1GLVA

Three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
299
Chain Sequence
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARGGGGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE SYNTHASE
publication title Three-dimensional structure of the glutathione synthetase from Escherichia coli B at 2.0 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutathione biosynthesis ligase
total genus 93
structure length 299
sequence length 303
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 1993-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain
A PF02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1glvA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1glvA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1glvA01
4GGMX 1KJIA 1GGOA 5C1PA 2R6FA 3R23A 5KKNB 3QFFA 3BSSA 1KJ9A 1KJQA 3G8DA 3Q1KA 2IP4A 1KEEA 3KALA 2FPIB 2W6OA 2SCUB 2YS6A 5DMXA 1IOWA 1DIKA 3I12A 4O4LF 4MV9A 2FPPB 5D8DA 4I55F 4IZOA 3HBLA 1OBGA 2W6MA 3VOTA 2R84A 2J9GA 3RV4A 2YZMA 4QSHA 4MV1A 4O4IF 3ETHA 5JVLA 1T36A 1UC9A 5FNVF 3ORRA 3GLKA 2R87A 3N6RA 3R5FA 4EA8A 3DF7A 2DIKA 4FGRA 4MV6A 2V59A 4DIMA 2R86A 2VQDA 4O7YA 2FP4B 4O7TA 2YS7A 4YAKB 3KAKA 4I50F 2PVPA 2NPOA 1GLVA 4O7RA 4FFPA 4MAMA 2DLNA 4IIJF 5BMVF 4O86A 4WD3A 4EA9A 1JDEA 1C3OA 3K5HA 4M9CA 3R5XA 3JRXA 4M9UA 3JZIA 2V58A 2OLSA 3RV3A 4EAAA 4I4TF 2CNQA 4TV8F 1I7NA 2DWCA 1C30A 2HJWA 1GSOA 2YL2A 3U9TA 4O81A 4O83A 1CQIB 4FFOA 4TUYF 1WR2A 2W6QA 3AX6A 1Z2NX 3N8DA 4EABA 1ULZA 5C8YF 1JKJB 4HNUA 2ZDQA 4MA0A 4MV4A 1CQJB 1EZ1A 1GSAA 2NU7B 4YJ3F 3VPCA 4FU0A 2W6ZA 3LWBA 2I80A 2W6NA 4C5AA 2R82A 1AUXA 1Z2PX 3BG5A 5JH7F 4EGQA 1PX2A 4M99A 5H80A 3MJFA 2R7MA 4FFMA 4XZ3B 4YBZB 3U54A 3V4ZA 3R9RA 4WBNF 1E4EA 2R85A 4O2BF 4M98A 5GONF 4ZQIA 4HNVA 2PBZA 1Z2OX 3HO8A 4ZI7F 4L1KA 2CNVA 2FPGB 2GPWA 4O7ZA 3TQTA 5J2TF 2VHEA 3TINA 2Z02A 5J2UF 1I7LA 4XX0B 3R5HA 3UFXB 2YWVA 3WO1A 1A9XA 4FFLA 2ZDGA 2YRXA 3MWDA 1UC8A 3G8CA 4RZQA 1DV2A 1B6RA 5CA0F 4ZHQF 4YB8B 4EA7A 4EGJA 1KC7A 4EG0A 2W71A 2P0AA 2XD4A 3KAJA 5JQWA 3HB9A 3AW8A 3OUZA 3WO0A 2GQRA 2HGSA 4O4JF 4HR7A 3BSYA 1AUVA 2VPQA 1VBHA 1VKZA 4O7VA 3SE7A 3VPDA 1CS0A 4MV7A 2NU8B 3LP8A 2QK4A 1IOVA 2YZGA 3U55A 3WNZA 2W70A 4MA5A 5JVDF 1A48A 3TIIA 4ZOLF 3VMMA 2R7KA 5HV6A 4O7NA 1GSHA 5KX5F 2NUAB 1BXRA 3TW6A 1KJJA 1KJ8A 1VBGA 4YJ2F 2X0SA 1SCUB 2R7NA 5BPFA 1EUDB 2C00A 2XCLA 2YZNA 3K3PA 2CNUA 1EYZA 1B6SA 1KUTA 2PN1A 4O7WA 1M0TA 4DLKA 2GQSA 2I8CA 2YYAA 5K2MA 5LOVF 4HNTA 4IWYA 5IYZF 4XYMB 4XYLB 1OBDA 2R7LA 3TIGA 1PK8A 4FFNA 4O2AF 3Q2OA 2FB9A 2YRWA 2V5AA 3RFCA 4ME6A 5C1OA 3MWEA 2GLTA 2GPSA 3JRWA 2NU9B 4HQ6A 1W96A 5JQGF 2VR1A 4J6EA 4Y8VB 2CZGA 4MV3A 3E5NA 4YAJB 2NU6B 5LXTF 4E4TA 5CB4F 2I87A 3VA7A 5CA1F 4TV9F 3GIDA 1CE8A 4FE2A 3U9SA 5I47A 2DZDA 5BPHA 3JZFA 4O4HF 1EUCB 1BNCA 1M6VA 5EZYF 2W6PA 3VPBA 1DV1A 4O82A 1EHIA 4IHJF 1M0WA 3RUPA 3ETJA 5HBRB 4MV8A 3KREA 1JDBB 3BSWA 3OUUA 4O7LA 1W93A 2ZDHA 3NUAA 5CAEB 1E4EB 3K5IA 1KBLA 2CQYA 3BFPA 4C5BA 2WYOA 2YW2A 4O84A 3ORQA 1JLLB 2Z04A 5LP6F 3V4SA 5LYJF 2YZLA 4NYEA 2QF7A 4O7SA 4FFRA 4IWXA 5LA6F 4C5CA
chains in the Genus database with same CATH superfamily
2BSQA 2ZRCA 3ODGA 3MQ4A 1PTJA 4K9KA 1BXKA 4KLCA 1JT9A 3PGVA 3UHJA 4CKYA 3KSAC 1G6OA 1T8WA 2GAOA 4RVHA 4PZAA 4KFUA 1FTQA 3N2ZB 4QSHA 1LBQA 3TLGA 4R2MA 1LKZA 4WJZA 2CV1A 4M7EA 4MIKA 1Y5RA 4UDYX 3ZY4A 4Y2TA 3E3OA 2OXEA 2GN8A 4NWIA 5HCNA 1XVVA 1VOTA 1EA7A 1WWKA 5JMTA 4OQXA 2IDJA 4K1XA 4QFDA 1OU4A 4UTOA 4ZJZA 1G20B 4JUIA 1XDGA 1OXMA 3QXHA 4JUZA 3S28A 2PVSA 2REQA 5FRDA 3EVTA 4JLUA 5K3SA 3ZS9A 2CNQA 1RXCA 3AHCA 4IWNA 1CR2A 5CCBA 4JFAA 1QHHB 3C5VA 1USUA 1U99A 1WJGA 5DXJA 3N8DA 2EL7A 4ATNA 4CKEA 2IW1A 2OECA 2I8LA 1RI3A 4RBNA 4Q3AA 4RQTA 1PZGA 5LYYA 5D84A 1DCFA 3CVWA 2FZGA 1I94B 4TXLA 4Y6PA 4EPYA 1NBEA 2E4YA 5CB0A 4EB3A 2W6NA 3JTMA 3KK0A 4I5GA 4MYHA 1XXHB 2Q6VA 1RM3A 4ZQBA 5CFRA 3KEGA 3EZLA 2BI8A 1IEVA 2GYWA 4I9NA 1DC6A 4I5IA 3V1LA 2W2TA 4A3GG 1NVVR 1RKXA 3D3NA 3HB0A 3LQSA 3MINB 4RY8A 2CNDA 2G9UA 1RLOA 4IOMA 1DIHA 1NUPA 5C5DA 1L7RA 2GK3A 2JFHA 4Z3DA 4WV3A 3ELBA 1XVIA 1KK3A 4BHTA 4DUYB 3ETGA 1E0AA 5DNUA 4UULA 4JC0A 3ROTA 4RE6A 4DN6A 2QENA 2GERA 3JQBC 1XTRA 4BEWA 1FTSA 4PZEA 2GEBA 1YTUA 1KY2A 4DHEA 1AV6A 3SOPA 3EULA 4AROA 4GC6A 3G79A 3DKPA 2ZREA 2GF9A 1P0QA 1XEWX 2UXCB 1CVRA 1Z5UA 4UJ3A 1RKQA 2CNBA 4F93B 5AW0A 2C0QA 1ACLA 1K4KA 5EJFA 1U7ZA 2NIPA 2WU8A 1JEYA 4GX2A 4DIOA 2PBLA 4Z49A 3HP1A 1Z0JA 1I3OA 3GPCA 1SQ6A 1F14A 1KPIA 1QO0D 3KB8A 1JJBA 2JCGA 2CLFB 2VH5R 3F5QA 4ZYTA 4KR2A 2QK4A 2PUHA 3U55A 1JH8A 3WJAA 2H57A 1DHTA 4Q03A 1G20A 1X74A 2O0HA 5D5PA 3SX2A 1KJ8A 2ZEJA 2BKUA 5ELXA 1IPFA 2H2DA 1G5QA 4INZA 3IP9A 4LF6H 4ETSA 3NNDA 2DFLA 1QHHA 3QLUA 5BUQA 1V0JA 2CK3A 1M0TA 4WOJA 3VBCA 2VLIA 5EXXA 2WG1A 1U8XX 2ROQA 1BWPA 1G0OA 5IAEA 5KT6A 5BR7A 1F7VA 2I71A 3ZTTA 2OYCA 1U3TA 3WL6A 4F4YA 1XXHA 2JFFA 5KJ6A 1PP4A 1VMDA 3SSAA 2YINC 2VP5A 1QF6A 4A3BG 3PV0A 3KVNA 3PXGA 3M6XA 3DE0X 5D7BA 5CA1F 4MRNA 3GIDA 3IBTA 5CVUA 4AU1A 4KBYA 3MINA 1F8UA 1YUBA 5BWCA 3TFOA 2VYQA 4G5HA 1RWKA 3T52A 4Q45A 2EX4A 1P5FA 1VCHA 4WK2B 3H1FA 3DOEA 3G0OA 2RGDA 3BUSA 2JJ8A 2RHMA 3ETJA 2XGPA 3T1TA 5CM8B 1JDBB 4GZLA 5A7HA 1OAAA 1Z8DA 2A88A 3OUUA 2NYRA 1GG8A 1S89A 4CYMA 3TJZA 1U2DC 1KVRA 1AM4D 5M29A 4D0RA 1CR4A 1SZPA 5DGAA 1ZHFA 4C6HA 2WJJA 1BVRA 3GGDA 4NFLA 1V96A 2VHTA 3A32A 4G81A 4F4JA 3LOQA 4D4MA 1M8FA 1RQPA 4GBMA 2FLKA 3TD2A 4YLYA 5BXQC 2FPIB 3X1MA 1T2NA 4H60A 1RHMA 2Z3VA 1JVNA 4FCCA 2XYQA 5H68A 2V7EA 2SICE 1J9EA 5EMNA 4B2LA 4YCAA 3TL3A 2C3YA 3CUVA 4UHKA 3WYFA 2IYEA 4KWEA 2YZMA 4H9GA 3DZGA 4A2AA 3ZGNA 4IFBA 1EWYA 4UASA 2DH5A 3ZPXA 4QBTA 2IYFA 1CNFA 4XD7A 3SGIA 4H7JA 1T25A 3KJQA 5I9NA 1EFLA 4BKRA 3Q8LA 4D8VA 2HG8A 2RGWA 3G5LA 3FFWA 2BGKA 1J23A 1SBHA 1EQAA 4FSDA 3RNLA 1ZIDA 1VPWA 4R2XA 1P17A 4D8UA 3FNIA 3C8DA 2Q2QA 2PYDA 1DX6A 2FMKA 4U7WA 5CDTA 1TE2A 4ARBA 2W6JA 3A04A 3IMCA 3QBDA 1H4SA 2DQYA 1JE0A 2VDJA 2PJDA 3KHRA 5LP1A 5EKSA 2QL7A 1U3UA 4AF8A 1I10A 2CDRA 2YWEA 1F6WA 3WRXA 5F2EA 4YPFA 1ZH0A 3GRRA 1N2ZA 3ZBPA 1RLUA 3H1AA 2BY4A 1LBHA 1SCJA 1NXWA 1W5TA 1PLJA 1R18A 2YY7A 2F4NA 2A9OA 1XJQA 16PKA 2OO5C 1FX0B 2C9MA 4XR9A 1OCEA 2O5CA 2PGJA 4MW5A 2HBZA 3LCCA 4ZI7F 1VLHA 2D8AA 2DY0A 2IYPA 4OQLA 1BC5A 3UAGA 4DV3H 4GD3Q 4AJIA 2COKA 5DTEA 2DC1A 1R5OA 1JEAA 2FPIA 1PJBA 2L42A 1N0WA 2J5XA 1IZ0A 1BDBA 1QFXA 3VBEA 5AJWA 2FHSA 4AO6A 2QIOA 1HEUA 4ZREA 4ARUA 4P5EA 1PZMA 2WJ3A 2WAMA 3ADBA 5KTYA 2ZSDA 3BABA 1Q6ZA 4RY9A 5KYNA 3AVYA 4BNHA 1SNYA 2D3WA 5AIAA 2ICAA 1OT5A 3CMMA 1H4VB 3RSFA 3VDNB 4JI5H 3UA3A 3KLMX 3F7NA 3K6SA 1E3TA 1QOZA 2IKQA 3A1NA 5CR5A 1LDEA 2W2VA 3GB8B 3MTJA 2GK7A 3I64A 4KGVA 3IV7A 1N6OA 4NZPA 3RQIA 2WZQA 4IDFA 1P5RA 1A0GA 4U02A 5KNDD 3V1YA 3BRWD 4WK6A 1U0HC 1VA4A 2OAEA 4D9IA 1UT8A 3ZQ4A 3GU3A 3K0FB 1H0SA 4G63A 4HGZA 1NAIA 2BD0A 3EZYA 2X13A 1K2WA 5KPDA 3L9XA 2XVAA 6REQB 4DR1H 1I2ZA 4IP0A 4KHPH 1KMHA 4JIMA 4KIGA 5E6UA 3UG7A 2Y6UA 4B2YA 1PJQA 1OGJA 4R2LA 4JV2A 2OVBA 5CVTA 2GNOA 4NEGA 1FX0A 2WAOA 2P65A 5CIQA 5IDQA 1Y1PA 4D5GA 1WDTA 5B3KA 1UJNA 1FDWA 2QD2A 1FF9A 4OHCA 1JR4A 1LDMA 2AN5A 1DV1A 3WWHA 5B6PA 3IPXA 1M2VB 4Q4HB 2QM0A 1ICIA 2CXHA 2X14A 2PHZA 4Z7OB 4AZVA 1NLMA 5AMXA 1WETA 1KAMA 3EYWA 2EWVA 3WFIA 3O1HB 1LQTA 1I4EB 4G0ZA 1YQGA 4WH0A 2A84A 1T6NA 3QNUA 4DLRA 4BV9A 4R5MA 3KLOA 5GZ6A 2UU9H 4QLBA 2BQRA 4H6WA 2R9VA 9LDBA 3EZXA 3B2NA 1TQ4A 1SKQA 1ZETA 4I6EA 1BSVA 2PFSA 1K1SA 2DPJA 1Z6PA 2H92A 3BK1A 4X8HA 1EG2A 4ED6A 2XQKA 5CVVA 3T1NA 3RS5A 1YRAA 4R9RA 1PW7A 4G0NA 2M98A 4KH1A 3PLAE 1E96A 4MP3A 4CR8A 1GZ6A 1RP7A 1W1UA 2HHLA 4CLDA 2J46A 3MCVA 3OTOB 4L4ZA 1CJVC 5A4IS 1BH2A 8OHMA 1D0SA 2XMZA 1R0RE 6REQA 3DE6X 4R0MA 5DGXA 5FWDA 2Q1SA 1OAOA 2JH8A 3MERA 4YVFA 3SYNA 4K9LA 1O8CA 1HFJA 2GZ1A 4MUAA 3GARA 1MZBA 1JA0A 3FTCA 4M9XA 5B2EA 2BGTA 3IKLA 4HBGA 2O6HA 4WAUA 1XZNA 5C35A 1HE4A 4E2XA 2ZRGA 4L50A 1BDHA 3MGGA 1PFGA 3T7DA 3THWB 2YOHA 4PRYA 2NZ2A 1WZEA 1M2VA 4J7XA 3DAOA 4Q4HA 3LHDA 2PMFA 4YRZA 1FP6A 1DO0A 4KPGA 2OO3A 4BV2A 3CZQA 4CM3A 4ZEWA 3HRKA 5KC9A 3F9CA 2VOJA 2RKBA 4N82A 1D1QA 1U0NA 2GBLC 4EX7A 1N2CE 2WDPA 3UVEA 3QVGB 3KZXA 2CXSA 4X61A 1ZXXA 3IQEA 5ESDA 1Z07A 4MWTA 4CV2A 2A30A 4DCJA 4EW6A 1XCPA 2PS3A 1DADA 4MS3B 3GLHE 2XKJE 3VOSA 2BHLA 4PN7A 4PPQA 4PPFA 5I5SA 1KI8A 4O4LB 1ZAYA 4WOPA 5KOYA 2R93G 2P41A 4U7FA 3V48A 1GV1A 4D0LB 1VSQA 2O57A 2VHYA 3QKWA 4EF5A 3NGMA 4N48A 3AOEC 1WEKA 4AY2A 4DMMA 4NFHA 4B79A 3T1VA 1A48A 3O2NA 4EL0A 2D4AA 3VM6A 1YRLA 5KC8A 3NALA 1KJJA 3DLIA 3Q40A 5F1KA 4GH5A 3O03A 3UK6A 1S2GA 4FGWA 1JSCA 2PU5A 2IS4A 1B7GO 4QPJC 2ZBVA 1HURA 1MQ9A 1FK8A 4TTIA 4FBUA 1A76A 4EY5A 1XJCA 4BNFA 1ISPA 4XYMB 2QP4A 2C5AA 4Z9FA 3AG5A 2YV2A 3DSRA 1QHFA 4R9VA 4Q82A 3PQ6A 1CERA 4C4PA 1PKXA 2YRWA 2DFDA 2ODNA 1L4FA 3THWA 3M6UA 3PC3A 3WGMA 3MJSA 4KO8A 3RTAA 4JB2A 5CBKA 5TMPA 3TM4A 1II8A 4Q66C 1U0LA 5DHSA 3AM5A 4UPEA 3IQFA 3EAGA 1IZ9A 3TQFA 5D6NA 5DX1A 3VVBA 1L7QA 3HUUA 1NP6A 2QLLA 4NFYA 1QPZA 4E32A 2JCBA 3EF0A 2Z3WA 2ZRLA 3A4NA 2LDBA 1U8FO 3B3AA 3L7JA 4E2ZA 2CT8A 2V3VA 3ZHBA 3QVGA 1RQGA 1XNHA 4FYIA 2BM9A 4YNBA 5LCXA 4O6VA 1CFZA 1AB5A 1A82A 5IYDG 3AJRA 3AUYA 2IYYA 5CCDA 2D00A 1P77A 5KOJB 1I9GA 2ZIVB 3INTA 5KVAA 4LJ4A 1BS1A 1YJQA 2N0SA 4DR3B 2WG0A 1KQPA 3MWLA 4RUKA 1KJQA 3I8SA 3LFHA 4AQDA 3DAFA 1ZNWA 3GFGA 4FJ1A 2BUBA 4RJJA 4FN4A 1YS4A 4LJYA 3D3WA 4OKSA 3EH1A 3PSHA 3IOYA 1RRMA 4PYJA 3QY0A 1GN8A 3ZE6A 3GGCA 3I5YA 1E9EA 4X91A 4B6FA 1SKBA 3V32A 1S9HA 3LUPA 1DC4A 4F2DA 2G08A 4B6JA 1C29B 3F73A 1FTGA 2QN1A 4OTZA 3HGMA 1TDJA 4XYMA 3E7XA 5A5EA 2B63G 3TWOA 1SQFA 4YUZA 1SXJC 4IRDA 2XUOA 1M0EA 2P40A 2WSSA 2QM8A 1S1CA 4MUEA 4BMPB 3VH4A 1JV2B 3HKZE 1JI3A 2D5BA 3CPHA 2ZE8A 1PWXA 4HNQA 2AK3A 5B1SA 2R97A 4HNUA 4MYUA 1UOPA 3UKDA 1XTSA 1Z0ZA 4FS8A 3DOHA 3Q7TA 4M1WA 4HVTA 1D7OA 5JROA 3HXTA 4XFKA 4BX3A 3UPDA 3ZU6A 2LTAA 3GBSA 3AERB 5KVQA 2XGMA 3INNA 3CUEF 5E3IA 5E1DA 3H0KA 5IBQA 3QE2A 4XW2A 4IG9A 3R4VA 3A9TA 4CUZA 2ZRNA 5J1SB 4ZZIA 1R5JA 3ANXA 4RF3A 3ZDQA 3L8EA 1JEEA 3G17A 4LRXA 4Z86A 5G0UA 3OY7A 3RGZA 1DKNA 3NQ41 2HNKA 4N0EA 3BTVA 3WGTA 4GG1A 4MV5A 4Z9XA 1FYXA 1ZU4A 5JALA 1N2CB 2JKYA 3PS9A 4Q39A 3OMLA 1NF3A 2Z02A 4JB0A 3L7OA 2X1LA 3O94A 3IAS1 1RM5A 2JIOA 4EYHB 3W6OA 3OCVA 2YBEA 1AXRA 2H7CA 3W7VA 2ATLA 1B74A 2AJLI 3GLHB 5KDDA 4MIOA 1N0UA 2NZYA 2DPHA 4U2EA 2AV6A 4KO1S 3KLPX 4NV0A 1YJAA 5CYOA 5T3YA 4R8KA 3PR2B 1X9NA 2XCIA 2VJCA 3EGDA 4IW3B 2KPOA 1BQEA 3WGJA 3GLGE 4O2AB 3LIIA 1MD9A 2J4DA 5DN6A 1CLEA 5I5UA 2WTAA 2QG9A 4OJMX 2OCAA 4IICA 1TD9A 3I5MA 5DOZA 2B8WA 2QR3A 4B87A 3NYIA 4RVDA 2QJRA 1OWNA 2YVAA 3BICA 4XUEA 2C58A 2H2HA 3D1VA 2YIJA 2B6HA 4JXZA 3IJ5A 3ZJUA 4V38A 3LRTA 4FC6A 4CG1A 1W49A 4GPIB 1K9SA 1C30B 1AZLA 1UK7A 3GHHA 4MHTA 4A91A 4RQAA 1ZOOA 3GH1A 3VJLA 1FYWA 3PQ8A 4O0LA 3GGOA 3MB8A 1L7DA 5C7LO 4XOIA 3N5CA 1PR1A 1S2IA 1L2ZA 2RGGA 2VDWB 1EWRA 5C53B 2HMVA 4QBGB 2X2EA 1N2CA 3JVEA 1S10A 4JJ6A 3EQ2A 5EXTA 4H0CA 4IS2A 2RHRA 2XT0A 3OQVA 2C94A 2NGRA 4BWVA 1ZM2A 5DM2A 4AG5A 3V2UA 1WCMA 1WW8A 1G291 5K8CA 4Q16A 5B6JA 5FBWB 2PKEA 3GLHA 3GZ4A 3S99A 4JI3B 2WFZA 3SLRA 3X44A 4JS0A 4LDJA 1NW5A 2Q5EA 1M2OB 5BWNA 1Z5VA 2X0JA 5EOVA 3DVSX 3TECE 4ITUA 1E0DA 1VJ1A 2HEGA 2HK9A 3KO8A 4LIPD 1P74A 4O2AA 4X0EA 2NZXA 1ZNXA 2O19A 4KU4A 1VL6A 3BTUA 4JJKA 5FLYA 1ORIA 5F23A 3WMEA 4YRIA 4DC9A 4YAEA 2HHHB 3JAWA 3NEJA 5KYKA 1BXGA 4TYNA 3CRRA 4FGRA 1PO7A 3GWGA 1PV2A 3K8OE 2VDOB 4QYXA 1R27A 3V1UA 1XMVA 2DBZA 2D5IA 3H9GA 1Y1SA 4EG8A 1NUTA 2VF2A 3KB1A 2D7CA 2NXWA 3HB7A 4IM7A 2CHQA 3GEBA 5CTAA 4RIFA 4U9IS 1EB8A 2ZJ5A 3BDIA 1O7JA 1YMQA 1C30A 3RHZA 3EPLA 2G8NA 4PQRA 1QHXA 4MZDA 1E1NA 4Q15A 2D54A 2CBXA 1E7RA 1PEYA 5A6SA 3O8RA 2IHZA 1CIPA 4MA0A 4MW4A 1L4LA 4A1OA 1LBSA 3SHVA 4WOCA 2VDWA 5AXAA 3GJ7A 4TTQA 1F0KA 4DKJA 1ZD8A 4RDIA 1G2IA 3MJDA 3O1JC 5FR1A 3VHXA 4GKJH 1Y42X 2ZRMA 4B9EA 3RHSA 3D59A 3CEAA 2Z9DA 4GEKA 2V6FA 4LRQA 1QRDA 3QE4A 4EYQA 4BKQA 2K4MA 2MYPA 1KC3A 4P80A 3TI9A 4HRAA 1U2TA 1TA8A 4RKWA 5CXQA 3OX3A 5CM0A 4FQ7A 3IDFA 3E7WA 4Q4JB 2P9FA 4FWIB 3U6BA 1V5EA 2FR0A 2DBYA 2VPTA 4IIDA 1IK6A 1UC8A 1Z2AA 4AG6A 2C2OA 5IDVA 4WN9B 3D0KA 4BFUA 2GOYA 1DFIA 3IQWA 1BKYA 4WL0A 2ZOSA 4EPVA 3IIEA 1VYUA 2VZ9A 4KQGA 1H0HA 2DKFA 4JIGA 5FFMA 5BWUA 3IT3A 4PU0A 3NB0A 4DJ5X 2QT9A 3MJHA 3W5HA 2PAFA 1KO1A 3GNLA 5F7XA 1ZLYA 3K9CA 1U9IC 3MGCA 5FUQA 2Q5IA 3LL4A 4OYLA 1W0KA 2J0QA 5LVAA 3UZBA 1R5BA 4ZGWA 2AZDA 3R6LA 1H23A 1C7RA 1AHIA 2AW3A 5CE8A 4DM3A 2OXIA 1GPAA 1OILA 5FB3A 3NP7A 4M21A 2B61A 3S70A 5C5JA 3HKZA 4G23A 3U3ZA 2JLRA 4WA8A 2G1KA 1PK7A 2CSUA 3GFPA 2DCUA 4MEAA 2CVPA 4RYDA 4CJXA 1UINA 4AY3A 4Y2UA 3B6EA 4BVBA 5BQ3A 3HE3A 5BMOA 2GMWA 3CZCA 2R7LA 4X20A 5AXDA 4F6RA 3MGBA 4JEMA 1A7KA 2ZBQA 2P4EA 3SHWA 1V8BA 4WFQA 1RI5A 1UBRS 1C9YA 5BR4A 2C3UA 1L4HA 2LDXA 2JGFA 1NLUA 5D3ZA 3L02A 1PF7E 4PDBA 1RC1A 3GUVA 3UT6A 3VYUB 3HL4A 4G09A 2JAHA 4JGGA 1Q17A 2J67A 2BCJQ 2ZBUA 3LWNA 3WADA 5EJ4A 3FAZA 3R3WA 2Q4OA 3O2QB 1XPJA 2VDRB 4B7CA 1QV7A 1HLFA 3MJRA 1X19A 4Q4JA 1C3EA 4OYRA 5KKAA 1T0UA 2NQ8A 5BY2A 4WN9A 2WYVA 1SUFA 5FEMA 2V98A 5BV0A 4MDHA 4WKOA 4CTMA 2I6SA 4N39A 3RC3A 3ADPA 2AC7A 1CCWA 2VHVA 4B3XA 5F1YA 3GLGA 3HDHA 2PH3A 4S1VA 1GO2A 1OH8A 1IQRA 1EQUA 4PS1A 1L5VA 5ALRA 3KC2A 1E3IA 3D6HA 1M74A 1IM8A 3DCNA 1ZESA 2WTFA 4R40A 3AINA 3GY0A 1H8EA 1G8SA 1TMOA 2Z6AA 4NSNA 4TL7A 1BX1A 2DABA 4CUJA 3H42B 2HL6A 2GN9A 3QVLA 3MELA 3PFNA 4YA6A 3L4SO 2L19A 1XRRA 2FRXA 4BQIA 1K86A 2DLNA 2O2GA 2A58A 3HCDA 4G1VA 4V0SA 1SB9A 3O91A 3I2KA 2OYRA 1ZWKA 3KQWA 4ARIA 5TF4A 3HDYA 1FLAA 4RY2A 3B1KA 1PFWA 4QWWA 3C4VA 5FLEX 3F7MA 1L5FA 5T8KC 3J7AK 5IANA 3K9NA 5FD8A 5JSUA 5EE9A 2VP9A 4ER7A 1RJRA 3LX8A 3LA6A 5I7RA 1DKMA 4TVKA 2XWBF 3HN6A 3FKSA 1ZXBA 3SIXA 3QWHA 2P8JA 1E61A 3WGLA 1UPBA 1H42A 1KE2A 1U28C 1YUNA 4N76A 3MYYA 2D5AA 2X9LA 2HPAA 3KWLA 1YQXA 1OIWA 4UQPA 3ZJTA 2C5EA 3AVOA 4NBTA 2JAXA 4P7KA 2OV6A 3PDIB 5ICSA 1Y8CA 4DL3A 3B9QA 5GY7A 1QH8B 1MF7A 1WW3A 1VZ3A 4S1NA 1D4OA 5AKLA 4IIEA 2ZIWB 4KQ2A 3QPDA 1EG7A 3ME5A 3CLRD 4GLWA 2XB6A 2HWWA 1KH2A 2PKRA 3WDSA 1SD2A 2CFTA 4YB8B 4XD2A 3V4PB 5BYKA 3HJHA 5MHTA 4EECA 2GXQA 5E0OA 5FA6A 3GRYA 4YBRA 4OD0A 4J1SA 2HDWA 1U1IA 2CFRA 2R47A 2XRYA 3E0QA 3UMRA 1YB5A 3TQ1A 2QNIA 2ZM6B 5C8ZA 3P4YA 3BRSA 5DAAA 2JDID 4UKDA 2PUBA 1XF9A 1F48A 5CYFA 3N1UA 2LBPA 1R3UA 2CNKA 2HU5A 4UE2A 4S1OA 1TU3A 4ZOLF 1X15A 4GO1A 1E20A 1YDWA 1T1JA 3EDYA 4BNWA 1FFSA 4ZAXA 3EISA 4KJZA 1GG9A 1HPLA 2EYUA 3EAFA 3M3DA 2QR2A 1WMSA 2I1VB 4R2HA 1E4OA 2Z9CA 2O8BA 2O0JA 4HGOA 3GA0A 3HJNA 2H5IA 1N8KA 1DXOA 3VZBA 121PA 5I48A 4O5AA 3RYHB 1AGPA 3LBFA 3DEYX 3N40P 3AXTA 2AH5A 5J4HA 5DYNA 3VC2A 5COAA 4ZU1X 4QDJA 1Z6XA 1T9GS 1AKQA 2FEWB 1OKKD 1OA0A 4BBZA 5BNTA 4YR2A 3JRWA 2QY6A 1DAIA 3LX5A 3OM1A 3CZPA 3CTPA 2F90A 4XVCA 5F52A 1DRVA 3D0RA 4A2QA 3TOCA 3CHYA 3LC0A 1IATA 3U9SA 1LPSA 1EBFA 4RXUA 2PKQP 3PDIA 1TCUA 4JSRA 3W6ZA 4LBVA 3HEAA 5D1HA 1RFLA 4O4IB 2PY6A 5EXDA 4IH1A 4QTUB 1HQKA 3NUAA 3H5TA 4WNCA 4ERNA 1GGMA 3D7MA 5EEGA 2VCYA 4YB8A 1XHLA 3ZKWA 3PF9A 3RABA 5JDIA 1N5MA 2NO9A 2PCJA 2O3TA 4CF5A 3FYSA 3P0RA 1N34B 1KJ9A 3KVRA 3C2QA 2Y6VA 4GUAA 2ZJAA 1W52X 2EKQA 4HYEA 1EXVA 2ETXA 1F6DA 3RUDA 5HGJA 3L84A 3Q72A 3RB3A 2CCGA 5EIHA 1GU7A 4EKIA 2ORED 2VDVE 1YR1A 4KAFA 4GSYA 2BGIA 4ZVRA 5IG2A 1NT4A 1K98A 2JVJA 5E0KB 1KMNA 2OAQ1 4F11A 2ZI5A 3HDGA 4E03A 2O8EB 2BM1A 3PYXA 4ZDJA 2R86A 4R98A 3R7SA 3PXCX 2RIRA 4AYBE 521PA 5IHXA 1FNMA 2FZLA 4TRNA 4ZXFA 4G25A 3LIPA 4MAMA 3RYHA 1IVYA 3FMVA 2NO1A 1UJ5A 1IVSA 3GEDA 4UZFA 2WMDA 1JR6A 1AF4A 1LU9A 3KHHA 1FMJA 4N40A 5DX8A 2C2MA 4O81A 1O4WA 1WHTA 5EN4A 4UMDA 5BYBA 5K03A 1XCLA 2H1SA 3DDNA 1MEJA 2FUG6 3NLLA 2J31A 2QUIA 5ALZA 3HB5X 2NP7A 4H4DA 3CRVA 4OXNA 1ECBA 3LWDA 2JGMA 3GJ6A 3VPCA 1KWGA 5KFXA 2W2MA 1IMJA 3E18A 2R82A 3VKUA 4R9SA 4FNGA 5LPNA 4DMUB 2UUBB 2E82A 4EW3A 2V9PA 2WK1A 4HUTA 5SY6A 3DT6A 2CVFA 2JLBA 2RGRA 4CUKA 4O4IA 2FW9A 4CEHA 3KCQA 5ER9A 4XCVA 2WB4A 3ZWKA 5TGTA 4O4JB 4FZ5A 2WMOB 3PL5A 3QF4B 2KS6A 1HFWA 1WV1A 1HV8A 1OI2A 4JC4A 2ORWA 1TAEA 3KOUA 5HE8A 4B3HA 3HV0A 2F7SA 2O8FA 1SHJA 1J8YF 3GEMA 4YP7A 2VYCA 3DBVO 1GTG1 4HEA6 2C5HA 2FX5A 3ABIA 4OHFA 1F4PA 5EUBA 4BASA 2PO7A 3U3JA 4LJ5A 1CWUA 1WM1A 1P1BA 3MHTA 4FQ8A 1KK2A 1IBMB 3ZWPA 3U1VA 3B8HA 1XZCA 3QLVC 821PA 5L1LA 3RU9A 3RREA 1QV6A 4A0HA 2MTBA 2O8EA 3L5OA 2IZ5A 3AIMA 4A3EG 5T3UA 1S8AA 2XLBA 2VWPA 1UDXA 4ZO9A 5L4SA 2JIRA 3TLEA 1AQ6A 4ID9A 1JDZA 4J0QA 2XQIA 3NKVA 4ON9A 1IIRA 5KX5F 1J5PA 1J97A 1S2OA 1R7RA 4LOIA 5CXXA 3F0TA 1DC7A 1PSDA 1NBMD 4JH0A 3VI4B 4F46A 3CQZA 2Z58A 2EP5A 3P2YA 5EJ9A 5DCWA 3FNHA 5JZVA 2FJZA 3IELA 1E7WA 3I9KA 1L7MA 2I4TA 4O7WA 4QGBA 3BPSA 1X8LA 1Y1TA 3NBAA 1RYDA 1GKLA 2CVZA 2FEXA 2XSZA 3T8YA 2QN6A 3TIGA 1BU5A 4BMCA 3UMGA 1KSJA 1U2RA 1XL0A 5TRTA 2O3SA 3OFND 4DXAA 4M1QA 1OREA 3JYQA 3K20A 5F51A 1JEYB 4C7XA 2Q50A 3L0PA 2PYZA 4AD8A 1OWTA 3B1FA 5E95A 3AMVA 4CODB 4ZT2A 3SR0A 1THMA 3OLXA 3KTMA 3HO6A 2ST1A 4GS5A 3GPBA 4YN3A 1L9XA 4O4JA 3P0HA 5JNRA 3UXYA 3QF4A 4A3SA 1CY1A 3BA6A 5IW8A 3LXRA 5KNCA 1KI4A 4GOKA 4ARVA 1A9TA 2CJFA 3KM0A 1SVKA 2FW6A 4YRSA 4XUCA 2OCLA 5DBFA 1KE1A 4LGYA 3WB1A 3R9KA 4JI2B 2D8MA 3AZOA 1Z4MA 4LVUA 1XVUA 2DKOA 4AXXA 1DFGA 1YULA 3KL2A 1URPA 4TTPA 1YIAA 3H9QA 4P92A 5EZQA 2JGIA 1B8PA 4IUDS 3MQFA 3X1DA 2PSEA 2DUWA 3SICE 4MCJA 1ABEA 2ZRJA 3KD2A 3OOEA 2CL7X 5L45A 4FGUA 4E5MA 5I3ZA 2FK7A 4IX1A 1SVWA 4CM8A 4W5NA 3FLMA 4RIIA 3RSSA 4FONA 1EUYA 1NA5A 3KVYA 3C7DB 1UEIA 1XZIA 2OCDA 5DG9A 1QZTA 2Q4BA 5KQGA 2CFOA 5AQ1A 4HAIA 2J3LA 3HY4A 3SBXA 3OF3A 3EN0A 3BXGA 4RFLA 1MG5A 3ENZA 2R87A 4ED7A 3RC9A 1VKHA 3RYTC 4JR2A 1CZUA 2E7ZA 2A35A 1F8YA 4BNTA 4H3VA 1FYDA 2K5UA 3MTBA 3BF8A 4HB3A 5JW6A 5BWLA 1IG0A 1ODFA 3GAAA 3IMFA 2P9TA 2VF7A 4LTDA 5CX1B 1TJ3A 3JYHA 3SVLA 4FR5A 3GV5B 3LLCA 3HCOA 1HLPA 3N8IA 3SFZA 4FFOA 1MJNA 4P2BA 3H19A 2BBSA 3EVEA 2AOUA 2I7VA 3GLVA 1VCMA 2P77A 1RKVA 5DKFA 1ZJ6A 2NSHA 1FFGA 4BFVA 3BJRA 1CC1S 2CLCX 3LJKA 1GKIA 3CF4G 3L1UA 3L4EA 2P5SA 3KJIA 3MLBA 2ZE6A 2O1EA 1H5NA 4EGQA 4DA0A 3ND6A 5F7OA 3LCVB 1ZJJA 2A5YB 5KFQA 3CPSA 1Z82A 4RK7A 3GJ0A 1JA1A 4QHYA 4U00A 3R9RA 1V71A 4WKPA 1P3JA 2Q6LA 1JIQA 3GVXA 5BQOA 4LZJA 4DNFA 3V4FA 1SCBA 4ZQEA 4L1KA 3HEMA 4HQNA 5G0TA 4I50A 3Q8WA 3GJ3A 1F0PA 4UOQA 2F8MA 4LJKA 3OX2A 5A7FA 2Q8NA 1MX1A 3CV3A 3FPKA 4I81A 5EWFA 3SQOA 1Y33E 2IZ1A 3LI2A 2XE4A 1YK0A 2EZTA 5E7MA 3OURA 1HNNA 2QGZA 1W4LA 3PEEA 2C4UA 3TLYA 1RVV1 4FHCA 3D4OA 1A50B 4LHEA 2BMWA 5B7QA 3R0IA 3L4KA 3HRHA 4BV8A 4QOFA 3AF5A 1PJ4A 4AYBA 3U0BA 4E7PA 4Q93A 5CB8A 2CCKA 2W0MA 5IF9A 1GCAA 2QYSA 4P54A 3TIXB 1N48A 4E31A 4CIXA 2X4IA 4XJVA 5CX1A 4PZPA 5I9BA 2X7JA 1Z25A 4R6XA 1DEXA 1ZM9A 1UDAA 3IUYA 2Q2OA 4L0CA 4E09A 4FW9A 4Y6LA 5L40A 2CZCA 1W35A 1FU4A 1QQAA 3OECA 5B37A 1MZPA 5T67A 1MC5A 1O75A 4C0KA 2F1IA 2ZJ0A 2ZSIA 3PDJA 3JYLA 4QDUA 4BB6A 5EY5B 2ES4A 3HUTA 1DPFA 3PF8A 3PHLA 1NZJA 2G6TA 2I29A 1FJGB 3BIXA 2OZKA 1LNSA 2OBLA 5C8XA 5HRAA 3N3AC 4P3YA 3BRQA 3EXG2 4CE6A 1LX6A 3GYGA 4B09A 3ADOA 3K6SB 1UANA 1YC2A 2AOXA 3UM9A 3WK5A 2AXEA 3WGIA 4IDAA 4G07A 2BHRA 2JAQA 1CR6A 4UNPA 1ZMXA 1FFEA 3L8GA 5K5EA 4UHEA 1YZUA 5JNLA 4YECA 2FDCA 3BIJA 5DT2A 5BV8A 1IBKB 3OZDA 4RCNA 3MGKA 4ZAFA 1K3TA 5IP7G 4YJGB 3F3MA 2W7PA 2V6IA 2YZLA 5FPOA 3Q7QA 5FDFA 3LZCA 3UAVA 4JV0A 1PJCA 3I9LA 4CQMB 2EERA 4EJ2A 4KXFB 4KIJA 2XVZA 1KMHB 4UFOA 4AS3A 2PX6A 5E6UB 1PT7A 3N75A 2OP0A 5AKZA 2QVCA 1IIBA 4FMBB 2VWHA 2TS1A 1U5AA 2JLCA 1GGEA 5KQMA 3FXAA 1M2HA 1K08A 3C1AA 2ZVJA 1HDCA 4BLRA 5HE9A 4MV1A 2R1ZA 4NE7A 2J3JA 1L3CA 2C0PA 4M36A 3R5FA 5FA8A 5BRAA 5U4XA 2G7MC 2VI5A 5B55A 1JHRA 4WCVA 3EQ7A 4XYBA 5IHPA 2BH9A 1H2YA 4YMUA 4H7PA 4LKRA 1NMQA 1ZWLA 4FMDF 4MWGA 1KJWA 2V6MA 4GLOA 4QOHA 1BXRB 3F6EX 1B73A 2Q5LA 2PUGA 3TXYA 5AJXA 2H3EA 1NKSA 1CHNA 3EVCA 4ONEA 2XMSA 3KNZA 5K0BA 1CYDA 2C2KA 5CCXA 3TCXB 4O83A 1OYVA 1A9YA 4BGDA 1D2EA 3RE1A 1R15A 1MXHA 2BFFA 5B3JA 3K0SA 4HX2A 1XBTA 1CNEA 3VSEA 3U4HA 5C37A 4LDZA 2XWJI 1ZGAA 5DWQA 1L5OA 4YP3A 1E32A 4UREA 3HSKA 2XTAA 3CG4A 1EINA 1NPYA 1X0VA 1NW4A 4B0PA 2WFLB 2UZ4A 1ZI9A 3B1ZA 3N9IA 1ZGBA 4HRVA 2JD2A 3G5AA 4L95C 4BEJA 4RTPA 2YZ7A 1N36B 3B6MA 1A0IA 3RK1A 4I1VA 4XOUA 4HN4B 4ARCA 5LMNB 4N01A 3QTLA 1I6MA 1P7CA 4HSEA 4YJGA 5IT5A 4JNKA 1KI9A 3NHZA 4GR9A 3Q3IA 4IH9A 5FUYA 3PHCA 4IIVA 4AZWA 2Q7OE 2FPGB 3FZYA 3WOHA 5G40A 3Q3GE 4GVXA 4COKA 3LY9A 5KNDH 1QIDA 1UWKA 2ZYTX 5H70A 1JKXA 3AUFA 4PZZA 4FGZA 4QIWE 1R4MB 4CQMA 1LWOA 2W6IA 3LT1A 2P62A 3RFUA 3VU8A 1X1SA 1Q1GA 1DIRA 4RPGA 3V2HA 2X8BA 1E99A 4F97A 3L43A 3FSGD 3RSLA 3TLBA 1B6RA 2SECE 2C9CA 3FVTA 3TD6A 1BGXT 1I7DA 4RXTA 1T0HB 4AWBA 4LSAA 1HFKA 3J81k 2W71A 4P93A 1RWBA 1PYGA 2PRIA 3QFCA 4K88A 1Y3FE 5MGNA 2JCXA 4PVCA 3LNCA 4KYUA 1A97A 4JYCA 1ZH6A 1EVEA 1D8TA 3P52A 4XASA 2WJZB 3Q8PB 2H65A 5C51B 2QUBA 4BIIA 4JLPA 2WYHA 3WLEA 1JQLB 3SXJA 3WWZA 3FROA 4UTNA 3HL0A 3GIPA 4CL0A 4BQPA 5AD1A 4D26A 2OO7A 5ECYA 5FTWA 5G0WA 3DMGA 1BXRA 5JYEA 4EATA 4OMDA 3AF0A 1CU1A 4MUIA 5HCIA 5K8LA 1IH8A 4I6JA 4P36A 4EKYA 2NTEA 5J5VA 4ED8A 2YOGA 2HRQA 3ZWAA 3ZYZA 3RU2A 2IYQA 4BMOB 2JLXA 3V6JA 5CU7A 3T5PA 3F74A 3HDVA 1DIGA 4AUEA 3Q8RB 3PUXA 4IHJB 3I5UA 3CF6R 1FSZA 3TAUA 1W4BA 1N5DA 1YBFA 2RHOA 3Q3JB 2WFLA 3ELUA 1X1CA 1MENA 2FPKA 1M7HA 1SXPA 4IVPA 2NVXA 1S0OA 1V3UA 3N0WA 2GO7A 4MJ3A 2BLNA 4PRKA 5IJZA 3PNVA 1Z0UA 3GZTB 2XF2A 3D9QX 4IQ0A 3NOQA 2DCMA 1RAEA 4C3ZA 1AE1A 3ADDA 1DXQA 2LUOA 2ON6A 4JYAB 1OBVA 2VLBA 4EMUA 2JLZA 3PICA 2MCTA 1N7JA 4EHLA 4UAVA 5CT9A 4PW0A 3HZZA 2AIRA 2FPGA 2QSYA 2UXDB 2Q62A 1RQNA 1R4MA 4X3CA 3ZDCA 3ILSA 2EJ3A 3EVNA 3K2EA 3ZE2B 5HTOA 2C20A 3HNRA 2ACVA 4D44A 1RCUA 1G17A 3IAAA 2PMBA 2MINB 5I4BA 2VJOA 3LY7A 2H1VA 1J21A 1SD5A 2WZDA 4ARZB 4PICA 1EKVA 3N2YA 1ATZA 3N5KA 4GYYA 3RKRA 4LYGA 1Z22A 3ZDZB 3AGPA 1Z18A 3MAGA 3R23A 1EP2B 3EUEA 2ACKA 3F4KA 1KO7A 3B3GA 3SBEA 4RVOA 2XNCA 2I76A 2C77A 1EE2A 3ZK9A 1A8IA 3GNSA 4CF4A 3OKFA 3IO3A 4PSVA 2XNDA 1II8B 4BEBA 2WB1E 5H8WA 1H4QA 5CW1A 3ZGXA 1CDOA 4EBBA 5HDBB 2PR2A 1TM2A 3MZ0A 3M33A 5FL3A 1YS6A 4J2HA 1OVGA 4CQNA 4BNIA 1WNFA 4RAZA 4BLSA 1ICEA 1UT6A 4AZ3B 3A3YA 2MSEB 2YYZA 3WBBA 5LJIA 3DMPA 4PZCA 1LK5A 2BGRA 4J4TA 4XVHA 5ALGA 4OK3A 2GCEA 3SLKA 1PFKA 4LKOA 3URMA 3TUJC 4IHJA 2TMYA 1DBWA 5CX4A 2CL0X 4B8ZA 2XLCA 5C4IA 3F7TA 1WH2A 2V1UA 4AG3A 1LZKA 1KKMA 3T9DA 4YT8A 2WP0A 4LBZA 4Q44A 1X8XA 1WKVA 1VXOA 2Q6TA 4YALA 3OX4A 1CZOA 4Y0NA 2B0CA 4WFJA 2WDZA 4H1HA 1A0OA 3D3WB 4BQEA 3KSZO 3OJOA 1M6NA 3COJA 3DONA 3UWKA 2WAAA 4KXNA 3WJ2A 2IJGX 1KEWA 1K7YA 2Q4DA 2V7XA 3TMKA 1HYGA 4M99A 2ZYVX 3IKVA 4UATA 4F12A 4W9NA 3NAGA 5B1YA 3BWBA 4UAJA 5K3DA 2CXQA 3DTGA 1R5NA 3H7IA 3WKDA 1L5SA 4Q9DA 3DW1X 4CIDA 2MINA 3U7GA 4GP9A 4P8RA 4ARZA 1D04A 3DTFA 1O0CA 4HB4A 3ESRA 4Q9LA 1U9CA 4NS4A 4XAQA 4LF7H 4QXOA 4JB8A 2WF6A 2XGOA 4XH9B 2WBLC 1KBQA 1VG0B 2IEIA 3H2KA 3DE5X 2OAP1 4AN0A 1XKLA 4FOSA 1YFZA 3QVXA 4L8VA 1TTTA 3DYVA 2FXVA 4D4IA 4J7UA 1G5IA 3HYRA 2I5PO 2UV8A 5KMGB 4AZ3A 2QYOA 4MWCA 3B9PA 5JBIA 4A3FG 3ITKA 3ML1A 3IX7A 4GAEA 3AF6A 3VO9A 4RVGA 2HA4A 1OC4A 2XMBA 1VJDA 3ZHCA 2ZIAA 4PG4A 1IAQA 4IIYA 1W4ZA 1ZR2A 3BEDA 1AKEA 4K87A 1DQYA 4PLCA 3QUQA 2DQ4A 1QPGA 3C98A 2XYHA 4OGWA 4G4SO 2GQSA 4IGKA 3NHJA 2I7CA 3II6X 2ECFA 4RMJA 2Y2UA 3TGWA 4M0MA 2D0OB 4KTTE 3V80A 3R9WA 3BACA 3KFLA 4OJNA 4D4GA 3T06B 1YVUA 4TYQA 4RZHA 1C1DB 2LIPA 3V6MA 3FUUA 3EGDB 3R3VA 3EC7A 4Y8VB 1M7GA 2HHJA 3ABOB 1U94A 5EUMA 3PSAA 1YKFA 2C4VA 4JLMA 4LGCA 4KOAA 4IDCA 4HLQB 5KHLB 2VDLB 2IPXA 3I9MA 1B2LA 2X8WA 4GGOA 1WB5A 4PG5A 5EKDA 2F3SA 4GOXA 1OYWA 2X41A 2WA1A 4QIWA 3RARA 3TY5A 4X66B 1WXWA 4U6PA 4Q3DA 1WCXA 3KREA 2AB0A 4Y30A 2XXAB 2AI2A 1DAFA 1H2FA 1OXVA 3M9LA 4O7LA 2JI4A 1QSGA 1IY2A 3LQFA 4MUNA 2YW2A 3DCIA 3T99A 1FEZA 5AK6A 2WWGA 4F4FA 1I7QB 2J7PD 1HTWA 5HJEA 2QU8A 4LHZA 3FCAA 2FW1A 3KHLA 2PMZE 5IJWA 2OTCA 1G8YA 4MGYR 2P6UA 4G6ZA 4LHVA 4L07A 4HATA 4HNGA 3IPYA 5KMGA 2C04A 4RUCA 3T5MA 1GPNA 3BORA 1CUUA 5ERGB 2EEPA 3A8TA 4ZJUA 5E2BA 2BC9A 5A5DA 3WBJA 2J3KA 2UUAB 4I4NA 3V9AA 3U1TA 1A4RA 5ILGA 3TW8B 3FHJA 5KWIA 3UUEA 1GZDA 5KFMA 5LIPA 4TPKA 1AO0A 4H7FA 3FGOA 3NDRA 1QHNA 3RIHA 2RK3A 3SBDA 3DF9A 1KR2A 3ZN2A 3V3KA 5J5CA 1K5GA 5K0EA 4KX5A 1V95A 2PVPA 5LZ5A 1XK7A 3WV4A 1OGIA 4DMLA 5F2KA 3B38A 4CMIB 1T9ZA 1X92A 5JCJD 1K5HA 1TQ8A 1YZLA 1G98A 1KZYC 4X9XA 2WB2A 5IC6A 4B3RB 4EG5A 3MIZA 2EKBA 4O2BB 1M8PA 4QG7A 3ETLA 1C1DA 4D57A 5K8VA 3HZHA 4XB1A 2QORA 1TT7A 4YFYA 4P7GA 3R76A 3KOXA 4N6OA 4Y8VA 1BJRE 1YE5A 5C5IA 3GJXB 1TO2E 2PZGA 2QU7A 4XM0A 3KDPA 3LDFA 4Q1DA 2XIGA 1K0FA 1QRTA 4PNHA 1IYDA 4F5DA 3MIIA 3GOHA 4FLMA 4P3XA 1EP9A 2WW8A 3JAWB 5JH7F 1BXGB 5DYGA 2M6SA 2WHRA 2BP7B 4G41A 4MA4A 1WXIA 5G1PA 1YE8A 1N4AA 5K3AA 1VMIA 2XXAA 2D1YA 4PNPA 1AH2A 3CC8A 4J1TA 5B4TA 4L15A 3HDJA 3N2LA 1N57A 1VHWA 2ZBPA 5E8JA 3KRTA 1FDOA 4OXYA 3PUVA 3SZOA 1TZ2A 5IAJA 4Q4DA 5BQ5A 2BGNA 2JA6G 2G9NA 5T14A 4NZYA 3B5JA 4NXNH 1VKNA 1SZJG 4YREA 2O2HA 1JAHA 5A6SB 4G5FA 2WB1A 3NRCA 4G5YA 2ZYSA 2WZBA 3ZLTA 2YJTD 3TW8A 3GV0A 3NTRA 2FETA 4ECUA 4PBRA 4B71A 4C89A 4EM6A 2IXDA 4BJHB 4EYGA 4G4SP 1M5RA 3VHXB 1E3SA 4CTOA 4UTRA 3IUSA 4IXWA 4G8BA 3W5VA 1XL1A 1WF3A 4MGHA 2AMFA 4BKOA 3I5AA 2YZGA 1L2TA 4YTEA 4OHVA 3WGOA 2ZYDA 1RMYA 3P4UA 1DWOA 4CMIA 1XGKA 3CZAA 5B6IA 1RC8A 3M1LA 3ND9A 2R93A 4QWDA 2LKDA 2C00A 4KDCA 4O2BA 5IP5A 1R16A 1QYVA 2YY5A 3TEFA 5FULA 2X8LA 3I42A 4NHOA 3S8MA 5LQRA 1FCJA 4H0NA 2VYVD 1Z7BA 1TQHA 1PQWA 1PQYA 1I3MA 3WQSB 5KQSA 2FQWA 4KWIA 3JQ9C 2R8PA 1HLDA 1SQGA 1J0EA 2NXJA 3HKDB 2OYSA 3K8ZA 2D13A 4W8GA 2BP7A 4LWOA 1BWSA 2QMOA 1KZGB 1W9MA 2Q5FA 5CHYA 5IU6A 4KE9A 4L5YA 5AI4A 5SYNA 2R66A 1AHPA 3E9MA 6ABPA 4CF6A 4BVEA 4FDAA 4NG5A 4HAZA 4ESVA 3T1HB 3LVFO 2J08A 1KS2A 1T3GA 3VC1A 2Z2ZA 4WY5A 3NC0B 2YOFA 4BXOB 1YB2A 5CFPA 1YS7A 3VO1A 2ZDHA 2OV3A 2R44A 1NXSA 4Y67A 3KBBA 4RV4A 4O84A 4X20B 4F6RB 2QDXA 2W43A 3PO2G 5LA6F 1HNWB 2VF4X 1MA0A 4F21A 1KP9A 4GZ5A 4Q3LA 5A4KA 4DQKA 4B4DA 4ED1A 4ZK2A 3BWXA 5DV9A 5EFOA 4GKAA 3OE5A 2PG3A 4F6CA 1ZD5A 1CJCA 3M8KA 1PR3A 2BQUA 3EPGA 3PXBA 4BTEA 1U6JA 2QX7A 1Y1WA 5KYXB 1QHGA 1PD0A 2IIBA 2Y68A 2GF2A 1NVMB 5D3MB 1ZMOA 1J24A 4IUBS 4ZVMA 5GIPE 5GGXA 4UXJA 3K4HA 1C7FA 4MVJD 3FYHA 5HP4A 1EFAA 4HLUA 5GWXA 4HLDA 3OJLA 4B7XA 1OLSB 3GIKA 2C83A 3GFTA 4RLFA 3LP6A 5CNKA 3HR4A 5EQTA 3A14A 3IQZA 1S03G 1AKYA 2MSNA 2RMKA 5AVRA 4JLWA 3Q12A 2HPZA 4S1TA 3SKYA 2CW8A 3MGAA 1W0JD 4JR0A 3KKEA 2PZBA 3HKDA 5HKLA 3GLGB 2C95A 4ZT4A 4AJLA 2OBXA 2VBFA 5B2ZA 2B63A 5EXPA 2AF4C 1DRWA 2IPOA 2ZSHA 4XCQA 4UE3S 3GDGA 2MU1A 4IEIA 5J2UB 4DRYA 1J25A 3F49S 3Q7SA 3QU9A 4J03A 4OKNA 1SULA 2Q6OA 1XFDA 3RLFA 3M4ZA 2AQ8A 3U48A 4BXOA 1GAQA 1T9BA 3D6JA 4GGPA 4PFJA 2J8ZA 4YFVA 3B1WA 3JR3A 2D0DA 3HOZG 5GONF 4O2LA 2PMZA 1CY2A 1VLJA 3OE4A 4FC7A 2DTDA 3NAZA 1Q83A 4EYSA 2YNMA 3EIHA 4R31A 1JDUA 2WE8A 3C6BA 2OHJA 4L3WA 4P3PA 3TY9A 4GLFA 5DHQA 3VOAA 3ELYA 2XJ4A 4W1PA 4MUGA 2ODPA 4RJ2A 3KB6A 5KYXA 4MTCA 5D3MA 5AI6A 421PA 5C5CA 1D2AA 3OLCX 4C4ZA 2X5NA 3KR9A 1G9SA 4N8DA 1EGMB 3OZFA 3AUJB 1I36A 1NJSA 5HF6A 1N1DA 1OLSA 4ALIA 3K1JA 3DFFA 4JXUA 3WRVA 3UCXA 5BN1A 2NSLA 4AWAA 3EVDA 3C7KA 3KZOA 3A4IA 1TT5B 1MJ5A 1ILEA 1T8PA 2R2AA 2E5LH 3J80A 3FWKA 1RE1A 4H08A 4TKLA 1A8SA 4KYVA 3T1OA 2A3RA 4MX8A 3NH6A 1NFQA 1MOZA 1Y7TA 2GJSA 4BVFA 5K05A 5J2UA 2JGAA 5AVWA 3FPFA 4D4JA 2A1HA 2JFOA 1GZSA 2A9FA 5KB3A 1UWCA 4EO4A 1OZFA 4YMLA 3B53X 4B3BA 1YVDA 1PJSA 4ZVLA 2PGNA 3T35A 5KG2A 1EFTA 5JISA 1QM5A 4JEIA 2ZB3A 5FLMG 2ACEA 1ADFA 5IM4F 2GK4A 4S3MA 1U0JA 2ZJFA 3U9LA 3E1SA 1QE3A 4O82A 3WZLA 1I6KA 3WJ7A 2ONKA 2IXEA 2VNKA 2X76A 3FUTA 1KIAA 2V4QA 2O8BB 4CKWA 2ZJ6A 3T3DA 2ANCA 3IVGA 3B52X 5CB6A 4HH0A 3TSAA 2IA6A 4GPBA 2PX5A 3FPGA 5IJ9B 4G9EA 1B8OA 5T6MA 4OHWA 4TOIA 2WIJA 4LISA 1FNBA 1GFZA 3G13A 3PZPA 2O2DA 2QLNA 2IBSA 3Q1KA 4Q6BA 4WI1A 3U0VA 2WKWA 1DAEA 2Y0EA 2CXRA 4FGLA 1OHHD 3B1YA 1Q0UA 3W5IA 5K2OA 1A71A 3ZDFA 2VT7A 2A3NA 3ZX5A 4EGFA 3KDAA 1PZEA 4OB7A 1B8UA 2GN6A 3PX3A 4UHCA 3MVEA 4XGIA 1YO6A 5L6MB 1YZ3A 4U7CA 2HYIC 3ND7A 3WGVA 5IUNC 2DIKA 1TT5A 3O8LA 3TXAA 3KELA 3K31A 3ZW8A 4JJIA 4YGYA 4H6PA 2ZUVA 5KKCA 4LXUA 5TC4A 3E3MA 2C9YA 2GA9A 3TKAA 1LW7A 1QFSA 3I53A 3ZKWB 2GWHA 4QUDA 2B98A 5G0SA 4Z4QA 4AI6A 4KQEA 1D4AA 3F6YA 3ZNOA 1D4ZA 4G89A 4MKGA 4HXGA 2M05A 5HF9A 2ZCVA 3PT9A 2PUJA 1U7PA 3DH0A 4H7IA 5KFPA 3QGMA 3TX6A 5M5BA 2R96A 3DC7A 3V8RA 4S04A 4QTXA 1M1YE 5B1IA 1LSJA 3K72B 5LMUH 1XZEA 4TXNA 1QFJA 3ER6A 1WMBA 4BNNA 2PT6A 1XNQH 5KT5A 4UCQA 2F3TA 1YZNA 1J33A 2XVYA 4KZPA 2I66A 2GRJA 1S6YA 5IJ9A 4JBWA 1M76A 2WVJA 4MPDA 5K9ZA 1FP2A 2QTTA 2WSLA 3ST7A 4ZQCB 5E4YA 2HQRA 3PNPA 4BU1A 1WHTB 5JDCA 4BVLA 1RABA 5KQPA 1JIJA 4GYKA 3CKKA 2PRSA 3UCFA 1T8RA 4ZHQF 4B5LA 2H1RA 2UYGA 3W2FA 4OQPA 2TMDA 3UXEA 3DHYA 4G1UC 4DBLC 3LPLA 4OMUA 5IBRA 5DISB 5JLAA 3ORHA 2RB5A 4EELA 1CEEA 2DLDA 3AVUA 1R0LA 2DH6A 2FG5A 1JQKA 4EIWA 1GQYA 2GD0A 2FOLA 1THZA 1PGPA 1ND6A 2FMXA 5TARA 4CEHB 2OAGA 1I4LD 2B7BA 3FTQA 4RWZA 4I6GA 5EWEA 1IOZA 5HCUA 3GILA 3T34A 2IDKA 3HGTA 3QFTA 2JGNA 5EZSA 4ERXA 3IJEB 2XCLA 2RONA 3A2KA 1RTTA 4TTTS 2O8FB 2AC4A 2YC4C 3IHTA 3LL7A 1GGHA 4UTPA 1B6SA 3IESA 4TQ9A 5A7GA 4JSTA 1FC0A 4OAPA 2J07A 4N54A 3IQIX 4UUNA 1I4DD 5JCPA 1NN1A 3C5CA 1ZU5A 4PG8A 1Y9DA 2WTUA 1H3EA 1P1HA 5AVOA 3MMZA 3AG6A 3OPXA 4F92B 1QRRA 4NF2A 2E1PA 3EVFA 3H9JA 4EAQA 3RFCA 4K9OA 4ME6A 4D8XA 5BQXA 1ESNA 2EGUA 4MTLA 2DBRA 4YCLA 2B5OA 2Q4TA 1MNAA 2E4UA 1WSBA 3R6DA 3ZCSA 3TI7A 2HLDA 1A8QA 2ZSAA 1PWYE 1M75A 3RVOA 4ZOBA 2VAPA 3FIUA 4N6GA 2Q5HA 5AT1A 4ZC1A 3ETCA 2I4NA 3AP3A 3DMDA 1R9GA 5BW6B 5IVKA 2X2OA 1RPTA 4P4NA 4TWIA 2BMEA 3S2SA 3DOUA 4BMXA 4LHWA 5BSKA 1QP7A 3Q7IA 2VVTA 3MR5A 1ULUA 3EIXA 1VA5A 5DX0A 2WLSA 1OFIA 1OA1A 4J7CA 3DAHA 3AM4A 1TW3A 2E2IA 3HBAA 4E70A 1WB9A 3KHSA 2J0UA 1E62A 3GVIA 3PWKA 4RDXA 3SX4A 1K63A 4B6GA 5J4LA 3COPA 2CFCA 3O8CA 1YAJA 1IOWA 3CCCA 3OEEA 4RNOA 5I9IA 3K70C 1WF6A 1GPBA 2CVQA 4URXR 4HQFA 2DT5A 4GZ3A 5ARCA 3HMKA 3W8RA 3JS5A 3W77A 5AR1A 4XWOA 4R3WA 3PUWA 2OD7A 4JI8H 3A0RB 4HQOA 3QLJA 2F1OA 4BNGA 2QNRA 3U3RA 2YV5A 3GA5A 4LC0A 5J40A 3RVJA 2X42A 4NX2A 3DYIA 2OK8A 5FNZA 4W1SA 1Z88A 5C7YA 1YT5A 1VBNA 3ACBA 1EFVB 3NT2A 4OPMA 1B42A 3AR6A 3R77A 4I7EA 2IOFK 4R0VA 4L0DA 2J3MA 2D2EA 1RJGA 3KU1A 5GJCA 4QFCA 3NIWA 4GI5A 4JUCA 1E3QA 4C9BA 4PZUA 4CE5A 3IP6A 1E6MA 4P83A 3QQMA 1TPYA 5KT7A 5C8YF 4CM8B 4X95A 1IDN1 3IUEA 2ZDQA 1QZ3A 3AUXA 2Q1XA 1EZ1A 1XQ6A 4BBPA 1ZSNA 5AVQA 1BVUA 1X8JA 5BNZA 4ESOA 1E9BA 4LYDA 4LOLA 4EFDA 3VR4H 4C0WA 4Q7KA 1E4GT 4LOAA 2FR1A 1Z2DA 3KJZA 3PLRA 4G3XA 1SBQA 4E7OA 2QRJA 4QOJA 3I3OA 2NNLD 4PIPA 4HUJA 4B3SH 3KWMA 3SEFA 4M9RA 3W2TA 2ODQA 5A71A 3FH0A 4AF7A 4WKBA 2HA2A 1X39A 3L1IA 4JROA 1YDHA 2HRRA 2FLLA 3O92A 3ZZ1A 3QLTA 1B41A 4YHHB 3O8QB 1NE7A 1O6GA 3U60B 3TXXA 2Y1GA 4BPRA 2AOUB 1RWXA 1DVRA 3FNGA 2FTKE 2OCIA 3WRYA 3R3ZA 3ZC3A 1Q7GA 3BMCB 5KJ1A 3OMWA 3U2QA 2B5VA 3A6KA 3G2KA 4R2JA 1U9YA 3GTQA 2GKSA 3L40A 4W8OA 3NBKA 5H16A 3RU3A 1EGQA 4QPPA 1RMQA 3G8AA 1G2QA 1RPZA 3EIUA 3EHEA 1YFJA 1OSNA 2V8OA 2BGGA 3ASVA 2OOKA 4MA5A 3VPSA 4JEHA 2WE6A 3SR4A 1EFVA 1ZUHA 4CMJA 4DRFA 4IJ6A 3MS2A 3N87A 4JZYA 5GOTA 3PNYA 1PEAA 3ILXA 5AW9A 4I50B 4S1PA 1XRPA 3FDZB 5JT1A 1L1FA 3V2GA 1JE1A 4WINA 1V9LA 2COEA 4ROTA 1UC4B 3KQUA 1J56A 2PL5A 4TMWA 1EP1B 2WHEA 3RT7A 5KREA 3PJEA 2OSVA 4E21A 1P61B 3TPFA 1BCRB 1P0FA 1Z6YA 4BNLA 2ZJ4A 5GM1A 4DV0B 4EFBA 3JQFC 1M1YA 1ZAKA 2IYWA 5KPJA 1KY4A 6NULA 5FL7A 4WRRA 4WBXC 1Y5MA 5JANA 3SC6A 1TLLA 3P4XA 2AHRA 2NU6B 3K35A 3ZDXB 1VCOA 4UCWA 2BGWA 1D03A 4OKIA 1S3GA 1O8BA 1UXIA 3VPAA 4JELA 4UARA 3HHPA 1O94A 4W5HA 1R12A 2P90A 2ZI3A 3KTAB 3RBEA 1L5RA 3O8QA 4ZALA 1JZSA 3EGXA 4ECEA 2V7QD 1UBCA 5FQNA 4J0EA 2YXLA 4V2UA 3WLMA 5F3RA 1JHYA 1MO2A 4TRRA 4DLWA 2Z95A 1J8FA 2RI0A 3BMCA 2CSXA 2Y8EA 4NOJA 4MEJA 2H1CA 2NO0A 2QTCA 1SKMA 1TA0A 1JIIA 3ZCPA 3VU3A 1FXWA 3EQZA 3E2MA 3WJ1A 1BDJA 3FRHA 3RUFA 1CDDA 4K6FA 2C4MA 2P1ZA 3L77A 4GOMD 2GZDA 4PYOA 2DLCX 1UPTA 4Q1FA 3MT9A 4QQKA 5E1BA 8ATCA 4P53A 3I01A 4LYJA 4R1LA 5BYJA 2E85A 2VHJA 2WICA 2C9DA 3PJDA 1NOIA 3FMOB 5DTMA 3PQ3A 4WEQA 4ZRDA 2OR3A 4ENTA 1MU0A 4BLUA 4Q48A 3K1TA 2I1LA 1UJ4A 3FDZA 3GFBA 4KR3A 1LSSA 1ZMBA 5LU8A 2VDUE 4CLOB 2Q7XA 1KR5A 4RHXA 4F91B 2WU1A 3GRFA 1UWLA 4D9EA 1GLVA 3ICQB 4RTQA 5DLGA 1XQ1A 2CF6A 1TJYA 1NGSA 5KSPA 3WAGA 4OX9B 5A06A 1BCRA 2G6BA 4MUXA 3M4XA 4BATA 1YONA 2O4UX 3KPVA 4BGVA 3U31A 1ODJA 5KVVA 4PHHA 4XQCA 3BILA 1KI1A 5EE0A 2O4CA 4NENA 1XK6A 4DM7A 5CBPB 1KYQA 2WAQE 1IWPB 3QX7A 2Q7DA 5CHEA 2NU6A 2J6BA 5DXFA 1O89A 1YR9A 5F9NA 4JCCA 4C3OB 1DIAA 4C1BA 4JYMA 2FF7A 4Q21A 4ARAA 1CZHA 3HZRA 1XTVA 3S2FA 4JOSA 4MVJM 3TLCA 3L07A 3KTAA 4ZI3A 1PX2A 3QPVA 2OSBA 3ZTWA 1KORA 3TDNA 4FYJA 4OM8A 5MN6A 2HNAA 4GNKA 4MARA 5I7WA 1UBKS 3UV6A 1DWPA 5CTJA 4OU4A 1WU7A 3PIDA 3AHHA 4EMSA 1HDRA 1FS5A 3ZU2A 1LBIA 1X13A 2GWRA 3ANSA 4TTSA 4FOLA 1X1DA 3G2JA 2VPZA 3D7KA 4F45A 4AC9A 3QI7A 4IIJA 3DWIA 3WDLA 2OBMA 3AEXA 1A9PA 1AHNA 2GJKA 2P6OA 1JIKA 5EINA 3LS2A 3AB7A 2BFFB 4DR7H 1PI3A 1P0CA 4PX3A 2R8ZA 1HR0B 2R25B 2HX1A 1VJCA 1EFRA 3A9WA 1M2EA 3HB9A 2J9XB 4BFCA 4OGGA 1EDZA 4IJMA 4ASUD 5L9AA 3DO5A 2OQ2A 1MOQA 1S4QA 2OGSA 5JRDS 1NSYA 4TWZA 1JSLA 5BSEA 1N2JA 4CLOA 4N1AA 3VC3A 2I91A 1QORA 3FTDA 1XNJA 3MFQA 3UGKA 3UMSA 1EKFA 5F98A 1WD5A 2QRNA 2B8TA 4O7NA 3RVMA 3VV3A 1O3YA 1USIA 2J9FA 2K6GA 1VC2A 4OXXA 5BR8B 1A2OA 3ZY5A 4KNVA 2YWBA 4UFPA 4PCUA 1U9JA 2C42A 1A4UA 3QHQA 4IOKA 1EMDA 1U8TA 2VDQB 5C4GB 3IAEA 1IJBA 3BJMA 5CBPA 1JEJA 3VVLA 3LT5A 1E59A 1G6HA 2X5OA 3IOBA 1LRKA 2RD2A 2BZ0A 4D9NA 2O2ZA 4GP7A 3U56A 5IEJA 1EIZA 4DDKA 1QR6A 2I4RA 4D74A 2FK2A 2NYVA 1W6RA 4P9NA 3VPXA 3Q10A 8ADHA 3KSBC 1PHRA 3DL4A 2CZGA 3TUIC 1ZO8A 2FPPA 3D7RA 5DGBA 1PV4A 2NSDA 5K0JA 3DEAA 4MI6A 3IE0A 1QHYA 5HMMA 2W6PA 1XB2A 1QNFA 2V0CA 4MROA 3J7TA 1N3IA 1FLNA 1EX9A 2E9SA 4L6AA 3AHFA 4QOSA 4RVUA 1Z38A 2QVLA 2Z5FA 2CDBA 5KYUB 4GLXA 3NASA 3T4XA 3FLBA 5LJLA 1D6JA 3BFPA 4WXPA 4PIVA 1A4IA 1YB1A 2ZB4A 2C3MA 1TZCA 5LP6F 3C3YA 3VFDA 4M9QA 2H2AA 4TL8A 3IV6A 5H81A 1DAHA 5F33A 4Y0VA 1WKBA 3BSSA 3WFZA 1SRRA 1Y6ZA 2C3PA 2D2XA 1N2GA 1LWNA 2P9HA 4A92A 4JI7H 1FFXB 2QN3A 5DZSA 1TM1E 1BO6A 3QFSA 4TUYB 4DC0A 1BE8A 3R2JA 1AKWA 1LBEA 4C30A 2JLWA 2QZSA 1DRUA 3UOAB 2W2LA 1CF4A 3W3ZB 5KFFA 4YMGA 3D8SA 4WGFA 3TAXA 2HAEA 1Z5GA 5E6RA 3GROA 3NVMB 1DTEA 4QATA 3E2IA 3MD0A 1T4MA 2QWXA 4FR2A 4OYHA 3WGHA 5D3KA 1G6Q1 1SO8A 2WNSA 4EMBA 1ORWA 2EG9A 2WC1A 2ZYRA 2O5RA 3JRXA 1N0VC 1Q7CA 4YUXA 4QVKA 1JFVA 3A0UA 1AGNA 4N0MA 4OB6A 3W9YA 4LYFA 3GA7A 1EE9A 2QMUA 4OIFA 3DAYA 3I6YA 1M6EX 4D4KA 2Y1XA 3DOIA 4TKZA 2R2GA 4ZC8A 2X7HA 3UV3A 4DJFC 4AL4A 2G1PA 1WZUA 2Q99A 3P5SA 2XYRA 3BKWA 1SZDA 1I0ZA 4WXMA 5AK3A 1VGQA 5FFFA 5KTTA 1CJBA 4MR7A 3AU8A 3KEMA 2CDCA 3R8XA 2GZ2A 1NR1A 2PKWA 2JI6A 5KYUA 4RACA 2RARA 4JI0H 3CNEA 4JYPA 4AQ7A 4FTWA 1XMJA 2P27A 3R24A 3THYB 1NFRA 1ZVVA 3COSA 2CKZB 4LN1A 4ZCIA 3DKRA 4E13A 1FJXA 3F96A 2AVNA 4XYLA 4LY3A 3OM8A 5DK6A 4TV8A 1EFCA 2FUG1 2PD4A 1FFXA 2AI3A 4A8TA 4O3MA 2EV9A 4TUYA 3QWAA 4AP6A 1ECCA 1RYSA 1ZK3A 4IF4A 4BGIA 2BDUA 4M1ZA 3SG0A 1QGDA 3RH0A 3REOA 2VQEH 5LD2B 1DUSA 4O7VA 2FMUA 4Y2SA 1LRLA 4J9NA 2CLSA 5B30A 2QZPA 1LQUA 1C0IA 3VTZA 3TLAA 5KI6A 4KWTA 3MOGA 1PL8A 5LBUA 4EJSC 3PA6A 4AUKA 3I3SR 3INGA 2XRZA 3VH2A 1XFAA 2BKAA 3VZDA 2HNBA 3R7FA 2WAQA 4NU6A 4ER3A 2QKYA 1K0UA 3A31A 1OBDA 2DM6A 4QU0A 4HEA1 3O4VA 2CL6X 5F76A 3JWJA 1W29A 4OO3A 2I2BA 1R0ZA 4DPLA 5IT4A 1L5ZA 1CQXA 1YV9A 2GLTA 2NYAA 1E2KA 1GCIA 4Z0HO 3REFA 1XQXA 3MD9A 3SY8A 2EXXA 5JMPA 1NW7A 1Y1RA 3H8SA 3DD5A 2NV2B 1RWMA 3IXMA 1T0BA 2C8JA 3U49A 1Y34E 1Q0HA 2OC4A 2WIDA 1KY5A 4DAAA 1JFFA 2EIYA 5F5NA 1KP3A 1UF9A 3THYA 1MBZA 4C05A 2CMHA 4CMCA 1CY0A 2IYOA 4KX3A 2V4UA 1ISFA 1XA0A 1PTJC 3PEYA 4M1YA 2UUOA 4QZVA 1ORTA 2GAFA 1U80A 4B6RA 3E70C 5GM2A 4OH7A 2ZI7A 3A4LA 4ECZA 3ICVA 2CMKA 2GCIA 2BMVA 3KXLA 3TQQA 4ZVQA 5CMLA 5JMWA 1S5PA 5AM4A 2X4DA 2BZGA 2YY6A 1N9GB 3U3KA 3FKIG 3FYTA 1VAJA 3QLEA 2NO7A 4LK2A 4E51A 3KQHA 1EM6A 4MLDA 3UJ7A 3EBOA 1X7GA 3K0CA 3EZGA 5F9LA 2FDXA 4ZV7A 3EXG1 2JBWA 3ZCVA 3F6SA 3MQ2A 4L8LA 1V39A 1ADYA 4DXDA 5CLHA 1CS0B 2YRFA 3ETDA 5JJCA 2H11A 4R2IA 4C76A 5BV7A 5HJ5A 1P4JA 3CW2A 2X5RA 1QO9A 1NX9A 2OBBA 3M81A 4NDAA 2YXDA 2IOQA 4B0OA 2YL2A 2ZM5A 3AIKA 5ERYA 1CQIB 5FBVB 3V7FA 1PR4A 3EK2A 3HBNA 1E0JA 3AFNA 4A82A 5LKRA 4LF4B 1NVDA 1PT6A 2HCTA 3WIDA 2ZRIA 1NVVQ 3EEOA 4BKUA 2ZR8A 5ADUS 3BZBA 1NKVA 3UHPA 4Z6KA 4G1BA 1GL9B 3TZBA 3ONWA 1VI5A 2R6ZA 1ZC4A 4RV9A 1LS6A 2N46A 3OLYA 4MICA 3AY0A 3MWJA 1P9LA 4I4LA 1SCNE 4NL4H 3B5EA 4F3YA 4YCBA 1XTBA 1SPXA 3FHOA 2WQ7A 2PZJA 4RKEA 1E2BA 4NFSA 3FDXA 2XQGA 3LUBA 2DERA 3VKGA 1JP7A 3ZDAA 2XRFA 5D01A 1T2AA 1WDMA 2C4KA 3BDAA 1VRWA 3BJZA 3GT7A 4PLGA 1QF9A 4DL4A 1UQUA 4RZQA 1DSSG 2HW8A 3OQPA 3BA8A 1O6ZA 2FEKA 3LQKA 3THXB 1N9GA 2JHAA 5KYVA 1EEXB 4KQ6A 1YS1X 3D8RA 5DSZA 5LDHA 3WL4A 2D74A 2HQBA 4OQFA 3PGKA 1CLUA 4HMOA 4J9VA 2F8LA 3SKVA 1R8JA 2R6HA 2VPQA 4DV7H 1DAPA 3CX8A 1QLHA 3SE7A 3N0XA 1CS0A 1THGA 4A27A 3QLUC 4I5DA 4X5OA 5JLJA 4QAJA 1YJBA 3BGDA 4Z3OA 3VO8A 4AJ9A 1JDTA 3H5LA 3E35A 4MMZB 4IBOA 3K71B 3ZI4A 3OJWA 4IVRA 3MC1A 3KR2A 1JIXA 5I9SA 2D2IA 3ZNNA 2HUPA 2OKCA 1CQIA 2HLPA 1SXJD 1SGWA 2HMAA 3S68A 4C2TA 2QD3A 4GL2A 3CE6A 1DDOA 1V11B 3LGAA 3ZHVA 4AO8A 3D64A 2P3QA 1JA9A 5DRTA 3HKEA 3NRJA 3PR5B 4CWAA 3HXKA 2NOAA 1JL3A 3T5KA 1XI2A 5C1OA 4FKBA 2ZCUA 2QXUA 3GLSA 5IVDA 3EGCA 3WL8A 2JJYA 3N58A 3JTEA 4RCYA 4L9WA 3KOOA 1G5HA 4IYRA 1JLRA 3FPSA 4BX8A 3DHWC 5BR1A 5KS8A 4Q43A 4RKQA 2W57A 1AKNA 2YWJA 1NN0A 1FLVA 4UNQA 1CB0A 4MINA 4YO8A 2BEVB 5DBEX 3QUTA 5IH7A 2CDNA 3TTWA 2II6A 1TXGA 1OB2A 2NVBA 1G8HA 5HBRB 4MYTA 5JS1A 3DP7A 4JY7A 1FBTA 2XMDA 3AFHA 3QW2A 1A8UA 2F4VB 1Q7EA 4DB2A 1WQ3A 5SYMA 4TQRA 3MWMA 4N9WA 3THXA 1TQ2A 2Z04A 3ZYCA 4TMTA 3KXPA 2EKPA 2GARA 1P91A 4P32A 2BGMA 3RO7A 1UH5A 3OE1A 1WDLA 2ID9A 2BDEA 1YL6A 4JC8A 1GCGA 1TJ4A 4Q9NA 3CMCO 4HN9A 1XU4A 3ZV6A 4FS3A 1GN9A 1Q16A 1GFWA 1LC0A 5J4KA 1S8FA 4A8JB 1ELOA 2C5FA 1OBGA 2IU3A 3NV9A 1GGVA 4M54A 2V6JA 4HVCA 4MPPA 2HH9A 1PNQA 5AJHA 5CRIA 5J43A 4AZTA 5B53A 1CZNA 1ML3A 4CKZA 4C3VA 4JI6H 4R3UC 2R79A 3TK1A 3RRXA 1RD4A 3RVDA 1RKUA 1XLTA 4URFA 1V11A 2EKLA 1J09A 5CGZA 1OPXA 3WC4A 4V3BA 2FMTA 3N44B 1E2IA 1CXZA 4BC0A 3WRXC 2DULA 2A33A 1P2DA 3MTGA 3ZOKA 4Y3UA 3EXHB 5TPZD 4HPJB 4FYPA 4UM9B 3GOQA 4XWKA 5CD9A 2MMGA 5A5GA 3VNBA 1JDBC 2WUGA 4OUDB 2YJ3A 3KXIA 1NXPA 2BEVA 5T4HA 5IRCD 5LWQA 4KRGA 1IZ8A 1KDOA 3UBTA 2IYVA 3SM9A 5IK2D 1M3SA 1Y6FA 3GLIE 3BMXA 1XYYA 1UZUA 2J6SA 3IVMA 4LXYA 3MT8A 4I1IA 5HBRA 1MH9A 1XSEA 2OCXA 4H4CA 2VT6A 4QA9A 4IJQA 3U3MA 5J58A 4MP6A 5CDUA 1Z2OX 4A1FA 3L6BA 1YQWA 2LXNA 3GTOA 4RM3A 1L5KA 2GZMA 3BXEA 1NG1A 2C35B 1R1DA 1F20A 2JH3A 4KN5A 1KS9A 1HYQA 1S8OA 3TD9A 1PFYA 3W2IA 2HM7A 4QXAA 1L7XA 3ZLBA 4A8JA 2QQGA 3LX4A 2UVPB 3H97A 3NDIA 2XR1A 4IIGA 1P7ZA 4P31A 2AX3A 2B2NA 2HGSA 2IP2A 4XIIA 2WJYA 3SZRA 5CEFA 2CFMA 1E9SA 4L4XA 1PGNA 4JVOA 1LNQA 5DFAA 3X1JA 3NH9A 2HGXA 5L9XA 3CH7A 3S7TA 3I2HA 2NTYC 1JMKC 4NYMR 1MV5A 3H87A 1C7IA 4LJ8A 3M1AA 2RK4A 1K7SN 2A9PA 3AWDA 3MJEA 2VC2B 3L0BA 3LW7A 3VR5A 2DWPA 1XMXA 3D8UA 1EGAA 2DQZA 5KZMB 5CXSA 1JBEA 1BKDR 2WAXA 2Z1NA 3L92A 4MWOA 5LQMA 2ZSKA 1PW5A 1O6CA 2BI7A 3EXHA 1DTSA 2JAOA 2ZCJA 4MUKA 4RHCA 3TW0A 4BUZA 4JOBA 4HRXA 1HEYA 1N32B 2CW5A 2JJ1D 4JLJA 5EZ5A 3R9XA 1VE3A 1C3OB 2QLFA 4OUDA 5AM5A 1IN4A 1WXFA 4YMHA 4Z2AA 2Z0MA 1T29A 1USKA 5AW5A 1SQSA 2IDZA 3EY9A 4CIWA 3L6CA 3EW7A 3H4IA 3FZQA 4K6MA 1KAGA 4C7VA 3EOZA 4QAQA 4HQ6A 4B73A 1QIJA 3VHLB 1R8SA 5LKAA 2KE5A 1V7PC 1W75A 1RBYA 2EJUA 1MGPA 3BFXA 4BKMA 1J2YA 5FIUA 3KAPA 4EKNB 1Y1KE 1FW8A 3E4DA 4E88A 4XSVA 5KFNA 2WTBA 1N5LA 2NADA 4PLWA 2BCEA 2E87A 3PR4A 3BB1A 1CVIA 3RHFA 2Z43A 1PS0A 4W5JA 2FQYA 2PQ0A 5DNEA 5JZSA 3INYA 3A3KA 1DJQA 3PQCA 3TCNA 4L4SA 1AZTA 2V3CC 3F6PA 2ZBFA 4F4HA 2UVPA 1QH0A 3V00A 3DLBA 2POQX 4GOJA 3T3PB 1GCOA 4TMXA 2YUIA 3O4RA 3KHUA 1U0OC 4RX1A 1U0EA 3RRMA 5KOHB 4MPJA 1K83A 4EYOA 2C61A 4L9SA 3LO8A 4FDVA 5JS8A 3G7UA 2O3QA 2XGSA 1PUXA 1OH7A 5LNK6 1FUKA 2RH5A 4DR2H 2PL1A 4CV0A 4ZOAA 5IMBA 3LBYA 3RGXA 2PQMA 5HQ3B 1G60A 4CEIA 3BB4A 3QBVA 4YJ3B 3LMKA 1P1JA 5CT5A 3T7RA 3JASA 4CKWB 1JBKA 5DEIA 3T1YB 4YDSA 1OW3B 3TNFA 4BNZA 2K7FA 1T8UA 1LSOA 4GMXA 3QWFA 4LX8A 1H2WA 2NZ8A 3EIOA 1C3OA 5L1JA 4KQFA 3A3PA 1FDSA 4I4TF 3W1WA 1YOVB 1VBKA 1KO5A 5B57C 5ECDA 4J76A 4MWZA 1O57A 1QHEA 3RS0A 3TE7A 1ABFA 5FD6A 1MOSA 4FSXA 3WQQA 1EVYA 3ODPA 2VAWA 2HO5A 1JHXA 3UGJA 2YVQA 5LWHA 2VJMB 3AR7A 5JWHA 3WLPA 3H1BA 1Z5NA 1YZVA 3IUQA 1G6KA 1D4FA 4NDZA 5CITA 4RIGA 2DTEA 1Z7YA 4IINA 3ZK7A 3U54A 3AP1A 2VXCA 2G80A 4EY7A 3E9ZA 3V8EA 4CL8A 3KOMA 3DC2A 3H3FA 1E4YA 3FUVA 3FW1A 3W5UA 3X1YA 3NIBA 5K0GA 1T5OA 4NXMH 1KXJA 5IJ0B 3EMDA 2HA3A 1GGFA 3PD7A 1KQFA 4DCTA 3I0ZA 3GD7A 2GPWA 3HI4A 2OG2A 2DSNA 3VTFA 1QIEA 1YI1A 4PZ8A 1FNSA 3WOVA 5FBLB 1K1QA 4YX9A 2QL5A 4FOPA 3AOGA 3MW8A 5KOHA 4Y9SA 1W7AA 3HMQA 4AY6A 4Q18A 1WXDA 2FX2A 4EG0A 5KFWA 3I4FA 1FSGA 1JLMA 4BECA 1AY0A 4LVOA 2PKYX 3ZG6A 4OMFG 5AVXA 2J9RA 1AUOA 4BFXA 1ZCJA 2ODAA 4ND6A 4X71A 5HQ3A 2CYAA 3MWGA 1YJCA 5ELLA 2PA3A 1Z5PA 2OGTA 4YJ3A 4F6LA 3DZ8A 4EK9A 3GRUA 3CNNA 4Z99A 1JECA 3TIIA 2FEOA 2O2XA 3PT5A 2DYKA 2XPCA 1A96A 1DQPA 5IXYA 2ECQA 1GZHB 1U5CA 4XLLA 2E2HA 1VIYA 3TQHA 2JIPA 5CJ2A 3BIFA 4RHUA 4GKKB 1YOVA 4D42A 3HA5A 1IXZA 3K3PA 1MJFA 4ADSG 4CL2A 4KE6A 4P7JA 5LMZA 3H0GG 3EXIA 3QSYA 1WUHS 1WB6A 1IYEA 2HEIA 1GKYA 4LF9H 1TX4B 5F9MA 2EEZA 4TLBA 5INTA 4U2BA 1GLNA 2VJMA 1HT1E 5REQB 3TQSA 3IR7A 3GBPA 1I2BA 4JR1A 4L72A 1U0TA 2B1GA 3W9BA 2LE0A 1R37A 4B2PA 4ZI2A 3QHAA 4K3UA 2V5AA 1I6WA 1K88A 4BYMA 4CMAA<