1GMGA

Alanine 31 proline mutant of rop protein, monoclinic form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords REGULATORY PROTEIN ROP
total genus 23
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gmgA00
1GTOA 1F4NA 1RPRA 1NKDA 2GHYA 1PD3A 1B6QA 1GMGA 2IJJA 2IJHA 3K79A 1F4MA 4DO2A 2IJIA 1ROPA 1RPOA 2IJKA
chains in the Genus database with same CATH superfamily
4WFHA 4B3RB 3BABA 3AK3A 1THZA 1K4DC 1Z5VA 1TUBA 5BR8O 4ZOLA 1N36B 5KHHA 2EIJB 5D5PA 5FPRA 4FMTA 1O9HA 5KX5B 1PP9H 4PD4F 1EZVH 1V54B 3N2GA 4CH4A 4P30A 2ZT9B 1JPXA 3JCZA 1IBKB 3NXSA 3KKYA 4ZBMA 4XDJA 1K5QA 4PDRA 1Q8IA 3PJSK 1GRJA 3BY6A 4UVBA 1XQ8A 3APQA 4NTXA 3DGEA 4O2BB 1AP6A 3SYCA 3L74H 2BCCH 2JDIG 5IJ9B 2NN4A 1OZ0A 2LFRA 5J2UB 1BQZA 5F2VO 4K35A 3JALB 3LDDA 3SYAA 2CTQA 3CS5A 4R50A 2YI9A 1FXKB 4WCEV 4F6RB 2LGWA 3TCUA 5CA0A 3X2QC 3CC2V 2QTSA 1K8AW 4LR3A 2HHHO 2JGDA 4Z1MG 4IYIA 4J80A 2UUCO 1X59A 2JS3A 1N33B 3T1YB 1YF2A 3QVNA 3H9VA 5LHHA 3SJCC 1K92A 3K08A 3AG3C 2Y4TA 4PDVA 2ZIOA 4U3JA 5J9PC 3JAKA 4BIUA 1Q6HA 2Q5ZA 4ZIBA 1QR8A 4OGQB 4DUZO 1OCZC 2F93B 4LNUB 5LOVB 2H8PC 1OCOC 4K0KB 3ICXA 2Q9LA 5B1AB 2OIGA 3DXRA 2ZR2A 4LC1A 4B7KA 3CX5F 3JD0A 1M90W 1AR5A 4XDLA 1MSDA 2Q68A 4FZ1A 3RBZA 1XMOO 3SYPA 3BA9A 2JS5A 4FVMA 5JCOA 3CWBH 5EIBC 1G1XB 2VQEO 1TAEA 2GTAA 4FFBA 1SQVH 5L3CA 5LMUB 3I56V 1SF9A 4O4HB 1P7BA 1WNSA 2N74A 1XL6A 3AG7A 4CS2A 4CBCA 3A0HZ 3H1HH 2QWQB 2ZKOA 1V55B 4KFMA 2EZPA 4UCUA 4PELA 2ZXWB 2ATKC 2QJ1A 2XAFA 3KCYA 4GKJO 5KA6A 2YEVB 1HNWB 3RFRA 3JATA 1Z5WA 1CP9A 2P4VA 2ZIMA 4NVPA 2LP7A 4DV7B 4JGSA 5H6RA 1FFXA 2QWPB 1AJNA 2FKXA 3HKBA 1I5YA 4RAIA 3CCEV 3L72H 3MHHC 2HVKC 3UT5B 3G6EV 3JARB 4QPKA 3RVZA 1IX9A 1OCCB 4O4HA 3W7XA 4DV7O 4LF9B 5GTHZ 4R7CA 3VQYA 5CB4B 1H2NA 1XMQO 4EFBA 2OTJV 2XHBA 4QE9A 3ZMTA 4QPJA 4ZI7A 4TSFG 3C3TA 4JI3O 2AW9A 1M9NA 1VQ6V 4JI0O 3D3IA 3E22A 3AG3B 1V54C 1XHZA 1HR0B 3JAKB 4KUMA 5DECA 4FM0A 4JTCB 3ZHSA 1OCRB 1Y76B 3VOUA 1IZ3A 2DYSC 3LDEA 1I94B 3N2GB 2ARHA 4DV3B 3K79A 2FMLA 2Q69A 4GX2A 3ABKB 4I4TB 3VQVA 5HFLA 2AXTZ 4QIWF 4F6RA 3K5OA 3M8AA 1GM9A 2QWNB 4H37A 4NXNO 3E8GA 3OFNG 1FJGO 3ZMVA 4LF8O 3JD4A 4FJCC 4XBFA 1KECA 1VQPV 1AI4A 3CRAA 5IJ9A 5J2UA 4LF8B 1K7DA 3ZCCA 1XBLA 3K04A 5TISZ 5CBHA 3RYFA 1ZL8A 4UCVA 2P5OA 1XMQB 2OIEA 3ABMB 4HNAB 3CCMV 1YDXA 4JPRA 5GONB 2HG5C 3Q4HA 4J41A 1QQCA 1XOUA 5JCOC 4FZ0A 3UT5A 1WLEA 3FX7A 3OUSA 1M4UA 1N32O 1JR9A 3FFQA 2EIMC 3LNMB 3RGBA 4WBNB 1XMOB 2DQ3A 4P9OA 1K34A 2DW4A 3SYQA 4B3TB 1SS3A 1QLNA 3ZRXA 4KHPB 1YVWA 4GX5A 3WB0A 1S76D 3K0DA 1DLBA 4DRXA 4GYCB 1XILA 4DV1O 1JFFB 2Y69C 1N34O 4LH6A 2DWEC 4AILC 2RMKB 5L3GA 2IW5A 5HFMA 1R1BA 2UU9O 2JK5C 1RSOB 1W2BU 1EN6A 2M7WA 3EHBB 4DK1A 1EZJA 4MVMA 4XDKA 3G4SV 1FJGB 2YIDA 2CUGA 3EFFK 1BCCH 1AI5A 2JGUA 3ZBHA 4F6EA 4FLXA 1HNZO 4DR4O 3BHPA 1P7GA 2Z3YA 5J2TA 3N2KA 3ZS8C 3F5WC 3HKDB 4AI8A 4JF3A 1AR1B 3AG1B 1Q6IA 3TXSA 3KG2A 3M7MX 4WFAV 4FM2A 5L3BA 4IYHA 3H1JH 1WP8A 4WFGA 3CCQV 3LSSA 1COWG 2WPDG 4TUYB 5KHIA 4G27B 4I55B 2QA4V 1YI2V 1JOYA 4DV4O 1I0HA 3WU2Z 3UKMA 3HR0A 1Q81W 1LNQA 2K1EA 1M57C 2A7WA 1DK1A 3JSNA 1GM8A 4LFCB 5IT9N 4TOIA 4FLYA 2GDSA 1FXVA 1ORQC 5LA6B 2ZD9A 3SPCA 1UJWB 4PA3A 1Y4MA 4LBEC 1GN6A 4DV6B 1Y67A 2GV9A 3E8HA 5LL6Y 5LXTA 1NT2B 1PV0A 3K03A 5BR8B 1OCRC 4JZGA 2LQTA 4JYAO 4GUNA 3QO8A 3K06A 4A5UB 1JMKC 1H2KA 1V55C 4U7OA 4LFAB 2GUZA 3B2EE 1YJNV 1IBKO 3CJHB 1VQKV 4O4IA 5L3FA 4JV5O 4X9QA 4MVUA 3ZMUA 3ZHRA 3B40A 4FK5C 1HR0O 1M93A 4K8ZA 1AR4A 5EBWC 5CBFA 2FYUH 5LP6B 3QO7A 2UXCO 3JD3A 3CRMA 1K5SA 4X66B 4JI0B 1PD3A 4TT3G 4DR1B 2YXYA 4FLTA 5JJEB 5JWPA 2QGNA 3RYCA 2YS8A 1P4RA 4Z1VA 4MVZA 2VWKA 3CCVV 3K59A 5IJ0B 1SKVA 4TV8B 4LNUA 2ZINA 4RUFA 2UXCB 2N04A 3W7UA 3JASB 1URFA 4LFBO 1XREA 5KMGB 2KKWA 1HNXO 3C3SA 4LF9O 3P30A 1N0JA 5JVDB 1YITV 4MSWC 4PI2A 5LGNA 2NNUA 4ASUG 3K5NA 2CTWA 2F66C 4G28B 3ZJZA 4O4JB 5B3SC 1M1KW 3ASOB 4NXNB 4FFBB 4PJ0Z 2BSKA 2B9ZA 4X1YB 4J7KA 3L71H 1NH2B 4JI7O 2A0LA 1E1QG 1EN5A 5LYJA 3A2FA 3BCCH 1GN4A 3JAWB 2DOSA 3TGUH 1SQBH 4DXWA 1JCHA 4FFKA 2JIZG 4JV5B 3W7TA 1HWYA 2GUZB 4E2LA 2PUSA 2RQ6A 5J2TB 1SQQH 3AG2B 5BMVA 4X62O 2Y0PA 2VQEB 4D7SA 4MS2A 4I0XA 4GX1A 3FB8C 1K73W 4KHPO 3SPIA 4TQFA 1IBLO 5KAIZ 1SQGA 4DR5B 1XNQO 4RQFA 3WFVA 1ZUQA 2OT5A 5EYPA 1M56C 1N34B 5EYPB 3UO2A 2W6JG 2HJDA 2GHYA 4JI2O 4FLWA 1VQNV 2CE4A 1O9GA 2ZDIA 3LSUA 3JALA 4DV3O 5JJJB 4NTWA 4PA4A 4KXRA 1VF6C 4NB5A 3VQXA 1OJHA 5LP6C 1QCEA 3E89A 1IBMB 2P6JA 2B5UA 1H8HG 3L73H 4UV8A 1ROPA 2XAHA 3T4DA 5AG2A 1AJQA 5IE9A 4IL6Z 2RN9A 4QJFB 2O57A 2X0LA 4DW1A 4J11A 2A3QA 2QDOA 4NYKA 3R66A 2UXXA 2UXBB 1NZ6A 4LF6O 2EIJC 4HBNA 3OTOO 3PN1A 1KUQA 4O4JA 3DXRB 1PPJH 3WG7B 5EK0A 3K3WA 1MZEA 3QTCA 1VQ9V 1WB8A 1JA8A 2G38A 2UUBO 2ZE6A 1W0JG 2IJJA 1RM1C 4DV0O 2V1DA 3JASA 4J7JA 3RVYA 4YXWG 5K1PA 5CA3A 1AILA 1HNWO 1N33O 5KA5A 1ZSPA 3OD4A 3RN4A 2DMXA 3U10A 2X7RB 4I4TA 3FB5C 2HJFC 1NH2D 2H3OA 1GMGA 2QSAA 1XUQA 2F95B 4U7NA 3ASNC 3LNNA 1V9PA 3UCSC 1H8EG 1S5LZ 4EB6B 3STLC 1NBMG 2QE7G 4E4EA 1WA8B 1E1RG 1DF4A 2DYSB 4IGGA 2RCVA 1WPXA 3S3WA 4R6ZA 5LOVA 1ZL8B 1UFIA 3SGIA 3L9DA 2K9PA 2YIBA 3SR2C 2WLHA 3T2MA 1AB3A 4DR4B 4LF6B 4LF5B 1DGSA 4YJ2A 1CEZA 4JZ2A 2KB1A 1NQTA 4I50B 4JI8B 4JI6B 1NJIW 2UXDB 1PNKA 1SC5B 2EBOA 2QKSA 4DYLA 2Q0OC 4LWSA 2EINB 4H44B 1KKDA 3CC7V 1K33A 1B04A 4DUYO 5EC2C 1NVPB 4NXMB 3WB1A 2EIKC 3THOA 3IC7A 2PI5A 4JI6O 3CCRV 5B3SB 4B3RO 1Q82W 1I08A 1QLEB 2F1MA 4PA9A 1XHXA 1Q3EA 3O65A 1KKCA 4H33A 3STZC 2ZDIC 5H5NA 4AQYO 3HKCA 1PNLA 2E5LB 2ITDC 4IT5A 2Q7HA 1HP8A 3CSXA 1XI1A 3LDCA 3SJBC 4UB8Z 4JI7B 3ABLB 4DW0A 1GAXA 2VQFO 1HNZB 2IJKA 1M56B 2WA4A 1F4MA 1BGYH 3CRCA 1Y74A 1N32B 1PM9A 3BRCA 3QNEA 2MW2B 1B6QA 4O4LA 3EXAA 5A9GA 4UCSA 2YI8A 1D5AA 2PYJA 1N8RW 4FLZA 3H1IH 2BOBC 1WP7A 4P9PA 4WFFA 4KL1A 5GW7A 4DR2O 5LHGA 4GKKO 5B1OA 1VQ7V 2HEPA 5JVDA 1KBHA 3ZHVA 4DR2B 2QWRB 3ASOC 2DYRB 3DSQA 4JYYA 3RYHA 1VQOV 4TV9B 3E8BA 4AHCA 1K97A 3H1KH 3E35A 3D36C 4PHZA 3T1YO 3JCUZ 3AK1A 4U3JB 4CH3A 4CH5A 1XNRB 1VQLV 2RJZA 4DV2B 1MNGA 3N27A 1OCZB 4LH7A 3CEIA 3W7WA 4X8AA 4JI2B 2WSSG 1QVGU 2DYRC 5B1AC 3MAQA 3OUFA 4UV9A 3CMEV 2WLLB 1AP5A 1HNXB 1SQFA 2FL4A 1LUWA 2IBZH 1R6NA 1VQ5V 1MSWD 4YIPA 2YSUB 2E75B 1SA0A 2VQFB 1MA1A 1OV9A 2JEUA 2WWWA 2QTOA 2WLKA 2ODMA 2H94A 2XT9A 1GO3F 3CPWU 1JX9A 1Q86W 3U11A 1SZTA 2WLIA 1IXBA 3ZIAG 5C8YB 1SESA 4RUEA 1G6UA 5KMGA 3K9AA 2KG7B 3ZMZA 4CC5A 2LJ2A 1NVPD 3OMNB 3SPGA 3HKCB 4X20B 3I55V 4HYOA 4DR3O 5CBGA 1M57B 4JTDB 1J5EO 5JJNB 3ZHTA 1VF7A 1QNMA 3ETEA 4HZ3A 2X6CA 2CH7A 1EBOA 2VRZA 3OMAB 1VQ4V 1F23A 5B1BB 1XNRO 3APOA 4I9QA 3OT7A 4K3AA 4UVAA 3OAAG 2RDCA 1ZTEA 1K4CC 1N0NA 2XAJA 1PL4A 2HKOA 1R6TA 4NKGB 5FNVA 1FXKA 4OX9O 4FPPA 5EC1C 1IVSA 1KYOF 4H13B 3CJHA 2KG7A 3G67A 5KAFZ 4BIOA 3K9SA 3S3XA 1D5NA 3AG1C 3FYEB 4L87A 5IYZB 3ETDA 1WB7A 4DV4B 2EIKB 1R3JC 3OGIB 4UUJC 2F23A 2E3CA 4LF7O 3FKSG 2F4VB 4LP8A 1FXKC 2XAGA 4I7ZB 1SA0B 1FXHA 2ZE5A 4EKWA 2W0FC 3VQWA 2QEXV 2IJIA 1RP3B 1OHHG 2MK3A 4X62B 1KB9F 4UFZA 2ZNIA 5KX5A 2F43G 4DUZB 1I94O 4B08A 4X89A 3U0ZA 1BS3A 5B66Z 3A0BZ 5FL7G 1TUBB 2Q7GA 5KLVH 2IH3C 1US6A 3K58A 3M99B 1Q6UA 4DK0A 3G71V 5JQGB 4R8CA 2Q0AA 3J7AU 2QKAA 3E83A 4TV9A 5IYCO 3BAAA 4TV8A 3QF7A 2DQ0A 3OMIB 1G4YB 2JJ1G 4YHHO 4EEQA 1MABG 2UUAB 2BTQA 2JRIA 2IU0A 3RYCB 1IBMO 3ABMC 1S0VA 3ETGA 4OX9B 4QGPA 2EILC 3P3NA 3E8FA 4MVQA 4BWAA 4JI4B 5GONA 1NTKH 5IDJA 4MW3A 4LCUC 4JAAA 1I5XA 3UO3A 1R3LC 1E79G 4J42A 1PNMA 5L3EA 3TETA 1FKAO 4N23A 1BT8A 4MVRA 4LFAO 4ICGA 3T1CA 1Y74B 1SQPH 4O4LB 1AI6A 2JVDA 5LGTA 3JD2A 2D2CB 2EIMB 1WPBA 2UXDO 3SPJA 4DR5O 2EZOA 2EILB 3JAMN 4DR3B 5B1BC 2CTPA 1S5JA 4QE7A 3HKEB 1H2GA 1ZAUA 3RYIA 2Q67A 4WF9V 1KD1W 4DRXB 5LHIA 2CTRA 1FS0G 2Q4PA 2B1GA 1JJ2U 4PA7A 3ZEDA 1PL0A 2QM7A 2EJRA 4DV0B 4JTAB 4B3SB 3CRQA 5E79Z 5DEDA 4ZHQA 3ABKC 3KZIZ 2CH7B 2OCHA 3LUTB 2UUBB 3ASNB 3OEHG 1JQ0A 5DM6V 2W6IG 3SJAC 1YIJV 3E2EA 2UU9B 3QO5A 1NTZH 1ZX3A 4MT8A 3VBBA 4I55A 4JI3B 2HP8A 3ZRWA 4I0XB 1IDSA 1MOFA 2XASA 1K9MW 1D2DA 4CS4A 1GN2A 3L75H 3UQ8A 4GCZA 2XAQA 3RW0A 3RYIB 1OCOB 2N05A 3FAVB 2IH1C 3HKDA 2OYQA 2OCCB 3T4ZA 1EFRG 3OR7C 4ZKIA 2ZNJA 4WFEA 3IAYA 4DO2A 1H38A 5K1XA 2EJ7A 2W0XA 4FLUA 2WAMA 4IIJA 2DN9A 1Z2GA 3AG2C 4JYAB 5LMNB 1VMGA 4LFCO 1QU7A 2PF4E 1L0NH 4K8XA 3KCXA 1F4NA 1LUVA 2GSMB 4DV6O 4GX0A 3OTFA 1U96A 2UXBO 3QG5A 3H01A 1GH6A 1YXBA 4Q20A 1RPRA 1Q5OA 4RWUA 4JI8O 3MHSC 4MVOA 3K5MA 3WB2A 2ZQMA 3CXCU 2QM4A 4X1KB 1CPYA 4YJ3A 4CH6A 4YJ2B 3FD9A 1FAFA 2CDYA 3ZN1A 5H9CA 3AK2A 4X20A 2IM9A 2YIBD 3HB3B 4UCTA 1YJ9V 1YSCA 3RWRD 5JQGA 3E22B 2A79B 4X64B 2NLJC 1N4CA 4B3MO 4WBNA 1NR1A 2YUAA 5D5QA 4X64O 5C8YA 2EX3A 4NR1A 3CD6V 1NKDA 3K5LA 1S72V 2VWJA 3Q4HB 4LFBB 5CN0A 1QHTA 5CB4A 3ZMSA 5EZYB 5ITZA 2KQXA 3F7YC 3BPZA 2WLNA 3T1HB 1YCIA 4X1IB 3B8MA 4I9WA 4YHHB 3K57A 5FLXN 4C7UA 2AZ2A 3UM7A 2LFSA 3L70H 4O2AA 4LF7B 4CS3A 1Q43A 2LGQA 4WFBV 1KQSU 1MG1A 3I5DA 2Y0IA 1FFXB 1IXMA 3CC4V 3IGAC 3A8TA 4MTXA 3TXQA 3CMAV 3CCJV 2DWDC 4X66O 1NS1A 4ABMA 1A32A 2UUCB 3DC6A 1VF5B 2Y69B 1TA8A 3X2QB 2OWOA 2IJHA 4RQEA 1RFYA 4JYCA 4MW8A 2BTOA 1R73A 1W0KG 2M6YA 1VQMV 2E5LO 1R3IC 5LA6A 2ETNA 4MTFA 1P49A 3GVMA 3TJTA 2ADQB 1WJZA 2PTMA 4J7ZA 5IY5B 2ZCEA 4B3MB 4IIJB 1AJPA 5CA1A 2X6BA 2ITCC 4DV2O 1YTFD 5H6QA 2UUAO 4I50A 4BIZA 1ZLZA 1XNQB 4NXMO 2FB5A 2YXHA 3ML0A 2P22C 3OE7G 1S77D 1VARA 4B3SO 3GWOA 2Y48A 3ABLC 3BFRA 1T5EA 3FAVA 3D8CA 1H2SB 2WLIB 4W4KA 2QWOB 2HVJC 4UCOA 2ZM6B 3LSQA 4GKKB 4W4LA 4JI1O 4OPHA 3N2KB 4DR6O 3JAWA 1KU9A 4YIOA 3ZN0A 2PYLA 5EZYA 2YICA 2ZE8A 4TWKA 3BEHA 3ZHQA 1M5IA 3BA8A 4UVCA 2A9HA 3HKBB 5JH7A 2P4KA 2DJVA 3ZRSA 2DE0X 2LW1A 1QR9A 3ABUA 3CP1A 3OGCC 4QNHB 2BOCC 4HAMA 5BMVB 2C2AA 3C90A 2YEVA 1QVFU 1BQ0A 3DTUB 4X65O 3P3PA 4NTYA 1FPOA 3OR6C 1S5HC 3CXHF 4JAVA 3W7SA 2YC0A 4X1KA 3SYOA 3J81N 4D6TH 4L8JA 4O2AB 4ZI7B 5IYBO 1NU1H 2Y4UA 4FLVA 1GM7A 5BY1A 1YJWV 5KHJA 1OCCC 5EBLC 3DC5A 2P90A 2HFEC 3TK1A 4OPAA 2KSDA 2A06H 5ITZB 2LW7A 1J95A 2B1IA 2PZSA 5GTIZ 5B5EZ 4DV1B 4GKJB 2FTKA 3CB2A 4JI4O 1ENVA 1GTOA 5IYZA 2R9RB 2XNDG 5L3DA 4DR7B 1FYJA 2E74B 1IBLB 1X4TA 2ADPA 2ZR3A 2QM8A 2JJ2G 3ABTA 4GZRB 3JSLA 3HPLC 3AEIA 1GK9A 3ZRWB 1AI7A 5BZBA 3OM3B 2P67A 3F7VC 4YJ3B 2R70A 3JD1A 3E86A 4B7EA 3J80N 5FPOA 4X65B 2JGDB 2LO1A 1BSMA 4PDMA 5JH7B 4N21A 5LP6A 4D7TA 4O4IB 4H0LB 4DV5O 2P06A 5H2FZ 1W59A 2NR5A 4OXSA 1IURA 1VEWA 1L8DA 1BHAA 4JAUA 4LWSB 5LMNO 5EIBD 1G8MA 1H2LA 2L6LA 5FNVB 4PV1B 5A2QN 5LYJB 1WA8A 5LGUA 1FFTB 3CYOA 3EVKA 2D3OW 4KP4A 3B4SA 2WLJA 4JYBA 5LBQA 4PI0A 3FYIB 5KHGA 5LXTB 1GN3A 1KP3A 1F51A 4GT1A 4FM1A 4J10A 3SJQC 1LR1A 1FD9A 3IFXA 4CC6A 3JYCA 2PY5A 2CK3G 3A0RA 1K3EA 2YIAA 2OTLV 3ETQA 3JARA 3G6BA 5IY5C 5CMUA 3ZX6A 1JVMA 5EBMC 3HKEA 5BXZA 4JASA 1BE3H 3CCUV 3IC9A 3CCSV 2XOKG 3AG4C 2EULA 4F4LA 2RNBA 2JEXA 3G80A 3IJ4A 4O2BA 4J9ZB 2Q8VA 5E1AC 3RYHB 5KHKA 1NI8A 2IU3A 4J9YB 4EB6A 3OTOB 2HR3A 2AHZA 1XL4A 4MTGA 1WAZA 2Z5UA 3CRRA 1U97A 1EN4A 2YDEA 4DR6B 3AG4B 4HNAA 2CGNA 4JI1B 3SDLA 1RSOA 2ZM6O 2Q6AA 2R72A 2VS0A 2AGAA 4U3FH 5IWAO 4IHJA 1Q7YW 3RT3C 1KP2A 3RYFB 4UXNA 4CZZA 1JFFA 1VP7A 5C93A 1N36O 1XEQA 2GTSA 4JI5B 4YY3B 3FB6C 1SRYA 3ZRVA 1VF6A 4UCRA 1DF5A 4X88A 1SERA 5KUMA 4DR7O 1BZKA 3D3QA 5IJ0A 4LF5O 1I7FA 1XDCA 1TVKB 2HLDG 3P32A 1VIBA 2OCCC 3NR7A 2CGOA 4AQYB 1TUEB 2L35A 5CA0B 4MTOA 3K0GA 2AZ0A 1YEWA 1QLEC 3D36A 1Y6XA 4K0KO 2ZXWC 1L0LH 4TUYA 3CE2A 5KUKA 3B09A 4RO2A 3MDSA 2V4DA 4DUYB 2CAZC 2GBOA 3B8NA 4G2KA 2YXLA 4LF4O 3CHXA 1CXZB 3GB7C 2QR4A 1NR7A 4FIPC 1KMIZ 4BW9A 1Q90D 1BL8A 4LF4B 2QKCA 1HW7A 4TQDA 1H2MA 4PA6A 1YTFB 1SQXH 1B06A 3T1HO 1UPGA 3O9OA 2V7QG 2HHHB 4Q6GA 1MMMA 3OEEG 5IWAB 3OW2U 2Q73A 2EINC 3B77A 1BHBA 4BW5A 1P84F 1JJOA 4B3TO 5CA1B 2WLLA 4PDLA 2F4VO 1ZWIC 1WN7A 5DN6G 2WLMA 4ZHQB 1EM1A 4GLXA 2Z0AA 1Y76A 4BAYA 2E76B 3CCLV 3H1LH 2X6AA 2ZE7A 2BE3A 2PI4A 1J5EB 1R3KC 4ZOLB 3SPHA 1RM1B 1NTMH 1L1FA 2ILMA 1TGOA 4DV5B 2AHYA 1RPOA 1Y66A 1BMFG 1YHQV 4IHJB 3FB7C 3GWKC 2Q7EA 3MD0A 1KC8W 1QBZA 2WA3A 4X1IA 5LMUO 1R6KA 4MVSA 1F7YA 3BVOA 2BSKB 4X1YA 4Z2WA 2XUMA 1PKXA 5IYDO 2R9AA 2PGGA 2UXNA 1DTOA 1HDJA 1GKFA 4I5SA 1S3JA 4P2ZA 1TVKA 2BTQB 4BR6A 4YY3O 3R65A 4JI5O 1AVMA 1MZFA 3WG7C 1YZBA 3F5TA 5B1NA 1VQ8V 2R9IA 3JATB 1SZXA 1SETA 4UB6Z 1AROP 2XTAA 2P7TC 3ZHUA 1B3QA 4EFEA 4DR1O
chains in the Genus database with same CATH topology
1OCRC 4WFHA 4TWKA 2JEUA 2WWWA 2QTOA 3BEHA 1THZA 1K4DC 2WLKA 2H94A 1GO3F 3QO8A 3CPWU 4UVCA 3K06A 2A9HA 1JX9A 1Q86W 2EIJB 1SZTA 2WLIA 1V55C 4FMTA 3ZIAG 3ZRSA 4U7OA 1SESA 1YJNV 1QR9A 3ABUA 3CP1A 4RUEA 1V54B 3OGCC 1VQKV 4QNHB 2BOCC 3K9AA 4HAMA 2C2AA 5L3FA 4P30A 3ZMZA 1JPXA 2YEVA 3JCZA 1QVFU 3NXSA 4MVUA 4ZBMA 4XDJA 3DTUB 3ZMUA 1K5QA 3OMNB 1NVPD 3SPGA 4PDRA 3I55V 3PJSK 4HYOA 3BY6A 3OR6C 1S5HC 4FK5C 4JAVA 3W7SA 5CBGA 4UVBA 5EBWC 5CBFA 1M57B 4JTDB 3SYOA 3QO7A 3DGEA 3JD3A 1K5SA 1PD3A 3ETEA 2X6CA 4HZ3A 3SYCA 5IYBO 4TT3G 1EBOA 1GM7A 1YJWV 2JDIG 1P4RA 3OMAB 1VQ4V 1OCCC 4MVZA 5EBLC 3CCVV 1F23A 5B1BB 1OZ0A 2P90A 2HFEC 2LFRA 4UVAA 3OAAG 3TK1A 4RUFA 3LDDA 3SYAA 1K4CC 2XAJA 3W7UA 1J95A 2HKOA 4R50A 1FXKA 2B1IA 1FXKB 4FPPA 5EC1C 4WCEV 3TCUA 3X2QC 3P30A 3CC2V 1YITV 4MSWC 5LGNA 1K8AW 2NNUA 4Z1MG 2FTKA 4ASUG 1ENVA 3ZJZA 3AG1C 3FYEB 4G28B 4L87A 1GTOA 3ETDA 5B3SC 1M1KW 2R9RB 3ASOB 2EIKB 2XNDG 5L3DA 5LHHA 1K92A 1R3JC 2ZR3A 2QM8A 2JJ2G 3K08A 3AG3C 3ABTA 4PDVA 4UUJC 5J9PC 4BIUA 3HPLC 1NH2B 3AEIA 3FKSG 1GK9A 1FXKC 4LP8A 2XAGA 3ZRWB 2A0LA 1AI7A 1E1QG 5BZBA 1FXHA 1QR8A 3OM3B 4EKWA 2P67A 2W0FC 3F7VC 1OCZC 2QEXV 2H8PC 2IJIA 3E86A 1OCOC 3JD1A 4DXWA 1JCHA 4PDMA 5B1AB 2JIZG 1OHHG 2MK3A 2ZR2A 4LC1A 3W7TA 1HWYA 4E2LA 2F43G 3JD0A 4X89A 1M90W 4N21A 4XDLA 2Q68A 3AG2B 3RBZA 5FL7G 3SYPA 2IH3C 4OXSA 4MS2A 4GX1A 3FB8C 1K73W 3M99B 3G71V 1BHAA 4JAUA 3SPIA 4R8CA 5L3CA 3E83A 3I56V 5IYCO 1P7BA 4RQFA 3WFVA 1XL6A 2DQ0A 2OT5A 1M56C 3OMIB 1G4YB 2JJ1G 1G8MA 4CBCA 1MABG 2IU0A 2W6JG 1V55B 4KFMA 2GHYA 2EZPA 3ABMC 1S0VA 5LGUA 3ETGA 1FFTB 3CYOA 2EILC 4PELA 2ZXWB 2ATKC 1VQNV 2XAFA 3E8FA 4MVQA 2D3OW 4KP4A 2ZDIA 5KA6A 2YEVB 5IDJA 4MW3A 4LCUC 2WLJA 4JYBA 4PA4A 5LBQA 3FYIB 1I5XA 1R3LC 1E79G 5L3EA 1PNMA 1CP9A 3TETA 1KP3A 1F51A 4N23A 4GT1A 2LP7A 4MVRA 4JGSA 3SJQC 1QCEA 3E89A 3IFXA 5H6RA 3JYCA 3T1CA 2P6JA 2B5UA 1AJNA 1H8HG 2CK3G 4UV8A 1ROPA 1AI6A 2XAHA 1K3EA 3A0RA 1I5YA 3T4DA 4RAIA 1AJQA 5LGTA 3JD2A 3CCEV 2EIMB 3MHHC 2HVKC 3SPJA 2EZOA 4QJFB 2OTLV 3G6EV 4QPKA 3RVZA 2EILB 2X0LA 5B1BC 5IY5C 1OCCB 5CMUA 3W7XA 4QE7A 1JVMA 5EBMC 4R7CA 1H2GA 2Q67A 4WF9V 1KD1W 5LHIA 4JASA 1FS0G 2UXXA 2B1GA 3CCUV 1JJ2U 4PA7A 3CCSV 2OTJV 2XOKG 3AG4C 1PL0A 2QM7A 2EJRA 4QE9A 4F4LA 3ZMTA 2EIJC 4JTAB 4QPJA 2JEXA 4TSFG 4J9ZB 3ABKC 5E1AC 3LUTB 3WG7B 3ASNB 1M9NA 3OEHG 5EK0A 3K3WA 1VQ6V 3D3IA 1VQ9V 1JQ0A 5DM6V 2IU3A 2W6IG 1YIJV 3E2EA 3QO5A 4J9YB 3AG3B 1V54C 4MT8A 3VBBA 1W0JG 2HR3A 2IJJA 4KUMA 4JTCB 1RM1C 2AHZA 3ZRWA 1XL4A 2V1DA 1OCRB 4MTGA 3RVYA 3VOUA 1MOFA 4YXWG 2Z5UA 2XASA 5CA3A 1K9MW 2DYSC 3AG4B 3LDEA 5KA5A 1Q7YW 4GCZA 2XAQA 3RW0A 1OCOB 2Q6AA 3K79A 2Q69A 4GX2A 2IH1C 2X7RB 3ABKB 2HJFC 1KP2A 2OCCB 1EFRG 3FB5C 4UXNA 3T4ZA 4CZZA 1NH2D 1GMGA 5HFLA 3OR7C 4ZKIA 5C93A 4WFEA 4DO2A 4QIWF 4U7NA 1H38A 3ASNC 1GM9A 2WAMA 1H8EG 4H37A 3AG2C 3E8GA 3FB6C 3OFNG 3ZMVA 1SRYA 1F4NA 3JD4A 4FJCC 3STLC 1NBMG 4XBFA 3ZRVA 1KECA 2QE7G 1VQPV 1AI4A 1DF5A 4X88A 1SERA 5KUMA 1E1RG 1DF4A 2DYSB 2GSMB 1WPXA 1K7DA 4GX0A 3ZCCA 4R6ZA 3K04A 3H01A 5CBHA 4Q20A 1RPRA 2HLDG 3P32A 2OCCC 1TUEB 3MHSC 2WLHA 4MVOA 3T2MA 3ABMB 3CCMV 2ZQMA 3CXCU 4MTOA 1CPYA 3K0GA 1CEZA 4JPRA 2KB1A 2HG5C 1QLEC 3D36A 1NQTA 2ZXWC 3ZN1A 5H9CA 5KUKA 1NJIW 1PNKA 4RO2A 2EBOA 2QKSA 3HB3B 1YJ9V 1YSCA 2EINB 1WLEA 3B8NA 3OUSA 4G2KA 2A79B 2NLJC 1KKDA 3GB7C 1NR7A 4FIPC 1NR1A 3CC7V 2EIMC 3LNMB 1BL8A 1K33A 5EC2C 1NVPB 2DQ3A 4P9OA 2EIKC 2PI5A 1K34A 3IC7A 2DW4A 3SYQA 3CCRV 3CD6V 5B3SB 4PA6A 1YTFB 1Q82W 1QLNA 3ZRXA 1QLEB 4PA9A 1NKDA 4GX5A 4H33A 1S76D 1S72V 2V7QG 3K0DA 3STZC 1DLBA 5CN0A 2ZDIC 3OEEG 3ZMSA 3OW2U 1PNLA 2EINC 3F7YC 3B77A 2ITDC 2WLNA 1BHBA 2Y69C 3B8MA 2DWEC 4I9WA 4BW5A 3LDCA 2IW5A 5L3GA 5HFMA 2JK5C 2WLLA 3UM7A 1W2BU 2LFSA 4PDLA 3ABLB 1ZWIC 2M7WA 5DN6G 3EHBB 2WLMA 2IJKA 1M56B 1EZJA 4WFBV 4MVMA 4XDKA 4BAYA 3G4SV 1KQSU 1MG1A 1F4MA 3CCLV 3EFFK 2X6AA 1IXMA 3QNEA 1B6QA 3CC4V 3IGAC 2PI4A 4MTXA 3CMAV 3CCJV 1AI5A 1R3KC 2DWDC 3SPHA 1RM1B 1N8RW 1L1FA 2Y69B 2BOBC 4P9PA 4WFFA 3X2QB 2Z3YA 2IJHA 2AHYA 5GW7A 1RPOA 5LHGA 1Y66A 4RQEA 5B1OA 1BMFG 1VQ7V 4JYCA 1YHQV 3F5WC 3FB7C 4JF3A 4MW8A 1AR1B 1R73A 1W0KG 3AG1B 1VQMV 1R3IC 3ASOC 3KG2A 2DYRB 3MD0A 4MTFA 1KC8W 4WFAV 1QBZA 1VQOV 5L3BA 5IY5B 3E8BA 1K97A 4WFGA 1R6KA 1AJPA 2X6BA 2ITCC 4MVSA 3CCQV 5H6QA 1YTFD 3LSSA 3E35A 1COWG 2WPDG 4G27B 4BIZA 2QA4V 1YI2V 1JOYA 1PKXA 5IYDO 3ML0A 3UKMA 2UXNA 3OE7G 1Q81W 1S77D 1VQLV 1DTOA 1LNQA 2K1EA 1GKFA 1M57C 1OCZB 4I5SA 3GWOA 1S3JA 2Y48A 4P2ZA 3ABLC 1GM8A 4X8AA 3W7WA 2WSSG 2WLIB 1QVGU 2DYRC 3R65A 5B1AC 1FXVA 1ORQC 2HVJC 2ZD9A 3SPCA 1UJWB 3LSQA 4PA3A 3WG7C 1Y4MA 3OUFA 4LBEC 4UV9A 5B1NA 3CMEV 2WLLB 1VQ8V 2R9IA 3E8HA 1R6NA 1VQ5V 3ZN0A 1MSWD 2YSUB 1SETA 3K03A 1AROP 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTO A;  1F4N A;  1RPR A;  1NKD A;  2GHY A;  1PD3 A;  1B6Q A;  1GMG A;  2IJJ A;  2IJH A;  3K79 A;  1F4M A;  4DO2 A;  2IJI A;  1ROP A;  1RPO A;  2IJK A; 
#chains in the Genus database with same CATH topology
 4WFH A;  4B3R B;  3BAB A;  3AK3 A;  1THZ A;  1K4D C;  1Z5V A;  1TUB A;  5BR8 O;  4ZOL A;  1N36 B;  5KHH A;  2EIJ B;  5D5P A;  5FPR A;  4FMT A;  1O9H A;  5KX5 B;  1PP9 H;  4PD4 F;  1EZV H;  1V54 B;  3N2G A;  4CH4 A;  4P30 A;  2ZT9 B;  1JPX A;  3JCZ A;  1IBK B;  3NXS A;  3KKY A;  4ZBM A;  4XDJ A;  1K5Q A;  4PDR A;  1Q8I A;  3PJS K;  1GRJ A;  3BY6 A;  4UVB A;  1XQ8 A;  3APQ A;  4NTX A;  3DGE A;  4O2B B;  1AP6 A;  3SYC A;  3L74 H;  2BCC H;  2JDI G;  5IJ9 B;  2NN4 A;  1OZ0 A;  2LFR A;  5J2U B;  1BQZ A;  5F2V O;  4K35 A;  3JAL B;  3LDD A;  3SYA A;  2CTQ A;  3CS5 A;  4R50 A;  2YI9 A;  1FXK B;  4WCE V;  4F6R B;  2LGW A;  3TCU A;  5CA0 A;  3X2Q C;  3CC2 V;  2QTS A;  1K8A W;  4LR3 A;  2HHH O;  2JGD A;  4Z1M G;  4IYI A;  4J80 A;  2UUC O;  1X59 A;  2JS3 A;  1N33 B;  3T1Y B;  1YF2 A;  3QVN A;  3H9V A;  5LHH A;  3SJC C;  1K92 A;  3K08 A;  3AG3 C;  2Y4T A;  4PDV A;  2ZIO A;  4U3J A;  5J9P C;  3JAK A;  4BIU A;  1Q6H A;  2Q5Z A;  4ZIB A;  1QR8 A;  4OGQ B;  4DUZ O;  1OCZ C;  2F93 B;  4LNU B;  5LOV B;  2H8P C;  1OCO C;  4K0K B;  3ICX A;  2Q9L A;  5B1A B;  2OIG A;  3DXR A;  2ZR2 A;  4LC1 A;  4B7K A;  3CX5 F;  3JD0 A;  1M90 W;  1AR5 A;  4XDL A;  1MSD A;  2Q68 A;  4FZ1 A;  3RBZ A;  1XMO O;  3SYP A;  3BA9 A;  2JS5 A;  4FVM A;  5JCO A;  3CWB H;  5EIB C;  1G1X B;  2VQE O;  1TAE A;  2GTA A;  4FFB A;  1SQV H;  5L3C A;  5LMU B;  3I56 V;  1SF9 A;  4O4H B;  1P7B A;  1WNS A;  2N74 A;  1XL6 A;  3AG7 A;  4CS2 A;  4CBC A;  3A0H Z;  3H1H H;  2QWQ B;  2ZKO A;  1V55 B;  4KFM A;  2EZP A;  4UCU A;  4PEL A;  2ZXW B;  2ATK C;  2QJ1 A;  2XAF A;  3KCY A;  4GKJ O;  5KA6 A;  2YEV B;  1HNW B;  3RFR A;  3JAT A;  1Z5W A;  1CP9 A;  2P4V A;  2ZIM A;  4NVP A;  2LP7 A;  4DV7 B;  4JGS A;  5H6R A;  1FFX A;  2QWP B;  1AJN A;  2FKX A;  3HKB A;  1I5Y A;  4RAI A;  3CCE V;  3L72 H;  3MHH C;  2HVK C;  3UT5 B;  3G6E V;  3JAR B;  4QPK A;  3RVZ A;  1IX9 A;  1OCC B;  4O4H A;  3W7X A;  4DV7 O;  4LF9 B;  5GTH Z;  4R7C A;  3VQY A;  5CB4 B;  1H2N A;  1XMQ O;  4EFB A;  2OTJ V;  2XHB A;  4QE9 A;  3ZMT A;  4QPJ A;  4ZI7 A;  4TSF G;  3C3T A;  4JI3 O;  2AW9 A;  1M9N A;  1VQ6 V;  4JI0 O;  3D3I A;  3E22 A;  3AG3 B;  1V54 C;  1XHZ A;  1HR0 B;  3JAK B;  4KUM A;  5DEC A;  4FM0 A;  4JTC B;  3ZHS A;  1OCR B;  1Y76 B;  3VOU A;  1IZ3 A;  2DYS C;  3LDE A;  1I94 B;  3N2G B;  2ARH A;  4DV3 B;  3K79 A;  2FML A;  2Q69 A;  4GX2 A;  3ABK B;  4I4T B;  3VQV A;  5HFL A;  2AXT Z;  4QIW F;  4F6R A;  3K5O A;  3M8A A;  1GM9 A;  2QWN B;  4H37 A;  4NXN O;  3E8G A;  3OFN G;  1FJG O;  3ZMV A;  4LF8 O;  3JD4 A;  4FJC C;  4XBF A;  1KEC A;  1VQP V;  1AI4 A;  3CRA A;  5IJ9 A;  5J2U A;  4LF8 B;  1K7D A;  3ZCC A;  1XBL A;  3K04 A;  5TIS Z;  5CBH A;  3RYF A;  1ZL8 A;  4UCV A;  2P5O A;  1XMQ B;  2OIE A;  3ABM B;  4HNA B;  3CCM V;  1YDX A;  4JPR A;  5GON B;  2HG5 C;  3Q4H A;  4J41 A;  1QQC A;  1XOU A;  5JCO C;  4FZ0 A;  3UT5 A;  1WLE A;  3FX7 A;  3OUS A;  1M4U A;  1N32 O;  1JR9 A;  3FFQ A;  2EIM C;  3LNM B;  3RGB A;  4WBN B;  1XMO B;  2DQ3 A;  4P9O A;  1K34 A;  2DW4 A;  3SYQ A;  4B3T B;  1SS3 A;  1QLN A;  3ZRX A;  4KHP B;  1YVW A;  4GX5 A;  3WB0 A;  1S76 D;  3K0D A;  1DLB A;  4DRX A;  4GYC B;  1XIL A;  4DV1 O;  1JFF B;  2Y69 C;  1N34 O;  4LH6 A;  2DWE C;  4AIL C;  2RMK B;  5L3G A;  2IW5 A;  5HFM A;  1R1B A;  2UU9 O;  2JK5 C;  1RSO B;  1W2B U;  1EN6 A;  2M7W A;  3EHB B;  4DK1 A;  1EZJ A;  4MVM A;  4XDK A;  3G4S V;  1FJG B;  2YID A;  2CUG A;  3EFF K;  1BCC H;  1AI5 A;  2JGU A;  3ZBH A;  4F6E A;  4FLX A;  1HNZ O;  4DR4 O;  3BHP A;  1P7G A;  2Z3Y A;  5J2T A;  3N2K A;  3ZS8 C;  3F5W C;  3HKD B;  4AI8 A;  4JF3 A;  1AR1 B;  3AG1 B;  1Q6I A;  3TXS A;  3KG2 A;  3M7M X;  4WFA V;  4FM2 A;  5L3B A;  4IYH A;  3H1J H;  1WP8 A;  4WFG A;  3CCQ V;  3LSS A;  1COW G;  2WPD G;  4TUY B;  5KHI A;  4G27 B;  4I55 B;  2QA4 V;  1YI2 V;  1JOY A;  4DV4 O;  1I0H A;  3WU2 Z;  3UKM A;  3HR0 A;  1Q81 W;  1LNQ A;  2K1E A;  1M57 C;  2A7W A;  1DK1 A;  3JSN A;  1GM8 A;  4LFC B;  5IT9 N;  4TOI A;  4FLY A;  2GDS A;  1FXV A;  1ORQ C;  5LA6 B;  2ZD9 A;  3SPC A;  1UJW B;  4PA3 A;  1Y4M A;  4LBE C;  1GN6 A;  4DV6 B;  1Y67 A;  2GV9 A;  3E8H A;  5LL6 Y;  5LXT A;  1NT2 B;  1PV0 A;  3K03 A;  5BR8 B;  1OCR C;  4JZG A;  2LQT A;  4JYA O;  4GUN A;  3QO8 A;  3K06 A;  4A5U B;  1JMK C;  1H2K A;  1V55 C;  4U7O A;  4LFA B;  2GUZ A;  3B2E E;  1YJN V;  1IBK O;  3CJH B;  1VQK V;  4O4I A;  5L3F A;  4JV5 O;  4X9Q A;  4MVU A;  3ZMU A;  3ZHR A;  3B40 A;  4FK5 C;  1HR0 O;  1M93 A;  4K8Z A;  1AR4 A;  5EBW C;  5CBF A;  2FYU H;  5LP6 B;  3QO7 A;  2UXC O;  3JD3 A;  3CRM A;  1K5S A;  4X66 B;  4JI0 B;  1PD3 A;  4TT3 G;  4DR1 B;  2YXY A;  4FLT A;  5JJE B;  5JWP A;  2QGN A;  3RYC A;  2YS8 A;  1P4R A;  4Z1V A;  4MVZ A;  2VWK A;  3CCV V;  3K59 A;  5IJ0 B;  1SKV A;  4TV8 B;  4LNU A;  2ZIN A;  4RUF A;  2UXC B;  2N04 A;  3W7U A;  3JAS B;  1URF A;  4LFB O;  1XRE A;  5KMG B;  2KKW A;  1HNX O;  3C3S A;  4LF9 O;  3P30 A;  1N0J A;  5JVD B;  1YIT V;  4MSW C;  4PI2 A;  5LGN A;  2NNU A;  4ASU G;  3K5N A;  2CTW A;  2F66 C;  4G28 B;  3ZJZ A;  4O4J B;  5B3S C;  1M1K W;  3ASO B;  4NXN B;  4FFB B;  4PJ0 Z;  2BSK A;  2B9Z A;  4X1Y B;  4J7K A;  3L71 H;  1NH2 B;  4JI7 O;  2A0L A;  1E1Q G;  1EN5 A;  5LYJ A;  3A2F A;  3BCC H;  1GN4 A;  3JAW B;  2DOS A;  3TGU H;  1SQB H;  4DXW A;  1JCH A;  4FFK A;  2JIZ G;  4JV5 B;  3W7T A;  1HWY A;  2GUZ B;  4E2L A;  2PUS A;  2RQ6 A;  5J2T B;  1SQQ H;  3AG2 B;  5BMV A;  4X62 O;  2Y0P A;  2VQE B;  4D7S A;  4MS2 A;  4I0X A;  4GX1 A;  3FB8 C;  1K73 W;  4KHP O;  3SPI A;  4TQF A;  1IBL O;  5KAI Z;  1SQG A;  4DR5 B;  1XNQ O;  4RQF A;  3WFV A;  1ZUQ A;  2OT5 A;  5EYP A;  1M56 C;  1N34 B;  5EYP B;  3UO2 A;  2W6J G;  2HJD A;  2GHY A;  4JI2 O;  4FLW A;  1VQN V;  2CE4 A;  1O9G A;  2ZDI A;  3LSU A;  3JAL A;  4DV3 O;  5JJJ B;  4NTW A;  4PA4 A;  4KXR A;  1VF6 C;  4NB5 A;  3VQX A;  1OJH A;  5LP6 C;  1QCE A;  3E89 A;  1IBM B;  2P6J A;  2B5U A;  1H8H G;  3L73 H;  4UV8 A;  1ROP A;  2XAH A;  3T4D A;  5AG2 A;  1AJQ A;  5IE9 A;  4IL6 Z;  2RN9 A;  4QJF B;  2O57 A;  2X0L A;  4DW1 A;  4J11 A;  2A3Q A;  2QDO A;  4NYK A;  3R66 A;  2UXX A;  2UXB B;  1NZ6 A;  4LF6 O;  2EIJ C;  4HBN A;  3OTO O;  3PN1 A;  1KUQ A;  4O4J A;  3DXR B;  1PPJ H;  3WG7 B;  5EK0 A;  3K3W A;  1MZE A;  3QTC A;  1VQ9 V;  1WB8 A;  1JA8 A;  2G38 A;  2UUB O;  2ZE6 A;  1W0J G;  2IJJ A;  1RM1 C;  4DV0 O;  2V1D A;  3JAS A;  4J7J A;  3RVY A;  4YXW G;  5K1P A;  5CA3 A;  1AIL A;  1HNW O;  1N33 O;  5KA5 A;  1ZSP A;  3OD4 A;  3RN4 A;  2DMX A;  3U10 A;  2X7R B;  4I4T A;  3FB5 C;  2HJF C;  1NH2 D;  2H3O A;  1GMG A;  2QSA A;  1XUQ A;  2F95 B;  4U7N A;  3ASN C;  3LNN A;  1V9P A;  3UCS C;  1H8E G;  1S5L Z;  4EB6 B;  3STL C;  1NBM G;  2QE7 G;  4E4E A;  1WA8 B;  1E1R G;  1DF4 A;  2DYS B;  4IGG A;  2RCV A;  1WPX A;  3S3W A;  4R6Z A;  5LOV A;  1ZL8 B;  1UFI A;  3SGI A;  3L9D A;  2K9P A;  2YIB A;  3SR2 C;  2WLH A;  3T2M A;  1AB3 A;  4DR4 B;  4LF6 B;  4LF5 B;  1DGS A;  4YJ2 A;  1CEZ A;  4JZ2 A;  2KB1 A;  1NQT A;  4I50 B;  4JI8 B;  4JI6 B;  1NJI W;  2UXD B;  1PNK A;  1SC5 B;  2EBO A;  2QKS A;  4DYL A;  2Q0O C;  4LWS A;  2EIN B;  4H44 B;  1KKD A;  3CC7 V;  1K33 A;  1B04 A;  4DUY O;  5EC2 C;  1NVP B;  4NXM B;  3WB1 A;  2EIK C;  3THO A;  3IC7 A;  2PI5 A;  4JI6 O;  3CCR V;  5B3S B;  4B3R O;  1Q82 W;  1I08 A;  1QLE B;  2F1M A;  4PA9 A;  1XHX A;  1Q3E A;  3O65 A;  1KKC A;  4H33 A;  3STZ C;  2ZDI C;  5H5N A;  4AQY O;  3HKC A;  1PNL A;  2E5L B;  2ITD C;  4IT5 A;  2Q7H A;  1HP8 A;  3CSX A;  1XI1 A;  3LDC A;  3SJB C;  4UB8 Z;  4JI7 B;  3ABL B;  4DW0 A;  1GAX A;  2VQF O;  1HNZ B;  2IJK A;  1M56 B;  2WA4 A;  1F4M A;  1BGY H;  3CRC A;  1Y74 A;  1N32 B;  1PM9 A;  3BRC A;  3QNE A;  2MW2 B;  1B6Q A;  4O4L A;  3EXA A;  5A9G A;  4UCS A;  2YI8 A;  1D5A A;  2PYJ A;  1N8R W;  4FLZ A;  3H1I H;  2BOB C;  1WP7 A;  4P9P A;  4WFF A;  4KL1 A;  5GW7 A;  4DR2 O;  5LHG A;  4GKK O;  5B1O A;  1VQ7 V;  2HEP A;  5JVD A;  1KBH A;  3ZHV A;  4DR2 B;  2QWR B;  3ASO C;  2DYR B;  3DSQ A;  4JYY A;  3RYH A;  1VQO V;  4TV9 B;  3E8B A;  4AHC A;  1K97 A;  3H1K H;  3E35 A;  3D36 C;  4PHZ A;  3T1Y O;  3JCU Z;  3AK1 A;  4U3J B;  4CH3 A;  4CH5 A;  1XNR B;  1VQL V;  2RJZ A;  4DV2 B;  1MNG A;  3N27 A;  1OCZ B;  4LH7 A;  3CEI A;  3W7W A;  4X8A A;  4JI2 B;  2WSS G;  1QVG U;  2DYR C;  5B1A C;  3MAQ A;  3OUF A;  4UV9 A;  3CME V;  2WLL B;  1AP5 A;  1HNX B;  1SQF A;  2FL4 A;  1LUW A;  2IBZ H;  1R6N A;  1VQ5 V;  1MSW D;  4YIP A;  2YSU B;  2E75 B;  1SA0 A;  2VQF B;  1MA1 A;  1OV9 A;  2JEU A;  2WWW A;  2QTO A;  2WLK A;  2ODM A;  2H94 A;  2XT9 A;  1GO3 F;  3CPW U;  1JX9 A;  1Q86 W;  3U11 A;  1SZT A;  2WLI A;  1IXB A;  3ZIA G;  5C8Y B;  1SES A;  4RUE A;  1G6U A;  5KMG A;  3K9A A;  2KG7 B;  3ZMZ A;  4CC5 A;  2LJ2 A;  1NVP D;  3OMN B;  3SPG A;  3HKC B;  4X20 B;  3I55 V;  4HYO A;  4DR3 O;  5CBG A;  1M57 B;  4JTD B;  1J5E O;  5JJN B;  3ZHT A;  1VF7 A;  1QNM A;  3ETE A;  4HZ3 A;  2X6C A;  2CH7 A;  1EBO A;  2VRZ A;  3OMA B;  1VQ4 V;  1F23 A;  5B1B B;  1XNR O;  3APO A;  4I9Q A;  3OT7 A;  4K3A A;  4UVA A;  3OAA G;  2RDC A;  1ZTE A;  1K4C C;  1N0N A;  2XAJ A;  1PL4 A;  2HKO A;  1R6T A;  4NKG B;  5FNV A;  1FXK A;  4OX9 O;  4FPP A;  5EC1 C;  1IVS A;  1KYO F;  4H13 B;  3CJH A;  2KG7 A;  3G67 A;  5KAF Z;  4BIO A;  3K9S A;  3S3X A;  1D5N A;  3AG1 C;  3FYE B;  4L87 A;  5IYZ B;  3ETD A;  1WB7 A;  4DV4 B;  2EIK B;  1R3J C;  3OGI B;  4UUJ C;  2F23 A;  2E3C A;  4LF7 O;  3FKS G;  2F4V B;  4LP8 A;  1FXK C;  2XAG A;  4I7Z B;  1SA0 B;  1FXH A;  2ZE5 A;  4EKW A;  2W0F C;  3VQW A;  2QEX V;  2IJI A;  1RP3 B;  1OHH G;  2MK3 A;  4X62 B;  1KB9 F;  4UFZ A;  2ZNI A;  5KX5 A;  2F43 G;  4DUZ B;  1I94 O;  4B08 A;  4X89 A;  3U0Z A;  1BS3 A;  5B66 Z;  3A0B Z;  5FL7 G;  1TUB B;  2Q7G A;  5KLV H;  2IH3 C;  1US6 A;  3K58 A;  3M99 B;  1Q6U A;  4DK0 A;  3G71 V;  5JQG B;  4R8C A;  2Q0A A;  3J7A U;  2QKA A;  3E83 A;  4TV9 A;  5IYC O;  3BAA A;  4TV8 A;  3QF7 A;  2DQ0 A;  3OMI B;  1G4Y B;  2JJ1 G;  4YHH O;  4EEQ A;  1MAB G;  2UUA B;  2BTQ A;  2JRI A;  2IU0 A;  3RYC B;  1IBM O;  3ABM C;  1S0V A;  3ETG A;  4OX9 B;  4QGP A;  2EIL C;  3P3N A;  3E8F A;  4MVQ A;  4BWA A;  4JI4 B;  5GON A;  1NTK H;  5IDJ A;  4MW3 A;  4LCU C;  4JAA A;  1I5X A;  3UO3 A;  1R3L C;  1E79 G;  4J42 A;  1PNM A;  5L3E A;  3TET A;  1FKA O;  4N23 A;  1BT8 A;  4MVR A;  4LFA O;  4ICG A;  3T1C A;  1Y74 B;  1SQP H;  4O4L B;  1AI6 A;  2JVD A;  5LGT A;  3JD2 A;  2D2C B;  2EIM B;  1WPB A;  2UXD O;  3SPJ A;  4DR5 O;  2EZO A;  2EIL B;  3JAM N;  4DR3 B;  5B1B C;  2CTP A;  1S5J A;  4QE7 A;  3HKE B;  1H2G A;  1ZAU A;  3RYI A;  2Q67 A;  4WF9 V;  1KD1 W;  4DRX B;  5LHI A;  2CTR A;  1FS0 G;  2Q4P A;  2B1G A;  1JJ2 U;  4PA7 A;  3ZED A;  1PL0 A;  2QM7 A;  2EJR A;  4DV0 B;  4JTA B;  4B3S B;  3CRQ A;  5E79 Z;  5DED A;  4ZHQ A;  3ABK C;  3KZI Z;  2CH7 B;  2OCH A;  3LUT B;  2UUB B;  3ASN B;  3OEH G;  1JQ0 A;  5DM6 V;  2W6I G;  3SJA C;  1YIJ V;  3E2E A;  2UU9 B;  3QO5 A;  1NTZ H;  1ZX3 A;  4MT8 A;  3VBB A;  4I55 A;  4JI3 B;  2HP8 A;  3ZRW A;  4I0X B;  1IDS A;  1MOF A;  2XAS A;  1K9M W;  1D2D A;  4CS4 A;  1GN2 A;  3L75 H;  3UQ8 A;  4GCZ A;  2XAQ A;  3RW0 A;  3RYI B;  1OCO B;  2N05 A;  3FAV B;  2IH1 C;  3HKD A;  2OYQ A;  2OCC B;  3T4Z A;  1EFR G;  3OR7 C;  4ZKI A;  2ZNJ A;  4WFE A;  3IAY A;  4DO2 A;  1H38 A;  5K1X A;  2EJ7 A;  2W0X A;  4FLU A;  2WAM A;  4IIJ A;  2DN9 A;  1Z2G A;  3AG2 C;  4JYA B;  5LMN B;  1VMG A;  4LFC O;  1QU7 A;  2PF4 E;  1L0N H;  4K8X A;  3KCX A;  1F4N A;  1LUV A;  2GSM B;  4DV6 O;  4GX0 A;  3OTF A;  1U96 A;  2UXB O;  3QG5 A;  3H01 A;  1GH6 A;  1YXB A;  4Q20 A;  1RPR A;  1Q5O A;  4RWU A;  4JI8 O;  3MHS C;  4MVO A;  3K5M A;  3WB2 A;  2ZQM A;  3CXC U;  2QM4 A;  4X1K B;  1CPY A;  4YJ3 A;  4CH6 A;  4YJ2 B;  3FD9 A;  1FAF A;  2CDY A;  3ZN1 A;  5H9C A;  3AK2 A;  4X20 A;  2IM9 A;  2YIB D;  3HB3 B;  4UCT A;  1YJ9 V;  1YSC A;  3RWR D;  5JQG A;  3E22 B;  2A79 B;  4X64 B;  2NLJ C;  1N4C A;  4B3M O;  4WBN A;  1NR1 A;  2YUA A;  5D5Q A;  4X64 O;  5C8Y A;  2EX3 A;  4NR1 A;  3CD6 V;  1NKD A;  3K5L A;  1S72 V;  2VWJ A;  3Q4H B;  4LFB B;  5CN0 A;  1QHT A;  5CB4 A;  3ZMS A;  5EZY B;  5ITZ A;  2KQX A;  3F7Y C;  3BPZ A;  2WLN A;  3T1H B;  1YCI A;  4X1I B;  3B8M A;  4I9W A;  4YHH B;  3K57 A;  5FLX N;  4C7U A;  2AZ2 A;  3UM7 A;  2LFS A;  3L70 H;  4O2A A;  4LF7 B;  4CS3 A;  1Q43 A;  2LGQ A;  4WFB V;  1KQS U;  1MG1 A;  3I5D A;  2Y0I A;  1FFX B;  1IXM A;  3CC4 V;  3IGA C;  3A8T A;  4MTX A;  3TXQ A;  3CMA V;  3CCJ V;  2DWD C;  4X66 O;  1NS1 A;  4ABM A;  1A32 A;  2UUC B;  3DC6 A;  1VF5 B;  2Y69 B;  1TA8 A;  3X2Q B;  2OWO A;  2IJH A;  4RQE A;  1RFY A;  4JYC A;  4MW8 A;  2BTO A;  1R73 A;  1W0K G;  2M6Y A;  1VQM V;  2E5L O;  1R3I C;  5LA6 A;  2ETN A;  4MTF A;  1P49 A;  3GVM A;  3TJT A;  2ADQ B;  1WJZ A;  2PTM A;  4J7Z A;  5IY5 B;  2ZCE A;  4B3M B;  4IIJ B;  1AJP A;  5CA1 A;  2X6B A;  2ITC C;  4DV2 O;  1YTF D;  5H6Q A;  2UUA O;  4I50 A;  4BIZ A;  1ZLZ A;  1XNQ B;  4NXM O;  2FB5 A;  2YXH A;  3ML0 A;  2P22 C;  3OE7 G;  1S77 D;  1VAR A;  4B3S O;  3GWO A;  2Y48 A;  3ABL C;  3BFR A;  1T5E A;  3FAV A;  3D8C A;  1H2S B;  2WLI B;  4W4K A;  2QWO B;  2HVJ C;  4UCO A;  2ZM6 B;  3LSQ A;  4GKK B;  4W4L A;  4JI1 O;  4OPH A;  3N2K B;  4DR6 O;  3JAW A;  1KU9 A;  4YIO A;  3ZN0 A;  2PYL A;  5EZY A;  2YIC A;  2ZE8 A;  4TWK A;  3BEH A;  3ZHQ A;  1M5I A;  3BA8 A;  4UVC A;  2A9H A;  3HKB B;  5JH7 A;  2P4K A;  2DJV A;  3ZRS A;  2DE0 X;  2LW1 A;  1QR9 A;  3ABU A;  3CP1 A;  3OGC C;  4QNH B;  2BOC C;  4HAM A;  5BMV B;  2C2A A;  3C90 A;  2YEV A;  1QVF U;  1BQ0 A;  3DTU B;  4X65 O;  3P3P A;  4NTY A;  1FPO A;  3OR6 C;  1S5H C;  3CXH F;  4JAV A;  3W7S A;  2YC0 A;  4X1K A;  3SYO A;  3J81 N;  4D6T H;  4L8J A;  4O2A B;  4ZI7 B;  5IYB O;  1NU1 H;  2Y4U A;  4FLV A;  1GM7 A;  5BY1 A;  1YJW V;  5KHJ A;  1OCC C;  5EBL C;  3DC5 A;  2P90 A;  2HFE C;  3TK1 A;  4OPA A;  2KSD A;  2A06 H;  5ITZ B;  2LW7 A;  1J95 A;  2B1I A;  2PZS A;  5GTI Z;  5B5E Z;  4DV1 B;  4GKJ B;  2FTK A;  3CB2 A;  4JI4 O;  1ENV A;  1GTO A;  5IYZ A;  2R9R B;  2XND G;  5L3D A;  4DR7 B;  1FYJ A;  2E74 B;  1IBL B;  1X4T A;  2ADP A;  2ZR3 A;  2QM8 A;  2JJ2 G;  3ABT A;  4GZR B;  3JSL A;  3HPL C;  3AEI A;  1GK9 A;  3ZRW B;  1AI7 A;  5BZB A;  3OM3 B;  2P67 A;  3F7V C;  4YJ3 B;  2R70 A;  3JD1 A;  3E86 A;  4B7E A;  3J80 N;  5FPO A;  4X65 B;  2JGD B;  2LO1 A;  1BSM A;  4PDM A;  5JH7 B;  4N21 A;  5LP6 A;  4D7T A;  4O4I B;  4H0L B;  4DV5 O;  2P06 A;  5H2F Z;  1W59 A;  2NR5 A;  4OXS A;  1IUR A;  1VEW A;  1L8D A;  1BHA A;  4JAU A;  4LWS B;  5LMN O;  5EIB D;  1G8M A;  1H2L A;  2L6L A;  5FNV B;  4PV1 B;  5A2Q N;  5LYJ B;  1WA8 A;  5LGU A;  1FFT B;  3CYO A;  3EVK A;  2D3O W;  4KP4 A;  3B4S A;  2WLJ A;  4JYB A;  5LBQ A;  4PI0 A;  3FYI B;  5KHG A;  5LXT B;  1GN3 A;  1KP3 A;  1F51 A;  4GT1 A;  4FM1 A;  4J10 A;  3SJQ C;  1LR1 A;  1FD9 A;  3IFX A;  4CC6 A;  3JYC A;  2PY5 A;  2CK3 G;  3A0R A;  1K3E A;  2YIA A;  2OTL V;  3ETQ A;  3JAR A;  3G6B A;  5IY5 C;  5CMU A;  3ZX6 A;  1JVM A;  5EBM C;  3HKE A;  5BXZ A;  4JAS A;  1BE3 H;  3CCU V;  3IC9 A;  3CCS V;  2XOK G;  3AG4 C;  2EUL A;  4F4L A;  2RNB A;  2JEX A;  3G80 A;  3IJ4 A;  4O2B A;  4J9Z B;  2Q8V A;  5E1A C;  3RYH B;  5KHK A;  1NI8 A;  2IU3 A;  4J9Y B;  4EB6 A;  3OTO B;  2HR3 A;  2AHZ A;  1XL4 A;  4MTG A;  1WAZ A;  2Z5U A;  3CRR A;  1U97 A;  1EN4 A;  2YDE A;  4DR6 B;  3AG4 B;  4HNA A;  2CGN A;  4JI1 B;  3SDL A;  1RSO A;  2ZM6 O;  2Q6A A;  2R72 A;  2VS0 A;  2AGA A;  4U3F H;  5IWA O;  4IHJ A;  1Q7Y W;  3RT3 C;  1KP2 A;  3RYF B;  4UXN A;  4CZZ A;  1JFF A;  1VP7 A;  5C93 A;  1N36 O;  1XEQ A;  2GTS A;  4JI5 B;  4YY3 B;  3FB6 C;  1SRY A;  3ZRV A;  1VF6 A;  4UCR A;  1DF5 A;  4X88 A;  1SER A;  5KUM A;  4DR7 O;  1BZK A;  3D3Q A;  5IJ0 A;  4LF5 O;  1I7F A;  1XDC A;  1TVK B;  2HLD G;  3P32 A;  1VIB A;  2OCC C;  3NR7 A;  2CGO A;  4AQY B;  1TUE B;  2L35 A;  5CA0 B;  4MTO A;  3K0G A;  2AZ0 A;  1YEW A;  1QLE C;  3D36 A;  1Y6X A;  4K0K O;  2ZXW C;  1L0L H;  4TUY A;  3CE2 A;  5KUK A;  3B09 A;  4RO2 A;  3MDS A;  2V4D A;  4DUY B;  2CAZ C;  2GBO A;  3B8N A;  4G2K A;  2YXL A;  4LF4 O;  3CHX A;  1CXZ B;  3GB7 C;  2QR4 A;  1NR7 A;  4FIP C;  1KMI Z;  4BW9 A;  1Q90 D;  1BL8 A;  4LF4 B;  2QKC A;  1HW7 A;  4TQD A;  1H2M A;  4PA6 A;  1YTF B;  1SQX H;  1B06 A;  3T1H O;  1UPG A;  3O9O A;  2V7Q G;  2HHH B;  4Q6G A;  1MMM A;  3OEE G;  5IWA B;  3OW2 U;  2Q73 A;  2EIN C;  3B77 A;  1BHB A;  4BW5 A;  1P84 F;  1JJO A;  4B3T O;  5CA1 B;  2WLL A;  4PDL A;  2F4V O;  1ZWI C;  1WN7 A;  5DN6 G;  2WLM A;  4ZHQ B;  1EM1 A;  4GLX A;  2Z0A A;  1Y76 A;  4BAY A;  2E76 B;  3CCL V;  3H1L H;  2X6A A;  2ZE7 A;  2BE3 A;  2PI4 A;  1J5E B;  1R3K C;  4ZOL B;  3SPH A;  1RM1 B;  1NTM H;  1L1F A;  2ILM A;  1TGO A;  4DV5 B;  2AHY A;  1RPO A;  1Y66 A;  1BMF G;  1YHQ V;  4IHJ B;  3FB7 C;  3GWK C;  2Q7E A;  3MD0 A;  1KC8 W;  1QBZ A;  2WA3 A;  4X1I A;  5LMU O;  1R6K A;  4MVS A;  1F7Y A;  3BVO A;  2BSK B;  4X1Y A;  4Z2W A;  2XUM A;  1PKX A;  5IYD O;  2R9A A;  2PGG A;  2UXN A;  1DTO A;  1HDJ A;  1GKF A;  4I5S A;  1S3J A;  4P2Z A;  1TVK A;  2BTQ B;  4BR6 A;  4YY3 O;  3R65 A;  4JI5 O;  1AVM A;  1MZF A;  3WG7 C;  1YZB A;  3F5T A;  5B1N A;  1VQ8 V;  2R9I A;  3JAT B;  1SZX A;  1SET A;  4UB6 Z;  1ARO P;  2XTA A;  2P7T C;  3ZHU A;  1B3Q A;  4EFE A;  4DR1 O; 
#chains in the Genus database with same CATH homology
 1OCR C;  4WFH A;  4TWK A;  2JEU A;  2WWW A;  2QTO A;  3BEH A;  1THZ A;  1K4D C;  2WLK A;  2H94 A;  1GO3 F;  3QO8 A;  3CPW U;  4UVC A;  3K06 A;  2A9H A;  1JX9 A;  1Q86 W;  2EIJ B;  1SZT A;  2WLI A;  1V55 C;  4FMT A;  3ZIA G;  3ZRS A;  4U7O A;  1SES A;  1YJN V;  1QR9 A;  3ABU A;  3CP1 A;  4RUE A;  1V54 B;  3OGC C;  1VQK V;  4QNH B;  2BOC C;  3K9A A;  4HAM A;  2C2A A;  5L3F A;  4P30 A;  3ZMZ A;  1JPX A;  2YEV A;  3JCZ A;  1QVF U;  3NXS A;  4MVU A;  4ZBM A;  4XDJ A;  3DTU B;  3ZMU A;  1K5Q A;  3OMN B;  1NVP D;  3SPG A;  4PDR A;  3I55 V;  3PJS K;  4HYO A;  3BY6 A;  3OR6 C;  1S5H C;  4FK5 C;  4JAV A;  3W7S A;  5CBG A;  4UVB A;  5EBW C;  5CBF A;  1M57 B;  4JTD B;  3SYO A;  3QO7 A;  3DGE A;  3JD3 A;  1K5S A;  1PD3 A;  3ETE A;  2X6C A;  4HZ3 A;  3SYC A;  5IYB O;  4TT3 G;  1EBO A;  1GM7 A;  1YJW V;  2JDI G;  1P4R A;  3OMA B;  1VQ4 V;  1OCC C;  4MVZ A;  5EBL C;  3CCV V;  1F23 A;  5B1B B;  1OZ0 A;  2P90 A;  2HFE C;  2LFR A;  4UVA A;  3OAA G;  3TK1 A;  4RUF A;  3LDD A;  3SYA A;  1K4C C;  2XAJ A;  3W7U A;  1J95 A;  2HKO A;  4R50 A;  1FXK A;  2B1I A;  1FXK B;  4FPP A;  5EC1 C;  4WCE V;  3TCU A;  3X2Q C;  3P30 A;  3CC2 V;  1YIT V;  4MSW C;  5LGN A;  1K8A W;  2NNU A;  4Z1M G;  2FTK A;  4ASU G;  1ENV A;  3ZJZ A;  3AG1 C;  3FYE B;  4G28 B;  4L87 A;  1GTO A;  3ETD A;  5B3S C;  1M1K W;  2R9R B;  3ASO B;  2EIK B;  2XND G;  5L3D A;  5LHH A;  1K92 A;  1R3J C;  2ZR3 A;  2QM8 A;  2JJ2 G;  3K08 A;  3AG3 C;  3ABT A;  4PDV A;  4UUJ C;  5J9P C;  4BIU A;  3HPL C;  1NH2 B;  3AEI A;  3FKS G;  1GK9 A;  1FXK C;  4LP8 A;  2XAG A;  3ZRW B;  2A0L A;  1AI7 A;  1E1Q G;  5BZB A;  1FXH A;  1QR8 A;  3OM3 B;  4EKW A;  2P67 A;  2W0F C;  3F7V C;  1OCZ C;  2QEX V;  2H8P C;  2IJI A;  3E86 A;  1OCO C;  3JD1 A;  4DXW A;  1JCH A;  4PDM A;  5B1A B;  2JIZ G;  1OHH G;  2MK3 A;  2ZR2 A;  4LC1 A;  3W7T A;  1HWY A;  4E2L A;  2F43 G;  3JD0 A;  4X89 A;  1M90 W;  4N21 A;  4XDL A;  2Q68 A;  3AG2 B;  3RBZ A;  5FL7 G;  3SYP A;  2IH3 C;  4OXS A;  4MS2 A;  4GX1 A;  3FB8 C;  1K73 W;  3M99 B;  3G71 V;  1BHA A;  4JAU A;  3SPI A;  4R8C A;  5L3C A;  3E83 A;  3I56 V;  5IYC O;  1P7B A;  4RQF A;  3WFV A;  1XL6 A;  2DQ0 A;  2OT5 A;  1M56 C;  3OMI B;  1G4Y B;  2JJ1 G;  1G8M A;  4CBC A;  1MAB G;  2IU0 A;  2W6J G;  1V55 B;  4KFM A;  2GHY A;  2EZP A;  3ABM C;  1S0V A;  5LGU A;  3ETG A;  1FFT B;  3CYO A;  2EIL C;  4PEL A;  2ZXW B;  2ATK C;  1VQN V;  2XAF A;  3E8F A;  4MVQ A;  2D3O W;  4KP4 A;  2ZDI A;  5KA6 A;  2YEV B;  5IDJ A;  4MW3 A;  4LCU C;  2WLJ A;  4JYB A;  4PA4 A;  5LBQ A;  3FYI B;  1I5X A;  1R3L C;  1E79 G;  5L3E A;  1PNM A;  1CP9 A;  3TET A;  1KP3 A;  1F51 A;  4N23 A;  4GT1 A;  2LP7 A;  4MVR A;  4JGS A;  3SJQ C;  1QCE A;  3E89 A;  3IFX A;  5H6R A;  3JYC A;  3T1C A;  2P6J A;  2B5U A;  1AJN A;  1H8H G;  2CK3 G;  4UV8 A;  1ROP A;  1AI6 A;  2XAH A;  1K3E A;  3A0R A;  1I5Y A;  3T4D A;  4RAI A;  1AJQ A;  5LGT A;  3JD2 A;  3CCE V;  2EIM B;  3MHH C;  2HVK C;  3SPJ A;  2EZO A;  4QJF B;  2OTL V;  3G6E V;  4QPK A;  3RVZ A;  2EIL B;  2X0L A;  5B1B C;  5IY5 C;  1OCC B;  5CMU A;  3W7X A;  4QE7 A;  1JVM A;  5EBM C;  4R7C A;  1H2G A;  2Q67 A;  4WF9 V;  1KD1 W;  5LHI A;  4JAS A;  1FS0 G;  2UXX A;  2B1G A;  3CCU V;  1JJ2 U;  4PA7 A;  3CCS V;  2OTJ V;  2XOK G;  3AG4 C;  1PL0 A;  2QM7 A;  2EJR A;  4QE9 A;  4F4L A;  3ZMT A;  2EIJ C;  4JTA B;  4QPJ A;  2JEX A;  4TSF G;  4J9Z B;  3ABK C;  5E1A C;  3LUT B;  3WG7 B;  3ASN B;  1M9N A;  3OEH G;  5EK0 A;  3K3W A;  1VQ6 V;  3D3I A;  1VQ9 V;  1JQ0 A;  5DM6 V;  2IU3 A;  2W6I G;  1YIJ V;  3E2E A;  3QO5 A;  4J9Y B;  3AG3 B;  1V54 C;  4MT8 A;  3VBB A;  1W0J G;  2HR3 A;  2IJJ A;  4KUM A;  4JTC B;  1RM1 C;  2AHZ A;  3ZRW A;  1XL4 A;  2V1D A;  1OCR B;  4MTG A;  3RVY A;  3VOU A;  1MOF A;  4YXW G;  2Z5U A;  2XAS A;  5CA3 A;  1K9M W;  2DYS C;  3AG4 B;  3LDE A;  5KA5 A;  1Q7Y W;  4GCZ A;  2XAQ A;  3RW0 A;  1OCO B;  2Q6A A;  3K79 A;  2Q69 A;  4GX2 A;  2IH1 C;  2X7R B;  3ABK B;  2HJF C;  1KP2 A;  2OCC B;  1EFR G;  3FB5 C;  4UXN A;  3T4Z A;  4CZZ A;  1NH2 D;  1GMG A;  5HFL A;  3OR7 C;  4ZKI A;  5C93 A;  4WFE A;  4DO2 A;  4QIW F;  4U7N A;  1H38 A;  3ASN C;  1GM9 A;  2WAM A;  1H8E G;  4H37 A;  3AG2 C;  3E8G A;  3FB6 C;  3OFN G;  3ZMV A;  1SRY A;  1F4N A;  3JD4 A;  4FJC C;  3STL C;  1NBM G;  4XBF A;  3ZRV A;  1KEC A;  2QE7 G;  1VQP V;  1AI4 A;  1DF5 A;  4X88 A;  1SER A;  5KUM A;  1E1R G;  1DF4 A;  2DYS B;  2GSM B;  1WPX A;  1K7D A;  4GX0 A;  3ZCC A;  4R6Z A;  3K04 A;  3H01 A;  5CBH A;  4Q20 A;  1RPR A;  2HLD G;  3P32 A;  2OCC C;  1TUE B;  3MHS C;  2WLH A;  4MVO A;  3T2M A;  3ABM B;  3CCM V;  2ZQM A;  3CXC U;  4MTO A;  1CPY A;  3K0G A;  1CEZ A;  4JPR A;  2KB1 A;  2HG5 C;  1QLE C;  3D36 A;  1NQT A;  2ZXW C;  3ZN1 A;  5H9C A;  5KUK A;  1NJI W;  1PNK A;  4RO2 A;  2EBO A;  2QKS A;  3HB3 B;  1YJ9 V;  1YSC A;  2EIN B;  1WLE A;  3B8N A;  3OUS A;  4G2K A;  2A79 B;  2NLJ C;  1KKD A;  3GB7 C;  1NR7 A;  4FIP C;  1NR1 A;  3CC7 V;  2EIM C;  3LNM B;  1BL8 A;  1K33 A;  5EC2 C;  1NVP B;  2DQ3 A;  4P9O A;  2EIK C;  2PI5 A;  1K34 A;  3IC7 A;  2DW4 A;  3SYQ A;  3CCR V;  3CD6 V;  5B3S B;  4PA6 A;  1YTF B;  1Q82 W;  1QLN A;  3ZRX A;  1QLE B;  4PA9 A;  1NKD A;  4GX5 A;  4H33 A;  1S76 D;  1S72 V;  2V7Q G;  3K0D A;  3STZ C;  1DLB A;  5CN0 A;  2ZDI C;  3OEE G;  3ZMS A;  3OW2 U;  1PNL A;  2EIN C;  3F7Y C;  3B77 A;  2ITD C;  2WLN A;  1BHB A;  2Y69 C;  3B8M A;  2DWE C;  4I9W A;  4BW5 A;  3LDC A;  2IW5 A;  5L3G A;  5HFM A;  2JK5 C;  2WLL A;  3UM7 A;  1W2B U;  2LFS A;  4PDL A;  3ABL B;  1ZWI C;  2M7W A;  5DN6 G;  3EHB B;  2WLM A;  2IJK A;  1M56 B;  1EZJ A;  4WFB V;  4MVM A;  4XDK A;  4BAY A;  3G4S V;  1KQS U;  1MG1 A;  1F4M A;  3CCL V;  3EFF K;  2X6A A;  1IXM A;  3QNE A;  1B6Q A;  3CC4 V;  3IGA C;  2PI4 A;  4MTX A;  3CMA V;  3CCJ V;  1AI5 A;  1R3K C;  2DWD C;  3SPH A;  1RM1 B;  1N8R W;  1L1F A;  2Y69 B;  2BOB C;  4P9P A;  4WFF A;  3X2Q B;  2Z3Y A;  2IJH A;  2AHY A;  5GW7 A;  1RPO A;  5LHG A;  1Y66 A;  4RQE A;  5B1O A;  1BMF G;  1VQ7 V;  4JYC A;  1YHQ V;  3F5W C;  3FB7 C;  4JF3 A;  4MW8 A;  1AR1 B;  1R73 A;  1W0K G;  3AG1 B;  1VQM V;  1R3I C;  3ASO C;  3KG2 A;  2DYR B;  3MD0 A;  4MTF A;  1KC8 W;  4WFA V;  1QBZ A;  1VQO V;  5L3B A;  5IY5 B;  3E8B A;  1K97 A;  4WFG A;  1R6K A;  1AJP A;  2X6B A;  2ITC C;  4MVS A;  3CCQ V;  5H6Q A;  1YTF D;  3LSS A;  3E35 A;  1COW G;  2WPD G;  4G27 B;  4BIZ A;  2QA4 V;  1YI2 V;  1JOY A;  1PKX A;  5IYD O;  3ML0 A;  3UKM A;  2UXN A;  3OE7 G;  1Q81 W;  1S77 D;  1VQL V;  1DTO A;  1LNQ A;  2K1E A;  1GKF A;  1M57 C;  1OCZ B;  4I5S A;  3GWO A;  1S3J A;  2Y48 A;  4P2Z A;  3ABL C;  1GM8 A;  4X8A A;  3W7W A;  2WSS G;  2WLI B;  1QVG U;  2DYR C;  3R65 A;  5B1A C;  1FXV A;  1ORQ C;  2HVJ C;  2ZD9 A;  3SPC A;  1UJW B;  3LSQ A;  4PA3 A;  3WG7 C;  1Y4M A;  3OUF A;  4LBE C;  4UV9 A;  5B1N A;  3CME V;  2WLL B;  1VQ8 V;  2R9I A;  3E8H A;  1R6N A;  1VQ5 V;  3ZN0 A;  1MSW D;  2YSU B;  1SET A;  3K03 A;  1ARO P;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...