1GLVA

Three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
299
Chain Sequence
b'MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE SYNTHASE
publication title Three-dimensional structure of the glutathione synthetase from Escherichia coli B at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
total genus 93
structure length 299
sequence length 303
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1993-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1glvA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1glvA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1glvA01
1T36A 3R23A 2W70A 1PX2A 4HQ6A 2V5AA 4MA0A 5BPFA 2W6QA 3ORQA 1GLVA 4IZOA 1M0TA 2QK4A 1GSOA 2IP4A 2YRWA 1AUXA 4O7TA 3V4ZA 1CQJB 1EYZA 2I8CA 1KEEA 2DZDA 1M6VA 4J6EA 4MV1A 2VHEA 3LWBA 3ETHA 3WNZA 3DF7A 4ZHQF 2X0SA 3KREA 4YAKB 1WR2A 1SCUB 1B6RA 4MV7A 1E4EB 2FPGB 4NYEA 3GLKA 2YS7A 5JQGF 5EZYF 3VPDA 4FFMA 3LP8A 2I80A 5BPHA 3AX6A 3ETJA 4O84A 2QF7A 3KALA 2YZGA 3KAJA 4TV8F 5KX5F 3VPBA 4WBNF 2W6OA 4C5AA 4O83A 4YJ2F 2R82A 4O4LF 4MV4A 3BFPA 4YBZB 1AUVA 5D8DA 2YZNA 5JH7F 5FNVF 2R7NA 4EGQA 2DWCA 5C8YF 5JVDF 2R7MA 3WO0A 1DV2A 4I50F 5KKNB 4IHJF 3TIGA 5CAEB 5JQWA 2HJWA 4O4HF 1EZ1A 4O7YA 4O82A 1VKZA 3TQTA 2J9GA 3I12A 3R5HA 3V4SA 2CNVA 3RUPA 5LP6F 4O7ZA 2NU9B 2VPQA 3K5HA 1C30A 2CZGA 1KJ8A 4O81A 1GSAA 4WD3A 2NPOA 5IYZF 2FPIB 4FFLA 4FE2A 4EGJA 4L1KA 5I47A 2FP4B 4FU0A 1JDEA 2C00A 4HNUA 2R85A 1DIKA 1OBDA 5LA6F 4ZOLF 4QSHA 1IOVA 4EA7A 2R7LA 2R7KA 2W6NA 4XZ3B 3GIDA 4M99A 4FFOA 2NU8B 5CA0F 3BSSA 4FFNA 3QFFA 2NUAB 5CB4F 4O7LA 4MV6A 4MA5A 4YAJB 5GONF 3HO8A 5J2TF 3U54A 2CQYA 3R5FA 2ZDGA 3G8CA 4YJ3F 1CS0A 4O7SA 4EG0A 3MWEA 4GGMX 3K5IA 4RZQA 3BSYA 2OLSA 3VMMA 4M9CA 4Y8VB 2NU6B 1EUCB 2VR1A 3U55A 3VOTA 2GQRA 3OUUA 2V59A 2NU7B 4TUYF 3UFXB 3Q1KA 4FFRA 5BMVF 4O7VA 2R6FA 2GPWA 2DLNA 1UC9A 3KAKA 3U9SA 4ZI7F 1M0WA 2SCUB 3BSWA 4EA8A 1Z2OX 2W6PA 2GQSA 4DLKA 2W6ZA 1EHIA 1CE8A 3RV3A 5JVLA 1EUDB 1Z2NX 3R5XA 4MV9A 4TV9F 3VPCA 1IOWA 1VBHA 4I4TF 4DIMA 5C1OA 2FB9A 2R86A 4XX0B 1I7NA 2ZDHA 5CA1F 2P0AA 3R9RA 4HR7A 1KBLA 3N6RA 4M98A 1GSHA 4ME6A 3JRWA 4O86A 4EABA 4M9UA 5HV6A 4EA9A 1JLLB 4C5BA 4O7RA 2R84A 3RFCA 1PK8A 2YZLA 5J2UF 5LXTF 2CNUA 4O4IF 4IWXA 2YS6A 3OUZA 2YYAA 2W6MA 1A9XA 3MJFA 2V58A 4ZQIA 1KUTA 1Z2PX 3SE7A 2XD4A 2W71A 4FGRA 4XYLB 3G8DA 4MAMA 4O2AF 4IIJF 4O4JF 2ZDQA 2YZMA 5K2MA 1OBGA 2Z04A 1W96A 3ORRA 4MV8A 3MWDA 1KJIA 2WYOA 2HGSA 1KJJA 2GLTA 3K3PA 1UC8A 3HB9A 3VA7A 4I55F 4YB8B 5C1PA 2FPPB 1I7LA 3JZIA 2Z02A 5LOVF 1E4EA 2PBZA 3N8DA 2VQDA 1DV1A 1GGOA 2YWVA 1W93A 2YL2A 4O7NA 1VBGA 3WO1A 4HNTA 3Q2OA 5H80A 2XCLA 2PVPA 4MV3A 3TINA 2DIKA 1JDBB 1B6SA 2I87A 4O7WA 5HBRB 3NUAA 3U9TA 3E5NA 1KC7A 1C3OA 3TW6A 2YRXA 1CQIB 1KJQA 4O2BF 3HBLA 4FFPA 1JKJB 5LYJF 2GPSA 3JZFA 2R87A 4EAAA 1BXRA 3TIIA 3JRXA 3RV4A 2PN1A 4IWYA 4XYMB 2YW2A 3AW8A 1A48A 4C5CA 1BNCA 4HNVA 4E4TA 5DMXA 2CNQA 3BG5A 1ULZA 1KJ9A
chains in the Genus database with same CATH superfamily
1NBHA 3U80A 5BPFA 3Q3JB 4L5CA 2FFRA 1IJFA 3IE0A 5EZQA 5CH3A 3OE7A 1VB3A 4B3TH 3R24A 3GIQA 4J0HA 4FM9A 3GP8A 3K94A 2Y1FA 2R97A 3BB1A 3MB5A 3CJRA 1IPFA 4MGHA 2A9KA 3ZJUA 4ERNA 1XQYA 3M3PA 5BQXA 1Q15A 2VYND 4HL6A 4N18A 2F4NA 4Q43A 4GMDA 1UKVY 4JB2A 3WNVA 2CV0A 1GFWA 3LD9A 2BN4A 4RANA 5IS2A 4UQOA 3CVWA 3AX6A 1LPBB 3GARA 2VAXA 5CHEA 3A4MA 3KXYT 4QHSA 5AFSA 2J30A 4PLTA 3WGYA 3VPBA 1S9HA 1E3SA 1XDUA 2GEJA 2DAAA 3TTYA 3MRXA 2AG0A 3PJDA 3SR3A 1OXMA 1US8B 3OZIA 1M72A 3BYZA 5KI6A 4O4LF 3OF3A 2QR2A 5C44G 1QR2A 2A0FA 2J45A 1Z0DA 3OEED 3ILHA 1PD1A 1WABA 4XD2A 5IM4A 4TVKA 5J2TA 2O4UX 2XCAA 4E5UA 4CUKA 5TB5A 4BZZA 2J5XA 1NXWA 2QB5A 4DXDA 1EKVA 4HX2A 1WSCA 2GN2A 5CYOA 5HF9A 4DV3B 4A92A 2I2XB 4NDAA 3TLGA 3NKLA 4FFLA 1AK9A 3KZOA 4WI1A 3TDKA 2FFBA 2IS2A 3HWX1 4DQNA 2EBFX 1P3DA 4FJ2A 3VPSA 1QH8A 3HJRA 2BLNA 2ZRLA 1RU3A 2O05A 3PPVA 4V0KA 3WGJA 3M9MB 4RIIA 3U81A 3BE6A 4JI3B 4K03A 4PZCA 2PBFA 3JAKB 2KQUA 4WEOA 3DTNA 4ZYYA 3LOUA 2XUFA 1XEWY 3LFHA 3OAAD 3P0HA 3V8NA 1D9ZA 1R27A 2IY8A 2MWMA 1N6LA 1BXGA 2QTRA 4QM6A 2O3JA 1XRQA 1KZ7B 4EEQA 4YRTA 3UWPA 4Q4LA 3LY8A 1ZL2A 4BVBA 2ZB3A 5BNFA 3HDHA 3TUJC 1DAAA 1AS3A 1WUTA 2ZBEA 2DFLA 1SIWA 1NF2A 3WYFA 2O2EA 5HIIA 3W2FA 2ICAA 4DILA 4J0DA 2OLKA 3UWDA 2GUWA 1RFGE 3U31A 1O6GA 3FJ1A 1HNXH 1CUVA 3CX4A 5TC4A 3Q11A 5KFFA 3CRZA 1XQVA 2B63A 4R01A 4RHEA 2NPIA 5JVLA 1JG6A 2O1SA 1PDVA 3KFVA 1P29A 2CNBA 3M2PA 2EYUA 5BN5B 2V6IA 2HRRA 4R2KA 1CDOA 3OTGA 3ZLVA 4WK2B 4NFLA 1PL7A 1E0JA 3PQEA 2WM8A 4OXIA 1U1FA 3HNPA 1ZNQO 1OOEA 1NKSA 1G3UA 4H4CA 1DIGA 1HEIA 1ZGAA 4D0LB 1QC5A 4UUGA 3VBEA 1H0SA 1ZSYA 5GM2A 1UBGA 1JHUA 4HVTA 3UK6A 3G8DA 4D44A 2YX1A 1FA9A 1QM5A 2X19A 1WPRA 4AS3A 3W7BA 1Y5RA 3F49S 3UIEA 2QJRA 3K9NA 1N5JA 1RKUA 3UCEA 1HT2E 5C51B 2QTFA 4UM8B 4YCJA 2OHJA 2VHYA 2R79A 2ZJ1A 3DPUA 2PWZA 2Z43A 2WDZA 3KVOA 1GQRA 5P21A 1HO3A 3JYNA 4W5HA 1V16A 2R96A 3BBPA 1DC7A 3RADC 2UYYA 5SZHB 3RAJA 3CZAA 3KVYA 2QTCA 2PYZA 2B82A 2HRBA 1GR1A 2A94A 1D4FA 4L5IA 1RM5A 3U9TA 3UQ8A 1RRFA 2QQ5A 1KYVA 3B48A 4FIZA 2A78A 3ZKAA 1AV6A 1BQ4A 1RWMA 3TQ1A 1YDHA 4EZBA 3WADA 4KSYA 3GJ0A 5T57A 3Q8PB 4TTVA 2CZQA 1E92A 3BE4A 2IU6A 1RQ7A 4DR6B 3P0EA 3NOOA 1HDZA 2QORA 2VHVA 5C8YA 3RF6A 2P2CA 1EDEA 4MDHA 3R09A 2UU9B 3KJFA 2GEBA 2H9AA 4DV7B 4B6PA 3TUZC 3O4IA 4ZRNA 3GIJA 4I1IA 5IEBA 1WQ1R 3S7ZA 1R6AA 3VNRA 4H7PA 1D07A 1SHTX 3HJUA 2R7ZA 4YAUA 1SVIA 5AOBA 4QQFA 5JQGF 3KQOA 3PR2B 1I1LA 3BACA 1PO7A 2H9IA 1G98A 5AHWA 2VQFB 2Y0SA 3A3NA 2B99A 1T3LA 5FWAA 5EA2A 2OZEA 3I1JA 1E6MA 5J59A 2E1RA 3S8EA 5A5EA 4UE2A 4Y8VA 2WUDA 3WXMA 1DMRA 4E1AA 3ZY6A 2O1EA 4QVGA 1P62B 1QOZA 3QTLA 1OYYA 1T4BA 4D9KA 1PL0A 4OHOA 2P6UA 4XDYA 4MRPA 2QGNA 4JI3H 3K6SB 4DV4B 1M2GA 3NI2A 4CUJA 1BX1A 4UATA 1N2EA 1GSAA 3CF6R 1GGKA 3B70A 3OT5A 5JW6A 2I2FA 4XGRA 2ON6A 1KJWA 4AG6A 2HMYB 5F12A 3RU3A 4O3SA 1H9AA 1LLDA 2IXBA 4ZGGA 5BSEA 1MO6A 3TAXA 3GTMA 3GIDA 1M2WA 1TTHA 5EXEA 2Y76A 1NX9A 1J2EA 1JG2A 1XDBA 1E0DA 1QAOA 3HJCA 1Z29A 1DBVO 1QIGA 2CXTA 4NZ9A 2ZVQX 2Q3FA 1ZHFA 3UATA 3M6WA 1X15A 1YJ8A 2ZJYA 3JARB 2NSJA 4NWIA 4F6RA 2EG9A 1E5QA 1QTQA 2BP7A 4JLJA 4KMOA 2AC4A 2GX6A 1JQDA 1JSLA 5AJWA 2Y71A 5KFAA 1U94A 4D56A 3GP3A 4FNAA 2H29A 4C21A 3LT2A 2XE6A 1NDQA 1QP8A 2CDAA 2G1PA 4PQFA 1WB4A 1FS5A 2QU7A 1W94A 4IDDA 5DSTA 5TMDA 3QLTA 4Q4AA 1L7OA 1P4AA 4MVJH 5BWXA 3UJHA 1TIBA 1VSQA 1UNNC 4A8JA 2JGNA 4RU1A 5H68A 1E9BA 3EF3A 1N57A 2OL4A 3B2EA 1ID1A 4A0HA 4HFJA 2Y0SE 1YS6A 5FADA 4X45A 5JEEA 5JTUA 2GT1A 1G8HA 4Z8YA 4PNEA 1DG1G 1J39A 4IXWA 3RS3A 1V5FA 5CLQA 7REQB 2PX6A 4RHUA 2GXQA 2IYQA 4NMHA 4RGYA 1ONOA 3TG2A 2G76A 3KETA 3ENQA 1IWOA 1ID8A 3TIVA 1KJNA 1TZKA 3E9RA 4FC7A 4L2IA 2RIRA 4Q39A 3BICA 3KUDA 5DTJA 4ABTA 1VI6A 2GNOA 5JECA 2V6JA 4DR1B 2C2BA 3KD2A 1SG0A 4K6GA 4HB4A 2VWGA 4J2HA 4X62B 4OY3A 2Q2OA 4C78A 3NDIA 5LVAA 4RF2A 4MIOA 2IEAA 3EC7A 4WMLA 5I9MA 4DR6H 1T9GR 2FWAA 3WV5A 3OETA 5IH3A 1W4BA 4RM3A 1GQYA 4DCPA 3JQ7A 1UXHA 2WHQA 2UU9H 4U63A 5I8ZA 1BAPA 2AOUB 4L78A 2YW9A 3MCAA 3NOQA 4DV7H 2Q5IA 3FGPA 4UTVA 3W8FA 2YXLA 2V7QD 2RH5A 2YR0A 1N8NA 2XR1A 1VP3A 2VHJA 3CEBA 2VXCA 2CYAA 1H2EA 1YZFA 3K35A 3WP1B 1M6NA 2VNJA 1XXHB 4C89A 4JFRA 1XRNA 3HXQA 2DFDA 1W5AA 1GUZA 4BNJA 1DBPA 2JVIA 3OTIA 3QKTA 1QHGA 3VYRB 2VQFH 2G7MC 3B53X 1KO1A 1NI4B 3S2FA 5KT7A 3O0TA 1FLAA 4CLXA 1ZOIA 1C9NA 3WNZA 2NNLD 2OLEA 4KQJA 4UMDA 4GYWA 5DTIA 1CUEA 1JAHA 1OA0A 1FFDA 1L5NA 3F71A 4HBZA 3DEZA 2KJQA 2C7BA 1YBFA 2XBLA 4DL6A 1W88A 1T1JA 2B30A 3TTTA 1LWNA 2JLAA 4G26A 1U7XA 4L4RA 3N87A 4X61A 4RMHA 4FFVA 2AXEA 3PXUA 3F67A 2OORA 1EI9A 4A5OA 1W36B 2VFAA 1HOXA 4DV4H 4J0JA 5AKKA 1KVTA 2YZ7A 3O1IC 1PS8A 4WUVA 1NNUA 1I6WA 3LC0A 2HJWA 3ZI4A 1XTTA 1QHFA 2B35A 4NP6A 3QBDA 1Y4SA 3DD1A 3ST7A 2DBZA 3BQ0A 4GEKA 3BH0A 4UEKA 3WMXA 1QRDA 2JGLA 3C87A 1G3MA 2ZCJA 2NO5A 3SEZA 5CLJA 3S2ZA 1KOGA 3A6GA 4RW0A 2W5UA 5DISC 1FTSA 5K0CA 2Q5CA 4O1HA 3RUEA 5J4HA 2FLLA 2EF0A 2BFEB 4H1HA 1M75A 1SXJD 5L7WA 3DVRX 1YJAA 4QSHA 3G89A 2QLTA 2RHWA 4MCHA 2AOTB 5IAAA 5JXJA 2XDYA 1JDVA 1YCHA 1TEHA 2CXRA 1Z8DA 2A5JA 5SZIA 1IVYA 1YZGA 5KNLA 4JELA 3MTBA 1I3MA 1YF3A 3E2PA 2XUIA 2NACA 3HXLA 1BEEA 4EJSB 3Q87B 3LHKA 2OFXA 2QN6A 1YCGA 2GEUA 2VCYA 3LUGA 1XALA 3HGTA 4W7IA 3H5AA 5CK5A 4DUGD 4EUFA 4AXXA 3NHYA 1ZGZA 2JCVA 1XTSA 4G24A 3JR7A 5JWOA 4IWNA 3WBBA 1RPAA 4OHCA 3D6NB 1XXLA 1FDOA 4TKVB 3QPWA 1KR5A 3WGVA 2AZTA 3E3MA 5DNDA 3DWEX 1XLUA 3A8TA 1U9ZA 1A5ZA 1ATIA 2Y1GA 2Q3LA 2ECKA 3SHTA 1OZFA 2W6PA 2JLZA 1MR3F 2VA8A 4PXAA 1UK9A 1UOQA 2NZ2A 2A0UA 5B7GA 1I2DA 1XU4A 4YCMA 3RBXA 4K9RA 3PRHA 1OWTA 2JLVA 4DMCA 4PSVA 1V3TA 3JRWA 1NKTA 5ALEA 5AHRA 2J48A 5JJ5A 4OL0A 4CR6A 5AI4A 3CQ9A 1PK8A 5A5VA 3K53A 3HBJA 5LXTF 2GA8A 1AKUA 3ZG6A 3VR0A 4DR1H 5AI8A 1RJ9B 5BQ5A 6PFKA 4L95C 5K6AC 1Z7EA 3SZUA 2AK3A 1OBGA 2P6OA 2ADFA 1QU3A 1M2HA 4OCZA 2DBYA 4CV2A 3HP7A 3FYUC 3R6DA 3CSUA 4LTDA 4ZDIA 2B8WA 2QEQA 1TU0A 3B3FA 2OYSA 3IP8A 2FCRA 4PNPA 2IYEA 5JSQA 3RNLA 3U4HA 3I9JA 3F7OA 2ZK7A 2V0CA 1YE5A 3T3MB 2H2GA 4JI4B 4YV1A 3O3CA 5LMNB 2MMGA 4UEWA 5KNCA 2VPYA 1DX9A 1Y98A 4U5XA 4B4OA 2PU5A 1NVVQ 4DA0A 1XK7A 4KYTA 2Y9PB 5JC1A 3PNOA 3FDIA 3AEKB 1Z5OA 1SVKA 2R8IA 1PZHA 2VP4A 4F0JA 4AROA 4L74A 3L06A 2AOXA 1P9RA 5E9JA 3G9TA 3OECA 3WKAA 4IWYA 3DTYA 1O9HA 2O5RA 5TF4A 1SD1A 4N5LA 4AN4A 3NO4A 1B73A 5EMLA 4XCQA 1DG3A 2DPLA 3T9CA 5BW4A 2WV7A 1JL3A 2WUWE 2P3SA 3B7GA 3W1GA 1H9CA 3DBVO 5DGIA 1Z9BA 4ECXA 3EDCA 2WE7A 4A0SA 3HXKA 5FIUA 1V37A 2WIKA 3PUZA 1QWOA 4I6GA 4QTYA 1RD4A 4DCVA 1QKJA 1VJ0A 3LSTA 4PZPA 2BFFB 1ZMOA 1E9SA 3ESBA 1QPZA 3UVEA 4OHXA 2W90A 1OWOA 4QICA 5HCNA 2ID4A 4F2GA 1G2QA 3A4TA 3HZZA 3EVFA 4CFSA 2P4UA 3EUWA 5CFOA 1ZIDA 2ZRPA 4NXMB 3H2YA 3GZJA 4JT9A 4JI5B 2GYUA 2J4CA 3WLEA 3LYUA 4DQKA 2WT8A 4QBKA 4GSKA 4O83A 1ES9A 1JPUA 5JSZA 2R82A 4MUHA 4U3JA 3TH5A 4Z4IA 3BGVA 2YBDA 1PK7A 5IYCG 5FUWA 5ICMA 4YJFB 1Q1ZA 3LCVB 3O75A 1TQ6A 5G1NA 2A3NA 4KO2S 2CDCA 3ME5A 1NOIA 2P69A 4NPAA 1NY5A 4B4WA 4N01A 4PRKA 1ZY2A 4X85A 2RCYA 3BA1A 2XMRA 3KHTA 3K96A 1KSJA 1JDEA 2C00A 3SLGA 1ZNZA 5F98A 2Q5FA 2K6GA 2ZPTX 3P9ZA 4RAOA 1KO4A 5ALFA 4CQJA 5BV8A 3PGMA 1WR8A 1SXIA 1ZI8A 4HT3B 3UC5A 2XV1A 4RL4A 2JIBA 4MV0A 1TUEA 3CPSA 1NVEA 3B12A 2B4TO 1B93A 3GUCA 3OO1A 1II8B 2YASA 3ZWOA 1VBMA 3EGXB 1RWXA 4M0KA 4I3HA 1TF2A 3ELYA 4URXR 4EQ5A 3BIWA 2OESA 3PQ4A 2J33A 4LY3A 1CJUC 2OZKA 3B6JA 1FFEA 2DH6A 5LQNA 5C7IO 3N43B 3LCCA 3L0OA 2ZS7A 3PXCX 5M29A 2WB4A 4G5XA 5D3KA 4R1NA 5K5EA 1KH1A 3DPSA 3Q98A 4F8EA 2JCBA 2B4KA 1GPYA 1I94H 3AP2A 4ZK6A 5TGZA 1RXIA 1X70A 4UARA 5KX5B 4RA9A 1K4YA 3FHJA 3STVA 2GZ1A 1WU8A 2WF8A 2WPDD 5FV7A 2JH3A 4JKIA 4I1UA 2GARA 2GVZC 4BO5A 4XQEA 2FUEA 3D3WA 4QO8A 2Y66A 1S7CA 2W11A 3IEXA 4C0QC 4UPVA 1E3WB 1OJ7A 1FMFA 2JAWA 1KRWA 3QMMA 1I4LD 1MKYA 4CG2A 4BFZA 3SHQA 3WIUA 3M5PA 3AVQA 4O3NA 2HX1A 2ABJA 5JCXA 1GOTA 2ID7A 4TM5A 4MVJI 1K7EB 4JI4H 3KKOA 2HJGA 1MNQA 3ORRA 2A0YA 4TL9A 2FJ0A 4D96A 2XMGA 4DPLA 3T9FA 4J0KA 5ILQA 1UM8A 5BWOA 1ESMA 3FFTA 1HQKA 3ZVNA 3CBQA 4X5OA 2I7TA 4M8NE 2PBZA 1M1XB 2Q2TA 3VKFA 3WGHA 3B78A 2H7VA 4JWKA 3I62A 2Q6LA 4W1QA 1CQPA 1H5NA 5BO5A 4WLNA 1MVOA 4PFJA 4EPXA 1CKNB 4BBAA 2I87A 3EJ6A 1SU7A 1R0CA 2I7CA 1ISHA 1E60A 1O5OA 4BLOA 3BMQB 4P93A 5JS7A 3RSQA 1E1LA 2E9SA 4BJ6A 2VEDA 3W05A 4I7EA 3O7WA 5JAPA 1TL7C 3AH8A 1PYOA 5K3DA 4UM5A 3C1OA 3C3MA 4U2GA 4ZPJA 4LN1A 3QY9A 4OGFA 1OFUX 1E3LA 5DXFA 1KVSA 1TGYA 4O4LA 4HNGA 1OGIA 1Q0QA 4ZA2A 3WGZA 1M0TA 1QG4A 2WFLA 2O2SA 4CV0A 4IXNA 2LTAA 3BFKA 3A36A 1IBMB 4NXMH 5DCYA 2ASLA 4JI5H 5EUBA 4IHKA 2BGTA 4OBBA 1C4KA 4YJGA 4HNHA 2CSUA 2BBOA 1RTTA 5L45A 3JYOA 3EPGA 1S3GA 1L5KA 3NS7A 3ZYCA 4DL7A 4D9NA 1N2GA 1BOFA 3F3YA 3Q7TA 4LPKA 3IKLA 4XGNA 1C50A 2VH5R 3PFCA 2HDHA 2R65A 2F8LA 4LRSB 2JFNA 1ZITA 3M6MD 1OFIA 1MD9A 2WP0A 4NZNA 1GYQA 3DOOA 2FJZA 1U0RA 4DNFA 1JLRA 4M1EA 4CMIB 2YZNA 2UVDA 2HLHA 2AKYA 1S9DA 1I4DD 3C3KA 3FRHA 1H0KA 2X13A 2W9CA 1PUJA 2EOAA 4DOMA 4FGZA 1ULTA 2X40A 2EQ5A 2DCUA 4CM6A 3JYPA 3FWYA 2BEVB 1X3LA 1BZYA 1JHDA 2WJWA 4EM6A 2XA2A 1WA5A 1Q0RA 3EHDA 4BBSG 1P7WA 1R0YA 2ACEA 4BVGA 5JS2A 4AWAA 5C8ZA 5AKHA 3ZK7A 4Q9JA 5EHNA 3R3HA 5LN1A 2BFWA 4P3YA 3ZR4B 4HDSB 1YUMA 4U8GA 1IVNA 4LF8B 3FDXA 4JH0A 2PAAA 4PTYA 3LKZA 4PWQA 4TQUS 2NWQA 2UDPA 2OLJA 5JISA 2FK3A 3HNOA 3G5LA 4LYDA 3CCCA 5P8WA 2IWRA 5CLFA 3B7WA 1UBEA 2WJPA 3WA6A 4YAKA 2C5BA 3L07A 2NZWA 3K5IA 4OB6A 4DV6B 4HS9A 1CQXA 5SZJA 3T5CA 4ECSA 4BWGA 1DZIA 3I04M 4BO6A 4PWZA 4P08A 4Y3UA 4UDYX 1NBIA 3MMXA 3Q1KA 4J0GA 2R6FA 2JCYA 1M10A 1GV0A 5DHPA 5I9LA 3G8YA 2CZCA 3CUUA 3GJ3A 4TLLB 3R5XA 4O25A 5ES3A 2CL6X 5BSMA 4O0LA 1QDLB 3QLUC 2MSEB 2X86A 4DIMA 5E0OA 3JD3A 2XIGA 3PKIA 5AOVA 5H59A 4JXZA 1YI1A 4D4MA 2PGDA 3VKUA 1IBCA 3QE3A 2DY0A 3VO1A 2ZLBA 5HIMA 2BGNA 3T94A 3EBPA 3U3KA 4WINA 3HZOA 3W5JA 2VJMA 5JCPA 1NF8A 2VOBA 2OGZA 1U9IA 1C2YA 2W71A 4E1VA 2H4JA 4R9SA 3PU6A 2HPVA 2V5VA 2ZDQA 3BE5A 3QKWA 3LBFA 2ZANA 5L1IA 4ZOLB 4DV2B 1NQUA 3WXBA 3PO2G 1X7WA 3QU9A 4KZKA 3LHSA 2DOKA 2CDRA 4RKRA 3GN2A 1VPEA 2UVUA 3AHEA 4FLMA 3ILVA 2AVNA 1KTVA 2BELA 2BHRA 1T9ZA 4GPZA 1HZZC 4X91A 3ZYZA 2FJUA 4WW0A 4LDJA 2C95A 4PZ0A 1XD2A 2C2KA 4WKBA 3U0GA 3FNBA 3TINA 4RZXA 3G1UA 1GR0A 4RQAA 3H8JA 5FV4A 4W9NC 1CYEA 2W93A 3RJTA 2H2AA 2H3EA 1USGA 3LHDA 4XVQA 2W42A 4KK4A 4R2IA 5JQGA 2JI7A 1IBMH 4J3JA 3K0FB 3RAPR 4IDEA 2CD9A 3Q6IA 9LDBA 1U90A 1SM4A 4ZZ3A 2QL7A 3B2QA 5I5XA 3D54D 3L7YA 3AIMA 3KSAC 4JP8A 5BWRA 3DYVA 4EI9A 5DF1A 2BGRA 3VOSA 3HVIA 7MDHA 4YJDA 2PCLA 3LWZA 1QO0A 5D1OA 2OQRA 4CKCA 3DF7A 5B3AA 2QE7A 1HDOA 1N1DA 5I8WA 3E3AA 4HQLA 4Q6WA 4JBWA 3WISA 4N76A 4I5GA 3R2JA 5EPEA 5KUTA 1GU1A 2F8TA 3HJBA 3HU2A 4GYYA 4MGEA 4GI5A 4J90A 3A1CA 4C6TA 1UCFA 4WLFA 4N0DA 2H5EA 1CUAA 3IJ5A 1S2GA 4WNAB 4RX1A 1XHEA 1KS9A 1RQ2A 2CFMA 1V3QE 4FR5A 3F90A 1POWA 4R1PA 4OHBA 2VF4X 1MZBA 2W7OA 3HEAA 4IMPA 3C6XA 3WWDA 1QPGA 5AUPB 2OOKA 4ZO4A 3ZZ0A 3KJHA 2PWBA 5AW7A 4C9BA 1C7QA 3NGXA 2RB4A 4TV8B 1KMIY 3FIJA 2RONA 3MM4A 4JGIA 4AP9A 5ALSA 4R1SA 5MHTA 4LF8H 5EEHA 2D54A 2WSMA 1UF9A 1YRHA 5U1PA 4ZVUA 1Z06A 3ZCXA 2AFHE 2VK4A 2QQEA 1P7CA 3AYZB 1DIKA 1A5AB 1GADO 3D6UA 4C4OA 4LGYA 3DEKA 3HMKA 4UCFA 2GK3A 1AKWA 1OWLA 1XN4A 4DV6H 4EHLA 4PBCA 4D4GA 3UT5B 3IG0A 3PQFA 4U9IS 3CW2A 4MULA 1ACMA 4JVOA 5CDUA 4WQMA 2IQ5A 3I45A 1U81A 2MINA 1YL6A 1P31A 2ZSHA 3G0CA 1I2KA 4CMJA 1QJCA 1T5TA 2IGBA 5DTEA 3AUFA 1IIRA 1WKCA 4GIBA 5L95A 4F4IA 3QBEA 1IY9A 3AF2A 2IXEA 3EAQA 4FSHA 3JQCA 5B12A 3W6OA 1KK2A 1FLDA 1DTSA 4MQ6A 1W7AA 3JATB 3RJ0A 5DRTA 4BKRA 3KEGA 2BTEA 3UAYA 4ZVTA 3WLSA 4CN8A 4TGLA 5F21A 3W9BA 3U62A 3CEJA 1OX5A 1F6WA 1IN5A 4RZ3A 1CB7A 2O8BB 4DN6A 2VHWA 1O6FA 3DZKA 3G2IA 2OOSA 4BKMA 4IH4A 4R8SA 2JA5G 1SCNE 2IOFK 4IJWA 4AO8A 1BX3A 2VJBA 4DJJA 3NM4A 4KQIA 4DV2H 4PPGA 3VXKA 3QSYA 3IMFA 4HZGA 5CBPA 3J81k 2FZ5A 4TLBA 2QX9A 4B43A 1QV6A 1R0SA 4CTNA 3LUBA 3D8NA 1JFVA 1RBMA 4PVCA 2G08A 3MCZA 4BU0A 1YOVB 2CHEA 3F47A 4JOBA 4HDNA 3WKEA 2O5EA 2NNWB 4FN5A 4K8OA 3G9ZA 3BABA 2P9BA 4CEHB 1G0NA 4FD2A 2P7HA 3ETCA 4LY9A 2WHYA 2WM3A 4LDNA 3OWXA 2DUJA 1Y3BE 1PL6A 2IDZA 1JGTA 3I2KA 4EPVA 3M4IA 3EVGA 4UZEA 5LQCA 2C4VA 1JMVA 3W5VA 5KOYA 2FQWA 3WIOA 2UZIR 5EHXA 3OP4A 1GLGA 3RVRA 4MR7A 3UMCA 2Q28A 5AK6A 2W8ZA 4XFKA 3EIHA 9ATCA 1Q7BA 4BO3A 1OASA 3CM0A 1DPGA 4J0IA 3ZD7A 5F3RA 2RDIA 1JXMA 3G2QA 2RB5A 3O8OB 2XT9A 421PA 1NG9A 4FFPA 4QPDA 5BUSA 1DXQA 1XYYA 4C4AA 2N42A 4RWZA 3VZRA 4JBGA 2X0NA 1W5FA 2WSSD 4LQLA 2W8KA 1ZLYA 3HYRA 2WTEA 4ICIA 3PYLA 2IYOA 2X4LA 3D7MA 1BDJA 3LC2O 2ZYAA 4TTIA 3IXLA 2H1HA 3P5BA 4DSZA 3B8HA 4M54A 4GMKA 1N78A 2H92A 1PN3A 1JLHA 3IEKA 3ZDEA 3PSHA 2HF9A 1HDXA 4HAUA 2B5VA 1NUPA 2F3TA 4TN1A 1SCUB 3PX2A 3D0OA 5ICFA 4PS0A 1NN0A 4UCTA 2J0QA 2ZT5A 4XYLA 3ZS8A 2OPHA 4IH9A 3GQCA 2OE2A 5E8RA 3NGDA 2IZOA 4HDCA 3N9IA 5ERYA 4FNOA 4KQEA 1YZYA 2P2GA 2C82A 5A2GA 4GKVA 3N2YA 2IYVA 2EBHX 2B1IA 3KKKA 5EL0A 3ELBA 4GX0A 2ECQA 1MA0A 4G5FA 1SAYA 1JFSA 3IOBA 1L4GA 1XGKA 2P9TA 4O02B 4C20A 1XEAA 4BO0A 1E2LA 5L53A 2WZBA 4UDNA 1VM6A 2R9VA 3DYIA 5FWYA 1X7DA 4BOYA 4IG4A 2VDWB 5FLXA 3O8CA 3PFGA 5AESA 1TB4A 2DULA 5DKFA 1GNQA 4GT1A 5BWMA 4A1FA 2C8KA 1DSSG 2IOHA 2C9BA 2OZVA 1KEVA 2GPAA 2J6BA 3GDGA 3O8BA 4I4CA 4MVYA 1Z5UA 4RU9A 2XYVA 4ZTZB 1BFDA 2FV8A 3ZWAA 3AR3A 4GAEA 4IIDA 2QUIA 5GMOA 2FSVA 2ZI9A 4IQ8A 4P4SA 1OAKA 5CRIA 1Z16A 1VGRA 2JFHA 4I99A 1W59A 4CTJA 2IH4A 4E94A 4YJHA 4EX7A 5J4VA 4B85A 3RVMA 5LXTA 4Z3KA 3IQXA 3VDXA 3ZHTA 4BCCA 2HSZA 4I0WB 2P5UA 2WICA 1OZAA 2QUBA 3RCBA 2GBLC 1GEGA 2XE7A 3LMLA 2QUKA 3C98A 3BCHA 5FQNA 2B92A 1PR3A 2F59A 5K3WA 1KK1A 5HPYB 3P9SA 4CV3A 3SGLA 2RKOA 2W6ZA 3KFLA 3KWFA 4AYWA 4H1WA 3C3WA 3R7FA 1J2YA 3IUSA 3D3KA 1Z2CA 3KYHC 4N1AA 2F3SA 3OHBA 3UOAB 3VR6D 1LBEA 3ABOB 1GKIA 2AXQA 1XQ9A 3F6CA 3V2GA 1OLOA 1XNHA 4E5SA 3GJXC 5EIWA 2CVQA 1K6EA 4ED3A 5A9SB 2ZR7A 3GELA 2YINC 1KUTA 3NORA 1BJRE 3L2OB 5DYNA 4CEIA 1ECPA 1V39A 1H2AS 5K2MA 1M1YB 4PN3A 2B0CA 5BOSB 4A8JC 2QVGA 1DBQA 1E0AA 1U8AA 4DQXA 1K8YB 2FEXA 2VLBA 1AO3A 3DAFA 3AFNA 3S4YA 4WXYB 2PZJA 4V3BA 3F6SA 1ZVVA 3BKWA 4TTTS 5A02A 3OCXA 4CR8A 1NXPA 3RUCA 3T95A 2XVXA 3ABQB 5EWJA 3V5NA 4RXMA 4CCYA 1T5BA 1CF2O 2MJLA 4N5NA 3T7EA 4RH0A 3V2UA 2A67A 2O2DA 4E2ZA 3NX4A 1IN8A 2CW5A 4NG4A 4V02A 4HDMB 4BN0A 3KXDA 2PEYA 2ZB4A 1LJ8A 1SK9A 4YRLA 1ZRHA 4BATA 4EUEA 1GVNB 1Y48E 2HO4A 3UK0A 1KEPA 2ZWOA 4QDKA 2VATA 1P72A 2IS1A 1Z2AA 1LD3A 1Y6QA 4PZUA 1NUHA 2RK4A 1REQB 3P4XA 5KJCA 4GMXA 4RPHA 1BWPA 3EISA 2GHRA 1R50A 1W44A 3P8ZA 4I5EA 2EIHA 1XJ0A 1XZIA 3B1ZA 2JH8A 3CT4A 5DLEA 4ECAA 2NUBA 5M04A 1VPVA 5C4GB 1UAGA 4G97A 2OV3A 4NONA 3QJGA 2G5GX 4GQBA 1M5RA 1IB6A 2WIBA 1LCIA 2QYSA 3KOYA 5HZMA 1YQXA 5KSWB 1X42A 3C43A 4OMCA 1TK3A 2WFAA 3KHGA 1OX4A 3LA8A 2QBYA 3SDBA 2BFCB 1W85A 3ICOA 1YL7A 5KNBH 2CXQA 1XRSB 3HP4A 4DY6A 1P5HA 3K4HA 3B3JA 1K92A 4A73A 1N92A 2GPBA 1RJQA 4FMDF 1N4AA 4INPA 4MS3B 4K86A 1GDHA 5KFDA 2Z2ZA 1I7DA 1Y6RA 3CR3C 4FILA 3ZBTA 4R2JA 3ROFA 2XMCA 3F98A 3R6LA 4B80A 3WO0A 4QDTA 3HBFA 4KCGA 4LH7A 4ED1A 4NULA 2Q4TA 4L8VA 3U9LA 3ICWA 4L73A 3REFA 4AX8A 1HSZA 2XWBF 1P0IA 5FA8A 4PYQA 3VDMA 2VHTA 1VJCA 5A6SB 4NQRA 1S8OA 3U44A 5GTDA 1KMNA 4XM0A 5FNVB 4KBFA 3DTVD 3BD7A 3ER8A 3DMRA 4O08A 4XB6B 1N5DA 5J43A 3KT8A 3C4JA 1K89A 3AF1A 3EN0A 1N56A 2QRZA 5ADVA 1Y1RA 3MXOA 1L2TA 4FVTA 4MRNA 2QP4A 1RWNA 4LPSA 1W2HA 1GARA 3L02A 5DI9A 1P2GA 3TX2A 4HMQA 4C01A 3N6VA 2XUHA 3PHJA 4Q7JB 3ZNPA 2WT9A 3VPAA 1SKMA 3BRCA 2J67A 3V32A 3G0HA 3R8CA 3TY9A 2Q9AA 2EBUA 4OK5A 5FKJA 3FD8A 1T5IA 1T6BY 1JEOA 4OYYA 3U26A 3ZCTA 4RUKA 4C76A 4TUYF 1R12A 3EQ8A 3Q9LA 3NVMB 5EG5A 4DCUA 2V9ZA 1FYEA 1U2GA 1QX4A 2Y4OA 4KVZA 4JUCA 4RQTA 1RWOA 5JUMA 2FGKA 3TW8B 1TIPA 4NU5A 1KTIA 1VBHA 4LNUB 1NDHA 4Q05A 4ZCIA 3PNKA 1YS4A 3Q9NA 3ER6A 4EI7A 5DXJA 3WWIA 3N6RA 5G0TA 1O94A 1F8UA 3BGSA 1ZOLA 3PWZA 1XE3A 4CCAA 1Y3DE 2Z09A 4QLAA 4X41A 4H3VA 1YVRA 3BZBA 2QRJA 4X8HA 4DY4A 3L4JA 2A7QA 1MABB 3DMDA 1DJLA 4REQB 2OGTA 1XL1A 1PTJC 5EEGA 1N2ZA 4JVNA 1QAMA 4HXYA 4OXNA 4GNRA 4E51A 1NM5A 4BVAA 2OHGA 2WKRA 1FLVA 2XD4A 4AO6A 2P1RA 5FUYA 2BGWA 2AGOA 2Z04A 4LJAA 3KWLA 2HAEA 1DRKA 2BDEA 1XV5A 3MWDA 2UVWA 3G02A 5AK5A 1JR2A 3RBZA 4M7PA 4WK4B 1M1NA 2C97A 2M98A 2G88A 5LQMA 1AKRA 4ZYUA 3VI3B 1GAJA 1CUHA 3RO7A 3HFGA 3CVZA 1RZVA 1DDOA 3ZWQA 4UCXA 3H4DA 1MLDA 3JD4A 3WYAA 5KFCA 1T5OA 2R8XA 3H42B 1ITZA 4X1YA 3H04A 1MO5A 1ZH0A 1LDYA 2VH1A 3NFRA 3HYTA 2UZ4A 3L41A 5JZ9A 3AY3A 1JJBA 3F74A 4WY8A 5IMBA 5CX4A 3SC4A 5DN6D 1NFQA 3AKDA 3HH8A 4A2AA 1JAIA 2VYCA 3ZI7A 3N0RA 3FPCA 1JPNA 5D3ZA 3VU9B 1I2CA 2BZ0A 1GLVA 1IU9A 1XELA 5EJMA 1ICIA 5CJJA 4ZREA 1I9CA 3H3XA 3GPLA 1MX5A 2FDXA 2QW8A 2BH9A 2P79A 1S2MA 3H1AA 1XLWA 3ZE0B 1AKNA 3EXFB 1TPYA 1NJ5A 5AKLA 4F3YA 4H0CA 1AB6A 2I3AA 1EKXA 3RIGA 3PFBA 3PEYA 2WD7B 4KH1A 3ES9A 5KG0A 4PBSA 3DBHA 3L6EA 1XPJA 1PZFA 2XADA 2P2DA 5DIZA 2HVQA 5FEMA 1OU4A 3RWOA 5AMXA 1K0UA 3I09A 4INJA 1AB5A 3E2MA 2ZRQA 1WXQA 3L0BA 5AW4A 3OCUA 3ZV5A 4MWTA 4FYXA 1G8GA 3IP6A 2O06A 1A88A 3E5HA 1Q6ZA 1PJ3A 3O4JA 1RI3A 1CK4A 3MILA 4BWVA 3GFTA 1U9CA 5K3FA 4OMUA 4XOUA 5KOHB 3R74A 3COYA 1RHKA 2VTKA 1NQVA 4R7GA 1VCMA 3AQ4A 3SS8A 4N03A 2I4NA 2HREA 4UM9B 2ZROA 2RDMA 4EUKA 2Z2JA 2V4QA 4LI3X 4MP3A 1SUPA 5LDGA 4B6RA 3ZHQA 1TMOA 5BXYA 1Z63A 3ZD6A 3OZ7A 1BQEA 3DOIA 4TWAA 2QT0A 3S5JA 3HSKA 1EJBA 1K6JA 4EGAA 4OXKA 3JYHA 4PIMA 3I2GA 1LVHA 4WXHA 4RJJA 1XNGA 1E2JA 1RP7A 4XD7A 3T3IA 3ROTA 4DIKA 4ROTA 2ILVA 4X54A 2D2XA 3PFNA 5HR5A 1F20A 1MXHA 3EA0A 4YT8A 2R1TB 1KVUA 4EL0A 3PNYA 1T2CA 1A50B 5ITZA 1D1TA 1K5DA 5K0LA 5LB4A 2HK8A 2PSDA 4P4GA 1GG9A 3P9IA 3GWGA 1UPUA 4EO7A 4ZU3A 4F91B 1C9EA 1RHJA 4YR9A 4RFSB 4AJOA 3TVTA 1QHEA 4Y6LA 4ZZ1A 3V8VA 2NQ8A 1T1RA 2ZRIA 4EPWA 5FWXA 4MCAA 2QTVB 4MYHA 1W1UA 3OQIA 3NDBB 5DNCA 1PDWA 3TQSA 1XTZA 2QR3A 2DLDA 3DGFC 4GZ6A 4B4VA 4IVPA 5DYGA 5FX2A 4AECA 5E7IA 4EECA 2YDXA 2L2QA 5B3JA 2P1DA 5IF3A 4RZIA 4DUYH 1YXMA 3ZU4A 2ASDA 4ECVA 1RWPA 2FWBA 3NOXA 5DP2A 1BH2A 5CCXA 2PE5A 2ZTHA 4HC4A 1PD0A 2H57A 4TYYA 4UEOA 3DC2A 5LC1A 1YR9A 4CKEB 3JZIA 4L76A 1FF9A 2HWYA 1H2BA 3EYWA 2WTXA 1FCJA 2R2AA 4LWPA 3O3MB 1A82A 1RYMA 4Q8EA 2QYTA 3IT1A 4ND5A 2ZYGA 1X39A 2AS0A 4HP8A 3N2KA 3HUEA 3N05A 2HNKA 2WIJA 3WGUA 1D2AA 3D7SA 3IEPA 2JFXA 3L8ZA 5MFPA 2R87A 1D2GA 1U7PA 1Q0SA 1WAMA 2CKMA 4AO7A 5IJWA 3BA6A 4EAAA 4BFYA 2FK1A 2XMZA 2AQKA 2HA3A 3QVGB 3A1WA 3HSSA 3PIIA 1IEQA 4QPPA 1MNAA 4ZYVA 4B6QA 5FR9A 2V7PA 1SBCA 3HUUA 4N0QA 4D99A 2F9FA 2DKFA 2AGPA 4UE3S 1BU8A 3V2HA 1BCRB 1ILWA 3GCWA 4DKXA 4KB5A 1CIVA 3VKGA 1BA2A 1Q84A 1H3EA 1TMKA 2DPGA 1TQ4A 4ARBA 5JJLA 3PUIA 4KI7A 2LIPA 4Y6SA 4Y1FA 3USES 3D8HA 2FFHA 2VXOA 1XR3A 2A14A 4XYBA 3QELB 1AJEA 4Q7KA 4D92A 1AF7A 1X7XB 5AKJA 1BGXT 2IOFA 3G59A 3ND7A 4UVHA 1YA4A 2ZKIA 4Q6BA 2H1RA 3MJDA 4UHFA 2M6RA 3KTFA 3P19A 2ISQA 2V6GA 4HHEA 2HU2A 4CIVA 1BMTA 2FR8A 4TS1A 4N3NA 1QF7A 4M0UA 4XLZA 4O4JB 1VE5A 1RK5A 1DELA 5L51A 4TQGA 1JKMA 5EYPA 4LCEA 4PTZA 2VZ0A 1R0BA 2PKQO 2Y27A 1F6DA 1G19A 1SA0A 1MRNA 3O3NB 1CDEA 2YC2C 4Q1FA 3GMIA 1TQDA 5J1SB 4DQUA 3N2GB 4DWVA 4MV5A 1THMA 4GF5A 1YASA 1XMIA 2H06A 2ZPUA 4OXRA 2LWIA 2R4TA 4DCGA 3OT4A 3SCZA 1A97A 3R9WA 2ZETA 3W8RA 3DEFA 1HLDA 2XCQA 3UCFA 1VHQA 3KSRA 5AI9A 5A0FA 1UMBB 4K6NA 1OR8A 3O1HB 4O2BB 3RNOA 1FP4B 1I94B 2Q0SA 4B81A 2Q49A 3UA3A 1E3DA 3EFEA 2WJGA 3AF4A 1E9FA 4NRDA 5IHPA 3E23A 5DNAA 3SXUA 1QH1B 2EEZA 3D4IA 4C4PA 2AN3A 3FOBA 1PEKE 2NZYA 2GSDA 5TQ0A 5A3QA 3M82A 2O7VA 4YMVA 2EARA 4DMRA 3G8CA 2W2QA 3JALA 2C3OA 4F3KA 4XH9B 1PG2A 1V7CA 2H2IA 1G55A 3QKIA 4M9CA 4B3FX 2QM0A 2DJ5A 3BAZA 3M89A 1P3Y1 5I9TA 4QU0A 3LBAA 5BYAA 1PZGA 1XCMA 1LVUA 2IKSA 4WNIA 3SNHA 1ABBA 4Y2HA 4ZCLA 1M0WA 1T8WA 5TS3A 1FQWA 3JQDA 2YY7A 4RVCA 1R0XA 1OWPA 2OCAA 1CE8A 4DGQA 5C18A 1P4HA 4NBSA 5J9FA 4OQDA 4PF1A 5JSHA 3AVOA 4A3DG 1Z4KA 1DS6A 4N3AA 1MOZA 2PZ8A 3VYUB 5HMLA 4CPDA 3O8RA 4E4RA 1TZBA 4OFWA 3C6KA 2EP5A 4EBBA 4AZTA 1KF0A 3OIYA 5CW1A 3PK0A 4FTWA 4WFQA 2FETA 3DD5A 5T14A 3LDGA 4DWJA 1V11B 2F43A 3K6KA 4I5DA 4A0FA 4H15A 1VJDA 3IPLA 5F76A 1QNLA 3AO0B 7YASA 1SC9A 5JXIA 1JLSA 2P30A 1OQAA 3IAXA 4JYMA 3RLFA 4J0CA 2A1TS 4MGYR 1ZN9A 4D41A 3QEOA 4O3OA 2OQ2A 1HF3A 3U49A 4LJ4A 2YL2A 2HVSA 2NYVA 2IS6A 1C5KA 2R1VB 1NPDA 2OYRA 3DOUA 4FZ3A 1KI2A 1KYZA 2ZWPA 3RK0A 2D59A 3BXZA 2OC9A 4U6PA 3IVAA 3NUQA 3U17A 1UOOA 4HGYA 1EIWA 1PKEA 1T35A 3NBYC 5AUOB 3DVAB 4ED0A 3PSAA 4Q4DA 3A04A 1R8JA 4ZZIA 4QPZA 4L27A 1G291 3LOQA 4CF7A 1EGQA 4BB0A 4Q1AA 5EP1A 4ECWA 2YWHA 1F51E 3DO5A 4HZUB 5KZMB 1JIQA 4ER7A 3N86A 1QTNA 2V97A 2RKWA 3D4LA 4UXJA 3HV2A 3LI2A 3ZDDA 3UAXA 2IP1A 3QVJA 5AI6A 5M34A 1ZCBA 4UFZA 4K6KA 5GVSA 3E9EA 5JFGA 4H4DA 4A91A 4YMWA 1TCBA 1U2SA 4OQQA 3K9GA 3LQ2A 2E5LB 1UM9B 5SYMA 1Z6AA 3V6LA 1DWQA 4PRZA 2PLFA 1C41A 3MWKA 2CCKA 1JE1A 3GLKA 2QYZA 1NNEA 3DAYA 5E6SB 1XQWA 4OLHA 2ERCA 2QTGA 4TTJA 2EWVA 5G4LA 5BMOA 3COJA 3TBHA 1EDZA 2PVSA 3A14A 1EXMA 1SVNA 3AESA 2W9BA 2VA3A 3F73A 3BFPA 1WCIB 5A2QA 4Q4JB 1BKDR 1DDIA 3VTFA 2FRDA 3ENKA 2ID8A 2FMFA 1UKEA 4DVGA 5F7ZA 5HM6A 4AMUA 2P40A 1U8UA 3V4SA 4AZ3B 1NNI1 3JPYA 1FPMA 2VPQA 3IALA 4XEUA 4MW9A 2H1WA 2Q8QA 2QUHA 4URVR 2ZULA 1JHMA 1N0WA 4CU2A 3ZU5A 3KQKA 1U0TA 1SBQA 5FLXW 2CFRA 4P0TA 3FJOA 4PCLA 5FCDA 1T1SA 3ZEAA 1ISRA 1N0IA 4PO9A 3T0GA 2D5BA 4D6PA 2O07A 3W2EA 4CM4B 1GEEA 3IV9A 2W6NA 1ISSA 5B1EA 2NXJA 2TMYA 2QD4A 1OX6A 4R54A 1DQPA 1WNTA 4BNNA 4Y2YA 1GXSA 2HMVA 3OD1A 2P9HA 2EJ0A 3VR1A 1DARA 1SOWA 3GGJA 3VZSA 4DIBA 4HFMA 3HVUA 4JR0A 1FSGA 2YQ4A 1YUBA 1VAJA 1M1ZA 2YJNA 3STTA 4JQCA 5KG6A 5I7SA 2VNKA 1NP3A 1KAQA 4A93G 1SIUA 1Y8QA 2PYDA 3BKXA 2HL6A 5EJ6A 4KFTA 4R3WA 4KBYA 4EBCA 1J70A 4BHTA 4FWBA 3C1UA 2F1KA 2CLKB 1UBHS 3BJZA 3SI7A 1PWYE 1X8LA 2PHZA 3MINA 2IHUA 4M1ZA 1J2RA 3ADOA 3DUFB 2WTFA 4ZOQI 3V4PB 2NOAA 3CO0S 4G1CA 3GTLA 4IGIA 1L5MA 4XAQA 3ETLA 4TXHA 4F46A 2D1YA 1W47A 3AV0B 1FKAH 2X5JO 8GPBA 1NAIA 3G68A 4UVGA 2UUAB 4V24A 2H4YA 4BKOA 3DYBA 3I1YA 3DAHA 3M9OB 4IYJA 1ADCA 1MPXA 3I6QA 4CEJB 2NQ2C 1YVDA 3H84A 3AJRA 5BNZA 1RAGA 1NQAO 3TNJA 2YS6A 3ZIDA 1VLZA 4MIYA 4IOKA 5CVEA 5F9HA 1L1FA 1BQ3A 1I36A 1XCPA 1A9YA 3ZGZA 4KQ1A 3FYHA 2W2VA 5CA1B 1S2LA 3RVPA 2AE1A 1YQTA 4N8DA 1LNSA 2D2IA 4JKOA 5IJ0B 4NEHB 3OFKA 4IFEA 3HKZE 2GH1A 1FOEB 3NC1C 2X7HA 3EDMA 1GPMA 1N5MA 5IJXA 3QOFA 5KNCD 3CNLA 1L5FA 1XKLA 4IQGA 4HQOA 3P0IA 2YWVA 2QZSA 4AZSA 2ZUDA 5JRDS 2Z2YA 3WAKA 1SCDA 1FUYB 1NLUA 4LFBB 3VZCA 3LKDA 4G9BA 1PGJA 1Z6TA 4G0ZA 4MVWA 1HETA 4H7EA 4N54A 3EPRA 2YHIB 4DLWA 2HU8A 5HBRB 3HMQA 5AW3A 2IHBA 1ZI6A 4DWWA 1W8IA 4BNGA 5LOVB 4RSMA 4UOEA 3WHPA 3KEOA 4JN6B 1IZ9A 1ZDMA 2FZWA 4B76A 1Z37A 1UMDA 4E4TA 2E5LH 3UF0A 3VX4A 3TLZA 1PQ4A 3DBRB 1G63A 3HB4X 1UPCA 1BTOA 1Z8HA 4BQNA 3IMEA 1OE0A 1PT7A 2REOA 4IS2A 4L0QA 5CNMA 1MJGA 5CFPA 3R7LA 4UTOA 2C4UA 4MUNA 4M1SA 5JZBA 3HG7A 1IRXA 1MT3A 4H60A 2P2ZA 3N2LA 2WHXA 1EEHA 1N2CB 3QLJA 1RJGA 2KW5A 5HEKA 3NV7A 4OD0A 1SZCA 2C77A 2DFVA 4HRVA 2O1XA 1YVUA 5T5QA 4H7DA 1ODIA 2HTEA 1X1RA 1XP5A 3IOYA 3MS4A 1ZGCA 1S10A 3ZJVA 4YPVA 4UNNA 1TFRA 1W5EA 3NHSA 3W4KA 2JA8G 1T8RA 1ZJJA 1E2GA 3IMGA 5CXSA 1CZLA 5A3JA 1XU9A 2IX3A 3FPGA 2FEMA 4ZARA 3PC8A 2G1KA 1DXHA 2WE8A 1MAVA 3SF8A 4KYUA 1SD2A 3DFUA 4G65A 4G63A 1Y14B 3BTVA 1CUZA 2WIDA 1F0NA 5KFSA 1E2NA 3FMPB 4BNTA 2A9QA 1HRKA 2ZE5A 2LGJA 2G5TA 3FTQA 2I6TA 4I9HA 2V7XA 4GHWA 4TUYA 2ZYWX 2P75A 4UCUA 5IAJA 1ZH8A 5DGHA 4MO2A 5DSZA 3RWBA 1B14A 4HDQB 4FMBB 5C7OO 4RMJA 3PHCA 4I5FA 1XLTA 4QQRA 4JAVC 2P6NA 4I3GA 2RHCA 3VZBA 1HFKA 2HHJA 3TOSA 2YWGA 1R6UA 3VR2A 1RCFA 3DAAA 3I42A 1DCMA 5FTLA 2QMZA 3K9FC 2W00A 3GDEA 3P26A 2F8MA 3EMKA 3KEFA 4B47A 1N75A 1V96A 1JB9A 2ZE7A 3FN4A 3E3OA 4OREX 4LC9A 2Z2KA 2AFHA 3FGZA 5TJHA 3QXXA 2QOEA 1ZN7A 2UUAH 4RS3A 4YT4A 1TU4A 4H1VA 2FWMX 4HN9A 5DCLA 1QK5A 2NGRA 2PT6A 1RZUA 4DLKA 2FSVC 4TVOA 4BGEA 3LL7A 1PLLA 3ZWMA 3CRVA 2X2EA 4I4TF 4BWYA 5HIJA 5BSHA 4BEWA 4JOQA 1TEXA 3FBGA 1U8CB 3AL3A 3C14C 1GCOA 5BYBA 1A5TA 3EAFA 1ETUA 3HO6A 4TX1A 1E7MA 2WAQE 1JG1A 4QWBA 2ZBPA 2NSYA 4X6UA 2PX5A 5HQTA 4KO1S 3GLFB 4UXHA 3GG2A 1OW3B 2FPOA 4PZLA 3EGDB 2WJIA 4KKVA 3CLVA 4IDOA 4LFBH 4B3DA 2G63A 4PZYA 2QD5A 4ZGWA 4UU0A 3N5KA 3DP7A 3QG1A 5CXQA 1WEKA 2H5JA 3TK1A 2JCXA 4FPXA 5T3UA 4A26A 3ONEA 4LMYA 2H65A 3WFZA 3QFSA 5H7XA 3ZS9A 2QLNA 3QEMB 3QI7A 4R4JA 2DHRA 1NQTA 3HE3A 2X8BA 3P9QA 4V39A 3D43A 4GZMA 5AW2A 1T0IA 3ZGYA 2ZFUA 3NUAA 3PUJA 4HKTA 3RGGA 3PC3A 4FFWA 2ETVA 2OFOA 3GLGB 3PXGA 4LJ7A 4FMCB 1FDWA 2GXAA 5EY5B 1T2FA 3STUA 5ADHA 3KUCA 5B6JA 5DOZA 3UJ9A 4MW5A 4GLWA 1NYRA 5EQTA 2CEKA 4FBLA 1NYTA 3RYIA 3VSCA 3U3ZA 1CLUA 3HY4A 2CLMB 3HOUG 2WUEA 2FW9A 3TW4A 2P9GA 3HR4A 1HLPA 3QWUA 4CE5A 3WLTA 1Q12A 5D86A 3TB6A 2VJOA 3Q5EA 3RIHA 4IDCA 3CX3A 1JHRA 2ZWVA 4XRGA 3ZDQA 3BJRA 2EQBA 3RREA 4ZYWA 3GEHA 4E0BA 3KKMA 3ND5A 3B3QA 4GECA 3FYCA 1A8HA 3HY3A 3AQIA 1V5IA 1JIUA 1SWWA 2J3QA 1I80A 2ETXA 3G2PA 5IDYA 4KSCA 5BNTA 2IEBA 5FBLB 2YBEA 1IDN1 1SOVA 4L5AA 1R0RE 1DJMA 3ASUA 3P7MA 3M6VA 5DLYA 1UKCA 3G5MA 3H2ZA 1XVIA 2J46A 3MCWA 4EUSA 3TQTA 2QPTA 2ORIA 3Q3CA 1IYZA 2GEVA 2C5EA 3RYCB 4F1WA 3C3BA 3NC0B 2O2GA 5CE8A 5BWCA 3CVUA 1EINA 1I1KA 1J23A 1I2AA 2XYQA 2Q3HA 2J0UB 4UTPA 3EGCA 3L1KA 1KNQA 3AEQB 2NUTA 4BJ5A 1RBZA 1S6YA 5FLMG 5IDWA 2PMDA 1G5IA 3FKIG 2O5CA 3NH9A 1W0KA 2VT7A 3QKRB 5CA0F 1X9HA 1H3NA 2ZI7A 3CIFA 2QLMA 1GDTA 1L4BA 1GTSA 4OKNA 3U54A 4G84A 3R5FA 1I4WA 3M34A 1ZZGA 3PC2A 4JJAA 1GZDA 1D0IA 4NX2A 4ZQCB 4XPIB 1XTIA 3PQ7A 2WA1A 1NIPA 2O8FB 2FPGA 1EUCB 1I14A 2VP0A 1WJGA 4RGBA 3VOTA 3WYBA 2W0SA 3I5AA 3HCRA 5CVCA 3RJZA 4DQVA 1OFHA 4CETA 2HXSA 1E6LA 4KGXA 3P20A 2OV4A 1XVUA 4DHWA 3G0IA 4IGKA 1KMCA 4JQZA 3LFUA 3TPZA 1AY0A 4Y6QA 3RS7A 3BMNB 3KHKA 1TA8A 1OC4A 3T1QA 2GD1O 1EUDB 4L51A 4L28A 4IUYA 1Z36A 1GZ3A 2WHRA 1KOJA 1WXIA 3IXQA 3QI2A 1E6KA 3EY4A 1RXCA 1Z7GA 4R8MA 5BMVB 4CHGA 3KSUA 2WNSA 4IDHA 3FGNA 1WU7A 4PQEA 1TF7A 3DR3A 5I7OA 1EFRA 4Z7QB 4HD8A 4YK7A 3NWJA 5AJTA 2Y9MB 4COOA 3MGCA 3JSAA 3GW8A 1YBMA 2H1FA 2XF8A 3AR5A 4YP7A 4AK9A 1OLSA 3W8DA 2ZJ6A 3N70A 4WFKA 4I7HA 1M34A 4DMMA 2SKEA 5IEJA 1PJLA 4UCQA 2OA0A 1YONA 5F23A 4I1PA 1PLKA 1O94C 4W1SA 1QKIA 2OVFA 2GZ2A 3OCWA 4FGKA 4QOEA 3K1JA 2PPVA 1M7JA 4BMPB 1Y89A 1R3UA 2JHFA 3WP0A 2XB9A 4U02A 3CZ9A 4R0VA 3JVVA 3A9TA 4J49A 4K6HA 4AYBE 4DAAA 3I2YX 5G1PA 2P2NA 4CZ2A 3V7UA 4TRRA 4BVEA 3UENA 3QZUA 4Z0HO 4QDJA 4RPCA 5JJBA 3THYB 3VGPA 1V43A 3VUFA 1FDIA 4JLMA 1YS9A 4IO1A 3JZFA 2E55A 4NKRA 3SMQA 4FE4A 1QONA 4OATA 2C4NA 2P27A 4KYVA 2I6SA 2IHKA 1I30A 1F0PA 3C5CA 3WNQA 4QX6A 2ZTLA 4CM3A 1XDZA 1QPBA 5BQFA 4KL8S 4NMXB 4HLCA 1KIAA 1RWVA 1UDRA 2R92G 2ZZKA 4OIFA 1CEQA 4YY3B 2AFRA 4JU8A 5K03A 3DFFA 3ENNA 3FCYA 3G88A 2XT0A 3NHKA 3R7AA 1X9NA 1HT1E 4PO8A 4URUR 2TECE 4GH5A 3FZYA 4H7HA 4ZQEA 3D2AA 4V0RA 3TOVA 3F4BA 1DB3A 5JARA 3O4GA 1N36B 3SR4A 4DCMA 4QKQA 2LW7A 2QN3A 2UYOA 5ENZA 3KTMA 3WI7A 3TGLA 2QNRA 2GERA 3JW8A 4OFXA 1E89A 3RRZA 5HUQA 4ZT2A 1GTG1 1CSEE 4YJ2F 5L1KA 5TRTA 5IC4A 2JFWA 3VQTA 1KZHA 3S5UA 5DQHA 1LA2A 2H17A 2NO9A 3P2YA 1NBME 5KFBA 1FSZA 3VHQA 1XWWA 3KLOA 2X76A 2EL7A 2I33A 3BXEA 2Q5OA 5L6MB 1J8YF 3ILXA 4YJKA 3O73A 1M34E 4HWTA 1SEIA 1A3CA 1LTHR 4H08A 1VL2A 2YFQA 3NHFA 5JU6A 2IYRA 3OCCA 2A2ZA 3BULA 3S55A 3UG7A 4MXDA 4YAOA 4R8UA 1SUAA 3COVA 3L0PA 3RM3A 1U7OA 3PIRA 5DVZA 2EGUA 1S0MA 3T5HA 4P5EA 1G2WA 3O31A 3P9KA 4Y2SA 3WIEA 3NHPA 2VHXA 16PKA 1TYAE 2KLHA 1WUIS 3MQFA 1SUIA 3MGGA 2JGMA 1DWPA 3SE0A 4E7PA 1KBZA 2QXTA 1U8YA 1A4UA 3ZHYA 4QYWA 2R11A 3ITNA 4XFJA 1PG5A 2IF0A 2OR3A 5LPNA 3IBGA 4PC6A 4RE5A 1CS0A 3LGSA 2P11A 3CRW1 4URHA 2OLSA 3F3MA 2DSNA 1AQ6A 3SZLA 3L8HA 1DC6A 2NU6B 4MR9B 4HVCA 1QGUA 5KWIA 4CNBA 4X20B 4BNDA 3F5MA 4OXXA 5I5GA 5I6DA 2IEGA 4CG3A 4IYRA 5TVKA 4ZC8A 3VVMA 4K2HA 2JIPA 4HEA1 1ZXXA 3JQ6A 1PGQA 1SG6A 1JBEA 1KU6A 3NETA 4B75A 4AG5A 4AJ9A 2HT1A 1J0CA 1EU1A 2O6HA 5ALRA 2Q6IA 2C3UA 2N1BA 5F7XA 5LBUA 4WOPA 4EITA 2GN8A 4G5RA 3S2SA 3WZMA 2VCHA 3PFHA 4PAMA 2PJUA 5J2UF 4ILEA 1W35A 3QFCA 3N40P 1AKYA 1T34A 3LF1A 3H4IA 3UGQA 2EFDB 3FB4A 3EUFA 1QU2A 1XEWX 5JSUA 2JGRA 4PHHA 4AW9A 4DRYA 4TTPA 2B20A 3IDZA 3D31A 2PMKA 5KOIA 3MOGA 4FYMA 2O8CA 5ER6A 1WTAA 3JPWA 1FVXA 2Q6KA 1KC3A 1N6NA 2BGJA 2OBMA 3PD1A 4I55F 3P2IA 4UKDA 4IRDA 3I2IA 3N2IA 2FMAA 2ET6A 1ZM4A 3GBVA 5BY2A 2HBZA 4NVRA 5FI1B 4ED7A 4MQUA 3PP8A 3VNAA 1HEYA 5TR9A 2DB3A 1L5VA 4HOYA 1RJDA 4AJ4A 4PLHA 3WWPA 4MRMA 1VMAA 2H8GA 4RHYA 4BV8A 1H85A 2I9KA 3EXHB 3QTBA 4J03A 4H2DA 4YY3H 2IBMA 1Y1VG 1M7GA 4AS2A 3W5BA 4LXTA 1TNDA 5KEIA 1AZWA 1BWSA 3U7QB 2JGDA 2V96A 2SKDA 2PN1A 2PL3A 5DHTA 4B35A 2Z9DA 2NT4A 5KBYA 1WQ3A 4WXEA 4Y2XA 4C6SA 1M6YA 5IP9G 4RETA 1EE9A 3UYLA 5C5EA 3MIZA 4AT1A 4BC0A 4ZI7B 2IEDA 4ZEVA 3R3XA 1IYDA 3A6DA 1NVDA 4MA0A 1SUDA 1U28A 1NVBA 1BX0A 1ZH2A 2OORC 1N36H 5ALIA 3H2GA 1B6TA 1EBBA 5DZSA 3A4LA 4MJXA 2AEEA 4AKTA 2EJTA 2DZDA 4MSUA 1PJZA 5DGCA 1XMXA 4CQNA 1Z34A 1JJFA 3BL8A 5HFNA 4Q66C 1EXVA 1M8KA 1OYOA 3MWLA 4BLPA 4DA8A 4ZIRA 3WVNA 2ZREA 4P58A 3NEPX 1GPLA 4ITRC 5FD6A 4LSGA 2FY8A 4RHCA 7AT1A 3VR5H 2OM2A 3GAAA 1V48A 2R8OA 3OZFA 4MW0A 1L7AA 4OLJA 2RHLA 1L5QA 4HY3A 2QPOA 3GNLA 2AUMA 3CCBA 3RYHB 5J4YA 3FPAA 1HDEA 3JVEA 1X7GA 1TTTA 2C35B 4N3BA 4ER0A 3DT9A 3EZ2A 5A2QW 3D59A 1JJAA 2EZTA 1WRBA 2XCTB 2W4QA 2Y1EA 3W6PA 5KTOA 3ISVA 3OKAA 3HXMA 3R9XB 5HCUA 2O8DA 3I6ZA 4S1PA 4FYYA 3ZZMA 1YK1A 3Q41A 4BTVA 2FR8C 2GZRA 3RVOA 3QBTA 4ZCTA 3WMWA 1U7WA 4YHBA 2HFJA 1SB8A 2W57A 3IRUA 3WOVA 4BO1A 1GAEO 3YASA 4MLPA 2W2KB 3ZUGA 5ECWA 2FRXA 3KFXA 3GT0A 3QU4A 2DFPA 3GT3A 4BVKA 3Q3VA 3Q6NA 1OZHA 5E9AA 4D2IA 2P7IA 4TSKA 3RR2A 3T7RA 2GJAA 5J40A 2QD1A 4EG0A 4EJ0A 4FR0A 4A15A 1A9SA 3TECE 4R51A 2RSLA 3FJYA 1HH4A 3O2QB 3UANA 2E2WA 3VUEA 3NHUA 4LQ4A 4A3FG 1R4AA 4DUYB 1Z0FA 1FVHA 3U7EB 5BSGA 2PV0A 1TVKB 3ANTA 2GPWA 1JEJA 3W4JA 5AW9A 4ITUA 2Y8EA 4YMIA 4X94A 2PTGA 1RZ3A 3GILA 1CW2B 2WRZA 2HGZA 5M3BA 3C8DA 5IULC 3FZNA 1LRKA 1KKLA 4ACBA 3WRYA 4D74A 3URKA 2WSYB 3U7JA 1J8FA 2POQX 3FZQA 4E6NA 1L5ZA 3AUJB 3OE7D 1NF9A 1EE1A 5ALLA 4B7UA 1ZAYA 1Y1LA 3NT4A 4WOBA 4ECUA 4KREA 2JFPA 4MRSA 1H22A 1DUIA 2IYWA 3GRVA 1EG2A 4EFMA 5AXDA 3ON5A 3BQNB 5KYNA 4BQSA 3DV9A 2XUJA 3KU1A 2BFDA 4Q4HA 1F0YA 1WMBA 1LLFA 4LHEA 3RSOA 3KWMA 1R64A 4ESEA 4IFIA 4H16A 4IR9A 2DPXA 3PC6A 1LF5A 3WAJA 3ZE9A 1BSVA 1U7UA 3N8DA 1J00A 1HE5A 2G1UA 3CZMA 2O2ZA 1JYFA 4NNPA 1BH6A 4KR0A 4GUDA 3GZNB 1SOMA 4Y9UA 1BHO1 1F3OA 2BIFA 2AHOA 1QE3A 4TXMA 1MB0A 5FOUA 3VTKA 4ED2A 1SCIA 3BS4A 3NG1A 4I8IA 3TW6A 3FROA 3AONB 3T3PB 1A7UA 3RSFA 3NIBA 1FTYA 1M8GA 3L4BA 4E5PA 4EG5A 4IIBA 2VXBA 4ZVPA 3OLQA 2HR1A 4QECA 4D6XA 4EDHA 1E7SA 5IDVA 1BNCA 4D3XA 3Q10A 3NBXX 2BJVA 3GC6A 3C16C 3HI6A 4ZZ0A 3QUAA 4OHPA 3BK1A 4ZVNA 2H1OA 2FAXA 5DN9A 2PRZA 2FWNA 4PYNA 1NW4A 4G86A 2M1XA 1OY1A 3DCJA 1VP9A 2EERA 4AZWA 4RQBA 1JT2A 3GNSA 2PMBA 3KREA 2R1ZA 4EGCB 3OC0A 1VLVA 3AB7A 4A2QA 4G0QA 4L5JA 4QGHA 1B8VA 4Q3DA 3ZDRA 1D7OA 3UK2A 3P2MA 4RCVA 1P0MA 3RYTC 4YUZA 1V25A 4JHLA 3FKSA 1P5RA 1S8AA 4LY0A 4WHMA 1KAEA 1EB9A 3CNOA 4JNKA 5LZ5A 5HJ2A 2GAOA 4NIMA 2OCBA 4J76A 4ZQBA 5HCIA 2D0OB 4XJXA 3QYAA 2Y1CA 1ESEA 4Z6KA 4YAGA 3G7UA 5CM8B 5D8DA 3P5SA 3WRVA 4TVSA 2PO7A 1CJKC 4EGQA 5IAEA 4J2OA 6REQA 4A16A 3K2BA 2IHYA 3IKJA 2RGNA 1VPLA 1G5RA 3GLUA 2AJCA 4V2UA 3K7EA 2DUNA 5AKZA 4XCVA 1XFDA 4EY5A 3ACCA 3FWKA 2BH2A 5A3VA 1KDRA 2RIPA 6AT1A 2XEDA 3CS3A 4AULA 2J9XB 3GZTB 2CJPA 2DLCX 3HA7A 3PZPA 3G5TA 4EFNA 1P91A 1H0HA 2Z4RA 3X1WA 2F9LA 5AJXA 2ZU0C 2FRDC 2QTLA 1C8BA 2IEIA 3E0QA 3GPCA 5AXAA 3GB8B 4L8GA 1PFQA 3RBEA 3GK3A 1PFGA 4Q9HA 4I4TA 4MLCA 3H7IA 1XKTA 2E5FA 5E25A 4ZN6A 2D5AA 2WTUA 4WBXC 4LJLA 4AUNA 3NBZC 3O93A 1OFGA 4ALJA 1EZZA 4DW8A 3GMSA 4NCHA 3GLIE 5LDDC 1TJ5A 3W2GA 4C7XA 1IH8A 3DW3X 2NW6A 3H2HA 3OUUA 2G17A 2XGOA 2KMLA 2JI6A 4TRMA 1F2VA 1GT91 3KE8A 4XWYA 3PW0A 1NMEA 3SK0A 3L7AA 2YXBA 2SCUB 3DV0B 2HYIC 3GCGA 3EQ7A 3ZHXA 4YBZA 4J1QA 1O94D 3ENVA 4BO2A 1A4XA 1TD1A 4PR0A 1KBQA 4HDKB 5EESA 3ZQ4A 3V8MA 1GIAA 2YOHA 3HCBA 4E03A 2IZ7A 2WQZA 4C08A 2YV4A 3N8IA 1G2IA 4IDAA 3AR4A 3FUVA 1IY1A 4XB2A 3K09A 2PFGA 1XC7A 5FFMA 2D1QA 1VKRA 2V9CA 1VHTA 2D5CA 3T3DA 4M8IA 5EERA 1ZMRA 4B6JA 1Z2PX 1HE8B 3KJIA 2XKKA 2J0VA 1FNBA 3BGIA 4DLUA 1XAIA 3FSJX 4DMHA 3O84A 1Z07A 2YWCA 4CW7A 1VKNA 1KE1A 1DHTA 4JA2A 2JLUA 1DTWB 4W9MC 1NONA 2QN2A 3EE6A 4X00A 3O90A 4K0KB 1LXCA 2J7PA 3HCAA 5A4DA 4HJRA 4UUPA 3IAUA 3REQA 1ZM3A 3LULA 1WB5A 3LZ6A 2SNIE 3V1NA 3CSWA 5HF5A 1ZU5A 3FAZA 1WVGA 2E87A 5HKBA 3IVRA 1P2UA 1OYVA 4YR3A 1T2VA 4LA4A 4GOMD 5IJ9A 1XBTA 2NN3C 3ELUA 4S1TA 3RBDA 2YCLA 2Z1MA 1L1QA 5CT8A 5A4JA 3MUOA 2PSSA 4OLAA 1LY1A 2ZBRA 3H0KA 4ZI3A 2JHCA 1T36A 2FWRA 2GYVA 1E1YA 2GASA 2G9RA 5GJWC 4R0MA 4DMUB 1R0ZA 1G8PA 4F84A 3OQBA 3ZK9A 3DP9A 1GNTA 2WE6A 2UVRA 2IU3A 3CE9A 5DGXA 5JS8A 4D8VA 3SQMA 2K2WA 1V5GA 1T15A 3ECAA 3BDVA 3SQDA 1QG6A 2I1QA 4PYJA 1V8OA 3VNUA 4ACAA 2HF8A 4J7AA 4MPTA 3JZAA 1OXVA 2J08A 3ZGVA 2NUAA 1Q1EA 1VLJA 4QEZA 3ELDA 1AXEA 3BHIA 4NYEA 3VKWA 4NCKA 1U0LA 4PCVA 3ZW8A 2Y05A 5JD3A 3B1KA 3A06A 1JR4A 4ZODA 4QLBA 5CA0A 5DNVA 3CVXA 3WLHA 2HJ9A 4PIVA 1OIWA 4L4SA 1UJMA 2ZCUA 1C9KA 2B1RA 1EFVB 1ECLA 3W7AA 1Z88A 5NLLA 1Y4UA 3OM0A 3OZUA 4CF3A 1XMSA 1ZFNA 4JV2A 2R4QA 4HEHA 1O08A 2IZ6A 3DEHA 2IU0A 3LUPA 4QBFA 4B32A 3Q6MA 3PNSA 4LSXA 3D4NA 2G1JA 2AG6A 4UZFA 1ELOA 2YQ5A 4Z5XA 2NG1A 2C9YA 2A86A 4RIFA 4S35A 3PWTA 4FYWA 3OSZA 3ISTA 1TAQA 3CMMA 3HDJA 5JCZA 4G0WA 3E5MA 2BAGA 4C0WA 4AY3A 5TPWB 5CB4F 4O5OA 4J9LA 1IZZA 4ZZ2A 5DT9A 1PWEA 4CMGA 4XD7D 3PC8C 3IIMA 5FWDA 3UMRA 4WFIA 4XR9A 2PQ2A 2RI6A 1JEQB 2L17A 2E4XA 4BBZA 5LBTA 4OX9B 2EIXA 5HQ3B 2DHCA 3BA9A 2QZJA 2ACVA 1ISJA 3UO8B 1FQKA 2QLLA 5JY1A 4EMUA 1S2IA 3KPYA 1SHZA 3JQAB 5AVJA 3R7SA 3JU3A 1C0EA 3HL0A 2H59A 2O0KA 4ZHSA 1KFJB 5DXAA 3WJ1A 2KE5A 5G40A 4O3PA 3MJCA 1MF7A 1DQYA 4WKCA 2WZQA 1U9IC 1KZYC 3R9IA 5AI0A 4C07A 3HR8A 3FNHA 4A0GA 1HGXA 4E88A 2HCTA 2QAJA 2BQUA 4AZ0A 1PR9A 5FBVB 3VPCA 4X1IB 1S3SA 3RUFA 1Z8NA 4O33A 5CPFA 1XZ8A 1U4NA 2IIBA 4JI7B 4Y67A 3ZY2A 5TARA 4BFVA 2RE8A 3BXFA 2WF7A 2PRIA 3BB3A 4MJ7A 4K0KH 5DASA 3FXAA 3MLBA 3OBIA 3PE6A 5GM1A 5D1HA 1H1LB 4GLBA 4H7KA 1CQJA 1N6IA 1CFZA 1WH2A 1KQ3A 4Q1VA 2ODEA 4QUBA 3KQMA 3K30A 3L6UA 1N5RA 3MS7A 4QA9A 4RO0A 4MV8A 3SSAA 5DHAA 3PC4A 2QMQA 3I9OA 5TPZA 2CT8A 3DA8A 2OD9A 2DQKA 2ORWA 3D3JA 1R6BX 1BD4A 3A1EA 1E8MA 4CL2A 4DA7A 4QXPA 5IBPA 5DG9A 3BSFA 3WDLA 5LD2C 1QTIA 2HK6A 4EEXA 2FCAA 2H4ZA 3HK2A 4BMOB 2OMEA 2YV3A 4QW8A 1CERA 2QY9A 2PYIA 1V9PA 2G0AA 1FU7A 4GR4A 4DR3B 1Q92A 2NSDA 1L5HA 3LHIA 4QYTA 2ODAA 4G4JA 1UBCA 1YQEA 2OILA 1UT8A 3S0JA 3VC1A 1DQZA 3NBFA 1DAOA 4CF5A 3C2QA 3D6TB 5T41A 3I6IA 3B60A 3HKZA 2COUA 4KRGA 4Q8FA 4QQNA 4JSTA 3RB6A 3OIUA 2W6QA 1KH3A 5KVCA 3DMHA 2EX0A 3ZU6A 4UU1A 1RJRA 5L3SB 4ZEWA 4KUGA 4KXLA 3WKDA 3RFUA 2XBMA 3EXIB 1JU3A 4HVLA 5LWHA 2H2HA 1ZRMA 5JCOA 4OU5A 3UQZA 2HA0A 1F4LA 1XRRA 2REBA 1U1DA 3GB9A 1G9TA 3QHQA 4L8LA 1KQOA 1KAOA 2NO7A 1K1EA 3T4UA 3ANYB 1KE2A 1PHRA 5BSWA 2CF6A 4B9AA 1NKVA 4QYIA 5DYYA 1QLHA 5EXSA 4JA0A 2QDXA 3S24A 4QJ5A 2YWFA 1VGQA 2HIHA 1I1NA 3TTVA 1RI4A 2RC6A 2IP2A 1N3BA 3EEQA 4OAPA 4DQ0A 5HUHA 4K81B 2CNWA 3FPEA 1DO8A 3TIGA 4MTCA 4H3KB 1BW9A 3DZDA 4EI2A 1SKBA 3AR6A 1ZMBA 4WERA 2OFPA 1RYZA 3HA5A 5DFAA 2NM0A 2WAXA 1YR7A 1U04A 1DAIA 4GWKA 3SM3A 2HIGA 1JDTA 4ON9A 3KEQA 3WL7A 4I1OA 1NF3A 3NRCA 3VISA 3PD0A 1CP3A 7GPBA 2HO5A 1KEEB 4OX9H 2QG4A 2JLCA 4AS1A 2UVQA 5DAAA 1U0OC 1C8KA 4KNWA 4WN9B 2QM8A 2QZZA 1J9EA 1GZ7A 3ESCA 3SZOA 3PXDA 1NJ8A 4I2NA 5BR1A 2I91A 2CMKA 3KUUA 3ZIUA 3AERA 1C7ZA 4BTLA 3AF6A 2YWDA 2VP3A 3HP1A 4HDAA 2V6FA 3KUXA 5J2UA 1NTRA 5IBQA 1G1MA 5C7LO 3SAJA 5EN4A 3UFXB 2X1MA 5IABA 3TLBA 4JI7H 3QBJA 4COKA 1RJPA 3NM6B 3PHGA 5DGAA 2G40A 1FFGA 1FP2A 2BW0A 3VHXB 2BHTA 2JGKA 5BSFA 5F7JA 1EHIA 2GWRA 4I55A 2XGJA 4MWCA 1X80A 5KFKA 3MWMA 4D4LA 4NESA 3KVNA 4PAOA 1OXXK 1POXA 2P0AA 1XKXA 1DFGA 5JAUA 4G5HA 4UDXX 1RYNA 1BDMA 5KT3A 2G7ZA 1RPTA 1XZQA 2NU9A 1ZQ9A 1B0UA 1GCIA 4NMLA 2IHTA 3OCJA 4EVSA 9ABPA 4GP6A 3RRBA 1WSBA 1OTYA 2MMCA 1C7IA 3MBOA 2B37A 3KT6A 2F4VB 3ED1A 4H3HB 1J20A 1HE4A 4IVNA 3PTZA 3ESXA 4XTCS 4AAYA 2D3TA 3N8NA 1A4RA 2A1UA 1AQIA 2F3PA 1C1DB 4MKIA 1OBCA 1SEVA 3OF5A 2CXPA 3QV2A 1GKLA 1R9NA 4AJEA 2A4MA 1GGHA 4PZ8A 3CW8X 1NP7A 4DR3H 1YQDA 5AOAA 4S1VA 2LR0A 1QVAA 1LPMA 1ZONA 3ROZA 5KC9A 1E0KA 4RS4A 1T9BA 4M1MA 2B9VA 2V7GA 1W73A 4A3KG 1QBKC 3O6VA 3I4LA 2BEWA 3ZV7A 1BFUA 3GA7A 2FE1A 3N5CA 2WAQA 2VI5A 2ARKA 3ADDA 3KP1A 2VJPA 5EUCA 1H65A 4YI3A 1T4DA 4LV5B 3E9MA 3ZD8A 3BRSA 4FBTA 2G77B 5F5NA 5DGDA 2JATA 4HQNA 4MA4A 2OFWA 3HLYA 4QWEA 5FO1A 1RAEA 3BA8A 4NLLA 5LLDA 1VHJA 4QW9A 3AHJA 4PAQA 1C1XA 3D0RA 4ROSA 3G1TA 1MW8X 3E4DA 4N49A 3FNGA 5B57C 3E35A 2ZR9A 1VRVA 4DL2A 1IYEA 3PFWO 1XZGA 5HK8A 2IPMA 1ZN2A 1P2DA 2DUWA 3PVSA 2AI2A 5AM0A 4L02A 4MMXB 3N74A 5KYWA 3WK4A 4RNNA 2C57A 3KB2A 2NU8A 1QGED 2AZXA 1QRAA 1II9A 5K8TA 4G36A 5B7QA 4M9ZA 2I55A 3E27A 3THXB 1KMMA 1EFTA 5EZYF 4YV0A 3CY6A 1UBSB 5L3QA 3LY5A 1QH0A 1B8UA 5HXAA 1ORTA 3IQDB 2FMHA 2DYKA 3VDQA 3KXIA 4QVKA 4JI1B 3F5QA 3K32A 4OIMA 3H1FA 1RC1A 1O95A 1ECBA 2PGIA 4WCVA 2VPSA 5CVDA 1G20E 1LEHA 3CUSA 4ARZA 5FQOA 1EFUA 3O8DA 2C9CA 1WCWA 1L7EA 3M4XA 3DL4A 1DCFA 1TVEA 4F4WA 5ERXA 3KOOA 3IBFA 1SQ0A 5LBIA 4EGJA 3G6YA 1N7HA 3FDZB 2GDZA 3SX2A 3ZVLA 4JJ4A 3O8QA 1Z47A 3O1JC 2XWJI 3TXAA 1XAGA 1YO6A 1NZDA 1I24A 1ZC3A 1EDDA 3EXEB 3H0EA 1Y1SA 1I6LA 2IELA 1SG9A 2DKNA 2VDMB 3GJTA 2EYQA 1FU8A 2NUPA 5KWEA 2HIXA 1J7KA 4BO8A 3S2IA 5KYYA 3HDVA 5CYGA 5J5VA 1ECCA 4UFNA 3I72A 1V5EA 4R7TA 3W2TA 4Q48A 4ZO7A 5DTMA 3UJ7A 4HMOA 5A3SA 4EQ6B 3O4HA 4MPRA 5FUQA 1IN6A 3I39X 4M1TA 2VWPA 4GI3A 2FK2A 3WGLA 5MF6A 4EHHA 1ODTC 3QK7A 3U40A 3UMBA 3PUXA 4Q47A 2PZMA 3SPXA 3IODA 2PX2A 4WZAA 5F2KA 5CT5A 1O97C 1QRTA 2A9FA 4IKEA 2GCOA 2JG3A 2F4VH 2E2IA 1EK2A 2DABA 1QP7A 3UYYA 4KQCA 2QXUA 5A7FA 4DRZA 3IERA 3FUTA 4BY1G 2ZRDA 4O7RA 1UT5A 4M36A 2CVHA 1BRMA 2ZS8A 4CJXA 1U1GA 2M6SA 4L22A 3KQUA 4M22A 2VZLA 1Y5MA 2Z5LA 2JFGA 2BEUA 3UFBA 3KLMX 1KYYA 3W90A 3SVTA 3C3YA 2HNBA 4BWSC 3NEJA 3U1VA 4UHBA 2ESRA 3EG9A 2XUAA 2VG8A 1ILEA 4V0OA 3IP3A 4JJKA 4TLEA 4ZCPA 5KYUB 4ZCQA 3JD2A 3JQ9A 2ZUFA 3P0FA 1NY6A 3L92A 4FKZA 1R7RA 1B2RA 3L8YA 1NASA 4HRYA 1TRKA 4YDSA 2P0EA 1G60A 5FUXA 1QS0A 2W8BA 2PQ0A 3K6RA 4X65B 2CXUA 2LD4A 4CRWB 1OB2A 4XGKA 1WHTB 1VKJA 4YNBA 2QM3A 5THXA 1NVFA 1CRPA 2PZGA 3URMA 3UA4A 5KTPA 2QAIA 3R3VA 1NLZA 3MMPA 2WC1A 3IHLA 5EWMA 1P2SA 4MS1B 1CEYA 5D3MB 1IZ8A 1RWBA 1QHYA 5I7WA 1LC3A 2EEPA 3VKHA 3B9PA 3G13A 4F2HA 5A0VA 3NFYA 3E3NA 4MINA 2HLDA 2I7DA 1XWIA 5FYDA 5I4B