGEA 2EKSB 4RBPH 1RJZB 3WEXB 4LU5H 1OPGL 2H2SC 1F3DH 1TVBB 5ENWB 1XGQB 3QFJB 1KUMA 2RFXB 3ULSA 3WFCL 3TCXA 4YDLB 5ADPL 5AWNH 4TTDD 4F7PB 2F54E 1F4AA 2BK8A 4OF0A 5L8KB 2R0LL 3C5ZA 3KVQA 2R1YB 4WFGD 3TA3B 4ZXBA 1MIML 4X80H 1C7TA 2QSQA 4MQXD 1KCRH 5F6HI 1TNNA 3WFHB 3M17B 4IOFC 1DBML 3KR3H 3MA7B 5TQ2H 3P4MB 1FZOB 3QQ3A 5HD8D 1A14H 1Z9SA 3ARQA 4XC1H 4DN3L 4G9FD 3X12B 1V3JA 4KJPC 4NNYA 4YHZL 4K8RH 3LKSA 4UT6L 3VXMA 4FG6D 3H0TA 1YJDH 3BN3B 3WIHH 3N9GL 2C5DC 5GS0H 3CVIL 2BXYA 4ODUB 4Z9KB 3T2NL 4RMWA 1W2KT 3IFPA 4G6FD 1RJYA 4I2XB 2A77H 4JE4B 3V9FA 3WKML 4TYUA 3B9KC 5E7BA 1QYGL 1MCEA 4FQHB 4HWBA 4X7EC 1OAKL 1NLDH 2AVGA 2NY1B 3QDAA 5EDXA 4WTXA 3UTQA 1JI1A 4EI5D 4L4TA 1Q1JL 4UOW1 3VXTB 3UTZA 4TPRL 3ZO0A 4M9PA 3U9PH 3OKMA 1D5IH 1CFSA 5JMRA 1NC4B 4JZJB 5BO1L 3MUGB 4XHJC 4YHYC 1N3NB 2Q7YA 4X5WB 2N1KA 2F5BL 5EIIA 3O81A 1IL1A 4HK3J 4FRWA 1QRND 4ODSH 4LBEA 5C8JB 5FO8A 4I0PD 4X6EB 2BSRB 1Q72L 1SY6H 1B88A 4PRIA 1SBBA 3EO9L 1D9KA 1GOGA 3O4LD 5JORB 4K3EH 3TVMD 1IGTB 5EB9A 3MXVL 4FTVE 4MYWB 3FRUB 1AKJB 5I2IA 1A47A 4N0RA 3S3JA 4HDIB 4QF1B 4DZ8A 3GSXB 1U3HD 5DVKA 2CLZA 1S7XB 5DUPH 5TGBB 4G8EA 3QXDA 4G8GA 3RNKB 3L6FA 4TRPL 4YNYA 3L3HB 4ZAKA 1T04B 3CFBA 1PSKL 1NDMA 5GGVL 4FMKA 5BW7A 2UWEF 4JQXC 4MJ5B 5E00A 4AM0A 4EVNB 1A4JB 5D1ZB 2A9NH 4PJ8B 1HQRB 3GJFK 5CEYB 2Z31C 3MJ9L 4L8SB 1TJIH 3QUXB 1ED3A 2UVFA 4LSQH 5KOVC 1CL7L 4JB9H 3TCLB 1NMCB 5DJYB 1U8IB 5E4EC 4HWEH 3UBXG 3QPQC 3LV3A 1CI5A 3LS4L 3W81A 4K7FA 3TH4T 1ROWA 3BD4A 4YHPA 1GAFH 4RIRB 1EMTL 2DTML 1WFUA 4POUB 1CDUA 3R1GH 3DVGB 4OCLC 5HPOA 4HUXB 1D5XB 2QTEA 3RFZC 2JIXB 1JBJA 4MXWL 3DX9B 4Y4KC 2HLFD 3BRGC 1IT9L 1DBJL 5FKAB 4HJ0C 3SDCA 1MRDL 1I9JL 3WFCH 1RZ8B 1FNEB 4IS6B 5ADPH 2GSGA 1MI5A 2IALB 1JV5A 4PRPA 5BV7C 4RSVA 3MBEC 5DMGD 2E27L 4OZHB 4J2XA 4F8QA 2YUZA 4ODWB 3ILPB 1SVCP 4O58L 3WO3B 1WICA 4WFGE 4IMKA 2Z8SA 2H1PH 3K4DA 2IMNA 1PX4A 3VFSA 3RIAF 3RDTD 1MHHA 1DBMH 2ZOKA 3D25B 3QUZD 3V0VB 2IQ9H 3MRLA 4G9FE 3NIFE 3FN3A 4YHZH 3I3DA 2AQ3A 2ATKB 3KPQA 1LO5A 4G7VH 5IESL 3O9WD 3N9GH 2YC1B 2EDNA 4MAYC 3WBDA 4P46C 1UWXH 4HBCL 3SE8H 3KPLB 4MB5A 1Y6KR 5BMFL 2BC4A 4HK0A 3OB0H 2I9TB 3BJ91 3CDCA 3CVHL 2FATH 1DE4B 3WKMH 3GJEA 4LFHD 3MLZL 1EZVX 4KVCL 3AREA 3MRPA 1KPUB 1AGFA 4A6YB 4KK8C 3GEWB 5JA8B 2HH0L 5F9WC 5FYLL 3BZFB 2XZQL 1EAPB 4FXKB 3SKOB 3R8QA 3X14B 4F7MB 2X4TA 2DIBA 1Q1JH 4X98A 3BDBA 4DKFL 3FO1B 1U8OB 1FVDA 3L3GB 1HXMA 3W0WD 2CRZA 2GUOA 1JWMB 4P4KA 1BJ8A 2DQJH 3QWRA 5BO1H 3WXVL 3MRGB 4PLKD 1IM9D 1FN4B 1I9RL 4P3CL 3HUJB 3KYOB 2F5BH 3T1FA 5C0GA 1X7QB 2EDEA 4AMKL 2WBJB 4I77H 1NAKH 1QRNE 5F88B 1WT5A 1VCAA 4YPJA 5BXFB 1Q72H 1ZHNA 3EO9H 3O4LE 3WL9A 3BE1H 3LRSA 5K9JL 5C2UB 3ALXA 2A1WL 4UUJA 3WSQL 4F8TA 5C0IB 4D0DA 2DF3A 5F9AC 4OCNC 4PY8J 3U83A 2Q76B 3VXNA 1G6RL 4P2OD 3MMEA 1LHZA 3SGJC 4TRPH 4HZLB 1CGWA 1P7QD 1PSKH 1IGJB 5GGVH 1T1YA 4MLSA 3E2HC 3VGDA 2YMXL 3MJ9H 2ZZUT 4NRYB 3VFMB 2I24N 1R0AL 1MFBH 4MJIE 4L8BB 1FAKT 4QHLB 3EBAA 1NEZB 3UPRB 2X1QA 15C8L 4Y5VB 1UKSA 3LS4H 1GGIH 1MVUB 1OGTA 3C5ZD 3U79A 2VTFA 4GBXC 1EV2E 3S36H 1HSBB 1VA9A 4GW5B 2DTMH 4LKXB 1KTLB 5FV2A 4N8PA 3O8XB 5AZ2L 4YLQT 5CLWA 2BNQA 3PV6A 3MV11 5DS8B 2WQRA 4LCWB 3VW3H 3ZKSD 5HJ3A 4MXWH 5C0DB 4UI2A 3GSUA 2MHAA 3LQZB 4JY5L 2X4NA 4Y16B 4ZNEE 1IT9H 3GSOA 3QEQD 1G9NH 3VXMD 4IOIB 3WO4B 3RKDD 1GRWA 4JLRA 4K71B 3RI5F 2C3VB 1MRDH 3R8BB 5C71A 1I9JH 1OM3L 3MYJB 1TDQA 4MSWB 1DQLH 2HTLC 3H7LA 3H3BC 5I19L 3T77A 5EBLA 5IMLB 2E27H 3I02A 2VWEE 3ARRA 1KB5L 1BQUA 2QJDA 3C87A 2GTZB 1WTGT 3TPUA 2GT9B 3WNOA 5I66A 5D7IA 4UV4L 1AGBB 3FAWA 2QQNL 2HT2D 4K3DL 4PP1C 1VADA 2IBZX 4JZOA 4PJEE 2IAMC 1KYOJ 1UH3A 5ESAB 1YECL 3IKCB 3CX5K 4FXLA 4MD5B 1S9YB 3BMWA 1QZ1A 3B5GA 4KJQD 2C1PA 5FDWB 3HAEG 3PWUB 3BP5A 4HBCH 4KV5E 4JANA 5LAXB 1MHCB 2W0PA 1MHPH 4LK4A 1T7XA 4G6ML 4FQ2L 1IEAB 3CVHH 3BDYL 3EYOA 4BSVB 5TDNB 5I1KL 3MLZH 1PG7L 5FO7B 3E6HA 3VD5A 5L6YH 5FF6A 1OTTD 3C9NA 5B38B 4OGZA 3ES6A 3QO1A 2HH0H 3GSWB 4OFYD 5EU4B 4M62L 1G0YR 3BP4A 2XZQH 3QAZC 1Q9KA 5I9QC 2OJZH 3BYYA 1BLNB 3SE9L 1RZIA 2VDRL 4JGUA 1DLHB 1YEEH 4DKFH 5TDOB 2E6QA 4G8GD 2EC8A 1CICB 1JK8A 1VEPA 3W0WE 4ZAKD 4PLJD 2ZG1A 5D7JC 5JIPA 3WXVH 1JGVL 4HHAA 1I9RH 4P3CH 4PJIB 1N2RA 1AY1L 1T89A 5J12C 2HRPL 5J6HA 4AMKH 1WZMA 5ANME 2MQCA 3ALWA 2D7PA 2B0SH 5CKGA 2DMBA 1ZKAA 3D0LA 5ISZA 4M43H 1DBKL 5ESQA 2ICCA 3P4LA 5F70A 1DBAL 3EZ8A 1XGTB 2X9WA 3PABA 3RQ3A 5K9JH 2FJFB 1UEMA 4ODTH 4QNPF 2A1WH 4TUOA 3CFCL 3MRNA 1G9ML 1OF2A 3NAAH 5E0QA 1LE9B 4KI5F 4PS4L 3EDEA 3HPJA 1E4KA 1SJHA 2Z91A 2XICA 1G6RH 3VG9B 3HFML 1NEUA 4NT6A 2CDEB 4YGVA 4G6KL 1KCVH 4PJDB 1XMWA 3VFPA 3AB0B 5DC0A 5CSZA 1KACB 4JFYA 2YMXH 4RAHA 1AO7D 4W4OC 3WFBL 3DXAA 3BYTA 1R0AH 3SDCD 4HG4K 1I8IA 1FQ9C 3BO8B 4YUEL 4P2RA 1MJUH 3TO4A 1MI5D 1TVDA 1UVQB 3SKMA 2NXYD 4M6ML 2PO6A 4DN4H 3ARBB 4OD2A 5LGJB 1SJVA 1SYSA 5BZDB 5HYSA 4X99B 1ACYL 1Q9WA 2AABH 4WHDA 5AZ2H 5DZOA 5FYKD 2V7NB 4PJGA 4KJYA 4Y2DA 1WBXB 5EBMB 1T20A 1FIEA 1GOHA 2FL5A 4RZCB 4HKXA 4JY5H 3JTSA 5T3XL 1TVHA 4OF3A 2NY3D 2FIRT 3A6BH 3IFOA 3QEQE 4HUNB 1FJ1B 1S7QA 1AJ7L 3VXME 3FB5B 3UMTA 3D2UB 3U82B 1OM3H 4S0SD 5KANG 3HI6L 4CVXA 8FABB 1OAUL 4OM0L 1R3LA 1KB5H 1ONQA 1R24B 2R23A 5DUBB 1QPXA 1A22B 1OW0C 1VEMA 43C9A 2BDNH 4PGCA 5GIRA 4OZFA 4UV4H 3EW3B 1FAIH 1ZLSL 1LNUB 1EIBA 2IEPA 2QQNH 3RY4A 3WLBA 2YPLB 4ONGL 1DANU 1V3LA 5IVXF 1D3CA 4ZUSB 1RUMH 5JXEC 4K55A 2WWMC 3QIWC 4PRNB 3VXRB 3QCUL 2A6KA 5IGXL 2ZNWA 3QWRD 1MCOL 5TDPB 2SEBA 4G8IB 3T2PA 5HYIA 3G6AA 2OL3B 4FQXB 5D4QA 3D85A 4Y5YC 2GJZA 4XXDB 1TITA 1H5BC 1MCQA 5E4IA 1KJ2B 3MFFB 3HE6D 1Y6NR 3BDYH 5IVXB 5T1LB 3GIZL 2P43B 1F3RB 4M7JL 1PG7H 5MERB 4PREA 4QRPD 4MJ4A 4ODVL 3KJ6H 4HGWB 2IPTL 2LVCA 5JW4R 3NIDF 3PL6C 4M62H 3VI3F 4HIHB 1I1YA 2VDRH 3F7YB 2QQQA 2QEJA 5F1NA 4OF7A 3KWWB 5JQ6L 4G8GE 5D6DC 4NJ9L 2VZSA 3D18B 1AR1C 1AXSB 4MDJB 1JGVH 4J23A 3VFWA 4NKMB 5EZLA 1YPZF 2EZ0D 3VFVA 3CDYA 4MQTB 1AY1H 5JO5B 3P73A 2HRPH 1FGNL 2YOCA 4G6AD 1FZKB 5C6WH 4PJ9B 4TOYL 1IM3A 3NFPB 5D5ME 5I1EL 4FQIL 3BD3A 4RQQA 3S37L 2VLRB 3UXFA 1ZA3B 3LZFH 1GXEA 3CFCH 4NZJA 1MOEA 3FAXA 1G9MH 4P5KA 4Q0XL 1YPZB 3SO3C 5C0BB 1AC0A 5E1HB 1QVOB 2BNQD 2DQUL 4XC3L 3FJTA 4PRBA 3RY5A 3HFMH 3VXPA 4OZGA 4G6KH 4JCMA 3MRMA 3B8SA 3KPPB 3EHBD 3RBSA 2WMPA 5E6YA 1CGSL 4YFEA 4MJ6B 1AO7E 2QBWA 1IGYB 1KLUA 3GMLA 1ZLUK 3RX7A 4YUEH 3V79C 3QFDA 1B9ZA 4LSVH 1VERA 2EYRB 1MI5E 3JTTB 4BQ6A 1V7NL 1C16B 1INQB 2P24A 4M6MH 3BRDA 5C0NC 1W0VB 3MREB 2DLEA 3EJZD 5FM8A 3W39B 4ZO8A 1HH9A 3DUHA 3H9YA 3WN5C 1ACYH 3W2DL 1T1WA 1CFQB 1H3XA 3BN9D 1MEXL 5FYKE 3QIBA 1ZVYA 1A3RL 1ZT7A 4GXUN 4TNVF 2OR9L 3CFEB 5T3XH 1QSED 3EIFA 1UQSA 1AJ7H 1A64A 4KKBD 2NY2D 2YUVA 5EPMA 1BFTA 4WJ5B 1CFVL 3HI6H 5K9OB 1A6ZA 3R06B 4TUKL 4DCQB 3WYRA 1OAUH 2YPKB 4OM0H 4M93B 4WI4A 4BZ2L 3ZKMC 1BVKA 1F11B 4P9ML 4QT5A 3BXNA 4HULB 3NN8A 1R5VA 5KVFH 3QPXL 2J8HA 3PQYB 1G9EA 1IAKA 4KZDL 4ONGH 3IDIA 2M8XA 2IPKA 2N7AA 1AFVL 3G5VA 5JIIA 5IROC 1VKXB 5T33L 1XIWA 3LSOA 4X4XA 1FL6B 4JFED 5IGXH 3PHOB 3ZYJA 3NFNB 1MCOH 2XKUA 1NGWA 4JRWA 2OP4L 1Q94B 4YDKL 1JF1A 4NDMB 1JVKA 4U1KB 4NQUA 1L7TL 2EEDA 1NCWL 3JWOL 3JUYA 5GGQL 2VDKL 1JFQL 3GIZH 3W11C 5ISZD 1TXKA 4JVUA 4WVRA 4XVSH 4QRPE 4ODVH 1FC1A 2IPTH 3W9DA 1Q9OB 2FH8A 2R15A 3NCMA 3P30H 4NOFA 4EIGB 1G7JB 3E6FB 2X09A 3H3PL 1RK1B 4A6YL 3HRZA 5D7SL 4LLUA 3V8OA 2HFGL 5C0CB 3VFRB 2JE8A 5JQ6H 4YBQD 4XPGL 1J8KA 3S4SB 1U93B 3ORJA 1RULL 2CIKB 3WIFA 1EHNA 2H8PB 3TN0A 4O51A 3RWFB 1CFTB 2IQAB 4ZO7A 3DXAD 1T2QL 3S3PA 4TOYH 3UX9B 3BESR 4P2RD 5MI0B 4UIKL 3FQNA 4M5YL 3TO4D 3HI1B 1KBGH 2OTUB 3LKNB 3MROB 3SCMC 2FECI 4WU7A 4FQIH 5LGHH 2X4PA 3FFDB 4XGZA 2H32B 4Q58C 2YR3A 4Z77B 2GK2A 3LRGA 4Q0XH 3WLWD 5DK2B 4OGAD 4OLYL 3PXHA 2V7HB 2ZG3A 1QTYT 4IM8A 4XC3H 3HNVH 2BNQE 1YYML 4DKDC 4Y2DD 2FGWH 3EYFA 3ZYZA 2CKNA 3FB8B 1M7DB 1CGSH 3GJFB 5F7LB 3TFKD 3RZCB 3VE0B 1YEJL 2VZ3A 5B21A 1KIPA 2XFXA 3CSPA 3IT8D 1OHQA 2FX8L 4NJAL 5HDLA 3OR6A 2X6MA 1WBZA 5DMKA 4GXUM 4E0RB 3X13B 5E7FA 4RMSA 4W4NA 1C1EH 2HWZL 1V7NH 2FO4B 1IEBB 4XI5C 5ICYA 4NIKB 1UEYA 4Y19A 4OZ4A 3O3UN 3GBNL 1HDMA 3W2DH 5JDSB 4NP4L 4F9LA 4QRUB 5B4MD 4PGEA 3ROLA 1NEZG 2EDLA 2F8OA 1MEXH 3CUPB 1DANT 1A3RH 2Q86A 1K5NB 3MZGB 4LDEB 1ZEAL 4QXTB 4OF5A 2OR9H 4BH7A 3N50A 4POYA 5EBGA 4NO0B 4M7LH 4K7PL 1ZLWK 3BD5A 1BEYL 4TUKH 2E7HA 5C92A 2K3TA 5DGRA 4UAOC 3T0VA 4BZ2H 1CIUA 2Q8AL 3T08A 5E2JA 3VXUA 4P9MH 4MNHB 1ULVA 4U1SA 3HCVB 5HGHB 1A9EA 3GMMA 3WHE1 3BP6B 5BRZB 4LCCA 3TBVA 4LHUB 1B6UA 4P5MA 2HN7A 5E5RB 5T33H 4KQ4L 4G8FA 1UCBL 2KQNA 3I6KA 5CD3A 3G08A 4JFEE 4TQEL 1RD6A 3SGEH 1LO4L 1FSKB 5BS0A 3EO0A 4KMTL 2NY5C 2XXCB 1NCWH 4FQLL 5FUOH 3VWJC 4OF6A 5ACMA 2VDKH 4F7EA 5F8QC 2JJVA 4Y4FC 5ISZE 4ZUUB 3O6FB 3UTSA 2WWKT 4S2SB 2Y07H 4X7CC 3MJ9A 1JHLL 1KXQE 3AAZA 1NC2D 1UCTA 5D7SH 3UBXA 2VN4A 1WFOA 3VXOA 5E99L 5B38G 2HRLA 5F7YC 1D5BB 1J05B 5AG8A 3RWEA 1XGRB 1RULH 4ZD3L 4JCLA 3UJIL 3EFFA 2DS4A 2YN3A 1BJMA 3HRPA 4BA8A 1T2QH 5FHAH 4RGND 1HCFX 3DXAE 3BW9A 3QEHA 1BWWA 4P2RE 4M5YH 2HVKB 3G5ZA 4MZ2A 2WINA 2X1WL 1B4JL 2QV2A 3DURB 3EYQC 1IFHH 1A6VL 4GLRI 1FCGA 1B90A 2MJWA 5FA3B 4KK5D 2VR5A 5TE4L 3INUH 3SPVA 3VFOA 5EOTB 4OLYH 1NCUA 5ADOL 5HHOB 3K0WA 2R9HD 3MV9A 3QIBD 4POZC 4PJGE 4JFOB 3C08H 5E8EA 1MCKA 3DUSB 3QYCA 4P23A 2HG5B 4NRXB 2O5XL 3B3IB 2JJSC 3IJSB 3QDJD 2LQRA 4HLZG 2XTLA 4NUJB 5E5MA 2ZP0T 1RJCA 3HMXA 2X05A 5HVFB 3CFKB 3MJGX 4KMLB 1JNLH 3C5JB 2YZ1A 4JJ5A 5D1QD 2DRUA 2PXYB 3QDHA 3C6SB 3L7EA 3KYMA 4OV5B 2P8MB 2KDGA 1CCZA 3QUMH 2H3NB 4OLZL 2OTPA 1HH6B 2ZPKL 2CSPA 3GBNH 4N1CA 1NCDH 1MRCL 3UO1L 5DMJB 4L9DA 2W1NA 2WM0A 2FWOB 3G6DL 4XVTH 1ZVSB 4PGDA 4ACPA 2Y5TB 3QQ4A 2C7UB 5KSBE 5GS0C 1OT2A 3RTQD 3QIUA 1XIWD 2MFNA 3F12B 4HIJB 4OM1H 2Z8RA 4K7PH 2PCPA 1SJXA 4KRMB 2OJEB 4EZMA 2RGSA 3T4YB 1FL3B 4KROC 2Q8AH 4JM2A 2J88L 2HMIC 1VACB 1T80A 4OKVB 3CC5B 3N1GC 2CRIA 2X2YA 4ODXB 3DETC 2XKSA 4QRQA 3UTTB 3RY6C 3TBWA 5FGCB 5J1AA 3EYUL 3MOQA 5D2LF 1GGBL 5GS1C 3BH8B 3Q2CA 2VJXA 4MVBD 4WWID 2YN5A 1GSMA 1H3UA 3CFDB 2WQ8A 2X1OA 4I1NB 5DI8B 4TQEH 4HAGA 3MRBB 1LO4H 4UT7L 3CH1A 3TN0D 4KMTH 1TJHL 5D2LB 2OZ4H 4FQLH 3OJDB 3VH8G 3HE7B 3WS3A 5DWUL 1G6RA 1P1ZB 4XNXL 4OIBA 4HKBB 4QOKA 4CVUA 1TFHA 4NN5C 5F1IB 3LN5B 3AM8A 2EDJA 3G5XA 1K8IA 1KJ2L 2Y36H 1AP2B 3OG6B 1OVZA 4AY0A 2D4DA 5HGAB 1JGDA 3DBXB 4H1LB 1JHLH 3D87B 1HHKA 2KBGA 2XT1B 2W59A 4LPTA 2ZCKL 5KSAC 2WUBL 4NFCA 4DK3A 1ZT1B 5E99H 3BGMA 4OZGE 5IEHA 5DA0B 5F9JB 1CLOL 3S34L 1JE6A 4ONFL 5I17A 2HFEA 2Z4QB 4GRWF 4NPYB 4XCYA 1JPFA 4HJJH 1XAUA 1U8JB 3ARGC 3NZ8A 2UV3A 5CIPA 4HW6A 5DJDA 3OJVC 4APQC 3LDBC 3QBTB 4RGNE 2ICEA 3OXSA 1WZ1L 3QNZB 2D9QB 3GK8H 4JDZB 1B4JH 3KPSA 1JPTL 4AENB 4Y19D 4FP8H 4GRWB 4P5TA 2A38A 5TE4H 4HXBH 2E3VA 1YMMD 4YR6A 4GAYB 1HXYB 4TTDC 1X5KA 2GSIB 3BDXA 3IF1B 1H8OA 4FZEL 4YHOL 2E9IA 1T4KA 2UY6A 4U2ZA 1KB5A 1X5JA 4U1MA 4LLVB 5E1AA 2BNUB 1HI6A 4JKMA 3QDJE 5CBEB 1ORQB 4MQXC 3KLDA 5LKNA 4MNGA 5H35A 2K9UA 3K1DA 3MJ6A 4PJCA 5HHNA 4KKCD 5GGTL 4PRHB 3P9LA 3G5YB 4JKKA 4FG6C 3VXUD 2ZPKH 1MRCH 3HAEA 4PJFF 1W0YT 2P5EB 2JB6B 1YY8A 4DWHA 4GRLB 5MEOB 1HILA 5D7KD 3QJHB 5FYJU 5IBTH 3D0VB 5CMAB 1A7RH 3MPCA 3HZMA 4PY7B 1U6AH 4Z95H 4LPXA 4NZUL 1RV6X 4XP5L 1DUZA 1T1XB 4OD3H 1LDPL 4Q9QL 3ZT6A 4O2CA 5DJXB 2DIAA 25C8L 5DSCA 3V6FA 4PJFB 3OR7B 4L9LA 4Z76A 1OGAA 1SEBA 4LCYB 4EI5C 4QHNB 4PG2A 1S7SB 4JQVA 2VDLL 5M95B 3QI9A 4WDIA 3IU4L 5DHVH 2J88H 4R0LC 4M1CD 3QT2A 2YD5A 3CD4A 1I8LC 1UZ6F 1VGEH 1CVSC 5D2NA 3EYUH 4XPFL 3T0EA 5FECB 4ZSOB 2QADD 1GGBH 3SEPA 4XPBL 3PGDA 35C8L 1ZSDB 4I0PC 3ZL4L 3PDOB 3K8KA 3CPLA 5L0QC 2QSCL 3TVMC 5IEKB 1FG2A 2R0WL 1N6QL 1RQ5A 4LLDA 1CD8A 5DJ0B 3GHEL 3CIQA 1PW3A 3PWVA 4UT7H 4QTHB 2NX5B 1U3HC 3Q0HA 5IV2A 1H3VA 1F3JA 3CSYA 4NO3B 5J56B 4XNXH 3AGVA 2ICWB 3DI3B 2VXSH 1J8HA 4O5LL 4JY6A 5IJVA 1GC1C 2YD1A 3LQMA 4LP5A 2FIKB 3HA0A 1X44A 3V2AR 1A3LL 2VLLA 2I07A 3B2VL 1UJTA 2ZCKH 1PG7X 4MJIB 3S35L 1XF4B 1NFIA 2X4OB 3MV9D 4NSKA 4Y4HB 3TBYA 3GKWL 1N59B 3REWA 5J6GB 1CLOH 3S34H 4ONFH 5F3BA 4P23D 4Q6IA 3RGHA 5A1AA 4PV9A 2DQTL 4XVUC 2AK4B 4PB0L 3ALPA 3I84A 4QY8A 4XRCB 1NFDF 1Q9LB 2MQ3A 2W91A 3KYNA 4WHTB 5JA9A 5ICZA 1WZ1H 2V9TA 4TULH 3OKLA 3S4SG 1HHGA 4OT1L 5JXAL 2HLFC 1IGMH 4X4YB 2A83A 3GBLA 2HJFB 1Z5LB 4Y19E 3UBXI 4NO2B 4NM4L 1JF6A 2F5AL 2YKLH 3BHBA 2ATPB 1JNNL 2VE6A 1YMME 2EKSA 3LKQB 3LQAC 3BQUA 1RJZA 1XF1A 3CU1A 3DOSA 4FZEH 5DMGC 3WEXA 3ISWA 2VWEC 4JHZA 3OXRB 5C0AB 4J3UA 5FK9B 3QIUD 2RFXA 1WAAF 4L4JA 4F7PA 5IT2H 5FYLD 1YA5A 2ORBH 3RDTC 3MNVB 43CAB 1A6TA 3QUZC 1I9EA 2CK0L 5GGTH 4MX7B 4JDVA 1LO2H 1FGVL 3AS1A 1QFHA 5AYUH 4MHHI 4X8JB 2ZUQB 4JM2D 5CSBA 3O3EB 5ESVA 1N5YL 1QFUL 3VXUE 3O9WC 3MA7A 1TCMA 3QXAB 2A0LD 3X12A 3ARWA 2V5SA 5A16B 5D7KE 2ITDB 1YEHL 4ZDHB 4P2CG 4P9HL 2VUYA 5H8DA 5C3LD 1TPXB 1JGLL 1T0MA 3D39A 5SV3A 1LDPH 4KPHH 4WI5A 3VFUB 4I2XA 3JWNC 5KZCB 4BQBA 5SWQA 2VDLH 1XCTB 5TPWL 3RWCB 3IU4H 3PDGA 2IBZY 1LO3L 5E56A 3EOTH 4QRRA 4QOKD 5EWIH 2VLJB 4R90L 1UGNA 4PLKC 2ILLA 2R56L 2B1AL 3L3KB 1I7RA 2ZKHH 1MY5A 4G42B 35C8H 1TJGH 1KJ3H 3L95B 3W5NA 4OFVA 1NC4A 5ANMB 2QHRL 3ZL4H 4PGBA 2QSCH 5IB5B 2ZUWA 5GS2D 3AS2A 1N7MH 2X89A 1PKOA 1P69B 3X11B 1N6QH 4JM4H 3GHEH 2HVJA 3WIIL 5FXCH 5E94B 1TZGL 5C8JA 4MD4B 2D31A 4X6EA 1EUTA 1U8NB 2BSRA 4LHUG 2ERJC 3MNWB 5JORA 4P2OC 1RI8A 5C08A 4EXPX 3FRUA 1A1MA 3QG6B 3GMPA 4PD4K 3NZHL 4NCC2 4QF1A 1G7MB 1IAOA 3E8UH 3KPSD 3GRWL 1FNGB 1AGEB 5MEND 5TGBA 5GQBA 4P5TD 3RNKA 1A3LH 3L3HA 1T04A 4D2NA 3WXWH 4WFFE 3S35H 4EVNA 3QZWB 2KUTA 1MQKL 4O9HL 5D1ZA 4PJ8A 3BWAA 3GKWH 5CEYA 3MV9E 3QUXA 5IB4A 3TJHC 2C3WA 3QHZH 4XWOD 3O2VH 3SN6N 3C5ZB 5DJYA 4PB0H 2JJTA 3BZDA 1U8IA 4ZXBB 2FBJH 1ZANL 4LVNB 2XYCA 4R3SB 2FX7H 2UWEA 4RIRA 3VGAB 3C2AH 4L5FH 1BQLL 5JXAH 2FD6L 4PRAB 1U8HA 3RKDC 4NM4H 3LKSB 2J8UF 2F5AH 2I25N 1D5XA 3UZQA 3QRFM 1IKNC 4CMMA 3VXMB