1GLVA

Three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
299
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the glutathione synthetase from Escherichia coli B at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
molecule keywords GLUTATHIONE SYNTHASE
total genus 93
structure length 299
sequence length 303
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1993-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1glvA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1glvA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1glvA01
3HBLA 3BG5A 3BSSA 1GLVA 4IIJF 1I7NA 4C5CA 4I50F 4RZQA 3BFPA 3I12A 2YS6A 4O86A 3NUAA 5EZYF 1AUXA 1T36A 4ZQIA 5LP6F 4GGMX 3LP8A 1Z2NX 4MV8A 4ZHQF 1VBHA 1ULZA 4O7WA 2CZGA 3KREA 3JRWA 5HV6A 3VMMA 4EGQA 3HB9A 5J2UF 4MA5A 5LA6F 4O7SA 3TQTA 2R7MA 2R7NA 5DMXA 3RUPA 2YZLA 4HNTA 2W6OA 3N6RA 5C1OA 4DLKA 3R9RA 5HBRB 1EYZA 2QK4A 2XCLA 5CA1F 1CE8A 2WYOA 5LXTF 2YYAA 3RFCA 4C5BA 4C5AA 3R5HA 4FFMA 3U9TA 4M9CA 2GLTA 2CNVA 4EA7A 4IZOA 3U9SA 1W93A 1GSHA 4MV1A 5BPFA 1KC7A 3WO0A 4YJ2F 1CS0A 3R23A 4E4TA 4WBNF 2R6FA 2ZDQA 4O7TA 3MJFA 2CQYA 4L1KA 4FU0A 1JDBB 4O7ZA 3DF7A 3K5HA 5K2MA 3ORQA 2YWVA 3GLKA 1M0TA 2YL2A 5BPHA 2I87A 3OUZA 2W6PA 2R84A 2C00A 4FFNA 2NU6B 3KALA 3V4SA 2R85A 3SE7A 4TUYF 1KJJA 5CAEB 5JQWA 3TINA 3K5IA 4YBZB 4FFOA 1GSOA 2QF7A 3Q2OA 1C3OA 2GPWA 4MV7A 3BSYA 4FFLA 5FNVF 2V58A 1JDEA 5C8YF 2NU9B 1DV2A 4IWXA 2DWCA 4O84A 1W96A 4J6EA 4XX0B 1BNCA 4YAJB 4FGRA 2IP4A 1E4EA 3WO1A 2I8CA 4O4IF 5CB4F 2YW2A 2PN1A 4O4JF 4QSHA 1DV1A 3G8CA 4XZ3B 2GQRA 5JVDF 2VPQA 3KAJA 1CQJB 1IOWA 2X0SA 1KJ8A 2DIKA 4EGJA 4M9UA 4I55F 1KUTA 3VPDA 1B6RA 5CA0F 1EUDB 2GPSA 2XD4A 1OBDA 5IYZF 3G8DA 3MWEA 2YRWA 2NUAB 4FE2A 2VQDA 4ZI7F 4Y8VB 2W6ZA 4XYMB 4XYLB 2YS7A 2YZMA 5D8DA 4O7NA 1KJ9A 4O7LA 5JQGF 5BMVF 4HQ6A 5LYJF 3ORRA 3HO8A 3U54A 2R7LA 1UC8A 1Z2OX 1A9XA 1I7LA 1PK8A 4MV6A 3ETHA 3GIDA 2W6NA 4YJ3F 2W6MA 4M98A 2VHEA 2YZNA 4O2AF 3VOTA 2V5AA 3R5FA 5H80A 2I80A 4O7YA 4I4TF 5C1PA 3OUUA 4HNVA 4EG0A 1KJQA 2DLNA 3UFXB 3RV3A 1CQIB 3JRXA 3AW8A 1IOVA 3KAKA 2NPOA 2CNUA 3E5NA 1JKJB 5J2TF 2R82A 5LOVF 3U55A 3V4ZA 4MV3A 2FPGB 2YRXA 4EABA 4O2BF 2R87A 4MA0A 5GONF 4HNUA 1EHIA 3K3PA 2FPPB 4DIMA 1UC9A 2Z02A 4IWYA 5JH7F 3LWBA 3TW6A 1DIKA 4TV9F 4ME6A 1KBLA 1M6VA 4YAKB 3RV4A 1C30A 3R5XA 4MV9A 2OLSA 3QFFA 1BXRA 1PX2A 1EUCB 2W70A 4O4HF 5KKNB 1OBGA 2ZDHA 3TIIA 2HGSA 2ZDGA 1SCUB 2PBZA 2V59A 5I47A 2W71A 1VKZA 1WR2A 2FP4B 4O7VA 3VPBA 2FPIB 1VBGA 4YB8B 2CNQA 1KEEA 2NU7B 3VPCA 4TV8F 4O82A 3JZIA 3Q1KA 4EA9A 2J9GA 3WNZA 1JLLB 3TIGA 1E4EB 2HJWA 2Z04A 4O81A 4ZOLF 3ETJA 4HR7A 2P0AA 3N8DA 4O7RA 1A48A 4EA8A 4O83A 2DZDA 1B6SA 2R7KA 4FFPA 5KX5F 2FB9A 4MAMA 2R86A 2YZGA 2W6QA 1GSAA 4O4LF 4M99A 1Z2PX 4IHJF 4NYEA 2GQSA 2NU8B 4MV4A 1AUVA 4WD3A 3JZFA 1KJIA 3MWDA 3VA7A 1M0WA 2PVPA 4EAAA 2VR1A 3AX6A 5JVLA 2SCUB 1GGOA 4FFRA 3BSWA 1EZ1A
chains in the Genus database with same CATH superfamily
3PZPA 1E2IA 4KE9A 3BMNA 1TYBE 4X41A 1ZCBA 1GZ7A 2UVVA 3G59A 5F64A 4TTJA 3ESAA 4RPHA 3Q8LA 1QYDA 2AC2A 1QRDA 4XIJA 3BXEA 2AMVA 1QVRA 2C0QA 3HA3A 1K4MA 2APJA 3AEQA 4CT0A 4GDFA 1FIUA 2ZIXA 4J0CA 2R8RA 4QO8A 4ALJA 4LXQA 4Z6KA 2JGDA 2W90A 4ZJUA 5FD6A 3T1VA 5KFIA 3AJ9A 3ZOZA 4KIJA 2Q5QA 4M1KA 2W2VA 4Z1MD 3GTKA 3DHEA 3FBTA 1L7PA 1CT9A 1H4SA 3N07A 3LVBA 4JYPA 4RQAA 4FM9A 3TEKA 3HOVG 2W0SA 2W9XA 5C8XA 1T2NA 4C20A 4RH0A 1KBOA 5LD2B 3PUYA 3OEED 1YZHA 5DHRA 1QRRA 3MMPA 1RWQA 4X61A 2I34A 1NJ5A 2QMHA 3UA3A 3BCUA 5M29A 1UP6A 5BV0A 2Z9DA 4CKBB 4CIWA 1PJAA 3FI0A 1OPRA 3DVAB 4ZHQF 3LCUA 4URYR 1I51A 1L5NA 1N5KA 2C03A 4Q6BA 4WHXA 1U9JA 3D4LA 3AIKA 3LKVA 5DNDA 2QORA 5U9CA 4KOEC 2Y77A 1ULZA 2CVQA 1ESNA 1LPNA 1BMFA 2DHQA 1ORTA 2QGZA 2E4AA 3JQ9C 1KEWA 4ND8B 4OPMA 1W1WA 2WJIA 3ESZA 3NBZB 4KUEA 2Q5OA 4JLDA 1OXVA 3UICA 3AGQA 3ROKA 1ONNA 3E9QA 3Q5EA 4FSXA 4HXEB 3ZNOA 5KSOA 4J94A 4BO2A 1PWEA 2C84A 3KL4A 2YV1A 2WHYA 3IVCA 1JX6A 3GCDA 1Z63A 5CTAA 5FPOA 3R7LA 3ACDA 2R7MA 5D6NA 4UKDA 1WOMA 1D6NA 1LWOA 1TRHA 2ACWA 2CKZB 3MBOA 2J0UA 3AOGA 5E4YA 5C4GB 5IP7G 1MNAA 1VRCA 1TT7A 3RS8A 3W9SA 5L4NA 4YT2A 2XQFA 1XTQA 3NC0C 3AO0B 3I0MA 4X8LA 2RK6A 3EVDA 3WBKA 3R3WA 5EJ5A 2VBGA 3M6XA 2HO4A 5EOYA 3I72A 3JWEA 4DARA 1A4RA 3K2QA 5BWTA 2P5UA 4QJIA 4EUNA 4RDXA 1Y7PA 3OFVA 3ZIAA 4EB8A 2YYAA 4PC6A 4DR7H 1AN0A 1NF2A 4C5BA 1QONA 1Y8QA 3K2BA 5FBWB 2EFJA 3AZOA 1J49A 1E59A 1R6AA 2CXSA 4V0LA 2ZUTA 4F0JA 2X0RA 4NOLA 2PUDA 1NBOA 3PFIA 4OFZA 2F43A 2QTHA 1WMEA 4KQ1A 3ZDXB 1NI4A 1T2UA 5AVQA 1L4EA 1QGUB 3KZMA 4ILEA 4MSUA 1SO8A 4XSGA 1I8TA 4O4LA 4PO1A 4UAJA 2JARA 5A2GA 3TQSA 3TQHA 1NBEA 1G5RA 2ZWAA 4QUKA 2JLZA 1UINA 4HYEA 1I2ZA 1M1NB 2V6IA 5U4QA 2UZIR 2G88A 5LD2C 1ZISA 3MRVA 2JS7A 3FAKA 3FNFA 4MV1A 2VA8A 4DPLA 1MA0A 3KJNA 3ONEA 2ZR9A 1ZHHA 3FNRA 4IFEA 3DBRA 3DKVA 1ZRHA 2WY2D 3O83A 4HEJA 2VP3A 5BSFA 4W82A 3T5PA 2V0GA 1HLFA 2FK2A 2Q8PA 4I1SA 4TL8A 1CRWG 1VYVA 2ZKLA 1KK3A 5ESWA 2JAQA 1IZ8A 1C8KA 2VUHB 3GFFA 4IDFA 1XVUA 4IX1A 2VQ3A 3QP9A 1GY8A 4OI2A 1V4YA 4M54A 5EUMA 1DNPA 4HEQA 1YJ8A 5HJ7A 1K66A 1V11A 5AM4A 4RKQA 1GZDA 3WK4A 3M4IA 1C14A 3A1CA 3N74A 5JATA 1TT5B 5DGAA 3KJEA 5LZ9A 1P75A 3FZYA 1PL8A 4UAUA 1PBNA 1RZ3A 2GWHA 5AM2A 1JYFA 3T5MA 3TPCA 1OTXA 2VPIA 3VPHA 1Z2AA 1QH0A 3KQHA 2UVPA 1N0VC 4TMYA 2W42A 3TZLA 1HDEA 1KZHA 6ABPA 2UUAB 3JWPA 4CI0B 3N8NA 1KYWA 5JCOA 2YKGA 3MIZA 4JWKA 2D1RA 4RZ2A 2WSLA 1KU0A 3IDOA 2XCPA 3GZTB 2GZAA 3V6LA 1DT5A 1AXGA 2RH9B 3HCDA 5JLAA 3OE7A 5HNEA 5DHQA 4YREA 4FZVA 4IMPA 5BURA 4KQ6A 3QELB 1P1BA 1Q7CA 2CK3A 2IUYA 4OYLA 3LP5A 3K5IA 1WETA 3TN7A 2JVKA 2FHSA 2IU6A 3A1DA 4GE3A 2W9BA 2QY6A 1JVSA 1MG0A 4M7EA 4M36A 3DJYA 4JBWA 4IGIA 2OV6A 4C0HA 1PL0A 1XTPA 2ZU0C 4YRGA 3GJXB 4LRXA 3O8BA 3K0HA 3OEHA 2ACEA 3UT5B 4D7AA 2ZPTX 4CQNA 4OHCA 5B7NA 1IRIA 1X86B 4FFLA 2BFNA 3THWB 3DWGA 1E6WA 5EE9A 1ZQ7A 5G4KA 5PGMA 5L7WA 4HQFA 1KMCA 1KFBB 4Q1BA 1THGA 2WG1A 4WTOA 1E5VA 3V3KA 4ETIA 2F9LA 4TT3A 1ZKDA 1XCGB 4A3EG 2V0CA 4KQ2A 1JZSA 1JVNA 4NL4H 4M1SA 4LJRA 2OYSA 1JLMA 1W96A 1VJ5A 1WMAA 1CIJA 4EATA 1WLYA 1Z2DA 4GDMA 5FTWA 3EEOA 1XRNA 4RJJA 1A2KC 1TT5A 1XNHA 5KNCD 2JIPA 821PA 5LYJB 1EX6A 3AM5A 4J1QA 4XTCS 3KKNA 5KFHA 4HB0A 4W9MC 4TWRA 4YRRA 1E4EA 2D1SA 3NHJA 2FPKA 3IVXA 4NDNE 4WA8A 4XX1A 3T12A 3TL2A 5BVGB 1LA2A 3CEAA 1Q12A 3VR3A 2BJVA 1CSEE 1C9JA 4YAIA 2VJKA 3V7NA 2BSAA 2J3EA 1U28C 5IJXA 1ISSA 1WXHA 3PPIA 3DCNA 4I66A 3ZCQA 4DJ5X 1WDWB 5BV1A 5LQMA 3ADBA 3I9NA 2VRCD 1RZVA 1G7RA 1XVIA 3I9V6 3FVQA 4RHEA 5FL7D 1U0GA 4MTLA 3IR7A 4H77A 3WL7A 4CCSA 5BSHA 1I0LA 3BACA 4HBZA 1Z73A 4HDQB 1CHDA 4LX8A 5EJMA 4DXHA 1F9AA 2L18A 5HILA 5GZ1A 2WU0A 1G3QA 1QHHB 1GCOA 5ERYA 3FGOA 4FB5A 1C1DB 3WB0A 4YMVA 4TXJA 1N32H 3EZ2A 3HR8A 4NXNB 4UPEA 2P75A 4XR4A 3DEIA 2I2WA 1DAHA 1L4GA 5HCUA 1AVTA 3VYTB 1GQRA 3NZEA 5DIFA 2QJOA 4QZVA 3GAFA 4RNNA 4RA6B 1Z4QA 1Y6ZA 2ABWA 1OUMA 2FXIA 3ONDA 2YICA 2UUCH 1TF5A 3RVMA 3MA0A 4CXMA 2QM8A 4D8WA 1DTWA 1II0A 3OLXA 2CT8A 3S2ZA 3H17A 5IAGA 3H5RA 4AIIA 1UJ5A 2F62A 1FX1A 1N9GB 2CLKB 4HWGA 3FDZA 4Z2AA 3QE9Y 3O8OB 2YZMA 2POCA 1H4VB 3C5VA 5KWVA 1OI4A 1UBTS 4ZAWA 5B53A 1EG7A 2GZSA 3CJQA 4OEHA 5KYNA 2BE9A 1TQ8A 4I5EA 4V2IA 4FNOA 1KRWA 3BIFA 2ZSHA 1JE1A 3QZUA 4L2IA 2ZUCA 2ZM6B 4GQBA 3TG2A 1UBEA 4H3VA 3TE7A 4HQ6A 3LTNC 5CLJA 3T99A 2E4XA 3DO5A 4DA9A 5EIEA 4FS2A 2RHTA 1IBMH 1ND6A 1DBWA 3H0KA 1OA1A 1O96B 2LKCA 3Q11A 4ALKA 5HWSA 5HXAA 3IJRA 3FHTA 3IIMA 1BOFA 1KEPA 1J0BA 4IS2A 1OV4A 4RGBA 4CCWA 1HSOA 2EBUA 1OA0A 4P80A 2IU4A 5ILOA 3VO1A 2OD2A 5KTTA 2ZIVB 3ELUA 1S2IA 2I4IA 5LQSA 2VDKB 5AVTA 2LZ0A 2P4HX 3PW7A 4RZIA 2GZHA 4JYAB 4JK3A 1OFUA 3MSXA 1JS1X 1MO4A 4GI7A 5M7EA 1JHOA 1QPZA 1CRPA 5DX0A 2VEDA 4NF2A 5F51A 5BQ5A 1L9KA 4YDQA 2Z5FA 5KVQA 5C3UA 1J2TA 3WGUA 4D9JA 2R96A 4XGRA 4JI1B 1Y5MA 1ZRMA 4XE5A 3E9YA 3UMJA 4W5RA 3MLAA 2P4EA 4QRDA 4C3OB 1AMOA 3HG7A 1AURA 3A6DA 4H6WA 1ICEA 2G04A 1A7UA 3MMNA 4PSDA 3QOWA 4UASA 1XMOH 3WGNA 3X1YA 2SBTA 3FCAA 2V6BA 3H2JA 5T5QA 1ZR4A 3KB8A 4YN3A 1AC5A 1YA6A 3C7KA 5NLLA 2WUDA 3RV3A 2CFCA 4R7RA 2I9PA 5HM6A 3ZTYA 4MZXA 3H05A 3MAJA 5FOXA 5H3CA 1TAQA 3FLMA 2HSJA 4KXVA 3KSZO 3LCRA 3I30X 1EXMA 4IXTA 1ZICA 1VIMA 2AH5A 3PJEA 4MI3A 3ZHQA 4DZRA 4I4TA 1OWTA 1HY3A 1U7UA 2GLXA 2SNIE 3GPDG 3U2QA 1JG7A 1U90A 4ZO9A 3RR2A 1XU7A 3GGPA 1GRRA 2QN2A 4JI5H 3U7IA 3D0KA 4BEVA 1EP9A 3R3JA 5LOVF 3BWYA 4PQYA 3L4EA 5AD1A 1G66A 4FKZA 3VUFA 4A3LG 2QAGB 4JC4A 4U2CA 3N40P 4MTDA 4U5QA 5TPWB 3DULA 2Q3FA 3NTLA 2GO1A 2OKGA 4KLAA 2FZLA 1T0JB 2FQXA 4PBTA 1XK7A 3T3DA 3P9SA 4LEIA 1X38A 4ODIA 1VKHA 3UWMA 4U5XA 4N3AA 1QLHA 3UPDA 1QV6A 4QD3A 4JLWA 4NJEB 1Y4AE 3ICPA 5HOEA 5FD5A 3JR7A 3PSAA 4HEA6 4OMCA 1RBYA 4YJFA 1VIAA 1RYHA 2WOJA 5HFNA 1H9BA 5ETJA 2O3JA 1UZNA 1HT0A 4QICA 4DV6H 3T9AA 3EIQA 4OAQA 3SCZA 2HHHB 1YMUA 3RANA 5IN4A 4A0QA 1F6BA 4ALNA 1BJKA 2NUBA 4XUGB 4LHVA 2NSHA 3U56A 4DCMA 1DTEA 2XH8A 3HSYA 4UCUA 4TGLA 4U7FA 5EUQB 3KQMA 2ZVQX 3T0IA 4LSXA 4S24A 2PSEA 3NGMA 3RK0A 5BW8A 5C1BA 4PLWA 4B8YA 5CB6A 4G0UA 2BKAA 2VAWA 3M9OB 2FUEA 5K0JA 4PF1A 3ECSA 3ND8A 2V7PA 2ZS7A 2FLPA 1RMYA 1CZLA 2QAIA 5SZHB 3CLUD 5HKKD 4MYCA 1L5QA 1JFFA 4RWZA 4C2TA 1P4RA 4PS1A 3ML1A 3I01A 1WHSA 2O8DA 1U3WA 1XOIA 4FBMA 3DNPA 4QASA 3HR4A 4Y6RA 2GERA 1O5TA 2FP4B 1GYFA 4KL8S 4AKTA 4HLDA 1HBJA 2IYNA 2J33A 1D0SA 4YAFA 2WWVD 4R1MA 4ZARA 3VKVA 1JYSA 3PKIA 2OV3A 5P8WA 2R4QA 1HUQA 5F12A 4DM3A 3QU5A 2GYYA 3RGXA 1FNNA 2IOYA 3DGEC 4A2CA 1OYOA 1A2BA 5K0FA 1QPGA 1TXGA 1U0JA 3PI7A 1Z82A 1DFHA 3KR2A 1JDNA 3O9VA 1JHRA 3WGHA 1XV5A 2HHLA 4QELA 4RE5A 3N70A 1FQJA 2WFLA 1R10A 2CJYA 2DMRA 2BI8A 3DV0A 3NCHA 3GMDA 3GP8A 1PEDA 1BJRE 4UUMA 5EDWA 2QZZA 4WJZA 3QQMA 2J9RA 4WXYB 2WTNA 4K9PA 4WNAB 3OZUA 5DF1A 1B8OA 1WUKS 5IXYA 2AOUB 1H8HD 1J5EB 2Z04A 1V45E 1XELA 3N0RA 2FMUA 3LQSA 3DE1X 1KDPA 4O2BB 5KWJA 5K5EA 3UUWA 3FGPA 3Q5GA 3W3AH 3KQNA 3QWFA 2HIXA 2HC9A 4RLQA 5F9LA 4QARA 3I6ZA 2P6NA 2ZPAA 1BAPA 1VCIA 2KSQA 3KOXA 4EA8A 2XWQA 3Q8QB 1T1SA 1HZZC 1ULBA 3DCIA 2QRNA 4PSUA 3TYXA 4URUR 3I23A 1J0XO 3QBVA 2RJNA 3KFXA 1VB3A 3FM9A 1A7AA 2QYSA 1VLJA 1ORDA 2MWMA 2E4ZA 2R7ZG 3MQ4A 3SYNA 5IT4A 4OJKA 5AM0A 1T8TA 4IMJB 3TAXA 1GNSA 3KQTA 3L1KA 4UVEA 1E9CA 4N0DA 1NXWA 2IYXA 4TSRA 5IDXA 4GPAA 4PFQA 1N0WA 3UHJA 1XT6A 3X1MA 2GBPA 2RF4A 1A9SA 1Q17A 2NU8B 3M0EA 4ZU6X 3RKSA 5JWHA 2QB5A 1H2HA 5E25A 2C82A 4GH5A 1YS7A 4C6RA 5J4KA 4A1FA 5JY6A 4WD3A 1QVAA 2UZ1A 2W9AA 3LX4A 3NWOA 2PD4A 4OQNA 5CVDA 3I9JA 3QVSA 5KI6A 1SBIA 5KG4A 3CKKA 4MP6A 4QQKA 2QZSA 4RMGA 1W36B 1P4AA 5BSGA 3MTGA 4ZCPA 9MHTA 2J3DA 3L9XA 3PG5A 4PU0A 3KJXA 2HSGA 5C5DA 1V6CA 2YWCA 3EUAA 5IBPA 4C6TA 1KIAA 4MR8A 3VVMA 1THMA 5HDBB 4MRMA 3STVA 2Z6VA 1P6QA 2QE7A 1V48A 3SHWA 4H27A 1HM5A 3AFOA 3W5IA 1EA7A 1FTSA 5IASA 4DUYB 1N2ZA 2JANA 2Z2YA 3T5CA 3DD1A 4EYHB 4QTZA 3VC2A 3OCCA 3HN2A 3B9PA 3MPUA 1FSPA 4HYYA 2DRIA 1JAYA 1NRXA 3KHRA 2GEKA 4HZGA 3SD7A 3DBHB 2OR3A 3WY9A 3N5CA 4IIJF 3EMBA 4GOOD 5KMGA 4RM3A 3NJRA 4OB7A 5I7EA 2YHBA 4YP0A 4QW9A 2DSNA 1DJLA 4MRVA 3SHFA 3VVCA 2ZBDA 3NP9A 4CG3A 3BGDA 4DT1B 2IHBA 1BVHA 4G36A 1DC3A 5T57A 1E5XA 2RJ3A 4A91A 2XGQA 3E18A 2YS6A 1V1RB 4MMYB 3PFGA 4URXR 1PRYA 1ZJZA 4Z9AA 3PZRA 3UJ9A 3PPVA 3KETA 1WBDA 4CEIA 4WIAA 4JGBA 4ZTUB 3GJ7A 1B23P 1JHVA 1ZL2A 1DWPA 3RTBA 1GNRA 2OBBA 4Q7LA 3D5QA 1L3CA 4XSVA 1JSCA 1BVUA 3H97A 3IOCA 4GU5A 4I8XA 4P33A 4KO3S 5JE8A 3RWMB 4A92A 5K0GA 2PXHA 2G9RA 4LVOA 3T7KA 4FNGA 1OFVA 4US0R 5EMLA 4B82A 4UNRA 5HNKA 2AJBA 1FVXA 4G09A 4I2NA 1OAOC 2KQUA 2OILA 3VR4A 3E35A 2GHTA 4WXMA 1AS0A 2W8ZA 1P16A 1A98A 4RAYA 3VYSB 3O3CA 5A05A 2QYZA 2EZUA 4F45A 1V4VA 4MRMB 4AM8A 3LTEA 4BIIA 4JYZA 2Q3LA 5C2JB 3JQQA 2IOFA 4PAOA 3A3KA 1R64A 1PUXA 1IEVA 1EB8A 1X7XB 2I3DA 3HLYA 5SYAA 5KYXB 2O59A 2IHZA 3N7TA 3OPMA 4XJTA 3VMMA 2GYVA 2DHRA 2JGRA 3I4CA 5BWVA 5BR1A 4TZKA 3UWPA 1KP3A 2BF7A 4QU0A 1E1YA 5BWBA 2CL6X 2RKBA 2H1VA 2PANA 4M9SA 5KBYA 4KGVA 4O7SA 1EJ6A 2OK8A 3ETCA 4O02B 4A7PA 3EXHA 4KAJA 3HJBA 4JROA 4UMVA 5AJYA 1PWYE 3W9UA 6Q21A 4LF5H 1RADA 1A9OA 4NV0A 3CUTA 5AW0A 3W05A 2BVNA 4DEXA 4DMCA 2X2EA 4MVYA 4F46A 1FDWA 1I6KA 1WB6A 3R9RA 1A9RA 2R9VA 3M83A 4CMAA 1FS4A 3VAAA 5ALPA 3NP7A 1WUJS 1ZZEA 4BB5A 4J0QA 3B3JA 2XE4A 1GA1A 2XRMA 3HFSA 1WVGA 4IDGA 4GOLD 1IHOA 4UOEA 1JQEA 4O6VA 4B3GA 1Q74A 2V7QA 4OFXA 1E79D 3WLQA 1K6MA 3MRTA 1Q16A 3V32A 3K53A 1EG2A 4JB3A 2VBIA 4A8PA 2RHOA 5KWEA 2VQEB 5ED4A 2WAXA 2ZYDA 4M1QA 1ZL0A 1KO5A 1C41A 3BWXA 4QXRA 4WEQA 3L4BC 1KY5A 2HJ9A 2H9YA 3OEWA 3E7DA 2Q5CA 3QKUA 3FOAA 4PN3A 2G9VA 4LSZA 5G41A 1QLWA 2WDTA 2EGUA 3OPYB 5AWFC 4EA7A 1U7ZA 1BCRA 1WZNA 4M0UA 2FUG6 2CNOA 3B1JA 4RACA 2ATLA 3NBYB 4PYKA 4UJ3A 2Z57A 2R8BA 4L5CA 4RSHA 1ZR2A 3SLRA 5FAKA 1XZNA 1SXJA 4LBWA 521PA 1LVHA 4DWOA 5JMOA 5AJVB 3JQPA 4C06A 4X6XA 1K7YA 4LNAA 1CUJA 2ATCA 1MFPA 2VJNA 2ZETA 3SZMA 2DQ4A 3NONA 1ZY2A 4ESHA 2HU8A 2FP4A 3WBJA 1GV0A 1PR2A 3T5JA 3U4CA 1XN4A 4LMBA 3LG2A 2EIYA 4KFUA 1NYQA 3FROA 1C1DA 2P69A 3UJPA 1W2WB 4BNKA 2WDZA 1QMGA 1Z6AA 4PZ6A 4V0ME 1A5BB 1F48A 5TF0A 2HT1A 4G0PA 4LC9A 3PJGA 4CBVA 5BPHA 1GYQA 2EJVA 1AX9A 2HBRA 2F1RA 3FVVA 2HHFA 2AFIE 5EJ6A 1BU5A 1JIHA 3II6X 5FOVA 3LL4A 2C7RA 1UKYA 1VAJA 1Z4KA 1ZNXA 3BQNB 4MEJA 3T7DA 3LUFA 3MGAA 3VR4D 1HNNA 2M32A 3HZZA 1KDTA 5L8VA 1YZVA 4WLVA 2EGGA 4ZZ3A 1ACMA 2Z1DA 5L3VA 1GM5A 4RB0A 1TADA 2F3PA 1T5OA 2XYGA 2ZJ8A 2G6TA 4E4YA 2PZAA 3CY6A 5IZCC 4UHKA 2AL7A 1LJ8A 3QVGA 3ESDA 4JI4H 3GRFA 4MQFA 1VXOA 1T1IA 2H57A 3G5MA 1P2BA 4CCAA 4TKVA 5LOVA 2CFOA 3LHIA 2HK7A 2OVBA 1XQ9A 4DJDC 2EBWA 2YC2C 5FBVB 1G8HA 4HDOB 4LXXA 1I7DA 2C88A 4CF5A 2B0CA 3FCUB 5JCJA 3SC2A 1AN9A 3UOGA 5IM4F 3RS2A 2Z56A 2PEZA 4KQKA 4O33A 1ICIA 1IJEA 3GIMA 3MD0A 3QWHA 4FOTA 1YSCA 1CKOA 3DTYA 1OXSC 2SHKA 3JWHA 4OO3A 2QXUA 4RD2A 2C2WA 4YY3B 4NCAA 1DV2A 1SVIA 3AQIA 3B5JA 3FSGA 4RLSA 4M0EA 3W0LB 3ZWKA 2JJ2A 2VDNB 1UZMA 3EPPA 4RJKA 3U4AA 4BPRA 3ADPA 2PH7A 4MGIR 3DTVB 4KE7A 2ZYSA 4R54A 1EVKA 2VQ6A 1AK1A 2MYPA 3O84A 1ZX1A 2LDBA 1YRQA 3PQFA 4FDUA 5FXMA 5A5DA 1F8XA 1N2CE 1R3DA 5K0BA 4MW0A 4DPKA 4IHJB 3HJCA 3CW9A 3USES 1BOOA 4B44A 2HU2A 5KVCA 4HGYA 5ECYA 4QUEA 3JQEA 2IXEA 3PVXA 3WYAA 3M4JA 3PQ3A 3VTZA 3K09C 3R3XA 1UKBA 2HSWA 4TM5A 1K92A 2X6RA 2YW2A 3H3JA 4JOCA 4XYBA 5DN6A 4DIKA 4QOSA 4H16A 3HKZA 1A9PA 4IDCA 4LMRA 5CXXA 3WZMA 4MKZA 2VH2A 1CLEA 1ZUWA 1FOEB 3QLEA 3JQFA 4ASUA 2ZRDA 1OWNA 3PW5A 3HABA 2CNDA 4G6ZA 1JIUA 4NE9A 3LDHA 1JU9A 4R31A 5AOCA 2NPFA 3FOEC 1PK9A 4IG9A 1AS3A 4LH7A 5JS7A 3ZJTA 4K05A 1U31A 3O4IA 2RGWA 1VA4A 4N5MA 1UK6A 5LMNH 2WMYA 4EJ2A 2A88A 2R1TA 4P86A 5T41A 3HJFA 1SXJD 5TVKA 4Q4CA 3LBAA 4UU7A 5KHLB 4YMUA 1Q0UA 4MULA 2GA9A 3LT2A 1EDOA 2PAFA 2PRZA 3D2AA 4MYTA 3EW7A 1FS5A 3DBHA 1ZYUA 4PXAA 5DLQC 5TGDA 1M74A 2CF6A 5TS3A 3ANXA 3IQXA 1VM6A 3VOBA 4AJ4A 4PGMA 4ID9A 3VZRA 2XMPA 4JI3B 5ANRB 4US2R 4HDMB 3BL8A 2ANCA 1CYDA 2OHVA 3OY7A 5BMOA 4FOPA 2AF4C 3H19A 2ODNA 5IH3A 1NUTA 2H6EA 4KXYA 4N0QA 2QWXA 5AI8A 4B47A 1KJYA 5CFQA 2R8EA 4FFBA 2G9NA 4DB4A 4CFZA 1H94A 1RQXA 3DR5A 5C4XG 3AESB 5F1OA 3PGA1 1Y6QA 1DO2A 1V5IA 4TM8A 3DMRA 3U3ZA 4HQOA 2XW6A 1NJ8A 3LLMA 5D8DA 3MPOA 3V8NA 1XD8A 4KITB 2IP1A 1WH2A 1IEQA 3DFFA 3DZDA 2PVSA 1P0IA 2QM3A 5JY1A 1O94A 2C5FA 1OB2A 5BMVF 3MAAC 3EXG1 5F77A 3R9XA 4J0HA 2A9KA 2ZSJA 3OUTA 1U1DA 1PN3A 2GX6A 4W5WA 1Z6YA 2CDAA 2AOTB 1EFDN 3O8OA 3N9IA 1XXHB 3P7MA 5FLKA 1P1JA 1R6DA 4X7PA 1LBIA 5TMDA 1FUEA 4TL6A 3E9DA 3F3SA 2QYOA 2CUNA 3FDXA 1CUDA 1YVUA 4BX0A 3U6BA 2GF2A 1Q0PA 1ZGGA 3BB1A 4L8VA 2LV8A 3ZCSA 4JGIA 1T9KA 5F2KA 4F5DA 5EJEA 1E32A 4HFRA 3BGVA 4L6AA 4G0OA 4PPGA 1Z35A 4YJ3F 1QHIA 3Q7SA 4QGGA 3SF0A 1CR2A 4GRDA 5C5IA 5EJAA 1CJCA 2VFAA 3ZD9A 1T3HA 2HK6A 5H16A 4A03A 3EFOA 1GUBA 2V55B 5E1MA 4XSHA 4O2AF 2YFHA 3IS3A 4ZCRA 2Q1XA 2QZPA 3FBWA 4OTZA 4PEVA 5ILQA 5LKAA 3DBVO 1JVBA 2XUKA 3QUAA 3MJSA 1CZUA 1NVMB 4NG5A 1JJIA 3O0DA 1EGVB 3S2GA 5A3SA 1BG6A 2XRFA 1HNXH 4ZT5A 2GRUA 2QI9C 1ZH6A 3OUUA 2WZQA 3BE8A 3N7AA 3WK6A 4S05A 1H3NA 3PR4A 2HCJB 1B2RA 1W5FA 2HMAA 2A1UA 2R4UA 1P3JA 3WWHA 4WUTA 3K1TA 3LUDA 4HDAA 1N34H 3IEPA 4L3OA 3E23A 2CJWA 3T4UA 4DV4B 4IV0A 1T3ZA 1O9GA 1REQA 1DJQA 1TFUA 1U5BB 3HI6A 3P9IA 2DFPA 4GC5A 4WVLA 3ZJYA 2FAXA 1I2MA 1W8IA 3KJFA 4MWDA 3GJ0A 4AJHA 3JRXA 3RRBA 1VCHA 5IDQA 2HM7A 2W9CA 3PDIB 4DGQA 1TYDE 1PNQA 4D57A 3OIDA 2ROQA 5AJWA 3FKSD 3MWMA 2ZUVA 2O52A 2VF7A 3NAGA 1TZ2A 5D3ZA 2O5RA 5J2TF 4QU9A 4I1YA 4FB4A 3QXCA 1NXXA 4KFSA 2FR8C 4DA0A 3GPCA 5BNFA 3W4JA 1U8YA 3U55A 4N0PA 4WW0A 4F92B 4FHGA 1AKUA 2X13A 4MUKA 4U3JA 1YONA 4QNNA 1XJCA 5B1YA 4U7TB 4AN4A 1Q7TA 3HOZG 2VZEA 1PAUA 4H0FA 1CQZA 3GJXC 1WP4A 3MTEA 4O8CA 3WE7A 1RPZA 1UNNC 1N33H 1D2GA 1RWMA 2Z3WA 4HDCA 4PSKA 3VO9A 4D6XA 5L6LB 3GTPA 2BGWA 2EHDA 4DRZA 4DRYA 3TF5A 2WSIA 2CJXA 3IT2A 2YWEA 3BGWA 2QRLA 2JFWA 3TIVA 1HGXA 4JVMA 2DU8A 4C21A 2ZRCA 3GLTA 3BZBA 2X0EA 4ND2A 4YRPA 3ULKA 3DEAA 2FVYA 5K0EA 3OOYA 2XZTA 1E8DA 3WYCA 1Q0SA 4YAKB 2R4TA 3RHFA 4CQMA 2FK1A 2HV9A 2WKPA 3HBJA 1V3UA 1FXWF 4INPA 5AKGA 5B4VA 1U7XA 1ML4A 1FNMA 4R9UC 4Q37A 3ECCA 3IEIA 4OOEA 5COBA 1XPUA 4D6YA 4AKEA 4F06A 5KS8A 4RO0A 4UM5A 3RLIA 1QAOA 4DL3A 5KTYA 1GAWA 2W70A 1MV8A 4ZRNA 3AUUA 3F96A 2Q6IA 4RFSA 1XDNA 3W5DA 4PCUA 1P91A 1YL6A 4MB6A 1P2GA 4HOYA 4Y7DA 2CCJA 3EMVA 2QRHA 1BH6A 2B1IA 3Q3HA 4ZJZA 3QG5A 2W71A 2FN7A 3EQZA 3MWJA 5EHXA 3I05A 4RNDB 2R8PA 3H4VA 9LDTA 4PPNA 1I3QA 4J03A 2GETA 4JQZA 3IXMA 3FMAA 4QQFA 4YV1A 4ARZA 1M1YB 3VPBA 5JEEA 4QWAA 4RZUA 4NSNA 5FPPA 1PD1A 2C7BA 1JEQB 1UOPA 3ZS8A 2PSDA 1OWPA 4WWHA 1AA6A 4LZLA 4ZEWA 1A5AB 3IILA 4NZPA 3WKBA 1ZBQA 2WVHA 3PS9A 2Z2KA 4EY6A 1GIAA 4REMA 3FETA 2QG6A 3IQEA 6NULA 2JAXA 2FW6A 1YJQA 2WF5A 4MROA 3JZIA 3Q1KA 2B7BA 4PZUA 4QOJA 1L4NA 2FLWA 2QD3A 1QWOA 4OH1A 3RJTA 3WNZA 1CDZA 3KAQA 3MELA 4BZWA 4ZOCA 1M1NA 4UMFA 1C8LA 2PHZA 3SX0A 4EKGA 3E7WA 3UB4A 5IPFA 1F3OA 1YMVA 2O0LA 2Y9PB 1AB5A 2XWBF 1IYDA 1FDVA 1M2HA 3P9ZA 2DTDA 1TI7A 2AOVA 2XA9A 3FR8A 4OIMA 3HU2A 4B3SB 4HYQA 4OJMX 3S0JA 4HR7A 2A35A 1N3IA 3AM1A 3PW4A 5DW3A 2AN5A 1EEXB 1S8FA 3AR5A 4FHEA 3T6KA 4HDRB 2B9EA 4O83A 5FOQA 2YMQA 2DZDA 1IY9A 1JWBB 4TXHA 2DERA 2IVFA 3COYA 4X71A 4A0HA 1C9NA 1QHHA 1A5SB 1VL0A 2XY4A 4FCVA 4ECEA 1VE3A 3HY4A 4UOQA 5EXDA 1RLOA 1UH5A 3QWIA 4DYHA 1DX9A 4Q24A 1CF4A 4K3UA 4C22A 2F1OA 2WHQA 4G65A 4Q9DA 2YZGA 5CFPA 3CNLA 3OTOB 5JDCA 4BP1A 2AR9A 1LLUA 1PWHA 5IC4A 3UW1A 1SQGA 1W2GA 4DJEC 4YHHB 2VAXA 1WBJB 4G37A 3PI6A 3MCZA 4I55A 3C48A 5EXPA 1TA8A 1BN6A 1PS8A 1VXRA 2Q5JA 3FLBA 5TPZD 3PDWA 4FEAA 3GLGA 1IB6A 1PJRA 3FSRA 5JJIA 2XEDA 1HT2E 2IYLD 3RBDA 4CMIA 4E31A 3IPCA 3IRVA 4JCCA 2F8TA 2Y27A 5JXHA 1FUUA 2W8BB 4YV0A 2PS9A 3GNTA 2DWQA 4ED6A 2IDMA 1M2WA 2KSWA 3R4VA 2ZSFA 3QU4A 2ASLA 4GF5A 2NSDA 3K9BA 3CRMA 2AG1A 5G2OA 1QYRA 3TOCA 1DQPA 2FSGA 2WPNA 1MGOA 2NOAA 3PT9A 4OGWA 1E62A 4J0IA 4LBVA 1JR3D 1POWA 3RU3A 1KT8A 1W0KD 3BGSA 4RQBA 1PT7A 4XGKA 4Q00A 4CV0A 2BEVB 2WV7A 5B2FA 2XODA 4B31A 3RB0A 1XK6A 3DFIA 3IR5A 3HBLA 2CSUA 3RRFA 1JB1A 2AN3A 2BGJA 3D8BA 4IDAA 3PICA 4NNPA 4HRXA 1XZLA 1R5NA 2E1RA 1S7GA 4Q4HB 1T5IA 1VZ3A 3OVMA 4HS4A 4IDQA 5AM3A 1JFTA 1F8YA 4AROA 1ODCA 2VJMA 4ZCMA 2W7PA 4OX9Y 4KCGA 3GT0A 1VHJA 1UKZA 3AOEA 4NNJA 1DIAA 1HQYE 2JLCA 1RI5A 4CLDA 3F8WA 5DYYA 1AO3A 2JD0A 4FBGA 1TWFA 5ULLA 4C0JA 2PGXA 1NI4B 3F49S 3NWBA 5DYNA 3FNEA 3WTCA 2ZB3A 1R4ZA 1N9ZA 3LUBA 1LJLA 3P2MA 1N6OA 2A9RA 1NE7A 1O9HA 3LBFA 1EE1A 2FUCA 4H60A 2IYAA 1WQ4A 3OURA 3OX2A 4XTRA 1CRQA 4GZ3A 3RD5A 2OZLB 3IV9A 4YV7A 3KDPA 1PV4A 3INNA 2PUWA 3ENNA 4ZRDA 2H8GA 3BIWA 3ZCTA 4BAZA 4PW0A 1VSVA 2JGMA 4LOJA 3OFKA 3EYYA 4QPJC 5KWIA 2Q4EA 4KXFB 4NU6A 4BV3A 4EUFA 5KS2A 1R8SA 1DCMA 4ZQHA 4HHEA 2DBZA 3I6QA 2R5WA 3UW3A 2XSZA 4ML3A 3MR6A 3RAXA 1VIYA 1D2AA 2VP5A 2ODEA 3WL3A 1N5DA 2P6RA 4NCKA 2B8NA 3F74A 3T7EA 3WGLA 1V9SA 4Y2VA 1RFGE 1REQB 2HRZA 2JCGA 3NJ4A 2NP6A 2SCUA 2WF8A 1P1FA 1MC1A 4FP9A 1IXSB 3EGXA 1AQYA 1TJ5A 4OHYA 5A0FA 1Y0BA 4D8UA 1H5NA 1ZP6A 3FKIA 1B0PA 2F7SA 2OZVA 1KO4A 2B92A 3FCXA 5J2UF 4YRIA 2A9FA 1QG4A 5HEKA 2BZSA 2G8NA 3T0GA 1JG6A 2P27A 4QVKA 2J85A 4J8PA 3A10A 4JT9A 4MVJA 2IH5A 2NSYA 1CB0A 1N2SA 2BEUA 1G3IA 4AN1A 4CDNA 1AQUA 3TMAA 1Y5NA 3GLIE 3KVYA 4W7SA 3MCTA 4NEQA 3AKCA 4DM7A 2RE8A 3ICQB 3S4YA 2GN8A 5ALFA 4DBVO 4DLKA 5E7IA 2EG9A 3CINA 1WRBA 4BB6A 4B83A 2Z6QA 1EYZA 2HHJA 2AXEA 2ODWA 2G1UA 2HRDA 2RGVA 2EWWA 1OGYA 2IW1A 3M6WA 1J9GA 3CUKA 1TRKA 4UC0A 1RQNA 2C4UA 3UMRA 1A8PA 3C8DA 4EHNA 4EKEA 1JIIA 4AQYH 5CFZA 2J67A 1NV9A 2P3SA 3I6MA 2BFDB 3PUKA 3ROTA 3F8SA 3KLNA 5LR6A 3J81A 3C6BA 3R0VA 4ZO4A 3GV7B 3GEBA 1CFZA 5IKXA 3ET4A 4QVIA 1UDBA 2C4TA 3GTGA 3U19A 1IBMB 3L6UA 1DIHA 3HR7A 4UVDA 4OJTA 3VFDA 1A9ZA 2PJZA 3D8UA 2Z4RA 1L7DA 3V1TC 2EL7A 4BVAA 2VNJA 2X7HA 1NUPA 1FU4A 2ZIXB 3OZIA 2BF4A 4X1YB 5CW1A 5EESA 2F3RA 2DBRA 3KHGA 4RDHA 3AM4A 4GKJH 1XJ0A 5BPFA 2VXBA 3MCUA 3LC7O 5DCYA 3S55A 2ZVPX 5J43A 2DTXA 3LX5A 3EGXB 1UT5A 3WHLA 3CLRD 3ZI7A 4EARA 4B7ZA 3K0CC 5DO9A 4XYGA 2ZJTA 1GDDA 1A72A 2RCYA 4GIBA 2R6FA 2ZWPA 1YACA 3QYJA 1J9ZA 3MJFA 1QIMA 3P2KA 3DHWC 3BOSA 5BVGA 1JIJA 1SRRA 2I4RA 3G8BA 4JHXA 1N8NA 4LVCA 1K97A 1KY4A 2H4WA 3T1HH 1JDBB 1SNYA 2YCLA 5FNVA 4B2LA 5C9ZA 4DDHA 4CHGA 2I9KA 1B74A 2IEGA 3M3HA 1EX7A 4BU0A 4DXDA 4ARIA 4V39A 1RHMA 5BN1A 1WCV1 2J4DA 4LWPA 1ARZA 4MV5A 2E82A 3S81A 1OFTA 1YWGO 3H4DA 2ADMA 1T1JA 1MIOA 2EJTA 3FDZB 5IZCA 3I3OA 3AR8A 2C2EA 3J80W 3EBOA 2DG2A 3FNHA 4O1HA 4U7GA 3AVWA 2FU5C 2P9FA 3G13A 3SSAA 2PO7A 4CKZA 3QSYA 4Z2YA 3WP0A 4R7GA 5NULA 3UWOA 3E1KA 3G2HA 4LOAA 3PTAA 2CDRA 3UT5A 4D4JA 1CKMA 1X39A 2WU1A 3GAZA 4ED0A 4Q4LA 1G4UR 1KFJB 3TQCA 5AW8A 6YASA 4KTTE 4UD2A 3E3NA 3ZN2A 1MLDA 3PQ5A 4CHTA 5IXSA 4IFBA 5FUYA 3LPCA 4CDRA 1Q19A 1NU8A 5AKXA 4CM8A 2GFQA 2VDVE 4GZ5A 1B42A 4E88A 1CY1A 2H16A 1KE2A 4MTEA 4DV5H 3T3GA 1Z8NA 3QUTA 2V97A 4E5PA 1C4WA 3HDVA 1Y1VA 2FG6C 5JADA 2RAPA 5KFAA 1YZUA 5EQTA 2V6GA 4ECSA 3V8MA 4ASUD 3TR5A 1FVOA 1O6ZA 4B4VA 5AVSA 4RS3A 4WECA 1QUFA 3U3KA 3NGDA 4KZKA 1B0AA 2Q2TA 3P26A 4LHXA 4GEGA 1TJ3A 2WJ6A 2BQUA 3BILA 1M6WA 1CJKC 1GYPA 1RJ9A 2XT0A 3F7NA 3MNFA 1H1LB 2OGSA 4WOBA 5G40A 4U2EA 1QGED 2J0EA 5EINA 1UBLS 2H2IA 2A92A 5H7XA 1RWVA 1USKA 2HT6A 3DEYX 3MT8A 4JU9A 3X1WA 2F9MA 4N6OA 2R97A 1T3GA 2AVNA 4WKNA 3TZEA 1MXHA 1PF7E 5FWDA 1BKYA 5FD8A 4NAVA 4GL4A 1JFLA 3ZHTA 3EG5A 1QU3A 3IMCA 5F3WB 2V4RA 2HPVA 4JAVC 1QORA 1H93A 2DYKA 1VPLA 2DFKB 4I9NA 4L5BA 3SQOA 4KBYA 2J41A 3BH0A 4FT2A 4LNUA 1NXSA 1KRXA 1A97A 2GQRA 2VP4A 2WJ4A 2C29D 3QIAA 3SC3A 2A1UB 2JAOA 2X0SA 3BICA 4EBCA 2J5BA 5ECDA 2CLFB 5JPIA 4AJKA 3ICWA 1YCDA 2NXEA 3ENVA 3GOHA 3QFRA 3L7AA 1LS6A 3A7EA 4OV6B 1KIMA 2JHCA 3PBKA 2IXTA 2ZWOA 4KTVE 4AC9A 1YR9A 1NRJB 1N5JA 4IOLA 4O2LA 3PEEA 4G5HA 1Y14B 4J9RA 1BXGB 1GAQA 4Y67A 1L4MA 4TVBA 5KOYA 2RK4A 3OFSA 4J4HA 2GPTA 3Q72A 3N6VA 5EWEA 4MUEA 3IUQA 4D9BA 4LWQA 4WBXC 3VGPA 2D5CA 2J8ZA 4FDTA 3GQBB 1NFQA 3LA6A 3P20A 4UUAA 3MWEA 1UODA 2H5LA 4AS3A 3NHBA 4OATA 2VL7A 5LWQA 4BUCA 1O8BA 3OTOH 2ZRKA 5FEUA 1NC1A 1VMIA 1P17A 1WD5A 4Z3OA 3WWZA 2JVJA 1WCIA 3NT4A 2ZSAA 4QYXA 2OXTA 3RUDA 2WSSA 3K92A 3LL7A 3B6JA 5C51B 1O6BA 3OIUA 3KKQA 1E2FA 4HYKA 4X44A 3RSGA 5AKYA 2P9QA 4FMCF 3HP7A 4TYPA 4UNPA 3L6OO 4WFKA 3LVQE 4EJ0A 2MTBA 4GPBA 3AVXA 2I7XA 4D0SA 3BWDD 3PGXA 3JD2A 4EI2A 2HQSA 1IN5A 1LWNA 2M2IA 3AHEA 1Y6JA 3BD6A 1T6BY 2KWIA 4JL6A 3EQ6A 4NJEA 4XOUA 2ZU6A 1VBKA 1EPUA 2FGKA 4A36A 2XTMA 3CHYA 1R9NA 1C2TA 1T9HA 3DB1A 4LYFA 3R9KA 3PX7A 2OM6A 1RWBA 3DDNA 4MUXA 3LIIA 4TMZA 5DE3A 5I7HA 2X4IA 2R6AA 3QUSA 3OWHA 4CQLB 4RM2A 3E9EA 4F7DA 3OSNA 1W7AA 1XQVA 4LY3A 2IV3A 3PXEA 2O6LA 4X5OA 3O21A 4N12A 4C4TA 1RTTA 1UJBA 2QVLA 3EZFA 2HMUA 4HLUC 4IZ6A 4QT0A 4WI1A 1CUIA 4OY3A 2IYWA 1WX1A 4EDHA 2W6MA 2G9ZA 3C16C 4UZSA 3ZVMA 3OZGA 2IY7A 2PG3A 3WBFA 2O7RA 3VOTA 2HX1A 3H16A 2YWHA 5A1JA 4DMMA 4LGMA 3EXHC 5IT0A 4P36A 1GFIA 3SXPA 1ZDMA 2IMWP 1RWKA 3A1UA 3LOQA 2QP9X 4EKNB 3OETA 4AYBE 1WVMA 4AP5A 1NXVA 2PXCA 4DIFA 4EQ6B 3K2IA 4GMKA 2LXNA 2WWGA 2GQ0A 5LB4A 4GUDA 3LDGA 3DV0B 3TJRA 1D7AA 1KI8A 1RQGA 3IIEA 2HLNA 3EDOA 3KSMA 4RS4A 4RL6A 5EKUA 4QW8A 3ST7A 4RHCA 3IO5A 4D8XA 4XWYA 3QEBZ 4DB2A 1N3YA 2W0MA 3FMIA 2OE2A 3OT1B 5DNVA 3H11A 4E07A 1ZK1A 2NZWA 2FKLA 1IOVA 2VDWA 1FX0B 3MJ4A 1XZEA 1R50A 3GFRA 1DBVO 4Q3LA 4RXTA 5DI3A 4DMRA 3FPEA 3W6OA 4QLAA 1JSLA 3GDOA 1AQIA 3SNKA 4CQMD 4Q9NA 2OHHA 5DVZA 2I91A 2ZWIA 2GF9A 1SUCA 4YX9A 5BMVA 1Y3BE 1R0ZA 2O1WA 3MJTA 4FE3A 4MV3A 1A0IA 2B8TA 1SXJB 3IAEA 2WV9A 4CGYA 3A2KA 5MN4A 3TTSA 2OP0A 3RYCB 5DBGA 4TROA 1IK6A 2HH9A 3BBLA 1I30A 1LPSA 3S2EA 3GTJA 1MKYA 3HXPA 3GJ3A 2VP2A 5GONF 1JT9A 3WRXC 4WKPA 1TO1E 2GYUA 3EUEA 2DFNA 4PM4A 5C44G 3QLVA 1FYDA 4CYMA 1L5OA 3UF0A 5CG1A 1RW4A 4DRXB 3CXRA 4IIXA 5REQA 2IX9A 3K0AB 2X40A 1NQ5A 2BR5A 3ZWPA 3WKAA 3AVUA 4ED7A 4N65A 3U7FB 3H5LA 4N7BA 1H65A 1H1LA 4EKIA 1CJBA 1GQYA 1V16B 4RSGA 4GQIA 4B87A 121PA 1KC1A 4NX2A 2YJTD 5EZYB 3F7OA 3IT0A 4BKOA 4B73A 4U7DA 5FIUA 5J2TB 3T5AA 3RV4A 3TGLA 5EZ5A 1JXAA 2NYRA 3RVPA 1RTKA 3OEEA 4ZMRA 5BOSA 1USIA 5AXAA 5HTKA 4C0WA 3I4NG 1AE1A 1LF5A 4N0EA 5TSDA 3UC9A 1XL0A 3TLAA 1EK0A 3EXHB 4OBXA 1U6IA 4FGKA 2IUTA 2GDZA 1RU3A 2D54A 1TZJA 4UM9D 1G7SA 5AJZA 3C1AA 1Z9BA 3HOUG 3DMPA 4UDXX 3SG0A 2ILTA 2ZBEA 3WJ1A 4LS3A 1SUBA 2CE2X 1C3XA 4C0XA 3ZWNA 1SCUB 1C8BA 4DLUA 1QIHA 1DIGA 4JI1H 4QPPA 4NCIA 4BYMA 4MIYA 4B85A 1JECA 4IXWA 4FBLA 3TW7A 1CRLA 3ETEA 4IRXA 4K9SA 4NICA 4Z0TA 3OE4A 4FBTA 5BMVB 1Z6XA 3ZWWA 1QG6A 2C5BA 3QZ8A 1XG5A 1NQOA 1D03A 4M89A 3U7EB 3J7TA 3V2IA 3QBJA 1ZGZA 2EFYA 2BEVA 1UM8A 4GXQA 4QBIA 3RF7A 5CBKA 4A3KG 2Y71A 3AF2A 4OU5A 1TB4A 5FAXA 3HSSA 4POAA 4ZIRB 1HORA 1I6UA 1F9EA 4YROA 3E61A 2GAAA 3UNXA 1KXZA 4XAQA 3MWEB 2NT3A 5LMUH 1RK6A 3AC0A 4BL5A 2P78A 2Q4RA 1O0SA 1MR3F 3QHQA 3ME5A 2HQOA 3F9RA 3EYWA 2OWOA 3CSDA 4BLQA 3GXOA 4PC3A 3ZQ6A 4E03A 5EXEA 5G1OA 4YDSA 5AKIA 1PEAA 3ZZTA 2I1WA 4J6FA 1GL6A 1X87A 3BF8A 3KLOA 4G4SP 4AJ1A 3FJ1A 2BIFA 1XLTC 2JFUA 2ZM6H 2G9UA 1T5DX 2BISA 2YXPX 4GLJA 3W1EA 3H1GA 1JMKC 1KRHA 3IAM1 4PQRA 4LI0A 2EQ5A 1FP6A 2P1DA 1EB9A 3F7TA 3H7AA 4PG7A 4X63A 1KDVA 4YYEA 2R1VA 3NTVA 1U8XX 1RJFA 3HDGA 5FADA 3K9WA 4HAYA 3Q3CA 1ZGCA 2EX1A 4IV5A 3E7PA 2OD7A 3VNQA 1TYAE 4KQXA 5A4DA 1AGYA 1WTAA 1E4GT 1Z28A 2WVJA 3I04M 2G1PA 2DT5A 2Q45A 4G1UC 4PQEA 3COVA 2ZGIA 1UPCA 3LQKA 4IIJA 3OLZA 3RH0A 4F85A 4GVPA 5FPRA 3WXBA 4FFVA 4C01A 2C35B 4P5DA 5T4HA 1G16A 2V8BA 4ZC8A 1IBRA 2GZ1A 3IEKA 3NC4A 1LLFA 2QN7A 5BQOA 5BSMA 1OWOA 3ADDA 2JA7A 4IHJF 2YJ4A 5LDHA 1ZG3A 1QCDA 2GQSA 3NIWA 4QBHA 2P9HA 3DTGA 4JSTA 1J8MF 3PF9A 5CD9A 1MJHA 1DHTA 3M9XA 5K0NA 3W6NA 2X3UA 1BE8A 3GJ8A 3ILXA 3PC6A 1EFCA 2YVAA 3EXG2 2GZMA 4RPIA 4JLAA 2FF5A 4L9SA 4PLGA 4LFBH 3AERB 4U9HS 2DPGA 3SE0A 1JMVA 3AL3A 3THWA 2XNDD 1RRCA 5JJLA 2CD7A 2YZKA 3NS7A 5JD4A 1M0WA 1HQDA 4NULA 5C31A 4D9FA 2WQ6A 2O8VA 1X1AA 1J0CA 1NMEA 1R4NA 2BMDA 3MLBA 3QV1A 4IQ0A 1C7JA 1GUZA 2GCEA 3N2NA 3WVNA 5EE1A 4ER7A 4M1TA 2A5GA 1K6XA 2BWJA 1APBA 4MP8A 4U0JA 2VZ9A 1Q1AA 4MUAA 2H4HA 5HKBA 2HU5A 1YL7A 1GGOA 4FFRA 1C30B 3KUKA 2VHCA 1G8FA 2R1VB 5D5HA 4XYEA 2QR5A 4GR5A 1Q77A 1QVWA 1V1RA 3KYDA 1EZ1A 3ZW7A 1TECE 3PCXA 3BSSA 4UE6A 3ZV7A 5B7PA 1WBBA 3E5HA 4D74A 1D2CA 1RLIA 2R2GA 4QATA 2X9NA 3T8YA 3RIHA 3AY3A 3GPIA 5DYWA 3BRWD 4KKVA 4DNPA 1G8GA 1ZLXA 1RLJA 4R3NA 2CEAA 4DWWA 3BKWA 3K6JA 1G19A 2X1HA 1D09A 1U8FO 2OSBA 3IUMA 4DY6A 5A02A 1KGDA 4B79A 1M6HA 2F67A 4FC6A 4OUDB 5EMJA 3MS7A 4YCAA 2G80A 3GYGA 1T36A 3G2QA 1F20A 4GP9A 1ULHA 5AK4A 5U1PA 4Q3OA 3KZCA 2FJPA 2QE7D 3D1JA 1Z7BA 3T3MB 3L46A 3GRRA 1NVWQ 1U7HA 4CUJA 3L1HA 3IE0A 1ZOLA 5EVJA 2YIDA 2NM0A 1KKLA 3P0HA 2XKKA 3LDUA 1A7JA 2H2AA 1MZPA 4ZN6A 1Z26A 1U80A 5F2OA 1AHPA 2XNSA 4IRUB 5DBHX 3H4MA 2IIPA 1L5HB 4DV0B 4CKCA 3LQYA 4MKGA 1I7SB 2UUAH 1R27A 3IA7A 4OXYA 3R3YA 4R1PA 3VOAA 3U4QA 2FP3A 3NPMA 2QROA 2Y0BA 4ONEA 3NDPA 3S29A 1EK1A 4QO7A 2XMZA 2EKPA 5CNIA 3VR3D 1RXEA 1V7CA 3Q41A 1HPLA 1XEFA 3CZ4A 4QRHA 2PRIA 3W79A 3RJ5A 3SLKA 1SB9A 3KREA 1C5KA 3HQ4O 4JC0A 1JPNA 2VJPA 3MBKA 4JL8A 4N01A 3GRVA 3RYIA 1HR0H 3QI7A 3P0FA 5DHTA 2VWGA 1Y8QB 2H54A 4N5DA 2WU3A 1OH8A 5DAAA 2BY4A 4B74A 1TMGE 2DX7A 4B35A 5ED0A 3KUDA 1Q0TA 1OROA 1PS0A 1S9DA 4TL7A 4B76A 2J9ZB 3IIKA 3DW3X 1M7JA 3NKVA 5H3HA 5B57C 1XWWA 1NVVR 4H31A 1ODLA 1T5HX 3BXFA 4R0VA 5KFEA 4W5HA 3DL7A 4JENA 1MAUA 2CLSA 2GB4A 2I6FA 2IDZA 3EPRA 3ZY6A 2CMFA 2GEUA 3T7AA 4D43A 2VUIB 2RHGB 4LF6B 5B3AA 2LTAA 5CE8A 4PN7A 1ZD3A 2QTBA 4K8OA 3G68A 4D0RA 1YDGA 3FI9A 1WLSA 2D8AA 4FONA 3AJEA 2I1VB 2W43A 3KZNA 3TEMA 2O48X 4P0PB 1TDJA 3PHIA 1ZSNA 2CBGA 4W9RA 1N0HA 1QHFA 3R7BA 2QMYA 5BY2A 3FFBA 1Z4IA 4QPZA 1AY0A 4E21A 3EVZA 2B6NA 2C31A 2H0AA 3I2GA 4MW7A 5DEIA 4CKBA 2AFIB 4LXIA 2YWFA 1QVVA 2QRGA 1P73A 2CNVA 4Z54A 4C7BA 3OWOA 4GP6A 5AUOB 5ICCA 1NGSA 2C2YA 3VR6D 3FOFC 1BRMA 4BIMA 2EKLA 2WJYA 3SBDA 2WHEA 2X0IA 3INRA 4JBIA 4WESA 1K2VN 3OU7A 2P7IA 4RTKA 1DE0A 1LW7A 2V4QA 1PGPA 3GAMA 5BRAA 1JR6A 1X13A 4HEA1 1GPDG 5CGZA 2CZQA 2HVQA 8ATCA 3HJGA 4O3PA 4IO0A 4TLEA 4DQNA 1QP8A 3DE7X 3DZFA 3HLKA 1RYFA 3AK4A 1VHTA 2H4ZA 1NG1A 4L1KA 2QT9A 5BWRA 1OR8A 4PG4A 3D59A 2Q49A 5D3MB 3TR0A 5FUMA 1HNWB 3DF7A 3ZCRA 5LP6B 3RT7A 1UUFA 3MMSA 3RK4A 3ORQA 3H0EA 3RI3A 5GAJA 5IHPA 4LHEA 4MIEA 3EVFA 5FI3A 4CV2A 1CUYA 2EOAA 2A6PA 4LE1A 4PANA 4ARVA 4C4YA 1M0TA 4HS9A 3CU5A 1RAEA 5EWGA 4PC2A 2CL0X 3U7GA 5CXQA 2C7PA 5BN4B 3SX2A 4XPIB 3U3OA 1CF9A 1BJTA 3AESA 2W6PA 4LCEA 5AK3A 3CLUC 3C5CA 4COKA 1V8FA 2ZRNA 2WE8A 3ETDA 1G1MA 4P0QB 1JIKA 2CXPA 4DYDA 1O0CA 3U81A 4DJJA 1VZ2A 1L1QA 1MJFA 4CCYA 1VYHA 2GBFA 5EZSA 2R8IA 3LQFA 1GJRA 1R0SA 4EM6A 2BDTA 3KHLA 1E58A 4L6CA 4J29A 1TJYA 3ZDZB 5DNAA 2JI9A 1KZ7B 2X6TA 2C5AA 3I09A 4UMDA 2OLEA 2JA8G 2WT8A 2NX2A 1T25A 5EZQA 5CIWA 3V1NA 2VUMG 4DZZA 1KZ6A 3PXXA 3OMLA 4NBUA 2H2FA 1Z29A 3T34A 5FV7A 5AVUA 1S3SA 5A4FS 3D7NA 1TD9A 1T9AA 4I8DA 4DIDA 3Q2OA 1MCZA 2NTJA 3O74A 5KO2A 2O8CA 1IC6A 5L4SA 2LP4Y 2F1IA 3TTUA 3BSYA 3KRTA 5CDTA 1UXKA 2N42A 2P2CA 1GPNA 4D3DA 1G98A 2JH8A 2WWWA 4ALLA 4RFVA 1YTUA 4ZO7A 3AONB 1ULTA 2PZFA 4I4NA 5KFFA 2VF2A 1NOJA 2XWPA 3IQZA 4RF3A 5A3JA 2R79A 2VP0A 3DLCA 2PT7A 3KX2A 3T1NA 5A4IS 1JIXA 5LZ4A 2X0FA 1WP9A 1RM0A 3CLSC 3DDSA 5E1DA 3IG0A 1N7IA 4URZR 2P8SA 4QIHA 4R6WA 2VA2A 2V7TA 4X6UA 3W34A 3WDKA 3BQ9A 1G5IA 2J0SA 2CFTA 1MP0A 3DV2A 3AEKB 4B9EA 1ZGJA 3NFYA 3IBCA 3KTFA 1XTZA 4H7FA 1M8GA 3QKIA 4MUNA 1RJRA 5TARA 4GZMA 3K7EA 4TZ0A 1CDEA 1QS0B 1ZW1A 3WIOA 2B9VA 4JI7B 2PMZA 1QR6A 4TTSA 5E0KB 3JQFC 1U3CA 4X94A 3MWLA 3THOA 2P9TA 4AUMA 2R6HA 3C5EA 1NJ1A 1WV1A 3P0JA 3V46A 4LE0A 4QUDA 2H0RA 3UT0A 4LJ4A 4ZYXA 2VBFA 2ICAA 2JJ2D 4K9NA 5DM4A 4DR2H 4HN4B 5KREA 3GA5A 5HG0A 1EUDB 4KQWA 2ATXA 4BFXA 2RDJA 1YR2A 4FWIB 1SCUA 1TPZA 2AQIA 3FLEA 1XA4A 2DR0A 4MW4A 1NBME 2J3IA 3VC3A 2RAUA 1B26A 1FSZA 3KM0A 2NUTA 3W2FA 4UEQA 4HG2A 3TSCA 1L4KA 4EW2A 1WVIA 3UYLA 4C4OA 1L4BA 4EFMA 3QKSA 1O96A 1KSFX 3U0BA 3RNLA 1PBTA 2QBYA 3L0DA 2P2YA 1U0NA 2DLCX 2Q2UA 1PR6A 1KYTA 3PN1A 1ODIA 1W5SA 2ORWA 3EIFA 4G5QA 2W6CX 4BB9A 5ES3A 5CH3A 1M34A 1U2QA 5IN5A 2AT1A 3DLPX 3L8FA 3QVMA 3LGXA 1SHUX 1DAFA 4ICIA 3ZXYA 5JC8A 4RTOA 1EMDA 2ZRIA 4L07A 4PVCA 4EBFA 5H68A 2VATA 1YR6A 2GUWA 2FZKA 3EGVA 5KT4A 3HYLA 3OJWA 3PCRB 3RRMA 4DSTA 4DY4A 3K73O 4PHGA 1CF2O 2DWUA 3LPMA 5K0TA 3I6BA 1K1EA 3FDJA 3KOYA 1E7MA 3ORRA 4A8JA 3OJFA 2JIDA 1YB5A 3MFQA 5D3MA 4AG6A 4WK2B 3GJSA 4A1OA 5E6SA 4YMIA 1DELA 1R4MB 2DBVO 4WZBB 5FWYB 1J5EH 5MGBA 4F2PA 4YS6A 1E3DA 5CIQA 4BNDA 4Z99A 5HKLA 3QQ5A 5CITA 2FSHA 3GU3A 4KBGA 1Z2OX 2H7CA 3DT8A 4DV4H 2XDQA 4LDZA 4QECA 2XB2A 1HQCA 4C7XA 1OV6A 2HGXA 1U3GA 5CEFA 3H75A 2AGQA 4KXQA 3KXPA 4L16A 2XYVA 4QDXA 3RYIB 1S3GA 3GRCA 4RPCA 1Q7RA 2CF5A 5C80A 5JPCA 4IHJA 2ZWVA 1Y98A 3OKFA 3S99A 3I4FA 1T0HB 1VI5A 3DE5X 3WLNA 2ZI5A 4EMBA 4P53A 4EL5A 2IDJA 3FUXA 4HNAA 3HFJA 3TZ6A 4I3GA 3F9IA 5AH0A 3RPEA 1BWRA 5CNMA 3T7SA 3HXLA 4X24A 5JRZA 1RAIA 2WB1A 2A14A 2AYZA 1OPXA 3WB9A 2CCKA 1AQJA 1VLVA 4IHAA 1J8VA 2B4KA 3D3WA 3UM9A 2QQEA 2ZRGA 1MTZA 2B30A 2H85A 3Q5DA 1KJQA 1DS6A 4JJZA 3NJ8A 3W77A 2A0WA 2IELA 3NHWA 4P3KA 1ELOA 1A2OA 2RH8A 3AF4A 3HLTA 1KJNA 4DW8A 3CW8X 3KQSA 2O1SA 2CLIB 2BLLA 1MB3A 2COUA 4MQMA 1IIBA 2X42A 2O8CB 3W6PA 3ZJUA 3Q9NA 5EFOA 3RB8A 3S2YA 2AJTA 4B4OA 2CNNA 2P4SA 1LPMA 4D96A 1USGA 5CB0A 1DWQA 1E7YA 3U7JA 1GZVA 1QANA 5F1YA 5LOVB 3CUVA 3OOHA 4TS3A 4X3PA 3U0GA 1B4DA 1ZGAA 3JSLA 3F2VA 3NPAA 1WCMG 5FYDA 3R7NA 4GR9A 4DSZA 4EX6A 2ZXEA 2R82A 5AW9A 2B82A 5IARA 2VXYA 2OGZA 5IUNC 2QJTA 3COPA 3PQ2A 3RIXA 4HPWA 1AGNA 4W5TA 3B1ZA 4YUZA 3LUCA 1TUBB 2A5JA 3QJ5A 5FLYA 2QPAA 1T9GS 1E2GA 2UVQA 1DXQA 5I8ZA 4QGBA 5BSWA 1W5BA 2ZSDA 3Q2KA 4J7CA 4OHOA 4DL2A 4X20B 3OTHA 4JXUA 1DRJA 4B2IA 2GVNA 1C9YA 2IP2A 2X19A 1K89A 3RW9A 1GDTA 3V6MA 3CNQS 2JIRA 2YBEA 3F5DA 4O0MA 1OBOA 4EPRA 4Z3KA 5BW6B 3IDAA 2V96A 2GF0A 2AWNA 3A32A 3B2QA 3IXLA 2WE7A 3NCTA 4Q0YA 1FDRA 3F47A 4YT4A 4CN8A 5JI3E 4KREA 2HZBA 1THZA 1XP5A 2C4HA 4NZOA 1WZIA 2L69A 4ECQA 2WWFA 4MVJH 3CV3A 3LBYA 3MXOA 4NCJA 5BV2P 1YRHA 1XCMA 2AR0A 4DLPA 2W83A 1QK3A 3HFGA 5BSKA 1QX4A 3KCQA 4Y8VA 3HA5A 4MRPA 4BQSA 4F50A 2JA6G 3RAFC 1ZJJA 1T4GA 2NZUG 3X1ZA 4IKOA 4BE4A 4XDHA 4IHQA 1W94A 3IJPA 1XEWY 1I5EA 2W2OA 4BNXA 3CRZA 3UXYA 1DJPA 5KB3A 1S89A 1K6JA 5JTUA 2OLKA 3BMQA 3QX8A 2CLCX 4I8IA 4GOKA 3N0VA 3QUQA 2PV7A 4YDHB 2OO5A 2R8HA 4JBLA 5MDHA 4XB2A 4YR3A 2VPXA 5KTSA 1ISFA 1W48A 4JI0H 2JDIA 1WPRA 3OT4A 1C0IA 4CMIB 2JBWA 1P0PA 2FWPA 1F51E 3A1VA 3BAZA 3ZV5A 5ADUS 3UVEA 1P7YA 3R8FA 4O7VA 2O3SA 3PU6A 2XWJI 2XPCA 4M53A 1Z56C 2EF1A 1IQUA 2J3JA 3VJLA 1VBGA 4HPJB 4I99A 4KAXA 2NUTB 5DTIA 3B7GA 4R1SA 2GFIA 3G79A 1T8RA 3EDQA 1KEEA 3N39C 3PUIA 2X5NA 2VPSA 1BD4A 4HQNA 3VPCA 2JFVA 3QKSB 4YH1A 1LW6E 3CRRA 4LY0A 4E2ZA 2K2QB 2C57A 4O82A 1DXHA 1K8YB 4NK4A 3PJFA 4L0QA 4ZAZA 4MWOA 3VOSA 2JLBA 2NO1A 3HH8A 1XAIA 3PKZA 5EIAA 5KKCA 2REOA 4X1YA 4EJ6A 3HCPA 2UYYA 1ULSA 4U1RA 4W9NA 1OT3A 4WPGA 1WMDA 3W5JA 3IMKA 2Z1MA 1N5LA 3DMFA 3TLXA 1PZMA 1UXGA 3G6WA 3USZA 2XECA 4BMCA 4QVGA 1ZITA 5FA6A 2XF2A 1HDYA 2ENWA 4LQDA 4EB6A 3ETJA 1QHYA 1PGQA 3NORA 4M8SA 3C98A 1G3UA 3R7FA 1QGDA 5JS8A 3AEKA 2QN6A 3QE4A 1FFYA 1Q7GA 2H0QA 1A9YA 3D6FA 4QUJA 4JJAA 4I19A 3GGJA 4X7RA 3JSNA 3JARA 1J8FA 3RU7A 1Z74A 4DMUB 1XD2B 1RZRD 3G9XA 3IMEA 4IIEA 2VYVA 4CE6A 4NBRA 5H5JA 4IINA 3L8MA 1G60A 2WPDA 4QYWA 4PTYA 3EVAA 2COIA 3FPGA 3OG9A 2OQ2A 1G38A 1DPFA 2R6DA 5F9HA 1WHSB 1GO3E 1FJGH 1SC3A 3GDHA 1U0OC 4NCXA 4Q8FA 2C2XA 4P3NA 2VSXA 2QQ0A 3L7NA 5CJPA 3BA9A 2V7VA 3T5BA 1MUUA 4GBGA 4N9WA 4ZALA 4F4DA 4UVGA 1DG3A 2D7CA 3E03A 3GT3A 3QVGB 4MQFB 5IT5A 1FW8A 1BEZA 2ERXA 1FFXB 2RGDA 2ZRLA 2AE2A 3H2ZA 2JLXA 1UBSB 1YQWA 4AAYA 3GJRA 4F2WA 4JI2B 3CTMA 2Q3CA 4FPXA 2HRBA 3H6KA 4K9DA 2J5XA 2QM7A 4R8KA 4IDPA 4J7XA 4F5YA 1VKJA 4WZBE 5LQCA 3O31A 3OOJA 3I04A 4B6RA 4C0KA 4IVPA 4KMMA 4HFJA 3X3HA 1WRVA 3CLVA 5EQFA 3CO5A 4JC5A 1RCUA 5AMXA 2PL3A 1T8YA 1NMZA 2CNBA 4LHYA 4DV2B 1TA4A 1TKBA 1JKMA 4AJEA 4DLLA 3REQB 4EO9A 3GI1A 3EZ7A 2WVGA 1HTTA 1DIOB 1OLUA 3ZE6A 3BWEA 3MD9A 3TS1A 1NBAA 2QU8A 2XMRA 3EIHA 5TNXA 2ZAYA 1NKSA 3DBRB 3BK2A 2NV2B 1CY2A 4O2BA 4UBIA 3HN6A 1C0LA 1NJSA 5AI5A 3BHIA 1L1EA 1OBHA 3SYRA 3QTBA 2BFPA 1J2YA 1GGMA 1PG5A 3S28A 3R24A 3UGQA 1U0HC 3H6GA 3IT3A 4M1MA 5B1SA 4E5MA 4AZ0B 4KR7A 4DDVA 1BC5A 3PRHA 4RZRA 1X7ZB 3CVOA 4I9HA 1KAQA 2PPVA 4XWOA 5KAPA 1YK0A 4X62H 2JI6A 2QYHA 2YRFA 3OU6A 3M2PA 4D0NA 1G8PA 4R0MA 4MVJF 1ESDA 4GOMD 5ALDA 4N18A 4V3BA 1SOVA 2ZJBA 4ZVTA 5SV2A 2LUOA 1DAMA 2XXJA 5KVAA 1UOEA 4FCTA 7REQB 2IK8A 3SZ3A 4ZEVA 1L4LA 1BTOA 1SKQA 3NV7A 4DC0A 2KW5A 4Z8XA 5IK2D 2FWMX 1O95A 2X2PA 1SKUA 4AY5A 1NF3A 3BD7A 2A1TR 2WD9A 3LF2A 4EQ6A 4DBLC 1B8PA 1BMDA 2ZIFA 2Q4TA 2JI8A 3I2HA 1CUAA 1E2MA 3VDNB 5E3IA 4D98A 4AJ2A 4Y9DA 2XXBA 4NWIA 4QM6A 1Z08A 2RGGA 3B6ZA 4F96A 1P45A 4R8LA 3FFAA 3A05A 1HOTA 1LZLA 3DZIA 4M38A 5GOZA 2DFVA 2OXCA 5FQNA 4EL0A 5AOAA 2GUGA 3REQA 3GRAA 3VH3A 2YX1A 4KKXB 4DQXA 3W5UA 3M4ZA 3NXKA 5H70A 1Q57A 2XZPA 3OJOA 2XE6A 3DR3A 3RARA 3S8MA 1QOZA 3L01A 2Z8ZA 2R62A 4CM9A 1I5RA 3EIOA 1KYIA 1SXJE 2VCYA 1YRBA 2DH5A 4ROTA 2AQ8A 2QN8A 3UJ3X 3FTDA 3VM6A 5B4UA 4EGQA 2VYVD 4YALA 3T4PA 4TTAA 3HB9A 2WZBA 1G5QA 1FQWA 2PS3A 1YKSA 2FVXA 2VK4A 3LDFA 1X42A 1CUFA 1U0FA 4U2KA 2GZ3A 3QYAA 4CG1A 2WJ3A 5EWMA 4C03A 3NBKA 1K7FB 1YBFA 2QLLA 4GM1A 4E12A 1X1DA 1UMKA 1RBQA 4HVTA 2G4CA 4MVXA 4OH7A 5EWLB 2Q3JA 1NN1A 2ODAA 2WP8J 4N39A 3ZYZA 3RVDA 4BNTA 1WXIA 3BSFA 5ELLA 5T6BA 2X1MA 3L8ZA 4XD7A 4AW9A 1HEYA 3SQLA 4M49A 5I9BA 3RASA 1ZESA 3DC2A 3QFSA 4C2AA 3E0XA 4BTLA 3DEHA 1LD3A 1K7XB 1LDBA 4XW2A 5TIIA 1WB5A 1BU8A 5FFMA 3R3VA 4EHBA 2ZT6A 4PX9A 3GEDA 4TXNA 5FUBA 5BWOA 2F90A 2I3BA 3DWIA 1YA4A 4K0RA 4QWWA 4ZVUA 4B6GA 4NHEA 5EJ2A 5JAIA 3JWJA 3C70A 2PZMA 3UB3A 3IP8A 3E3MA 3AV3A 3LCJA 4GPTA 4ZEXA 4DUYH 3QQPA 4Q4HA 1L5LA 2PLRA 1KYQA 3IELA 3VGJA 3VI4B 4ESEA 3ZHYA 1L4FA 3LC1O 3PIRA 1G64A 4N7MA 3OF3A 2YFKA 4V1CI 3CYFA 5AXBA 3FNBA 4EHLA 3D8NA 3G6KA 3O9MA 4IZOA 4O3MA 4YGXB 2BQ3A 3HT5A 1GSHA 1DX4A 3ZGZA 1XMQH 2GEJA 4S1PA 3GWZA 3ZQUA 5JISA 1RAFA 1QIIA 3HKDB 3M2TA 1E1DA 5IF9A 4IH9A 4IJWA 4Q48A 3SP1A 4D3FA 1K2WA 1EJBA 1ESZA 2AG6A 3Q0TA 1M7GA 1W9HA 2GMWA 4L76A 2WTUA 3N2KB 2ZI7A 4CIAA 2QP3A 3IC5A 5J47A 3KQWA 2XCRB 2CQYA 3AI1A 1ZC4A 3CZRA 1VMAA 4LXYA 2BTQB 1J00A 2J0VA 3M6IA 3V55A 4LNUB 4ETMA 2VYQA 4ED3A 4BO8A 2XUAA 4B1FA 3OQ6A 4EUSA 1AKMA 1FP1D 3Q88A 1GVNB 3GZ4A 3ORYA 1WXEA 2FDRA 1N4AA 1E2HA 4BAGA 3K5PA 3KZVA 4HGRA 5J9FA 1UBHS 3OM9A 1A5ZA 4OF4A 1N1GA 1SUEA 3CCFA 1NFRA 5E7JA 5IZ4A 3JZAA 4GPD1 2G3YA 4IAJA 3TGPA 2RGRA 3AVYA 3T9CA 5KYKA 1ISJA 5LIRA 3SEFA 1EFHA 1OTYA 5J63A 5TRTA 4Z4HA 3D3KA 4QAQA 5F4BA 3O7MA 1QV7A 3R0IA 1ABFA 3EGOA 3D7SA 1NW4A 4I4CA 2FLVA 3UV6A 1ZN2A 2P6MA 3KSBC 3UH0A 1V39A 2XA1A 5F9MA 5I3ZA 3EVTA 3AR6A 3UG7A 4PZ9A 1HSZA 2DFDA 2NV0A 2ORED 2EWMA 4MUFA 2OUKA 2QENA 3K2EA 5JU6A 1FSSA 4JI6H 1Y7TA 1U65A 3CPJB 1KS9A 1JQDA 3N2GA 2WM2A 3V4VB 5F23A 5I01A 4JI0B 4NARA 4UVHA 4FGWA 5AXCA 1J4AA 1M2FA 1U7OA 2AZDA 3EG9A 3ONVA 4LF4B 1FJ2A 5C81A 5DTJA 2P6PA 3WGGA 2NU9B 1DPGA 4IWXA 1G1AA 1KEUA 2YHSA 3RUFA 3IV7A 2JH3A 4CT5A 1KVQA 2AMLA 1DXYA 3CEHA 4QOFA 1UM9A 1MOZA 5TJHA 3FYDA 4AY4A 3H18A 4KR3A 4EECA 1F2DA 1AJEA 1ECCA 4CM4A 3FYSA 1LB1B 2ZUBA 1XKLA 5CNJA 3NO4A 4FSDA 1XZHA 1SU8A 4MGEA 3C5WP 1BNCA 2FFRA 3VZSA 3PR2B 2P1ZA 4IGEA 5AI6A 3RYTC 3UCFA 4COOA 4BWVA 1H6AA 3GBPA 4A10A 4ZCSA 5DASA 1EIWA 3WSTA 2PN1A 1QLJA 2M05A 1Z0KA 4E1BA 2JEFA 1EAYA 4RULA 4Q4DA 4BQIA 1WSAA 1UPAA 3TQFA 1RXVA 1UFVA 2H4YA 1S2GA 4FIZA 3GJQA 2J3HA 3AR9A 1CQJB 1U94A 2WTBA 2H06A 1KJ8A 5ELMA 2O19A 4G85A 4HB2A 4HSEA 2VQFH 1WB9A 2ECOA 4DQVA 1ZW6A 3OJCA 2C8VA 2DY0A 1EKFA 3NYWA 2Z5LA 1KH3A 3LLUA 4YP9A 5IJZA 4KFTA 1YRYE 2WYVA 1VDMA 2Q4BA 3LWZA 4DHWA 4OX9B 1IY8A 3V6HA 1H9AA 4EB3A 1JB9A 5M34A 2WB4A 2W6ID 3T7IA 3VNUA 4BQOA 1PNTA 2AC4A 1LPOA 2I3GA 4DVGA 4F7WA 4CIDA 2B8EA 1K6IA 3QENA 2BMJA 2BKEA 1OIXA 1DQZA 3JZMA 4V0OA 4HXGA 1CBUA 5DBFA 5BNWA 4X65B 4DQLA 2ZWMA 4ZI7F 1VKNA 4KPGA 5CB4A 3QPUA 4GZ6A 1RIIA 2GZDA 2ZANA 1I4WA 3BFXA 1S0NA 3IUPA 2W6ZA 2Y0DA 3LHSA 1BYIA 2VDOB 2C96A 3FHLA 4N9QA 1GOTA 1EFKA 3KBOA 1OIVA 3MLEA 5CCXA 2G5TA 3I2JA 1WUHS 3K6RA 1S0MA 2I4LA 3WR5A 1KBQA 5KFOA 3I2FA 4B4UA 5EZYA 5UKDA 3OSZA 4KAFA 3H9GA 4CMFA 1P2VA 1JXLA 4O4JB 3LCVB 1H5UA 4RLFA 4CQLA 1NMQA 4RIGA 5FBZA 3O8QB 3NDRA 3ZQ4A 5K09A 1PYGA 4EMSA 3GFPA 4XJSA 4LSAA 1RKQA 2BC9A 5K1ZA 3HGTA 4FUTA 5LDGA 5IT9A 4LZJA 1SEIA 1V43A 4PE5B 4RENA 3IAS6 4FFDA 1W4ZA 1CQJA 1DBSA 2QL6A 4JSYA 4AFNA 3G7UA 5KUTA 2QVXX 3G2NA 4IRCA 3N58A 4GYJA 4W5QA 4FLFA 3GLUA 4ZT6A 2XTJA 4X8HA 3V80A 1WDTA 3QKWA 2A78A 3ESCA 1U5AA 1I4DD 2X2FA 5FNVB 4OP1A 1HL3A 5CLFA 4KVGA 3B36A 2EARA 4G25A 2PKQO 1PFUA 3L7MA 2VYCA 3WJ7A 1T2FA 3P19A 4JX8A 2J7PA 4BLPA 4DEVA 4EH1A 3D8RA 1JG1A 2FLKA 1KKMA 3G82C 3GD7A 4JIGA 3TUJC 4EI9A 2IZ6A 1X74A 2PX4A 4OQPA 4R4JA 1JF8A 3F67A 5DCLA 4YXWA 3SMQA 5LC1A 1N75A 3TB6A 1QO9A 3L06A 4M9QA 3IOYA 1EFRD 4M1OA 1S01A 4GC9A 4MW1A 1RE0A 1I2LA 3MILA 5AYVA 2ABJA 4ZPXA 5BWCA 4CMCA 1M83A 2FQ1A 4EG0A 3HM2A 2NACA 1CR4A 2RGUA 2C9BA 2WBLC 5AHOA 2A4KA 5SY9A 4EHHA 4EYQA 5DI3B 3D3JA 3FOWA 3PVSA 1ODFA 3W6UA 2J6SA 3WFZA 5CDYA 4BCBA 1WNFA 5K0SA 5KNDA 2IV2X 5AVOA 4UBKA 4TS4A 5DBIA 4ZMSA 1CQIB 4LOIA 3C87A 3I9MA 8ADHA 5IEBA 4J2HA 3MZ0A 3EWIA 5FI1B 1FDSA 4O4LB 2UUBH 2ZT7A 1DKQA 1OI2A 2RGNC 2H7XA 4M88A 5LA6A 3FCEA 4RMJA 1JTFA 4LNHA 3JAMW 4BJ6A 4ZIRA 1JALA 1PGJA 1JKJB 1F5SA 4ZVNA 1XQ6A 3RRJA 1F6WA 2JIQA 3QXSA 1SCKA 1XLWA 4HNSA 3S2IA 3U37A 5ALHA 4WESB 1SJ9A 1ST3A 3GLHA 2YVQA 1I1KA 2VBCA 5KHAA 5I9MA 4Y2QA 4D8VA 5J40A 4EB6B 4OL0A 1L5ZA 4FMBB 2XLBA 4JGGA 5CBPB 1TOAA 1T2VA 2GEBA 4WERA 2QDKA 4CGZA 3WFJA 3ZDEA 4MPPA 1TO2E 1M54A 4Q7EA 1JSZA 5LZ5A 3DZKA 3G0GA 3OZEA 4MWEA 4YJDA 4CEHB 3ZR4B 4G67A 3GJYA 3M4YA 3L49A 3QE0A 2Z98A 1P2FA 3LM8A 3SC2B 3RG2A 1F6DA 4BWFB 1NA5A 2XCTB 1GZ4A 1NX9A 3B3QA 2ZUFA 4HNUA 2Y4RA 2ZJ1A 3OPQA 3L7IA 4YP1A 4BEBA 2NZ8A 2R8ZA 3C3DA 1OZ0A 2JHGA 4ENTA 1JA9A 3Q40A 3D8TA 3NMUF 1WHTA 3EPIA 1H1DA 3WRYA 3B3GA 4WY8A 2HD4A 4RLHA 2X15A 1S96A 2V03A 2BTQA 1H9CA 5E3HA 2XR1A 2VI5A 3ODGA 2O2EA 2WUFA 3C1UA 5JCXA 2P68A 3KLBA 3PXUA 3ZUPA 4EBBA 3A37A 2H1LA 1XQXA 1V7QA 4LWOA 3LK7A 3M9LA 2ZIUB 4N7JA 4CCYB 4MEBA 3BB4A 4FYKA 1XB2A 3KC2A 1NUUA 2PQ0A 2UV8A 3T61A 2WWXA 4KQCA 3WIUA 5ARBA 1ZI6A 4ATNA 5JZOA 3F6SA 5K3WA 2HHFB 3BTVA 3C6ZA 3DVRX 1IL0A 3HXKA 5I7OA 9ABPA 2M6KA 3B70A 2MR5A 4WLEA 4YPFA 3UGJA 1RIFA 4M46A 3P45A 2J31A 2VHWA 4G8DA 2W9BB 2IHYA 4QPDA 5FPYA 2GBLC