1GLVA

Three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
299
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the glutathione synthetase from Escherichia coli B at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
molecule keywords GLUTATHIONE SYNTHASE
total genus 93
structure length 299
sequence length 303
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1993-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1glvA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1glvA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1glvA01
3RV4A 5C8YF 4FU0A 4YAJB 5LYJF 4MV3A 2R82A 2CNUA 4XZ3B 5BPHA 3KAKA 4EGJA 1UC8A 2DWCA 3VMMA 4WBNF 2YRWA 4FE2A 4FFLA 5IYZF 4TV9F 4O7YA 1C30A 2GPSA 4HNTA 3ETJA 4GGMX 3U54A 2FB9A 4MAMA 1EHIA 3VPDA 1EYZA 1B6RA 3WO0A 4C5AA 3JRWA 4O83A 4QSHA 2GQSA 2VHEA 2NU8B 3G8DA 5HV6A 4Y8VB 1C3OA 1KUTA 1CQJB 4O84A 4O7VA 2OLSA 5CB4F 1Z2OX 2CZGA 2YW2A 5HBRB 3R5XA 4O7LA 3G8CA 1DV1A 4NYEA 4M9CA 2NU7B 2IP4A 2WYOA 3U55A 4EA7A 5J2UF 2YS7A 4EAAA 2YZLA 4HR7A 3MWEA 4M98A 4TUYF 5JQWA 2R7MA 3ORRA 2VPQA 3R9RA 3V4SA 4I55F 4O86A 2XD4A 3TIGA 2FPPB 2I87A 2W71A 4RZQA 2QK4A 2X0SA 4DLKA 2DIKA 4O2AF 2V58A 4IHJF 4YB8B 2Z04A 1CS0A 2W6NA 3JRXA 4MV4A 1CE8A 1BXRA 2ZDGA 1M6VA 1E4EB 3RV3A 4XX0B 1B6SA 3AW8A 1I7NA 4O4JF 4C5CA 5I47A 5KKNB 3HO8A 2R86A 2FPGB 1WR2A 3BSSA 3TW6A 1OBDA 1GSAA 2Z02A 4EA8A 4YJ3F 3LWBA 1AUVA 1ULZA 3U9SA 3KREA 4FFPA 1GLVA 3UFXB 4O7SA 3VPCA 1E4EA 4EA9A 3KAJA 2VQDA 3Q1KA 4FFOA 2V5AA 3N8DA 5H80A 2PBZA 2P0AA 1JKJB 5C1OA 1EUCB 3RFCA 4O81A 3TQTA 1EUDB 2ZDHA 3JZFA 4L1KA 4EG0A 3AX6A 2PVPA 3WO1A 1KJQA 3HB9A 4I4TF 1KBLA 4EABA 5K2MA 3BFPA 2YZGA 2HGSA 2R7KA 2R7NA 5GONF 2R7LA 3MWDA 4ZQIA 4J6EA 1A48A 3BG5A 2VR1A 3N6RA 1GGOA 1GSHA 2R85A 2CNQA 2I8CA 3R23A 4IIJF 4ZI7F 2NUAB 4FFNA 3R5HA 2CNVA 5BMVF 3KALA 4ME6A 2FP4B 1SCUB 4O4LF 4ZHQF 2GQRA 3NUAA 4O7NA 4EGQA 4MV8A 5LP6F 2GLTA 5J2TF 5JH7F 4YAKB 3MJFA 5C1PA 1VBGA 2NU6B 4O4HF 2YL2A 4MV7A 4O2BF 4HQ6A 4FFRA 4O7RA 3ORQA 2QF7A 3GIDA 1Z2PX 3I12A 3WNZA 3BSYA 1OBGA 4I50F 1KC7A 2W6MA 2R87A 1A9XA 4MV6A 4XYLB 4YJ2F 1KJIA 2YRXA 5KX5F 1M0TA 3TIIA 1JLLB 1EZ1A 1GSOA 1VBHA 4MA0A 4E4TA 5FNVF 5JQGF 2C00A 3K5IA 1IOWA 1UC9A 2V59A 1AUXA 4C5BA 1IOVA 1W93A 5CA1F 2NPOA 2W6ZA 5LA6F 3V4ZA 2YS6A 1KJJA 3TINA 2CQYA 2DLNA 3DF7A 4MA5A 3JZIA 4O7TA 5JVLA 2HJWA 3VA7A 4O7ZA 3RUPA 2YYAA 3Q2OA 4MV1A 2YZMA 1KEEA 1JDBB 2XCLA 5DMXA 2GPWA 4DIMA 1PX2A 4MV9A 3QFFA 3HBLA 3K3PA 2FPIB 1I7LA 1KJ9A 1BNCA 1PK8A 3BSWA 3K5HA 2ZDQA 1JDEA 3VPBA 5CAEB 3SE7A 5LOVF 2I80A 4XYMB 4WD3A 2PN1A 3VOTA 1DV2A 4O82A 2NU9B 2R6FA 4M99A 3GLKA 5BPFA 5JVDF 4ZOLF 4IWXA 2W6PA 4FGRA 4O7WA 1CQIB 3OUZA 4O4IF 3E5NA 2J9GA 4YBZB 2R84A 4IWYA 3LP8A 4IZOA 3U9TA 1DIKA 1W96A 1T36A 3R5FA 4HNVA 2DZDA 2YWVA 4M9UA 1M0WA 5LXTF 3ETHA 4HNUA 5EZYF 3OUUA 4FFMA 5D8DA 5CA0F 2YZNA 1VKZA 2W70A 1KJ8A 2SCUB 4TV8F 2W6QA 1Z2NX 2W6OA
chains in the Genus database with same CATH superfamily
1DQNA 1JP7A 1OX4B 1JIUA 2CDRA 2EIHA 4K9SA 3RUEA 1G3UA 4M9SA 3HDYA 3I01M 1P2TA 5FTWA 5HKOA 3HJRA 5FI0B 4ITRC 1DINA 1UDCA 5AW3A 4KI7A 4AZWA 2R5WA 4RFSA 1T15A 4PIMA 3UPTA 1HNXB 1N34B 2WBLC 1UKVY 4EFBA 2YJ3A 1WW8A 3CONA 3PCRB 1LDYA 2Q49A 3DBVO 2HKIA 1TDJA 4DL4A 2GS9A 3FNRA 3GMTA 4GSYA 2PO5A 4N5LA 2R8KA 1FB5A 1E89A 1QIFA 3BFXA 3GRFA 3KKQA 5ISMA 3G13A 1NVKA 1XCGB 1BRMA 2CBZA 3AEQA 3R6DA 1T13A 4KOAA 4F04A 1K8RA 4I08A 3SEQA 1KNQA 3F1KA 3KEQA 1G8JA 1HY3A 4HWKA 4RM3A 1OGYA 1CB7A 1L4FA 1SC4A 4Q7JB 2ONZA 3DZJA 3K3VA 5DV9A 3BTUA 2NSHA 1YUMA 2IHYA 5A71A 3WLMA 5F23A 5BWVA 2AKAB 2PL9A 3DCIA 2Z08A 3WLKX 3D4PA 3EGEA 2JZNA 4CL8A 1Y8CA 2CDCA 1OFUX 2V6JA 2QQGA 3ORSA 2A58A 4BAGA 1VHTA 5CMLA 5EJ2A 3RIGA 4HVLA 3G5LA 3D7KA 1E3SA 3GW8A 3SHVA 1HKHA 1L4BA 1TKAA 2AKEA 5LMUH 1HZZC 2ZJ0A 5CB8A 1ZMTA 4BBPA 5F9HA 3EVFA 4KE6A 3FKSA 4DLTA 1HQCA 1TF2A 5J5CA 4C4RA 1HTWA 4JYAB 4WWHA 2O3RA 4CF6A 1EYZA 1P7YA 1XTPA 3PNOA 5KQRA 4DQVA 1JAHA 3AUKA 4EG4A 1J00A 2O2GA 4KN5A 1A50B 1N92A 4JLPA 2FLKA 3M4XA 1OWTA 3ICPA 4C14A 4YRSA 2HU8A 3AEQB 3QVGB 5C51B 1BDHA 3D4NA 4G5HA 1YL7A 3ZDCA 1V7PC 2PS3A 5EHIA 4AP6A 1RPTA 3G8DA 2G7MC 5FUWA 4CQJA 2KM1A 1T4CA 4H4DA 6AT1A 1L5YA 2PO7A 3R7NA 1E79D 4YPVA 4HYYA 2P4UA 3F90A 5IXJA 3AZQA 2ZCJA 4DTCA 1TCCA 2HREA 2NUPB 1O4VA 1LI7A 3RT7A 3GLRA 3A9VA 1H6DA 4O84A 4BMYA 2Q28A 4YRKA 1V45E 2G63A 2QLTA 1PNVA 1Z2EA 2C2RA 2VJQA 3E15A 4LG1A 1DVRA 3EAFA 3N53A 1XD2B 2BCEA 2PXHA 4N1AA 3L0YA 2EXXA 4X44A 4B6GA 4LI3X 2B7CA 4LY9A 5LLDA 4UVEA 1JQKA 5G4LA 2DWQA 1IBLB 1TO6A 1T9CA 2X7JA 3B8HA 3GNLA 3K0SA 2G83A 2JJ1D 3FZEA 4K5QA 2QJTA 2IP4A 3LCUA 2HGWA 5EZSA 2YNMD 1CHNA 2Q29A 2FUG6 2GUWA 1CU1A 4UHCA 1H9CA 3GAFA 4F4JA 1GGNA 3CUYA 3NYIA 4IKOA 2JD0A 1H22A 4S1VA 4XGKA 2QN7A 5AK3A 1S0MA 3ENZA 2I8AA 4RNNA 5AH0A 5AI5A 3KYDB 4OM8A 4X7RA 2X0FA 3EISA 4RDCA 3AFNA 1AS2A 2HCFA 3FYSA 4U39A 4ZU3A 1IHXA 5F2EA 4MQEA 1UEJA 3SNHA 2J31A 5GMOA 4O86A 2BN4A 1SQ5A 4P7BA 4DMKA 2AGOA 1VPDA 4WN9B 2AI1A 3B13B 3ZZNA 2JEZA 3TQCA 3SBXA 4RZQA 4A73A 5AVTA 1DHTA 2JDIA 4NESA 5B37A 4AYTA 2DIKA 2HM7A 1MIHA 3KSRA 4KIUA 4RZRA 4E5MA 4YB8B 1ECFA 2F67A 2C5HA 3JQRA 5FTKA 5EUQB 4EIWA 4ZYUA 3HSYA 5FUVA 1OWMA 4W8GA 1JEQB 3R3YA 2QTGA 3ZHXA 2Z2JA 5E1BA 3H1TA 5GVSA 1NYLA 2NUTB 3D8RA 3K9LA 3LTEA 1BXRA 4HAOA 5SY6A 1G41A 4M7RA 4NE9A 2WUVA 4OYYA 4AU1A 1T29A 1OXUA 1SC1A 1K7YA 2E4AA 4NCBA 4F56A 1MZPA 1M6VB 2IEZA 2W5UA 2YHUA 3F67A 5KZMB 2AUNA 2VS1A 1I5OA 3UEOA 4TZTA 2C2YA 4O4HB 1F7VA 2JFUA 1J4AA 2NO9A 2O7SA 4MQLA 5HDQA 1RHRA 3HXOA 1LD3A 1SURA 1ZSYA 5DISC 3CNLA 3I58A 3S6JA 3MWEB 3UV6A 3VVLA 4ZDWA 2QNRA 2ONKA 4OQNA 3RARA 3RUIA 1RP1A 2QRPA 4ISCA 1EFUA 5LZ9A 1XD9A 3D1VA 3MQFA 4ZT5A 4YT4A 3BSSA 1RYYA 4K26A 5K0NA 1UUFA 2FR8A 3WMRA 2FEOA 4H17A 3NC0B 4KITB 2Q0QA 4F45A 3OQMA 1E99A 1UBJS 2NU9A 3FPGA 2IUFA 4ML3A 4MWGA 4P7KA 1RQRA 2EKQA 3WLQA 4QLBA 4IUYA 4WVFA 1R66A 4HDAA 2YJTD 3V7WA 3EGOA 4OHFA 1KC3A 2OGWA 2AV6A 4QX6A 1XJ0A 4BRSA 4DSZA 1AH2A 4HX5A 5HZKA 4F1JA 4N41A 1Z0JA 1X2EA 4ATNA 1R4AA 1VSTA 2XE8A 1C7JA 1P0FA 2QLMA 1PCXA 3FSEA 4EL0A 4GL4A 4Q47A 5F33A 1RZ3A 1SBYA 1YB4A 4QPCA 3C14C 1CJMA 3WDLA 4YR9A 3GN2A 5ESDA 4AZ3B 3PGMA 2X0EA 1FPMA 2VQDA 2IYPA 5A0VA 1UBNA 2HQSA 4YP6A 1ZD2P 3VZCA 2NXWA 2J3IA 2ONCA 1M74A 2ZIEA 5LD2B 4D26A 2GJ9A 3PHGA 4YJHA 4OG2A 4W82A 3ZU6A 1LS6A 1W2WB 1YT5A 5FLKA 3TQTA 4TLBA 3RBVA 4PZUA 3D8BA 2A9FA 3WWJA 2YC4C 1YKGA 2VDKB 3LLSA 1WX1A 3JQ7B 3ZLJA 1W8IA 4I6GA 4PIVA 5K4HA 4WASA 3VO2A 3ZWNA 3HA7A 4JQSA 3ZU4A 3RF2A 3PXCX 1TK9A 1Q95A 2VZEA 5TF4A 2PJUA 1JHMA 4Z51A 3NHLA 2DHRA 1KOFA 1BKDR 1MX1A 3CCCA 2R8ZA 1T34A 4FK8A 1NVEA 1O5TA 3HR8A 1K9VF 3PITA 4D8XA 2B9VA 5L6MB 5JQGB 1I32A 3IXMA 5JFGA 1VBMA 4YJFB 3JYOA 3MLAA 1K1EA 4DMFA 1VG9B 2GCIA 4P4TA 2HVSA 4AP9A 3UANA 2AIRA 4X61A 1LBQA 3R77A 3VSDA 1KDYA 1GGKA 1XEWX 3KQVA 4ZQIA 1QG2A 3QBVA 4CIVA 5THKA 4C7VA 4V0LA 3LKZA 3A4TA 3A6ZA 1EDBA 5CVEA 3U17A 5HMLA 4Z53A 4JENA 3WS7A 2BSQA 3I01A 1ZMBA 3AETA 2G88A 4A6PA 1J39A 4IIBA 1DE0A 2OM6A 3FBTA 4Y67A 3BFJA 2H6EA 5C53B 1F2TA 4LC0A 5LMZA 2AUMA 3WKBA 1TI7A 2VCYA 1YB7A 5JSQA 1KEVA 3ELYA 2HBZA 1LRJA 4HHEA 1K83A 1XZCA 2XT6A 4HDCA 2QDKA 4QYIB 2ZFUA 4CF7A 1W19A 3DQZA 3FMGA 3EUFA 3UK0A 1E9DA 3DBLB 2Z43A 3T1YB 2J6BA 1V4YA 5JNVA 3K8ZA 3FPAA 3K0AB 4I4CA 3ZHOA 2CY0A 1N2HA 4CN9A 1C9JA 2I6QA 1FDIA 3NWJA 4JBWA 4MX8A 5TPWA 1Z2AA 2IOFA 3BIFA 3PGLA 2AH5A 4XI9A 5H4GA 4WV3A 2GXUA 3OZEA 4TSRA 2Y4RA 3ONNA 4AO8A 3I9V6 3L9XA 1J0EA 1QR2A 2ZQYA 4YV0A 3QU9A 4PHTA 3AR5A 1JG7A 4ZD6A 4D43A 3N28A 4MR7B 1S2GA 3HOXG 3D8HA 4FOPA 3CX6A 4G6ZA 1JZSA 1YDFA 2GCPA 2AOTB 2VOBA 4NBUA 1EFAA 4NATA 1D7OA 1QIJA 1E9FA 1FNMA 3LVBA 3OQ1A 3BMOB 3OCXA 4YRTA 4ZVPA 5LB4A 4AWAA 4O2BF 2FK1A 4FBUA 3BXOA 1WRVA 4XQEA 3LL4A 2LBPA 3KV1A 2QORA 3NDRA 4WA7A 3MGAA 3SS8A 3BJZA 4GG1A 4TQUS 5EIXA 2OL4A 4HWTA 1NLYA 3VR1A 1QRDA 1T5SA 2LR0A 4QTYA 4EITA 3G2QA 5F9LA 2Z8XA 1SFRA 1RJ9B 3I12A 3O03A 1EVLA 5T4FA 2XC9A 1EHCA 2GZRA 5LIRA 3MCUA 3RFVA 1RADA 4RJLA 4CC5A 1JG4A 3GVXA 1GZ7A 4FP9A 4KXVA 4MV6A 1FFYA 3QLUA 3WRXC 1CIJA 2NZVG 3AF4A 4ENSA 2WJYA 3JQCA 4KK4A 4GRIA 4C7MA 1XTBA 2BJWA 1SVWA 5HCUA 4P3PA 2O3TA 3G7NA 3HRKA 4QHSA 4KQGA 1FYFA 5IUJC 1TWCA 1ZI9A 5K2OA 4NH0A 3HLTA 3UJHA 1TF7A 2IF2A 1ZVJA 3CUVA 3MQ4A 4ED9A 3Q3GE 3TUZC 2JLSA 2XZTA 1XR3A 1ZICA 3NTUA 1ZP6A 2CFSA 5COBA 1M0TA 1MB3A 2QRMA 4G0YA 5F9NA 3X1ZA 3IUYA 4R3NA 2V98A 2IPLA 2F90A 4OHCA 4Z4CA 1IEWA 1LEHA 2D4HA 2F59A 2JPDA 4YMGA 4X85A 4DLYA 3HCRA 3URMA 2E4XA 2XA1A 3DDNA 1P0MA 4J7XA 1GSOA 4N03A 5FNVF 1OMOA 1H69A 1UWKA 4MYTA 5BOVA 3IBGA 4DFDA 3JAKA 1XZPA 1VAJA 1SB8A 1JEYA 2UXDH 3INNA 3HKEB 1BMQA 1ZZGA 4OP1A 1C0LA 1ODJA 3NFYA 5DISB 4A2AA 2GESA 1A9YA 1U90A 1C2YA 3CT4A 4C7OB 3QU5A 4K3VA 2Q2UA 3C48A 4K1LA 3GC6A 3SXPA 4C0WA 1KEEB 1QH8B 2NPOA 3RC9A 3VGPA 1B2LA 1KI8A 1W0CA 3QMVA 3R3WA 4PE5B 4ZYYA 2J48A 5ABPA 2PMWB 4QARA 5SV2A 1C4OA 2C1EA 4Y1RA 2MHCA 1U0JA 4P4SB 1MPTA 1JEEA 5CLGA 1OT3A 4Z99A 2G17A 3L5OA 5I7VA 4CDMA 5LZ4A 2WAQE 5ICEA 4NBKA 2IHZA 1PZGA 4AK9A 1SU4A 1EBFA 2VOJA 2WK1A 3N2YA 4FMDF 5FBZA 1CR2A 5FEUA 2JGNA 4TSFA 5TIIA 1MRZA 1TU4A 3M9LA 3LGAA 4G25A 4O1MA 4G09A 5LC1A 3GTLA 1GV1A 3OZAA 4JOQA 5BSWA 2WPDA 1OYWA 2Q2NA 2ZRJA 3O4VA 3OPXA 1L7OA 2R97A 4XGRA 4RHXA 2F3UA 2VDNB 1IB0A 4PC1A 4MJLA 2ZSJA 3WFZA 2IS1A 2E4UA 4OTZA 4O7ZA 1H4SA 3G82C 3ZYZA 3O47A 4E5VA 2GTIA 1OBOA 1Z63A 2B2XA 5LKAA 1YB6A 4DQUA 4F93B 2J0SA 4Q66C 3DGFC 3RAXA 1OY1A 4X5OA 3TNLA 2FJ0A 5K4AA 5C52B 4RKFA 1J56A 5BSKA 1CF2O 2IJGX 5G0UA 4DDWA 2OBFA 4A1FA 2QUIA 3E05A 1EXVA 3ZZMA 1RLOA 3PNKA 1MZBA 4O2AB 1RBMA 2FZWA 3MS4A 2B3DA 5DMXA 4MTDA 4L6AA 3K4HA 1ZUD1 4NL4H 4ZC1A 4ENWA 4F6RB 1BDMA 1Z22A 1C0EA 3IL2A 2PV0A 3PEVA 10MHA 1P17A 1KEZA 2HYIC 1P33A 1X86B 3PWZA 4MOWA 2FPIB 4D0LB 5HZHA 2YXDA 3V7YA 3IAHA 1ZJWA 3DP9A 4C30A 2J85A 2TS1A 5I60A 2POCA 4BCCA 2CFIA 2WLSA 2UV8A 2ZYVX 3PPVA 1E59A 1GGEA 3ISTA 4F4IA 2JARA 3KAQA 4F46A 4R2KA 2X0RA 5MF6A 4HFJA 2P9YA 2REBA 4WK6A 4TXJA 1JVBA 3JAMA 1T2DA 1EWRA 2DQYA 1E3JA 1EVJA 1C5KA 2O3UA 3OZFA 3QLVC 1RR6A 4MRRA 1O95D 2WINI 4YALA 4UZSA 2B4QA 4J0MA 3BICA 4HUQA 4CM3A 3HKZE 5HGJA 5AESA 5EG5A 2BV3A 2PGLA 2PUHA 4HD8A 4W9RA 2EQBA 1YZVA 2HIHA 4YROA 4O82A 1RKVA 221PA 2H7XA 2ZAOA 1Z37A 3MERA 2NZUG 1WSAA 4IICA 5BWNA 3PR5B 2ZT7A 4KBFA 1R2QA 1YVEI 4V3CA 3CU5A 3QW2A 3VNUA 2C8VA 2HJRA 5HFNA 1NVWQ 2FPXA 1FTGA 1KR5A 3UN1A 4EZIA 3CEMA 4Z7JA 4IWXA 1OAOA 1ZMXA 3DE3X 3EHEA 4LQ4A 4EI9A 3R3UA 4KYTA 2C2OA 4ZI3A 3WA6A 2X3UA 3A25A 2OD7A 1JR3E 3S4YA 1S89A 1XZHA 2R84A 3CKMA 4RNMA 3FOAA 2Q5CA 3INTA 5LZ8A 4M76B 1LFDB 4I1SA 2VPYA 2VA3A 1PLJA 3LUPA 4OREX 4TPKA 3TMKA 3ZBQA 4PZCA 3THWA 3P26A 1L7QA 2VYQA 1E0JA 4B0OA 3I9FA 3NHFA 2PM8A 2ZYAA 5ECGC 4JI7H 1JHZA 2XLCA 3ZTTA 1Z8DA 1S01A 1TFRA 2O8DA 3DE0X 4A5OA 2IELA 4XDYA 2E82A 3PCTA 5K8CA 4P31A 2J3KA 1Z75A 1T3LA 3N2GB 3UK6A 1JR3A 1TMKA 1IM2A 4QRIA 1LY1A 2RGCA 3IEXA 3VU0A 1IG3A 1O94D 1N6OA 1PQ4A 2BDUA 2PX3A 1Q0PA 2QVCA 5H81A 3SJUA 3DFMA 1K7FB 3UWPA 5CD1A 2ZAYA 3NTLA 3WISA 4CKWA 3REOA 1GN9A 4P80A 3MGKA 1CR1A 3OCCA 4YRPA 1WULS 2W48A 1XZBA 1RIFA 2NN3C 2ZTVA 4EQ6B 4F6LA 4PBRA 3SQOA 3WC4A 1WLSA 4H3VA 4NYMR 4I4LA 3EA5A 1USWA 2LKCA 1W87A 2V1UA 2B0CA 4XPIB 1AKTA 3PQ4A 3H1AA 5GIOE 3AIOA 1WF6A 4DPKA 2OQRA 4OYHA 1P3DA 3CO5A 5AQ1A 3FCEA 5AKKA 2IXDA 1U0LA 4NPHA 2AC4A 2CHEA 4E11A 3DAPA 3HFJA 1ZH0A 2VH1A 4J0GA 3Q7PA 4F0JA 2IS2A 1MLDA 4H7KA 3NP7A 2WHQA 4NYIR 4ECVA 3U7EB 3USZA 7AT1A 3IGFA 3AL2A 4FU0A 1EP9A 3UUEA 4CMIA 4KWCA 1AJEA 1Z15A 3TS1A 2PKCA 3L1KA 1SN7A 4LVUA 5C3MA 5FBQB 1MFPA 4MGYR 3SU8A 5JYEA 4BX9A 3VYUB 2D62A 3HGQA 4DCGA 4DQ0A 1GOTA 1AX9A 3CKKA 3PFWO 2I9PA 3PUWA 2PUVA 4M6WA 3VR6D 2GO7A 2BRUC 4KU4A 4AMUA 3OHAA 2PG3A 3LLCA 3WYNA 3C87A 1ND5A 3AJEA 4BV2A 3U5TA 5F2OA 1T1GA 2QP4A 2ADFA 2CYCA 2NU8A 1AC5A 1WUHS 2Y1GA 3EA4A 5EN4A 4MS3A 4B4VA 3O8NA 3ZBUA 4CV1A 3TLAA 4LTNA 2RB5A 4F1WA 3LWNA 3A2NA 2JH3A 3GELA 4PPGA 4GVPA 2C3PA 3CW8X 4W5NA 5NULA 2Q3EA 4F86A 4KLCA 3D0OA 1WY5A 1EK6A 1DEHA 1I1MA 1TIPA 2V97A 3L8YA 5AW6A 3MJDA 4H7HA 4QYMA 5TNXA 1N2BA 2ZE7A 3QG5A 1UFOA 1AM4D 3AHHA 1M2OA 1EFRD 1Q7TA 1ZWKA 3IV9A 3QV2A 4O33A 4F5DA 2QROA 2XTJA 1SCAA 2HMTA 3AR4A 3NIDB 1I94H 3IUBA 3VR3D 4Y1FA 2JAOA 1U65A 1V8FA 2QN3A 4LTMA 5L1IA 1QWSA 2H11A 3FYDA 3K9CA 1PLLA 4O63O 2Q5JA 2NU7A 4PPQA 4EZEA 3C4VA 4F5EA 3VTFA 2BPOA 1QX3A 4P58A 2QX9A 2PZJA 4CXMA 2CJWA 2X9GA 4JVMA 4F06A 3KS9A 4GP7A 3VZDA 1GM5A 1RJWA 5BRJA 2LE0A 4QT4A 4Q39A 1S8NA 3KP1A 1YF3A 2R8OA 1YUNA 5CFLA 1H0RA 1VRVA 3IUJA 1DKQA 4YR0A 3I39X 5B3KA 3TGWA 2I29A 4ZV7A 1TZJA 1NJSA 2JEFA 1DIRA 1E79A 1EX9A 1Q21A 4F50A 1RWOA 3B5JA 5DULA 4Z3OA 2EW2A 3L41A 1X9HA 3T06B 1F8YA 4XUEA 3TSWA 5CCDA 2IIVA 3DYVA 4AMZA 1A5ZA 3S2YA 2PPLA 3UQZA 1DKMA 4BP8A 1GTL1 2ERCA 2E7ZA 2YW2A 2I6SA 3DLPX 1GFIA 4KK3A 4KUHA 4C6SA 1XMOB 2VJLA 2ZE8A 3BILA 3SC2A 1MGOA 2PCLA 4XWOA 2OPBA 3H83A 5LL6b 2DPIA 2WI8A 3OLZA 4K05A 4EX6A 1F1BA 2A0YA 2XKKA 2LVBA 4Q19A 3LAWA 1R3UA 1VPTA 1DMRA 1M75A 1YJQA 3MZ0A 1Z6TA 2CDNA 4FMPA 3K1ZA 1SBQA 3UV7A 2JLZA 3P9KA 2V4QA 1KVRA 1NQVA 1ZK4A 3FPFA 2WAAA 3F47A 3ZHZA 3ZWDA 4BP3A 4F4UA 4Q9DA 1CF4A 2HUPA 3WBJA 4D46A 1SWWA 2JIMA 3C3MA 3C0FB 3PHJA 4M8LA 5KDLA 3HBAA 4GZMA 4K81B 3RYIB 4TUYF 3TLGA 1VIVA 3ZIAA 2FOIA 2HG8A 2YVLA 4HMQA 1OPXA 4BUCA 1YRAA 5A6VA 3R9RA 2B82A 2V4MA 5E1OA 4ZMRA 2WF8A 5ITVA 3Q7IA 4WBSA 5JS8A 2JKZA 2Y2UA 3K4QA 5FB3A 1RZRD 1GPMA 4N48A 5A06A 2PU7A 3M1AA 3WP1B 4Y2VA 4TVIA 1XWFA 3G2OA 3H9UA 4JXKA 2CXOA 5IT5A 1A2BA 2D1TA 3TD2A 1RYEA 1TX4B 1H8HA 4LV6A 3TZHA 4RCVA 3RANA 1XZGA 3CLHA 2PMFA 4TVOA 4YBZA 1GNVA 1E6WA 1YRHA 4L8GA 2ABWA 2PGAA 1P91A 3EFEA 4FD3A 2OYRA 4EY8A 3FPBA 3O0DA 4DKJA 1DIAA 3G9QA 3COSA 1QDLB 1JSCA 4OAPA 2WIKA 3OD1A 1E7YA 4XX0B 1C3VA 4MW0A 5FV4A 1VYUA 3KOYA 1YR6A 5DTJA 5KYTA 1XTTA 1R0RE 1ETUA 1R6AA 2GYWA 4DV6H 2YIDA 4KV9A 4YQEA 1CX9B 1WXWA 1Z25A 1NNLA 1H2XA 3CFYA 3VJRA 1N3BA 2IP1A 4AQDA 4BNLA 2ZJ8A 3BMXA 5ALUA 1TC1A 5EE9A 4J16C 3P9ZA 3SZUA 3ESCA 5HKLA 1BS2A 4HNAB 3RC1A 2D1FA 2NYVA 3DUFA 4FM9A 4LGCA 1QXSA 3SHFA 3VVMA 1CC1S 4IGKA 3EPIA 2NYRA 3Q9UA 4B2YA 4C7BA 2WA1A 4PSDA 4Y6RA 2KW5A 1JDPA 2QZSA 3V4LA 3MJCA 4OLFA 4DPLA 4DA7A 5EWJB 9GPBA 3LQQA 1IHPA 2Q4RA 1ABEA 4HGPA 4CT4B 1IXRC 2VPWA 3GJRA 2ZI6A 4ZI7B 1E4GT 1TB4A 4JB0A 4MRAA 4B4OA 3GIMA 4DLRA 2RJ3A 3D59A 2YJ6A 4WZBE 3Q11A 1GAJA 1EVZA 1M54A 4EPWA 5AJXA 3BFVA 4KPGA 1VSVA 2P78A 4XDZA 4UXJA 5D5QA 4LF6B 1GCOA 1KVQA 1G63A 2UUAH 5A4FS 1XTSA 4HGNA 1P5JA 5JRDS 1WETA 4M1WA 1KKUA 4XWGA 2FEAA 1FJHA 1FYXA 1UBMS 1ZS9A 3EXHB 1ZDMA 4M2LA 4QUHA 2J5KA 4IXMA 1X8KA 3UFBA 1T4MA 1KH1A 5JSFA 1V5IA 4AWXA 1DQSA 4GECA 3GTMA 1UMCB 3EMVA 2F1IA 2FRVA 1NM5A 3ZHBA 1T6XA 2P2CA 4TLMB 1ZGZA 3L8DA 4GQBA 3ESAA 3G0CA 3HBMA 3DFFA 2PZEA 1EUYA 4EG0A 3QX9A 1PNTA 5KPJA 4KQKA 2DPJA 5HG0A 1H05A 2EJBA 3DOCA 3EVAA 1W6RA 4ZO9A 5KT6A 4XA8A 5ALWA 4B4UA 4HFMA 4EJ2A 1OBCA 5K2MA 1P1BA 1U9JA 3D7SA 5A04A 1JQDA 5ALMA 5IYZA 1S8AA 3WKAA 1A9PA 2GVNA 3L40A 3OFSA 2BI8A 2YVAA 3AFHA 1RWWA 4G26A 4PRKA 4Q24A 5E7JA 5FOSA 5HXAA 2J0QA 1YQDA 3L0DA 3FOFC 3WGQA 2CUZA 2KX7A 5ED0A 2UXCH 2H7VA 2XF2A 1SXJA 3AEKA 3U3XA 1I7PA 3ZBTA 3FG9A 2R6CA 1J97A 1N8KA 1VYHA 2BC9A 5AM1A 2ZK7A 5REQA 3SX4A 5KTYA 1DX9A 2WF5A 1GNTA 3D4OA 3C16C 2UXBH 4QOHA 1WDMA 4YRJA 2R85A 3OCVA 2UUAB 1NBEA 2F43B 5LXTA 3LQYA 4IIYA 4PG7A 2ZYIA 2W7PA 4EG5A 3FX2A 2ID4A 1GNQA 1FJGB 4IUBS 4RZ2A 5EAIA 2AQIA 3OJ0A 1CUJA 4IIJF 2Y1CA 3PEUA 5CVJA 4YUAA 1D6SA 2IP2A 1C1XA 1U7XA 2C58A 3ELBA 1NDHA 3LUGA 4ZHQA 1EM8B 4ZCSA 1T4CB 2CNVA 2OXCA 4G97A 1SNYA 2E4ZA 1VG0B 2EQAA 3UMGA 4DV4B 2PVCA 1I8TA 4HK4A 4EHJA 1M9NA 1S0NA 1P4RA 1T9BA 4GL2A 1K5GA 2FFQA 4PZZA 5I51A 1YVRA 1DIOB 1ADJA 3KXLA 3OAAD 1UC5B 1YKFA 2AGVA 1NV8A 3ENKA 3UXMA 1HG0A 2GK4A 1YOBA 1UQUA 2ZKIA 1I5RA 4D6YA 3KTMA 1ECJA 1PGJA 2AXNA 1K5PA 1VS0A 4JJKA 3EZFA 5TF0A 4UQPA 3ZGOA 2COKA 1AK9A 4IV8A 5L45A 3PI7A 4IIEA 2H16A 3U7RA 2FSHA 1T91A 4P4NA 1MJFA 5EWEA 3BYZA 4DJTA 1E9SA 3UMJA 2BFAA 2HX1A 3K32A 4FFRA 4W1RA 4JXUA 1SD1A 3K1AB 4I46A 5ENDA 4O3MA 3DHEA 3AB8A 3RRBA 5LOVB 1C29B 4EEQA 1DTEA 1X1QA 3L1VA 3M6MD 3SQDA 4A91A 3RBDA 2VVTA 2NADA 4PTYA 5F7OA 1I3MA 2ID9A 1TUEA 2WFMA 1TLTA 2GHQA 3K15A 4UW9A 3WNZA 2Q3JA 3A11A 1VRCA 3NLLA 4JP1A 4R6XA 3RS7A 4NJEA 3L7JA 4N5DA 5DRYA 4D8YA 1MAAA 3U44A 2IX9A 5EEHA 1JFTA 1NF9A 2IZOA 2IZ7A 2QU8A 1GYPA 1A5BB 4LRYA 1O08A 2QYHA 4X24A 2W6MA 4X1IA 5CIWA 2IKQA 3O4HA 5DHRA 5JCOC 1ECBA 2EYQA 1ZD5A 2BVNA 2O5VA 2QRUA 3D31A 3MTJA 3NBAA 4IHJB 5EC8A 3RBZA 5JC1A 2ZJ6A 4L78A 1S3FA 4WK2B 5H82A 1LVHA 3I4MG 3OU6A 4ND1A 4OXNA 4J9LA 3ZHVA 4GGOA 4EF5A 4KHZA 3IMFA 3TLJA 1IJKA 1QFYA 4IMPA 5JD3A 3B78A 1LS1A 5K01A 2G5GX 4WFJA 1E2BA 2BM1A 2ECOA 3KBOA 2ZAGA 4EVSA 5HS4A 2D2EA 4DUZB 1VI6A 5SZJA 3N07A 4LECA 4NONA 1N2SA 1Z8FA 4JA2A 3UH1A 4OQMA 1EZ1A 3JQGB 4KAFA 5GY7A 3RASA 1UK8A 4IRCA 2PKXA 3AG5A 5LOVA 5LMUB 5JECA 2BYTA 4BZXA 1DEXA 3GIPA 1HFWA 3ILYA 2GCOB 1B8UA 1GT6A 1Z6ZA 3AV0B 1UC9A 4P5DA 4D3DA 3E27A 3F2IA 1R15A 1Z0DA 4JEIA 6CHYA 3F6RA 2H51A 3HEBA 4GH5A 1KE1A 1CY0A 2XNSA 4CVNA 4E7OA 3TCXB 1BS9A 1ID8A 1IPEA 1DOZA 4R8MA 2FMKA 5F5XA 2BE9A 2Q9AA 2W6ZA 1MA0A 1X1RA 2O4UX 1MG5A 2QRQA 3QZUA 4OBBA 5KAPA 5M04A 2FYTA 2GA8A 5KG0A 4KJZA 4P93A 2CVQA 2P9CA 1Y1SA 2V74B 5AI6A 3EVDA 5E4TA 1CULC 5JSZB 3CEJA 4ZO7A 5AVKA 2XWPA 2BQRA 1N5MA 3FNHA 4G01B 2NAFA 2JF0A 4IX9A 1FNSA 2IV3A 3C6MA 3TEKA 1I2MA 2W6ID 4IP0A 4Z8YA 3W8NA 4YYEA 4ZT6A 2PRSA 3E9QA 1UZLA 3DF7A 2D13A 3DV9A 1JX4A 1SOWA 1M2EA 4DN6A 1CUVA 3JPYA 4ZFNA 2C7VA 4OU4A 2PGIA 1RWNA 3EWAA 4P34A 4PQEA 2IRWA 1LPSA 1YMVA 4TKLA 5E6UA 3NAQA 4H59A 3SSOA 1UPTA 3W2FA 1GQOA 1S3SA 4JI3H 3MB5A 4HWPA 5D7NA 2DB3A 5IBQA 5CHYA 4OB8A 4WLUA 2YZMA 3UAOA 1QOZA 1LWNA 3GX1A 2C22A 2P8JA 4NJOA 4Y0VA 2UXCB 4Z0TA 4GPIB 1KOLA 1LQTA 4LDQA 3FOBA 1U0GA 1HZJA 2AK2A 4PLGA 3Q41A 4V02A 2YQ4A 4BBRG 2ZS8A 3IDSA 1HDOA 3PQEA 4QECA 2RG7A 2AE2A 4R2LA 2Z5GA 3HYCA 2TYSB 3LUAA 4MUGA 5IJAA 3ERCA 5D84A 4H16A 4QFDA 5F1OA 1PJ2A 4JLNA 1NVGA 1UBRS 3B1XA 3N3AC 4IJ5A 4BBZA 1E2GA 3DZIA 4DNFA 3KJQA 2I2BA 3T7KA 5J2UA 2RF4A 4YH1A 1LDNA 4XDHA 4NZOA 4IKPA 3P2OA 1TIKA 3GH1A 1FRZA 2REOA 3OESA 4KEAA 3NEPX 3OIGA 4KX3A 1JDEA 4W6ZA 2I7VA 3HADA 3SF8A 3F8WA 1SO8A 2IY7A 2VYNA 3OJFA 3I42A 5IAOA 1ZC4A 1YFKA 3TW8A 3NI2A 2NAPA 1NUQA 2VBIA 3RI3A 3ZPXA 3ZZ1A 1Q7BA 5H0IA 4EHFA 4GVLA 1ZAYA 5A2QA 1PK7A 2ZUEA 4I19A 2Y0DA 1CCWA 3N2KB 2JLWA 3NH9A 2WAMA 3BGWA 2Y77A 3MTDA 4F6CA 1EUDA 2Y66A 1SVNA 1VHJA 5FUBA 3UAYA 2GRAA 4N0QA 3GLGB 3ADDA 2HBYA 3DR5A 1KI6A 2ZRPA 4D92A 1ZVMA 4S1NA 4PIPA 2IHNA 1YRWA 1ZOSA 1G291 3MJRA 2AMVA 2GJ8A 2YMQA 2P41A 4NENB 2DAAA 4HXFB 4KBYA 4Z1OA 4ZVMA 5I7UA 4DV5B 1UDWA 5I3CA 1Z4MA 2UU9B 3ND8A 1A0OA 1CQIA 1NVXQ 1X9GA 4FGWA 1M1ZA 3HXQA 4TKMA 2BR5A 4L15A 2D59A 4A0FA 4GPZA 1C7RA 4NV0A 3RAFC 2ECPA 2J3JA 4WOKA 4MR7A 4U7FA 1ZJ6A 3BF7A 2L19A 5G3YA 1II0A 1UC4B 3N2GA 3FDIA 5E2BA 4AN0A 2AEJA 5C7LO 5KVAA 1Y7LA 4TMFA 4J1NA 5DOZA 2HA7A 2HV9A 4KTTE 4GE3A 5EVCA 1W49A 4DCVA 1XTIA 4I5DA 4LHWA 4IQ4A 4J3JA 2HHHB 3NOOA 3TPFA 1DDGA 4GBED 5JEDA 4X20A 3BAZA 2ZJFA 4LBWA 4RMJA 3VDXA 1HNZB 2X4LA 2V96A 4IDPA 3ZXYA 1DHRA 1QIGA 4D3FA 3PENA 4FUQA 4NX2A 2OGUA 1WUTA 2FKLA 2DC1A 4U6QA 5IFLA 2NTNA 4KWEA 4FYWA 4K9KA 4PLFA 3NHJA 1R3DA 3SC6A 4M8SA 3GH3A 5KI6A 2K7ZA 1IM5A 2PBLA 2F8LA 1VKHA 2OZVA 3ZCRA 2SCUB 4L73A 2OQIA 5IKEA 3FMAA 1OLUA 4RLFA 1NN0A 1XYVA 1AN0A 1O54A 1TW2A 1SBCA 4Q1BA 4RS3A 5LFAA 4L4ZA 1DBPA 1KDZA 5FPYA 1XN4A 3M3HA 4ZJUA 1N48A 2DVMA 4QHYA 1ZM7A 3CA8A 3N59A 3F1LA 3ULKA 4AZ3A 2VSXA 1R88A 5KDDA 1TD1A 3THSA 4V3BA 3GTGA 3DR3A 3CVUA 1FP4A 1YFJA 2C8LA 1XLTA 2MU1A 1B8VA 1XP5A 2NU6A 3Q5DA 2H65A 2CJFA 1ZXBA 1EX7A 2D3TA 3JARA 1G8SA 1A4RA 4R68A 3PC8A 5GGYA 1IXYA 2GJSA 1UKBA 1KEWA 1U3WA 1O97D 1FP6A 1K4MA 3IA7A 3PC7A 3ZI4A 4D9IA 3DMNA 2GBIA 2R7ZA 2Q9BA 2XGGA 3FMVA 1BJKA 2H2GA 1UC8A 2RFLA 4INOA 4P98A 1ODLA 4QQFA 4YP1A 3HGMA 5DM2A 4TXHA 3VSCA 2ID8A 3SF0A 4BBAA 4AKHA 4RACA 4UEKA 2X9QA 2YRWA 5E0OA 4BFVA 1VP9A 4QEZA 1A2QA 3R5TA 3STWA 3EDMA 1HQDA 4LRUA 1SUAA 4B6FA 1RYNA 3MF4A 1C4KA 4QDXA 1HYEA 1B16A 1UJMA 3ZY4A 4TV9F 1CRZA 4YCDA 1ADGA 2EU8A 5EIAA 3SEZA 5CFMA 5HP4A 2W2PA 4BZWA 2H1VA 3FKIG 2P1DA 5AVXA 1M1NA 1O89A 1U3GA 4MKFA 1ISMA 2Q5FA 2YYSA 1FQOA 3RWMB 4EB8A 1D1SA 2ZIXB 2O8CA 4JSRA 5COQA 2LGJA 3OPQA 2LDBA 1HRKA 1XNRH 1E6KA 3FRIA 3KAPA 3PNPA 1B6RA 1A88A 2NZ2A 4ZTBA 3K9NA 2P91A 4ECWA 2EATA 3EBPA 2CK3D 2XQIA 4MCIA 1BVHA 3B9PA 1N2OA 4LOLA 3RSOA 3U0VA 2CW7A 1IU9A 1P5HA 4UVIA 3S1SA 1YQTA 1DBVO 1XAJA 3VPFA 1CNFA 1E7RA 1OTHA 1GGHA 1I6LA 1OSNA 3X2FA 3SJBA 1ZRSA 2NU8B 4YWHA 4MTEA 2WSMA 5EOYA 1NJ6A 3Q88A 1X7ZB 5AJHA 1L5KA 3WLFA 4FHEA 2ZTHA 1WSBA 2XDAA 3AEXA 3GBVA 4D8TA 2OR3A 5CA0A 3WWPA 1VJTA 2A0UA 3FROA 2G6TA 2O1EA 4J7AA 3IP3A 5EIHA 4C89A 3HT5A 4O3FA 3SSMA 2WJHA 2E85A 3GQVA 1J70A 1NVMB 3Q5GA 4N5HX 3G0GA 4M8KA 4XSVA 5J40A 2CEAA 3D4BA 5TEVA 3EPKA 3ET5A 4GX0A 2NTEA 2O3SA 2CZGA 1D03A 3GF4A 1SB9A 1KYTA 2QP9X 2P9TA 3ETGA 4GXRA 4J2HA 4RY2A 3E8SA 3RU9A 3ZH9B 3KB1A 3E5MA 1I1HA 4MK4A 2Y71A 4Q4JA 5F4ZA 1FZTA 5ILOA 2HMUA 2HK7A 2RB4A 1NFRA 1GEGA 4GYKA 4ABYA 2Q2VA 2JHFA 3ONWA 1A69A 1XV5A 4A2PA 3BABA 2F00A 2B94A 4XGIA 3RH0A 4HAXA 4MHSA 3FDXA 2P9ZA 3NBXX 4K86A 4UEQA 3STXA 1QBKC 4D9JA 4UTVA 1QK4A 1RLMA 1H3EA 3M1YA 3I6MA 1RM0A 2B4KA 1ZBDA 3M89A 4GM4A 3QJ5A 3M1LA 3GEIA 3TTYA 4DAEA 4EAAA 1UBTS 1XJQA 1EFCA 2HPAA 3TQIA 3KYDA 1GLNA 3G9XA 4KWHA 2BCGY 1V8OA 4I55F 2PLNA 5FLMG 3P2JA 1OBHA 4L51A 1KGSA 4C07A 1J0AA 1V2GA 5LVAA 2PANA 3IMGA 3O8LA 5MGNA 1MOQA 3AVQA 2VG8A 3THYB 2XRMA 3EH2A 1YC5A 4J91A 5LJIA 2I7CA 4LMRA 4YMVA 2WC1A 3M5WA 1PWHA 2QV7A 1O0CA 3E2PA 3AWDA 4D42A 4RDHA 4BO5A 1EGQA 4UPEA 5K6RA 3U7HB 5FJIA 4DLAA 3CPSA 4JIGA 3RAPR 3AFMA 1OXVA 3OHMA 3UM9A 3ELDA 2CDBA 3E84A 1M6VA 3HKBB 4INPA 2CSXA 3DAYA 1H1LA 4NOLA 3CKYA 4HEQA 1Y7PA 3FY4A 1LBTA 1P7PA 2GN1A 3AW8A 3HL0A 2JBWA 2YCHA 2R00C 3RG2A 3V1NA 3QUBA 4R8KA 5D2CA 5HR5A 2YX1A 4R1TA 4G5XA 1J90A 3PW0A 1UQTA 3Q8QB 3O2SB 4NLLA 2FLPA 4AYBA 1VMIA 4TMZA 3TLGB 1IY0A 1U4SA 3DUFB 3IOCA 5GOTA 5D1OB 2DFPA 2AS0A 2JRLA 1VDMA 3GGGA 5ALYA 4B2PA 1E6MA 4KO1S 2HNBA 4PANA 4MI3A 2XIQA 1KE2A 5KJ1A 3AHJA 2GK3A 2L69A 3CNQS 2RHWA 4IEIA 1E3WA 4H1VA 1NA5A 5FPHA 5A5EA 5KFMA 3QKRB 3F7OA 4HTAA 3FPEA 1G6KA 4HWRA 2XKBA 2B5OA 4MQBA 4ZA2A 3KUKA 3J81k 3ZYCA 1IHOA 5D00A 4W4TA 5LQSA 3DOIA 5T7BA 3UUFA 4K6CA 4B1FA 1SA0B 2H5EA 2JCSA 4LUCA 2BGWA 2X5JO 4JUAA 3SQWA 2O0KA 2XDYA 1RDFA 1M5RA 2QTMA 3C3DA 2X4DA 1LK5A 2QE7A 1JE0A 1FZQA 6REQA 1JDJA 5C1OA 2PA3A 1E6UA 3QHQA 3SN6A 3UWKA 4FYYA 1EUCB 3O4JA 3X3HA 3IKMB 4CRWB 3RFCA 3IHKA 4W7IA 2ZXFA 4BFLA 4PGMA 1FX0B 1X7XB 4WBXC 1EKPA 3MT9A 1DUVG 1QYCA 3NDIA 5H68A 1XK7A 3B60A 2O2YA 3HDTA 2WWIA 1Y5NA 2QN2A 3DKRA 4UAVA 3TSYA 3S55A 4PBTA 3Q8RB 4DR2H 1XVTA 4DL3A 3VPGA 5B5SA 2F55A 4CIYA 2VXCA 2I2AA 2YBDA 4XB1A 2X0DA 3RABA 3BEDA 3W1EA 4NSNA 3QNUA 3OJOA 4HH1A 4TMXA 2V5UA 3PNVA 4WNCA 2IUUA 4GWKA 3FIUA 4WZAA 3U1TA 3H9CA 5HIIA 3TPZA 3KJNA 1JBEA 4A23A 5B1DA 4M7OA 5DN9A 5K3BA 5IT9W 1Z29A 4RXMA 3VR6H 3BAAA 5B4VA 3I4LA 2ZM5A 5D87A 5FTNA 1C8KA 3GOHA 3DE5X 3ZVRA 4M0LA 1E1NA 4Q4LA 1ZM9A 2F43A 4YRFA 4BVJA 4EY7A 5JYBA 1W5EA 5AKGA 3S27A 1PSWA 1XLVA 2OHFA 2RGEA 3H4BA 3H2KA 3O93A 3FAKA 1WVGA 2PLRA 3PDUA 3BE6A 3QQPA 3MW8A 3RWOA 4JS0A 2AF3C 1N6HA 1VJGA 2SBTA 3U3KA 4C01A 3QKUA 3C24A 4QW9A 4ECUA 2PLFA 3HYLA 2N0SA 2B83A 3DONA 2FK3A 5F4BA 5IC6A 4EHHA 5K0EA 5FBHA 2PXAA 3LNCA 3K30A 4GZ3A 1E1CA 1XUOA 3MJSA 3G2HA 3TRIA 3W3ZB 3N6VA 5EERA 1ARZA 4TTTS 1FU7A 3VZBA 4MV8A 4GW3A 5KYXA 3PL1A 1GYFA 3TVYA 4D4HA 1ZISA 1ZKDA 2X14A 1NYQA 4YP9A 1ZIPA 1KU0A 2AI3A 2MSCB 1QKKA 2HDOA 3H9BA 3O73A 2XWQA 4XR9A 4DBLE 5B1EA 3SXUA 2G36A 2B6HA 1M2JA 3NGDA 4KXXA 2C94A 3CJTA 3LF2A 4RZHA 4EECA 1YAJA 1XO1A 5JY6A 2HBQA 2QL7A 2OAGA 1U2GC 4A8JC 3OFJA 5AHXA 1B0AA 3QH4A 1MW8X 4RY9A 3PJEA 3COWA 4FYMA 4A36A 3VR5H 4RGYA 1DBSA 1E2JA 2R1TB 3HDQA 4G1CA 4OLJA 3KQTA 4OFBA 1JZQA 4GT1A 1JQLB 5K6AC 2WP0A 3T5PA 4B3SB 4PYNA 1KQ3A 1Q3TA 1QCCA 2XVAA 3JW8A 4GLXA 1M1UA 1GPKA 4NPCA 2NYAA 1V9SA 3PTZA 4DEVA 2AMYA 4KHPH 5KPDA 3FTPA 1MOSA 1ZJYA 3DFZA 1EU1A 1J8FA 2CXXA 5AM2A 3O8CA 1WB6A 1P7VA 3K9HA 2BP7A 4FNAA 4AX4A 2JBHA 1M6YA 1THMA 1X1DA 5ALEA 4YJ2F 1JV2B 2VUSA 3QYAA 1C30B 1IJBA 3GLHE 4JJ4A 2F48A 3H1BA 1S9FA 3I2YX 3QRWA 2VXOA 4YONB 2WB4A 4PLHA 1BH2A 5I9TA 1JXLA 1Z8HA 5SZKB 2HJSA 4I5EA 1OLXA 5ERYA 3SICE 2K4MA 4MMYB 1TJ4A 3E2MA 3EULA 4DREA 5JEEA 4ESVA 4PFSA 1QRTA 4UEWA 1DL5A 2YXPX 2Z8YM 1P3Y1 3TRKA 1SKMA 4KDCA 1ESMA 4XB2A 2QG6A 5I5UA 2ZWOA 1VBHA 1VBNA 2R2AA 2ZT5A 3OJCA 4R8UA 4QZVA 3W3AH 4QTTB 1Q7EA 1E6EA 4ZICA 4GOLD 4ZT2A 1CY2A 3PXAA 2YWCA 3MSXA 4QICA 3HKEA 3NO4A 4NECA 3W7AA 4G1BA 4QOIA 2HDKA 1KZYC 5HM8A 4XVQA 1QQBA 1CD5A 1Q1AA 3T15A 3DULA 3WOVA 5CA1F 3LFUA 3RFFA 4RD3A 2EFEB 3OQIB 1RI5A 3LY8A 5ALHA 1J25A 3H75A 2QUBA 1XXHA 2ZB7A 1C0PA 1X80A 3BDVA 3HCFA 3MUEA 2OE2A 5FI5A 1YBVA 3UUWA 1Y6JA 2J41A 4B6SA 4R6WA 4ZDIA 2YS6A 4UDOA 3IAEA 4WFQA 1T10A 1R4NA 4AICA 1QC5A 5JALA 1IPHA 1H5NA 4NZZA 4Q4AB 5AMXA 3RVSA 1QRSA 2V65A 4GKBA 2RIRA 3EZ9A 2VJAA 4DJ5X 1A9SA 3H1EA 4IH4A 1P45A 1E2KA 2VDQB 3UB3A 1RTTA 1M76A 1I0LA 1NR7A 2QL9A 2Y3IA 3BWYA 3GUVA 1I1KA 3MK31 1NW9B 3GZNA 3L8FA 2CXTA 2J67A 4IXWA 1ZINA 2ZPTX 1K2VN 3HSSA 2H2WA 3EHDA 1YDEA 4QOFA 1N9KA 4XQGA 2C4UA 5BWWA 4YXWD 1T9ZA 3M4YA 1V1JA 2NPIA 3JQ7A 2K6GA 4G4SO 4U9UA 4FCWA 2GEKA 2AMFA 1E3EA 1C9YA 5EIEA 4RHUA 4JT8A 1U11A 1ZPDA 4UCTA 3UA3A 1N25A 4Y7DA 4RELA 3QWHA 2CVPA 1NNSA 1V6AA 1PW7A 4QNRA 4B87A 1NMYA 1XA0A 5TEWA 1ES9A 1B3RA 1K5DA 1SVUA 1X7GA 3ANYB 3HCWA 2PX4A 4HVAA 4HX9A 1DB3A 1QO0D 2P11A 3KUCA 3EWIA 4HLNA 4TTQA 2P8SA 1XU4A 3M6IA 4LJ9A 2IHTA 2IZ1A 4G37A 3PX2A 8MHTA 3S99A 1IJEA 1XWWA 1MO5A 4X64H 2KQUA 4KW7A 3PPWA 5KYYA 2JI4A 3SKXA 5TQVA 2J6CA 2V9ZA 3DH0A 2SKDA 2ZZKA 5REQB 3QITA 4EY5A 2NWQA 3SE7A 4RIFA 5CXSA 4LOKA 2XDQA 1JA1A 2I80A 3AHEA 3OIFA 4JELA 2PZGA 4NG5A 5CXXA 3SYRA 4ZYTA 3N05A 4HAVA 4G5RA 3RSLA 2CUNA 3DCNA 2YN2A 3K1TA 3LQ2A 1F38A 4YQYA 3V9PA 1K63A 2RH4A 3G85A 1A7KA 4QE3A 3OM8A 5I01A 3SHOA 3ES9A 3K70B 4IY1A 2DJ5A 3ZK8A 2NU9B 4ARIA 1KZHA 1AKUA 2QRVA 4J3FA 3UJPA 2IY9A 4ZO6A 1G5IA 5KJFA 2DR2A 1YRYE 3K0AA 4FFSA 3V7UA 2XCIA 2YHSA 3ZDDA 5EJ8A 2PUWA 3T9CA 2R8GA 3HM2A 4XD7D 5EWLB 4DTIA 3VQTA 1IRIA 1IUNA 2HOQA 2ZRQA 2H31A 3AEYA 3DLTA 4GUAA 1I9GA 3OUZA 1OIVA 2FE4A 4ZQEA 5C9ZA 1FUUA 2CW8A 5JTTA 3TFWA 3DL0A 1L6RA 2P5UA 1HORA 2NX2A 1JI3A 3GVHA 4HPJB 1Y8AA 3CCBA 1VJ0A 1XTQA 3UKJA 1J20A 4I6JA 5A3QA 3IO3A 2G1JA 1XKQA 3IILA 1XVAA 2HEGA 2LCIA 4COOA 3W0LB 5CDTA 1N8SA 4ARCA 1XNQB 3C8HA 1HK7A 3MTAA 1FUYB 1Y63A 4JP3A 5DHQA 1CR4A 4H1TA 2QWXA 3MT7A 1DAAA 1DWUA 1HEYA 1XTRA 4DIDA 5I9NA 1JAIA 2VQEB 4K88A 3WKDA 2P3LA 4C0BA 2FFRA 2VCHA 1GPJA 5E38A 4TZ6A 2XUJA 2I6GA 3E6AA 2O3QA 1WM1A 1OWNA 1CPYA 3KR1A 3VR3A 4LF6H 2AWOA 2HCTA 1PRYA 4GI3A 3I04M 521PA 3A28A 4RK7A 1A1SA 5K3AA 4PHFA 2HSGA 1N7IA 1R8QA 4ZOLB 1XAIA 4LIPD 3IESA 3FUTA 4YAIA 2C29D 4UEJA 3OFVA 3H0GA 1NF3A 1IXKA 1Z6XA 1P0QA 3WRYC 3MR6A 3L0SA 1K5HA 1P2UA 3BE8A 1JTFA 4Q3KA 3SM9A 3URKA 4C4OA 1Q2XA 5ETJA 5DLFA 3TZKA 3HVIA 3PHLA 4NAHA 3ITKA 4DR3B 3DV0A 3GB8B 5DGIA 3O9ZA 4C0LA 3SQMA 2VEDA 3ETDA 2W6OA 1E3LA 3PHCA 2EHJA 2ZR7A 1Q91A 2VWPA 5JZBA 2Q2TA 3EB9A 3C5EA 3UTDA 3P7MA 2CSUA 1NVDA 1XEFA 2M98A 2XAUA 4JBYA 2HHFB 3FYCA 4QPPA 5C18A 4KSBA 2IEIA 4YAJB 4UCQA 5AI0A 3QYFA 5DB4A 1TMYA 5DGDA 2B4TO 4ZPXA 5ARCA 4YMIA 4WOJA 3WSVA 1R0XA 1LJUA 4CM5A 2OV6A 1H94A 2QNIA 3MJVA 3OT1B 2HHAA 3QPVA 2R6GA 1E8MA 3GTJA 3A1CA 4Q9JA 4BFUA 1ILEA 1QHEA 2XCAA 3KU1A 5F77A 4UOQA 3FN4A 1JN0A 4RZSA 2WV9A 3AFOA 3LBNA 4YMLA 1ZUNB 4WCVA 3KAKA 4DZZA 1VMDA 1JT2A 2FQ1A 2YV3A 3DHYA 3K09A 1EFRA 3OKPA 4L4XA 4BUZA 2IY8A 5I5TA 3ZWXA 5BY2A 2ZYSA 3FMFA 3ICCA 1L1EA 3W6ZA 3MUOA 4MZXA 3CZRA 3OIUA 4NYJR 1GR1A 1QRUA 3FBGA 4H31A 1FVHA 1MFZA 2WHRA 4IUCS 5I9BA 1K6JA 4N8SA 1XPUA 3CF4A 2O8FA 4TWBA 1GQYA 5G40A 3C3AA 4ZVSA 3NBZC 4A3FG 2UYQA 3A6JA 5WRFA 2H5IA 2N47A 3HB4X 1LPNA 3QPBA 2HA0A 4EKYA 3D6HA 3L3BA 1I3KA 2NO5A 3L84A 5IH3A 2PFKA 1T0UA 1A8IA 3RK4A 3IIMA 4QYTA 2HQBA 5CFNA 3AM3A 4YR2A 3I4CA 4UNNA 2C9DA 2IDMA 1EFVB 1UANA 4EJFA 2O5CA 4Q82A 1JU3A 1W44A 3BA8A 3CNHA 1XSEA 2J09A 1P61B 3OTGA 3ONFA 3ZX4A 1N6RA 3P0EA 5C32A 4G8CA 3RVQA 1L5OA 1J99A 1BCSA 2QT9A 4BV8A 5HV6A 1PJ8A 3PR2B 1E7MA 1JXMA 2OUKA 3B6JA 4HNQA 3OOWA 4I2VA 4K8RB 2KB0A 3OSPA 2WF9A 4LHXA 3VO8A 5BWOA 2D4AA 2W2XA 5HUQA 1OOEA 2GVZC 1PFUA 1Y6ZA 4V39A 2X23A 3O2QB 5L9XA 3FR7A 4X8LA 4O2AA 4BDSA 5BRAA 4JQZA 3UBMA 2PYZA 3IT2A 5DWVA 5K6AA 3C4JA 4XM0A 4LF5H 3UJAA 9ATCA 3LE8A 2W9AA 3DEKA 2X9VA 3KFXA 3D6JA 1JQBA 4JMPA 1M7HA 3O7MA 3T1YH 2PKQO 4EP1A 2BQUA 1E2PA 1P19A 3NBZB 1E1QD 1CVLA 2DKFA 3DCYA 4M83A 4Q18A 3T5TA 1GPDG 4KDRA 4F2WA 1X1BA 5KTKA 4KODA 2F1RA 1PQYA 2FG5A 4NP6A 1XROA 4NY1A 2HAEA 4EA7A 1MVNA 1HZZA 1Y8QA 3RGZA 1COWD 5K45A 1AQUA 2JEGA 2ZB3A 3K1AA 3LPMA 4E0BA 2JIOA 3N6XA 1JMVA 1IMJA 1E7SA 4Q3DA 4XOUA 5D01A 5JO9A 3PQDA 4JI5H 1JKIA 1N5KA 4GMKA 3RYIA 4Q3OA 2G8NA 2WWRA 1F0PA 2QE6A 3IV6A 1SQFA 5BSEA 2CYAA 1M34A 1LC0A 5JPCA 2OY0A 5E4JA 2I87A 3NVKI 4XYLA 2W71A 1A4XA 3T7CA 2GRUA 1NTRA 5C34B 1A7JA 3VKWA 5E4FA 2FZEA 1WUJS 3DC7A 3FKIA 2V58A 4J9OA 2PUFA 2Z04A 1X74A 4YAGA 1N2EA 4D57A 2UZAA 3K2EA 3KB2A 4JOCA 4N6GA 2ZRDA 4V0NA 4D0NA 2B21A 1G7CA 4LZPA 3I52A 3MGGA 4P7FA 2OZPA 3TQ1A 3W5AA 2MTBA 1TYBE 2XGMA 1JW9B 3BXFA 4GGPA 1ECCA 1ZD8A 2H52A 2ZBQA 5ILGA 4BATA 3WXBA 1R8XA 3TY5A 1GUBA 1OFHA 1SKAA 1PR5A 3OPYI 2P9QA 3U13A 2W90A 4HG2A 4LXQA 3CXUA 4Q9LA 1AMOA 3U09A 2WWYA 2K2WA 1DT5A 1YB2A 3K31A 4KMRA 1HPLA 4D4KA 5AM3A 1ZVVA 2Z4RA 1NIPA 3BPSA 5LIPA 3I61A 3BC1A 2PT6A 3K9WA 2WWWA 2XCTB 5H02A 4IV5A 3DE7X 3R3JA 3WKCA 5BR4A 3W5CA 4GKKB 2NO0A 4UATA 4LCEA 1KQOA 2YV2A 3S7ZA 3IAUA 3TOSA 2QUJA 4Z5XA 3NNNA 2BELA 4NEHB 1WUKS 1GA1A 3BQMB 3FMIA 3LI2A 4UBJA 5AKYA 5F64A 4DM4A 5BSMA 4C0SA 4DC1A 2OCXA 3HB5X 3D1LA 5D3KA 4A10A 1NBMD 4YO8A 1G4HA 1M5TA 3K73O 4IJVA 3HCPA 2YXLA 3RROA 3ZDEA 1WCWA 2QTVA 1JIKA 1XT6A 3KZNA 1UDBA 3BWBA 2HIXA 2FE3A 1M6HA 4WIAA 4UKDA 2AW3A 3MR2A 5KFEA 2IIQA 1Z5ZA 1WXIA 1Y3IA 2PSDA 3KKEA 2BFNA 2DHCA 5CFOA 3HCBA 4P0TA 3VZPA 3E9ZA 4MZDA 5GAJA 2H48A 3KAJA 1TVEA 2DFVA 2EGUA 4WOBA 4WZBB 4C6HA 5GZ6A 4NJMB 1IATA 1QZ3A 1US8B 3R0IA 5IM5A 3AETB 3P71T 1NBWB 3GEHA 4X3PA 3FE2A 5CGZA 4W63A 2R1UA 3U4QB 1W73A 1RK6A 4N47A 1U0TA 2XCUA 4WZ6A 2PMZA 3QWFA 5KFQA 4RHFA 4CIXA 4C3UA 4F4YA 3H0EA 3SQXA 2V7UA 1VSBA 2BEVA 3A3YA 1PQPA 3BD9A 4ARBA 3JZFA 4UCVA 2OCDA 2RSLA 5AJZA 4J4TA 1GG2A 4YRQA 1A9TA 2HY7A 4HB2A 4PNZA 3KSMA 1DP4A 1KIFA 1KK0A 3GJYA 3IR5A 3N40P 1R64A 3I9KA 3D8UA 3U80A 5T6BA 1M0SA 4C3OB 1AN7A 4FDUA 3T94A 2ZRHA 1PJTA 3A70A 3BKWA 3WJAA 3V2HA 4BLQA 3CF0A 2A0FA 2FEMA 1L5GB 4Y98A 5KTPA 1X3LA 4U6PA 1UOQA 3CRW1 1Z4KA 3LLVA 1P7WA 1Q7RA 1GAQA 1NY5A 2VP6A 1UPAA 4E70A 1ESZA 2Q5OA 5KTTA 2BFOA 1ZMRA 2R25B 3T5DA 5EEGA 1QIDA 3OTHA 3KZVA 3VNVA 3CG0A 3MWDB 1FC0A 3DS8A 5KOHA 2FUCA 2OFPA 1X7HA 3X44A 3O9VA 1XMQH 1D3AA 4GEKA 4WJZA 2CNOA 2J0UB 3CUEF 3CE6A 3R75A 3BJMA 2R93G 2J45A 4RF2A 2R79A 3ZZUA 3ESDA 5HM6A 4JI6B 3I4NG 5L53A 3FTNA 3R40A 3ROGA 3N8KA 3N2KA 1L8AA 3IEMA 3R9WA 5C8YA 2B98A 1ZH4A 3X0DA 4OOFA 2J33A 4XEUA 1NXVA 2H5JA 4S2EA 1E1CB 1C3XA 1LF5A 2OLKA 1GFWA 2BQ3A 1KEUA 3ZWMA 4RTNA 5KYGA 3THYA 1WU7A 5I5XA 2F64A 3L07A 1CUAA 2FA9A 5T67A 1UJ6A 1PS9A 4XWYA 2YQ5A 1QHFA 2LRHA 5G1PA 4HI0E 4WECA 4FEEA 3VHXA 4GBMA 1KI7A 5DFAA 1B04A 5JAZA 1H2BA 1ILWA 1FRFS 2ODAA 2XW6A 4FFDA 2ZU0C 2JFFA 1P0PA 3IH5A 2YHIB 2VDWA 2CHFA 3HU5A 2O7QA 1RRFA 1Z7GA 1RWVA 1XZAA 4JUZA 1UBLS 3QNMA 4KQFA 2QZJA 4Y2JA 4DIEA 1HDCA 1PFVA 2VAMA 1B26A 4JI5B 4CM8A 4CUKA 3FSJX 3G6KA 4DRXB 5A4AA 4K6OA 3SQNA 3VKFA 4XRRA 2ZJTA 2GHTA 2XUPA 4ZOBA 3W3AD 4QEDA 2BMVA 4C0KA 1OH6A 5A2QW 2B37A 2ZJZA 4IGEA 2CNDA 2PT9A 2QVZX 4YJGB 1FFHA 4AF6A 3CEBA 3K2QA 2J6SA 2CLIB 2JIQA 4BAZA 4RK0A 3UVEA 2AR0A 2J9FB 1LNQA 5LDGA 4B81A 3WLNA 3HEMA 1F5NA 4NK4A 4KCGA 2DMRA 2B7LA 4S12A 1ZM4A 5FA8A 4LMYA 2ASLA 1PR4A 3ITEA 4PZLA 1X7YA 2PZKA 4N0EA 3WX0A 4QVIA 3FCCA 3G17A 3LUDA 5C4MA 5H8WA 1S8OA 2IA5A 1FP7A 3IVCA 2DR0A 4A8PA 4AS2A 2QRJA 2X41A 4LRWA 1DQPA 4LF4B 1I24A 2NO7A 3G7UA 1C7QA 1XTZA 3HCAA 2QPOA 3TDKA 1GPUA 3L93A 4CF5A 1WIWA 4AKEA 4BKRA 2YRXA 3AMVA 4XIGS 5KVVA 3PA8A 4UDXX 4BWGA 2G1KA 3N42B 1A8PA 1Z83A 1K7SN 2B63G 1NE7A 4D5EA 1EX1A 2PLWA 3FCSB 2N42A 2E4WA 3JARB 4S1PA 2UUCB 2OVBA 1EP3B 1J21A 2B36A 2CJWB 4A3GG 1VLHA 3BTOA 2GBGA 2VF4X 2ZIZA 4ON9A 3IEUA 4PG5A 3ROKA 3GLIB 1YDGA 4OU5A 4MWCA 4E4TA 3L06A 4ND7A 1K89A 3WR5A 1G3IA 3EG9A 1IOWA 1XNRB 4XQCA 4Y18A 3TLEA 3GZJA 5LD2C 3RVRA 3HUDA 3O91A 4EYEA 2XRYA 5L8VA 1YB5A 1JR2A 4J3NA 1EP1B 2JVKA 2OFXA 3RG8A 2IFTA 2P77A 1NX9A 2Y6UA 1QH1B 3KEMA 4TV8B 5DBFA 3IXLA 1LCIA 5BV0A 3HACA 3ZX5A 1JU9A 3AYHB 3GN1A 3DOUA 1IUPA 2EKDA 1Z18A 2B8JA 2G1AA 4C03A 4JYPA 1ID1A 3V4ZA 3OU7A 4PGAA 5MN6A 4RESA 3X1JA 1COZA 3N2LA 4UUNA 1SZCA 5T4EA 4I1VA 1B1CA 1FJ2A 4LDRA 1B0UA 2GN4A 1K4YA 4XM2A 5IVHA 3KT3A 3GDGA 5LQRA 4GSKA 4OI2A 3B2NA 1VQ1A 3DG9A 2I3AA 1FSPA 3GA7A 1WTAA 4JCCA 4U02A 1L7MA 2AD1A 1PDOA 2WM2A 3PO2G 3N7AA 4CG0A 5EJ5A 4QU8A 1DC7A 5GJBA 5IBRA 3C3XA 1K7CA 1C1DB 1FSFA 1GCAA 3TGPA 2Q5HA 3WWDA 4ZN6A 4DSTA 4RH1A 1SYXB 4D9BA 4G5OA 3PF8A 3H19A 1RLJA 3LGSA 3JX9A 1QH0A 1QHNA 3QXHA 3KJZA 3ZG6A 1VPVA 4JI4H 1RABA 2BFEB 1CRLA 4MVJE 3CSUA 4RA9B 4NCIA 4LHEA 3Q3JB 1TJYA 2VRWA 2XCLA 3PSHA 3FYUB 3TW0A 3I28A 3O0TA 3IKJA 5EZQA 3E61A 3V3KA 5JS6A 3VTKA 4N7JA 4AD8A 4BXOB 1W75A 1JRLA 4ZCPA 2KSWA 5LQDA 2FWRA 3A06A 4UU1A 4FI3F 1HLGA 4OJTA 5CP8A 1PT9A 2ZYGA 3KLPX 4KH0A 3BDIA 1YASA 4NAVA 4UULA 5D3MA 5BQPA 3WK7A 2DECA 4DSAA 4ENUA 3AUFA 2QE7D 3EY9A 4GI7A 4CM1A 1Z7WA 1TCBA 1O6FA 1ZK2A 1Y3CE 4BP1A 4RUCA 2R7ZG 2AZ4A 4RQTA 3WGTA 4DBLC 5CAEB 1O1YA 5K6TA 4AYBE 2YFQA 3DV2A 2VJCA 1EE9A 1RQ7A 1BMTA 3KL2A 4OXYA 5IX8A 5J3JA 1NASA 4B8WA 1NBAA 4PGGA 2BZ0A 3OLWA 3DAOA 3E7DA 2P4QA 1K06A 2VJNA 1XTUA 2X15A 4KDEA 4C4XA 2V7PA 3EVCA 4L4SA 1I6MA 1MPXA 1APBA 1Z7BA 2BIFA 3JQEA 4RNCA 2JKVA 2RDIA 2L0XA 2AFHB 4TVBA 3S2EA 3TOVA 2XCQA 2NG1A 1G0NA 1J9GA 1XB2A 1FTNA 1TAHA 3MEQA 1P5RA 3AV3A 3H42B 4X3OA 3RS4A 1E1YA 3DJFA 3UENA 1H5QA 2QVGA 1O95A 2BFCB 1PDVA 2LNDA 3AFIA 3EGXB 4FXOA 2WFLA 4QAJA 3ZUPA 1Z6PA 4LJKA 5IG2A 4A6EA 3OMWA 4HOYA 1SBNE 2B99A 1BD4A 3WLLA 2AR7A 3OE5A 4W1SA 3UJCA 1YULA 3ZZTA 4CLRB 5KU7A 1U2ZA 3ONEA 1DAOA 3NBQA 2V45A 5JAUA 1MKYA 5ELMA 3I5UA 4TQSA 4UCRA 3JZAA 3NASA 4OP2A 5LQJA 4KREA 3LYHA 1WSWA 3TFOA 2A5YB 2R8YA 4AW9A 3H1GA 5D1OA 3B53X 4QVGA 4AJIA 1UXJA 5TSDA 121PA 1H8HD 2J5BA 3CJQA 5JMWA 5F9FA 2PD6A 2DF8A 4N18A 2H1IA 1SQGA 3OX2A 2QRVB 1T25A 3BGDA 5KHLB 5EE3A 5JRZA 2IZ0A 3U3MA 6ABPA 4A6DA 1D2EA 2GB4A 2I1WA 3K0KA 1A9RA 1QYXA 1KU6A 1MRNA 3KXDA 4X1IB 2JEJA 5FT9A 1P75A 4NBNA 3OQBA 3JAMW 2QTTA 2BKLA 3EXFB 2O8VA 1GTRA 3HJCA 1UT5A 3K0BA 1W2GA 2F3PA 3QVOA 4X6UA 2JFXA 4YGXB 5DBOA 5BSHA 5K20A 4G1VA 3NTVA 3PVCA 5E0KB 2O2IA 1Y4AE 2XT0A 3LKBA 3RRZA 2FUEA 4KXUA 4QDUA 5DGBA 3EMKA 4UBKA 1XDZA 4EKGA 3A27A 2JAXA 4PW0A 5PNTA 2ZUTA 1H6CA 2Z09A 2XCSB 4A27A 4DM3A 2ACKA 4NDNE 5IAJA 3OCYA 4PHGA 2FZ5A 4F7DA 1QGAA 1TTHA 1VBKA 3G5MA 2ASJA 2P75A 4DMRA 1NATA 2EJUA 3QEOA 1IK4A 1NP7A 4B7AA 3Q4GA 3GPCA 1WRBA 1Y82A 1CXZA 1K2WA 4LC9A 4XEHA 2W6JA 5IBCA 5LYJF 3GQBA 1IUKA 4I1OA 2AZMA 3UO8B 1I1NA 2RC6A 1C9DB 5SYNA 3OPYA 2C42A 4ESHA 1IAQA 4DB4A 2JIPA 1JIXA 4C06A 1JJIA 1VPWA 3Q6NA 3QVKA 3IPXA 2O8NA 3MJTA 1YU9A 1VJ1A 1X94A 2Z1MA 3OBIA 5DXAA 5EJFA 4BNTA 1G18A 1EXWA 1TLLA 4U2DA 5EJ9A 3LH5A 3H18A 1G2OA 1NXQA 2QY6A 1FUEA 4QWAA 3DQQA 5I4IA 1YFLA 4Q8FA 2DPHA 1ZVKA 3ABRB 1HI9A 5ITSA 2CLFB 1TUBA 3CZMA 3WK6A 3MT0A 3OCWA 1EFDN 1WZNA 1B1AA 1MJGA 1ZO8A 3NTRA 4RIIA 4URYR 2NACA 5JSYA 3TJRA 5JT1A 2NP7A 1RXIA 3P0HA 3A6KA 4BL5A 1C30A 4M1SA 1WNFA 1PKXA 4BBSG 4TLLB 1ENOA 3PDJA 5HDBB 4D9KA 1X7WB 1VHQA 1P1CA 2F2TA 3E3OA 5AXAA 1E0KA 1C3EA 3E9DA 4A3MG 3LL7A 4L8LA 4TMKA 4N54A 4TTIA 1P77A 4UUBA 3VX4A 2D00A 2FKNA 3H6KA 2W57A 4YY3B 5HZGA 3TECE 4H2DA 1W85A 3WMEA 3VSEA 2FOXA 2ZRIA 3OQNA 1S3GA 2VJMA 2GTHA 4H4CA 3HVHA 4RQAA 3P2EA 2OZKA 3RC2A 3WZ2A 3ZE1B 1R0LA 3BXZA 4FMDB 1JJBA 1E58A 1R0CA 1KVTA 1SAYA 2E89A 5IC4A 2AN3A 4M36A 1DS6A 4KPFC 4Y8VB 4C88A 1PYGA 5FV7A 1FOEB 3GA5A 3QMWA 5L3ZA 2ZUCA 3CW9A 2YIJA 1R8SA 1Z13A 1CHDA 4KC0A 2J9RA 3GFPA 3PXEA 4DXDA 1Z9BA 1IZ8A 1XAGA 2WTMA 1U1CA 1FS5A 2YW9A 1OJ7A 4CIAA 4R7RA 2WQZA 4ZTZB 1MT0A 3HLYA 4TYPA 2AK3A 3PQCA 1N2CE 2OLSA 3SZOA 3C8UA 3ZCTA 4B84A 4EFKA 4ZEWA 5IVIA 4LE1A 4G2NA 3WADA 5AFSA 3GVPA 1K1QA 2CBGA 3PVZA 1NW3A 1XA3A 2WD7B 3CEPB 1Z33A 4Q37A 3O4FA 4XDGA 4YRDA 4OKIA 3BACA 4L5AA 1DV1A 5DHUA 4A1OA 5DW3A 1Z4LA 3ZDRA 1JG1A 2BEWB 4YFYA 1Y6RA 1Z2DA 1R0SA 2QX8A 3B82A 3DYIA 3LVQE 2XHEA 4BTVA 1WXFA 5A1JA 3DPUA 1BGVA 3QE3A 1MD9A 3Q15C 1WBDA 4D41A 2YS7A 1CQZA 1EHYA 1IEQA 3QX3A 3BIXA 4CIBA 1PSZA 1DIHA 1Y4SA 4H3SA 4KI0A 4ARZA 4CE5A 3KE8A 3QFTA 3MWEA 2RGXA 1XPJA 5JQWA 1R6DA 2Y92A 3O4IA 3LX8A 4XCQA 5KT5A 2C04A 1XTJA 1ZW6A 5K8TA 1NKSA 1P73A 3RQIA 1RBQA 1SVOA 4EKEA 3VHQA 1JHYA 2E6KA 2ZJAA 3D3QA 1Y80A 1BMDA 2XD4A 1O03A 4S3MA 4URUR 5DYYA 5EXSA 3RUDA 2VNJA 4DR4H 4RWZA 4ARUA 4D4JA 4RTPA 1HOTA 3FUCA 1TIBA 4CN8A 3UY4A 1JG2A 1P1FA 3VI4B 4FIZA 1EK2A 5BURA 4O2AF 1MABB 1QO0A 1NJFA 1YA4A 1VJ5A 1X2BA 3C3WA 1J0DA 4COKA 1RAGA 4EEZA 8ATCA 4ZV4A 4IJWA 2JJ2A 4YAUA 3LUJA 3ASVA 1JQJC 2B8EA 2BHRA 4CKEA 1RBZA 3PR4A 3CKLA 1ISSA 3T3GA 2V9PA 1CUHA 3REFA 4MVJM 1UKEA 1B41A 3C98A 4DADA 2QTFA 1OWLA 4U9HS 1RI1A 4NIMA 4Y6OA 4IVPA 5DO9A 4E32A 3BERA 1XLWA 4MIKA 4MLCA 3AWIA 1ULAA 2BDEA 4OGFA 2ESRA 3LYLA 4LF9B 4LV8B 5KKNB 4WKCA 4QQNA 2V8OA 2HQRA 3B20A 3CV3A 2FPGB 3DAHA 1P74A 1QG0A 5DGHA 1FRVA 2C5EA 2R48A 4WINA 5KYWB 3DDOA 3LM8A 3KSUA 1KP9A 2G8LA 3KO8A 4O2LA 2WT4A 5G02A 4GM0A 4XB6B 4EBDA 1LTQA 1GSAA 4S1TA 1BOOA 3KQLA 3H9GA 3W1WA 1RRVA 4K6GA 4Y9TA 5KG7A 4YN3A 1M73E 2QN6A 5GWXA 1LZLA 1T8WA 1JFLA 3GEBA 3NCHA 4FYHA 3BQ1A 3SQLA 3LXRA 4ZVKA 1SIWA 3MG9A 4K9QA 5LQCA 2IXEA 2QP3A 4Y2TA 2BZGA 1JLKA 2AFVA 2E4VA 4UOZA 4O7SA 1LX7A 1VYTA 2A0KA 3ILSA 3QG1A 3U3RA 3EYAA 3LT1A 2QZ9A 3A10A 2OKGA 3CTMA 4LRTB 4Q4AA 4YPFA 2AI2A 2BD0A 5J4HA 1KY4A 1XQYA 2OZEA 2QPAA 3R0VA 4AJKA 4ES6A 4OYLA 1RWMA 3VBCA 2ACVA 3RSHA 1NVBA 1SA0A 2DPLA 4ID9A 4QDOA 4MUYA 4FDTA 4TX1A 4IOMA 1NZFA 1X77A 1CLUA 4R1SA 2I1LA 4CM6A 3RB3A 1C3JA 2YIVX 3CINA 3WLTA 2X22A 3FPJA 3H2HA 4M1QA 4RVOA 1M1YE 1DJLA 2E49A 2YNMA 2YY5A 5AOCA 1WABA 1EJ2A 2QW1A 2JZCA 2WSSD 3PBKA 4BNNA 2VF8A 3LRPA 3SJZA 2PUAA 4J9VA 4RUKA 1DIBA 1OAOC 1UL1X 3VSBA 1DBQA 1EUDB 3AVPA 4Q12A 4X8HA 3QFSA 2FDRA 1Z6QA 1C2TA 1KJZA 4JBHA 4E2FA 1AKQA 2G3YA 1KO8A 4OHZA 3Q8PB 5B2FA 5JASA 2ASEA 3V1LA 1V8ZA 2W42A 2Y9PB 4P8RA 5I5WA 1SUSA 2OV1A 3VU8A 5L3SA 3NBMA 1ZCFA 3H05A 3W2EA 4G0ZA 2WM3A 3PNSA 1QCYA 1TE2A 3EDRA 1KETA 1II9A 3WMFA 4DWWA 4AROA 1W6UA 2ZVPX 3HP4A 1P60A 3DMRA 3GJ4A 1RRKA 2OEPA 3N0TA 4MJXA 2HVRA 3TRFA 3UCXA 2NV6A 3D2BA 4N3BA 4MI6A 2ZXEA 4YCAA 1PL7A 2FQXA 2L42A 3Q7TA 5AIAA 3OIWA 5EHQA 2GM5A 1PWYE 3ANSA 3DLAA 3OHPA 3AJDA 5F2KA 1HEUA 4OQYA 2HHJA 5AKJA 5DGXA 2XQFA 2RAPA 3E18A 3O83A 1E5VA 1FNNA 3AEKB 3LHFA 3HJFA 4LHZA 3AOEC 3R0ZA 3W9YA 2EWWA 4BNDB 1UJ4A 3PNQA 7YASA 5DG8A 1V95A 1V8BA 2J3DA 3EEBA 4DV3H 3EVEA 4AIIA 2OHIA 1Y1LA 1VCHA 2FGJA 1A2OA 2XGSA 3NIWA 3QEJA 3RK0A 5KNLA 4NXNB 3SJCA 3B38A 2VDLB 3UMBA 5JH7B 1TFUA 2NUAB 2H08A 3NWBA 3UTCA 3G02A 4A82A 4F21A 3HUEA 2D7JA 1X7ZA 4QELA 2R1ZA 2VZ9A 1PR1A 3IAXA 3LOUA 4GNRA 5E7IA 3G5UA 5K0TA 4D45A 4ILEA 4C4ZA 5KQGA 1NNEA 1UMDB 1T2CA 4Z86A 2VHQA 4ESOA 3M81A 1UXGA 5C7YA 4RL6A 4ED2A 1TVKB 2R6HA 5F52A 3L1HA 3WDMA 4O7NA 1OLUB 3E22B 1I2LA 2PUEA 5LP6F 2GYUA 5CA1B 3OE1A 4U7JA 5CB6A 2JLVA 1QYWA 3I62A 3WHPA 4HLQB 4RETA 1KHHA 3AU8A 5C4GB 3W5UA 3EEFA 4MB2A 2OBMA 1OZFA 4AF7A 2I78A 1W8DA 2FP3A 4E2YA 4LV5B 4OHYA 1XCJA 3MN1A 3QXSA 3L1IA 2BRUA 4L8FA 2PPVA 3V8PA 3R5JA 1DI0A 4CU2A 1MW9X 4HQ6A 1SU6A 3AM5A 1RQ2A 5KYYB 3OZSA 4PLZA 1NI5A 3ORQA 2BZSA 4PZ9A 4XVRA 4R4JA 4WL0A 5KQMA 2A3NA 1W36D 4D9EA 2OH2A 4WESA 4W8HA 1U5BA 2OV8A 3ZXUB 1Y4DE 3MFYA 2M6RA 4GLBA 4L07A 3TQOA 1V6CA 1CJBA 3DEJA 1GUYA 2FN4A 3MRVA 4NCJA 5HK8A 5K3FA 4DSUA 4I3FA 2CCGA 2J9YB 1HNXH 1QJ4A 5IYCG 5LQAA 2ZETA 4XYLB 3AONB 1LSOA 4EO7A 5KSPA 5JVDB 4JV2A 3Q7QA 3F6CA 2LCQA 2FAXA 2Z3ZA 4NMHA 3ZV3A 5C1IA 2VFAA 1T5DX 4OA5A 4YRRA 4L6CA 5B36A 2HC9A 3J80W 2PZAA 3ER6A 5FQOA 1YC2A 3T1OA 3A6HA 3H2IA 5JTUA 2WV7A 3KD2A 4EG1A 4NOKA 2YWXA 2RCYA 4ZRDA 1RYZA 3IQWA 4EUKA 3MOSA 1T4GA 2H59A 4MIOA 3A37A 4LJ6A 5HF6A 4ND6A 2X2OA 2C9YA 1FA9A 3B5IA 2ZSIA 2HJGA 3HA5A 4PGFA 5DLQC 3ZE2B 4FB5A 4LNHA 1MA3A 1AO3A 1NLMA 4Q48A 4YHHB 1F4PA 1AKEA 3JVIA 4CT5A 4JYAH 4YMHA 4IDQA 4HQKA 2YHBA 2C00A 4OVKA 3S44A 4ZJYA 3J81A 1JJAA 1IOLA 1GFSA 4U7PB 3RKUA 1VJCA 4TVKA 2ALZA 1ATIA 4OI4A 4WY5A 1Y48E 4N6NA 2DM6A 3WMXA 3L92A 5CA0B 5K8IA 3RVNA 2VIIA 1B8PA 4JC0A 4E1AA 2FZLA 2IODA 1OW3B 1ZXXA 3IV7A 3RTGA 2R11A 3FFTA 1L9XA 5JBIA 1IOVA 4KJXA 3W04A 3FVTA 2BTEA 3M5PA 4ZK6A 3ZGVA 3SNOA 4UM8B 1XXHB 4UU7A 1Q0HA 5F78A 1T8SA 1YU6A 5JJCA 3DBHA 1U3CA 2O8FB 3EIEA 5JU6A 1YI1A 1XRLA 4GSLA 4PLTA 3Q85A 5DE3A 1GNSA 3IR7A 4QO8A 3U81A 1RC1A 1E3MA 1TO1E 4GKJH 2Y1LA 3EEQA 4RVDA 5D6NA 5FOTA 3NBKA 2QMZA 5FIUA 1EZ4A 5DQGA 1CY6A 2ENUA 2XF8A 2DLNA 5BW5A 3IKVA 3R9XB 4OQXA 2R8XA 3A1WA 3HA3A 3ZVLA 3MTIA 3R7DA 4QDTA 4XTRA 1JZTA 3OURA 4HRXA 4DL9A 4DMMA 3PV0A 3JZIA 5LBTA 3M6UA 4BZZA 5LU8A 3RHTA 1LTHR 3OTIA 1RI2A 1JFSA 4PC2A 3VA7A 2BR0A