1GMGA

Alanine 31 proline mutant of rop protein, monoclinic form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN ROP
publication title Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 23
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gmgA00
3K79A 1ROPA 1F4MA 1PD3A 1GTOA 1RPOA 2IJKA 2IJJA 2GHYA 1GMGA 1F4NA 1NKDA 2IJHA 1B6QA 1RPRA 4DO2A 2IJIA
chains in the Genus database with same CATH superfamily
1I5XA 2DQ3A 4CH3A 3AG3C 1N32B 3FAVA 3VQVA 2BTQA 5EK0A 3RWRD 1LUWA 5EYPA 2X6AA 1VARA 4TQFA 3CXCU 1J5EO 5DECA 1WP7A 1F51A 4JI1O 1P4RA 3K03A 2UXNA 5LA6A 3A0HZ 5LGNA 3MHHC 1VQ6V 3DC6A 1H2LA 2ZR2A 4FLTA 5IT9N 4NTXA 3A2FA 2CE4A 5KMGA 4OX9O 4GUNA 3JAKA 1PL0A 1Z5VA 5LGTA 1KECA 2EBOA 2DJVA 1H2NA 1ENVA 3UT5B 1BMFG 4WFHA 4G2KA 4ZHQA 2OYQA 4J42A 4U3JB 1VQMV 1UJWB 3E22B 2IU3A 2PI5A 1ZWIC 3F7YC 2QKSA 2Q4PA 3CPWU 4DR4B 5B1AB 1FFTB 4XDJA 5DN6G 1Q5OA 3QO7A 4MW8A 4X62O 1HR0O 2EIMC 4DW1A 3BVOA 4YJ3B 1ZTEA 2VQEB 1Q81W 1JA8A 5LXTB 1SQFA 3G80A 1R3KC 5J2UA 3JALA 3QF7A 4LFBB 2Y69C 2JEXA 3CD6V 1VF6A 5FNVB 2FKXA 4OGQB 4UB8Z 1AI5A 1VQ9V 2X6BA 4JI5B 4O4HB 3K5OA 1IDSA 3GWOA 4F4LA 1I5YA 4RAIA 5FL7G 2ZD9A 4PA3A 1K33A 2XAFA 1FXKC 4EB6A 1WPXA 1HNXO 2NLJC 2F1MA 4Q6GA 5LHGA 3W7TA 5J2TB 3C3SA 1W59A 4XBFA 5CB4A 1N0JA 1N36B 2FTKA 4DK0A 1KKCA 5IYZA 1GAXA 1LR1A 4EFEA 2WA4A 4TT3G 3N2KA 1KC8W 1KMIZ 4JI4O 3RFRA 1ZL8A 4LH7A 3H1LH 5CN0A 4F6RA 4TV9A 4NTYA 1OV9A 1AVMA 4LFAO 2H8PC 3ICXA 2UUAB 1SZXA 1QLNA 5AG2A 3CB2A 2UU9B 1WN7A 3CS5A 1XUQA 4JI7O 1NBMG 2RNBA 1JVMA 1NH2B 1QBZA 4LF8O 4DR3O 1GTOA 2ADQB 4JZGA 5GONB 1SS3A 5EBWC 2EIMB 1X4TA 2WLKA 2VQFB 4FLZA 3K04A 3CCVV 2RN9A 2X6CA 2UXCO 4FM0A 2FMLA 1RPRA 1EFRG 2Y4TA 1AI6A 1MZFA 4UCOA 2Y69B 4H33A 2X7RB 2HJFC 1QCEA 1A32A 2XAQA 3OEHG 2W0FC 3OUSA 3E35A 4K8XA 3SDLA 1AP6A 2CGNA 3ZRSA 3D3QA 3HKEB 3G6BA 1EM1A 4HAMA 4R7CA 4H37A 3LNNA 5EIBC 3E86A 1E1QG 4H44B 3T1CA 5JVDB 3JD3A 1VF6C 4JV5B 4FLVA 4KFMA 2DYSC 2F66C 5B1NA 4IYIA 1N8RW 2PYJA 4RUEA 2GHYA 3PJSK 2BTQB 1S5HC 5EYPB 2Z3YA 5JCOA 1P7BA 4B7KA 3OR6C 4P30A 4FZ1A 1XNRO 1JMKC 1SERA 2ZCEA 4JGSA 4WFBV 4DV3B 4BAYA 1ZLZA 5HFLA 5LA6B 2KG7A 3G6EV 4X8AA 3FB8C 1JJ2U 1JFFA 1OCZC 3B8MA 3FD9A 3FFQA 3S3WA 4GX0A 2W6JG 5KMGB 5EBLC 4JPRA 3ZN1A 1J5EB 4W4LA 3WB0A 1NR7A 1UFIA 4JI1B 4P9OA 1RSOA 2FYUH 2UUBO 3OAAG 4LH6A 4PI0A 1FXVA 1S77D 4O4IA 4JI2O 5LHIA 4ZHQB 3T1HO 1PNMA 2ARHA 4CS3A 4OX9B 2IH1C 3R66A 4IYHA 2RCVA 1YF2A 4FK5C 5A2QN 3ETEA 1N32O 1FXHA 2Q7GA 5C93A 3HKBB 1B06A 3F5WC 5J9PC 2GDSA 2JVDA 5KHJA 1TGOA 4QPJA 3TXQA 3JASA 2H94A 4O4LA 1QVFU 1VQKV 1YEWA 4FLXA 3GVMA 2AHYA 2ILMA 5J2UB 2WAMA 3JALB 5H5NA 3THOA 1MZEA 2PGGA 3LDCA 3T2MA 3OTFA 4E4EA 3JAMN 3KCYA 4B7EA 3CEIA 1M5IA 2DYSB 4X62B 3ETGA 1HR0B 3BA8A 2IJHA 3SYAA 1PNKA 4HYOA 3CC4V 2XUMA 1GN3A 1Z5WA 2KQXA 4UCRA 1GRJA 4RQFA 1JPXA 5JJJB 4EB6B 1R3LC 4DK1A 1S5JA 4TUYA 3CC7V 2QM8A 2LFRA 3ZIAG 5IJ0A 2VWJA 1OCZB 2Q0AA 5CB4B 1M93A 1NTKH 2JS3A 2P90A 1EN4A 1PKXA 2ZXWB 3JSLA 4FLUA 1VEWA 5IYZB 1F23A 5KHGA 5A9GA 1GKFA 1T5EA 2XAHA 3N2KB 1EZVH 1VQ8V 1AROP 2FB5A 1K73W 3C90A 1HNXB 4F6RB 4TV9B 2QWPB 5LYJA 2LGWA 3X2QB 1IBLO 4WF9V 4DR2O 2M6YA 4DR6O 4FIPC 2QEXV 1BE3H 1TAEA 1XBLA 2DOSA 3K5LA 2QA4V 3MAQA 1BT8A 4UXNA 3ZHUA 1H38A 3CJHA 2EZOA 1ZUQA 4CBCA 5KUKA 1IBMO 1NQTA 5IYCO 4LFAB 3CXHF 3CRRA 1K97A 3RYHA 4GYCB 2QTOA 2HHHO 3G71V 3VQYA 4JI7B 3RYCA 3A0BZ 1AJNA 2DWEC 4I5SA 4LNUA 4NVPA 4LF8B 1RM1C 4DR3B 2PUSA 2ADPA 2W0XA 2PY5A 1VMGA 2XASA 4UFZA 5KHIA 3O9OA 1DLBA 3LSSA 1K92A 3K08A 5GTHZ 3ASNC 5BMVA 1JQ0A 2UXCB 2OCCC 2B5UA 4LWSA 2OTJV 4IGGA 4DYLA 1WA8B 4JASA 3UKMA 4C7UA 3STLC 1IZ3A 4X1YA 1XMOO 3D36A 1V54C 4JAAA 2H3OA 2F93B 4G28B 3K9SA 2BTOA 3ABMC 4ZI7A 3ETDA 3IC7A 5H6QA 5KHKA 4B08A 1FJGO 3T4ZA 1DF4A 5IWAO 5E79Z 1VIBA 2Q69A 2KG7B 1IVSA 1W0KG 2HFEC 2JS5A 1JFFB 1QNMA 4LC1A 1TUBB 5CBFA 4W4KA 2LP7A 2AW9A 5ITZA 1XNRB 5CA0B 2BSKA 1US6A 3TETA 1UPGA 2CGOA 3SYPA 1YTFB 3WG7C 2LGQA 1M56C 1RSOB 5IE9A 2HVJC 4O4IB 2QSAA 4DV6O 1OZ0A 1G6UA 3ZHTA 4DV2B 1PM9A 3AG7A 4MW3A 5K1PA 4I0XB 3H1HH 2UUBB 5LGUA 4K3AA 1R3JC 4WBNA 1OCOB 4O4LB 1XL6A 3T1HB 2R9AA 4QNHB 4QE7A 4YY3O 3N2GA 2CTQA 2JRIA 4ICGA 2YSUB 3ASNB 4HNAB 2OCCB 4J7KA 5B1OA 1R6NA 3H1IH 4LF9O 4WCEV 1VP7A 4PJ0Z 3RVZA 3P3NA 4BR6A 1V54B 2GUZA 1SQGA 2QR4A 3ABMB 1CP9A 4I7ZB 1N0NA 2YDEA 2JEUA 1OCRB 1L8DA 1RFYA 2A7WA 2DE0X 3JD1A 4WFEA 4KXRA 4DR5O 4NXMO 4BWAA 4LF5O 3D36C 4MSWC 4TUYB 4NB5A 3UCSC 3CE2A 1M90W 5IJ0B 1IURA 1HW7A 1YHQV 4NXNO 1Q6IA 2R70A 4ZOLA 1PPJH 2YIBA 2OT5A 3P30A 3QNEA 5IJ9A 2QWOB 4FFKA 1K9MW 3WG7B 1VF7A 2VS0A 5EZYA 1M56B 3HPLC 1R1BA 3SPGA 4PA6A 4CZZA 2C2AA 2V4DA 5CA1A 2Y4UA 4X66O 4JTDB 1AP5A 2F4VO 4UV9A 2WLJA 4MVUA 1WNSA 3D8CA 3OW2U 3O65A 1Y67A 3VOUA 3G4SV 1S72V 4EKWA 2MW2B 3L71H 3T4DA 2CUGA 4DW0A 4O4JA 3CJHB 4J7JA 5FPOA 2XNDG 3KG2A 3OMNB 1IBLB 3R65A 1COWG 1WAZA 3ZN0A 4DR2B 4DR6B 3RYHB 5LBQA 4DV0O 3J80N 4JTCB 1WJZA 4JAUA 3K57A 4GX2A 4QJFB 2JIZG 5DM6V 3RYCB 3CMEV 2D3OW 4LNUB 1ROPA 2QM4A 1G1XB 4A5UB 1IBMB 1DTOA 4FVMA 4I9WA 5JQGA 4MTOA 1YXBA 1EBOA 3CRQA 1YJNV 1BQ0A 3LDDA 5EC2C 3I5DA 1P7GA 2HHHB 1R73A 2AHZA 3B77A 3HB3B 4LWSB 5IDJA 4BW9A 3ZRWA 2JK5C 2YICA 3OTOO 4FFBA 1B3QA 4LFCB 1H2KA 4F6EA 3BCCH 1GK9A 3SJCC 2UUCO 2ZE6A 3TXSA 2CTRA 4ZI7B 2QWRB 3BRCA 1R6KA 3SPHA 3OFNG 1HNWB 3J7AU 5IYBO 2E76B 1SQPH 1XMOB 3CCEV 3K0DA 2OCHA 1JR9A 3LDEA 3ABKC 2GSMB 4KP4A 3SPCA 4UCSA 3SJQC 2YXHA 5ITZB 5L3EA 1FJGB 2BSKB 3EHBB 2LW1A 4J9YB 1SQBH 1SRYA 2QJ1A 2A06H 5IWAB 3K5NA 2ZIOA 1L1FA 4HBNA 4WFFA 1KBHA 3ASOC 3LNMB 3E83A 1V55C 2Q9LA 4IHJA 5LOVA 4QGPA 2EIJC 2P6JA 2A79B 4JYYA 2UXDO 1M57C 5CBHA 2VWKA 3L72H 3ZCCA 2DWDC 3H1KH 4LCUC 1QR8A 2LW7A 3FX7A 4MVSA 2GBOA 3ZBHA 3LSUA 2L6LA 4UCTA 2Q67A 4DV6B 2ZE5A 2DN9A 4B3RO 4I9QA 4X1IA 1NS1A 2BE3A 3DC5A 2JGDA 2KB1A 3N2GB 4MTXA 2XHBA 3FAVB 4LF4B 3JYCA 1F4MA 1CEZA 1Y74A 3DXRA 1YI2V 1TA8A 4TV8A 3ZHRA 2DYRC 3BPZA 1R6TA 1M9NA 3ZJZA 3HKCA 4FJCC 1XMQO 3EFFK 2P4VA 1G8MA 1BGYH 2GUZB 2OIGA 4YY3B 1L0LH 3P32A 1ZX3A 2R9IA 2YXLA 4TWKA 3K0GA 3VQXA 1K8AW 3SJBC 2ZXWC 4NTWA 1XDCA 4LF9B 1OHHG 4DV2O 1TVKA 1QLEC 4CC6A 3JAKB 4J41A 2YXYA 4FM1A 3IGAC 3FB5C 1BL8A 2CDYA 3SYOA 2CH7A 3APOA 3LUTB 1BHAA 3ETQA 4JI3B 3X2QC 3M7MX 3L75H 2EULA 3ABKB 4H0LB 2EJ7A 4UV8A 2ZNIA 4ZOLB 2IJJA 3RVYA 5IJ9B 3MHSC 1Q43A 4DR5B 4R50A 1QHTA 3E89A 2XAJA 2NNUA 5EZYB 3OE7G 4NXMB 1QU7A 4LF5B 3ASOB 4UVBA 3TCUA 3TJTA 1V55B 2P4KA 3APQA 2AGAA 2LO1A 3HKDA 5CA1B 4NXNB 3BEHA 2EIJB 2CTWA 4I50A 3F7VC 1GM8A 1NVPB 1M57B 4E2LA 3JD2A 2Q0OC 3SYQA 3UO3A 1B6QA 1K5SA 4O4JB 1W0JG 3ABLC 2Z5UA 4ASUG 5B5EZ 1XHXA 5D5PA 2A3QA 4MVZA 4U7OA 1SQXH 4K8ZA 3ABUA 4X66B 2Z0AA 2F4VB 3AK1A 1WB7A 1XL4A 3ZMSA 4D7TA 5C8YA 2HR3A 4CH6A 3CYOA 1Y4MA 3U11A 2UXBO 3QTCA 1EN5A 2ZINA 3CHXA 2DYRB 2RDCA 3I56V 5JJEB 3G67A 1AR5A 1RPOA 2BOBC 5JQGB 1NH2D 3E8HA 2Y48A 4DV0B 4BIOA 1XILA 4PDVA 3K9AA 2Q73A 2WLLA 2ETNA 1XEQA 1YITV 3CCJV 1BQZA 2P7TC 5JCOC 3JD4A 1QLEB 1GO3F 4QIWF 1YJ9V 1MSDA 1YSCA 2Y0IA 1ZL8B 2EINC 3P3PA 2EX3A 3UT5A 4IL6Z 5D5QA 4R8CA 2Q6AA 4J9ZB 1D5NA 2DQ0A 3WFVA 2JJ2G 5L3FA 5L3BA 3KZIZ 1JOYA 3OTOB 2B9ZA 2ZDIA 3WB2A 5HFMA 4PA7A 3ZX6A 3ZS8C 2QM7A 3ML0A 1S0VA 2UUCB 3RYFA 3SYCA 4PA4A 4PA9A 1GM9A 2XT9A 4LR3A 1E1RG 3A8TA 1FPOA 5L3CA 5LXTA 3K59A 1E79G 2DMXA 1SQQH 3ABLB 1S76D 4PDRA 4K35A 4LFCO 4IHJB 5LOVB 1OCOC 2W6IG 1F7YA 1BCCH 2ZNJA 3FKSG 1YIJV 4XDKA 3ZEDA 1D2DA 5JH7A 3JSNA 1VQNV 1XREA 1VQPV 2CAZC 5CA3A 1DK1A 2K9PA 2GTAA 1HNWO 5BR8O 5H2FZ 4U7NA 2CTPA 2OWOA 4I4TA 4N21A 2JGDB 2Y0PA 1ORQC 2QKAA 2UXDB 3HR0A 2ZE8A 3CWBH 3CP1A 2K1EA 4DUYO 1Y74B 4TV8B 1MNGA 1OCRC 3JCZA 1O9HA 3HKCB 3AG4C 4RWUA 3C3TA 3GWKC 2EINB 2M7WA 4JYCA 3RYIA 5FLXN 2L35A 4B3RB 1AI7A 1JX9A 3JATA 3SPIA 5LHHA 4X9QA 4JI6O 3H9VA 5KA5A 1TVKB 1ZSPA 2PI4A 1GN4A 4QPKA 3E2EA 4DV7O 1SETA 4MT8A 5EIBD 1XMQB 4PV1B 3IAYA 4BIUA 4I55A 1H8HG 4WFAV 4X20A 2YS8A 4J7ZA 1XI1A 3OGIB 2LJ2A 4O2BA 1Z2GA 3TGUH 4FPPA 1J95A 4YJ2A 1MSWD 2ZDIC 1R3IC 4JI0O 1B04A 4LF4O 2HLDG 3B2EE 5LL6Y 2D2CB 1I08A 4TSFG 3JCUZ 3VBBA 3JASB 1XNQO 1YCIA 3HKDB 4JYBA 2WLHA 5H6RA 5BXZA 2IU0A 4NR1A 1PP9H 4BW5A 1Q8IA 3L70H 4X64O 3CMAV 2BOCC 2N74A 1SF9A 1Q90D 4IT5A 3CCUV 4FZ0A 1FXKA 4WFGA 4DV4O 4AQYO 5F2VO 2KKWA 3CCMV 4JI3O 4UUJC 3L73H 5C8YB 4KL1A 3A0RA 1O9GA 3OUFA 4DRXA 4B3MO 3L9DA 4JYAB 5K1XA 1NZ6A 1EN6A 3AG4B 3E8GA 2PYLA 1TUEB 1PV0A 5LP6A 1H2MA 2P06A 3I55V 1S5LZ 1YZBA 3NXSA 3JD0A 3MDSA 4MTFA 4JTAB 4CH4A 2WLLB 2YIDA 3QO5A 1BZKA 5B3SB 1IX9A 2UXBB 3BABA 1Q6UA 3QG5A 3WU2Z 4J11A 4KHPO 1AR4A 2ZT9B 4OXSA 3OM3B 1KD1W 5LYJB 1L0NH 4UCUA 1WPBA 3FYIB 4DV5O 2IH3C 5B1BC 1FAFA 2LQTA 1NJIW 1MG1A 4LF7O 4FLYA 1Y76A 1FFXA 3D3IA 3RN4A 3CCSV 1I94O 4YIOA 4MS2A 3CC2V 3HKBA 1IXMA 3RYFB 1AB3A 2ZIMA 3CCRV 4NKGB 3W7WA 4AI8A 2ZR3A 3K5MA 3H01A 2A9HA 3AG1C 3U10A 5IY5B 3W7SA 1GH6A 2EILB 4JI8B 3OMAB 4GLXA 4GZRB 2PZSA 1SA0A 4RUFA 1P84F 1M1KW 4X1KA 2IM9A 2P22C 4DV1O 4DO2A 3N27A 3VQWA 2GTSA 3FYEB 1WP8A 3DSQA 5KLVH 2YI8A 4O2AA 3AG3B 3IFXA 3SR2C 1JCHA 5BMVB 5JH7B 2ZM6O 4L8JA 1AJPA 3E8FA 4EFBA 4LP8A 1HNZO 3AK2A 4YHHO 1YTFD 5IYDO 1K4DC 4TQDA 5BZBA 4X1YB 4ZIBA 4U3FH 5B66Z 4I4TB 3Q4HA 3CCLV 1PNLA 1H2SB 3FB6C 4QE9A 2PTMA 3H1JH 1BS3A 3SJAC 1YVWA 3KKYA 3ZMZA 1SQVH 1WLEA 5KX5A 2NR5A 5L3GA 5BR8B 1KQSU 3CRAA 5LP6C 3RYIB 1NR1A 4GKKB 3JATB 1NTZH 2ZE7A 3AG2C 5B1BB 2XOKG 2HEPA 4AHCA 5GW7A 4DUYB 2F95B 2HJDA 2UXXA 1XQ8A 2DW4A 4CC5A 1BSMA 3DGEA 5BY1A 4UVCA 1GN2A 2WLIA 4I55B 1RP3B 3ZMVA 1IXBA 4X20B 2B1GA 4JI6B 4J10A 4GCZA 4O2BB 3ABTA 3AG1B 5KA6A 4DR7O 4X65O 2E3CA 3RT3C 4K0KO 4YJ2B 2R72A 4DV7B 2OTLV 1GMGA 3EVKA 1AILA 1N34O 2FL4A 3B40A 4PD4F 2A0LA 4WBNB 4B3TO 1KYOF 4MTGA 4UVAA 4G27B 5DEDA 1URFA 1VQOV 3CRCA 4H13B 2V7QG 2PF4E 4Z1MG 3IJ4A 4FLWA 4JI0B 1U97A 2YEVA 2HG5C 2YC0A 4GT1A 4DUZO 3CSXA 1KU9A 1H2GA 1KP3A 4PELA 2JJ1G 4B3SO 3RBZA 1WA8A 5LMUO 4TOIA 4P9PA 2WWWA 2Q68A 4FM2A 1XNQB 1AJQA 1FXKB 4N23A 1QVGU 1U96A 4DR1O 1XHZA 2Q7HA 4GKJB 1VQLV 5GTIZ 1K4CC 1I7FA 1LNQA 4X64B 1YJWV 4DRXB 2AZ2A 1V9PA 4LF6O 3JAWA 3OMIB 2IJKA 2NN4A 5LP6B 2CK3G 3J81N 3UO2A 4DV4B 4AQYB 2HP8A 5L3DA 1LUVA 3OGCC 2P5OA 2YUAA 4IIJA 3AG2B 1TUBA 4ZBMA 1N33O 1MABG 5TISZ 3U0ZA 4B3MB 5KAIZ 1VF5B 5CA0A 2P67A 3B4SA 4J80A 1K7DA 3T1YO 1H8EG 2QE7G 5CBGA 5H9CA 2BCCH 3ZRXA 3BFRA 1OJHA 4CH5A 4ABMA 5LMNO 3WB1A 4R6ZA 1DF5A 3JARA 3B09A 4UCVA 1IBKO 2E5LO 1NI8A 1FD9A 1Y66A 5JWPA 3BA9A 5JJNB 2AXTZ 3LSQA 1Y76B 3S3XA 1MA1A 1FFXB 1HP8A 3OD4A 4I0XA 4KHPB 1G4YB 3FB7C 1PD3A 3ZRVA 4JYAO 4DV5B 1THZA 3EXAA 2WPDG 3STZC 2EJRA 4JAVA 4LF7B 4ZKIA 3BAAA 2QWQB 4YXWG 1I94B 2Q5ZA 3K58A 4HNAA 1KP2A 1SA0B 3AK3A 2EIKC 1S3JA 4X1KB 3L74H 1FKAO 3QO8A 1Q6HA 1K5QA 1NU1H 2QDOA 3BHPA 3CRMA 3NR7A 4D7SA 3B8NA 2OIEA 1KUQA 1YDXA 4O2AB 5KHHA 2VRZA 3QVNA 1W2BU 3M8AA 4GX5A 2XAGA 3ZRWB 4MVMA 4GX1A 4MVRA 4FFBB 4DV1B 1SESA 3UQ8A 1CXZB 3E8BA 1NKDA 3OEEG 1Q82W 3Q4HB 1M4UA 2WLNA 4DR4O 2JGUA 3CCQV 2ZM6B 2YI9A 1ZAUA 4MVQA 4RO2A 5E1AC 3ZHVA 1NTMH 1HNZB 4YHHB 5KX5B 2QKCA 4Z2WA 1HWYA 4U3JA 1KKDA 2HVKC 3E22A 4JI8O 1GN6A 2VQEO 3PN1A 4Q20A 4FMTA 4CS2A 4LFBO 1N4CA 4PHZA 1FS0G 2QGNA 3IC9A 2ITCC 1HDJA 2MK3A 4YJ3A 4JI4B 1Y6XA 4JI5O 1VQ4V 2KSDA 2RMKB 2WLIB 4EEQA 1OCCC 4HZ3A 2Q8VA 4XDLA 1FYJA 3DTUB 5FNVA 2Q7EA 1SKVA 1QR9A 3K3WA 1GM7A 1AR1B 2G38A 1K3EA 4JZ2A 1SZTA 4KUMA 1N36O 2ATKC 4YIPA 2GV9A 1Q7YW 2ZKOA 2EIKB 4O4HA 2ITDC 3ZHQA 2V1DA 1WB8A 4JF3A 1I0HA 3ZMUA 2AZ0A 1NT2B 1SC5B 4PI2A 3SPJA 4X1IB 4DR7B 4X65B 4AILC 4GKKO 4K0KB 5J2TA 2RJZA 5FPRA 2ODMA 2YEVB 2YIAA 2YIBD 3OT7A 2E74B 3K06A 2IJIA 2QTSA 3DXRB 2UUAO 1N34B 3CX5F 4NYKA 1XOUA 3K79A 4B3TB 2IW5A 2WA3A 4LBEC 2LFSA 2UU9O 5KAFZ 4OPAA 2QWNB 1Q86W 4BIZA 3AEIA 4DUZB 2HKOA 4L87A 5KUMA 5B3SC 1NVPD 3W7UA 2VQFO 1JJOA 4B3SB 4PDLA 5LMUB 3JAWB 4PDMA 1DGSA 2ZQMA 3ZMTA 4P2ZA 1VQ5V 3KCXA 3GB7C 3ZHSA 4RQEA 4DR1B 1K34A 3UM7A 2CH7B 4DXWA 2N05A 2WSSG 4IIJB 4OPHA 2O57A 1EZJA 3OR7C 5GONA 2R9RB 4D6TH 1P49A 4LF6B 1BHBA 3RGBA 3W7XA 5EC1C 2RQ6A 2X0LA 3RW0A 3F5TA 1KB9F 2IBZH 1OCCB 2F23A 3BY6A 4X88A 4UB6Z 1Q3EA 5B1AC 4JV5O 2JDIG 1N33B 3JARB 3SGIA 2F43G 4I50B 5CMUA 5IY5C 4GKJO 4X89A 1MMMA 1D5AA 2EILC 3M99B 3T1YB 3TK1A 3MD0A 2EZPA 3HKEA 1AI4A 1VQ7V 1F4NA 2XTAA 4CS4A 1CPYA 2E75B 1X59A 1RM1B 5LMNB 5JVDA 4JI2B 5EBMC 2N04A 4DV3O 1PL4A 1IBKB 2E5LB 1MOFA 2WLMA 4Z1VA 1QQCA 2B1IA 4MVOA
chains in the Genus database with same CATH topology
1K97A 1I5XA 2DQ3A 4UV8A 2IJJA 3AG3C 3FB6C 4QE9A 3RVYA 3MHSC 5EK0A 2QTOA 3ZMZA 1WLEA 3G71V 2X6AA 4R50A 3E89A 2XAJA 2NNUA 5L3GA 1AJNA 2DWEC 3OE7G 4I5SA 1KQSU 3ASOB 4UVBA 3TCUA 3CXCU 1RM1C 1V55B 1F51A 1NR1A 1P4RA 3K03A 2XASA 2UXNA 3AG2C 5B1BB 2XOKG 3BEHA 2EIJB 1DLBA 3LSSA 1K92A 5LGNA 3MHHC 1VQ6V 5GW7A 3K08A 3ASNC 2ZR2A 3F7VC 1GM8A 1JQ0A 1NVPB 1M57B 2UXXA 4E2LA 2OCCC 2B5UA 2DW4A 3JD2A 3SYQA 2OTJV 3DGEA 1B6QA 1K5SA 4JASA 1W0JG 3ABLC 2Z5UA 4UVCA 3UKMA 4ASUG 2WLIA 1PL0A 3STLC 5LGTA 1KECA 3ZMVA 4MVZA 2B1GA 4U7OA 2EBOA 1V54C 3D36A 4GCZA 3ABUA 1ENVA 1BMFG 3ABTA 4WFHA 1XL4A 4G28B 3ABMC 3AG1B 4G2KA 5KA6A 3ETDA 3IC7A 3ZMSA 5H6QA 2HR3A 1VQMV 1UJWB 3CYOA 1Y4MA 2OTLV 2IU3A 1GMGA 3T4ZA 2DYRB 1DF4A 3I56V 2PI5A 1RPOA 2A0LA 2BOBC 1ZWIC 3F7YC 2QKSA 4MTGA 2Q69A 3CPWU 4UVAA 3E8HA 1NH2D 2Y48A 4G27B 5B1AB 1FFTB 1W0KG 2HFEC 1VQOV 4XDJA 5DN6G 4LC1A 4PDVA 3K9AA 3QO7A 4MW8A 5CBFA 2V7QG 2EIMC 2WLLA 4Z1MG 2LP7A 1YITV 2YEVA 3CCJV 2HG5C 4GT1A 2P7TC 3JD4A 1Q81W 3TETA 3SYPA 1R3KC 1H2GA 1KP3A 1QLEB 4PELA 3WG7C 1YTFB 1GO3F 2JJ1G 4QIWF 3RBZA 1M56C 4P9PA 1YJ9V 2WWWA 2Q68A 2Y69C 1YSCA 2JEXA 2EINC 2HVJC 3CD6V 1AJQA 1FXKB 4N23A 1QVGU 1VQLV 4MVOA 1K4CC 4R8CA 2Q6AA 1OZ0A 4J9ZB 1AI5A 1LNQA 1VQ9V 2DQ0A 3WFVA 2JJ2G 2X6BA 5L3FA 5L3BA 4MW3A 1YJWV 1JOYA 2ZDIA 3OMIB 5HFMA 4PA7A 3GWOA 5LGUA 2QM7A 2IJKA 4F4LA 1I5YA 2CK3G 4RAIA 1R3JC 3ML0A 5FL7G 2ZD9A 1S0VA 4PA3A 1K33A 2XAFA 1FXKC 1OCOB 5L3DA 1WPXA 3SYCA 1XL6A 4PA4A 2NLJC 3OGCC 4QNHB 4QE7A 5LHGA 3AG2B 3W7TA 4XBFA 4ZBMA 4PA9A 1GM9A 1MABG 2YSUB 3ASNB 2FTKA 1E1RG 2OCCB 2P67A 5L3CA 5B1OA 1K7DA 1R6NA 4TT3G 1E79G 1H8EG 2QE7G 5CBGA 4WCEV 3ABLB 5H9CA 1KC8W 3ZRXA 1S76D 4PDRA 3RVZA 5CN0A 1OCOC 1V54B 2W6IG 4R6ZA 1DF5A 3ABMB 1CP9A 3FKSG 1YIJV 1Y66A 4XDKA 3LSQA 2H8PC 1QLNA 2JEUA 1VQNV 1OCRB 1VQPV 1G4YB 5CA3A 3FB7C 3JD1A 4WFEA 1PD3A 1NBMG 3ZRVA 1JVMA 1THZA 1NH2B 4MSWC 1QBZA 4U7NA 1GTOA 2WPDG 3STZC 1M90W 2EJRA 4JAVA 4N21A 1ORQC 5EBWC 2EIMB 1YHQV 2WLKA 4ZKIA 3K04A 4YXWG 2OT5A 3CCVV 3CP1A 3P30A 2K1EA 1KP2A 3QNEA 2X6CA 1K9MW 1OCRC 2EIKC 3WG7B 1RPRA 3JCZA 1S3JA 1EFRG 1AI6A 3AG4C 3QO8A 1M56B 2Y69B 3HPLC 4H33A 2EINB 2M7WA 4JYCA 1K5QA 2X7RB 1AI7A 2HJFC 1QCEA 3SPGA 4PA6A 1JX9A 2C2AA 2XAQA 3B8NA 3SPIA 4CZZA 5LHHA 3OEHG 4JTDB 2W0FC 3OUSA 3E35A 4UV9A 3ZRSA 2WLJA 4MVUA 1W2BU 5KA5A 3OW2U 4GX5A 2PI4A 2XAGA 4HAMA 4QPKA 3ZRWB 3VOUA 4R7CA 4H37A 3G4SV 3E2EA 1S72V 4EKWA 1SETA 4MVMA 4GX1A 4MVRA 3T4DA 4MT8A 1SESA 3E86A 1E1QG 3T1CA 4BIUA 3JD3A 3E8BA 1NKDA 2XNDG 1H8HG 3KG2A 3OEEG 1Q82W 4WFAV 3OMNB 3R65A 4KFMA 1COWG 2DYSC 3ZN0A 1N8RW 5B1NA 2WLNA 5LBQA 3CCQV 4FPPA 1J95A 4MVQA 4RO2A 4RUEA 4JTCB 4JAUA 5E1AC 2GHYA 3PJSK 1S5HC 4GX2A 1HWYA 2ZDIC 2Z3YA 1MSWD 1R3IC 1P7BA 4QJFB 1KKDA 2HVKC 2JIZG 3OR6C 4P30A 5DM6V 2HLDG 3CMEV 2D3OW 4Q20A 1SERA 1ROPA 4JGSA 4FMTA 4WFBV 4TSFG 1DTOA 4I9WA 4BAYA 4MTOA 5HFLA 3VBBA 1EBOA 4JYBA 1FS0G 1YJNV 3G6EV 2WLHA 5EC2C 5H6RA 4X8AA 3FB8C 1JJ2U 1OCZC 3B8MA 2IU0A 4GX0A 2ITCC 2W6JG 2MK3A 1R73A 4BW5A 2AHZA 3B77A 3HB3B 5EBLC 5IDJA 3CMAV 4JPRA 3ZRWA 3ZN1A 2BOCC 2JK5C 1VQ4V 1NR7A 2WLIB 4P9OA 3OAAG 1OCCC 4HZ3A 1FXVA 4XDLA 3CCUV 1S77D 1FXKA 3DTUB 4WFGA 1GK9A 5LHIA 1QR9A 3K3WA 3CCMV 1PNMA 1GM7A 1AR1B 1K3EA 4UUJC 2IH1C 3A0RA 1SZTA 4KUMA 3OUFA 1R6KA 3SPHA 4FK5C 2ATKC 3ETEA 3OFNG 1Q7YW 1FXHA 2EIKB 2ITDC 5C93A 5IYBO 3AG4B 3E8GA 3CCEV 1TUEB 3F5WC 5J9PC 2V1DA 3K0DA 3I55V 4QPJA 4JF3A 3NXSA 2H94A 3JD0A 3LDEA 3ZMUA 3ABKC 1QVFU 2GSMB 4KP4A 3SPCA 3SPJA 1VQKV 4MTFA 4JTAB 2WLLB 3SJQC 3QO5A 5L3EA 3EHBB 2YEVB 4J9YB 5B3SB 2AHYA 5IYCO 3K06A 2IJIA 1SRYA 2WAMA 1L1FA 3K79A 4WFFA 3ASOC 2IW5A 3LDCA 3LNMB 3E83A 4LBEC 1V55C 4OXSA 2LFSA 3T2MA 3OM3B 1KD1W 3FYIB 2DYSB 3ETGA 2IH3C 5B1BC 1Q86W 2IJHA 2EIJC 3SYAA 1PNKA 1NJIW 1MG1A 2P6JA 4BIZA 2A79B 3AEIA 4HYOA 3CC4V 2HKOA 4L87A 5KUMA 1M57C 5CBHA 5B3SC 1NVPD 3W7UA 3D3IA 3CCSV 4PDLA 4PDMA 2ZQMA 4MS2A 3ZMTA 3ZCCA 2DWDC 3CC2V 4LCUC 4P2ZA 1VQ5V 1QR8A 3GB7C 4RQFA 4RQEA 1JPXA 4MVSA 1IXMA 1K34A 1R3LC 3UM7A 4DXWA 3CC7V 3CCRV 2Q67A 2WSSG 3W7WA 2QM8A 2ZR3A 2LFRA 1EZJA 3H01A 2A9HA 3AG1C 3OR7C 2KB1A 4MTXA 1OCZB 3ZIAG 5IY5B 3W7SA 2ZXWB 2EILB 2P90A 1PKXA 2R9RB 3OMAB 1F23A 3JYCA 1BHBA 1F4MA 1CEZA 3W7XA 1YI2V 4RUFA 2DYRC 1GKFA 5EC1C 2XAHA 1M1KW 1M9NA 2X0LA 3ZJZA 1VQ8V 1AROP 3RW0A 1K73W 4FJCC 4DO2A 1OCCB 3BY6A 3EFFK 4X88A 1G8MA 3X2QB 5B1AC 3FYEB 2JDIG 3P32A 2F43G 5CMUA 4WF9V 2R9IA 5IY5C 4X89A 4TWKA 3AG3B 3IFXA 3K0GA 1JCHA 4FIPC 1K8AW 2QEXV 2EILC 2ZXWC 3M99B 1AJPA 3E8FA 3TK1A 3MD0A 4LP8A 1OHHG 2EZPA 1AI4A 1VQ7V 1F4NA 1QLEC 2QA4V 1YTFD 1CPYA 3IGAC 3FB5C 5IYDO 1BL8A 4UXNA 1RM1B 1H38A 1K4DC 2EZOA 5BZBA 5EBMC 3SYOA 4CBCA 3LUTB 5KUKA 1BHAA 1NQTA 3X2QC 1MOFA 3ABKB 2WLMA 3CCLV 1PNLA 2B1IA 3LDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K79 A;  1ROP A;  1F4M A;  1PD3 A;  1GTO A;  1RPO A;  2IJK A;  2IJJ A;  2GHY A;  1GMG A;  1F4N A;  1NKD A;  2IJH A;  1B6Q A;  1RPR A;  4DO2 A;  2IJI A; 
#chains in the Genus database with same CATH topology
 1I5X A;  2DQ3 A;  4CH3 A;  3AG3 C;  1N32 B;  3FAV A;  3VQV A;  2BTQ A;  5EK0 A;  3RWR D;  1LUW A;  5EYP A;  2X6A A;  1VAR A;  4TQF A;  3CXC U;  1J5E O;  5DEC A;  1WP7 A;  1F51 A;  4JI1 O;  1P4R A;  3K03 A;  2UXN A;  5LA6 A;  3A0H Z;  5LGN A;  3MHH C;  1VQ6 V;  3DC6 A;  1H2L A;  2ZR2 A;  4FLT A;  5IT9 N;  4NTX A;  3A2F A;  2CE4 A;  5KMG A;  4OX9 O;  4GUN A;  3JAK A;  1PL0 A;  1Z5V A;  5LGT A;  1KEC A;  2EBO A;  2DJV A;  1H2N A;  1ENV A;  3UT5 B;  1BMF G;  4WFH A;  4G2K A;  4ZHQ A;  2OYQ A;  4J42 A;  4U3J B;  1VQM V;  1UJW B;  3E22 B;  2IU3 A;  2PI5 A;  1ZWI C;  3F7Y C;  2QKS A;  2Q4P A;  3CPW U;  4DR4 B;  5B1A B;  1FFT B;  4XDJ A;  5DN6 G;  1Q5O A;  3QO7 A;  4MW8 A;  4X62 O;  1HR0 O;  2EIM C;  4DW1 A;  3BVO A;  4YJ3 B;  1ZTE A;  2VQE B;  1Q81 W;  1JA8 A;  5LXT B;  1SQF A;  3G80 A;  1R3K C;  5J2U A;  3JAL A;  3QF7 A;  4LFB B;  2Y69 C;  2JEX A;  3CD6 V;  1VF6 A;  5FNV B;  2FKX A;  4OGQ B;  4UB8 Z;  1AI5 A;  1VQ9 V;  2X6B A;  4JI5 B;  4O4H B;  3K5O A;  1IDS A;  3GWO A;  4F4L A;  1I5Y A;  4RAI A;  5FL7 G;  2ZD9 A;  4PA3 A;  1K33 A;  2XAF A;  1FXK C;  4EB6 A;  1WPX A;  1HNX O;  2NLJ C;  2F1M A;  4Q6G A;  5LHG A;  3W7T A;  5J2T B;  3C3S A;  1W59 A;  4XBF A;  5CB4 A;  1N0J A;  1N36 B;  2FTK A;  4DK0 A;  1KKC A;  5IYZ A;  1GAX A;  1LR1 A;  4EFE A;  2WA4 A;  4TT3 G;  3N2K A;  1KC8 W;  1KMI Z;  4JI4 O;  3RFR A;  1ZL8 A;  4LH7 A;  3H1L H;  5CN0 A;  4F6R A;  4TV9 A;  4NTY A;  1OV9 A;  1AVM A;  4LFA O;  2H8P C;  3ICX A;  2UUA B;  1SZX A;  1QLN A;  5AG2 A;  3CB2 A;  2UU9 B;  1WN7 A;  3CS5 A;  1XUQ A;  4JI7 O;  1NBM G;  2RNB A;  1JVM A;  1NH2 B;  1QBZ A;  4LF8 O;  4DR3 O;  1GTO A;  2ADQ B;  4JZG A;  5GON B;  1SS3 A;  5EBW C;  2EIM B;  1X4T A;  2WLK A;  2VQF B;  4FLZ A;  3K04 A;  3CCV V;  2RN9 A;  2X6C A;  2UXC O;  4FM0 A;  2FML A;  1RPR A;  1EFR G;  2Y4T A;  1AI6 A;  1MZF A;  4UCO A;  2Y69 B;  4H33 A;  2X7R B;  2HJF C;  1QCE A;  1A32 A;  2XAQ A;  3OEH G;  2W0F C;  3OUS A;  3E35 A;  4K8X A;  3SDL A;  1AP6 A;  2CGN A;  3ZRS A;  3D3Q A;  3HKE B;  3G6B A;  1EM1 A;  4HAM A;  4R7C A;  4H37 A;  3LNN A;  5EIB C;  3E86 A;  1E1Q G;  4H44 B;  3T1C A;  5JVD B;  3JD3 A;  1VF6 C;  4JV5 B;  4FLV A;  4KFM A;  2DYS C;  2F66 C;  5B1N A;  4IYI A;  1N8R W;  2PYJ A;  4RUE A;  2GHY A;  3PJS K;  2BTQ B;  1S5H C;  5EYP B;  2Z3Y A;  5JCO A;  1P7B A;  4B7K A;  3OR6 C;  4P30 A;  4FZ1 A;  1XNR O;  1JMK C;  1SER A;  2ZCE A;  4JGS A;  4WFB V;  4DV3 B;  4BAY A;  1ZLZ A;  5HFL A;  5LA6 B;  2KG7 A;  3G6E V;  4X8A A;  3FB8 C;  1JJ2 U;  1JFF A;  1OCZ C;  3B8M A;  3FD9 A;  3FFQ A;  3S3W A;  4GX0 A;  2W6J G;  5KMG B;  5EBL C;  4JPR A;  3ZN1 A;  1J5E B;  4W4L A;  3WB0 A;  1NR7 A;  1UFI A;  4JI1 B;  4P9O A;  1RSO A;  2FYU H;  2UUB O;  3OAA G;  4LH6 A;  4PI0 A;  1FXV A;  1S77 D;  4O4I A;  4JI2 O;  5LHI A;  4ZHQ B;  3T1H O;  1PNM A;  2ARH A;  4CS3 A;  4OX9 B;  2IH1 C;  3R66 A;  4IYH A;  2RCV A;  1YF2 A;  4FK5 C;  5A2Q N;  3ETE A;  1N32 O;  1FXH A;  2Q7G A;  5C93 A;  3HKB B;  1B06 A;  3F5W C;  5J9P C;  2GDS A;  2JVD A;  5KHJ A;  1TGO A;  4QPJ A;  3TXQ A;  3JAS A;  2H94 A;  4O4L A;  1QVF U;  1VQK V;  1YEW A;  4FLX A;  3GVM A;  2AHY A;  2ILM A;  5J2U B;  2WAM A;  3JAL B;  5H5N A;  3THO A;  1MZE A;  2PGG A;  3LDC A;  3T2M A;  3OTF A;  4E4E A;  3JAM N;  3KCY A;  4B7E A;  3CEI A;  1M5I A;  2DYS B;  4X62 B;  3ETG A;  1HR0 B;  3BA8 A;  2IJH A;  3SYA A;  1PNK A;  4HYO A;  3CC4 V;  2XUM A;  1GN3 A;  1Z5W A;  2KQX A;  4UCR A;  1GRJ A;  4RQF A;  1JPX A;  5JJJ B;  4EB6 B;  1R3L C;  4DK1 A;  1S5J A;  4TUY A;  3CC7 V;  2QM8 A;  2LFR A;  3ZIA G;  5IJ0 A;  2VWJ A;  1OCZ B;  2Q0A A;  5CB4 B;  1M93 A;  1NTK H;  2JS3 A;  2P90 A;  1EN4 A;  1PKX A;  2ZXW B;  3JSL A;  4FLU A;  1VEW A;  5IYZ B;  1F23 A;  5KHG A;  5A9G A;  1GKF A;  1T5E A;  2XAH A;  3N2K B;  1EZV H;  1VQ8 V;  1ARO P;  2FB5 A;  1K73 W;  3C90 A;  1HNX B;  4F6R B;  4TV9 B;  2QWP B;  5LYJ A;  2LGW A;  3X2Q B;  1IBL O;  4WF9 V;  4DR2 O;  2M6Y A;  4DR6 O;  4FIP C;  2QEX V;  1BE3 H;  1TAE A;  1XBL A;  2DOS A;  3K5L A;  2QA4 V;  3MAQ A;  1BT8 A;  4UXN A;  3ZHU A;  1H38 A;  3CJH A;  2EZO A;  1ZUQ A;  4CBC A;  5KUK A;  1IBM O;  1NQT A;  5IYC O;  4LFA B;  3CXH F;  3CRR A;  1K97 A;  3RYH A;  4GYC B;  2QTO A;  2HHH O;  3G71 V;  3VQY A;  4JI7 B;  3RYC A;  3A0B Z;  1AJN A;  2DWE C;  4I5S A;  4LNU A;  4NVP A;  4LF8 B;  1RM1 C;  4DR3 B;  2PUS A;  2ADP A;  2W0X A;  2PY5 A;  1VMG A;  2XAS A;  4UFZ A;  5KHI A;  3O9O A;  1DLB A;  3LSS A;  1K92 A;  3K08 A;  5GTH Z;  3ASN C;  5BMV A;  1JQ0 A;  2UXC B;  2OCC C;  2B5U A;  4LWS A;  2OTJ V;  4IGG A;  4DYL A;  1WA8 B;  4JAS A;  3UKM A;  4C7U A;  3STL C;  1IZ3 A;  4X1Y A;  1XMO O;  3D36 A;  1V54 C;  4JAA A;  2H3O A;  2F93 B;  4G28 B;  3K9S A;  2BTO A;  3ABM C;  4ZI7 A;  3ETD A;  3IC7 A;  5H6Q A;  5KHK A;  4B08 A;  1FJG O;  3T4Z A;  1DF4 A;  5IWA O;  5E79 Z;  1VIB A;  2Q69 A;  2KG7 B;  1IVS A;  1W0K G;  2HFE C;  2JS5 A;  1JFF B;  1QNM A;  4LC1 A;  1TUB B;  5CBF A;  4W4K A;  2LP7 A;  2AW9 A;  5ITZ A;  1XNR B;  5CA0 B;  2BSK A;  1US6 A;  3TET A;  1UPG A;  2CGO A;  3SYP A;  1YTF B;  3WG7 C;  2LGQ A;  1M56 C;  1RSO B;  5IE9 A;  2HVJ C;  4O4I B;  2QSA A;  4DV6 O;  1OZ0 A;  1G6U A;  3ZHT A;  4DV2 B;  1PM9 A;  3AG7 A;  4MW3 A;  5K1P A;  4I0X B;  3H1H H;  2UUB B;  5LGU A;  4K3A A;  1R3J C;  4WBN A;  1OCO B;  4O4L B;  1XL6 A;  3T1H B;  2R9A A;  4QNH B;  4QE7 A;  4YY3 O;  3N2G A;  2CTQ A;  2JRI A;  4ICG A;  2YSU B;  3ASN B;  4HNA B;  2OCC B;  4J7K A;  5B1O A;  1R6N A;  3H1I H;  4LF9 O;  4WCE V;  1VP7 A;  4PJ0 Z;  3RVZ A;  3P3N A;  4BR6 A;  1V54 B;  2GUZ A;  1SQG A;  2QR4 A;  3ABM B;  1CP9 A;  4I7Z B;  1N0N A;  2YDE A;  2JEU A;  1OCR B;  1L8D A;  1RFY A;  2A7W A;  2DE0 X;  3JD1 A;  4WFE A;  4KXR A;  4DR5 O;  4NXM O;  4BWA A;  4LF5 O;  3D36 C;  4MSW C;  4TUY B;  4NB5 A;  3UCS C;  3CE2 A;  1M90 W;  5IJ0 B;  1IUR A;  1HW7 A;  1YHQ V;  4NXN O;  1Q6I A;  2R70 A;  4ZOL A;  1PPJ H;  2YIB A;  2OT5 A;  3P30 A;  3QNE A;  5IJ9 A;  2QWO B;  4FFK A;  1K9M W;  3WG7 B;  1VF7 A;  2VS0 A;  5EZY A;  1M56 B;  3HPL C;  1R1B A;  3SPG A;  4PA6 A;  4CZZ A;  2C2A A;  2V4D A;  5CA1 A;  2Y4U A;  4X66 O;  4JTD B;  1AP5 A;  2F4V O;  4UV9 A;  2WLJ A;  4MVU A;  1WNS A;  3D8C A;  3OW2 U;  3O65 A;  1Y67 A;  3VOU A;  3G4S V;  1S72 V;  4EKW A;  2MW2 B;  3L71 H;  3T4D A;  2CUG A;  4DW0 A;  4O4J A;  3CJH B;  4J7J A;  5FPO A;  2XND G;  3KG2 A;  3OMN B;  1IBL B;  3R65 A;  1COW G;  1WAZ A;  3ZN0 A;  4DR2 B;  4DR6 B;  3RYH B;  5LBQ A;  4DV0 O;  3J80 N;  4JTC B;  1WJZ A;  4JAU A;  3K57 A;  4GX2 A;  4QJF B;  2JIZ G;  5DM6 V;  3RYC B;  3CME V;  2D3O W;  4LNU B;  1ROP A;  2QM4 A;  1G1X B;  4A5U B;  1IBM B;  1DTO A;  4FVM A;  4I9W A;  5JQG A;  4MTO A;  1YXB A;  1EBO A;  3CRQ A;  1YJN V;  1BQ0 A;  3LDD A;  5EC2 C;  3I5D A;  1P7G A;  2HHH B;  1R73 A;  2AHZ A;  3B77 A;  3HB3 B;  4LWS B;  5IDJ A;  4BW9 A;  3ZRW A;  2JK5 C;  2YIC A;  3OTO O;  4FFB A;  1B3Q A;  4LFC B;  1H2K A;  4F6E A;  3BCC H;  1GK9 A;  3SJC C;  2UUC O;  2ZE6 A;  3TXS A;  2CTR A;  4ZI7 B;  2QWR B;  3BRC A;  1R6K A;  3SPH A;  3OFN G;  1HNW B;  3J7A U;  5IYB O;  2E76 B;  1SQP H;  1XMO B;  3CCE V;  3K0D A;  2OCH A;  1JR9 A;  3LDE A;  3ABK C;  2GSM B;  4KP4 A;  3SPC A;  4UCS A;  3SJQ C;  2YXH A;  5ITZ B;  5L3E A;  1FJG B;  2BSK B;  3EHB B;  2LW1 A;  4J9Y B;  1SQB H;  1SRY A;  2QJ1 A;  2A06 H;  5IWA B;  3K5N A;  2ZIO A;  1L1F A;  4HBN A;  4WFF A;  1KBH A;  3ASO C;  3LNM B;  3E83 A;  1V55 C;  2Q9L A;  4IHJ A;  5LOV A;  4QGP A;  2EIJ C;  2P6J A;  2A79 B;  4JYY A;  2UXD O;  1M57 C;  5CBH A;  2VWK A;  3L72 H;  3ZCC A;  2DWD C;  3H1K H;  4LCU C;  1QR8 A;  2LW7 A;  3FX7 A;  4MVS A;  2GBO A;  3ZBH A;  3LSU A;  2L6L A;  4UCT A;  2Q67 A;  4DV6 B;  2ZE5 A;  2DN9 A;  4B3R O;  4I9Q A;  4X1I A;  1NS1 A;  2BE3 A;  3DC5 A;  2JGD A;  2KB1 A;  3N2G B;  4MTX A;  2XHB A;  3FAV B;  4LF4 B;  3JYC A;  1F4M A;  1CEZ A;  1Y74 A;  3DXR A;  1YI2 V;  1TA8 A;  4TV8 A;  3ZHR A;  2DYR C;  3BPZ A;  1R6T A;  1M9N A;  3ZJZ A;  3HKC A;  4FJC C;  1XMQ O;  3EFF K;  2P4V A;  1G8M A;  1BGY H;  2GUZ B;  2OIG A;  4YY3 B;  1L0L H;  3P32 A;  1ZX3 A;  2R9I A;  2YXL A;  4TWK A;  3K0G A;  3VQX A;  1K8A W;  3SJB C;  2ZXW C;  4NTW A;  1XDC A;  4LF9 B;  1OHH G;  4DV2 O;  1TVK A;  1QLE C;  4CC6 A;  3JAK B;  4J41 A;  2YXY A;  4FM1 A;  3IGA C;  3FB5 C;  1BL8 A;  2CDY A;  3SYO A;  2CH7 A;  3APO A;  3LUT B;  1BHA A;  3ETQ A;  4JI3 B;  3X2Q C;  3M7M X;  3L75 H;  2EUL A;  3ABK B;  4H0L B;  2EJ7 A;  4UV8 A;  2ZNI A;  4ZOL B;  2IJJ A;  3RVY A;  5IJ9 B;  3MHS C;  1Q43 A;  4DR5 B;  4R50 A;  1QHT A;  3E89 A;  2XAJ A;  2NNU A;  5EZY B;  3OE7 G;  4NXM B;  1QU7 A;  4LF5 B;  3ASO B;  4UVB A;  3TCU A;  3TJT A;  1V55 B;  2P4K A;  3APQ A;  2AGA A;  2LO1 A;  3HKD A;  5CA1 B;  4NXN B;  3BEH A;  2EIJ B;  2CTW A;  4I50 A;  3F7V C;  1GM8 A;  1NVP B;  1M57 B;  4E2L A;  3JD2 A;  2Q0O C;  3SYQ A;  3UO3 A;  1B6Q A;  1K5S A;  4O4J B;  1W0J G;  3ABL C;  2Z5U A;  4ASU G;  5B5E Z;  1XHX A;  5D5P A;  2A3Q A;  4MVZ A;  4U7O A;  1SQX H;  4K8Z A;  3ABU A;  4X66 B;  2Z0A A;  2F4V B;  3AK1 A;  1WB7 A;  1XL4 A;  3ZMS A;  4D7T A;  5C8Y A;  2HR3 A;  4CH6 A;  3CYO A;  1Y4M A;  3U11 A;  2UXB O;  3QTC A;  1EN5 A;  2ZIN A;  3CHX A;  2DYR B;  2RDC A;  3I56 V;  5JJE B;  3G67 A;  1AR5 A;  1RPO A;  2BOB C;  5JQG B;  1NH2 D;  3E8H A;  2Y48 A;  4DV0 B;  4BIO A;  1XIL A;  4PDV A;  3K9A A;  2Q73 A;  2WLL A;  2ETN A;  1XEQ A;  1YIT V;  3CCJ V;  1BQZ A;  2P7T C;  5JCO C;  3JD4 A;  1QLE B;  1GO3 F;  4QIW F;  1YJ9 V;  1MSD A;  1YSC A;  2Y0I A;  1ZL8 B;  2EIN C;  3P3P A;  2EX3 A;  3UT5 A;  4IL6 Z;  5D5Q A;  4R8C A;  2Q6A A;  4J9Z B;  1D5N A;  2DQ0 A;  3WFV A;  2JJ2 G;  5L3F A;  5L3B A;  3KZI Z;  1JOY A;  3OTO B;  2B9Z A;  2ZDI A;  3WB2 A;  5HFM A;  4PA7 A;  3ZX6 A;  3ZS8 C;  2QM7 A;  3ML0 A;  1S0V A;  2UUC B;  3RYF A;  3SYC A;  4PA4 A;  4PA9 A;  1GM9 A;  2XT9 A;  4LR3 A;  1E1R G;  3A8T A;  1FPO A;  5L3C A;  5LXT A;  3K59 A;  1E79 G;  2DMX A;  1SQQ H;  3ABL B;  1S76 D;  4PDR A;  4K35 A;  4LFC O;  4IHJ B;  5LOV B;  1OCO C;  2W6I G;  1F7Y A;  1BCC H;  2ZNJ A;  3FKS G;  1YIJ V;  4XDK A;  3ZED A;  1D2D A;  5JH7 A;  3JSN A;  1VQN V;  1XRE A;  1VQP V;  2CAZ C;  5CA3 A;  1DK1 A;  2K9P A;  2GTA A;  1HNW O;  5BR8 O;  5H2F Z;  4U7N A;  2CTP A;  2OWO A;  4I4T A;  4N21 A;  2JGD B;  2Y0P A;  1ORQ C;  2QKA A;  2UXD B;  3HR0 A;  2ZE8 A;  3CWB H;  3CP1 A;  2K1E A;  4DUY O;  1Y74 B;  4TV8 B;  1MNG A;  1OCR C;  3JCZ A;  1O9H A;  3HKC B;  3AG4 C;  4RWU A;  3C3T A;  3GWK C;  2EIN B;  2M7W A;  4JYC A;  3RYI A;  5FLX N;  2L35 A;  4B3R B;  1AI7 A;  1JX9 A;  3JAT A;  3SPI A;  5LHH A;  4X9Q A;  4JI6 O;  3H9V A;  5KA5 A;  1TVK B;  1ZSP A;  2PI4 A;  1GN4 A;  4QPK A;  3E2E A;  4DV7 O;  1SET A;  4MT8 A;  5EIB D;  1XMQ B;  4PV1 B;  3IAY A;  4BIU A;  4I55 A;  1H8H G;  4WFA V;  4X20 A;  2YS8 A;  4J7Z A;  1XI1 A;  3OGI B;  2LJ2 A;  4O2B A;  1Z2G A;  3TGU H;  4FPP A;  1J95 A;  4YJ2 A;  1MSW D;  2ZDI C;  1R3I C;  4JI0 O;  1B04 A;  4LF4 O;  2HLD G;  3B2E E;  5LL6 Y;  2D2C B;  1I08 A;  4TSF G;  3JCU Z;  3VBB A;  3JAS B;  1XNQ O;  1YCI A;  3HKD B;  4JYB A;  2WLH A;  5H6R A;  5BXZ A;  2IU0 A;  4NR1 A;  1PP9 H;  4BW5 A;  1Q8I A;  3L70 H;  4X64 O;  3CMA V;  2BOC C;  2N74 A;  1SF9 A;  1Q90 D;  4IT5 A;  3CCU V;  4FZ0 A;  1FXK A;  4WFG A;  4DV4 O;  4AQY O;  5F2V O;  2KKW A;  3CCM V;  4JI3 O;  4UUJ C;  3L73 H;  5C8Y B;  4KL1 A;  3A0R A;  1O9G A;  3OUF A;  4DRX A;  4B3M O;  3L9D A;  4JYA B;  5K1X A;  1NZ6 A;  1EN6 A;  3AG4 B;  3E8G A;  2PYL A;  1TUE B;  1PV0 A;  5LP6 A;  1H2M A;  2P06 A;  3I55 V;  1S5L Z;  1YZB A;  3NXS A;  3JD0 A;  3MDS A;  4MTF A;  4JTA B;  4CH4 A;  2WLL B;  2YID A;  3QO5 A;  1BZK A;  5B3S B;  1IX9 A;  2UXB B;  3BAB A;  1Q6U A;  3QG5 A;  3WU2 Z;  4J11 A;  4KHP O;  1AR4 A;  2ZT9 B;  4OXS A;  3OM3 B;  1KD1 W;  5LYJ B;  1L0N H;  4UCU A;  1WPB A;  3FYI B;  4DV5 O;  2IH3 C;  5B1B C;  1FAF A;  2LQT A;  1NJI W;  1MG1 A;  4LF7 O;  4FLY A;  1Y76 A;  1FFX A;  3D3I A;  3RN4 A;  3CCS V;  1I94 O;  4YIO A;  4MS2 A;  3CC2 V;  3HKB A;  1IXM A;  3RYF B;  1AB3 A;  2ZIM A;  3CCR V;  4NKG B;  3W7W A;  4AI8 A;  2ZR3 A;  3K5M A;  3H01 A;  2A9H A;  3AG1 C;  3U10 A;  5IY5 B;  3W7S A;  1GH6 A;  2EIL B;  4JI8 B;  3OMA B;  4GLX A;  4GZR B;  2PZS A;  1SA0 A;  4RUF A;  1P84 F;  1M1K W;  4X1K A;  2IM9 A;  2P22 C;  4DV1 O;  4DO2 A;  3N27 A;  3VQW A;  2GTS A;  3FYE B;  1WP8 A;  3DSQ A;  5KLV H;  2YI8 A;  4O2A A;  3AG3 B;  3IFX A;  3SR2 C;  1JCH A;  5BMV B;  5JH7 B;  2ZM6 O;  4L8J A;  1AJP A;  3E8F A;  4EFB A;  4LP8 A;  1HNZ O;  3AK2 A;  4YHH O;  1YTF D;  5IYD O;  1K4D C;  4TQD A;  5BZB A;  4X1Y B;  4ZIB A;  4U3F H;  5B66 Z;  4I4T B;  3Q4H A;  3CCL V;  1PNL A;  1H2S B;  3FB6 C;  4QE9 A;  2PTM A;  3H1J H;  1BS3 A;  3SJA C;  1YVW A;  3KKY A;  3ZMZ A;  1SQV H;  1WLE A;  5KX5 A;  2NR5 A;  5L3G A;  5BR8 B;  1KQS U;  3CRA A;  5LP6 C;  3RYI B;  1NR1 A;  4GKK B;  3JAT B;  1NTZ H;  2ZE7 A;  3AG2 C;  5B1B B;  2XOK G;  2HEP A;  4AHC A;  5GW7 A;  4DUY B;  2F95 B;  2HJD A;  2UXX A;  1XQ8 A;  2DW4 A;  4CC5 A;  1BSM A;  3DGE A;  5BY1 A;  4UVC A;  1GN2 A;  2WLI A;  4I55 B;  1RP3 B;  3ZMV A;  1IXB A;  4X20 B;  2B1G A;  4JI6 B;  4J10 A;  4GCZ A;  4O2B B;  3ABT A;  3AG1 B;  5KA6 A;  4DR7 O;  4X65 O;  2E3C A;  3RT3 C;  4K0K O;  4YJ2 B;  2R72 A;  4DV7 B;  2OTL V;  1GMG A;  3EVK A;  1AIL A;  1N34 O;  2FL4 A;  3B40 A;  4PD4 F;  2A0L A;  4WBN B;  4B3T O;  1KYO F;  4MTG A;  4UVA A;  4G27 B;  5DED A;  1URF A;  1VQO V;  3CRC A;  4H13 B;  2V7Q G;  2PF4 E;  4Z1M G;  3IJ4 A;  4FLW A;  4JI0 B;  1U97 A;  2YEV A;  2HG5 C;  2YC0 A;  4GT1 A;  4DUZ O;  3CSX A;  1KU9 A;  1H2G A;  1KP3 A;  4PEL A;  2JJ1 G;  4B3S O;  3RBZ A;  1WA8 A;  5LMU O;  4TOI A;  4P9P A;  2WWW A;  2Q68 A;  4FM2 A;  1XNQ B;  1AJQ A;  1FXK B;  4N23 A;  1QVG U;  1U96 A;  4DR1 O;  1XHZ A;  2Q7H A;  4GKJ B;  1VQL V;  5GTI Z;  1K4C C;  1I7F A;  1LNQ A;  4X64 B;  1YJW V;  4DRX B;  2AZ2 A;  1V9P A;  4LF6 O;  3JAW A;  3OMI B;  2IJK A;  2NN4 A;  5LP6 B;  2CK3 G;  3J81 N;  3UO2 A;  4DV4 B;  4AQY B;  2HP8 A;  5L3D A;  1LUV A;  3OGC C;  2P5O A;  2YUA A;  4IIJ A;  3AG2 B;  1TUB A;  4ZBM A;  1N33 O;  1MAB G;  5TIS Z;  3U0Z A;  4B3M B;  5KAI Z;  1VF5 B;  5CA0 A;  2P67 A;  3B4S A;  4J80 A;  1K7D A;  3T1Y O;  1H8E G;  2QE7 G;  5CBG A;  5H9C A;  2BCC H;  3ZRX A;  3BFR A;  1OJH A;  4CH5 A;  4ABM A;  5LMN O;  3WB1 A;  4R6Z A;  1DF5 A;  3JAR A;  3B09 A;  4UCV A;  1IBK O;  2E5L O;  1NI8 A;  1FD9 A;  1Y66 A;  5JWP A;  3BA9 A;  5JJN B;  2AXT Z;  3LSQ A;  1Y76 B;  3S3X A;  1MA1 A;  1FFX B;  1HP8 A;  3OD4 A;  4I0X A;  4KHP B;  1G4Y B;  3FB7 C;  1PD3 A;  3ZRV A;  4JYA O;  4DV5 B;  1THZ A;  3EXA A;  2WPD G;  3STZ C;  2EJR A;  4JAV A;  4LF7 B;  4ZKI A;  3BAA A;  2QWQ B;  4YXW G;  1I94 B;  2Q5Z A;  3K58 A;  4HNA A;  1KP2 A;  1SA0 B;  3AK3 A;  2EIK C;  1S3J A;  4X1K B;  3L74 H;  1FKA O;  3QO8 A;  1Q6H A;  1K5Q A;  1NU1 H;  2QDO A;  3BHP A;  3CRM A;  3NR7 A;  4D7S A;  3B8N A;  2OIE A;  1KUQ A;  1YDX A;  4O2A B;  5KHH A;  2VRZ A;  3QVN A;  1W2B U;  3M8A A;  4GX5 A;  2XAG A;  3ZRW B;  4MVM A;  4GX1 A;  4MVR A;  4FFB B;  4DV1 B;  1SES A;  3UQ8 A;  1CXZ B;  3E8B A;  1NKD A;  3OEE G;  1Q82 W;  3Q4H B;  1M4U A;  2WLN A;  4DR4 O;  2JGU A;  3CCQ V;  2ZM6 B;  2YI9 A;  1ZAU A;  4MVQ A;  4RO2 A;  5E1A C;  3ZHV A;  1NTM H;  1HNZ B;  4YHH B;  5KX5 B;  2QKC A;  4Z2W A;  1HWY A;  4U3J A;  1KKD A;  2HVK C;  3E22 A;  4JI8 O;  1GN6 A;  2VQE O;  3PN1 A;  4Q20 A;  4FMT A;  4CS2 A;  4LFB O;  1N4C A;  4PHZ A;  1FS0 G;  2QGN A;  3IC9 A;  2ITC C;  1HDJ A;  2MK3 A;  4YJ3 A;  4JI4 B;  1Y6X A;  4JI5 O;  1VQ4 V;  2KSD A;  2RMK B;  2WLI B;  4EEQ A;  1OCC C;  4HZ3 A;  2Q8V A;  4XDL A;  1FYJ A;  3DTU B;  5FNV A;  2Q7E A;  1SKV A;  1QR9 A;  3K3W A;  1GM7 A;  1AR1 B;  2G38 A;  1K3E A;  4JZ2 A;  1SZT A;  4KUM A;  1N36 O;  2ATK C;  4YIP A;  2GV9 A;  1Q7Y W;  2ZKO A;  2EIK B;  4O4H A;  2ITD C;  3ZHQ A;  2V1D A;  1WB8 A;  4JF3 A;  1I0H A;  3ZMU A;  2AZ0 A;  1NT2 B;  1SC5 B;  4PI2 A;  3SPJ A;  4X1I B;  4DR7 B;  4X65 B;  4AIL C;  4GKK O;  4K0K B;  5J2T A;  2RJZ A;  5FPR A;  2ODM A;  2YEV B;  2YIA A;  2YIB D;  3OT7 A;  2E74 B;  3K06 A;  2IJI A;  2QTS A;  3DXR B;  2UUA O;  1N34 B;  3CX5 F;  4NYK A;  1XOU A;  3K79 A;  4B3T B;  2IW5 A;  2WA3 A;  4LBE C;  2LFS A;  2UU9 O;  5KAF Z;  4OPA A;  2QWN B;  1Q86 W;  4BIZ A;  3AEI A;  4DUZ B;  2HKO A;  4L87 A;  5KUM A;  5B3S C;  1NVP D;  3W7U A;  2VQF O;  1JJO A;  4B3S B;  4PDL A;  5LMU B;  3JAW B;  4PDM A;  1DGS A;  2ZQM A;  3ZMT A;  4P2Z A;  1VQ5 V;  3KCX A;  3GB7 C;  3ZHS A;  4RQE A;  4DR1 B;  1K34 A;  3UM7 A;  2CH7 B;  4DXW A;  2N05 A;  2WSS G;  4IIJ B;  4OPH A;  2O57 A;  1EZJ A;  3OR7 C;  5GON A;  2R9R B;  4D6T H;  1P49 A;  4LF6 B;  1BHB A;  3RGB A;  3W7X A;  5EC1 C;  2RQ6 A;  2X0L A;  3RW0 A;  3F5T A;  1KB9 F;  2IBZ H;  1OCC B;  2F23 A;  3BY6 A;  4X88 A;  4UB6 Z;  1Q3E A;  5B1A C;  4JV5 O;  2JDI G;  1N33 B;  3JAR B;  3SGI A;  2F43 G;  4I50 B;  5CMU A;  5IY5 C;  4GKJ O;  4X89 A;  1MMM A;  1D5A A;  2EIL C;  3M99 B;  3T1Y B;  3TK1 A;  3MD0 A;  2EZP A;  3HKE A;  1AI4 A;  1VQ7 V;  1F4N A;  2XTA A;  4CS4 A;  1CPY A;  2E75 B;  1X59 A;  1RM1 B;  5LMN B;  5JVD A;  4JI2 B;  5EBM C;  2N04 A;  4DV3 O;  1PL4 A;  1IBK B;  2E5L B;  1MOF A;  2WLM A;  4Z1V A;  1QQC A;  2B1I A;  4MVO A; 
#chains in the Genus database with same CATH homology
 1K97 A;  1I5X A;  2DQ3 A;  4UV8 A;  2IJJ A;  3AG3 C;  3FB6 C;  4QE9 A;  3RVY A;  3MHS C;  5EK0 A;  2QTO A;  3ZMZ A;  1WLE A;  3G71 V;  2X6A A;  4R50 A;  3E89 A;  2XAJ A;  2NNU A;  5L3G A;  1AJN A;  2DWE C;  3OE7 G;  4I5S A;  1KQS U;  3ASO B;  4UVB A;  3TCU A;  3CXC U;  1RM1 C;  1V55 B;  1F51 A;  1NR1 A;  1P4R A;  3K03 A;  2XAS A;  2UXN A;  3AG2 C;  5B1B B;  2XOK G;  3BEH A;  2EIJ B;  1DLB A;  3LSS A;  1K92 A;  5LGN A;  3MHH C;  1VQ6 V;  5GW7 A;  3K08 A;  3ASN C;  2ZR2 A;  3F7V C;  1GM8 A;  1JQ0 A;  1NVP B;  1M57 B;  2UXX A;  4E2L A;  2OCC C;  2B5U A;  2DW4 A;  3JD2 A;  3SYQ A;  2OTJ V;  3DGE A;  1B6Q A;  1K5S A;  4JAS A;  1W0J G;  3ABL C;  2Z5U A;  4UVC A;  3UKM A;  4ASU G;  2WLI A;  1PL0 A;  3STL C;  5LGT A;  1KEC A;  3ZMV A;  4MVZ A;  2B1G A;  4U7O A;  2EBO A;  1V54 C;  3D36 A;  4GCZ A;  3ABU A;  1ENV A;  1BMF G;  3ABT A;  4WFH A;  1XL4 A;  4G28 B;  3ABM C;  3AG1 B;  4G2K A;  5KA6 A;  3ETD A;  3IC7 A;  3ZMS A;  5H6Q A;  2HR3 A;  1VQM V;  1UJW B;  3CYO A;  1Y4M A;  2OTL V;  2IU3 A;  1GMG A;  3T4Z A;  2DYR B;  1DF4 A;  3I56 V;  2PI5 A;  1RPO A;  2A0L A;  2BOB C;  1ZWI C;  3F7Y C;  2QKS A;  4MTG A;  2Q69 A;  3CPW U;  4UVA A;  3E8H A;  1NH2 D;  2Y48 A;  4G27 B;  5B1A B;  1FFT B;  1W0K G;  2HFE C;  1VQO V;  4XDJ A;  5DN6 G;  4LC1 A;  4PDV A;  3K9A A;  3QO7 A;  4MW8 A;  5CBF A;  2V7Q G;  2EIM C;  2WLL A;  4Z1M G;  2LP7 A;  1YIT V;  2YEV A;  3CCJ V;  2HG5 C;  4GT1 A;  2P7T C;  3JD4 A;  1Q81 W;  3TET A;  3SYP A;  1R3K C;  1H2G A;  1KP3 A;  1QLE B;  4PEL A;  3WG7 C;  1YTF B;  1GO3 F;  2JJ1 G;  4QIW F;  3RBZ A;  1M56 C;  4P9P A;  1YJ9 V;  2WWW A;  2Q68 A;  2Y69 C;  1YSC A;  2JEX A;  2EIN C;  2HVJ C;  3CD6 V;  1AJQ A;  1FXK B;  4N23 A;  1QVG U;  1VQL V;  4MVO A;  1K4C C;  4R8C A;  2Q6A A;  1OZ0 A;  4J9Z B;  1AI5 A;  1LNQ A;  1VQ9 V;  2DQ0 A;  3WFV A;  2JJ2 G;  2X6B A;  5L3F A;  5L3B A;  4MW3 A;  1YJW V;  1JOY A;  2ZDI A;  3OMI B;  5HFM A;  4PA7 A;  3GWO A;  5LGU A;  2QM7 A;  2IJK A;  4F4L A;  1I5Y A;  2CK3 G;  4RAI A;  1R3J C;  3ML0 A;  5FL7 G;  2ZD9 A;  1S0V A;  4PA3 A;  1K33 A;  2XAF A;  1FXK C;  1OCO B;  5L3D A;  1WPX A;  3SYC A;  1XL6 A;  4PA4 A;  2NLJ C;  3OGC C;  4QNH B;  4QE7 A;  5LHG A;  3AG2 B;  3W7T A;  4XBF A;  4ZBM A;  4PA9 A;  1GM9 A;  1MAB G;  2YSU B;  3ASN B;  2FTK A;  1E1R G;  2OCC B;  2P67 A;  5L3C A;  5B1O A;  1K7D A;  1R6N A;  4TT3 G;  1E79 G;  1H8E G;  2QE7 G;  5CBG A;  4WCE V;  3ABL B;  5H9C A;  1KC8 W;  3ZRX A;  1S76 D;  4PDR A;  3RVZ A;  5CN0 A;  1OCO C;  1V54 B;  2W6I G;  4R6Z A;  1DF5 A;  3ABM B;  1CP9 A;  3FKS G;  1YIJ V;  1Y66 A;  4XDK A;  3LSQ A;  2H8P C;  1QLN A;  2JEU A;  1VQN V;  1OCR B;  1VQP V;  1G4Y B;  5CA3 A;  3FB7 C;  3JD1 A;  4WFE A;  1PD3 A;  1NBM G;  3ZRV A;  1JVM A;  1THZ A;  1NH2 B;  4MSW C;  1QBZ A;  4U7N A;  1GTO A;  2WPD G;  3STZ C;  1M90 W;  2EJR A;  4JAV A;  4N21 A;  1ORQ C;  5EBW C;  2EIM B;  1YHQ V;  2WLK A;  4ZKI A;  3K04 A;  4YXW G;  2OT5 A;  3CCV V;  3CP1 A;  3P30 A;  2K1E A;  1KP2 A;  3QNE A;  2X6C A;  1K9M W;  1OCR C;  2EIK C;  3WG7 B;  1RPR A;  3JCZ A;  1S3J A;  1EFR G;  1AI6 A;  3AG4 C;  3QO8 A;  1M56 B;  2Y69 B;  3HPL C;  4H33 A;  2EIN B;  2M7W A;  4JYC A;  1K5Q A;  2X7R B;  1AI7 A;  2HJF C;  1QCE A;  3SPG A;  4PA6 A;  1JX9 A;  2C2A A;  2XAQ A;  3B8N A;  3SPI A;  4CZZ A;  5LHH A;  3OEH G;  4JTD B;  2W0F C;  3OUS A;  3E35 A;  4UV9 A;  3ZRS A;  2WLJ A;  4MVU A;  1W2B U;  5KA5 A;  3OW2 U;  4GX5 A;  2PI4 A;  2XAG A;  4HAM A;  4QPK A;  3ZRW B;  3VOU A;  4R7C A;  4H37 A;  3G4S V;  3E2E A;  1S72 V;  4EKW A;  1SET A;  4MVM A;  4GX1 A;  4MVR A;  3T4D A;  4MT8 A;  1SES A;  3E86 A;  1E1Q G;  3T1C A;  4BIU A;  3JD3 A;  3E8B A;  1NKD A;  2XND G;  1H8H G;  3KG2 A;  3OEE G;  1Q82 W;  4WFA V;  3OMN B;  3R65 A;  4KFM A;  1COW G;  2DYS C;  3ZN0 A;  1N8R W;  5B1N A;  2WLN A;  5LBQ A;  3CCQ V;  4FPP A;  1J95 A;  4MVQ A;  4RO2 A;  4RUE A;  4JTC B;  4JAU A;  5E1A C;  2GHY A;  3PJS K;  1S5H C;  4GX2 A;  1HWY A;  2ZDI C;  2Z3Y A;  1MSW D;  1R3I C;  1P7B A;  4QJF B;  1KKD A;  2HVK C;  2JIZ G;  3OR6 C;  4P30 A;  5DM6 V;  2HLD G;  3CME V;  2D3O W;  4Q20 A;  1SER A;  1ROP A;  4JGS A;  4FMT A;  4WFB V;  4TSF G;  1DTO A;  4I9W A;  4BAY A;  4MTO A;  5HFL A;  3VBB A;  1EBO A;  4JYB A;  1FS0 G;  1YJN V;  3G6E V;  2WLH A;  5EC2 C;  5H6R A;  4X8A A;  3FB8 C;  1JJ2 U;  1OCZ C;  3B8M A;  2IU0 A;  4GX0 A;  2ITC C;  2W6J G;  2MK3 A;  1R73 A;  4BW5 A;  2AHZ A;  3B77 A;  3HB3 B;  5EBL C;  5IDJ A;  3CMA V;  4JPR A;  3ZRW A;  3ZN1 A;  2BOC C;  2JK5 C;  1VQ4 V;  1NR7 A;  2WLI B;  4P9O A;  3OAA G;  1OCC C;  4HZ3 A;  1FXV A;  4XDL A;  3CCU V;  1S77 D;  1FXK A;  3DTU B;  4WFG A;  1GK9 A;  5LHI A;  1QR9 A;  3K3W A;  3CCM V;  1PNM A;  1GM7 A;  1AR1 B;  1K3E A;  4UUJ C;  2IH1 C;  3A0R A;  1SZT A;  4KUM A;  3OUF A;  1R6K A;  3SPH A;  4FK5 C;  2ATK C;  3ETE A;  3OFN G;  1Q7Y W;  1FXH A;  2EIK B;  2ITD C;  5C93 A;  5IYB O;  3AG4 B;  3E8G A;  3CCE V;  1TUE B;  3F5W C;  5J9P C;  2V1D A;  3K0D A;  3I55 V;  4QPJ A;  4JF3 A;  3NXS A;  2H94 A;  3JD0 A;  3LDE A;  3ZMU A;  3ABK C;  1QVF U;  2GSM B;  4KP4 A;  3SPC A;  3SPJ A;  1VQK V;  4MTF A;  4JTA B;  2WLL B;  3SJQ C;  3QO5 A;  5L3E A;  3EHB B;  2YEV B;  4J9Y B;  5B3S B;  2AHY A;  5IYC O;  3K06 A;  2IJI A;  1SRY A;  2WAM A;  1L1F A;  3K79 A;  4WFF A;  3ASO C;  2IW5 A;  3LDC A;  3LNM B;  3E83 A;  4LBE C;  1V55 C;  4OXS A;  2LFS A;  3T2M A;  3OM3 B;  1KD1 W;  3FYI B;  2DYS B;  3ETG A;  2IH3 C;  5B1B C;  1Q86 W;  2IJH A;  2EIJ C;  3SYA A;  1PNK A;  1NJI W;  1MG1 A;  2P6J A;  4BIZ A;  2A79 B;  3AEI A;  4HYO A;  3CC4 V;  2HKO A;  4L87 A;  5KUM A;  1M57 C;  5CBH A;  5B3S C;  1NVP D;  3W7U A;  3D3I A;  3CCS V;  4PDL A;  4PDM A;  2ZQM A;  4MS2 A;  3ZMT A;  3ZCC A;  2DWD C;  3CC2 V;  4LCU C;  4P2Z A;  1VQ5 V;  1QR8 A;  3GB7 C;  4RQF A;  4RQE A;  1JPX A;  4MVS A;  1IXM A;  1K34 A;  1R3L C;  3UM7 A;  4DXW A;  3CC7 V;  3CCR V;  2Q67 A;  2WSS G;  3W7W A;  2QM8 A;  2ZR3 A;  2LFR A;  1EZJ A;  3H01 A;  2A9H A;  3AG1 C;  3OR7 C;  2KB1 A;  4MTX A;  1OCZ B;  3ZIA G;  5IY5 B;  3W7S A;  2ZXW B;  2EIL B;  2P90 A;  1PKX A;  2R9R B;  3OMA B;  1F23 A;  3JYC A;  1BHB A;  1F4M A;  1CEZ A;  3W7X A;  1YI2 V;  4RUF A;  2DYR C;  1GKF A;  5EC1 C;  2XAH A;  1M1K W;  1M9N A;  2X0L A;  3ZJZ A;  1VQ8 V;  1ARO P;  3RW0 A;  1K73 W;  4FJC C;  4DO2 A;  1OCC B;  3BY6 A;  3EFF K;  4X88 A;  1G8M A;  3X2Q B;  5B1A C;  3FYE B;  2JDI G;  3P32 A;  2F43 G;  5CMU A;  4WF9 V;  2R9I A;  5IY5 C;  4X89 A;  4TWK A;  3AG3 B;  3IFX A;  3K0G A;  1JCH A;  4FIP C;  1K8A W;  2QEX V;  2EIL C;  2ZXW C;  3M99 B;  1AJP A;  3E8F A;  3TK1 A;  3MD0 A;  4LP8 A;  1OHH G;  2EZP A;  1AI4 A;  1VQ7 V;  1F4N A;  1QLE C;  2QA4 V;  1YTF D;  1CPY A;  3IGA C;  3FB5 C;  5IYD O;  1BL8 A;  4UXN A;  1RM1 B;  1H38 A;  1K4D C;  2EZO A;  5BZB A;  5EBM C;  3SYO A;  4CBC A;  3LUT B;  5KUK A;  1BHA A;  1NQT A;  3X2Q C;  1MOF A;  3ABK B;  2WLM A;  3CCL V;  1PNL A;  2B1I A;  3LDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...