1GMGA

Alanine 31 proline mutant of rop protein, monoclinic form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN ROP
molecule tags Transcription regulation
source organism Escherichia coli
publication title Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search.
pubmed doi rcsb
total genus 23
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gmgA00
3K79A 2GHYA 4DO2A 2IJHA 1F4MA 1RPRA 1RPOA 2IJIA 1F4NA 1PD3A 1GMGA 1B6QA 2IJJA 2IJKA 1ROPA 1NKDA 1GTOA
chains in the Genus database with same CATH superfamily
1VQPV 2HG5C 1F23A 4O4JA 5JCOA 5F2VO 1K4DC 4JASA 2OCHA 2F43G 3EFFK 4X66B 1DK1A 5CBGA 5JQGB 1OJHA 2KSDA 3AG1C 2ZNIA 3CRMA 1SKVA 3JCZA 2ZR3A 4JGSA 4JI5O 4O2AA 3CPWU 2JS3A 2H8PC 4O4JB 4RO2A 4GX2A 3E8GA 2BTQA 1A32A 3K08A 1FAFA 1CPYA 2IU0A 3UO2A 1VQMV 2NLJC 3JD2A 1NTKH 2VRZA 1SQGA 3E8BA 3JYCA 4B3MO 4Z2WA 1FFXB 4GKKO 4YJ3B 4ZI7A 2QM7A 2E5LB 3EHBB 5L3BA 3E8HA 3T1YO 2E74B 1SA0A 1P7GA 1R3IC 1V54C 4X1KA 1FD9A 2PY5A 4Z1VA 1H2MA 2RJZA 4JI2O 1SS3A 4JI8O 4W4LA 5LMNO 4LNUA 3O65A 5J2TA 1IZ3A 4K8XA 1X4TA 3HKDB 3ZCCA 3RBZA 1IXBA 5EIBC 4R6ZA 4DR5O 1D5AA 1R3LC 2Z3YA 2P6JA 5KAFZ 4EB6A 5JVDB 5KMGA 1XDCA 4XDLA 2YSUB 3AG3B 3ZHTA 2R9IA 4AILC 1D5NA 5B66Z 4AHCA 4B7KA 1S5HC 3IFXA 2IH1C 5CA0A 2XTAA 1FXKC 3OR6C 3G67A 4BIUA 3ZHUA 5IYZB 3J81N 1MG1A 5KHIA 1EBOA 4BW5A 1GRJA 1NI8A 4Q20A 2Q67A 1HWYA 2RQ6A 3K79A 2UUAO 4YJ2A 2ZNJA 4KHPB 5LYJA 2A7WA 3ASNC 3M99B 5K1PA 5B1AC 2YI8A 1JQ0A 5B1OA 4CBCA 4DV7B 3OFNG 2DYRB 5JH7A 2HLDG 4LP8A 3FYEB 3ZMTA 3W7SA 2Q9LA 4ASUG 2ZDIC 3UKMA 1JA8A 1HNWO 4JI6B 4K3AA 4MTOA 3T4ZA 4X66O 1GAXA 2IJIA 4X65B 1K97A 3UQ8A 4RUFA 3B8MA 2CTPA 4PA6A 5E79Z 4U3JA 2WAMA 2M6YA 2FTKA 4AI8A 5IE9A 4DV1O 1S5JA 2EBOA 1UJWB 1K3EA 3ZBHA 5FL7G 4WBNB 5IY5B 1CXZB 2IJJA 3S3WA 5BR8O 4LFCO 1HR0B 1FFXA 3J7AU 2LO1A 1E79G 1XMOB 3ETEA 3KKYA 4XDKA 1XMQO 5H6QA 3ZN1A 2JGDB 1AP6A 1Y67A 3KCXA 2R70A 3CRRA 3D3IA 5LXTA 2OWOA 2F95B 3QO5A 3HKBB 4HNAA 2OT5A 4H0LB 2FB5A 3U0ZA 4DR2B 4YJ3A 2ZM6O 4L8JA 4H13B 3ABLC 3SPGA 1I5XA 1S5LZ 3WB0A 5KUKA 1ZL8B 2QSAA 4B3TB 1SA0B 2HHHB 5LMNB 2EIMC 1XEQA 1I7FA 3F7VC 1CP9A 2RNBA 4MTFA 3E22A 1EFRG 4X1IA 1Y4MA 4O2AB 1SQQH 1G1XB 1GO3F 1SQXH 3BPZA 1VQ8V 3LDDA 1IXMA 1R6KA 2DYRC 4GX1A 3ZHRA 1KUQA 1FJGO 2PI5A 1QLEB 2K9PA 2PYJA 4JI0O 1VQNV 4CS4A 2QJ1A 1K4CC 1PNKA 2EINB 1I0HA 3X2QC 3VQXA 5GONB 1PL0A 3SYOA 4PD4F 4QPJA 1NTMH 2F93B 3SJQC 4N23A 1VARA 4TWKA 3C3TA 4O4IB 1TVKB 2IW5A 1O9GA 2QGNA 1PM9A 2EIKB 1GK9A 1QVGU 3C3SA 3JCUZ 2P5OA 5LBQA 5LL6Y 2WLLB 2X6BA 1THZA 4IHJA 4FMTA 4JZ2A 3JAMN 2QWRB 3ZMVA 4WFFA 4GT1A 2P06A 2RCVA 1TUBB 4U7OA 2HVJC 2LJ2A 2QE7G 3OE7G 5K1XA 1PL4A 3AG3C 4FM1A 1EZJA 4JYBA 3DC5A 2X0LA 1RSOA 3CYOA 3JATA 1TGOA 2KG7B 1OHHG 3HR0A 3STZC 4JAAA 1H2LA 1CEZA 1PD3A 3N2KA 2A06H 1ZTEA 3K06A 5JCOC 2UUCO 3WFVA 4JTAB 5IYCO 4BR6A 4EKWA 3ZRWB 4MVSA 2GHYA 3TETA 4DRXA 1MZFA 4FFKA 2Q7HA 1NBMG 1QLEC 2PUSA 3CC4V 1H2KA 2Q7EA 3OW2U 1DGSA 2VQFO 4PA4A 1L0NH 1HW7A 2VQEO 1WJZA 1JPXA 3E2EA 2QKCA 1QVFU 1AJPA 2UXCB 2CDYA 3RT3C 4RQEA 2EZOA 3BRCA 5EBWC 1EN6A 2HJFC 2AXTZ 2JIZG 3RWRD 4I4TB 1BQZA 1AR5A 2Y0PA 1YHQV 1K9MW 2Q8VA 2JRIA 4DR7B 2DYSB 5LHIA 2AHZA 3A0BZ 3AK3A 4FJCC 4FLUA 1K92A 3G71V 3RYIB 2ATKC 4Z1MG 5LHGA 3KCYA 3BEHA 2G38A 2Q73A 1SQBH 2N04A 3CJHA 4BIZA 1N0JA 4I4TA 1KKCA 3D3QA 3ZHVA 2B9ZA 4PA7A 1COWG 2AZ0A 3SYAA 4MVUA 1JJOA 2B5UA 3BCCH 1QQCA 2Z0AA 3D8CA 2QDOA 3JAWB 3CP1A 4CS3A 2EJ7A 5KHJA 4E4EA 3RYCA 1M9NA 1B6QA 2EIJC 2K1EA 1Y74A 3X2QB 2CAZC 1V55C 1Q43A 1Y76A 2GTSA 3H1JH 4FFBA 1OCZC 1KD1W 4LFAO 4U7NA 3H1HH 4A5UB 2Q5ZA 1IDSA 4QE7A 5AG2A 2R9RB 4LF4O 4IGGA 4LF8O 3MDSA 4I5SA 4FLVA 2ZE7A 4U3JB 4RAIA 4GZRB 3K03A 1L0LH 2WLLA 4PV1B 2EIMB 1WB8A 5KMGB 1GN2A 3ASOC 2UUBO 2UXXA 4JYYA 5H5NA 1M1KW 4GUNA 3CX5F 4TSFG 2QM8A 2LFSA 2YIDA 4JI8B 1VQOV 1YDXA 1M93A 1NS1A 4WFEA 5JJNB 1XILA 3AG4C 3VQYA 1W2BU 2CTRA 4MW8A 2EILC 4DV3O 3M7MX 1KP3A 1E1RG 1N33O 3F7YC 4I50A 2QWQB 3B09A 1KQSU 3UCSC 3W7TA 3FX7A 3U10A 5EYPB 2UU9O 1P49A 3BFRA 5BY1A 5KHGA 3DTUB 4JYCA 3A0RA 3K58A 4UVCA 2CE4A 2CH7B 4D7SA 5IJ9B 4DR4O 1VQKV 2OTLV 1TVKA 5CA1B 3KG2A 2M7WA 4DR4B 4FK5C 4KL1A 3N2GB 3W7WA 4DV0B 1PKXA 2ADPA 1TAEA 4IYHA 3JD3A 3CB2A 5CB4A 4GKJO 1NVPB 2KB1A 1HNWB 2GUZB 2W0XA 4DV2B 2JEXA 1XNQO 3T1CA 4K0KB 2YS8A 1RM1C 1AILA 2YICA 3OTOB 1VMGA 4PDVA 5EC1C 2QR4A 1ZX3A 1IBLO 5DM6V 3OTOO 2P90A 1F51A 3DXRB 1XHXA 1AB3A 2XAQA 2OCCB 1WA8B 2DW4A 3HKCA 3JAWA 1IVSA 4I55A 1Y6XA 3K59A 3WU2Z 5LMUO 5EZYA 1JR9A 4LF6B 2MK3A 1EN4A 1H8EG 3DC6A 4LF7O 1GKFA 2CUGA 2XHBA 4JI1O 1W0JG 2JS5A 5IYDO 1M56B 1JCHA 2RDCA 2YEVA 3TK1A 2ZQMA 1YXBA 4B3MB 4I7ZB 4LF5O 4R8CA 3HB3B 1NVPD 2BOBC 1JVMA 3JATB 2HKOA 2ZINA 4MTGA 4OGQB 1H2NA 4XBFA 3L73H 4TQDA 4O4HB 1I94O 3K3WA 5L3FA 1SRYA 4QIWF 3CRQA 1KB9F 4IT5A 4G2KA 1VF6C 1EZVH 2HJDA 3SR2C 1FFTB 4LH7A 1B06A 3LNMB 4IIJB 3H9VA 5LGTA 4X62O 1F4MA 4PHZA 1Q3EA 1N34B 2OTJV 1JMKC 1VQ7V 3SYCA 1NKDA 5J2UB 1XREA 2AHYA 3JASB 2UUAB 3F5TA 5CA3A 2P4VA 4FFBB 3AG4B 2YIAA 4GKJB 3O9OA 1FXKA 2VS0A 1BZKA 3VQVA 2FMLA 1GN6A 4DUZB 5IWAO 2JGDA 4TT3G 4CH3A 3UT5A 4DUZO 3E8FA 4O4HA 1G8MA 1TA8A 4HNAB 3HKBA 3OUFA 2B1GA 3OGCC 4EEQA 3CCUV 3F5WC 4CZZA 2E76B 2RMKB 2ZIOA 1YTFD 1ZWIC 1J5EB 3CE2A 3CHXA 4X1YB 3ABTA 3ABKC 1O9HA 1OCRB 4LWSA 1UFIA 1B04A 5L3DA 4HAMA 2WPDG 3BA8A 4G28B 4B3RO 4LFCB 1SESA 4F4LA 4PDLA 5DECA 4LR3A 2P4KA 2WA3A 2AZ2A 1XMQB 2QWPB 2ZD9A 3RFRA 4NVPA 2P67A 4R50A 5CA0B 5LMUB 3DXRA 2ETNA 1VF7A 4I50B 4MSWC 4DR2O 1ZL8A 2ZM6B 3CRCA 2ADQB 3QF7A 5HFLA 3ZHSA 2DWDC 2YDEA 3NR7A 4J42A 1YCIA 4JPRA 5JVDA 3FFQA 1ORQC 1Q7YW 5KAIZ 1WAZA 3HKEB 1BCCH 1P7BA 2OIEA 1GM8A 1MNGA 5KHHA 1Q8IA 3ETGA 2E75B 4JI3O 2XAGA 5B1AB 4BW9A 4P9PA 1V54B 2F66C 3SPIA 4HZ3A 2GV9A 3UO3A 4GKKB 4UUJC 4X9QA 2DQ3A 5CBFA 2JGUA 1LNQA 4O4LB 1Q90D 4J41A 4ZI7B 1FXHA 4B3TO 1SETA 3HKDA 1R6TA 1Q82W 4LH6A 3JALB 2Y0IA 2GTAA 3ASNB 1N34O 4OX9O 3GB7C 5EYPA 1FPOA 3BAAA 2FL4A 1VQ6V 1MZEA 3QVNA 1FXKB 1XBLA 3FB8C 2WLNA 4IL6Z 1GH6A 3CCJV 2N05A 2KQXA 3QTCA 2L35A 4I0XB 3S3XA 5BMVA 3IGAC 1OCCB 4Q6GA 1Q6UA 4E2LA 2ZXWB 5LP6B 3RYIA 4K8ZA 3L74H 3DSQA 1FXVA 1P84F 2DJVA 4MT8A 4OPHA 4WFBV 2LQTA 4R7CA 3CCSV 1JOYA 2Y69C 2W0FC 3EXAA 1XI1A 2X6AA 2A3QA 5B3SC 2BSKA 4KHPO 4WCEV 2X6CA 2F4VB 3AK2A 4LF8B 5IJ0A 2GUZA 5KA6A 4FLYA 1VIBA 3SPCA 5B1NA 1XQ8A 4JYAO 3WG7B 2GSMB 1K5QA 3B40A 3MD0A 4EFBA 1OCRC 4WF9V 2JK5C 3ABLB 5FLXN 2Q0OC 4JI7O 4TQFA 1YIJV 4MS2A 2DMXA 4MVRA 4MTXA 3JASA 3ZS8C 1RP3B 4MW3A 3CMAV 5CMUA 2EINC 1N32O 1DF5A 4UXNA 4JTCB 1ZUQA 1I5YA 1N4CA 3APQA 4B08A 4JI4O 4DV3B 1SZXA 3QO7A 4UV9A 4NTYA 3CSXA 2H3OA 5BR8B 1YJNV 1WB7A 3P3PA 5KUMA 1KBHA 1MABG 3U11A 5ITZB 5CN0A 2LFRA 4MVMA 4NTXA 2ZDIA 4IIJA 3JSLA 4TV9A 1FKAO 4O2BB 3JAKB 4TV9B 1NJIW 2ZXWC 1JFFB 1GN3A 3LDEA 5JJEB 3AG2B 4LC1A 1SQFA 4DW0A 3K5NA 3ZMSA 4O2BA 2UXDO 2CGNA 2Y69B 4OPAA 4D7TA 3CC2V 1W59A 4LNUB 4L87A 1XNQB 2XASA 1ZSPA 1SQVH 4K0KO 3A2FA 2QKAA 1D2DA 4DYLA 4F6RB 2JEUA 3CCMV 4X20B 5EBMC 2A9HA 1KU9A 3K04A 1QHTA 1VF6A 4DUYB 3TXSA 4NYKA 1BHAA 5H6RA 3M8AA 3OEEG 2VWJA 1VQ5V 4PELA 4KFMA 3UM7A 5J9PC 2XUMA 4LWSB 1BL8A 1VQ9V 1N0NA 4NTWA 1ENVA 2UUBB 3BY6A 1V55B 4DV5B 3B2EE 3GWKC 5GTHZ 1WNSA 1XNRB 2ZE5A 3T1HO 1Z2GA 1GM7A 2BTQB 4O4LA 3E89A 4JI4B 1K7DA 3SJBC 1NTZH 4KUMA 4LF9B 1BMFG 2QEXV 4YHHO 5IYBO 1U96A 3GWOA 3SJAC 4YHHB 1EM1A 1XOUA 4LCUC 2L6LA 1PPJH 2DQ0A 2WWWA 2AW9A 2YIBA 1H2SB 4JAUA 5A2QN 4WFGA 2P7TC 2QTOA 2R9AA 5LA6A 2A0LA 3SJCC 4MVOA 1QU7A 5IYZA 2D2CB 1MSDA 3G4SV 3BHPA 4I0XA 2JVDA 1Y74B 5BZBA 3P30A 4WBNA 5H9CA 1WPBA 2DYSC 5BXZA 5EK0A 4DV0O 3G80A 2UUCB 1KC8W 3E86A 3R65A 1YITV 1YZBA 2Q4PA 3STLC 3AG1B 1NT2B 4DV4B 3C90A 3CXHF 5KX5B 4PI2A 3FAVA 1RSOB 3ZMZA 4DUYO 3IJ4A 1WLEA 1R1BA 3FB6C 1MA1A 2CGOA 2R72A 3L9DA 5LXTB 1JFFA 4DR6B 1KKDA 4CH4A 3DGEA 4EFEA 2YUAA 3ZRVA 2NN4A 4DV2O 2ZE6A 3JARA 3AG2C 4H44B 3RYHA 4MVZA 3L71H 1XHZA 5DEDA 4YIOA 4CC5A 1AI6A 1LUVA 1M4UA 4GCZA 4DR7O 3T4DA 3ABMB 3ASOB 1KECA 2YXYA 4LF5B 3AK1A 4UB6Z 1ZAUA 5H2FZ 4JTDB 2RN9A 3CC7V 2JJ1G 2X7RB 1QBZA 2BE3A 3P32A 3K5LA 1F4NA 2E3CA 3CS5A 1GM9A 4J9YB 1M56C 2P22C 1M57B 1T5EA 4JI2B 4DR1B 3T1HB 4J9ZB 2EX3A 4CH5A 1PP9H 2ZT9B 1IURA 1JJ2U 1BSMA 1VF5B 3PJSK 4KXRA 1GTOA 1UPGA 1IX9A 1F7YA 4WFAV 3OT7A 2ARHA 3K5OA 1YSCA 4DK1A 2E5LO 1RM1B 1MOFA 1Z5WA 3JD0A 4FLXA 1BE3H 3K5MA 2WLIA 4PDMA 1Q6HA 4DRXB 1HNZB 1US6A 4LFBO 1IBKB 2XAJA 2LP7A 2DOSA 3N27A 2VWKA 1DF4A 5JJJB 3K57A 1QNMA 3CWBH 4PI0A 4TUYB 1U97A 3HKEA 4LBEC 5D5QA 3CXCU 5GTIZ 5IT9N 4B3SB 2HFEC 4EB6B 1FYJA 4UCSA 2HVKC 3L72H 4CH6A 2H94A 4YXWG 2JDIG 4UVBA 2XAHA 4DR5B 3ZMUA 3VQWA 2W6JG 1R3JC 1Z5VA 2ZIMA 4UCTA 2OCCC 4ZHQA 4YIPA 4DV4O 3RVZA 4DV6O 3NXSA 4F6EA 5A9GA 1IBLB 1IBMB 1K8AW 1HDJA 2AGAA 1SF9A 1K73W 3B77A 1WA8A 1AP5A 5CB4B 4NXMO 5GONA 1RPRA 5LYJB 4DV1B 1R6NA 4CS2A 5HFMA 2LW7A 4X64O 4I55B 4J7JA 3RYHB 2WLJA 4UV8A 4UCUA 3CCEV 3CRAA 1NZ6A 2OYQA 2EILB 3D36A 2Q68A 3MAQA 2FYUH 2WLHA 3FB7C 1KMIZ 4F6RA 1OV9A 2EIJB 1YJWV 3G6EV 4YY3B 3RN4A 4JI7B 4YJ2B 4JI6O 1Y66A 4GX5A 1QR8A 2UXNA 3ZIAG 2ODMA 2DN9A 2V1DA 2KKWA 1YF2A 4HBNA 1AJQA 2WSSG 2WA4A 4P30A 3CD6V 1DLBA 2Y4UA 4N21A 1YEWA 3SGIA 1S76D 2BSKB 3ABMC 3CMEV 4FPPA 3GVMA 2UXBB 2QWOB 1HNZO 1NH2B 3WB1A 4UFZA 1S0VA 4U3FH 3OGIB 2UXBO 4C7UA 1OCOB 1EN5A 3I5DA 3ZJZA 1G4YB 2YXHA 3ML0A 4DW1A 2JJ2G 3ABKB 3K0GA 1XMOO 4GLXA 2C2AA 1JX9A 4BAYA 1DTOA 3H1LH 4RQFA 2NNUA 3T1YB 3QO8A 2Q7GA 4JV5O 3K9SA 5IWAB 1I94B 1AI5A 5C93A 3E35A 1Q5OA 1G6UA 5LA6B 3ZHQA 2UXDB 3I56V 4DK0A 2Y4TA 3A0HZ 5IDJA 5IY5C 4X62B 2IM9A 1J5EO 1VQLV 1NR1A 4NXMB 2PI4A 5B3SB 2PZSA 3CCRV 1SC5B 1AROP 1VQ4V 3LUTB 2F23A 5CA1A 1PNLA 4DXWA 4B3RB 1N36O 3OAAG 4RWUA 1S3JA 1FJGB 3N2KB 4DV6B 3L70H 4J7ZA 2LW1A 2ZKOA 4JYAB 2OIGA 4X1IB 3HPLC 2IJHA 3THOA 2QA4V 3TCUA 4G27B 4UCVA 4J80A 4YY3O 2A79B 3H1IH 3SPHA 1Q6IA 4XDJA 2PYLA 3AEIA 2F1MA 3VBBA 3OEHG 2LGWA 1OCZB 4O4IA 1J95A 3EVKA 3N2GA 3SYPA 4J11A 5JH7B 2F4VO 3B8NA 3ICXA 2O57A 4JI5B 1OCOC 3RYCB 2LGQA 3SDLA 1AI7A 3WG7C 3ETQA 4UCRA 2MW2B 2B1IA 2EJRA 4PA3A 4TV8B 2KG7A 2QKSA 4JI3B 3WB2A 2WLMA 1WPXA 1S77D 2Q6AA 2CTQA 4D6TH 3E83A 4X65O 1M57C 2VQFB 1WN7A 4X89A 3LNNA 3RVYA 4OXSA 4PA9A 3KZIZ 1YTFB 5E1AC 2XT9A 5GW7A 1BT8A 1QLNA 5LP6C 3BVOA 5LHHA 4I9WA 4X8AA 2QTSA 1QR9A 4K35A 4AQYB 4QPKA 1BHBA 4RUEA 2ZR2A 2Z5UA 4OX9B 1I08A 1FS0G 3CCVV 4WFHA 4BWAA 2HR3A 3LDCA 4ZBMA 1YI2V 5KHKA 3BA9A 1VP7A 5LGUA 4FM0A 4B7EA 2PF4E 4X1KB 5L3GA 2WLKA 2GBOA 1GN4A 1M5IA 1YJ9V 4FLZA 3G6BA 3P3NA 4FZ1A 4ZKIA 2XNDG 5J2TB 4NB5A 1N36B 2PTMA 5FNVB 3TGUH 3BABA 2UXCO 2ZCEA 2CH7A 1AVMA 5EZYB 1QCEA 2Y48A 4IYIA 2BCCH 4LFAB 1SZTA 4NXNB 3FAVB 4ICGA 5BMVB 1AJNA 2QWNB 4CC6A 3B4SA 2HP8A 2FKXA 1R73A 2EIKC 1Q86W 3ZRSA 1BGYH 2IBZH 1M90W 1NH2D 1HP8A 4DV7O 3JAKA 3ZRXA 3OUSA 4FLTA 3FKSG 2ILMA 3OD4A 3MHHC 2XAFA 1LUWA 3CJHB 1B3QA 4DV5O 3K0DA 3ZRWA 3HKCB 1ROPA 3LSSA 2BOCC 3PN1A 3CCQV 3JARB 1WP8A 1S72V 1HNXO 1N32B 3ABUA 3ZX6A 3TJTA 5IJ9A 4ZOLA 3QG5A 1H2GA 1LR1A 3CCLV 5EC2C 1H8HG 2WLIB 3SYQA 2ZE8A 3Q4HA 5B1BB 4FIPC 1AI4A 3E22B 5FPRA 1HR0O 5ITZA 2PGGA 5JWPA 1YVWA 5B5EZ 4NR1A 5DN6G 4MVQA 3SPJA 4DR3O 4LFBB 1OCCC 5EIBD 3D36C 3OMAB 1V9PA 5FPOA 3JD1A 5EBLC 3Q4HB 1P4RA 1MSWD 3ETDA 3JALA 1L1FA 4AQYO 1RFYA 5KX5A 2ITDC 2YXLA 3ZN0A 5LGNA 4H37A 3FD9A 5D5PA 2EULA 4KP4A 3TXQA 4QNHB 1KP2A 2IH3C 2N74A 1VEWA 2HHHO 2V7QG 2DE0X 3JSNA 4P9OA 4ABMA 2YEVB 3MHSC 3AG7A 3H1KH 4NXNO 4UCOA 1SQPH 2UU9B 1GMGA 2ITCC 2IU3A 4GYCB 4JF3A 1URFA 2EZPA 1ZLZA 4H33A 1AR1B 3FB5C 4ZIBA 1KYOF 1WP7A 3OMIB 4JI0B 2NR5A 4FVMA 2Q0AA 5C8YA 4DR6O 3IC9A 4LF6O 2CK3G 1E1QG 4UVAA 4LF7B 1BQ0A 4NKGB 1N8RW 4JI1B 3QNEA 5LOVA 4JZGA 1W0KG 5LP6A 1XL6A 1PNMA 4QGPA 1XNRO 5LOVB 4I9QA 3R66A 2BTOA 2DWEC 4GX0A 4BIOA 1PV0A 1XUQA 4QE9A 1XL4A 1SERA 1X59A 3I55V 4LF9O 2V4DA 3OTFA 3FYIB 3A8TA 2W6IG 4QJFB 3OM3B 2XOKG 5KLVH 4J10A 3APOA 3W7XA 1NQTA 5KA5A 1HNXB 2IJKA 2YIBD 1Y76B 4UB8Z 5TISZ 4DR1O 4ZOLB 5L3EA 1Q81W 4HYOA 3T2MA 1AR4A 4PJ0Z 3RW0A 1L8DA 5C8YB 3UT5B 1IBKO 4FZ0A 4X20A 4X88A 4LF4B 3IAYA 4IHJB 2CTWA 4X1YA 3CEIA 2D3OW 1BS3A 1H38A 2QM4A 4ZHQB 4TUYA 4TOIA 4JV5B 1OZ0A 4DR3B 1TUBA 4PDRA 5L3CA 3RYFB 3ZEDA 5FNVA 5JQGA 2YI9A 3RGBA 1MMMA 5IJ0B 3K9AA 2HEPA 3OR7C 3LSUA 3W7UA 4W4KA 4DO2A 4J7KA 4FM2A 1TUEB 2VQEB 3VOUA 5CBHA 1K33A 4B3SO 3H01A 3RYFA 1K5SA 1NU1H 1NR7A 1N33B 3J80N 5J2UA 4X64B 3JD4A 3OMNB 4P2ZA 4FLWA 2Q69A 1K34A 3L75H 3IC7A 1RPOA 2GDSA 3LSQA 1IBMO 1R3KC 4JAVA 2YC0A 4TV8A 5B1BC
chains in the Genus database with same CATH topology
1VQPV 2HG5C 1F23A 3E35A 1K4DC 4JASA 3QO7A 4UV9A 4QE7A 2R9RB 2F43G 3I56V 3EFFK 4I5SA 1YJNV 5IDJA 5IY5C 5CBGA 4RAIA 1VQLV 1NR1A 3K03A 3AG1C 2WLLA 5KUMA 1MABG 2PI4A 2EIMB 5CN0A 5B3SB 2LFRA 4MVMA 3CCRV 2ZDIA 3JCZA 2ZR3A 4JGSA 1AROP 3ASOC 1VQ4V 3LUTB 2UXXA 1M1KW 3CPWU 1PNLA 2H8PC 4RO2A 4GX2A 3E8GA 4TSFG 4DXWA 3K08A 2QM8A 2LFSA 3OAAG 1CPYA 1NJIW 1S3JA 1VQOV 2ZXWC 4WFEA 3LDEA 2IU0A 3HPLC 2IJHA 3AG2B 3AG4C 2QA4V 4LC1A 1VQMV 2NLJC 3JD2A 3TCUA 4G27B 3E8BA 1W2BU 3JYCA 4MW8A 2EILC 2A79B 1KP3A 3SPHA 3ZMSA 1E1RG 4XDJA 2QM7A 3AEIA 2Y69B 3CC2V 3EHBB 3VBBA 3F7YC 3OEHG 1OCZB 4L87A 2XASA 1J95A 5L3BA 1KQSU 3E8HA 3W7TA 3SYPA 3B8NA 3DTUB 4JYCA 1OCOC 2JEUA 3A0RA 3CCMV 5EBMC 2A9HA 1AI7A 3K04A 3WG7C 1R3IC 4UVCA 1V54C 2B1IA 2EJRA 4UXNA 1BHAA 4PA3A 5H6RA 3OEEG 1VQKV 2QKSA 2OTLV 2WLMA 1VQ5V 1WPXA 3KG2A 2M7WA 4PELA 4KFMA 1S77D 2Q6AA 3UM7A 4FK5C 5J9PC 3E83A 3ZCCA 1BL8A 3W7WA 3RBZA 1M57C 1PKXA 1VQ9V 4X89A 4R6ZA 3RVYA 4OXSA 1ENVA 4PA9A 1R3LC 2Z3YA 2P6JA 3BY6A 3JD3A 1V55B 1YTFB 5E1AC 5GW7A 1NVPB 2KB1A 1QLNA 4XDLA 2YSUB 3AG3B 2R9IA 2JEXA 5LHHA 4I9WA 4X8AA 1QR9A 3T1CA 1GM7A 4QPKA 1BHBA 1RM1C 4RUEA 2ZR2A 1S5HC 2Z5UA 4PDVA 5EC1C 3IFXA 2IH1C 1FS0G 3E89A 3CCVV 4WFHA 5DM6V 1K7DA 2HR3A 2P90A 1F51A 4KUMA 1FXKC 3LDCA 1BMFG 3OR6C 4ZBMA 1YI2V 2QEXV 4BIUA 2XAQA 5IYBO 2OCCB 1MG1A 2DW4A 3GWOA 1EBOA 4BW5A 4Q20A 5LGUA 2Q67A 1HWYA 4LCUC 3K79A 2DQ0A 2WWWA 5L3GA 2WLKA 4JAUA 2MK3A 1H8EG 3M99B 3ASNC 4WFGA 1GKFA 5B1AC 1YJ9V 1JQ0A 1W0JG 5B1OA 4CBCA 5IYDO 2P7TC 2QTOA 3OFNG 4ZKIA 2XNDG 2DYRB 2HLDG 4LP8A 3FYEB 1M56B 2A0LA 3ZMTA 3W7SA 1JCHA 4ASUG 4MVOA 2ZDIC 2YEVA 3TK1A 3UKMA 2ZQMA 3G4SV 4MTOA 5BZBA 4R8CA 3T4ZA 3HB3B 3P30A 5H9CA 2DYSC 1NVPD 2BOBC 2IJIA 1QCEA 1K97A 2Y48A 5EK0A 4RUFA 3B8MA 1JVMA 1KC8W 2HKOA 3E86A 4MTGA 3R65A 4PA6A 4XBFA 1YITV 3K3WA 1SZTA 5L3FA 2WAMA 1SRYA 2FTKA 3STLC 4QIWF 3AG1B 2EBOA 4G2KA 1UJWB 1AJNA 1K3EA 5FL7G 1R73A 2EIKC 5IY5B 1Q86W 1FFTB 2IJJA 3ZRSA 3LNMB 5LGTA 3ZMZA 1M90W 1NH2D 1F4MA 1WLEA 3FB6C 1E79G 3ZRXA 3OUSA 3FKSG 3ETEA 3MHHC 2OTJV 2XAFA 4XDKA 5H6QA 3ZN1A 1VQ7V 3SYCA 1NKDA 1KKDA 3DGEA 3D3IA 3K0DA 2AHYA 3ZRWA 1ROPA 3LSSA 2BOCC 3CCQV 3QO5A 1S72V 2OT5A 5CA3A 3ZRVA 3ABUA 3AG2C 3AG4B 4MVZA 3ABLC 1FXKA 1AI6A 1H2GA 3SPGA 3CCLV 1I5XA 4GCZA 5EC2C 1H8HG 3T4DA 3ABMB 3ASOB 5KUKA 4TT3G 2WLIB 3SYQA 1KECA 5B1BB 3E8FA 4FIPC 1AI4A 2EIMC 1G8MA 4JTDB 3CC7V 3OUFA 4MTFA 3F7VC 1CP9A 2B1GA 2JJ1G 2X7RB 3OGCC 1QBZA 3CCUV 1EFRG 3F5WC 4CZZA 1Y4MA 1YTFD 1ZWIC 5DN6G 4MVQA 3SPJA 3P32A 1GO3F 1F4NA 3ABTA 1VQ8V 1OCCC 3LDDA 1GM9A 3OMAB 1IXMA 1R6KA 2DYRC 4GX1A 4J9YB 3ABKC 1M56C 1OCRB 2PI5A 1M57B 1QLEB 3JD1A 5EBLC 1P4RA 5L3DA 4HAMA 1MSWD 2WPDG 3ETDA 4J9ZB 1L1FA 4G28B 1VQNV 1SESA 1K4CC 1PNKA 4F4LA 4PDLA 2ITDC 2EINB 3ZN0A 3X2QC 1JJ2U 1PL0A 3SYOA 5LGNA 4H37A 3PJSK 4QPJA 1GTOA 3SJQC 4N23A 4KP4A 2ZD9A 4QNHB 4WFAV 4TWKA 1KP2A 2IH3C 2P67A 4R50A 2V7QG 2IW5A 1YSCA 1RM1B 1MOFA 3JD0A 4MSWC 2EIKB 2WLIA 4PDMA 4P9OA 1GK9A 1QVGU 2YEVB 3MHSC 5HFLA 2DWDC 1GMGA 2ITCC 5LBQA 2IU3A 4JPRA 4JF3A 2XAJA 2LP7A 2EZPA 2WLLB 2X6BA 1ORQC 1Q7YW 1THZA 4H33A 1DF4A 4FMTA 3FB5C 1AR1B 3OMIB 1P7BA 1GM8A 3ZMVA 4WFFA 4LBEC 3ETGA 2CK3G 4GT1A 3CXCU 2XAGA 5B1AB 1E1QG 4UVAA 4P9PA 4U7OA 1V54B 2HVJC 2HFEC 1N8RW 2QE7G 3OE7G 3QNEA 3SPIA 2HVKC 4HZ3A 2H94A 1W0KG 2JDIG 3AG3C 4UVBA 4YXWG 1XL6A 4UUJC 1EZJA 1PNMA 2XAHA 4JYBA 3ZMUA 2DQ3A 5CBFA 2X0LA 2W6JG 1R3JC 3CYOA 2OCCC 2DWEC 1OHHG 4GX0A 1LNQA 3RVZA 3NXSA 3STZC 4QE9A 1XL4A 1FXHA 1SERA 3I55V 1SETA 1K8AW 1CEZA 1Q82W 1PD3A 1K73W 3K06A 3FYIB 3WFVA 3ASNB 3B77A 4JTAB 5IYCO 2W6IG 3ZRWB 3GB7C 4EKWA 4MVSA 2GHYA 3OM3B 2XOKG 4QJFB 3TETA 1RPRA 1R6NA 5HFMA 1NBMG 1VQ6V 1QLEC 3CC4V 2WLJA 3W7XA 1NQTA 4UV8A 5KA5A 3OW2U 2IJKA 3CCEV 1FXKB 5L3EA 1Q81W 4PA4A 3FB8C 2EILB 2WLNA 4HYOA 3T2MA 3D36A 3RW0A 2Q68A 3CCJV 1JPXA 2WLHA 3E2EA 3FB7C 1QVFU 1AJPA 2EIJB 1YJWV 4X88A 3IGAC 1OCCB 3G6EV 4E2LA 2ZXWB 4RQEA 2EZOA 5EBWC 2HJFC 1Y66A 4GX5A 2JIZG 1QR8A 2UXNA 3ZIAG 2D3OW 1FXVA 1H38A 4MT8A 2V1DA 4WFBV 1AJQA 1OZ0A 2WSSG 4R7CA 1YHQV 4P30A 3CCSV 1K9MW 3CD6V 4PDRA 1DLBA 5L3CA 4N21A 1JOYA 2Y69C 1S76D 3ABMC 3CMEV 2W0FC 4FPPA 2DYSB 5LHIA 2AHZA 2X6AA 5B3SC 4FJCC 4WCEV 1K92A 2X6CA 3K9AA 3G71V 3OR7C 2ATKC 1NH2B 3W7UA 4Z1MG 5KA6A 5LHGA 1S0VA 4DO2A 1OCOB 3BEHA 3SPCA 1G4YB 5B1NA 3ZJZA 3WG7B 1TUEB 3ML0A 3VOUA 4BIZA 2GSMB 5CBHA 1K5QA 1K33A 3MD0A 4PA7A 2JJ2G 3H01A 3ABKB 1COWG 3K0GA 4MVUA 1OCRC 2B5UA 1K5SA 3SYAA 2C2AA 2JK5C 1NR7A 3ABLB 4WF9V 1JX9A 4BAYA 1DTOA 3CP1A 3JD4A 3OMNB 4P2ZA 1YIJV 4MS2A 4RQFA 2Q69A 4MVRA 4MTXA 1K34A 1M9NA 2NNUA 1B6QA 4MW3A 2EIJC 3QO8A 3CMAV 2K1EA 5CMUA 2EINC 3X2QB 3IC7A 1V55C 1RPOA 3LSQA 1KD1W 1AI5A 1DF5A 1OCZC 1R3KC 4JAVA 4JTCB 4U7NA 5C93A 1I5YA 5B1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K79 A;  2GHY A;  4DO2 A;  2IJH A;  1F4M A;  1RPR A;  1RPO A;  2IJI A;  1F4N A;  1PD3 A;  1GMG A;  1B6Q A;  2IJJ A;  2IJK A;  1ROP A;  1NKD A;  1GTO A; 
#chains in the Genus database with same CATH topology
 1VQP V;  2HG5 C;  1F23 A;  4O4J A;  5JCO A;  5F2V O;  1K4D C;  4JAS A;  2OCH A;  2F43 G;  3EFF K;  4X66 B;  1DK1 A;  5CBG A;  5JQG B;  1OJH A;  2KSD A;  3AG1 C;  2ZNI A;  3CRM A;  1SKV A;  3JCZ A;  2ZR3 A;  4JGS A;  4JI5 O;  4O2A A;  3CPW U;  2JS3 A;  2H8P C;  4O4J B;  4RO2 A;  4GX2 A;  3E8G A;  2BTQ A;  1A32 A;  3K08 A;  1FAF A;  1CPY A;  2IU0 A;  3UO2 A;  1VQM V;  2NLJ C;  3JD2 A;  1NTK H;  2VRZ A;  1SQG A;  3E8B A;  3JYC A;  4B3M O;  4Z2W A;  1FFX B;  4GKK O;  4YJ3 B;  4ZI7 A;  2QM7 A;  2E5L B;  3EHB B;  5L3B A;  3E8H A;  3T1Y O;  2E74 B;  1SA0 A;  1P7G A;  1R3I C;  1V54 C;  4X1K A;  1FD9 A;  2PY5 A;  4Z1V A;  1H2M A;  2RJZ A;  4JI2 O;  1SS3 A;  4JI8 O;  4W4L A;  5LMN O;  4LNU A;  3O65 A;  5J2T A;  1IZ3 A;  4K8X A;  1X4T A;  3HKD B;  3ZCC A;  3RBZ A;  1IXB A;  5EIB C;  4R6Z A;  4DR5 O;  1D5A A;  1R3L C;  2Z3Y A;  2P6J A;  5KAF Z;  4EB6 A;  5JVD B;  5KMG A;  1XDC A;  4XDL A;  2YSU B;  3AG3 B;  3ZHT A;  2R9I A;  4AIL C;  1D5N A;  5B66 Z;  4AHC A;  4B7K A;  1S5H C;  3IFX A;  2IH1 C;  5CA0 A;  2XTA A;  1FXK C;  3OR6 C;  3G67 A;  4BIU A;  3ZHU A;  5IYZ B;  3J81 N;  1MG1 A;  5KHI A;  1EBO A;  4BW5 A;  1GRJ A;  1NI8 A;  4Q20 A;  2Q67 A;  1HWY A;  2RQ6 A;  3K79 A;  2UUA O;  4YJ2 A;  2ZNJ A;  4KHP B;  5LYJ A;  2A7W A;  3ASN C;  3M99 B;  5K1P A;  5B1A C;  2YI8 A;  1JQ0 A;  5B1O A;  4CBC A;  4DV7 B;  3OFN G;  2DYR B;  5JH7 A;  2HLD G;  4LP8 A;  3FYE B;  3ZMT A;  3W7S A;  2Q9L A;  4ASU G;  2ZDI C;  3UKM A;  1JA8 A;  1HNW O;  4JI6 B;  4K3A A;  4MTO A;  3T4Z A;  4X66 O;  1GAX A;  2IJI A;  4X65 B;  1K97 A;  3UQ8 A;  4RUF A;  3B8M A;  2CTP A;  4PA6 A;  5E79 Z;  4U3J A;  2WAM A;  2M6Y A;  2FTK A;  4AI8 A;  5IE9 A;  4DV1 O;  1S5J A;  2EBO A;  1UJW B;  1K3E A;  3ZBH A;  5FL7 G;  4WBN B;  5IY5 B;  1CXZ B;  2IJJ A;  3S3W A;  5BR8 O;  4LFC O;  1HR0 B;  1FFX A;  3J7A U;  2LO1 A;  1E79 G;  1XMO B;  3ETE A;  3KKY A;  4XDK A;  1XMQ O;  5H6Q A;  3ZN1 A;  2JGD B;  1AP6 A;  1Y67 A;  3KCX A;  2R70 A;  3CRR A;  3D3I A;  5LXT A;  2OWO A;  2F95 B;  3QO5 A;  3HKB B;  4HNA A;  2OT5 A;  4H0L B;  2FB5 A;  3U0Z A;  4DR2 B;  4YJ3 A;  2ZM6 O;  4L8J A;  4H13 B;  3ABL C;  3SPG A;  1I5X A;  1S5L Z;  3WB0 A;  5KUK A;  1ZL8 B;  2QSA A;  4B3T B;  1SA0 B;  2HHH B;  5LMN B;  2EIM C;  1XEQ A;  1I7F A;  3F7V C;  1CP9 A;  2RNB A;  4MTF A;  3E22 A;  1EFR G;  4X1I A;  1Y4M A;  4O2A B;  1SQQ H;  1G1X B;  1GO3 F;  1SQX H;  3BPZ A;  1VQ8 V;  3LDD A;  1IXM A;  1R6K A;  2DYR C;  4GX1 A;  3ZHR A;  1KUQ A;  1FJG O;  2PI5 A;  1QLE B;  2K9P A;  2PYJ A;  4JI0 O;  1VQN V;  4CS4 A;  2QJ1 A;  1K4C C;  1PNK A;  2EIN B;  1I0H A;  3X2Q C;  3VQX A;  5GON B;  1PL0 A;  3SYO A;  4PD4 F;  4QPJ A;  1NTM H;  2F93 B;  3SJQ C;  4N23 A;  1VAR A;  4TWK A;  3C3T A;  4O4I B;  1TVK B;  2IW5 A;  1O9G A;  2QGN A;  1PM9 A;  2EIK B;  1GK9 A;  1QVG U;  3C3S A;  3JCU Z;  2P5O A;  5LBQ A;  5LL6 Y;  2WLL B;  2X6B A;  1THZ A;  4IHJ A;  4FMT A;  4JZ2 A;  3JAM N;  2QWR B;  3ZMV A;  4WFF A;  4GT1 A;  2P06 A;  2RCV A;  1TUB B;  4U7O A;  2HVJ C;  2LJ2 A;  2QE7 G;  3OE7 G;  5K1X A;  1PL4 A;  3AG3 C;  4FM1 A;  1EZJ A;  4JYB A;  3DC5 A;  2X0L A;  1RSO A;  3CYO A;  3JAT A;  1TGO A;  2KG7 B;  1OHH G;  3HR0 A;  3STZ C;  4JAA A;  1H2L A;  1CEZ A;  1PD3 A;  3N2K A;  2A06 H;  1ZTE A;  3K06 A;  5JCO C;  2UUC O;  3WFV A;  4JTA B;  5IYC O;  4BR6 A;  4EKW A;  3ZRW B;  4MVS A;  2GHY A;  3TET A;  4DRX A;  1MZF A;  4FFK A;  2Q7H A;  1NBM G;  1QLE C;  2PUS A;  3CC4 V;  1H2K A;  2Q7E A;  3OW2 U;  1DGS A;  2VQF O;  4PA4 A;  1L0N H;  1HW7 A;  2VQE O;  1WJZ A;  1JPX A;  3E2E A;  2QKC A;  1QVF U;  1AJP A;  2UXC B;  2CDY A;  3RT3 C;  4RQE A;  2EZO A;  3BRC A;  5EBW C;  1EN6 A;  2HJF C;  2AXT Z;  2JIZ G;  3RWR D;  4I4T B;  1BQZ A;  1AR5 A;  2Y0P A;  1YHQ V;  1K9M W;  2Q8V A;  2JRI A;  4DR7 B;  2DYS B;  5LHI A;  2AHZ A;  3A0B Z;  3AK3 A;  4FJC C;  4FLU A;  1K92 A;  3G71 V;  3RYI B;  2ATK C;  4Z1M G;  5LHG A;  3KCY A;  3BEH A;  2G38 A;  2Q73 A;  1SQB H;  2N04 A;  3CJH A;  4BIZ A;  1N0J A;  4I4T A;  1KKC A;  3D3Q A;  3ZHV A;  2B9Z A;  4PA7 A;  1COW G;  2AZ0 A;  3SYA A;  4MVU A;  1JJO A;  2B5U A;  3BCC H;  1QQC A;  2Z0A A;  3D8C A;  2QDO A;  3JAW B;  3CP1 A;  4CS3 A;  2EJ7 A;  5KHJ A;  4E4E A;  3RYC A;  1M9N A;  1B6Q A;  2EIJ C;  2K1E A;  1Y74 A;  3X2Q B;  2CAZ C;  1V55 C;  1Q43 A;  1Y76 A;  2GTS A;  3H1J H;  4FFB A;  1OCZ C;  1KD1 W;  4LFA O;  4U7N A;  3H1H H;  4A5U B;  2Q5Z A;  1IDS A;  4QE7 A;  5AG2 A;  2R9R B;  4LF4 O;  4IGG A;  4LF8 O;  3MDS A;  4I5S A;  4FLV A;  2ZE7 A;  4U3J B;  4RAI A;  4GZR B;  3K03 A;  1L0L H;  2WLL A;  4PV1 B;  2EIM B;  1WB8 A;  5KMG B;  1GN2 A;  3ASO C;  2UUB O;  2UXX A;  4JYY A;  5H5N A;  1M1K W;  4GUN A;  3CX5 F;  4TSF G;  2QM8 A;  2LFS A;  2YID A;  4JI8 B;  1VQO V;  1YDX A;  1M93 A;  1NS1 A;  4WFE A;  5JJN B;  1XIL A;  3AG4 C;  3VQY A;  1W2B U;  2CTR A;  4MW8 A;  2EIL C;  4DV3 O;  3M7M X;  1KP3 A;  1E1R G;  1N33 O;  3F7Y C;  4I50 A;  2QWQ B;  3B09 A;  1KQS U;  3UCS C;  3W7T A;  3FX7 A;  3U10 A;  5EYP B;  2UU9 O;  1P49 A;  3BFR A;  5BY1 A;  5KHG A;  3DTU B;  4JYC A;  3A0R A;  3K58 A;  4UVC A;  2CE4 A;  2CH7 B;  4D7S A;  5IJ9 B;  4DR4 O;  1VQK V;  2OTL V;  1TVK A;  5CA1 B;  3KG2 A;  2M7W A;  4DR4 B;  4FK5 C;  4KL1 A;  3N2G B;  3W7W A;  4DV0 B;  1PKX A;  2ADP A;  1TAE A;  4IYH A;  3JD3 A;  3CB2 A;  5CB4 A;  4GKJ O;  1NVP B;  2KB1 A;  1HNW B;  2GUZ B;  2W0X A;  4DV2 B;  2JEX A;  1XNQ O;  3T1C A;  4K0K B;  2YS8 A;  1RM1 C;  1AIL A;  2YIC A;  3OTO B;  1VMG A;  4PDV A;  5EC1 C;  2QR4 A;  1ZX3 A;  1IBL O;  5DM6 V;  3OTO O;  2P90 A;  1F51 A;  3DXR B;  1XHX A;  1AB3 A;  2XAQ A;  2OCC B;  1WA8 B;  2DW4 A;  3HKC A;  3JAW A;  1IVS A;  4I55 A;  1Y6X A;  3K59 A;  3WU2 Z;  5LMU O;  5EZY A;  1JR9 A;  4LF6 B;  2MK3 A;  1EN4 A;  1H8E G;  3DC6 A;  4LF7 O;  1GKF A;  2CUG A;  2XHB A;  4JI1 O;  1W0J G;  2JS5 A;  5IYD O;  1M56 B;  1JCH A;  2RDC A;  2YEV A;  3TK1 A;  2ZQM A;  1YXB A;  4B3M B;  4I7Z B;  4LF5 O;  4R8C A;  3HB3 B;  1NVP D;  2BOB C;  1JVM A;  3JAT B;  2HKO A;  2ZIN A;  4MTG A;  4OGQ B;  1H2N A;  4XBF A;  3L73 H;  4TQD A;  4O4H B;  1I94 O;  3K3W A;  5L3F A;  1SRY A;  4QIW F;  3CRQ A;  1KB9 F;  4IT5 A;  4G2K A;  1VF6 C;  1EZV H;  2HJD A;  3SR2 C;  1FFT B;  4LH7 A;  1B06 A;  3LNM B;  4IIJ B;  3H9V A;  5LGT A;  4X62 O;  1F4M A;  4PHZ A;  1Q3E A;  1N34 B;  2OTJ V;  1JMK C;  1VQ7 V;  3SYC A;  1NKD A;  5J2U B;  1XRE A;  2AHY A;  3JAS B;  2UUA B;  3F5T A;  5CA3 A;  2P4V A;  4FFB B;  3AG4 B;  2YIA A;  4GKJ B;  3O9O A;  1FXK A;  2VS0 A;  1BZK A;  3VQV A;  2FML A;  1GN6 A;  4DUZ B;  5IWA O;  2JGD A;  4TT3 G;  4CH3 A;  3UT5 A;  4DUZ O;  3E8F A;  4O4H A;  1G8M A;  1TA8 A;  4HNA B;  3HKB A;  3OUF A;  2B1G A;  3OGC C;  4EEQ A;  3CCU V;  3F5W C;  4CZZ A;  2E76 B;  2RMK B;  2ZIO A;  1YTF D;  1ZWI C;  1J5E B;  3CE2 A;  3CHX A;  4X1Y B;  3ABT A;  3ABK C;  1O9H A;  1OCR B;  4LWS A;  1UFI A;  1B04 A;  5L3D A;  4HAM A;  2WPD G;  3BA8 A;  4G28 B;  4B3R O;  4LFC B;  1SES A;  4F4L A;  4PDL A;  5DEC A;  4LR3 A;  2P4K A;  2WA3 A;  2AZ2 A;  1XMQ B;  2QWP B;  2ZD9 A;  3RFR A;  4NVP A;  2P67 A;  4R50 A;  5CA0 B;  5LMU B;  3DXR A;  2ETN A;  1VF7 A;  4I50 B;  4MSW C;  4DR2 O;  1ZL8 A;  2ZM6 B;  3CRC A;  2ADQ B;  3QF7 A;  5HFL A;  3ZHS A;  2DWD C;  2YDE A;  3NR7 A;  4J42 A;  1YCI A;  4JPR A;  5JVD A;  3FFQ A;  1ORQ C;  1Q7Y W;  5KAI Z;  1WAZ A;  3HKE B;  1BCC H;  1P7B A;  2OIE A;  1GM8 A;  1MNG A;  5KHH A;  1Q8I A;  3ETG A;  2E75 B;  4JI3 O;  2XAG A;  5B1A B;  4BW9 A;  4P9P A;  1V54 B;  2F66 C;  3SPI A;  4HZ3 A;  2GV9 A;  3UO3 A;  4GKK B;  4UUJ C;  4X9Q A;  2DQ3 A;  5CBF A;  2JGU A;  1LNQ A;  4O4L B;  1Q90 D;  4J41 A;  4ZI7 B;  1FXH A;  4B3T O;  1SET A;  3HKD A;  1R6T A;  1Q82 W;  4LH6 A;  3JAL B;  2Y0I A;  2GTA A;  3ASN B;  1N34 O;  4OX9 O;  3GB7 C;  5EYP A;  1FPO A;  3BAA A;  2FL4 A;  1VQ6 V;  1MZE A;  3QVN A;  1FXK B;  1XBL A;  3FB8 C;  2WLN A;  4IL6 Z;  1GH6 A;  3CCJ V;  2N05 A;  2KQX A;  3QTC A;  2L35 A;  4I0X B;  3S3X A;  5BMV A;  3IGA C;  1OCC B;  4Q6G A;  1Q6U A;  4E2L A;  2ZXW B;  5LP6 B;  3RYI A;  4K8Z A;  3L74 H;  3DSQ A;  1FXV A;  1P84 F;  2DJV A;  4MT8 A;  4OPH A;  4WFB V;  2LQT A;  4R7C A;  3CCS V;  1JOY A;  2Y69 C;  2W0F C;  3EXA A;  1XI1 A;  2X6A A;  2A3Q A;  5B3S C;  2BSK A;  4KHP O;  4WCE V;  2X6C A;  2F4V B;  3AK2 A;  4LF8 B;  5IJ0 A;  2GUZ A;  5KA6 A;  4FLY A;  1VIB A;  3SPC A;  5B1N A;  1XQ8 A;  4JYA O;  3WG7 B;  2GSM B;  1K5Q A;  3B40 A;  3MD0 A;  4EFB A;  1OCR C;  4WF9 V;  2JK5 C;  3ABL B;  5FLX N;  2Q0O C;  4JI7 O;  4TQF A;  1YIJ V;  4MS2 A;  2DMX A;  4MVR A;  4MTX A;  3JAS A;  3ZS8 C;  1RP3 B;  4MW3 A;  3CMA V;  5CMU A;  2EIN C;  1N32 O;  1DF5 A;  4UXN A;  4JTC B;  1ZUQ A;  1I5Y A;  1N4C A;  3APQ A;  4B08 A;  4JI4 O;  4DV3 B;  1SZX A;  3QO7 A;  4UV9 A;  4NTY A;  3CSX A;  2H3O A;  5BR8 B;  1YJN V;  1WB7 A;  3P3P A;  5KUM A;  1KBH A;  1MAB G;  3U11 A;  5ITZ B;  5CN0 A;  2LFR A;  4MVM A;  4NTX A;  2ZDI A;  4IIJ A;  3JSL A;  4TV9 A;  1FKA O;  4O2B B;  3JAK B;  4TV9 B;  1NJI W;  2ZXW C;  1JFF B;  1GN3 A;  3LDE A;  5JJE B;  3AG2 B;  4LC1 A;  1SQF A;  4DW0 A;  3K5N A;  3ZMS A;  4O2B A;  2UXD O;  2CGN A;  2Y69 B;  4OPA A;  4D7T A;  3CC2 V;  1W59 A;  4LNU B;  4L87 A;  1XNQ B;  2XAS A;  1ZSP A;  1SQV H;  4K0K O;  3A2F A;  2QKA A;  1D2D A;  4DYL A;  4F6R B;  2JEU A;  3CCM V;  4X20 B;  5EBM C;  2A9H A;  1KU9 A;  3K04 A;  1QHT A;  1VF6 A;  4DUY B;  3TXS A;  4NYK A;  1BHA A;  5H6R A;  3M8A A;  3OEE G;  2VWJ A;  1VQ5 V;  4PEL A;  4KFM A;  3UM7 A;  5J9P C;  2XUM A;  4LWS B;  1BL8 A;  1VQ9 V;  1N0N A;  4NTW A;  1ENV A;  2UUB B;  3BY6 A;  1V55 B;  4DV5 B;  3B2E E;  3GWK C;  5GTH Z;  1WNS A;  1XNR B;  2ZE5 A;  3T1H O;  1Z2G A;  1GM7 A;  2BTQ B;  4O4L A;  3E89 A;  4JI4 B;  1K7D A;  3SJB C;  1NTZ H;  4KUM A;  4LF9 B;  1BMF G;  2QEX V;  4YHH O;  5IYB O;  1U96 A;  3GWO A;  3SJA C;  4YHH B;  1EM1 A;  1XOU A;  4LCU C;  2L6L A;  1PPJ H;  2DQ0 A;  2WWW A;  2AW9 A;  2YIB A;  1H2S B;  4JAU A;  5A2Q N;  4WFG A;  2P7T C;  2QTO A;  2R9A A;  5LA6 A;  2A0L A;  3SJC C;  4MVO A;  1QU7 A;  5IYZ A;  2D2C B;  1MSD A;  3G4S V;  3BHP A;  4I0X A;  2JVD A;  1Y74 B;  5BZB A;  3P30 A;  4WBN A;  5H9C A;  1WPB A;  2DYS C;  5BXZ A;  5EK0 A;  4DV0 O;  3G80 A;  2UUC B;  1KC8 W;  3E86 A;  3R65 A;  1YIT V;  1YZB A;  2Q4P A;  3STL C;  3AG1 B;  1NT2 B;  4DV4 B;  3C90 A;  3CXH F;  5KX5 B;  4PI2 A;  3FAV A;  1RSO B;  3ZMZ A;  4DUY O;  3IJ4 A;  1WLE A;  1R1B A;  3FB6 C;  1MA1 A;  2CGO A;  2R72 A;  3L9D A;  5LXT B;  1JFF A;  4DR6 B;  1KKD A;  4CH4 A;  3DGE A;  4EFE A;  2YUA A;  3ZRV A;  2NN4 A;  4DV2 O;  2ZE6 A;  3JAR A;  3AG2 C;  4H44 B;  3RYH A;  4MVZ A;  3L71 H;  1XHZ A;  5DED A;  4YIO A;  4CC5 A;  1AI6 A;  1LUV A;  1M4U A;  4GCZ A;  4DR7 O;  3T4D A;  3ABM B;  3ASO B;  1KEC A;  2YXY A;  4LF5 B;  3AK1 A;  4UB6 Z;  1ZAU A;  5H2F Z;  4JTD B;  2RN9 A;  3CC7 V;  2JJ1 G;  2X7R B;  1QBZ A;  2BE3 A;  3P32 A;  3K5L A;  1F4N A;  2E3C A;  3CS5 A;  1GM9 A;  4J9Y B;  1M56 C;  2P22 C;  1M57 B;  1T5E A;  4JI2 B;  4DR1 B;  3T1H B;  4J9Z B;  2EX3 A;  4CH5 A;  1PP9 H;  2ZT9 B;  1IUR A;  1JJ2 U;  1BSM A;  1VF5 B;  3PJS K;  4KXR A;  1GTO A;  1UPG A;  1IX9 A;  1F7Y A;  4WFA V;  3OT7 A;  2ARH A;  3K5O A;  1YSC A;  4DK1 A;  2E5L O;  1RM1 B;  1MOF A;  1Z5W A;  3JD0 A;  4FLX A;  1BE3 H;  3K5M A;  2WLI A;  4PDM A;  1Q6H A;  4DRX B;  1HNZ B;  1US6 A;  4LFB O;  1IBK B;  2XAJ A;  2LP7 A;  2DOS A;  3N27 A;  2VWK A;  1DF4 A;  5JJJ B;  3K57 A;  1QNM A;  3CWB H;  4PI0 A;  4TUY B;  1U97 A;  3HKE A;  4LBE C;  5D5Q A;  3CXC U;  5GTI Z;  5IT9 N;  4B3S B;  2HFE C;  4EB6 B;  1FYJ A;  4UCS A;  2HVK C;  3L72 H;  4CH6 A;  2H94 A;  4YXW G;  2JDI G;  4UVB A;  2XAH A;  4DR5 B;  3ZMU A;  3VQW A;  2W6J G;  1R3J C;  1Z5V A;  2ZIM A;  4UCT A;  2OCC C;  4ZHQ A;  4YIP A;  4DV4 O;  3RVZ A;  4DV6 O;  3NXS A;  4F6E A;  5A9G A;  1IBL B;  1IBM B;  1K8A W;  1HDJ A;  2AGA A;  1SF9 A;  1K73 W;  3B77 A;  1WA8 A;  1AP5 A;  5CB4 B;  4NXM O;  5GON A;  1RPR A;  5LYJ B;  4DV1 B;  1R6N A;  4CS2 A;  5HFM A;  2LW7 A;  4X64 O;  4I55 B;  4J7J A;  3RYH B;  2WLJ A;  4UV8 A;  4UCU A;  3CCE V;  3CRA A;  1NZ6 A;  2OYQ A;  2EIL B;  3D36 A;  2Q68 A;  3MAQ A;  2FYU H;  2WLH A;  3FB7 C;  1KMI Z;  4F6R A;  1OV9 A;  2EIJ B;  1YJW V;  3G6E V;  4YY3 B;  3RN4 A;  4JI7 B;  4YJ2 B;  4JI6 O;  1Y66 A;  4GX5 A;  1QR8 A;  2UXN A;  3ZIA G;  2ODM A;  2DN9 A;  2V1D A;  2KKW A;  1YF2 A;  4HBN A;  1AJQ A;  2WSS G;  2WA4 A;  4P30 A;  3CD6 V;  1DLB A;  2Y4U A;  4N21 A;  1YEW A;  3SGI A;  1S76 D;  2BSK B;  3ABM C;  3CME V;  4FPP A;  3GVM A;  2UXB B;  2QWO B;  1HNZ O;  1NH2 B;  3WB1 A;  4UFZ A;  1S0V A;  4U3F H;  3OGI B;  2UXB O;  4C7U A;  1OCO B;  1EN5 A;  3I5D A;  3ZJZ A;  1G4Y B;  2YXH A;  3ML0 A;  4DW1 A;  2JJ2 G;  3ABK B;  3K0G A;  1XMO O;  4GLX A;  2C2A A;  1JX9 A;  4BAY A;  1DTO A;  3H1L H;  4RQF A;  2NNU A;  3T1Y B;  3QO8 A;  2Q7G A;  4JV5 O;  3K9S A;  5IWA B;  1I94 B;  1AI5 A;  5C93 A;  3E35 A;  1Q5O A;  1G6U A;  5LA6 B;  3ZHQ A;  2UXD B;  3I56 V;  4DK0 A;  2Y4T A;  3A0H Z;  5IDJ A;  5IY5 C;  4X62 B;  2IM9 A;  1J5E O;  1VQL V;  1NR1 A;  4NXM B;  2PI4 A;  5B3S B;  2PZS A;  3CCR V;  1SC5 B;  1ARO P;  1VQ4 V;  3LUT B;  2F23 A;  5CA1 A;  1PNL A;  4DXW A;  4B3R B;  1N36 O;  3OAA G;  4RWU A;  1S3J A;  1FJG B;  3N2K B;  4DV6 B;  3L70 H;  4J7Z A;  2LW1 A;  2ZKO A;  4JYA B;  2OIG A;  4X1I B;  3HPL C;  2IJH A;  3THO A;  2QA4 V;  3TCU A;  4G27 B;  4UCV A;  4J80 A;  4YY3 O;  2A79 B;  3H1I H;  3SPH A;  1Q6I A;  4XDJ A;  2PYL A;  3AEI A;  2F1M A;  3VBB A;  3OEH G;  2LGW A;  1OCZ B;  4O4I A;  1J95 A;  3EVK A;  3N2G A;  3SYP A;  4J11 A;  5JH7 B;  2F4V O;  3B8N A;  3ICX A;  2O57 A;  4JI5 B;  1OCO C;  3RYC B;  2LGQ A;  3SDL A;  1AI7 A;  3WG7 C;  3ETQ A;  4UCR A;  2MW2 B;  2B1I A;  2EJR A;  4PA3 A;  4TV8 B;  2KG7 A;  2QKS A;  4JI3 B;  3WB2 A;  2WLM A;  1WPX A;  1S77 D;  2Q6A A;  2CTQ A;  4D6T H;  3E83 A;  4X65 O;  1M57 C;  2VQF B;  1WN7 A;  4X89 A;  3LNN A;  3RVY A;  4OXS A;  4PA9 A;  3KZI Z;  1YTF B;  5E1A C;  2XT9 A;  5GW7 A;  1BT8 A;  1QLN A;  5LP6 C;  3BVO A;  5LHH A;  4I9W A;  4X8A A;  2QTS A;  1QR9 A;  4K35 A;  4AQY B;  4QPK A;  1BHB A;  4RUE A;  2ZR2 A;  2Z5U A;  4OX9 B;  1I08 A;  1FS0 G;  3CCV V;  4WFH A;  4BWA A;  2HR3 A;  3LDC A;  4ZBM A;  1YI2 V;  5KHK A;  3BA9 A;  1VP7 A;  5LGU A;  4FM0 A;  4B7E A;  2PF4 E;  4X1K B;  5L3G A;  2WLK A;  2GBO A;  1GN4 A;  1M5I A;  1YJ9 V;  4FLZ A;  3G6B A;  3P3N A;  4FZ1 A;  4ZKI A;  2XND G;  5J2T B;  4NB5 A;  1N36 B;  2PTM A;  5FNV B;  3TGU H;  3BAB A;  2UXC O;  2ZCE A;  2CH7 A;  1AVM A;  5EZY B;  1QCE A;  2Y48 A;  4IYI A;  2BCC H;  4LFA B;  1SZT A;  4NXN B;  3FAV B;  4ICG A;  5BMV B;  1AJN A;  2QWN B;  4CC6 A;  3B4S A;  2HP8 A;  2FKX A;  1R73 A;  2EIK C;  1Q86 W;  3ZRS A;  1BGY H;  2IBZ H;  1M90 W;  1NH2 D;  1HP8 A;  4DV7 O;  3JAK A;  3ZRX A;  3OUS A;  4FLT A;  3FKS G;  2ILM A;  3OD4 A;  3MHH C;  2XAF A;  1LUW A;  3CJH B;  1B3Q A;  4DV5 O;  3K0D A;  3ZRW A;  3HKC B;  1ROP A;  3LSS A;  2BOC C;  3PN1 A;  3CCQ V;  3JAR B;  1WP8 A;  1S72 V;  1HNX O;  1N32 B;  3ABU A;  3ZX6 A;  3TJT A;  5IJ9 A;  4ZOL A;  3QG5 A;  1H2G A;  1LR1 A;  3CCL V;  5EC2 C;  1H8H G;  2WLI B;  3SYQ A;  2ZE8 A;  3Q4H A;  5B1B B;  4FIP C;  1AI4 A;  3E22 B;  5FPR A;  1HR0 O;  5ITZ A;  2PGG A;  5JWP A;  1YVW A;  5B5E Z;  4NR1 A;  5DN6 G;  4MVQ A;  3SPJ A;  4DR3 O;  4LFB B;  1OCC C;  5EIB D;  3D36 C;  3OMA B;  1V9P A;  5FPO A;  3JD1 A;  5EBL C;  3Q4H B;  1P4R A;  1MSW D;  3ETD A;  3JAL A;  1L1F A;  4AQY O;  1RFY A;  5KX5 A;  2ITD C;  2YXL A;  3ZN0 A;  5LGN A;  4H37 A;  3FD9 A;  5D5P A;  2EUL A;  4KP4 A;  3TXQ A;  4QNH B;  1KP2 A;  2IH3 C;  2N74 A;  1VEW A;  2HHH O;  2V7Q G;  2DE0 X;  3JSN A;  4P9O A;  4ABM A;  2YEV B;  3MHS C;  3AG7 A;  3H1K H;  4NXN O;  4UCO A;  1SQP H;  2UU9 B;  1GMG A;  2ITC C;  2IU3 A;  4GYC B;  4JF3 A;  1URF A;  2EZP A;  1ZLZ A;  4H33 A;  1AR1 B;  3FB5 C;  4ZIB A;  1KYO F;  1WP7 A;  3OMI B;  4JI0 B;  2NR5 A;  4FVM A;  2Q0A A;  5C8Y A;  4DR6 O;  3IC9 A;  4LF6 O;  2CK3 G;  1E1Q G;  4UVA A;  4LF7 B;  1BQ0 A;  4NKG B;  1N8R W;  4JI1 B;  3QNE A;  5LOV A;  4JZG A;  1W0K G;  5LP6 A;  1XL6 A;  1PNM A;  4QGP A;  1XNR O;  5LOV B;  4I9Q A;  3R66 A;  2BTO A;  2DWE C;  4GX0 A;  4BIO A;  1PV0 A;  1XUQ A;  4QE9 A;  1XL4 A;  1SER A;  1X59 A;  3I55 V;  4LF9 O;  2V4D A;  3OTF A;  3FYI B;  3A8T A;  2W6I G;  4QJF B;  3OM3 B;  2XOK G;  5KLV H;  4J10 A;  3APO A;  3W7X A;  1NQT A;  5KA5 A;  1HNX B;  2IJK A;  2YIB D;  1Y76 B;  4UB8 Z;  5TIS Z;  4DR1 O;  4ZOL B;  5L3E A;  1Q81 W;  4HYO A;  3T2M A;  1AR4 A;  4PJ0 Z;  3RW0 A;  1L8D A;  5C8Y B;  3UT5 B;  1IBK O;  4FZ0 A;  4X20 A;  4X88 A;  4LF4 B;  3IAY A;  4IHJ B;  2CTW A;  4X1Y A;  3CEI A;  2D3O W;  1BS3 A;  1H38 A;  2QM4 A;  4ZHQ B;  4TUY A;  4TOI A;  4JV5 B;  1OZ0 A;  4DR3 B;  1TUB A;  4PDR A;  5L3C A;  3RYF B;  3ZED A;  5FNV A;  5JQG A;  2YI9 A;  3RGB A;  1MMM A;  5IJ0 B;  3K9A A;  2HEP A;  3OR7 C;  3LSU A;  3W7U A;  4W4K A;  4DO2 A;  4J7K A;  4FM2 A;  1TUE B;  2VQE B;  3VOU A;  5CBH A;  1K33 A;  4B3S O;  3H01 A;  3RYF A;  1K5S A;  1NU1 H;  1NR7 A;  1N33 B;  3J80 N;  5J2U A;  4X64 B;  3JD4 A;  3OMN B;  4P2Z A;  4FLW A;  2Q69 A;  1K34 A;  3L75 H;  3IC7 A;  1RPO A;  2GDS A;  3LSQ A;  1IBM O;  1R3K C;  4JAV A;  2YC0 A;  4TV8 A;  5B1B C; 
#chains in the Genus database with same CATH homology
 1VQP V;  2HG5 C;  1F23 A;  3E35 A;  1K4D C;  4JAS A;  3QO7 A;  4UV9 A;  4QE7 A;  2R9R B;  2F43 G;  3I56 V;  3EFF K;  4I5S A;  1YJN V;  5IDJ A;  5IY5 C;  5CBG A;  4RAI A;  1VQL V;  1NR1 A;  3K03 A;  3AG1 C;  2WLL A;  5KUM A;  1MAB G;  2PI4 A;  2EIM B;  5CN0 A;  5B3S B;  2LFR A;  4MVM A;  3CCR V;  2ZDI A;  3JCZ A;  2ZR3 A;  4JGS A;  1ARO P;  3ASO C;  1VQ4 V;  3LUT B;  2UXX A;  1M1K W;  3CPW U;  1PNL A;  2H8P C;  4RO2 A;  4GX2 A;  3E8G A;  4TSF G;  4DXW A;  3K08 A;  2QM8 A;  2LFS A;  3OAA G;  1CPY A;  1NJI W;  1S3J A;  1VQO V;  2ZXW C;  4WFE A;  3LDE A;  2IU0 A;  3HPL C;  2IJH A;  3AG2 B;  3AG4 C;  2QA4 V;  4LC1 A;  1VQM V;  2NLJ C;  3JD2 A;  3TCU A;  4G27 B;  3E8B A;  1W2B U;  3JYC A;  4MW8 A;  2EIL C;  2A79 B;  1KP3 A;  3SPH A;  3ZMS A;  1E1R G;  4XDJ A;  2QM7 A;  3AEI A;  2Y69 B;  3CC2 V;  3EHB B;  3VBB A;  3F7Y C;  3OEH G;  1OCZ B;  4L87 A;  2XAS A;  1J95 A;  5L3B A;  1KQS U;  3E8H A;  3W7T A;  3SYP A;  3B8N A;  3DTU B;  4JYC A;  1OCO C;  2JEU A;  3A0R A;  3CCM V;  5EBM C;  2A9H A;  1AI7 A;  3K04 A;  3WG7 C;  1R3I C;  4UVC A;  1V54 C;  2B1I A;  2EJR A;  4UXN A;  1BHA A;  4PA3 A;  5H6R A;  3OEE G;  1VQK V;  2QKS A;  2OTL V;  2WLM A;  1VQ5 V;  1WPX A;  3KG2 A;  2M7W A;  4PEL A;  4KFM A;  1S77 D;  2Q6A A;  3UM7 A;  4FK5 C;  5J9P C;  3E83 A;  3ZCC A;  1BL8 A;  3W7W A;  3RBZ A;  1M57 C;  1PKX A;  1VQ9 V;  4X89 A;  4R6Z A;  3RVY A;  4OXS A;  1ENV A;  4PA9 A;  1R3L C;  2Z3Y A;  2P6J A;  3BY6 A;  3JD3 A;  1V55 B;  1YTF B;  5E1A C;  5GW7 A;  1NVP B;  2KB1 A;  1QLN A;  4XDL A;  2YSU B;  3AG3 B;  2R9I A;  2JEX A;  5LHH A;  4I9W A;  4X8A A;  1QR9 A;  3T1C A;  1GM7 A;  4QPK A;  1BHB A;  1RM1 C;  4RUE A;  2ZR2 A;  1S5H C;  2Z5U A;  4PDV A;  5EC1 C;  3IFX A;  2IH1 C;  1FS0 G;  3E89 A;  3CCV V;  4WFH A;  5DM6 V;  1K7D A;  2HR3 A;  2P90 A;  1F51 A;  4KUM A;  1FXK C;  3LDC A;  1BMF G;  3OR6 C;  4ZBM A;  1YI2 V;  2QEX V;  4BIU A;  2XAQ A;  5IYB O;  2OCC B;  1MG1 A;  2DW4 A;  3GWO A;  1EBO A;  4BW5 A;  4Q20 A;  5LGU A;  2Q67 A;  1HWY A;  4LCU C;  3K79 A;  2DQ0 A;  2WWW A;  5L3G A;  2WLK A;  4JAU A;  2MK3 A;  1H8E G;  3M99 B;  3ASN C;  4WFG A;  1GKF A;  5B1A C;  1YJ9 V;  1JQ0 A;  1W0J G;  5B1O A;  4CBC A;  5IYD O;  2P7T C;  2QTO A;  3OFN G;  4ZKI A;  2XND G;  2DYR B;  2HLD G;  4LP8 A;  3FYE B;  1M56 B;  2A0L A;  3ZMT A;  3W7S A;  1JCH A;  4ASU G;  4MVO A;  2ZDI C;  2YEV A;  3TK1 A;  3UKM A;  2ZQM A;  3G4S V;  4MTO A;  5BZB A;  4R8C A;  3T4Z A;  3HB3 B;  3P30 A;  5H9C A;  2DYS C;  1NVP D;  2BOB C;  2IJI A;  1QCE A;  1K97 A;  2Y48 A;  5EK0 A;  4RUF A;  3B8M A;  1JVM A;  1KC8 W;  2HKO A;  3E86 A;  4MTG A;  3R65 A;  4PA6 A;  4XBF A;  1YIT V;  3K3W A;  1SZT A;  5L3F A;  2WAM A;  1SRY A;  2FTK A;  3STL C;  4QIW F;  3AG1 B;  2EBO A;  4G2K A;  1UJW B;  1AJN A;  1K3E A;  5FL7 G;  1R73 A;  2EIK C;  5IY5 B;  1Q86 W;  1FFT B;  2IJJ A;  3ZRS A;  3LNM B;  5LGT A;  3ZMZ A;  1M90 W;  1NH2 D;  1F4M A;  1WLE A;  3FB6 C;  1E79 G;  3ZRX A;  3OUS A;  3FKS G;  3ETE A;  3MHH C;  2OTJ V;  2XAF A;  4XDK A;  5H6Q A;  3ZN1 A;  1VQ7 V;  3SYC A;  1NKD A;  1KKD A;  3DGE A;  3D3I A;  3K0D A;  2AHY A;  3ZRW A;  1ROP A;  3LSS A;  2BOC C;  3CCQ V;  3QO5 A;  1S72 V;  2OT5 A;  5CA3 A;  3ZRV A;  3ABU A;  3AG2 C;  3AG4 B;  4MVZ A;  3ABL C;  1FXK A;  1AI6 A;  1H2G A;  3SPG A;  3CCL V;  1I5X A;  4GCZ A;  5EC2 C;  1H8H G;  3T4D A;  3ABM B;  3ASO B;  5KUK A;  4TT3 G;  2WLI B;  3SYQ A;  1KEC A;  5B1B B;  3E8F A;  4FIP C;  1AI4 A;  2EIM C;  1G8M A;  4JTD B;  3CC7 V;  3OUF A;  4MTF A;  3F7V C;  1CP9 A;  2B1G A;  2JJ1 G;  2X7R B;  3OGC C;  1QBZ A;  3CCU V;  1EFR G;  3F5W C;  4CZZ A;  1Y4M A;  1YTF D;  1ZWI C;  5DN6 G;  4MVQ A;  3SPJ A;  3P32 A;  1GO3 F;  1F4N A;  3ABT A;  1VQ8 V;  1OCC C;  3LDD A;  1GM9 A;  3OMA B;  1IXM A;  1R6K A;  2DYR C;  4GX1 A;  4J9Y B;  3ABK C;  1M56 C;  1OCR B;  2PI5 A;  1M57 B;  1QLE B;  3JD1 A;  5EBL C;  1P4R A;  5L3D A;  4HAM A;  1MSW D;  2WPD G;  3ETD A;  4J9Z B;  1L1F A;  4G28 B;  1VQN V;  1SES A;  1K4C C;  1PNK A;  4F4L A;  4PDL A;  2ITD C;  2EIN B;  3ZN0 A;  3X2Q C;  1JJ2 U;  1PL0 A;  3SYO A;  5LGN A;  4H37 A;  3PJS K;  4QPJ A;  1GTO A;  3SJQ C;  4N23 A;  4KP4 A;  2ZD9 A;  4QNH B;  4WFA V;  4TWK A;  1KP2 A;  2IH3 C;  2P67 A;  4R50 A;  2V7Q G;  2IW5 A;  1YSC A;  1RM1 B;  1MOF A;  3JD0 A;  4MSW C;  2EIK B;  2WLI A;  4PDM A;  4P9O A;  1GK9 A;  1QVG U;  2YEV B;  3MHS C;  5HFL A;  2DWD C;  1GMG A;  2ITC C;  5LBQ A;  2IU3 A;  4JPR A;  4JF3 A;  2XAJ A;  2LP7 A;  2EZP A;  2WLL B;  2X6B A;  1ORQ C;  1Q7Y W;  1THZ A;  4H33 A;  1DF4 A;  4FMT A;  3FB5 C;  1AR1 B;  3OMI B;  1P7B A;  1GM8 A;  3ZMV A;  4WFF A;  4LBE C;  3ETG A;  2CK3 G;  4GT1 A;  3CXC U;  2XAG A;  5B1A B;  1E1Q G;  4UVA A;  4P9P A;  4U7O A;  1V54 B;  2HVJ C;  2HFE C;  1N8R W;  2QE7 G;  3OE7 G;  3QNE A;  3SPI A;  2HVK C;  4HZ3 A;  2H94 A;  1W0K G;  2JDI G;  3AG3 C;  4UVB A;  4YXW G;  1XL6 A;  4UUJ C;  1EZJ A;  1PNM A;  2XAH A;  4JYB A;  3ZMU A;  2DQ3 A;  5CBF A;  2X0L A;  2W6J G;  1R3J C;  3CYO A;  2OCC C;  2DWE C;  1OHH G;  4GX0 A;  1LNQ A;  3RVZ A;  3NXS A;  3STZ C;  4QE9 A;  1XL4 A;  1FXH A;  1SER A;  3I55 V;  1SET A;  1K8A W;  1CEZ A;  1Q82 W;  1PD3 A;  1K73 W;  3K06 A;  3FYI B;  3WFV A;  3ASN B;  3B77 A;  4JTA B;  5IYC O;  2W6I G;  3ZRW B;  3GB7 C;  4EKW A;  4MVS A;  2GHY A;  3OM3 B;  2XOK G;  4QJF B;  3TET A;  1RPR A;  1R6N A;  5HFM A;  1NBM G;  1VQ6 V;  1QLE C;  3CC4 V;  2WLJ A;  3W7X A;  1NQT A;  4UV8 A;  5KA5 A;  3OW2 U;  2IJK A;  3CCE V;  1FXK B;  5L3E A;  1Q81 W;  4PA4 A;  3FB8 C;  2EIL B;  2WLN A;  4HYO A;  3T2M A;  3D36 A;  3RW0 A;  2Q68 A;  3CCJ V;  1JPX A;  2WLH A;  3E2E A;  3FB7 C;  1QVF U;  1AJP A;  2EIJ B;  1YJW V;  4X88 A;  3IGA C;  1OCC B;  3G6E V;  4E2L A;  2ZXW B;  4RQE A;  2EZO A;  5EBW C;  2HJF C;  1Y66 A;  4GX5 A;  2JIZ G;  1QR8 A;  2UXN A;  3ZIA G;  2D3O W;  1FXV A;  1H38 A;  4MT8 A;  2V1D A;  4WFB V;  1AJQ A;  1OZ0 A;  2WSS G;  4R7C A;  1YHQ V;  4P30 A;  3CCS V;  1K9M W;  3CD6 V;  4PDR A;  1DLB A;  5L3C A;  4N21 A;  1JOY A;  2Y69 C;  1S76 D;  3ABM C;  3CME V;  2W0F C;  4FPP A;  2DYS B;  5LHI A;  2AHZ A;  2X6A A;  5B3S C;  4FJC C;  4WCE V;  1K92 A;  2X6C A;  3K9A A;  3G71 V;  3OR7 C;  2ATK C;  1NH2 B;  3W7U A;  4Z1M G;  5KA6 A;  5LHG A;  1S0V A;  4DO2 A;  1OCO B;  3BEH A;  3SPC A;  1G4Y B;  5B1N A;  3ZJZ A;  3WG7 B;  1TUE B;  3ML0 A;  3VOU A;  4BIZ A;  2GSM B;  5CBH A;  1K5Q A;  1K33 A;  3MD0 A;  4PA7 A;  2JJ2 G;  3H01 A;  3ABK B;  1COW G;  3K0G A;  4MVU A;  1OCR C;  2B5U A;  1K5S A;  3SYA A;  2C2A A;  2JK5 C;  1NR7 A;  3ABL B;  4WF9 V;  1JX9 A;  4BAY A;  1DTO A;  3CP1 A;  3JD4 A;  3OMN B;  4P2Z A;  1YIJ V;  4MS2 A;  4RQF A;  2Q69 A;  4MVR A;  4MTX A;  1K34 A;  1M9N A;  2NNU A;  1B6Q A;  4MW3 A;  2EIJ C;  3QO8 A;  3CMA V;  2K1E A;  5CMU A;  2EIN C;  3X2Q B;  3IC7 A;  1V55 C;  1RPO A;  3LSQ A;  1KD1 W;  1AI5 A;  1DF5 A;  1OCZ C;  1R3K C;  4JAV A;  4JTC B;  4U7N A;  5C93 A;  1I5Y A;  5B1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...