1GMGA

Alanine 31 proline mutant of rop protein, monoclinic form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords REGULATORY PROTEIN ROP
total genus 23
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gmgA00
2GHYA 1RPOA 1F4NA 2IJKA 1PD3A 1F4MA 3K79A 1RPRA 2IJIA 2IJJA 2IJHA 4DO2A 1ROPA 1B6QA 1GMGA 1GTOA 1NKDA
chains in the Genus database with same CATH superfamily
4DW0A 3CCEV 3ASNC 3HKCB 4TUYB 3E8HA 4OX9B 2OT5A 1WB8A 1VF6A 1VQPV 1HWYA 4CC6A 2EILB 1K3EA 2V1DA 4LF8B 4MTGA 4OGQB 4GLXA 3ZHSA 3GWKC 3JAWB 3OE7G 5B1NA 1HNZO 2IJHA 1AROP 2Q7HA 2JS3A 2GV9A 1OHHG 5D5QA 4LWSB 3RYFA 3T1CA 3TJTA 1J95A 1E1RG 3JD2A 5DM6V 5EK0A 1BZKA 4NXMB 4ZI7A 1CP9A 3QO5A 2FTKA 3AG3B 3G6BA 4RQFA 2WLJA 5H5NA 4I9WA 2UUBB 3CXHF 3JARB 4JTAB 1OCZB 2H3OA 1B06A 1HNXB 1Y74B 2ZE5A 3JD1A 4GX1A 1AJQA 1QLNA 5CB4A 3BFRA 2XAGA 2ZD9A 3BHPA 4DR4O 4FLTA 2XAFA 2CGOA 4JI6B 1NR1A 3CRCA 1XNRO 2X6AA 3L74H 4BAYA 1JFFB 2Q9LA 2QDOA 3K79A 2ZCEA 3ML0A 3FB5C 1R6TA 1K73W 1N34B 3CCSV 2YDEA 1QVGU 1IXBA 5JQGB 4X1KA 1IBKB 4PDLA 2ZQMA 3IFXA 4JYYA 1XEQA 4LF6O 4X20A 4I0XB 4MS2A 1OCCC 3DXRA 4WFEA 3SGIA 3ZMVA 4XBFA 4O2AA 2ILMA 3T1HB 4YIPA 2B1GA 4UV8A 2Q0AA 4ZIBA 2HR3A 1LNQA 4PDRA 5KMGA 4LCUC 5H2FZ 3UT5A 4JI2O 3F7YC 1JOYA 4H13B 4DRXA 2ZE6A 4DRXB 1XILA 3ZMZA 3CP1A 1GM9A 2P4VA 1YXBA 1XUQA 1X59A 2VWJA 1SS3A 4X1YA 3AK1A 3Q4HA 4PV1B 5KAFZ 1DF4A 4DV0B 1TAEA 5IDJA 4B3SO 4I7ZB 2P6JA 3JD0A 4UB8Z 1HR0O 4HBNA 3JAKB 1M1KW 4PHZA 4JI4B 1MA1A 3AG1B 3UKMA 4UUJC 3ZHTA 3O9OA 1RSOA 1YTFB 5J9PC 2DYSC 5LYJB 2QTOA 4YJ2B 4WFGA 2GHYA 3SJCC 4CS4A 4DUZO 3MHSC 2W6JG 2DQ0A 4TV8A 1VARA 1H2KA 3ZHRA 4N23A 4R7CA 4G2KA 4X62O 3AK2A 5LGNA 4DR7O 1SKVA 4JASA 4KXRA 4BWAA 2HJFC 1Y6XA 1XNRB 3BRCA 3E8FA 4DR5O 5CA3A 2WLNA 3L9DA 3SPIA 4MVSA 3CSXA 4EB6A 1R3KC 3DC5A 5EYPA 5KHKA 4FLUA 3OMAB 3G4SV 1FFXB 4FM0A 3N2KA 2YS8A 2JVDA 5IY5C 1WA8B 3FAVA 2LGWA 1NS1A 1H2NA 4WFFA 3L72H 2UU9O 5AG2A 1EZVH 2H8PC 1KP3A 3UQ8A 4JYAB 5CMUA 2QWOB 4JZ2A 5LP6A 1F4MA 2HLDG 5L3DA 3ABLC 3TGUH 3ABUA 4ICGA 5L3BA 2HHHO 3CC7V 3CCMV 1M9NA 4O4IB 4JGSA 2JGDA 5IWAO 4PA4A 5H9CA 3QNEA 1AI6A 3FB8C 2ZINA 4FFBB 4B3TB 3OD4A 1QR9A 4DK1A 4UCUA 2W0XA 3HB3B 3U0ZA 4QPJA 3IC7A 2K1EA 3O65A 2EJRA 1SESA 5BZBA 5CBHA 1Q7YW 4GT1A 1NVPB 1P84F 2CTPA 1NTZH 5CBGA 4JI6O 3TXSA 4CH5A 4FLZA 4FLVA 2GBOA 4F6EA 3ZIAG 1K7DA 3E8BA 1FXKA 4FLXA 4PA6A 4I50A 1PL0A 1RSOB 3W7XA 4KHPO 4NXNO 3SJAC 4UVCA 2PI5A 4JI0B 1GN4A 4PA3A 5L3CA 4JAUA 1VMGA 2CTRA 3RYIB 1ZAUA 5CA0A 4I4TA 4LWSA 4JI5O 4NVPA 1NVPD 3P3NA 2BE3A 2EILC 2X6CA 4QJFB 5LHHA 5LP6C 2JK5C 4LF6B 3JAWA 1SZTA 3JSNA 4LFAO 2Q67A 3ZMUA 2HEPA 1N0JA 3J80N 2HVJC 2P4KA 2YEVB 2ZNJA 4IIJA 2BSKA 3LNNA 2PUSA 2M7WA 1HNZB 1BHAA 1AP6A 4KL1A 3AEIA 5KMGB 3KZIZ 4LH6A 5B1AB 3U11A 3C3SA 5HFMA 1VF6C 1H2GA 2AGAA 2IU3A 1BMFG 5FPOA 2ZXWB 4PDMA 3OM3B 4P30A 3KCYA 1SZXA 5J2TA 4B3SB 1MZEA 4MVOA 5B1BC 5KHIA 1IURA 1BQ0A 4ZBMA 5JQGA 4RAIA 1N36O 4RUEA 2OWOA 1FYJA 1N4CA 5EC2C 5GONA 4G27B 5KHJA 2LW7A 3J81N 4IL6Z 5L3FA 4BIUA 4PELA 2QM4A 2EIJB 3D36C 3HKEB 4F6RA 2UXCO 3GVMA 2R72A 2OIGA 2XNDG 1N32B 4DR5B 1WPBA 2UXCB 4K3AA 2QE7G 3T4ZA 4E4EA 3OMIB 3HKEA 3MD0A 3ABKC 2DN9A 2Y0PA 5JVDA 5CB4B 1B6QA 2A06H 2IM9A 2HVKC 3K06A 4R8CA 4U3JB 3BY6A 4XDLA 3CB2A 1ZLZA 3BA9A 3ZJZA 5IYDO 4HNAB 3WB2A 1Y76B 4O4HA 4XDJA 3FKSG 2JEXA 1JA8A 1XQ8A 2MK3A 3B4SA 3K5MA 4CZZA 2YIDA 3RN4A 3RBZA 3ETGA 1I5XA 1M56B 1IVSA 1Z5VA 4QE9A 5HFLA 5FNVA 5DN6G 4DV6B 3SYOA 1YJNV 4TUYA 3OTOO 3AG3C 3LSUA 1F4NA 2ZXWC 2ZIOA 3E89A 4UVBA 1UFIA 2F1MA 1KYOF 3TETA 3OMNB 1P7GA 2Q0OC 3K0DA 1PD3A 4TT3G 5LHGA 4I55B 3ASOB 3S3WA 1BE3H 3LDDA 4B08A 2KG7A 3AG2B 1D5NA 3CS5A 3CYOA 2ADPA 4UCOA 4LFAB 1SQGA 2Q7EA 3ZN0A 2G38A 4TWKA 4JI5B 4H0LB 4GUNA 2IJJA 3T1YB 2F66C 1EFRG 4UCRA 3JATB 2PY5A 2RN9A 3CCUV 3ABTA 2Y69B 3LSQA 3S3XA 4DYLA 2EZPA 1R3JC 3H1JH 4CH4A 2CE4A 5LGTA 4X1IB 3N27A 1Q3EA 4RQEA 3OAAG 5CN0A 2JIZG 2IW5A 4WF9V 4GCZA 3CEIA 3K59A 4KFMA 3H1LH 1SQBH 3IC9A 4K35A 4F4LA 1MABG 1JX9A 3ABLB 2F23A 3H1HH 3K5NA 2VRZA 4NR1A 3RVZA 2LP7A 1NH2B 2YC0A 4B3MO 1Q6HA 1M56C 4BIZA 3MHHC 3G6EV 4DV5B 3I56V 3SR2C 4H44B 2UUBO 1M90W 4DV1B 2EULA 4Z1VA 3KKYA 4O4LA 1H38A 3JYCA 2KB1A 4BIOA 1ORQC 1M4UA 2QGNA 2AXTZ 1XMOO 1L0NH 4X88A 3CRAA 5EZYB 2F43G 1DF5A 1NJIW 1XL6A 2BTQB 5JH7A 5LHIA 4LFBB 3MDSA 3FB6C 2HG5C 3RWRD 4NXMO 4HNAA 2C2AA 4FPPA 4J42A 1F23A 2DYRB 1MSDA 4ASUG 4GX0A 1H2LA 1BHBA 3FD9A 1VEWA 1CPYA 2IJIA 2Y4UA 2ITDC 3PJSK 2LW1A 3D8CA 1K5SA 4UCTA 2GUZA 4GX5A 2QWRB 4LR3A 5DEDA 3ZEDA 5E1AC 4IGGA 2VQEB 3X2QC 2N05A 4DUYO 4FFKA 4DUZB 3JARA 3CC4V 3ZN1A 4F6RB 4X1IA 1H8EG 3VBBA 1B04A 1WB7A 2E76B 3RW0A 2EJ7A 3CE2A 4IHJB 3VOUA 3SYPA 3I55V 3RT3C 4NTYA 1EM1A 2RCVA 4LF7O 2NNUA 4IYHA 1Q8IA 1QBZA 3A8TA 1VQ5V 4BR6A 1XNQB 3CRQA 2D2CB 2QKAA 4FJCC 3MAQA 1E1QG 2UU9B 3Q4HB 1KUQA 4LC1A 1YITV 5KHGA 3M8AA 1VQNV 1TUBA 5IT9N 1FAFA 1AR1B 1TVKA 4DR1B 1XNQO 3NR7A 3E86A 2KQXA 2YEVA 3M99B 3K9AA 1SA0A 1N36B 3LUTB 2ETNA 2NN4A 1IBMB 4ABMA 4GX2A 4OPAA 2R9RB 3A2FA 4TSFG 1Q86W 1ZUQA 4DV5O 4PJ0Z 2CH7B 1BT8A 2LFSA 3E35A 4JF3A 4JI7B 3RYIA 2JGUA 2IH1C 1VQ9V 1V54B 2AW9A 4I0XA 1FXKC 4JPRA 5JCOA 3ZMSA 2UXDB 4MW8A 5FPRA 5A9GA 2Q68A 1DTOA 1Y76A 4FK5C 1AILA 4JYCA 2Q6AA 3ZBHA 1XREA 2NLJC 3APOA 2UXXA 3B8MA 1FJGB 4IHJA 1VQOV 5GTHZ 3WFVA 1MSWD 4QIWF 3G71V 5ITZB 5L3GA 5FL7G 1XMOB 1Q5OA 1FD9A 3SJQC 1XMQO 2ZDIA 4K8ZA 1FJGO 3CCJV 2UUCO 5B66Z 4PDVA 2DMXA 4RO2A 4J7JA 4TV9A 2ATKC 3BPZA 4YY3B 4FFBA 5EBWC 3EVKA 2UUCB 4O4JB 2BTQA 5JH7B 4H37A 2DQ3A 2P06A 2CTQA 5J2UA 2XTAA 1XMQB 2EINC 4J41A 2EIKB 3SYAA 3JALA 1VIBA 1V55B 2GSMB 2ZM6B 5CBFA 4K8XA 3ABKB 4JTDB 1SRYA 4FZ0A 2GTSA 1WN7A 3CWBH 1SF9A 3UM7A 1SC5B 1QNMA 1R1BA 3H01A 3K04A 3E8GA 4X8AA 3HKCA 4P9OA 1OCOC 5KLVH 4LNUB 2XOKG 3E83A 2XAQA 1WA8A 1SQVH 3FAVB 1RPOA 2QM8A 3ZHUA 4JYAO 1IBLB 3CCRV 2ZIMA 1YSCA 2YI9A 4JI4O 3K58A 4HZ3A 1OJHA 3SYCA 5IYCO 3F7VC 4LFCO 4J9YB 4WFAV 3A0RA 2JRIA 5KA5A 2FMLA 2UUAB 2IH3C 3C90A 2ZNIA 4LF5O 3ZRSA 1R3LC 1XDCA 1VQMV 4BW5A 4AQYO 3CJHA 1XHZA 4U7OA 4TV8B 2ZDIC 2DYSB 4ZKIA 2EIMB 3CJHB 5LOVB 4WFHA 3AG2C 4DV4O 1ROPA 1WNSA 2DWEC 4LF8O 3WG7C 5E79Z 2E5LO 2WLIB 2Q73A 5EBLC 1I7FA 4MVZA 3JCUZ 4JAAA 4XDKA 5JCOC 4X66B 1K33A 1Y4MA 2B9ZA 3ETDA 3HR0A 1VQ8V 2V4DA 1NKDA 3DGEA 1Q82W 4FZ1A 2GTAA 2PZSA 3VQYA 1VQKV 1TVKB 3CRMA 1OCOB 3DXRB 5IY5B 1CEZA 4J7ZA 1I08A 1QLEB 4NKGB 1TUBB 2XUMA 1M57C 2YIBD 2ADQB 3OUSA 2D3OW 4WCEV 2ZR3A 1QHTA 4K0KB 5IE9A 2L35A 1JQ0A 2Y69C 3QG5A 3BCCH 2YI8A 3OGIB 4WBNA 1YF2A 3AK3A 1U96A 1PNKA 2AZ2A 1NTKH 4U3JA 1N33O 3ETEA 4EFEA 3FYIB 1JFFA 3OTFA 1OZ0A 3N2KB 4UVAA 3B2EE 4DV3O 5KX5A 1AI7A 3OEEG 4YHHB 5JJEB 1PL4A 3E22A 5B1OA 3UCSC 4EB6B 1W0JG 3THOA 1K9MW 4J10A 2WA3A 5TISZ 5LMUO 3D3QA 1D2DA 2OTJV 4KHPB 1WAZA 3HKBB 4GKJO 4AILC 3W7SA 1M93A 3JAMN 2IJKA 4FLWA 4UXNA 4ZI7B 2K9PA 2LGQA 2X0LA 3JSLA 4MTFA 5B5EZ 1Z5WA 2Q4PA 2Y4TA 2L6LA 1N8RW 4Z2WA 2YIBA 2QJ1A 2E74B 4DR2B 4NB5A 5KHHA 3QVNA 1JR9A 3L70H 5LGUA 2ZM6O 1HNXO 4FVMA 3K08A 4DR6B 1YVWA 2CH7A 1WLEA 3ZHQA 5JJNB 1XHXA 2DJVA 1Q43A 4LF9O 2Z0AA 2WAMA 4B7EA 2JDIG 5F2VO 4U7NA 1KKDA 5H6RA 2ZT9B 1SA0B 4X89A 1IX9A 1AJPA 2FKXA 5B1AC 3RGBA 1YJWV 1URFA 2VQFB 4NXNB 3B40A 4LFCB 4X62B 5C8YA 2FB5A 1ZWIC 2XAHA 3RYHA 4P9PA 1AR5A 4UCSA 5LA6B 1G8MA 1RM1B 3D3IA 2YXYA 1HP8A 3OFNG 4DR2O 3K03A 3CPWU 4CS3A 3CRRA 3K9SA 2ZE7A 2QR4A 5IJ9B 1E79G 1F7YA 1R3IC 1AP5A 4OXSA 5C93A 4PI0A 4W4KA 1KQSU 4DO2A 1S77D 1RP3B 4DR3B 2DE0X 2LFRA 4J80A 3FYEB 2JJ1G 5LXTA 4LP8A 3CCLV 4EKWA 3P3PA 1SQFA 4I50B 5LBQA 3G80A 3CD6V 3UO2A 4W4LA 3K3WA 4JV5O 1MG1A 1S3JA 1EBOA 4I9QA 2LQTA 3RFRA 3VQWA 2A0LA 1QQCA 3IJ4A 1KB9F 5IJ0B 4RWUA 4HYOA 3ZRXA 1N32O 1PNMA 1THZA 1BS3A 1COWG 3OUFA 5IYBO 2Q5ZA 1U97A 1BCCH 1AB3A 4Q6GA 1O9HA 3A0BZ 2UXNA 4TQFA 3T1YO 2WLLA 2JEUA 1XOUA 4DR6O 1OCRC 1GTOA 1GH6A 1HNWB 1PNLA 3LDEA 3H9VA 1MOFA 2YXLA 2WPDG 1BSMA 4DV2O 2KKWA 3STLC 3BEHA 5KUKA 1OCZC 1JVMA 2Z5UA 2YUAA 4CC5A 3ZS8C 1JMKC 2QWPB 4X1KB 5BMVA 1S5JA 5EYPB 1S0VA 3L75H 4YJ3B 1V9PA 4DUYB 5GTIZ 4PA7A 2BOCC 3BVOA 4KP4A 4H33A 4CBCA 3JASA 4PI2A 1IBKO 5LMUB 3HKDB 2N04A 3P32A 1SQPH 1GKFA 3LSSA 1TA8A 4DV7O 3HKBA 3FX7A 3T4DA 1BQZA 1RFYA 5FLXN 2VS0A 3CMEV 1K8AW 4L87A 2CTWA 3CXCU 2WWWA 3WB1A 1KU9A 2CGNA 4L8JA 4NYKA 4JI8B 2YSUB 4YJ2A 3SDLA 3E22B 5LYJA 1NI8A 4UB6Z 1JCHA 5A2QN 5KX5B 3W7UA 1NTMH 5LOVA 1V55C 2VWKA 3HPLC 4G28B 5GONB 2RDCA 2CUGA 1DLBA 3JAKA 5B3SB 1EN6A 3OT7A 2DOSA 1KC8W 4B3MB 3AG1C 5LA6A 1ZL8A 3EHBB 5IYZB 4ZHQA 2XT9A 2W0FC 3ASNB 4DV1O 4AI8A 2EIMC 4D6TH 1YI2V 3DC6A 1H8HG 1MZFA 3B77A 3UT5B 4MVMA 5L3EA 3G67A 1GMGA 1QR8A 1L8DA 3RYCB 1K97A 3BABA 1KKCA 4J7KA 4FM1A 1RPRA 4IIJB 1AI5A 1NR7A 4J9ZB 4Q20A 4X65B 2PYJA 3X2QB 1XBLA 1VQ7V 1WP7A 1JJ2U 2X6BA 1OCCB 3ZCCA 2QKCA 1FFTB 2E3CA 1N33B 1YDXA 4GKJB 4DV2B 3BAAA 1I5YA 2KSDA 3JD4A 2BOBC 5LMNO 4JI1B 3VQVA 1GN2A 4LFBO 2QTSA 2DW4A 4DV4B 1VQ4V 2PGGA 1WP8A 5GW7A 4YIOA 2F95B 3L73H 2GDSA 1QCEA 4D7TA 2RQ6A 1IDSA 2WLKA 1VF5B 2AHYA 1VF7A 4JV5B 2AZ0A 1O9GA 1W2BU 3K5OA 2DYRC 1SQQH 4DV7B 2N74A 1US6A 5JWPA 2QWNB 4LF9B 1Z2GA 3A0HZ 1Y74A 1GN3A 1QLEC 4TQDA 1FXVA 1P7BA 4B3TO 2UXDO 1PKXA 2BTOA 3OGCC 5IWAB 2A9HA 4HAMA 3FB7C 4WBNB 4DV6O 2B1IA 5DECA 1VQLV 1SQXH 1P4RA 1SERA 2O57A 4LBEC 2QA4V 1IBLO 5J2TB 2F4VB 1AR4A 3B09A 4E2LA 5D5PA 1NZ6A 2QKSA 2OCHA 1M57B 3ZRWA 4DR4B 4FIPC 3APQA 3PN1A 3RYCA 5EBMC 4X64O 2P7TC 1AVMA 1G4YB 2F93B 4BW9A 4LF4B 4O4JA 3CHXA 1R73A 4B3RO 3OEHG 3QO7A 4GZRB 5EIBD 4D7SA 3SPGA 1B3QA 3CC2V 4DK0A 1HDJA 4IYIA 1FS0G 1EN4A 5BR8O 4YY3O 3JCZA 3OW2U 3ZRVA 5IYZA 1K34A 4NTXA 1ZL8B 2OCCC 4ZOLB 1JJOA 3UO3A 2ODMA 3TCUA 4B7KA 2H94A 4MW3A 4LF5B 1GM7A 4I4TB 3B8NA 2CAZC 1K4CC 1VQ6V 1N0NA 2EZOA 1GM8A 1X4TA 5BY1A 3ICXA 4JZGA 4DXWA 2YIAA 4Z1MG 2CK3G 1VP7A 5K1PA 4GKKB 3SYQA 3JATA 3QTCA 4MVUA 3E2EA 1PV0A 1XL4A 2ZE8A 4GYCB 2HHHB 3F5WC 4GKKO 4P2ZA 2Q69A 5H6QA 3TK1A 1KMIZ 1Y66A 5KUMA 1YZBA 3IGAC 4PA9A 3K5LA 3HKDA 4EEQA 1J5EB 3RYHB 1Q6UA 5C8YB 1OV9A 2A79B 2YXHA 1L1FA 4O2BB 3W7TA 4YHHO 1RM1C 2QM7A 2R70A 5BMVB 5KAIZ 1IBMO 1PPJH 2OCCB 3R65A 1DK1A 1G1XB 1K4DC 3OR7C 4JI2B 4JI3B 1G6UA 1TUEB 1KD1W 2X7RB 4NTWA 2R9IA 1K5QA 1LR1A 4MTXA 2QSAA 5BR8B 2WA4A 4MVRA 3SPJA 4QE7A 4QPKA 4JI1O 1FFXA 1P49A 1R6NA 3JD3A 3R66A 1I94O 5EIBC 4DV3B 5JVDB 3CCVV 4N21A 3QF7A 3KCXA 1OCRB 1Q90D 1MNGA 1K92A 2Q8VA 4JI8O 1S76D 4UCVA 3SPCA 2WSSG 5IJ0A 2P67A 4QNHB 4KUMA 3CCQV 1NBMG 4TV9B 1S72V 2F4VO 1IZ3A 1JPXA 3SPHA 2OTLV 5K1XA 2XAJA 1W0KG 4J11A 2PI4A 4FLYA 1I0HA 4EFBA 3NXSA 2A3QA 2CDYA 1ZTEA 4LH7A 3ZX6A 4JYBA 2ARHA 2FL4A 3LDCA 4CH6A 1DGSA 4PD4F 3LNMB 3W7WA 1YTFD 1YIJV 3SJBC 2BCCH 4X66O 1M5IA 3RYFB 1SETA 2UXBO 1S5LZ 1HNWO 2EIJC 4C7UA 2NR5A 2YICA 2UUAO 2MW2B 1ZSPA 4ZOLA 1XI1A 5EC1C 2E5LB 2RMKB 4LF4O 3TXQA 1NU1H 1W59A 2EBOA 3GWOA 3WB0A 1YJ9V 3C3TA 3CMAV 4X64B 2VQEO 4I55A 4O2BA 2IBZH 3M7MX 4AQYB 4JI3O 2FYUH 3ASOC 1QVFU 4ZHQB 3T2MA 2QEXV 4DR7B 3KG2A 2EX3A 1YEWA 4UV9A 1ZX3A 1UPGA 3IAYA 1R6KA 4O2AB 2DWDC 3T1HO 3ZRWB 3H1KH 5FNVB 4DR3O 1HR0B 4MVQA 4U3FH 2AHZA 4X20B 4AHCA 2WLIA 3H1IH 3CX5F 2ZKOA 5KA6A 2HJDA 2WLHA 1GAXA 4TOIA 1FXKB 1NT2B 2P90A 2OIEA 1FKAO 3EXAA 4R50A 2JJ2G 2P5OA 4DV0O 5CA1A 4MTOA 3ABMC 3K0GA 4MT8A 3STZC 4CS2A 4R6ZA 1NH2D 2LO1A 3ZMTA 1I94B 2Z3YA 4YXWG 5B3SC 1Q6IA 1AI4A 1NQTA 4OPHA 4UFZA 1WJZA 2B5UA 4YJ3A 1FXHA 2JGDB 1D5AA 3DTUB 2GUZB 1F51A 3D36A 1KP2A 3ETQA 3I5DA 4IT5A 3U10A 3BA8A 1J5EO 4RUFA 3N2GA 3ZHVA 1WPXA 4WFBV 2V7QG 1PM9A 4FMTA 4I5SA 5LP6B 3RVYA 2UXBB 5LL6Y 1N34O 4LNUA 1LUWA 2QWQB 5EZYA 2W6IG 4LF7B 4O4IA 4JAVA 4B3RB 1BGYH 2A7WA 1L0LH 3EFFK 3P30A 2EINB 2WLLB 1IXMA 1MMMA 2EIKC 1CXZB 3L71H 1KBHA 2XHBA 4FM2A 3WU2Z 2ZR2A 3OTOB 2PTMA 3JALB 4O4HB 1KECA 1H2SB 5J2UB 1TGOA 1YCIA 1H2MA 3ABMB 4JTCB 3QO8A 2E75B 4O4LB 3AG7A 1AJNA 1HW7A 2WLMA 1GRJA 3K57A 3F5TA 3J7AU 2Q7GA 1A32A 1BL8A 2LJ2A 3N2GB 3VQXA 1PP9H 2BSKB 2M6YA 5LXTB 2PF4E 1GK9A 2HFEC 2PYLA 4QGPA 2VQFO 3DSQA 1GO3F 5ITZA 2ITCC 4JI0O 5LMNB 3AG4C 2Y0IA 5BXZA 3OR6C 1QU7A 1ENVA 2XASA 1S5HC 2P22C 5CA1B 5CA0B 4A5UB 5IJ9A 1Y67A 1UJWB 1Q81W 4DR1O 5B1BB 1GN6A 2RJZA 1V54C 1T5EA 1EZJA 1LUVA 1YHQV 3FFQA 4K0KO 2R9AA 3WG7B 4CH3A 2KG7B 2RNBA 2Y48A 3AG4B 4OX9O 4JI7O 1FPOA 4DW1A 2HP8A 2OYQA 1EN5A 2JS5A 5JJJB 4MSWC 4X1YB 2IU0A 4X65O 2HKOA 3JASB 4X9QA 3GB7C
chains in the Genus database with same CATH topology
3DGEA 1Q82W 3CCEV 4QE9A 3ASNC 5HFLA 2QKSA 5DN6G 1YJNV 1M57B 3SYOA 1VQKV 3AG3C 3ZRWA 3E8HA 1F4NA 2OT5A 1OCOB 2ZXWC 5IY5B 4FIPC 1VQPV 3E89A 4UVBA 5EBMC 1HWYA 2P7TC 1QLEB 1CEZA 1G4YB 2EILB 3TETA 1K3EA 3OMNB 3K0DA 1PD3A 2V1DA 1M57C 4MTGA 4TT3G 3OUSA 1R73A 2D3OW 4WCEV 2ZR3A 5LHGA 3OEHG 3OE7G 1JQ0A 2Y69C 5B1NA 2IJHA 1AROP 3QO7A 3ASOB 3SPGA 1OHHG 3CC2V 1PNKA 3LDDA 1FS0G 3AG2B 3ETEA 3JCZA 3FYIB 3T1CA 3OW2U 3ZRVA 1J95A 1E1RG 1OZ0A 1K34A 3JD2A 5EK0A 5DM6V 3CYOA 4UVAA 2OCCC 1CP9A 1AI7A 3QO5A 3OEEG 3ZN0A 2FTKA 3AG3B 4TWKA 3TCUA 5B1OA 4RQFA 2WLJA 2H94A 4MW3A 4I9WA 1GM7A 2IJJA 1W0JG 4JTAB 3B8NA 1K9MW 1OCZB 1K4CC 1EFRG 1VQ6V 2EZOA 1GM8A 3JD1A 2OTJV 4GX1A 3CCUV 1AJQA 2Y69B 3ABTA 3LSQA 1QLNA 5KUKA 2EZPA 2XAGA 2ZD9A 1R3JC 4DXWA 3W7SA 5LGTA 2IJKA 2XAFA 4UXNA 4Z1MG 2CK3G 3SYQA 1NR1A 2X0LA 4MVUA 2X6AA 4RQEA 4MTFA 4BAYA 3E2EA 3OAAG 3K79A 1XL4A 5CN0A 2JIZG 3ML0A 2IW5A 3FB5C 3F5WC 4GCZA 4WF9V 1K73W 4P2ZA 4KFMA 1N8RW 3CCSV 4F4LA 1QVGU 2Q69A 5H6QA 3TK1A 1Y66A 5KUMA 1MABG 1JX9A 3ABLB 3IGAC 4PA9A 4PDLA 3RVZA 2ZQMA 3IFXA 5LGUA 2LP7A 1NH2B 3K08A 1M56C 4BIZA 3MHHC 4MS2A 2A79B 1L1FA 3G6EV 1WLEA 3I56V 1OCCC 3W7TA 4WFEA 2QM7A 1RM1C 3ZMVA 4XBFA 2WAMA 2B1GA 4UV8A 1M90W 2OCCB 3R65A 2JDIG 1K4DC 3OR7C 4U7NA 2HR3A 1LNQA 1KKDA 5H6RA 1TUEB 4PDRA 1H38A 3JYCA 2KB1A 1KD1W 2X7RB 4LCUC 2R9IA 1K5QA 4X89A 4MTXA 1ORQC 3F7YC 1JOYA 1AJPA 4X88A 5B1AC 3ZMZA 4MVRA 3CP1A 1GM9A 1YJWV 2F43G 1DF5A 1NJIW 3SPJA 1XL6A 4QE7A 1ZWIC 2XAHA 5LHIA 4P9PA 4QPKA 3FB6C 1R6NA 2HG5C 3JD3A 3CCVV 4N21A 1G8MA 1RM1B 1DF4A 5IDJA 4E2LA 2P6JA 1OCRB 2C2AA 3D3IA 4FPPA 1K92A 3JD0A 1F23A 3OFNG 1S76D 2DYRB 3K03A 4ASUG 4GX0A 3CPWU 1M1KW 3SPCA 2WSSG 1BHBA 2P67A 1CPYA 2IJIA 4QNHB 4KUMA 1E79G 3CCQV 2ITDC 3AG1B 3UKMA 4UUJC 1NBMG 1R3IC 3PJSK 4OXSA 5C93A 1S72V 1YTFB 5J9PC 2DYSC 1K5SA 2QTOA 1KQSU 1JPXA 4WFGA 4GX5A 2GHYA 3SPHA 4DO2A 2OTLV 1S77D 2XAJA 1W0KG 3MHSC 5E1AC 3X2QC 2LFRA 2W6JG 2PI4A 2DQ0A 3FYEB 2JJ1G 3NXSA 3CC4V 3ZN1A 4LP8A 4N23A 4R7CA 3CCLV 1H8EG 4G2KA 4EKWA 3VBBA 5LGNA 3RW0A 4JYBA 5LBQA 3CD6V 4JASA 3SYPA 3VOUA 3K3WA 3I55V 1MG1A 1S3JA 1EBOA 2HJFC 3LDCA 3LNMB 3E8FA 3W7WA 2A0LA 1YTFD 1YIJV 5CA3A 2NNUA 2WLNA 1QBZA 4HYOA 3SPIA 3ZRXA 4MVSA 1SETA 1PNMA 1THZA 1COWG 3OUFA 1VQ5V 5IYBO 1R3KC 4FJCC 2EIJC 1E1QG 3OMAB 3G4SV 2UXNA 4LC1A 1YITV 5EC1C 2WLLA 2JEUA 1VQNV 5IY5C 1OCRC 1GTOA 2EBOA 3GWOA 1YJ9V 1AR1B 1PNLA 3LDEA 4WFFA 3CMAV 1MOFA 3ETGA 2WPDG 3E86A 2H8PC 1KP3A 2YEVA 3M99B 3K9AA 5CMUA 3STLC 3ASOC 1QVFU 3LUTB 3BEHA 1F4MA 1OCZC 2HLDG 5L3DA 3T2MA 1JVMA 2Z5UA 3ABLC 3KG2A 2QEXV 3ABUA 5L3BA 4UV9A 4GX2A 3CC7V 3CCMV 1R6KA 2R9RB 2DWDC 4TSFG 3ZRWB 1Q86W 1M9NA 4JGSA 1S0VA 2LFSA 4PA4A 3E35A 4JF3A 4MVQA 5H9CA 2IH1C 3QNEA 1AI6A 2BOCC 4PA7A 1V54B 1VQ9V 3FB8C 4KP4A 4H33A 4CBCA 1FXKC 2AHZA 4JPRA 3ZMSA 4MW8A 2WLIA 1QR9A 3P32A 3HB3B 1GKFA 2Q68A 3LSSA 4QPJA 5KA6A 2WLHA 1DTOA 3IC7A 2K1EA 1Q7YW 2EJRA 1SESA 4FK5C 4JYCA 5BZBA 1FXKB 5CBHA 4GT1A 2Q6AA 3T4DA 1NVPB 2NLJC 2P90A 5CBGA 4R50A 3CMEV 2JJ2G 1K8AW 4L87A 3CXCU 2WWWA 4MTOA 2UXXA 3ABMC 3B8MA 3K0GA 4MT8A 3STZC 4R6ZA 1NH2D 2YSUB 1K7DA 3E8BA 3ZIAG 1FXKA 3ZMTA 1VQOV 4PA6A 3WFVA 1MSWD 1PL0A 4QIWF 3W7XA 1JCHA 2Z3YA 4YXWG 5B3SC 3W7UA 2PI5A 1V55C 4UVCA 3G71V 5L3GA 5FL7G 3HPLC 4G28B 4PA3A 5L3CA 4JAUA 1AI4A 1NQTA 1DLBA 3SJQC 2B5UA 1NVPD 5B3SB 1FXHA 3DTUB 2ZDIA 2EILC 2X6CA 4QJFB 1KC8W 5LHHA 1F51A 3D36A 1KP2A 2JK5C 3CCJV 3AG1C 4PDVA 4RUFA 1SZTA 1WPXA 4RO2A 2ATKC 4WFBV 2V7QG 2Q67A 5EBWC 3EHBB 3ZMUA 4FMTA 4I5SA 3RVYA 4H37A 2DQ3A 2HVJC 2W0FC 3ASNB 2YEVB 2W6IG 2EINC 2EIKB 4JAVA 2EIMC 3SYAA 1YI2V 2M7WA 1H8HG 1V55B 2GSMB 3B77A 3EFFK 4MVMA 5CBFA 1BHAA 3P30A 5L3EA 3ABKB 3AEIA 4JTDB 1SRYA 1GMGA 2EINB 2WLLB 1IXMA 1M56B 1QR8A 5B1AB 2EIKC 5HFMA 2ZR2A 3UM7A 1H2GA 1K97A 3H01A 3K04A 2IU3A 3E8GA 1RPRA 1BMFG 4X8AA 1KECA 4P9OA 1OCOC 2ZXWB 4PDMA 3ABMB 2XOKG 1AI5A 4JTCB 1NR7A 3E83A 3OM3B 2XAQA 3QO8A 4P30A 4J9ZB 4Q20A 1RPOA 2QM8A 3X2QB 1AJNA 3CCRV 2WLMA 1VQ7V 1JJ2U 2X6BA 1OCCB 4MVOA 3ZCCA 1BL8A 5B1BC 1YSCA 4ZBMA 4RAIA 4HZ3A 1FFTB 3SYCA 4RUEA 1GK9A 5IYCO 3F7VC 5EC2C 4J9YB 4WFAV 1I5YA 2HFEC 3A0RA 3JD4A 4G27B 2BOBC 1GO3F 5KA5A 2ITCC 5L3FA 2IH3C 4BIUA 4PELA 3AG4C 2DW4A 1VQ4V 3OR6C 3ZRSA 1R3LC 2EIJB 1VQMV 1ENVA 5GW7A 4BW5A 2XASA 1S5HC 4U7OA 2XNDG 1UJWB 1Q81W 2ZDIC 1QCEA 2DYSB 4ZKIA 2EIMB 2WLKA 2QE7G 2AHYA 3AG2C 4WFHA 5B1BB 3T4ZA 3OMIB 1ROPA 1V54C 2DWEC 3MD0A 3ABKC 3WG7C 1EZJA 1W2BU 1YHQV 2DYRC 1B6QA 2WLIB 1QLEC 5EBLC 1FXVA 1P7BA 2HVKC 3K06A 3WG7B 1PKXA 4R8CA 3OGCC 4XDLA 3BY6A 4MVZA 2A9HA 2Y48A 4HAMA 3AG4B 3FB7C 4XDKA 3ZJZA 5IYDO 1VQLV 2B1IA 4XDJA 1K33A 1Y4MA 3FKSG 2JEXA 3ETDA 4MSWC 1P4RA 1SERA 2IU0A 2MK3A 4LBEC 2HKOA 2QA4V 1VQ8V 4CZZA 3RBZA 1I5XA 3GB7C 1NKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHY A;  1RPO A;  1F4N A;  2IJK A;  1PD3 A;  1F4M A;  3K79 A;  1RPR A;  2IJI A;  2IJJ A;  2IJH A;  4DO2 A;  1ROP A;  1B6Q A;  1GMG A;  1GTO A;  1NKD A; 
#chains in the Genus database with same CATH topology
 4DW0 A;  3CCE V;  3ASN C;  3HKC B;  4TUY B;  3E8H A;  4OX9 B;  2OT5 A;  1WB8 A;  1VF6 A;  1VQP V;  1HWY A;  4CC6 A;  2EIL B;  1K3E A;  2V1D A;  4LF8 B;  4MTG A;  4OGQ B;  4GLX A;  3ZHS A;  3GWK C;  3JAW B;  3OE7 G;  5B1N A;  1HNZ O;  2IJH A;  1ARO P;  2Q7H A;  2JS3 A;  2GV9 A;  1OHH G;  5D5Q A;  4LWS B;  3RYF A;  3T1C A;  3TJT A;  1J95 A;  1E1R G;  3JD2 A;  5DM6 V;  5EK0 A;  1BZK A;  4NXM B;  4ZI7 A;  1CP9 A;  3QO5 A;  2FTK A;  3AG3 B;  3G6B A;  4RQF A;  2WLJ A;  5H5N A;  4I9W A;  2UUB B;  3CXH F;  3JAR B;  4JTA B;  1OCZ B;  2H3O A;  1B06 A;  1HNX B;  1Y74 B;  2ZE5 A;  3JD1 A;  4GX1 A;  1AJQ A;  1QLN A;  5CB4 A;  3BFR A;  2XAG A;  2ZD9 A;  3BHP A;  4DR4 O;  4FLT A;  2XAF A;  2CGO A;  4JI6 B;  1NR1 A;  3CRC A;  1XNR O;  2X6A A;  3L74 H;  4BAY A;  1JFF B;  2Q9L A;  2QDO A;  3K79 A;  2ZCE A;  3ML0 A;  3FB5 C;  1R6T A;  1K73 W;  1N34 B;  3CCS V;  2YDE A;  1QVG U;  1IXB A;  5JQG B;  4X1K A;  1IBK B;  4PDL A;  2ZQM A;  3IFX A;  4JYY A;  1XEQ A;  4LF6 O;  4X20 A;  4I0X B;  4MS2 A;  1OCC C;  3DXR A;  4WFE A;  3SGI A;  3ZMV A;  4XBF A;  4O2A A;  2ILM A;  3T1H B;  4YIP A;  2B1G A;  4UV8 A;  2Q0A A;  4ZIB A;  2HR3 A;  1LNQ A;  4PDR A;  5KMG A;  4LCU C;  5H2F Z;  3UT5 A;  4JI2 O;  3F7Y C;  1JOY A;  4H13 B;  4DRX A;  2ZE6 A;  4DRX B;  1XIL A;  3ZMZ A;  3CP1 A;  1GM9 A;  2P4V A;  1YXB A;  1XUQ A;  1X59 A;  2VWJ A;  1SS3 A;  4X1Y A;  3AK1 A;  3Q4H A;  4PV1 B;  5KAF Z;  1DF4 A;  4DV0 B;  1TAE A;  5IDJ A;  4B3S O;  4I7Z B;  2P6J A;  3JD0 A;  4UB8 Z;  1HR0 O;  4HBN A;  3JAK B;  1M1K W;  4PHZ A;  4JI4 B;  1MA1 A;  3AG1 B;  3UKM A;  4UUJ C;  3ZHT A;  3O9O A;  1RSO A;  1YTF B;  5J9P C;  2DYS C;  5LYJ B;  2QTO A;  4YJ2 B;  4WFG A;  2GHY A;  3SJC C;  4CS4 A;  4DUZ O;  3MHS C;  2W6J G;  2DQ0 A;  4TV8 A;  1VAR A;  1H2K A;  3ZHR A;  4N23 A;  4R7C A;  4G2K A;  4X62 O;  3AK2 A;  5LGN A;  4DR7 O;  1SKV A;  4JAS A;  4KXR A;  4BWA A;  2HJF C;  1Y6X A;  1XNR B;  3BRC A;  3E8F A;  4DR5 O;  5CA3 A;  2WLN A;  3L9D A;  3SPI A;  4MVS A;  3CSX A;  4EB6 A;  1R3K C;  3DC5 A;  5EYP A;  5KHK A;  4FLU A;  3OMA B;  3G4S V;  1FFX B;  4FM0 A;  3N2K A;  2YS8 A;  2JVD A;  5IY5 C;  1WA8 B;  3FAV A;  2LGW A;  1NS1 A;  1H2N A;  4WFF A;  3L72 H;  2UU9 O;  5AG2 A;  1EZV H;  2H8P C;  1KP3 A;  3UQ8 A;  4JYA B;  5CMU A;  2QWO B;  4JZ2 A;  5LP6 A;  1F4M A;  2HLD G;  5L3D A;  3ABL C;  3TGU H;  3ABU A;  4ICG A;  5L3B A;  2HHH O;  3CC7 V;  3CCM V;  1M9N A;  4O4I B;  4JGS A;  2JGD A;  5IWA O;  4PA4 A;  5H9C A;  3QNE A;  1AI6 A;  3FB8 C;  2ZIN A;  4FFB B;  4B3T B;  3OD4 A;  1QR9 A;  4DK1 A;  4UCU A;  2W0X A;  3HB3 B;  3U0Z A;  4QPJ A;  3IC7 A;  2K1E A;  3O65 A;  2EJR A;  1SES A;  5BZB A;  5CBH A;  1Q7Y W;  4GT1 A;  1NVP B;  1P84 F;  2CTP A;  1NTZ H;  5CBG A;  4JI6 O;  3TXS A;  4CH5 A;  4FLZ A;  4FLV A;  2GBO A;  4F6E A;  3ZIA G;  1K7D A;  3E8B A;  1FXK A;  4FLX A;  4PA6 A;  4I50 A;  1PL0 A;  1RSO B;  3W7X A;  4KHP O;  4NXN O;  3SJA C;  4UVC A;  2PI5 A;  4JI0 B;  1GN4 A;  4PA3 A;  5L3C A;  4JAU A;  1VMG A;  2CTR A;  3RYI B;  1ZAU A;  5CA0 A;  4I4T A;  4LWS A;  4JI5 O;  4NVP A;  1NVP D;  3P3N A;  2BE3 A;  2EIL C;  2X6C A;  4QJF B;  5LHH A;  5LP6 C;  2JK5 C;  4LF6 B;  3JAW A;  1SZT A;  3JSN A;  4LFA O;  2Q67 A;  3ZMU A;  2HEP A;  1N0J A;  3J80 N;  2HVJ C;  2P4K A;  2YEV B;  2ZNJ A;  4IIJ A;  2BSK A;  3LNN A;  2PUS A;  2M7W A;  1HNZ B;  1BHA A;  1AP6 A;  4KL1 A;  3AEI A;  5KMG B;  3KZI Z;  4LH6 A;  5B1A B;  3U11 A;  3C3S A;  5HFM A;  1VF6 C;  1H2G A;  2AGA A;  2IU3 A;  1BMF G;  5FPO A;  2ZXW B;  4PDM A;  3OM3 B;  4P30 A;  3KCY A;  1SZX A;  5J2T A;  4B3S B;  1MZE A;  4MVO A;  5B1B C;  5KHI A;  1IUR A;  1BQ0 A;  4ZBM A;  5JQG A;  4RAI A;  1N36 O;  4RUE A;  2OWO A;  1FYJ A;  1N4C A;  5EC2 C;  5GON A;  4G27 B;  5KHJ A;  2LW7 A;  3J81 N;  4IL6 Z;  5L3F A;  4BIU A;  4PEL A;  2QM4 A;  2EIJ B;  3D36 C;  3HKE B;  4F6R A;  2UXC O;  3GVM A;  2R72 A;  2OIG A;  2XND G;  1N32 B;  4DR5 B;  1WPB A;  2UXC B;  4K3A A;  2QE7 G;  3T4Z A;  4E4E A;  3OMI B;  3HKE A;  3MD0 A;  3ABK C;  2DN9 A;  2Y0P A;  5JVD A;  5CB4 B;  1B6Q A;  2A06 H;  2IM9 A;  2HVK C;  3K06 A;  4R8C A;  4U3J B;  3BY6 A;  4XDL A;  3CB2 A;  1ZLZ A;  3BA9 A;  3ZJZ A;  5IYD O;  4HNA B;  3WB2 A;  1Y76 B;  4O4H A;  4XDJ A;  3FKS G;  2JEX A;  1JA8 A;  1XQ8 A;  2MK3 A;  3B4S A;  3K5M A;  4CZZ A;  2YID A;  3RN4 A;  3RBZ A;  3ETG A;  1I5X A;  1M56 B;  1IVS A;  1Z5V A;  4QE9 A;  5HFL A;  5FNV A;  5DN6 G;  4DV6 B;  3SYO A;  1YJN V;  4TUY A;  3OTO O;  3AG3 C;  3LSU A;  1F4N A;  2ZXW C;  2ZIO A;  3E89 A;  4UVB A;  1UFI A;  2F1M A;  1KYO F;  3TET A;  3OMN B;  1P7G A;  2Q0O C;  3K0D A;  1PD3 A;  4TT3 G;  5LHG A;  4I55 B;  3ASO B;  3S3W A;  1BE3 H;  3LDD A;  4B08 A;  2KG7 A;  3AG2 B;  1D5N A;  3CS5 A;  3CYO A;  2ADP A;  4UCO A;  4LFA B;  1SQG A;  2Q7E A;  3ZN0 A;  2G38 A;  4TWK A;  4JI5 B;  4H0L B;  4GUN A;  2IJJ A;  3T1Y B;  2F66 C;  1EFR G;  4UCR A;  3JAT B;  2PY5 A;  2RN9 A;  3CCU V;  3ABT A;  2Y69 B;  3LSQ A;  3S3X A;  4DYL A;  2EZP A;  1R3J C;  3H1J H;  4CH4 A;  2CE4 A;  5LGT A;  4X1I B;  3N27 A;  1Q3E A;  4RQE A;  3OAA G;  5CN0 A;  2JIZ G;  2IW5 A;  4WF9 V;  4GCZ A;  3CEI A;  3K59 A;  4KFM A;  3H1L H;  1SQB H;  3IC9 A;  4K35 A;  4F4L A;  1MAB G;  1JX9 A;  3ABL B;  2F23 A;  3H1H H;  3K5N A;  2VRZ A;  4NR1 A;  3RVZ A;  2LP7 A;  1NH2 B;  2YC0 A;  4B3M O;  1Q6H A;  1M56 C;  4BIZ A;  3MHH C;  3G6E V;  4DV5 B;  3I56 V;  3SR2 C;  4H44 B;  2UUB O;  1M90 W;  4DV1 B;  2EUL A;  4Z1V A;  3KKY A;  4O4L A;  1H38 A;  3JYC A;  2KB1 A;  4BIO A;  1ORQ C;  1M4U A;  2QGN A;  2AXT Z;  1XMO O;  1L0N H;  4X88 A;  3CRA A;  5EZY B;  2F43 G;  1DF5 A;  1NJI W;  1XL6 A;  2BTQ B;  5JH7 A;  5LHI A;  4LFB B;  3MDS A;  3FB6 C;  2HG5 C;  3RWR D;  4NXM O;  4HNA A;  2C2A A;  4FPP A;  4J42 A;  1F23 A;  2DYR B;  1MSD A;  4ASU G;  4GX0 A;  1H2L A;  1BHB A;  3FD9 A;  1VEW A;  1CPY A;  2IJI A;  2Y4U A;  2ITD C;  3PJS K;  2LW1 A;  3D8C A;  1K5S A;  4UCT A;  2GUZ A;  4GX5 A;  2QWR B;  4LR3 A;  5DED A;  3ZED A;  5E1A C;  4IGG A;  2VQE B;  3X2Q C;  2N05 A;  4DUY O;  4FFK A;  4DUZ B;  3JAR A;  3CC4 V;  3ZN1 A;  4F6R B;  4X1I A;  1H8E G;  3VBB A;  1B04 A;  1WB7 A;  2E76 B;  3RW0 A;  2EJ7 A;  3CE2 A;  4IHJ B;  3VOU A;  3SYP A;  3I55 V;  3RT3 C;  4NTY A;  1EM1 A;  2RCV A;  4LF7 O;  2NNU A;  4IYH A;  1Q8I A;  1QBZ A;  3A8T A;  1VQ5 V;  4BR6 A;  1XNQ B;  3CRQ A;  2D2C B;  2QKA A;  4FJC C;  3MAQ A;  1E1Q G;  2UU9 B;  3Q4H B;  1KUQ A;  4LC1 A;  1YIT V;  5KHG A;  3M8A A;  1VQN V;  1TUB A;  5IT9 N;  1FAF A;  1AR1 B;  1TVK A;  4DR1 B;  1XNQ O;  3NR7 A;  3E86 A;  2KQX A;  2YEV A;  3M99 B;  3K9A A;  1SA0 A;  1N36 B;  3LUT B;  2ETN A;  2NN4 A;  1IBM B;  4ABM A;  4GX2 A;  4OPA A;  2R9R B;  3A2F A;  4TSF G;  1Q86 W;  1ZUQ A;  4DV5 O;  4PJ0 Z;  2CH7 B;  1BT8 A;  2LFS A;  3E35 A;  4JF3 A;  4JI7 B;  3RYI A;  2JGU A;  2IH1 C;  1VQ9 V;  1V54 B;  2AW9 A;  4I0X A;  1FXK C;  4JPR A;  5JCO A;  3ZMS A;  2UXD B;  4MW8 A;  5FPR A;  5A9G A;  2Q68 A;  1DTO A;  1Y76 A;  4FK5 C;  1AIL A;  4JYC A;  2Q6A A;  3ZBH A;  1XRE A;  2NLJ C;  3APO A;  2UXX A;  3B8M A;  1FJG B;  4IHJ A;  1VQO V;  5GTH Z;  3WFV A;  1MSW D;  4QIW F;  3G71 V;  5ITZ B;  5L3G A;  5FL7 G;  1XMO B;  1Q5O A;  1FD9 A;  3SJQ C;  1XMQ O;  2ZDI A;  4K8Z A;  1FJG O;  3CCJ V;  2UUC O;  5B66 Z;  4PDV A;  2DMX A;  4RO2 A;  4J7J A;  4TV9 A;  2ATK C;  3BPZ A;  4YY3 B;  4FFB A;  5EBW C;  3EVK A;  2UUC B;  4O4J B;  2BTQ A;  5JH7 B;  4H37 A;  2DQ3 A;  2P06 A;  2CTQ A;  5J2U A;  2XTA A;  1XMQ B;  2EIN C;  4J41 A;  2EIK B;  3SYA A;  3JAL A;  1VIB A;  1V55 B;  2GSM B;  2ZM6 B;  5CBF A;  4K8X A;  3ABK B;  4JTD B;  1SRY A;  4FZ0 A;  2GTS A;  1WN7 A;  3CWB H;  1SF9 A;  3UM7 A;  1SC5 B;  1QNM A;  1R1B A;  3H01 A;  3K04 A;  3E8G A;  4X8A A;  3HKC A;  4P9O A;  1OCO C;  5KLV H;  4LNU B;  2XOK G;  3E83 A;  2XAQ A;  1WA8 A;  1SQV H;  3FAV B;  1RPO A;  2QM8 A;  3ZHU A;  4JYA O;  1IBL B;  3CCR V;  2ZIM A;  1YSC A;  2YI9 A;  4JI4 O;  3K58 A;  4HZ3 A;  1OJH A;  3SYC A;  5IYC O;  3F7V C;  4LFC O;  4J9Y B;  4WFA V;  3A0R A;  2JRI A;  5KA5 A;  2FML A;  2UUA B;  2IH3 C;  3C90 A;  2ZNI A;  4LF5 O;  3ZRS A;  1R3L C;  1XDC A;  1VQM V;  4BW5 A;  4AQY O;  3CJH A;  1XHZ A;  4U7O A;  4TV8 B;  2ZDI C;  2DYS B;  4ZKI A;  2EIM B;  3CJH B;  5LOV B;  4WFH A;  3AG2 C;  4DV4 O;  1ROP A;  1WNS A;  2DWE C;  4LF8 O;  3WG7 C;  5E79 Z;  2E5L O;  2WLI B;  2Q73 A;  5EBL C;  1I7F A;  4MVZ A;  3JCU Z;  4JAA A;  4XDK A;  5JCO C;  4X66 B;  1K33 A;  1Y4M A;  2B9Z A;  3ETD A;  3HR0 A;  1VQ8 V;  2V4D A;  1NKD A;  3DGE A;  1Q82 W;  4FZ1 A;  2GTA A;  2PZS A;  3VQY A;  1VQK V;  1TVK B;  3CRM A;  1OCO B;  3DXR B;  5IY5 B;  1CEZ A;  4J7Z A;  1I08 A;  1QLE B;  4NKG B;  1TUB B;  2XUM A;  1M57 C;  2YIB D;  2ADQ B;  3OUS A;  2D3O W;  4WCE V;  2ZR3 A;  1QHT A;  4K0K B;  5IE9 A;  2L35 A;  1JQ0 A;  2Y69 C;  3QG5 A;  3BCC H;  2YI8 A;  3OGI B;  4WBN A;  1YF2 A;  3AK3 A;  1U96 A;  1PNK A;  2AZ2 A;  1NTK H;  4U3J A;  1N33 O;  3ETE A;  4EFE A;  3FYI B;  1JFF A;  3OTF A;  1OZ0 A;  3N2K B;  4UVA A;  3B2E E;  4DV3 O;  5KX5 A;  1AI7 A;  3OEE G;  4YHH B;  5JJE B;  1PL4 A;  3E22 A;  5B1O A;  3UCS C;  4EB6 B;  1W0J G;  3THO A;  1K9M W;  4J10 A;  2WA3 A;  5TIS Z;  5LMU O;  3D3Q A;  1D2D A;  2OTJ V;  4KHP B;  1WAZ A;  3HKB B;  4GKJ O;  4AIL C;  3W7S A;  1M93 A;  3JAM N;  2IJK A;  4FLW A;  4UXN A;  4ZI7 B;  2K9P A;  2LGQ A;  2X0L A;  3JSL A;  4MTF A;  5B5E Z;  1Z5W A;  2Q4P A;  2Y4T A;  2L6L A;  1N8R W;  4Z2W A;  2YIB A;  2QJ1 A;  2E74 B;  4DR2 B;  4NB5 A;  5KHH A;  3QVN A;  1JR9 A;  3L70 H;  5LGU A;  2ZM6 O;  1HNX O;  4FVM A;  3K08 A;  4DR6 B;  1YVW A;  2CH7 A;  1WLE A;  3ZHQ A;  5JJN B;  1XHX A;  2DJV A;  1Q43 A;  4LF9 O;  2Z0A A;  2WAM A;  4B7E A;  2JDI G;  5F2V O;  4U7N A;  1KKD A;  5H6R A;  2ZT9 B;  1SA0 B;  4X89 A;  1IX9 A;  1AJP A;  2FKX A;  5B1A C;  3RGB A;  1YJW V;  1URF A;  2VQF B;  4NXN B;  3B40 A;  4LFC B;  4X62 B;  5C8Y A;  2FB5 A;  1ZWI C;  2XAH A;  3RYH A;  4P9P A;  1AR5 A;  4UCS A;  5LA6 B;  1G8M A;  1RM1 B;  3D3I A;  2YXY A;  1HP8 A;  3OFN G;  4DR2 O;  3K03 A;  3CPW U;  4CS3 A;  3CRR A;  3K9S A;  2ZE7 A;  2QR4 A;  5IJ9 B;  1E79 G;  1F7Y A;  1R3I C;  1AP5 A;  4OXS A;  5C93 A;  4PI0 A;  4W4K A;  1KQS U;  4DO2 A;  1S77 D;  1RP3 B;  4DR3 B;  2DE0 X;  2LFR A;  4J80 A;  3FYE B;  2JJ1 G;  5LXT A;  4LP8 A;  3CCL V;  4EKW A;  3P3P A;  1SQF A;  4I50 B;  5LBQ A;  3G80 A;  3CD6 V;  3UO2 A;  4W4L A;  3K3W A;  4JV5 O;  1MG1 A;  1S3J A;  1EBO A;  4I9Q A;  2LQT A;  3RFR A;  3VQW A;  2A0L A;  1QQC A;  3IJ4 A;  1KB9 F;  5IJ0 B;  4RWU A;  4HYO A;  3ZRX A;  1N32 O;  1PNM A;  1THZ A;  1BS3 A;  1COW G;  3OUF A;  5IYB O;  2Q5Z A;  1U97 A;  1BCC H;  1AB3 A;  4Q6G A;  1O9H A;  3A0B Z;  2UXN A;  4TQF A;  3T1Y O;  2WLL A;  2JEU A;  1XOU A;  4DR6 O;  1OCR C;  1GTO A;  1GH6 A;  1HNW B;  1PNL A;  3LDE A;  3H9V A;  1MOF A;  2YXL A;  2WPD G;  1BSM A;  4DV2 O;  2KKW A;  3STL C;  3BEH A;  5KUK A;  1OCZ C;  1JVM A;  2Z5U A;  2YUA A;  4CC5 A;  3ZS8 C;  1JMK C;  2QWP B;  4X1K B;  5BMV A;  1S5J A;  5EYP B;  1S0V A;  3L75 H;  4YJ3 B;  1V9P A;  4DUY B;  5GTI Z;  4PA7 A;  2BOC C;  3BVO A;  4KP4 A;  4H33 A;  4CBC A;  3JAS A;  4PI2 A;  1IBK O;  5LMU B;  3HKD B;  2N04 A;  3P32 A;  1SQP H;  1GKF A;  3LSS A;  1TA8 A;  4DV7 O;  3HKB A;  3FX7 A;  3T4D A;  1BQZ A;  1RFY A;  5FLX N;  2VS0 A;  3CME V;  1K8A W;  4L87 A;  2CTW A;  3CXC U;  2WWW A;  3WB1 A;  1KU9 A;  2CGN A;  4L8J A;  4NYK A;  4JI8 B;  2YSU B;  4YJ2 A;  3SDL A;  3E22 B;  5LYJ A;  1NI8 A;  4UB6 Z;  1JCH A;  5A2Q N;  5KX5 B;  3W7U A;  1NTM H;  5LOV A;  1V55 C;  2VWK A;  3HPL C;  4G28 B;  5GON B;  2RDC A;  2CUG A;  1DLB A;  3JAK A;  5B3S B;  1EN6 A;  3OT7 A;  2DOS A;  1KC8 W;  4B3M B;  3AG1 C;  5LA6 A;  1ZL8 A;  3EHB B;  5IYZ B;  4ZHQ A;  2XT9 A;  2W0F C;  3ASN B;  4DV1 O;  4AI8 A;  2EIM C;  4D6T H;  1YI2 V;  3DC6 A;  1H8H G;  1MZF A;  3B77 A;  3UT5 B;  4MVM A;  5L3E A;  3G67 A;  1GMG A;  1QR8 A;  1L8D A;  3RYC B;  1K97 A;  3BAB A;  1KKC A;  4J7K A;  4FM1 A;  1RPR A;  4IIJ B;  1AI5 A;  1NR7 A;  4J9Z B;  4Q20 A;  4X65 B;  2PYJ A;  3X2Q B;  1XBL A;  1VQ7 V;  1WP7 A;  1JJ2 U;  2X6B A;  1OCC B;  3ZCC A;  2QKC A;  1FFT B;  2E3C A;  1N33 B;  1YDX A;  4GKJ B;  4DV2 B;  3BAA A;  1I5Y A;  2KSD A;  3JD4 A;  2BOB C;  5LMN O;  4JI1 B;  3VQV A;  1GN2 A;  4LFB O;  2QTS A;  2DW4 A;  4DV4 B;  1VQ4 V;  2PGG A;  1WP8 A;  5GW7 A;  4YIO A;  2F95 B;  3L73 H;  2GDS A;  1QCE A;  4D7T A;  2RQ6 A;  1IDS A;  2WLK A;  1VF5 B;  2AHY A;  1VF7 A;  4JV5 B;  2AZ0 A;  1O9G A;  1W2B U;  3K5O A;  2DYR C;  1SQQ H;  4DV7 B;  2N74 A;  1US6 A;  5JWP A;  2QWN B;  4LF9 B;  1Z2G A;  3A0H Z;  1Y74 A;  1GN3 A;  1QLE C;  4TQD A;  1FXV A;  1P7B A;  4B3T O;  2UXD O;  1PKX A;  2BTO A;  3OGC C;  5IWA B;  2A9H A;  4HAM A;  3FB7 C;  4WBN B;  4DV6 O;  2B1I A;  5DEC A;  1VQL V;  1SQX H;  1P4R A;  1SER A;  2O57 A;  4LBE C;  2QA4 V;  1IBL O;  5J2T B;  2F4V B;  1AR4 A;  3B09 A;  4E2L A;  5D5P A;  1NZ6 A;  2QKS A;  2OCH A;  1M57 B;  3ZRW A;  4DR4 B;  4FIP C;  3APQ A;  3PN1 A;  3RYC A;  5EBM C;  4X64 O;  2P7T C;  1AVM A;  1G4Y B;  2F93 B;  4BW9 A;  4LF4 B;  4O4J A;  3CHX A;  1R73 A;  4B3R O;  3OEH G;  3QO7 A;  4GZR B;  5EIB D;  4D7S A;  3SPG A;  1B3Q A;  3CC2 V;  4DK0 A;  1HDJ A;  4IYI A;  1FS0 G;  1EN4 A;  5BR8 O;  4YY3 O;  3JCZ A;  3OW2 U;  3ZRV A;  5IYZ A;  1K34 A;  4NTX A;  1ZL8 B;  2OCC C;  4ZOL B;  1JJO A;  3UO3 A;  2ODM A;  3TCU A;  4B7K A;  2H94 A;  4MW3 A;  4LF5 B;  1GM7 A;  4I4T B;  3B8N A;  2CAZ C;  1K4C C;  1VQ6 V;  1N0N A;  2EZO A;  1GM8 A;  1X4T A;  5BY1 A;  3ICX A;  4JZG A;  4DXW A;  2YIA A;  4Z1M G;  2CK3 G;  1VP7 A;  5K1P A;  4GKK B;  3SYQ A;  3JAT A;  3QTC A;  4MVU A;  3E2E A;  1PV0 A;  1XL4 A;  2ZE8 A;  4GYC B;  2HHH B;  3F5W C;  4GKK O;  4P2Z A;  2Q69 A;  5H6Q A;  3TK1 A;  1KMI Z;  1Y66 A;  5KUM A;  1YZB A;  3IGA C;  4PA9 A;  3K5L A;  3HKD A;  4EEQ A;  1J5E B;  3RYH B;  1Q6U A;  5C8Y B;  1OV9 A;  2A79 B;  2YXH A;  1L1F A;  4O2B B;  3W7T A;  4YHH O;  1RM1 C;  2QM7 A;  2R70 A;  5BMV B;  5KAI Z;  1IBM O;  1PPJ H;  2OCC B;  3R65 A;  1DK1 A;  1G1X B;  1K4D C;  3OR7 C;  4JI2 B;  4JI3 B;  1G6U A;  1TUE B;  1KD1 W;  2X7R B;  4NTW A;  2R9I A;  1K5Q A;  1LR1 A;  4MTX A;  2QSA A;  5BR8 B;  2WA4 A;  4MVR A;  3SPJ A;  4QE7 A;  4QPK A;  4JI1 O;  1FFX A;  1P49 A;  1R6N A;  3JD3 A;  3R66 A;  1I94 O;  5EIB C;  4DV3 B;  5JVD B;  3CCV V;  4N21 A;  3QF7 A;  3KCX A;  1OCR B;  1Q90 D;  1MNG A;  1K92 A;  2Q8V A;  4JI8 O;  1S76 D;  4UCV A;  3SPC A;  2WSS G;  5IJ0 A;  2P67 A;  4QNH B;  4KUM A;  3CCQ V;  1NBM G;  4TV9 B;  1S72 V;  2F4V O;  1IZ3 A;  1JPX A;  3SPH A;  2OTL V;  5K1X A;  2XAJ A;  1W0K G;  4J11 A;  2PI4 A;  4FLY A;  1I0H A;  4EFB A;  3NXS A;  2A3Q A;  2CDY A;  1ZTE A;  4LH7 A;  3ZX6 A;  4JYB A;  2ARH A;  2FL4 A;  3LDC A;  4CH6 A;  1DGS A;  4PD4 F;  3LNM B;  3W7W A;  1YTF D;  1YIJ V;  3SJB C;  2BCC H;  4X66 O;  1M5I A;  3RYF B;  1SET A;  2UXB O;  1S5L Z;  1HNW O;  2EIJ C;  4C7U A;  2NR5 A;  2YIC A;  2UUA O;  2MW2 B;  1ZSP A;  4ZOL A;  1XI1 A;  5EC1 C;  2E5L B;  2RMK B;  4LF4 O;  3TXQ A;  1NU1 H;  1W59 A;  2EBO A;  3GWO A;  3WB0 A;  1YJ9 V;  3C3T A;  3CMA V;  4X64 B;  2VQE O;  4I55 A;  4O2B A;  2IBZ H;  3M7M X;  4AQY B;  4JI3 O;  2FYU H;  3ASO C;  1QVF U;  4ZHQ B;  3T2M A;  2QEX V;  4DR7 B;  3KG2 A;  2EX3 A;  1YEW A;  4UV9 A;  1ZX3 A;  1UPG A;  3IAY A;  1R6K A;  4O2A B;  2DWD C;  3T1H O;  3ZRW B;  3H1K H;  5FNV B;  4DR3 O;  1HR0 B;  4MVQ A;  4U3F H;  2AHZ A;  4X20 B;  4AHC A;  2WLI A;  3H1I H;  3CX5 F;  2ZKO A;  5KA6 A;  2HJD A;  2WLH A;  1GAX A;  4TOI A;  1FXK B;  1NT2 B;  2P90 A;  2OIE A;  1FKA O;  3EXA A;  4R50 A;  2JJ2 G;  2P5O A;  4DV0 O;  5CA1 A;  4MTO A;  3ABM C;  3K0G A;  4MT8 A;  3STZ C;  4CS2 A;  4R6Z A;  1NH2 D;  2LO1 A;  3ZMT A;  1I94 B;  2Z3Y A;  4YXW G;  5B3S C;  1Q6I A;  1AI4 A;  1NQT A;  4OPH A;  4UFZ A;  1WJZ A;  2B5U A;  4YJ3 A;  1FXH A;  2JGD B;  1D5A A;  3DTU B;  2GUZ B;  1F51 A;  3D36 A;  1KP2 A;  3ETQ A;  3I5D A;  4IT5 A;  3U10 A;  3BA8 A;  1J5E O;  4RUF A;  3N2G A;  3ZHV A;  1WPX A;  4WFB V;  2V7Q G;  1PM9 A;  4FMT A;  4I5S A;  5LP6 B;  3RVY A;  2UXB B;  5LL6 Y;  1N34 O;  4LNU A;  1LUW A;  2QWQ B;  5EZY A;  2W6I G;  4LF7 B;  4O4I A;  4JAV A;  4B3R B;  1BGY H;  2A7W A;  1L0L H;  3EFF K;  3P30 A;  2EIN B;  2WLL B;  1IXM A;  1MMM A;  2EIK C;  1CXZ B;  3L71 H;  1KBH A;  2XHB A;  4FM2 A;  3WU2 Z;  2ZR2 A;  3OTO B;  2PTM A;  3JAL B;  4O4H B;  1KEC A;  1H2S B;  5J2U B;  1TGO A;  1YCI A;  1H2M A;  3ABM B;  4JTC B;  3QO8 A;  2E75 B;  4O4L B;  3AG7 A;  1AJN A;  1HW7 A;  2WLM A;  1GRJ A;  3K57 A;  3F5T A;  3J7A U;  2Q7G A;  1A32 A;  1BL8 A;  2LJ2 A;  3N2G B;  3VQX A;  1PP9 H;  2BSK B;  2M6Y A;  5LXT B;  2PF4 E;  1GK9 A;  2HFE C;  2PYL A;  4QGP A;  2VQF O;  3DSQ A;  1GO3 F;  5ITZ A;  2ITC C;  4JI0 O;  5LMN B;  3AG4 C;  2Y0I A;  5BXZ A;  3OR6 C;  1QU7 A;  1ENV A;  2XAS A;  1S5H C;  2P22 C;  5CA1 B;  5CA0 B;  4A5U B;  5IJ9 A;  1Y67 A;  1UJW B;  1Q81 W;  4DR1 O;  5B1B B;  1GN6 A;  2RJZ A;  1V54 C;  1T5E A;  1EZJ A;  1LUV A;  1YHQ V;  3FFQ A;  4K0K O;  2R9A A;  3WG7 B;  4CH3 A;  2KG7 B;  2RNB A;  2Y48 A;  3AG4 B;  4OX9 O;  4JI7 O;  1FPO A;  4DW1 A;  2HP8 A;  2OYQ A;  1EN5 A;  2JS5 A;  5JJJ B;  4MSW C;  4X1Y B;  2IU0 A;  4X65 O;  2HKO A;  3JAS B;  4X9Q A;  3GB7 C; 
#chains in the Genus database with same CATH homology
 3DGE A;  1Q82 W;  3CCE V;  4QE9 A;  3ASN C;  5HFL A;  2QKS A;  5DN6 G;  1YJN V;  1M57 B;  3SYO A;  1VQK V;  3AG3 C;  3ZRW A;  3E8H A;  1F4N A;  2OT5 A;  1OCO B;  2ZXW C;  5IY5 B;  4FIP C;  1VQP V;  3E89 A;  4UVB A;  5EBM C;  1HWY A;  2P7T C;  1QLE B;  1CEZ A;  1G4Y B;  2EIL B;  3TET A;  1K3E A;  3OMN B;  3K0D A;  1PD3 A;  2V1D A;  1M57 C;  4MTG A;  4TT3 G;  3OUS A;  1R73 A;  2D3O W;  4WCE V;  2ZR3 A;  5LHG A;  3OEH G;  3OE7 G;  1JQ0 A;  2Y69 C;  5B1N A;  2IJH A;  1ARO P;  3QO7 A;  3ASO B;  3SPG A;  1OHH G;  3CC2 V;  1PNK A;  3LDD A;  1FS0 G;  3AG2 B;  3ETE A;  3JCZ A;  3FYI B;  3T1C A;  3OW2 U;  3ZRV A;  1J95 A;  1E1R G;  1OZ0 A;  1K34 A;  3JD2 A;  5EK0 A;  5DM6 V;  3CYO A;  4UVA A;  2OCC C;  1CP9 A;  1AI7 A;  3QO5 A;  3OEE G;  3ZN0 A;  2FTK A;  3AG3 B;  4TWK A;  3TCU A;  5B1O A;  4RQF A;  2WLJ A;  2H94 A;  4MW3 A;  4I9W A;  1GM7 A;  2IJJ A;  1W0J G;  4JTA B;  3B8N A;  1K9M W;  1OCZ B;  1K4C C;  1EFR G;  1VQ6 V;  2EZO A;  1GM8 A;  3JD1 A;  2OTJ V;  4GX1 A;  3CCU V;  1AJQ A;  2Y69 B;  3ABT A;  3LSQ A;  1QLN A;  5KUK A;  2EZP A;  2XAG A;  2ZD9 A;  1R3J C;  4DXW A;  3W7S A;  5LGT A;  2IJK A;  2XAF A;  4UXN A;  4Z1M G;  2CK3 G;  3SYQ A;  1NR1 A;  2X0L A;  4MVU A;  2X6A A;  4RQE A;  4MTF A;  4BAY A;  3E2E A;  3OAA G;  3K79 A;  1XL4 A;  5CN0 A;  2JIZ G;  3ML0 A;  2IW5 A;  3FB5 C;  3F5W C;  4GCZ A;  4WF9 V;  1K73 W;  4P2Z A;  4KFM A;  1N8R W;  3CCS V;  4F4L A;  1QVG U;  2Q69 A;  5H6Q A;  3TK1 A;  1Y66 A;  5KUM A;  1MAB G;  1JX9 A;  3ABL B;  3IGA C;  4PA9 A;  4PDL A;  3RVZ A;  2ZQM A;  3IFX A;  5LGU A;  2LP7 A;  1NH2 B;  3K08 A;  1M56 C;  4BIZ A;  3MHH C;  4MS2 A;  2A79 B;  1L1F A;  3G6E V;  1WLE A;  3I56 V;  1OCC C;  3W7T A;  4WFE A;  2QM7 A;  1RM1 C;  3ZMV A;  4XBF A;  2WAM A;  2B1G A;  4UV8 A;  1M90 W;  2OCC B;  3R65 A;  2JDI G;  1K4D C;  3OR7 C;  4U7N A;  2HR3 A;  1LNQ A;  1KKD A;  5H6R A;  1TUE B;  4PDR A;  1H38 A;  3JYC A;  2KB1 A;  1KD1 W;  2X7R B;  4LCU C;  2R9I A;  1K5Q A;  4X89 A;  4MTX A;  1ORQ C;  3F7Y C;  1JOY A;  1AJP A;  4X88 A;  5B1A C;  3ZMZ A;  4MVR A;  3CP1 A;  1GM9 A;  1YJW V;  2F43 G;  1DF5 A;  1NJI W;  3SPJ A;  1XL6 A;  4QE7 A;  1ZWI C;  2XAH A;  5LHI A;  4P9P A;  4QPK A;  3FB6 C;  1R6N A;  2HG5 C;  3JD3 A;  3CCV V;  4N21 A;  1G8M A;  1RM1 B;  1DF4 A;  5IDJ A;  4E2L A;  2P6J A;  1OCR B;  2C2A A;  3D3I A;  4FPP A;  1K92 A;  3JD0 A;  1F23 A;  3OFN G;  1S76 D;  2DYR B;  3K03 A;  4ASU G;  4GX0 A;  3CPW U;  1M1K W;  3SPC A;  2WSS G;  1BHB A;  2P67 A;  1CPY A;  2IJI A;  4QNH B;  4KUM A;  1E79 G;  3CCQ V;  2ITD C;  3AG1 B;  3UKM A;  4UUJ C;  1NBM G;  1R3I C;  3PJS K;  4OXS A;  5C93 A;  1S72 V;  1YTF B;  5J9P C;  2DYS C;  1K5S A;  2QTO A;  1KQS U;  1JPX A;  4WFG A;  4GX5 A;  2GHY A;  3SPH A;  4DO2 A;  2OTL V;  1S77 D;  2XAJ A;  1W0K G;  3MHS C;  5E1A C;  3X2Q C;  2LFR A;  2W6J G;  2PI4 A;  2DQ0 A;  3FYE B;  2JJ1 G;  3NXS A;  3CC4 V;  3ZN1 A;  4LP8 A;  4N23 A;  4R7C A;  3CCL V;  1H8E G;  4G2K A;  4EKW A;  3VBB A;  5LGN A;  3RW0 A;  4JYB A;  5LBQ A;  3CD6 V;  4JAS A;  3SYP A;  3VOU A;  3K3W A;  3I55 V;  1MG1 A;  1S3J A;  1EBO A;  2HJF C;  3LDC A;  3LNM B;  3E8F A;  3W7W A;  2A0L A;  1YTF D;  1YIJ V;  5CA3 A;  2NNU A;  2WLN A;  1QBZ A;  4HYO A;  3SPI A;  3ZRX A;  4MVS A;  1SET A;  1PNM A;  1THZ A;  1COW G;  3OUF A;  1VQ5 V;  5IYB O;  1R3K C;  4FJC C;  2EIJ C;  1E1Q G;  3OMA B;  3G4S V;  2UXN A;  4LC1 A;  1YIT V;  5EC1 C;  2WLL A;  2JEU A;  1VQN V;  5IY5 C;  1OCR C;  1GTO A;  2EBO A;  3GWO A;  1YJ9 V;  1AR1 B;  1PNL A;  3LDE A;  4WFF A;  3CMA V;  1MOF A;  3ETG A;  2WPD G;  3E86 A;  2H8P C;  1KP3 A;  2YEV A;  3M99 B;  3K9A A;  5CMU A;  3STL C;  3ASO C;  1QVF U;  3LUT B;  3BEH A;  1F4M A;  1OCZ C;  2HLD G;  5L3D A;  3T2M A;  1JVM A;  2Z5U A;  3ABL C;  3KG2 A;  2QEX V;  3ABU A;  5L3B A;  4UV9 A;  4GX2 A;  3CC7 V;  3CCM V;  1R6K A;  2R9R B;  2DWD C;  4TSF G;  3ZRW B;  1Q86 W;  1M9N A;  4JGS A;  1S0V A;  2LFS A;  4PA4 A;  3E35 A;  4JF3 A;  4MVQ A;  5H9C A;  2IH1 C;  3QNE A;  1AI6 A;  2BOC C;  4PA7 A;  1V54 B;  1VQ9 V;  3FB8 C;  4KP4 A;  4H33 A;  4CBC A;  1FXK C;  2AHZ A;  4JPR A;  3ZMS A;  4MW8 A;  2WLI A;  1QR9 A;  3P32 A;  3HB3 B;  1GKF A;  2Q68 A;  3LSS A;  4QPJ A;  5KA6 A;  2WLH A;  1DTO A;  3IC7 A;  2K1E A;  1Q7Y W;  2EJR A;  1SES A;  4FK5 C;  4JYC A;  5BZB A;  1FXK B;  5CBH A;  4GT1 A;  2Q6A A;  3T4D A;  1NVP B;  2NLJ C;  2P90 A;  5CBG A;  4R50 A;  3CME V;  2JJ2 G;  1K8A W;  4L87 A;  3CXC U;  2WWW A;  4MTO A;  2UXX A;  3ABM C;  3B8M A;  3K0G A;  4MT8 A;  3STZ C;  4R6Z A;  1NH2 D;  2YSU B;  1K7D A;  3E8B A;  3ZIA G;  1FXK A;  3ZMT A;  1VQO V;  4PA6 A;  3WFV A;  1MSW D;  1PL0 A;  4QIW F;  3W7X A;  1JCH A;  2Z3Y A;  4YXW G;  5B3S C;  3W7U A;  2PI5 A;  1V55 C;  4UVC A;  3G71 V;  5L3G A;  5FL7 G;  3HPL C;  4G28 B;  4PA3 A;  5L3C A;  4JAU A;  1AI4 A;  1NQT A;  1DLB A;  3SJQ C;  2B5U A;  1NVP D;  5B3S B;  1FXH A;  3DTU B;  2ZDI A;  2EIL C;  2X6C A;  4QJF B;  1KC8 W;  5LHH A;  1F51 A;  3D36 A;  1KP2 A;  2JK5 C;  3CCJ V;  3AG1 C;  4PDV A;  4RUF A;  1SZT A;  1WPX A;  4RO2 A;  2ATK C;  4WFB V;  2V7Q G;  2Q67 A;  5EBW C;  3EHB B;  3ZMU A;  4FMT A;  4I5S A;  3RVY A;  4H37 A;  2DQ3 A;  2HVJ C;  2W0F C;  3ASN B;  2YEV B;  2W6I G;  2EIN C;  2EIK B;  4JAV A;  2EIM C;  3SYA A;  1YI2 V;  2M7W A;  1H8H G;  1V55 B;  2GSM B;  3B77 A;  3EFF K;  4MVM A;  5CBF A;  1BHA A;  3P30 A;  5L3E A;  3ABK B;  3AEI A;  4JTD B;  1SRY A;  1GMG A;  2EIN B;  2WLL B;  1IXM A;  1M56 B;  1QR8 A;  5B1A B;  2EIK C;  5HFM A;  2ZR2 A;  3UM7 A;  1H2G A;  1K97 A;  3H01 A;  3K04 A;  2IU3 A;  3E8G A;  1RPR A;  1BMF G;  4X8A A;  1KEC A;  4P9O A;  1OCO C;  2ZXW B;  4PDM A;  3ABM B;  2XOK G;  1AI5 A;  4JTC B;  1NR7 A;  3E83 A;  3OM3 B;  2XAQ A;  3QO8 A;  4P30 A;  4J9Z B;  4Q20 A;  1RPO A;  2QM8 A;  3X2Q B;  1AJN A;  3CCR V;  2WLM A;  1VQ7 V;  1JJ2 U;  2X6B A;  1OCC B;  4MVO A;  3ZCC A;  1BL8 A;  5B1B C;  1YSC A;  4ZBM A;  4RAI A;  4HZ3 A;  1FFT B;  3SYC A;  4RUE A;  1GK9 A;  5IYC O;  3F7V C;  5EC2 C;  4J9Y B;  4WFA V;  1I5Y A;  2HFE C;  3A0R A;  3JD4 A;  4G27 B;  2BOB C;  1GO3 F;  5KA5 A;  2ITC C;  5L3F A;  2IH3 C;  4BIU A;  4PEL A;  3AG4 C;  2DW4 A;  1VQ4 V;  3OR6 C;  3ZRS A;  1R3L C;  2EIJ B;  1VQM V;  1ENV A;  5GW7 A;  4BW5 A;  2XAS A;  1S5H C;  4U7O A;  2XND G;  1UJW B;  1Q81 W;  2ZDI C;  1QCE A;  2DYS B;  4ZKI A;  2EIM B;  2WLK A;  2QE7 G;  2AHY A;  3AG2 C;  4WFH A;  5B1B B;  3T4Z A;  3OMI B;  1ROP A;  1V54 C;  2DWE C;  3MD0 A;  3ABK C;  3WG7 C;  1EZJ A;  1W2B U;  1YHQ V;  2DYR C;  1B6Q A;  2WLI B;  1QLE C;  5EBL C;  1FXV A;  1P7B A;  2HVK C;  3K06 A;  3WG7 B;  1PKX A;  4R8C A;  3OGC C;  4XDL A;  3BY6 A;  4MVZ A;  2A9H A;  2Y48 A;  4HAM A;  3AG4 B;  3FB7 C;  4XDK A;  3ZJZ A;  5IYD O;  1VQL V;  2B1I A;  4XDJ A;  1K33 A;  1Y4M A;  3FKS G;  2JEX A;  3ETD A;  4MSW C;  1P4R A;  1SER A;  2IU0 A;  2MK3 A;  4LBE C;  2HKO A;  2QA4 V;  1VQ8 V;  4CZZ A;  3RBZ A;  1I5X A;  3GB7 C;  1NKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...