1GMGA

Alanine 31 proline mutant of rop protein, monoclinic form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN ROP
publication title Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 23
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gmgA00
2IJKA 2IJHA 1NKDA 3K79A 1GTOA 1F4NA 1RPOA 4DO2A 1F4MA 1GMGA 1PD3A 1RPRA 2IJJA 2GHYA 1ROPA 1B6QA 2IJIA
chains in the Genus database with same CATH superfamily
1K92A 4NKGB 3EVKA 4DR1B 1VP7A 2EIMC 2K1EA 3L74H 1WAZA 5ITZB 3T1HO 3UO3A 3OEHG 5LOVB 4MT8A 4I50A 2JK5C 1YXBA 3AG4C 4X64O 1Q5OA 4B3MO 3AG3B 5IYCO 2QKCA 1JPXA 4FM2A 3W7TA 2WLNA 5L3EA 4WFEA 4G27B 4DV6O 3HKBA 2QWQB 2YSUB 1QU7A 4DR7B 1FAFA 3ZIAG 2QGNA 3HR0A 4R6ZA 4JTCB 4WFHA 3HKDB 1XILA 2XASA 4LFAB 1N32B 3A2FA 5JJNB 1N36B 3FKSG 2BTQA 4OPAA 4PA7A 4DK0A 3K06A 5LYJA 4PD4F 3JAKA 4BAYA 4JI6B 4X65B 1N33O 4B7EA 3MAQA 3JASB 4GUNA 2OCCB 2Q7EA 2PZSA 4MTGA 1Y74A 2GHYA 1KD1W 2ZXWC 2IJKA 2BTOA 1US6A 3G67A 3BY6A 1Y66A 4KHPO 4EFEA 1GO3F 2BOCC 1NKDA 4ZI7A 4QPJA 5J2TB 4CBCA 1PKXA 2Y4UA 5H2FZ 1Y76B 3APOA 2VQEB 3CCSV 2UUBB 1WN7A 3ZHUA 2ZE8A 4I9WA 2L35A 4LP8A 1H2LA 3HKEB 2X6BA 3ZX6A 2Q4PA 2QWOB 2A7WA 4BW5A 4FLXA 2PI5A 3W7WA 4DV2O 2FYUH 1U97A 1V9PA 2WLIB 3ETDA 2FB5A 2L6LA 1G1XB 4TQDA 2Y0PA 3OM3B 4LF4O 4X20B 3E35A 1ZL8B 3F5TA 1H2NA 1FD9A 4B7KA 3D36A 3PJSK 2JGDB 3CCUV 4K8ZA 3B2EE 4UFZA 1DF5A 1XL6A 5B3SC 3CC2V 2R70A 2NR5A 1R3JC 1BSMA 3D3IA 1GN4A 4DO2A 4PA4A 4FLZA 3C90A 4O4IB 1PNLA 1YJ9V 2CGNA 3B09A 3ABTA 4K8XA 3CWBH 1QVFU 1TVKA 4PDLA 4TV8B 4X88A 4J42A 2UUCB 2ZKOA 4JAAA 1NR7A 1XMQO 3B77A 4MVMA 4RWUA 4B3RB 1V54C 1YITV 3K5LA 2F95B 3CSXA 5LGNA 4ZBMA 1VIBA 4H33A 4PDMA 1IVSA 5L3FA 3OEEG 4MVZA 2JDIG 2Q67A 1FYJA 2CTQA 1DTOA 1W2BU 4GT1A 4O2BA 1YJWV 1KP2A 1XMOB 1R6TA 4TUYB 3SJBC 1Q6IA 4J9YB 3HKCB 5GONA 4WBNB 4DR2B 1P49A 2JIZG 1Y4MA 3SYOA 3LNNA 3WB2A 4B3SB 3FB6C 2WWWA 3LUTB 2ZM6B 2DN9A 2M7WA 4NVPA 3SJQC 1RM1C 3TJTA 1E1QG 3K9SA 3JALB 3DXRA 4PHZA 4MVSA 2X6AA 3GB7C 1W0JG 2ADQB 4QIWF 5DN6G 1XNQO 2OYQA 4YJ3A 5KA6A 2BOBC 3VBBA 1PNKA 3P32A 5EC1C 3T1YB 4LF5B 2D2CB 2R9RB 1GM7A 1DGSA 4JI4O 2QKAA 3F5WC 2E3CA 2CAZC 3L70H 2MK3A 2CH7A 2IM9A 2P6JA 2QDOA 1AVMA 3H1HH 5LMUO 4FLWA 2DW4A 2PY5A 4FZ1A 3KKYA 4I9QA 1P4RA 2UXCB 4WFFA 1Z2GA 3BA9A 4F6EA 2EZPA 3QTCA 4DR5O 3E8GA 3OFNG 4AQYO 4MW8A 4MTOA 1BQ0A 3N27A 4J7JA 4O2AB 1MA1A 3CCVV 3ZN0A 3MD0A 2F43G 4KXRA 2Y69C 3LNMB 4PA6A 2Y48A 3K9AA 3A8TA 1VQLV 3ZHVA 1VQPV 3DSQA 1NR1A 3TXSA 3E8BA 1IBMB 4KP4A 3H1IH 5BMVA 2PTMA 1M56C 2P7TC 3EXAA 4FK5C 1YF2A 2VQFB 1JQ0A 5B1NA 1RPRA 1NTKH 2ZNJA 3UQ8A 5FNVB 2XUMA 2QA4V 1WP8A 3E83A 3OAAG 1K5QA 2Q7HA 3DC6A 4NTYA 3RYCB 3K04A 1ZAUA 2GDSA 3QO8A 3FB7C 2WLLB 5LA6A 3OTOB 2XHBA 4NXNO 3WG7C 2ZE5A 5CN0A 2PYJA 3FX7A 4OXSA 2WLKA 5LXTA 3N2KB 1J95A 4I4TA 4P9OA 4K35A 4YJ2A 4DV4B 4DV5O 4JI8B 3BRCA 3OMNB 2DYSC 1WPBA 5KUKA 1XDCA 2W6JG 1OCZC 4TT3G 1XL4A 4O4HA 3G4SV 2P5OA 3NR7A 3U0ZA 4DV7B 1K97A 1GN3A 4U7NA 3TGUH 3QG5A 3ASOB 4UCVA 2WA4A 4YIPA 4J41A 1QQCA 5CA3A 1SETA 4JZGA 1BGYH 1GN2A 2X7RB 3FAVB 5LGTA 1GK9A 1I5YA 4N23A 5EIBD 4NTWA 5TISZ 1SQXH 3ETQA 2YC0A 5HFLA 3AG3C 1HP8A 1BCCH 3AG1B 4JYBA 1K8AW 4PDVA 4JI7B 1NS1A 2EJRA 1AJPA 2B9ZA 4LBEC 5K1XA 5LHHA 4LF7O 4Z2WA 5L3CA 1GKFA 2ETNA 4DR4B 2Y4TA 3AK3A 3ETGA 3E22B 4HYOA 2YIBA 2R72A 3MDSA 4JI1B 1QNMA 2ZE6A 1AROP 1F4NA 1QVGU 1O9HA 3OD4A 4DR6O 1ORQC 3AG2B 3L73H 4FFBB 4WCEV 4YIOA 2DQ0A 2ZD9A 2AW9A 5IYZB 4UVBA 3JYCA 2YIAA 1HNWB 3UT5B 5JVDB 1SQVH 2EX3A 3RYHA 1M57C 5J2UB 2Q73A 1W59A 1GRJA 2HR3A 5EZYA 2OCCC 2F93B 3FYIB 3O65A 3WB1A 5DM6V 4Q20A 4JI5O 1EZVH 4R8CA 3JATB 4I0XA 1OCCC 4JYAB 3ZMZA 5KMGB 1TUBB 4F6RB 3CCMV 2GUZA 5JH7A 2HG5C 3K0GA 3CHXA 2P4VA 1AR4A 3BABA 5KHKA 2UU9O 3ABMB 2ZIMA 4MVOA 2PUSA 1SQGA 1WNSA 4WFGA 1YIJV 2LGWA 3CMEV 1MMMA 5KX5A 1AB3A 5KHGA 4TV9B 1XEQA 1SA0B 2DWDC 3GWKC 3G71V 2XAHA 1J5EB 3DGEA 4DV3O 1S72V 3IFXA 3ZEDA 2P22C 1WA8A 3K0DA 2A06H 2HJFC 2EBOA 4X62B 1JMKC 4IYHA 1IBLB 2QKSA 1XUQA 3ZRSA 1BE3H 1NTZH 2R9IA 2YICA 3K5MA 5LP6B 2RN9A 2X6CA 2QM7A 2YXYA 4DR1O 5KHHA 4HNAB 4GKJB 4DK1A 3Q4HB 1OV9A 1YCIA 1R6KA 1FXHA 3U10A 3ZJZA 5IY5B 5BR8O 2ITCC 1Q6UA 2DYRC 2B1GA 2F1MA 4H0LB 4O4LB 3QO5A 4FMTA 4JI2O 1L0NH 1JVMA 3BAAA 1H2GA 3K59A 2YXHA 2EIJC 2LW1A 4JI0O 4TQFA 1H8HG 4LNUB 4DR7O 1AR5A 1BZKA 3F7YC 1GM8A 2ZNIA 4LFAO 5F2VO 1N32O 4QGPA 5H6QA 1RSOA 1FXKA 2LO1A 1N36O 3CCEV 4KFMA 1Q82W 4I50B 2AHZA 4GLXA 1H38A 5LBQA 3T1CA 1F23A 4EFBA 4JI6O 3ABKB 4TWKA 1K7DA 1YJNV 4W4KA 2QSAA 2EINC 5EC2C 4OX9O 4LH7A 4H13B 3CD6V 3IC9A 2OCHA 4X66B 3L75H 1NH2D 3JCUZ 4G2KA 4X1YA 2IBZH 2WA3A 2H94A 3BCCH 1OCOB 1NVPD 3FFQA 2F4VB 1WPXA 1ROPA 3ZHQA 1XNRB 3CRCA 2BTQB 5IJ0A 2P06A 4UCRA 4PJ0Z 5LYJB 3JAKB 2BSKA 1G4YB 2UXNA 3K5NA 4PDRA 4DUZO 4X64B 3OR6C 4G28B 3CJHA 5JWPA 4B3MB 2PF4E 1Y74B 4BIOA 1VQOV 4GZRB 2CTRA 3RGBA 3MHHC 4RQEA 4JI3O 4D6TH 5IWAO 1URFA 4DV6B 4ZI7B 3CMAV 4JYYA 1HDJA 1WP7A 4YY3B 2HKOA 4JGSA 4H37A 4QE7A 3SGIA 1Q90D 2QWRB 1NT2B 4CH4A 1I94B 3WU2Z 3M8AA 4FLUA 2UXDB 3RT3C 2E5LO 1ZTEA 5CB4A 2RNBA 3E8HA 1NZ6A 2UXBB 3CCRV 3SYCA 1VQKV 4J80A 3LDCA 1EM1A 1IXBA 2YI8A 5B1BB 1PPJH 2Q9LA 1PV0A 3BEHA 1YSCA 3G6BA 1JCHA 4DYLA 3T2MA 3BPZA 3JAWA 4I55A 3ZMSA 1N34B 5FPOA 1S0VA 1YHQV 3IGAC 2ITDC 1K34A 2JVDA 4KHPB 3B8MA 4DV1O 2FTKA 3RYFA 1SC5B 1JJ2U 3TCUA 1VF5B 4AILC 1XMOO 1AI4A 1QBZA 1FPOA 2YUAA 1XBLA 3ZHRA 2IJIA 1EZJA 2Q8VA 3ASOC 2KB1A 4RQFA 1NBMG 1ENVA 3X2QC 4B3SO 2JS5A 5LMNO 1KMIZ 1M4UA 2GV9A 2AZ0A 3K58A 3T4ZA 5B66Z 1D5AA 3J80N 2V4DA 1TVKB 5FLXN 3CXCU 1TA8A 3KZIZ 3TK1A 3UKMA 2NNUA 1E1RG 3H01A 2RDCA 1S5LZ 2F23A 4OPHA 4EEQA 1HR0O 1BQZA 1H2MA 2KG7A 3L71H 1DF4A 1WB7A 3AG1C 3ZBHA 4LF4B 4GKKB 4MTFA 3T1YO 3KG2A 4O2BB 4WFBV 3DC5A 3I56V 4K0KB 5CBHA 1GM9A 3W7UA 2LP7A 4U7OA 1OCRB 4NTXA 4DV0B 5GONB 2ILMA 2PI4A 4UVAA 5B1AC 2P67A 2YEVA 1MZEA 1OJHA 5KA5A 4ASUG 2WSSG 3CE2A 1V55C 3AG2C 4X1KA 3DXRB 3UCSC 4LWSA 3RYIA 4YJ3B 3AG4B 2CK3G 2IH1C 1SZXA 3CRAA 2WLJA 1S3JA 1XMQB 5JJJB 1Q81W 1VMGA 3ZRVA 2BE3A 1KU9A 2H3OA 1K5SA 5CBGA 2LFSA 1FJGO 1Q8IA 2CH7B 2KKWA 4LFBO 3ZRWA 1XI1A 5CA1A 1QLNA 1G8MA 3M7MX 3OUFA 5L3BA 2EIKB 4TSFG 1AR1B 4LC1A 2OIGA 1T5EA 3ASNB 2Y0IA 2JEUA 1R1BA 3GVMA 3WFVA 2BCCH 1N8RW 1KBHA 2ADPA 1K33A 3TETA 3RBZA 3ABMC 1XNQB 3OTOO 5K1PA 2DMXA 2IJHA 3H1LH 4L8JA 3UM7A 4UCUA 4BW9A 4U3JA 3LSUA 5C93A 4QPKA 2JGUA 4JI4B 2JRIA 4DR3O 1Y67A 1Q43A 4XBFA 3B8NA 5BMVB 2AGAA 1SQPH 3P3NA 3VQVA 4KUMA 5LMUB 1VQ6V 4LF9B 3THOA 2XT9A 3N2GA 2XAJA 3K08A 3EFFK 1MABG 2HEPA 3FB8C 2OTLV 5FNVA 2WLHA 3JD2A 5LA6B 4UV9A 2PYLA 4AQYB 1ZLZA 4AHCA 5IY5C 4EKWA 1YI2V 4QE9A 3OGIB 4FIPC 5D5PA 1GMGA 3OMIB 4F4LA 5LXTB 2N04A 4I4TB 2LW7A 2OIEA 4YJ2B 2D3OW 2W6IG 2GBOA 2Z5UA 2Z0AA 2GTSA 2CTPA 1FS0G 2LJ2A 4JZ2A 3S3XA 1A32A 1MSWD 3OR7C 4TOIA 2M6YA 3ZHTA 4O4HB 3FYEB 2FL4A 5GW7A 3ZRXA 4DR4O 1XHXA 2CDYA 1VF7A 4UCTA 5B3SB 2X0LA 3D3QA 3ZCCA 4X89A 4UVCA 1AP6A 4BR6A 1GTOA 4JI1O 5CA0A 3AEIA 4PV1B 4J9ZB 3ABLB 1PL4A 3TXQA 2B1IA 2HHHO 5LHGA 4FVMA 5EYPA 3FAVA 1L0LH 5IJ9A 4EB6A 5IDJA 1V54B 3JARA 1Z5VA 2P90A 1DLBA 4XDKA 4J7KA 3ZN1A 4MVQA 2HVJC 2N74A 4DRXA 4DW1A 5B1OA 5KAFZ 1MZFA 2Q7GA 4DV5B 2QTSA 2V7QG 4GX2A 4IL6Z 4PA9A 3RN4A 3CCQV 1OCOC 4O4JA 4JTAB 2QJ1A 1DK1A 5EBLC 1LNQA 3BVOA 1YVWA 1R3KC 1RM1B 3KCXA 3W7XA 3CCLV 3RYHB 4BWAA 3LSSA 4DUYO 2H8PC 4LH6A 3CRQA 4HAMA 5EZYB 1VQ5V 3ML0A 4LF6B 2RJZA 1KECA 4LR3A 1PL0A 4P30A 4XDLA 1FFXA 2UUAO 2UXXA 1ZSPA 4I0XB 1NJIW 1F7YA 4FFKA 2HLDG 2ZCEA 3SPJA 1KKCA 1UJWB 4D7SA 5E1AC 2QM4A 2GUZB 1JFFA 1P7BA 5JH7B 4Z1VA 1MNGA 4DR6B 2GSMB 3GWOA 3I55V 1K4DC 1UPGA 3OMAB 3CS5A 4IT5A 3ETEA 1TUEB 4NXMO 4GX1A 4HZ3A 1VQMV 3C3TA 3VQYA 3CRRA 1Q6HA 5JQGA 4IGGA 5KX5B 5LL6Y 2YIBD 2EJ7A 2ZINA 3ZMTA 1YTFD 2Y69B 1MOFA 1B6QA 1HNXB 1HNZB 5H5NA 1WA8B 1SF9A 2YXLA 4MTXA 2QE7G 2N05A 3LSQA 2A0LA 4ZOLA 1EFRG 1YEWA 4JI5B 1CEZA 2AZ2A 1IX9A 1FFTB 1CP9A 4X1IA 1XQ8A 2XAGA 4IHJA 1K73W 2IU3A 5D5QA 1HNZO 1M56B 4DXWA 1NH2B 1GAXA 4I5SA 2XNDG 3JSNA 5C8YA 4PI2A 1NVPB 4MVUA 4H44B 1BMFG 5IT9N 1S5JA 1IZ3A 4UCOA 3STZC 2P4KA 2YS8A 3P3PA 1EN4A 5JCOC 3WG7B 2K9PA 2RCVA 5KLVH 3CP1A 2QM8A 3AK2A 4YHHB 3JSLA 1Q86W 4NR1A 1IBKB 3PN1A 2CUGA 4DV3B 3A0RA 3F7VC 4NYKA 4JTDB 3BA8A 3UO2A 2LFRA 1H2SB 2DYSB 2EILB 5E79Z 1OCRC 1Y6XA 4PELA 4LCUC 1RSOB 4IIJA 4ZHQA 1M90W 4LF8B 3JCZA 1FXKB 4B3TB 4X65O 5ITZA 3DTUB 1NU1H 5BXZA 5LOVA 3APQA 1YZBA 1ZX3A 5J9PC 3JD1A 5BR8B 1AILA 4PI0A 1SZTA 3SJAC 2ZDIC 5EK0A 3QF7A 1UFIA 2IH3C 3HKBB 2DE0X 4NB5A 4CS3A 2JS3A 4JV5B 3K03A 4JI2B 3G6EV 2ARHA 4R50A 2WAMA 4WF9V 3H1JH 4UXNA 2Q68A 3NXSA 4JAVA 4QJFB 4D7TA 4X1YB 1QLEB 4JI0B 4LFCB 2VQEO 3SYAA 2DQ3A 4YY3O 4J11A 2UUBO 1E79G 2E75B 3HKDA 2CGOA 1X59A 3JD3A 1QR8A 4I7ZB 4CH3A 2EIKC 5IJ0B 2Z3YA 1K4CC 1O9GA 4J10A 3T1HB 1I94O 2JJ2G 3OT7A 1Q3EA 1AI7A 2UXDO 2BSKB 2LGQA 2IU0A 3ASNC 4IYIA 2UXBO 5L3DA 1RP3B 3CJHB 3JASA 3CRMA 5FPRA 3ZMVA 1M57B 4MS2A 3RFRA 4J7ZA 1VEWA 2Q5ZA 4OX9B 4U3FH 1N34O 1I08A 4ZHQB 5EIBC 1HW7A 2ODMA 1W0KG 4BIZA 2F66C 5J2TA 3E8FA 1Y76A 2RMKB 3VQWA 1M93A 1OCCB 4OGQB 2IJJA 3P30A 3H1KH 1I5XA 2YI9A 3RW0A 1SQQH 4L87A 1GH6A 5CB4B 1N33B 3HKEA 1AP5A 2QR4A 2XAQA 2XTAA 3E2EA 4Q6GA 3K5OA 1YDXA 2UUCO 1EN5A 3H9VA 4DUZB 4B3RO 2WLIA 3JAWB 5CMUA 4I55B 1I7FA 3CXHF 2A9HA 2LQTA 1BT8A 4JI3B 4X20A 1ZL8A 1XHZA 5IWAB 2FKXA 5DEDA 5HFMA 3CCJV 2G38A 4GKKO 3RYFB 5B5EZ 1THZA 2KQXA 2JGDA 3J81N 4K0KO 1JJOA 3ZHSA 1KB9F 2AHYA 3SPHA 4DR2O 3QO7A 4DV0O 1N0NA 2ZR3A 4GCZA 2ZM6O 1K9MW 2AXTZ 5BY1A 2E5LB 1H8EG 1G6UA 4O4IA 4DV2B 2DWEC 3JAMN 3QNEA 2GTAA 3OE7G 3SYPA 3VOUA 2FMLA 5IYDO 4E4EA 3ABLC 4TV8A 3ZMUA 2DYRB 3FD9A 4A5UB 3OW2U 2A3QA 1MSDA 5JCOA 4LF5O 1BHAA 2KG7B 3RWRD 3KCYA 4N21A 5A2QN 1VQ4V 2DJVA 1CXZB 1Z5WA 1GN6A 2EIJB 3CYOA 4DV1B 3E89A 3A0HZ 3EHBB 4UV8A 4JPRA 1VARA 3IAYA 1NQTA 4TUYA 1IURA 1JA8A 2YEVB 4YXWG 3HKCA 4WBNA 2EIMB 2VWKA 3R65A 2Q69A 2Q6AA 3HB3B 2UXCO 2HP8A 4UB8Z 2JEXA 4X1KB 4LWSB 3RYIB 5LMNB 3JALA 3BFRA 4FLVA 3I5DA 4ZKIA 4P9PA 1NI8A 3CC4V 2ZE7A 1WB8A 3ICXA 2ZDIA 1M9NA 4GYCB 4C7UA 1OHHG 2VWJA 2EINB 3L9DA 4CS4A 3STLC 1HR0B 3IJ4A 1IBMO 3CX5F 1BS3A 1SS3A 3ZRWB 5KHIA 5CA1B 4FLYA 4CZZA 4GX5A 4RUEA 1QCEA 2VQFO 3WB0A 5L3GA 3W7SA 1ZWIC 1B3QA 5JJEB 1B06A 4W4LA 4LF9O 2A79B 3FB5C 4R7CA 2XOKG 4RAIA 2OTJV 2OWOA 5LHIA 3S3WA 3JD0A 4O2AA 1KUQA 2ZXWB 5EBWC 3K79A 4MW3A 1SQBH 3K57A 4U3JB 4K3AA 4DV4O 3QVNA 4JI8O 1KP3A 1TAEA 1FJGB 1IXMA 1M1KW 1K3EA 2KSDA 3CEIA 2HFEC 2PGGA 1L1FA 4LFBB 3CC7V 2CE4A 4CS2A 3B4SA 4DV7O 1VQ7V 3N2GB 5AG2A 1ZUQA 5LP6C 5A9GA 1D2DA 1SKVA 4DR5B 3B40A 3IC7A 4JASA 3ZS8C 3RYCA 1VF6C 4XDJA 3SPCA 2W0XA 4DW0A 5KAIZ 2EZOA 2ZR2A 2WLLA 2C2AA 1S76D 1L8DA 1WLEA 1NTMH 2VS0A 5H6RA 1KC8W 4KL1A 1LUWA 4FJCC 2QEXV 4JI7O 1SQFA 4ICGA 3N2KA 2NN4A 5IYBO 5BZBA 2MW2B 3T4DA 4MVRA 3A0BZ 4DR3B 4CC6A 4JF3A 5KHJA 1KQSU 1AJNA 3E86A 1P7GA 3LDEA 3SPGA 2EILC 1PP9H 3OUSA 4FM1A 5CA0B 4X8AA 1B04A 1FXKC 4UB6Z 4BIUA 2E76B 4JYCA 3SPIA 3CPWU 1VQ9V 2QWPB 1F51A 1HNWO 3X2QB 4NXNB 2HJDA 5EBMC 1Q7YW 1SRYA 1HWYA 2YDEA 3ABKC 3M99B 3SDLA 2NLJC 5EYPB 1I0HA 4CC5A 5IJ9B 4EB6B 3K3WA 3JARB 3OGCC 3JD4A 1AI6A 4CH6A 4DRXB 2Q0OC 4LF6O 1U96A 4AI8A 3OTFA 2ZT9B 3R66A 1S5HC 4JYAO 1YTFB 1AJQA 1QLEC 2RQ6A 3E22A 1JX9A 4O4JB 5B1AB 2E74B 2QTOA 4P2ZA 1R3IC 4FFBA 3ABUA 1V55B 4ABMA 5IYZA 1EN6A 4B08A 4FPPA 3UT5A 1S77D 5JVDA 2QWNB 1COWG 5J2UA 2HHHB 1N4CA 1R73A 1VQ8V 2ZIOA 2JJ1G 3SYQA 1J5EO 1M5IA 5LGUA 4UCSA 2IW5A 1PNMA 1XREA 2EULA 1KKDA 4Z1MG 1EBOA 1AI5A 4LF7B 3U11A 1HNXO 1FFXB 1MG1A 4FZ0A 4FM0A 4X62O 3JATA 3LDDA 2O57A 4GX0A 5GTHZ 1P84F 2R9AA 4JAUA 4MSWC 3VQXA 1IBLO 1SERA 4QNHB 5KMGA 1JFFB 3SR2C 1TUBA 1R6NA 4F6RA 5KUMA 1BHBA 4PA3A 4GKJO 4X9QA 3AG7A 5CBFA 1RFYA 2W0FC 5IE9A 1WJZA 5B1BC 4FLTA 3AK1A 5JQGB 1FKAO 1H2KA 4DUYB 2YIDA 1CPYA 4TV9A 1QHTA 3CB2A 2HVKC 1SA0A 1TGOA 4ZOLB 1FXVA 3D36C 4YHHO 4RO2A 2B5UA 2WPDG 1IBKO 4X1IB 2UUAB 3L72H 4IHJB 1LUVA 3G80A 3MHSC 1X4TA 4CH5A 5GTIZ 1XOUA 1VQNV 5C8YB 2UU9B 1BL8A 4LF8O 1KYOF 2Q0AA 5LP6A 1QR9A 4HNAA 1R3LC 2ZQMA 4B3TO 4UUJC 3Q4HA 4RUFA 3SJCC 1PD3A 1PM9A 4NXMB 3HPLC 1VF6A 3O9OA 2ATKC 1N0JA 5DECA 2WLMA 4HBNA 4O4LA 3C3SA 1JOYA 2CTWA 1IDSA 5H9CA 4E2LA 1LR1A 2OT5A 4X66O 4JV5O 1OZ0A 4WFAV 3RVZA 3J7AU 1OCZB 3D8CA 1RPOA 2VRZA 3RVYA 2XAFA 1D5NA 4LNUA 2F4VO 1JR9A 5FL7G 4LFCO 1F4MA 2DOSA 2V1DA 1XNRO 3BHPA 1SESA 4ZIBA 4IIJB
chains in the Genus database with same CATH topology
4UVBA 1K92A 2IJHA 3JYCA 1THZA 3UM7A 2EIMC 2K1EA 1M57C 5C93A 4QPKA 2AHYA 3SPHA 2HR3A 3OEHG 4MT8A 2JK5C 2OCCC 3QO7A 4XBFA 2ZR3A 3B8NA 3AG4C 3FYIB 4GCZA 5DM6V 1K9MW 4Q20A 3AG3B 5IYCO 1H8EG 1JPXA 4KUMA 1VQ6V 3W7TA 2WLNA 2DWEC 5L3EA 4R8CA 4WFEA 4G27B 3QNEA 3OE7G 3SYPA 3VOUA 2XAJA 5IYDO 1OCCC 3ABLC 3K08A 2YSUB 3EFFK 1MABG 3ZMUA 3ZMZA 2DYRB 3FB8C 3OW2U 2OTLV 3ZIAG 4R6ZA 2WLHA 4JTCB 1BHAA 4WFHA 3JD2A 3CCMV 4UV9A 2HG5C 5IY5C 2XASA 3K0GA 4N21A 4EKWA 1YI2V 1VQ4V 4QE9A 1GMGA 4FIPC 3ABMB 2EIJB 3OMIB 4MVOA 3CYOA 4F4LA 3E89A 3FKSG 3EHBB 4PA7A 4UV8A 4WFGA 4JPRA 1YIJV 1NQTA 3K06A 3CMEV 4BAYA 2D3OW 2W6IG 2YEVB 4YXWG 2EIMB 2DWDC 2Z5UA 1MSWD 3R65A 1FS0G 3OR7C 3G71V 2XAHA 3DGEA 2Q69A 2Q6AA 3FYEB 3HB3B 1S72V 3IFXA 2JEXA 5GW7A 3ZRXA 2OCCB 3K0DA 4MTGA 5B3SB 2HJFC 2EBOA 2X0LA 2GHYA 3ZCCA 1KD1W 2ZXWC 2IJKA 4X89A 4ZKIA 4UVCA 4P9PA 1GTOA 3BY6A 3CC4V 1Y66A 1GO3F 3CCJV 2BOCC 1NKDA 2ZDIA 2QKSA 3ZRSA 4QPJA 1M9NA 3AEIA 4J9ZB 1OHHG 3ABLB 4CBCA 1PKXA 2EINB 2R9IA 3STLC 3CCSV 2B1IA 5LHGA 2X6CA 2QM7A 5IDJA 4I9WA 3ZRWB 1R6KA 1FXHA 3ZJZA 1V54B 5IY5B 2ITCC 4LP8A 2P90A 1DLBA 4XDKA 2DYRC 2B1GA 4MVQA 3ZN1A 2HVJC 4CZZA 2X6BA 4GX5A 4RUEA 5B1OA 1QCEA 3QO5A 4BW5A 5L3GA 3W7SA 4FMTA 2PI5A 1JVMA 1ZWIC 2V7QG 4GX2A 3W7WA 1H2GA 4PA9A 3ETDA 2WLIB 2EIJC 2A79B 3CCQV 1OCOC 3FB5C 4R7CA 2XOKG 4RAIA 2OTJV 1H8HG 4JTAB 5LHIA 3OM3B 5EBLC 3E35A 1LNQA 3JD0A 3F7YC 2ZXWB 1R3KC 1GM8A 5EBWC 1RM1B 3K79A 4MW3A 3D36A 3PJSK 5H6QA 3CCLV 3W7XA 3CCUV 1FXKA 3LSSA 2H8PC 1DF5A 4HAMA 1XL6A 5B3SC 4KFMA 3CCEV 1Q82W 3CC2V 2AHZA 1H38A 5LBQA 1VQ5V 1KP3A 3T1CA 1IXMA 1R3JC 1F23A 3ML0A 1K3EA 1L1FA 1M1KW 2HFEC 3D3IA 4DO2A 3CC7V 4PA4A 3ABKB 4TWKA 1K7DA 1PNLA 1KECA 1YJ9V 1YJNV 1VQ7V 1PL0A 4P30A 4XDLA 2EINC 5EC2C 2UXXA 1NJIW 3ABTA 1QVFU 2HLDG 4PDLA 4X88A 3CD6V 3IC7A 1NR7A 3B77A 4MVMA 3SPJA 4JASA 1UJWB 1NH2D 1V54C 4XDJA 4G2KA 1YITV 5E1AC 3SPCA 1P7BA 2EZOA 2ZR2A 4ZBMA 5LGNA 2WLLA 4H33A 2C2AA 4PDMA 5L3FA 2H94A 1S76D 3OEEG 2GSMB 4MVZA 2JDIG 1OCOB 3GWOA 3I55V 1NVPD 2Q67A 1WLEA 1WPXA 1ROPA 1K4DC 3OMAB 1DTOA 5H6RA 1W2BU 1KC8W 4GT1A 3ETEA 1TUEB 4FJCC 4GX1A 4HZ3A 1YJWV 1KP2A 2QEXV 1VQMV 5IYBO 5BZBA 3T4DA 4J9YB 1G4YB 4MVRA 2UXNA 2JIZG 3ZMTA 1Y4MA 3SYOA 1YTFD 4PDRA 2Y69B 1MOFA 1B6QA 3FB6C 2WWWA 3OR6C 3LUTB 4G28B 4JF3A 2M7WA 3SJQC 1RM1C 1E1QG 4MTXA 1KQSU 2QE7G 1AJNA 3E86A 3LDEA 2A0LA 3LSQA 1EFRG 3SPGA 1CEZA 1VQOV 1FFTB 2EILC 4MVSA 2X6AA 1CP9A 3GB7C 1W0JG 3MHHC 4RQEA 3OUSA 4QIWF 5DN6G 2XAGA 4X8AA 1FXKC 5KA6A 2BOBC 4BIUA 4JYCA 2IU3A 3SPIA 3CPWU 3VBBA 1K73W 1VQ9V 1M56B 4DXWA 1F51A 3CMAV 1NH2B 1PNKA 3X2QB 2HKOA 4JGSA 5EBMC 1Q7YW 4H37A 3P32A 5EC1C 4I5SA 2XNDG 1SRYA 1HWYA 3ABKC 3M99B 4QE7A 2NLJC 2R9RB 1GM7A 3F5WC 1NVPB 4MVUA 1BMFG 3K3WA 2MK3A 3STZC 3OGCC 2P6JA 3JD4A 1AI6A 3E8HA 3WG7B 2DW4A 3CCRV 3SYCA 1VQKV 3LDCA 1S5HC 3CP1A 2QM8A 1YTFB 1AJQA 5B1BB 1Q86W 1QLEC 1P4RA 3BEHA 4WFFA 3A0RA 1YSCA 3F7VC 1JX9A 1JCHA 2EZPA 4JTDB 3T2MA 3E8GA 3OFNG 3ZMSA 5B1AB 4MW8A 2LFRA 4MTOA 1S0VA 1YHQV 3IGAC 2DYSB 2QTOA 2ITDC 1K34A 4P2ZA 3CCVV 2EILB 1R3IC 3B8MA 3ZN0A 3MD0A 3ABUA 2FTKA 1OCRC 2F43G 4PELA 4LCUC 1V55B 2Y69C 1M90W 1JJ2U 3LNMB 4PA6A 3JCZA 1FXKB 3TCUA 4FPPA 1S77D 2Y48A 3K9AA 1VQLV 1COWG 1VQPV 3DTUB 1NR1A 1AI4A 1QBZA 1R73A 3E8BA 1VQ8V 2IJIA 2JJ1G 5J9PC 4KP4A 3SYQA 3JD1A 1EZJA 5LGUA 1SZTA 2IW5A 1PNMA 2ZDIC 3ASOC 5EK0A 2KB1A 1KKDA 4Z1MG 1EBOA 4RQFA 1AI5A 1M56C 1NBMG 2IH3C 2P7TC 1ENVA 4FK5C 3X2QC 1MG1A 1JQ0A 5B1NA 1RPRA 3T4ZA 3K03A 3LDDA 4GX0A 3G6EV 2QA4V 4JAUA 4R50A 3E83A 2WAMA 3OAAG 4MSWC 4WF9V 1K5QA 1SERA 4UXNA 2Q68A 3NXSA 3TK1A 4JAVA 3K04A 4QNHB 4QJFB 3UKMA 2NNUA 1E1RG 3H01A 3QO8A 3FB7C 1R6NA 2WLLB 1QLEB 5KUMA 3SYAA 1BHBA 2DQ3A 1DF4A 1E79G 3AG1C 4PA3A 3WG7C 4MTFA 5CN0A 3KG2A 3JD3A 4OXSA 5CBFA 2W0FC 1QR8A 4WFBV 2WLKA 2EIKC 3I56V 2Z3YA 1K4CC 5CBHA 1GM9A 5B1BC 3W7UA 2LP7A 4U7OA 1J95A 2JJ2G 4P9OA 1AI7A 1OCRB 2PI4A 2IU0A 4UVAA 5B1AC 3ASNC 2P67A 2YEVA 1CPYA 3OMNB 2DYSC 2HVKC 5L3DA 5KUKA 2W6JG 5KA5A 4ASUG 1OCZC 2WSSG 1XL4A 4TT3G 3G4SV 1FXVA 3ZMVA 1M57B 4MS2A 1V55C 3AG2C 1K97A 4RO2A 2B5UA 2WPDG 4U7NA 3ASOB 3AG4B 2CK3G 2IH1C 2WLJA 1S3JA 5CA3A 1SETA 1Q81W 3MHSC 1W0KG 2X7RB 5LGTA 4BIZA 3E8FA 3ZRVA 1GK9A 1I5YA 4N23A 1VQNV 1BL8A 1K5SA 5CBGA 1OCCB 2LFSA 2IJJA 3P30A 1I5XA 1QR9A 2ZQMA 1R3LC 3AG3C 5HFLA 4UUJC 3RW0A 4RUFA 4L87A 3AG1B 4JYBA 1PD3A 3ZRWA 3HPLC 1K8AW 4PDVA 1QLNA 2EJRA 1G8MA 3OUFA 5L3BA 2EIKB 2ATKC 4TSFG 2WLMA 2XAQA 1AJPA 1JOYA 4LBEC 5H9CA 5LHHA 1AR1B 3E2EA 4LC1A 4E2LA 5L3CA 1GKFA 2OT5A 3ETGA 3ASNB 4HYOA 2JEUA 1OZ0A 4WFAV 2WLIA 5CMUA 3WFVA 3RVZA 1N8RW 1AROP 1OCZB 1F4NA 1RPOA 1K33A 2A9HA 3TETA 1QVGU 3RBZA 3ABMC 1ORQC 3RVYA 2XAFA 3AG2B 5FL7G 4WCEV 1F4MA 2V1DA 2DQ0A 2ZD9A 5HFMA 1SESA 3CXCU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJK A;  2IJH A;  1NKD A;  3K79 A;  1GTO A;  1F4N A;  1RPO A;  4DO2 A;  1F4M A;  1GMG A;  1PD3 A;  1RPR A;  2IJJ A;  2GHY A;  1ROP A;  1B6Q A;  2IJI A; 
#chains in the Genus database with same CATH topology
 1K92 A;  4NKG B;  3EVK A;  4DR1 B;  1VP7 A;  2EIM C;  2K1E A;  3L74 H;  1WAZ A;  5ITZ B;  3T1H O;  3UO3 A;  3OEH G;  5LOV B;  4MT8 A;  4I50 A;  2JK5 C;  1YXB A;  3AG4 C;  4X64 O;  1Q5O A;  4B3M O;  3AG3 B;  5IYC O;  2QKC A;  1JPX A;  4FM2 A;  3W7T A;  2WLN A;  5L3E A;  4WFE A;  4G27 B;  4DV6 O;  3HKB A;  2QWQ B;  2YSU B;  1QU7 A;  4DR7 B;  1FAF A;  3ZIA G;  2QGN A;  3HR0 A;  4R6Z A;  4JTC B;  4WFH A;  3HKD B;  1XIL A;  2XAS A;  4LFA B;  1N32 B;  3A2F A;  5JJN B;  1N36 B;  3FKS G;  2BTQ A;  4OPA A;  4PA7 A;  4DK0 A;  3K06 A;  5LYJ A;  4PD4 F;  3JAK A;  4BAY A;  4JI6 B;  4X65 B;  1N33 O;  4B7E A;  3MAQ A;  3JAS B;  4GUN A;  2OCC B;  2Q7E A;  2PZS A;  4MTG A;  1Y74 A;  2GHY A;  1KD1 W;  2ZXW C;  2IJK A;  2BTO A;  1US6 A;  3G67 A;  3BY6 A;  1Y66 A;  4KHP O;  4EFE A;  1GO3 F;  2BOC C;  1NKD A;  4ZI7 A;  4QPJ A;  5J2T B;  4CBC A;  1PKX A;  2Y4U A;  5H2F Z;  1Y76 B;  3APO A;  2VQE B;  3CCS V;  2UUB B;  1WN7 A;  3ZHU A;  2ZE8 A;  4I9W A;  2L35 A;  4LP8 A;  1H2L A;  3HKE B;  2X6B A;  3ZX6 A;  2Q4P A;  2QWO B;  2A7W A;  4BW5 A;  4FLX A;  2PI5 A;  3W7W A;  4DV2 O;  2FYU H;  1U97 A;  1V9P A;  2WLI B;  3ETD A;  2FB5 A;  2L6L A;  1G1X B;  4TQD A;  2Y0P A;  3OM3 B;  4LF4 O;  4X20 B;  3E35 A;  1ZL8 B;  3F5T A;  1H2N A;  1FD9 A;  4B7K A;  3D36 A;  3PJS K;  2JGD B;  3CCU V;  4K8Z A;  3B2E E;  4UFZ A;  1DF5 A;  1XL6 A;  5B3S C;  3CC2 V;  2R70 A;  2NR5 A;  1R3J C;  1BSM A;  3D3I A;  1GN4 A;  4DO2 A;  4PA4 A;  4FLZ A;  3C90 A;  4O4I B;  1PNL A;  1YJ9 V;  2CGN A;  3B09 A;  3ABT A;  4K8X A;  3CWB H;  1QVF U;  1TVK A;  4PDL A;  4TV8 B;  4X88 A;  4J42 A;  2UUC B;  2ZKO A;  4JAA A;  1NR7 A;  1XMQ O;  3B77 A;  4MVM A;  4RWU A;  4B3R B;  1V54 C;  1YIT V;  3K5L A;  2F95 B;  3CSX A;  5LGN A;  4ZBM A;  1VIB A;  4H33 A;  4PDM A;  1IVS A;  5L3F A;  3OEE G;  4MVZ A;  2JDI G;  2Q67 A;  1FYJ A;  2CTQ A;  1DTO A;  1W2B U;  4GT1 A;  4O2B A;  1YJW V;  1KP2 A;  1XMO B;  1R6T A;  4TUY B;  3SJB C;  1Q6I A;  4J9Y B;  3HKC B;  5GON A;  4WBN B;  4DR2 B;  1P49 A;  2JIZ G;  1Y4M A;  3SYO A;  3LNN A;  3WB2 A;  4B3S B;  3FB6 C;  2WWW A;  3LUT B;  2ZM6 B;  2DN9 A;  2M7W A;  4NVP A;  3SJQ C;  1RM1 C;  3TJT A;  1E1Q G;  3K9S A;  3JAL B;  3DXR A;  4PHZ A;  4MVS A;  2X6A A;  3GB7 C;  1W0J G;  2ADQ B;  4QIW F;  5DN6 G;  1XNQ O;  2OYQ A;  4YJ3 A;  5KA6 A;  2BOB C;  3VBB A;  1PNK A;  3P32 A;  5EC1 C;  3T1Y B;  4LF5 B;  2D2C B;  2R9R B;  1GM7 A;  1DGS A;  4JI4 O;  2QKA A;  3F5W C;  2E3C A;  2CAZ C;  3L70 H;  2MK3 A;  2CH7 A;  2IM9 A;  2P6J A;  2QDO A;  1AVM A;  3H1H H;  5LMU O;  4FLW A;  2DW4 A;  2PY5 A;  4FZ1 A;  3KKY A;  4I9Q A;  1P4R A;  2UXC B;  4WFF A;  1Z2G A;  3BA9 A;  4F6E A;  2EZP A;  3QTC A;  4DR5 O;  3E8G A;  3OFN G;  4AQY O;  4MW8 A;  4MTO A;  1BQ0 A;  3N27 A;  4J7J A;  4O2A B;  1MA1 A;  3CCV V;  3ZN0 A;  3MD0 A;  2F43 G;  4KXR A;  2Y69 C;  3LNM B;  4PA6 A;  2Y48 A;  3K9A A;  3A8T A;  1VQL V;  3ZHV A;  1VQP V;  3DSQ A;  1NR1 A;  3TXS A;  3E8B A;  1IBM B;  4KP4 A;  3H1I H;  5BMV A;  2PTM A;  1M56 C;  2P7T C;  3EXA A;  4FK5 C;  1YF2 A;  2VQF B;  1JQ0 A;  5B1N A;  1RPR A;  1NTK H;  2ZNJ A;  3UQ8 A;  5FNV B;  2XUM A;  2QA4 V;  1WP8 A;  3E83 A;  3OAA G;  1K5Q A;  2Q7H A;  3DC6 A;  4NTY A;  3RYC B;  3K04 A;  1ZAU A;  2GDS A;  3QO8 A;  3FB7 C;  2WLL B;  5LA6 A;  3OTO B;  2XHB A;  4NXN O;  3WG7 C;  2ZE5 A;  5CN0 A;  2PYJ A;  3FX7 A;  4OXS A;  2WLK A;  5LXT A;  3N2K B;  1J95 A;  4I4T A;  4P9O A;  4K35 A;  4YJ2 A;  4DV4 B;  4DV5 O;  4JI8 B;  3BRC A;  3OMN B;  2DYS C;  1WPB A;  5KUK A;  1XDC A;  2W6J G;  1OCZ C;  4TT3 G;  1XL4 A;  4O4H A;  3G4S V;  2P5O A;  3NR7 A;  3U0Z A;  4DV7 B;  1K97 A;  1GN3 A;  4U7N A;  3TGU H;  3QG5 A;  3ASO B;  4UCV A;  2WA4 A;  4YIP A;  4J41 A;  1QQC A;  5CA3 A;  1SET A;  4JZG A;  1BGY H;  1GN2 A;  2X7R B;  3FAV B;  5LGT A;  1GK9 A;  1I5Y A;  4N23 A;  5EIB D;  4NTW A;  5TIS Z;  1SQX H;  3ETQ A;  2YC0 A;  5HFL A;  3AG3 C;  1HP8 A;  1BCC H;  3AG1 B;  4JYB A;  1K8A W;  4PDV A;  4JI7 B;  1NS1 A;  2EJR A;  1AJP A;  2B9Z A;  4LBE C;  5K1X A;  5LHH A;  4LF7 O;  4Z2W A;  5L3C A;  1GKF A;  2ETN A;  4DR4 B;  2Y4T A;  3AK3 A;  3ETG A;  3E22 B;  4HYO A;  2YIB A;  2R72 A;  3MDS A;  4JI1 B;  1QNM A;  2ZE6 A;  1ARO P;  1F4N A;  1QVG U;  1O9H A;  3OD4 A;  4DR6 O;  1ORQ C;  3AG2 B;  3L73 H;  4FFB B;  4WCE V;  4YIO A;  2DQ0 A;  2ZD9 A;  2AW9 A;  5IYZ B;  4UVB A;  3JYC A;  2YIA A;  1HNW B;  3UT5 B;  5JVD B;  1SQV H;  2EX3 A;  3RYH A;  1M57 C;  5J2U B;  2Q73 A;  1W59 A;  1GRJ A;  2HR3 A;  5EZY A;  2OCC C;  2F93 B;  3FYI B;  3O65 A;  3WB1 A;  5DM6 V;  4Q20 A;  4JI5 O;  1EZV H;  4R8C A;  3JAT B;  4I0X A;  1OCC C;  4JYA B;  3ZMZ A;  5KMG B;  1TUB B;  4F6R B;  3CCM V;  2GUZ A;  5JH7 A;  2HG5 C;  3K0G A;  3CHX A;  2P4V A;  1AR4 A;  3BAB A;  5KHK A;  2UU9 O;  3ABM B;  2ZIM A;  4MVO A;  2PUS A;  1SQG A;  1WNS A;  4WFG A;  1YIJ V;  2LGW A;  3CME V;  1MMM A;  5KX5 A;  1AB3 A;  5KHG A;  4TV9 B;  1XEQ A;  1SA0 B;  2DWD C;  3GWK C;  3G71 V;  2XAH A;  1J5E B;  3DGE A;  4DV3 O;  1S72 V;  3IFX A;  3ZED A;  2P22 C;  1WA8 A;  3K0D A;  2A06 H;  2HJF C;  2EBO A;  4X62 B;  1JMK C;  4IYH A;  1IBL B;  2QKS A;  1XUQ A;  3ZRS A;  1BE3 H;  1NTZ H;  2R9I A;  2YIC A;  3K5M A;  5LP6 B;  2RN9 A;  2X6C A;  2QM7 A;  2YXY A;  4DR1 O;  5KHH A;  4HNA B;  4GKJ B;  4DK1 A;  3Q4H B;  1OV9 A;  1YCI A;  1R6K A;  1FXH A;  3U10 A;  3ZJZ A;  5IY5 B;  5BR8 O;  2ITC C;  1Q6U A;  2DYR C;  2B1G A;  2F1M A;  4H0L B;  4O4L B;  3QO5 A;  4FMT A;  4JI2 O;  1L0N H;  1JVM A;  3BAA A;  1H2G A;  3K59 A;  2YXH A;  2EIJ C;  2LW1 A;  4JI0 O;  4TQF A;  1H8H G;  4LNU B;  4DR7 O;  1AR5 A;  1BZK A;  3F7Y C;  1GM8 A;  2ZNI A;  4LFA O;  5F2V O;  1N32 O;  4QGP A;  5H6Q A;  1RSO A;  1FXK A;  2LO1 A;  1N36 O;  3CCE V;  4KFM A;  1Q82 W;  4I50 B;  2AHZ A;  4GLX A;  1H38 A;  5LBQ A;  3T1C A;  1F23 A;  4EFB A;  4JI6 O;  3ABK B;  4TWK A;  1K7D A;  1YJN V;  4W4K A;  2QSA A;  2EIN C;  5EC2 C;  4OX9 O;  4LH7 A;  4H13 B;  3CD6 V;  3IC9 A;  2OCH A;  4X66 B;  3L75 H;  1NH2 D;  3JCU Z;  4G2K A;  4X1Y A;  2IBZ H;  2WA3 A;  2H94 A;  3BCC H;  1OCO B;  1NVP D;  3FFQ A;  2F4V B;  1WPX A;  1ROP A;  3ZHQ A;  1XNR B;  3CRC A;  2BTQ B;  5IJ0 A;  2P06 A;  4UCR A;  4PJ0 Z;  5LYJ B;  3JAK B;  2BSK A;  1G4Y B;  2UXN A;  3K5N A;  4PDR A;  4DUZ O;  4X64 B;  3OR6 C;  4G28 B;  3CJH A;  5JWP A;  4B3M B;  2PF4 E;  1Y74 B;  4BIO A;  1VQO V;  4GZR B;  2CTR A;  3RGB A;  3MHH C;  4RQE A;  4JI3 O;  4D6T H;  5IWA O;  1URF A;  4DV6 B;  4ZI7 B;  3CMA V;  4JYY A;  1HDJ A;  1WP7 A;  4YY3 B;  2HKO A;  4JGS A;  4H37 A;  4QE7 A;  3SGI A;  1Q90 D;  2QWR B;  1NT2 B;  4CH4 A;  1I94 B;  3WU2 Z;  3M8A A;  4FLU A;  2UXD B;  3RT3 C;  2E5L O;  1ZTE A;  5CB4 A;  2RNB A;  3E8H A;  1NZ6 A;  2UXB B;  3CCR V;  3SYC A;  1VQK V;  4J80 A;  3LDC A;  1EM1 A;  1IXB A;  2YI8 A;  5B1B B;  1PPJ H;  2Q9L A;  1PV0 A;  3BEH A;  1YSC A;  3G6B A;  1JCH A;  4DYL A;  3T2M A;  3BPZ A;  3JAW A;  4I55 A;  3ZMS A;  1N34 B;  5FPO A;  1S0V A;  1YHQ V;  3IGA C;  2ITD C;  1K34 A;  2JVD A;  4KHP B;  3B8M A;  4DV1 O;  2FTK A;  3RYF A;  1SC5 B;  1JJ2 U;  3TCU A;  1VF5 B;  4AIL C;  1XMO O;  1AI4 A;  1QBZ A;  1FPO A;  2YUA A;  1XBL A;  3ZHR A;  2IJI A;  1EZJ A;  2Q8V A;  3ASO C;  2KB1 A;  4RQF A;  1NBM G;  1ENV A;  3X2Q C;  4B3S O;  2JS5 A;  5LMN O;  1KMI Z;  1M4U A;  2GV9 A;  2AZ0 A;  3K58 A;  3T4Z A;  5B66 Z;  1D5A A;  3J80 N;  2V4D A;  1TVK B;  5FLX N;  3CXC U;  1TA8 A;  3KZI Z;  3TK1 A;  3UKM A;  2NNU A;  1E1R G;  3H01 A;  2RDC A;  1S5L Z;  2F23 A;  4OPH A;  4EEQ A;  1HR0 O;  1BQZ A;  1H2M A;  2KG7 A;  3L71 H;  1DF4 A;  1WB7 A;  3AG1 C;  3ZBH A;  4LF4 B;  4GKK B;  4MTF A;  3T1Y O;  3KG2 A;  4O2B B;  4WFB V;  3DC5 A;  3I56 V;  4K0K B;  5CBH A;  1GM9 A;  3W7U A;  2LP7 A;  4U7O A;  1OCR B;  4NTX A;  4DV0 B;  5GON B;  2ILM A;  2PI4 A;  4UVA A;  5B1A C;  2P67 A;  2YEV A;  1MZE A;  1OJH A;  5KA5 A;  4ASU G;  2WSS G;  3CE2 A;  1V55 C;  3AG2 C;  4X1K A;  3DXR B;  3UCS C;  4LWS A;  3RYI A;  4YJ3 B;  3AG4 B;  2CK3 G;  2IH1 C;  1SZX A;  3CRA A;  2WLJ A;  1S3J A;  1XMQ B;  5JJJ B;  1Q81 W;  1VMG A;  3ZRV A;  2BE3 A;  1KU9 A;  2H3O A;  1K5S A;  5CBG A;  2LFS A;  1FJG O;  1Q8I A;  2CH7 B;  2KKW A;  4LFB O;  3ZRW A;  1XI1 A;  5CA1 A;  1QLN A;  1G8M A;  3M7M X;  3OUF A;  5L3B A;  2EIK B;  4TSF G;  1AR1 B;  4LC1 A;  2OIG A;  1T5E A;  3ASN B;  2Y0I A;  2JEU A;  1R1B A;  3GVM A;  3WFV A;  2BCC H;  1N8R W;  1KBH A;  2ADP A;  1K33 A;  3TET A;  3RBZ A;  3ABM C;  1XNQ B;  3OTO O;  5K1P A;  2DMX A;  2IJH A;  3H1L H;  4L8J A;  3UM7 A;  4UCU A;  4BW9 A;  4U3J A;  3LSU A;  5C93 A;  4QPK A;  2JGU A;  4JI4 B;  2JRI A;  4DR3 O;  1Y67 A;  1Q43 A;  4XBF A;  3B8N A;  5BMV B;  2AGA A;  1SQP H;  3P3N A;  3VQV A;  4KUM A;  5LMU B;  1VQ6 V;  4LF9 B;  3THO A;  2XT9 A;  3N2G A;  2XAJ A;  3K08 A;  3EFF K;  1MAB G;  2HEP A;  3FB8 C;  2OTL V;  5FNV A;  2WLH A;  3JD2 A;  5LA6 B;  4UV9 A;  2PYL A;  4AQY B;  1ZLZ A;  4AHC A;  5IY5 C;  4EKW A;  1YI2 V;  4QE9 A;  3OGI B;  4FIP C;  5D5P A;  1GMG A;  3OMI B;  4F4L A;  5LXT B;  2N04 A;  4I4T B;  2LW7 A;  2OIE A;  4YJ2 B;  2D3O W;  2W6I G;  2GBO A;  2Z5U A;  2Z0A A;  2GTS A;  2CTP A;  1FS0 G;  2LJ2 A;  4JZ2 A;  3S3X A;  1A32 A;  1MSW D;  3OR7 C;  4TOI A;  2M6Y A;  3ZHT A;  4O4H B;  3FYE B;  2FL4 A;  5GW7 A;  3ZRX A;  4DR4 O;  1XHX A;  2CDY A;  1VF7 A;  4UCT A;  5B3S B;  2X0L A;  3D3Q A;  3ZCC A;  4X89 A;  4UVC A;  1AP6 A;  4BR6 A;  1GTO A;  4JI1 O;  5CA0 A;  3AEI A;  4PV1 B;  4J9Z B;  3ABL B;  1PL4 A;  3TXQ A;  2B1I A;  2HHH O;  5LHG A;  4FVM A;  5EYP A;  3FAV A;  1L0L H;  5IJ9 A;  4EB6 A;  5IDJ A;  1V54 B;  3JAR A;  1Z5V A;  2P90 A;  1DLB A;  4XDK A;  4J7K A;  3ZN1 A;  4MVQ A;  2HVJ C;  2N74 A;  4DRX A;  4DW1 A;  5B1O A;  5KAF Z;  1MZF A;  2Q7G A;  4DV5 B;  2QTS A;  2V7Q G;  4GX2 A;  4IL6 Z;  4PA9 A;  3RN4 A;  3CCQ V;  1OCO C;  4O4J A;  4JTA B;  2QJ1 A;  1DK1 A;  5EBL C;  1LNQ A;  3BVO A;  1YVW A;  1R3K C;  1RM1 B;  3KCX A;  3W7X A;  3CCL V;  3RYH B;  4BWA A;  3LSS A;  4DUY O;  2H8P C;  4LH6 A;  3CRQ A;  4HAM A;  5EZY B;  1VQ5 V;  3ML0 A;  4LF6 B;  2RJZ A;  1KEC A;  4LR3 A;  1PL0 A;  4P30 A;  4XDL A;  1FFX A;  2UUA O;  2UXX A;  1ZSP A;  4I0X B;  1NJI W;  1F7Y A;  4FFK A;  2HLD G;  2ZCE A;  3SPJ A;  1KKC A;  1UJW B;  4D7S A;  5E1A C;  2QM4 A;  2GUZ B;  1JFF A;  1P7B A;  5JH7 B;  4Z1V A;  1MNG A;  4DR6 B;  2GSM B;  3GWO A;  3I55 V;  1K4D C;  1UPG A;  3OMA B;  3CS5 A;  4IT5 A;  3ETE A;  1TUE B;  4NXM O;  4GX1 A;  4HZ3 A;  1VQM V;  3C3T A;  3VQY A;  3CRR A;  1Q6H A;  5JQG A;  4IGG A;  5KX5 B;  5LL6 Y;  2YIB D;  2EJ7 A;  2ZIN A;  3ZMT A;  1YTF D;  2Y69 B;  1MOF A;  1B6Q A;  1HNX B;  1HNZ B;  5H5N A;  1WA8 B;  1SF9 A;  2YXL A;  4MTX A;  2QE7 G;  2N05 A;  3LSQ A;  2A0L A;  4ZOL A;  1EFR G;  1YEW A;  4JI5 B;  1CEZ A;  2AZ2 A;  1IX9 A;  1FFT B;  1CP9 A;  4X1I A;  1XQ8 A;  2XAG A;  4IHJ A;  1K73 W;  2IU3 A;  5D5Q A;  1HNZ O;  1M56 B;  4DXW A;  1NH2 B;  1GAX A;  4I5S A;  2XND G;  3JSN A;  5C8Y A;  4PI2 A;  1NVP B;  4MVU A;  4H44 B;  1BMF G;  5IT9 N;  1S5J A;  1IZ3 A;  4UCO A;  3STZ C;  2P4K A;  2YS8 A;  3P3P A;  1EN4 A;  5JCO C;  3WG7 B;  2K9P A;  2RCV A;  5KLV H;  3CP1 A;  2QM8 A;  3AK2 A;  4YHH B;  3JSL A;  1Q86 W;  4NR1 A;  1IBK B;  3PN1 A;  2CUG A;  4DV3 B;  3A0R A;  3F7V C;  4NYK A;  4JTD B;  3BA8 A;  3UO2 A;  2LFR A;  1H2S B;  2DYS B;  2EIL B;  5E79 Z;  1OCR C;  1Y6X A;  4PEL A;  4LCU C;  1RSO B;  4IIJ A;  4ZHQ A;  1M90 W;  4LF8 B;  3JCZ A;  1FXK B;  4B3T B;  4X65 O;  5ITZ A;  3DTU B;  1NU1 H;  5BXZ A;  5LOV A;  3APQ A;  1YZB A;  1ZX3 A;  5J9P C;  3JD1 A;  5BR8 B;  1AIL A;  4PI0 A;  1SZT A;  3SJA C;  2ZDI C;  5EK0 A;  3QF7 A;  1UFI A;  2IH3 C;  3HKB B;  2DE0 X;  4NB5 A;  4CS3 A;  2JS3 A;  4JV5 B;  3K03 A;  4JI2 B;  3G6E V;  2ARH A;  4R50 A;  2WAM A;  4WF9 V;  3H1J H;  4UXN A;  2Q68 A;  3NXS A;  4JAV A;  4QJF B;  4D7T A;  4X1Y B;  1QLE B;  4JI0 B;  4LFC B;  2VQE O;  3SYA A;  2DQ3 A;  4YY3 O;  4J11 A;  2UUB O;  1E79 G;  2E75 B;  3HKD A;  2CGO A;  1X59 A;  3JD3 A;  1QR8 A;  4I7Z B;  4CH3 A;  2EIK C;  5IJ0 B;  2Z3Y A;  1K4C C;  1O9G A;  4J10 A;  3T1H B;  1I94 O;  2JJ2 G;  3OT7 A;  1Q3E A;  1AI7 A;  2UXD O;  2BSK B;  2LGQ A;  2IU0 A;  3ASN C;  4IYI A;  2UXB O;  5L3D A;  1RP3 B;  3CJH B;  3JAS A;  3CRM A;  5FPR A;  3ZMV A;  1M57 B;  4MS2 A;  3RFR A;  4J7Z A;  1VEW A;  2Q5Z A;  4OX9 B;  4U3F H;  1N34 O;  1I08 A;  4ZHQ B;  5EIB C;  1HW7 A;  2ODM A;  1W0K G;  4BIZ A;  2F66 C;  5J2T A;  3E8F A;  1Y76 A;  2RMK B;  3VQW A;  1M93 A;  1OCC B;  4OGQ B;  2IJJ A;  3P30 A;  3H1K H;  1I5X A;  2YI9 A;  3RW0 A;  1SQQ H;  4L87 A;  1GH6 A;  5CB4 B;  1N33 B;  3HKE A;  1AP5 A;  2QR4 A;  2XAQ A;  2XTA A;  3E2E A;  4Q6G A;  3K5O A;  1YDX A;  2UUC O;  1EN5 A;  3H9V A;  4DUZ B;  4B3R O;  2WLI A;  3JAW B;  5CMU A;  4I55 B;  1I7F A;  3CXH F;  2A9H A;  2LQT A;  1BT8 A;  4JI3 B;  4X20 A;  1ZL8 A;  1XHZ A;  5IWA B;  2FKX A;  5DED A;  5HFM A;  3CCJ V;  2G38 A;  4GKK O;  3RYF B;  5B5E Z;  1THZ A;  2KQX A;  2JGD A;  3J81 N;  4K0K O;  1JJO A;  3ZHS A;  1KB9 F;  2AHY A;  3SPH A;  4DR2 O;  3QO7 A;  4DV0 O;  1N0N A;  2ZR3 A;  4GCZ A;  2ZM6 O;  1K9M W;  2AXT Z;  5BY1 A;  2E5L B;  1H8E G;  1G6U A;  4O4I A;  4DV2 B;  2DWE C;  3JAM N;  3QNE A;  2GTA A;  3OE7 G;  3SYP A;  3VOU A;  2FML A;  5IYD O;  4E4E A;  3ABL C;  4TV8 A;  3ZMU A;  2DYR B;  3FD9 A;  4A5U B;  3OW2 U;  2A3Q A;  1MSD A;  5JCO A;  4LF5 O;  1BHA A;  2KG7 B;  3RWR D;  3KCY A;  4N21 A;  5A2Q N;  1VQ4 V;  2DJV A;  1CXZ B;  1Z5W A;  1GN6 A;  2EIJ B;  3CYO A;  4DV1 B;  3E89 A;  3A0H Z;  3EHB B;  4UV8 A;  4JPR A;  1VAR A;  3IAY A;  1NQT A;  4TUY A;  1IUR A;  1JA8 A;  2YEV B;  4YXW G;  3HKC A;  4WBN A;  2EIM B;  2VWK A;  3R65 A;  2Q69 A;  2Q6A A;  3HB3 B;  2UXC O;  2HP8 A;  4UB8 Z;  2JEX A;  4X1K B;  4LWS B;  3RYI B;  5LMN B;  3JAL A;  3BFR A;  4FLV A;  3I5D A;  4ZKI A;  4P9P A;  1NI8 A;  3CC4 V;  2ZE7 A;  1WB8 A;  3ICX A;  2ZDI A;  1M9N A;  4GYC B;  4C7U A;  1OHH G;  2VWJ A;  2EIN B;  3L9D A;  4CS4 A;  3STL C;  1HR0 B;  3IJ4 A;  1IBM O;  3CX5 F;  1BS3 A;  1SS3 A;  3ZRW B;  5KHI A;  5CA1 B;  4FLY A;  4CZZ A;  4GX5 A;  4RUE A;  1QCE A;  2VQF O;  3WB0 A;  5L3G A;  3W7S A;  1ZWI C;  1B3Q A;  5JJE B;  1B06 A;  4W4L A;  4LF9 O;  2A79 B;  3FB5 C;  4R7C A;  2XOK G;  4RAI A;  2OTJ V;  2OWO A;  5LHI A;  3S3W A;  3JD0 A;  4O2A A;  1KUQ A;  2ZXW B;  5EBW C;  3K79 A;  4MW3 A;  1SQB H;  3K57 A;  4U3J B;  4K3A A;  4DV4 O;  3QVN A;  4JI8 O;  1KP3 A;  1TAE A;  1FJG B;  1IXM A;  1M1K W;  1K3E A;  2KSD A;  3CEI A;  2HFE C;  2PGG A;  1L1F A;  4LFB B;  3CC7 V;  2CE4 A;  4CS2 A;  3B4S A;  4DV7 O;  1VQ7 V;  3N2G B;  5AG2 A;  1ZUQ A;  5LP6 C;  5A9G A;  1D2D A;  1SKV A;  4DR5 B;  3B40 A;  3IC7 A;  4JAS A;  3ZS8 C;  3RYC A;  1VF6 C;  4XDJ A;  3SPC A;  2W0X A;  4DW0 A;  5KAI Z;  2EZO A;  2ZR2 A;  2WLL A;  2C2A A;  1S76 D;  1L8D A;  1WLE A;  1NTM H;  2VS0 A;  5H6R A;  1KC8 W;  4KL1 A;  1LUW A;  4FJC C;  2QEX V;  4JI7 O;  1SQF A;  4ICG A;  3N2K A;  2NN4 A;  5IYB O;  5BZB A;  2MW2 B;  3T4D A;  4MVR A;  3A0B Z;  4DR3 B;  4CC6 A;  4JF3 A;  5KHJ A;  1KQS U;  1AJN A;  3E86 A;  1P7G A;  3LDE A;  3SPG A;  2EIL C;  1PP9 H;  3OUS A;  4FM1 A;  5CA0 B;  4X8A A;  1B04 A;  1FXK C;  4UB6 Z;  4BIU A;  2E76 B;  4JYC A;  3SPI A;  3CPW U;  1VQ9 V;  2QWP B;  1F51 A;  1HNW O;  3X2Q B;  4NXN B;  2HJD A;  5EBM C;  1Q7Y W;  1SRY A;  1HWY A;  2YDE A;  3ABK C;  3M99 B;  3SDL A;  2NLJ C;  5EYP B;  1I0H A;  4CC5 A;  5IJ9 B;  4EB6 B;  3K3W A;  3JAR B;  3OGC C;  3JD4 A;  1AI6 A;  4CH6 A;  4DRX B;  2Q0O C;  4LF6 O;  1U96 A;  4AI8 A;  3OTF A;  2ZT9 B;  3R66 A;  1S5H C;  4JYA O;  1YTF B;  1AJQ A;  1QLE C;  2RQ6 A;  3E22 A;  1JX9 A;  4O4J B;  5B1A B;  2E74 B;  2QTO A;  4P2Z A;  1R3I C;  4FFB A;  3ABU A;  1V55 B;  4ABM A;  5IYZ A;  1EN6 A;  4B08 A;  4FPP A;  3UT5 A;  1S77 D;  5JVD A;  2QWN B;  1COW G;  5J2U A;  2HHH B;  1N4C A;  1R73 A;  1VQ8 V;  2ZIO A;  2JJ1 G;  3SYQ A;  1J5E O;  1M5I A;  5LGU A;  4UCS A;  2IW5 A;  1PNM A;  1XRE A;  2EUL A;  1KKD A;  4Z1M G;  1EBO A;  1AI5 A;  4LF7 B;  3U11 A;  1HNX O;  1FFX B;  1MG1 A;  4FZ0 A;  4FM0 A;  4X62 O;  3JAT A;  3LDD A;  2O57 A;  4GX0 A;  5GTH Z;  1P84 F;  2R9A A;  4JAU A;  4MSW C;  3VQX A;  1IBL O;  1SER A;  4QNH B;  5KMG A;  1JFF B;  3SR2 C;  1TUB A;  1R6N A;  4F6R A;  5KUM A;  1BHB A;  4PA3 A;  4GKJ O;  4X9Q A;  3AG7 A;  5CBF A;  1RFY A;  2W0F C;  5IE9 A;  1WJZ A;  5B1B C;  4FLT A;  3AK1 A;  5JQG B;  1FKA O;  1H2K A;  4DUY B;  2YID A;  1CPY A;  4TV9 A;  1QHT A;  3CB2 A;  2HVK C;  1SA0 A;  1TGO A;  4ZOL B;  1FXV A;  3D36 C;  4YHH O;  4RO2 A;  2B5U A;  2WPD G;  1IBK O;  4X1I B;  2UUA B;  3L72 H;  4IHJ B;  1LUV A;  3G80 A;  3MHS C;  1X4T A;  4CH5 A;  5GTI Z;  1XOU A;  1VQN V;  5C8Y B;  2UU9 B;  1BL8 A;  4LF8 O;  1KYO F;  2Q0A A;  5LP6 A;  1QR9 A;  4HNA A;  1R3L C;  2ZQM A;  4B3T O;  4UUJ C;  3Q4H A;  4RUF A;  3SJC C;  1PD3 A;  1PM9 A;  4NXM B;  3HPL C;  1VF6 A;  3O9O A;  2ATK C;  1N0J A;  5DEC A;  2WLM A;  4HBN A;  4O4L A;  3C3S A;  1JOY A;  2CTW A;  1IDS A;  5H9C A;  4E2L A;  1LR1 A;  2OT5 A;  4X66 O;  4JV5 O;  1OZ0 A;  4WFA V;  3RVZ A;  3J7A U;  1OCZ B;  3D8C A;  1RPO A;  2VRZ A;  3RVY A;  2XAF A;  1D5N A;  4LNU A;  2F4V O;  1JR9 A;  5FL7 G;  4LFC O;  1F4M A;  2DOS A;  2V1D A;  1XNR O;  3BHP A;  1SES A;  4ZIB A;  4IIJ B; 
#chains in the Genus database with same CATH homology
 4UVB A;  1K92 A;  2IJH A;  3JYC A;  1THZ A;  3UM7 A;  2EIM C;  2K1E A;  1M57 C;  5C93 A;  4QPK A;  2AHY A;  3SPH A;  2HR3 A;  3OEH G;  4MT8 A;  2JK5 C;  2OCC C;  3QO7 A;  4XBF A;  2ZR3 A;  3B8N A;  3AG4 C;  3FYI B;  4GCZ A;  5DM6 V;  1K9M W;  4Q20 A;  3AG3 B;  5IYC O;  1H8E G;  1JPX A;  4KUM A;  1VQ6 V;  3W7T A;  2WLN A;  2DWE C;  5L3E A;  4R8C A;  4WFE A;  4G27 B;  3QNE A;  3OE7 G;  3SYP A;  3VOU A;  2XAJ A;  5IYD O;  1OCC C;  3ABL C;  3K08 A;  2YSU B;  3EFF K;  1MAB G;  3ZMU A;  3ZMZ A;  2DYR B;  3FB8 C;  3OW2 U;  2OTL V;  3ZIA G;  4R6Z A;  2WLH A;  4JTC B;  1BHA A;  4WFH A;  3JD2 A;  3CCM V;  4UV9 A;  2HG5 C;  5IY5 C;  2XAS A;  3K0G A;  4N21 A;  4EKW A;  1YI2 V;  1VQ4 V;  4QE9 A;  1GMG A;  4FIP C;  3ABM B;  2EIJ B;  3OMI B;  4MVO A;  3CYO A;  4F4L A;  3E89 A;  3FKS G;  3EHB B;  4PA7 A;  4UV8 A;  4WFG A;  4JPR A;  1YIJ V;  1NQT A;  3K06 A;  3CME V;  4BAY A;  2D3O W;  2W6I G;  2YEV B;  4YXW G;  2EIM B;  2DWD C;  2Z5U A;  1MSW D;  3R65 A;  1FS0 G;  3OR7 C;  3G71 V;  2XAH A;  3DGE A;  2Q69 A;  2Q6A A;  3FYE B;  3HB3 B;  1S72 V;  3IFX A;  2JEX A;  5GW7 A;  3ZRX A;  2OCC B;  3K0D A;  4MTG A;  5B3S B;  2HJF C;  2EBO A;  2X0L A;  2GHY A;  3ZCC A;  1KD1 W;  2ZXW C;  2IJK A;  4X89 A;  4ZKI A;  4UVC A;  4P9P A;  1GTO A;  3BY6 A;  3CC4 V;  1Y66 A;  1GO3 F;  3CCJ V;  2BOC C;  1NKD A;  2ZDI A;  2QKS A;  3ZRS A;  4QPJ A;  1M9N A;  3AEI A;  4J9Z B;  1OHH G;  3ABL B;  4CBC A;  1PKX A;  2EIN B;  2R9I A;  3STL C;  3CCS V;  2B1I A;  5LHG A;  2X6C A;  2QM7 A;  5IDJ A;  4I9W A;  3ZRW B;  1R6K A;  1FXH A;  3ZJZ A;  1V54 B;  5IY5 B;  2ITC C;  4LP8 A;  2P90 A;  1DLB A;  4XDK A;  2DYR C;  2B1G A;  4MVQ A;  3ZN1 A;  2HVJ C;  4CZZ A;  2X6B A;  4GX5 A;  4RUE A;  5B1O A;  1QCE A;  3QO5 A;  4BW5 A;  5L3G A;  3W7S A;  4FMT A;  2PI5 A;  1JVM A;  1ZWI C;  2V7Q G;  4GX2 A;  3W7W A;  1H2G A;  4PA9 A;  3ETD A;  2WLI B;  2EIJ C;  2A79 B;  3CCQ V;  1OCO C;  3FB5 C;  4R7C A;  2XOK G;  4RAI A;  2OTJ V;  1H8H G;  4JTA B;  5LHI A;  3OM3 B;  5EBL C;  3E35 A;  1LNQ A;  3JD0 A;  3F7Y C;  2ZXW B;  1R3K C;  1GM8 A;  5EBW C;  1RM1 B;  3K79 A;  4MW3 A;  3D36 A;  3PJS K;  5H6Q A;  3CCL V;  3W7X A;  3CCU V;  1FXK A;  3LSS A;  2H8P C;  1DF5 A;  4HAM A;  1XL6 A;  5B3S C;  4KFM A;  3CCE V;  1Q82 W;  3CC2 V;  2AHZ A;  1H38 A;  5LBQ A;  1VQ5 V;  1KP3 A;  3T1C A;  1IXM A;  1R3J C;  1F23 A;  3ML0 A;  1K3E A;  1L1F A;  1M1K W;  2HFE C;  3D3I A;  4DO2 A;  3CC7 V;  4PA4 A;  3ABK B;  4TWK A;  1K7D A;  1PNL A;  1KEC A;  1YJ9 V;  1YJN V;  1VQ7 V;  1PL0 A;  4P30 A;  4XDL A;  2EIN C;  5EC2 C;  2UXX A;  1NJI W;  3ABT A;  1QVF U;  2HLD G;  4PDL A;  4X88 A;  3CD6 V;  3IC7 A;  1NR7 A;  3B77 A;  4MVM A;  3SPJ A;  4JAS A;  1UJW B;  1NH2 D;  1V54 C;  4XDJ A;  4G2K A;  1YIT V;  5E1A C;  3SPC A;  1P7B A;  2EZO A;  2ZR2 A;  4ZBM A;  5LGN A;  2WLL A;  4H33 A;  2C2A A;  4PDM A;  5L3F A;  2H94 A;  1S76 D;  3OEE G;  2GSM B;  4MVZ A;  2JDI G;  1OCO B;  3GWO A;  3I55 V;  1NVP D;  2Q67 A;  1WLE A;  1WPX A;  1ROP A;  1K4D C;  3OMA B;  1DTO A;  5H6R A;  1W2B U;  1KC8 W;  4GT1 A;  3ETE A;  1TUE B;  4FJC C;  4GX1 A;  4HZ3 A;  1YJW V;  1KP2 A;  2QEX V;  1VQM V;  5IYB O;  5BZB A;  3T4D A;  4J9Y B;  1G4Y B;  4MVR A;  2UXN A;  2JIZ G;  3ZMT A;  1Y4M A;  3SYO A;  1YTF D;  4PDR A;  2Y69 B;  1MOF A;  1B6Q A;  3FB6 C;  2WWW A;  3OR6 C;  3LUT B;  4G28 B;  4JF3 A;  2M7W A;  3SJQ C;  1RM1 C;  1E1Q G;  4MTX A;  1KQS U;  2QE7 G;  1AJN A;  3E86 A;  3LDE A;  2A0L A;  3LSQ A;  1EFR G;  3SPG A;  1CEZ A;  1VQO V;  1FFT B;  2EIL C;  4MVS A;  2X6A A;  1CP9 A;  3GB7 C;  1W0J G;  3MHH C;  4RQE A;  3OUS A;  4QIW F;  5DN6 G;  2XAG A;  4X8A A;  1FXK C;  5KA6 A;  2BOB C;  4BIU A;  4JYC A;  2IU3 A;  3SPI A;  3CPW U;  3VBB A;  1K73 W;  1VQ9 V;  1M56 B;  4DXW A;  1F51 A;  3CMA V;  1NH2 B;  1PNK A;  3X2Q B;  2HKO A;  4JGS A;  5EBM C;  1Q7Y W;  4H37 A;  3P32 A;  5EC1 C;  4I5S A;  2XND G;  1SRY A;  1HWY A;  3ABK C;  3M99 B;  4QE7 A;  2NLJ C;  2R9R B;  1GM7 A;  3F5W C;  1NVP B;  4MVU A;  1BMF G;  3K3W A;  2MK3 A;  3STZ C;  3OGC C;  2P6J A;  3JD4 A;  1AI6 A;  3E8H A;  3WG7 B;  2DW4 A;  3CCR V;  3SYC A;  1VQK V;  3LDC A;  1S5H C;  3CP1 A;  2QM8 A;  1YTF B;  1AJQ A;  5B1B B;  1Q86 W;  1QLE C;  1P4R A;  3BEH A;  4WFF A;  3A0R A;  1YSC A;  3F7V C;  1JX9 A;  1JCH A;  2EZP A;  4JTD B;  3T2M A;  3E8G A;  3OFN G;  3ZMS A;  5B1A B;  4MW8 A;  2LFR A;  4MTO A;  1S0V A;  1YHQ V;  3IGA C;  2DYS B;  2QTO A;  2ITD C;  1K34 A;  4P2Z A;  3CCV V;  2EIL B;  1R3I C;  3B8M A;  3ZN0 A;  3MD0 A;  3ABU A;  2FTK A;  1OCR C;  2F43 G;  4PEL A;  4LCU C;  1V55 B;  2Y69 C;  1M90 W;  1JJ2 U;  3LNM B;  4PA6 A;  3JCZ A;  1FXK B;  3TCU A;  4FPP A;  1S77 D;  2Y48 A;  3K9A A;  1VQL V;  1COW G;  1VQP V;  3DTU B;  1NR1 A;  1AI4 A;  1QBZ A;  1R73 A;  3E8B A;  1VQ8 V;  2IJI A;  2JJ1 G;  5J9P C;  4KP4 A;  3SYQ A;  3JD1 A;  1EZJ A;  5LGU A;  1SZT A;  2IW5 A;  1PNM A;  2ZDI C;  3ASO C;  5EK0 A;  2KB1 A;  1KKD A;  4Z1M G;  1EBO A;  4RQF A;  1AI5 A;  1M56 C;  1NBM G;  2IH3 C;  2P7T C;  1ENV A;  4FK5 C;  3X2Q C;  1MG1 A;  1JQ0 A;  5B1N A;  1RPR A;  3T4Z A;  3K03 A;  3LDD A;  4GX0 A;  3G6E V;  2QA4 V;  4JAU A;  4R50 A;  3E83 A;  2WAM A;  3OAA G;  4MSW C;  4WF9 V;  1K5Q A;  1SER A;  4UXN A;  2Q68 A;  3NXS A;  3TK1 A;  4JAV A;  3K04 A;  4QNH B;  4QJF B;  3UKM A;  2NNU A;  1E1R G;  3H01 A;  3QO8 A;  3FB7 C;  1R6N A;  2WLL B;  1QLE B;  5KUM A;  3SYA A;  1BHB A;  2DQ3 A;  1DF4 A;  1E79 G;  3AG1 C;  4PA3 A;  3WG7 C;  4MTF A;  5CN0 A;  3KG2 A;  3JD3 A;  4OXS A;  5CBF A;  2W0F C;  1QR8 A;  4WFB V;  2WLK A;  2EIK C;  3I56 V;  2Z3Y A;  1K4C C;  5CBH A;  1GM9 A;  5B1B C;  3W7U A;  2LP7 A;  4U7O A;  1J95 A;  2JJ2 G;  4P9O A;  1AI7 A;  1OCR B;  2PI4 A;  2IU0 A;  4UVA A;  5B1A C;  3ASN C;  2P67 A;  2YEV A;  1CPY A;  3OMN B;  2DYS C;  2HVK C;  5L3D A;  5KUK A;  2W6J G;  5KA5 A;  4ASU G;  1OCZ C;  2WSS G;  1XL4 A;  4TT3 G;  3G4S V;  1FXV A;  3ZMV A;  1M57 B;  4MS2 A;  1V55 C;  3AG2 C;  1K97 A;  4RO2 A;  2B5U A;  2WPD G;  4U7N A;  3ASO B;  3AG4 B;  2CK3 G;  2IH1 C;  2WLJ A;  1S3J A;  5CA3 A;  1SET A;  1Q81 W;  3MHS C;  1W0K G;  2X7R B;  5LGT A;  4BIZ A;  3E8F A;  3ZRV A;  1GK9 A;  1I5Y A;  4N23 A;  1VQN V;  1BL8 A;  1K5S A;  5CBG A;  1OCC B;  2LFS A;  2IJJ A;  3P30 A;  1I5X A;  1QR9 A;  2ZQM A;  1R3L C;  3AG3 C;  5HFL A;  4UUJ C;  3RW0 A;  4RUF A;  4L87 A;  3AG1 B;  4JYB A;  1PD3 A;  3ZRW A;  3HPL C;  1K8A W;  4PDV A;  1QLN A;  2EJR A;  1G8M A;  3OUF A;  5L3B A;  2EIK B;  2ATK C;  4TSF G;  2WLM A;  2XAQ A;  1AJP A;  1JOY A;  4LBE C;  5H9C A;  5LHH A;  1AR1 B;  3E2E A;  4LC1 A;  4E2L A;  5L3C A;  1GKF A;  2OT5 A;  3ETG A;  3ASN B;  4HYO A;  2JEU A;  1OZ0 A;  4WFA V;  2WLI A;  5CMU A;  3WFV A;  3RVZ A;  1N8R W;  1ARO P;  1OCZ B;  1F4N A;  1RPO A;  1K33 A;  2A9H A;  3TET A;  1QVG U;  3RBZ A;  3ABM C;  1ORQ C;  3RVY A;  2XAF A;  3AG2 B;  5FL7 G;  4WCE V;  1F4M A;  2V1D A;  2DQ0 A;  2ZD9 A;  5HFM A;  1SES A;  3CXC U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...