1GMWA

Structure of uree
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Chaperone
molecule keywords UREE
total genus 36
structure length 138
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmwA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmwA01
3NXZA 1C3GA 3TJ9A 3NY0A 2Q2GA 2QLDA 3AGYA 1GMWD 3TJ8A 1NLTA 4J80A 1XAOA 1GMVA 1EB0A 4L3KA 3LA0A 2B26A 3TJAA 3LZ8A 1GMUA 1EARA 3AGZA 3L9ZA 3I38A 2HFVA 3AGXA 1GMWA
chains in the Genus database with same CATH superfamily
1UPPA 3QFHA 2IC3A 1Q1KA 3TX0A 2I9SA 4LF6F 3BQ2A 1C0TB 4YB6A 2LMIA 3LAMA 3PTWA 1HQ2A 4ED2A 3VQSA 4CO0A 4QWEA 4P6QA 3X3UA 1NSKL 1SKRA 4ZJQA 1JIHA 2DNHA 1VBZA 1HBNA 3KNAA 4R5PB 3M4XA 6FD1A 2EBEA 3FBBA 2XYGB 1JJHA 1RWNB 1WSVA 4PWWA 2DNOA 4KY3A 5I42A 2BKNA 4CO3A 1OYDA 4P74A 2QRRA 1T8EA 1GX6A 5KFUA 4RO0A 4I68A 2J9CA 5K14A 2IJNA 1JB0C 4DV4J 3W64A 1JWWA 4HACA 3DKDA 4KQZA 2MQNA 1AZSA 1IQZA 1RT3B 2BW7A 2YNFA 4K2XA 3CCQS 5D0GA 4X66J 3CCZA 1K0TA 1J27A 1VGYA 2GJ2A 1FT8A 4CYUA 3X1LB 4FYDA 2IY5B 4AQYF 3BBCA 3BM7A 1YK9A 2KXFA 3UW1A 4AT1B 3BBFA 4R8UB 3UR0A 5KFKA 2JEFA 1JNRB 1N36F 3DRPA 2N3LA 1KD1T 2B4VA 2WCXA 1TTHB 1EP4B 4L73A 2ZDOA 3D1OA 5BYQA 5J2MA 4F0KA 2DYAA 3TYTA 1Z2LA 2CVIA 2YPYA 3THTA 2AP6A 4YS2A 3D3CJ 1HQUB 2XI2A 3D6FB 3BR8A 2JH3A 4ANDA 4WKYA 4W98A 1ZETA 5AJ3F 5T7LA 3PX4A 4QIEA 1HIYA 5D4PA 3P45B 4JI6F 2JC0A 3AJ2A 4ID5A 1QAIA 3HK2A 3BO3A 3EJMA 3SSSA 1R0BG 1WEZA 2XEXA 4DPWA 5E3QA 3MTJA 4MKVA 3OTDA 3QGIA 4DR5F 3H59A 5AE3A 2D9OA 3OTCA 3IWLA 1X4EA 3ENVA 1T11A 4U95A 2HHXA 2EFPA 1RAHB 2HK2A 3DRRB 2ZOFA 3Q2SC 4ZVRB 2HBYB 2NXJA 1CG2A 3PACA 2DHXA 4RBUA 4UUWA 5IC4B 3QT8A 1FJ7A 1NU4A 5SZTA 1IR2A 3HCXA 1D3WA 2BACA 4IRKA 4Q2LA 2Y8WA 4X84A 4WU2A 3DNCA 3M8ZA 3T9NA 3FEXB 4C8NA 2VA2A 1GEHA 2WOMB 4ZVUB 2BRKA 2FJAB 2J7KA 4MT1A 3A8JA 4LREA 3Q8PB 2DGTA 4USMA 3KLIA 3IXQA 4TQRA 3KLVA 5CHCB 4F25A 2CQIA 1TUWA 3QO9B 2HLTA 1RB0A 1S1VA 2WAQD 4ZS6A 4D3HA 5L9NA 3SFUA 3GU0A 3KK1B 1S10A 2O1PA 2MMYA 5L8RC 5AJ3J 4F02A 2B9YA 2HNZB 2FLLA 4ERDA 1FXLA 1CEZA 3AB2B 1T9YA 1E6YA 1TP7A 2PI5A 4OI4A 3SCLE 2NPFA 4B9VA 4DSKA 1R8HA 3FCVA 1AB8A 4RUCA 1IBMF 4TKTA 1F5CA 2ZNZA 1NZAA 3GR0A 1N36J 4QYZJ 1HI1A 2GA7A 3EMTA 2MPUA 3T9ZA 1U1OA 1R8PA 3I0RB 1WG4A 2V2KA 3MM8B 5E2QA 1H74A 4M5KA 4NLGA 4R5PA 2UXBF 5JUMA 3G6ES 2ZBRA 2G13A 3AKOB 3I9V9 1H0HB 3HHDA 3GJTB 5KG5A 3T1YF 1N0UA 3LUYA 1EIYB 3VGSA 2CFXA 5HMZA 5F8HA 2BW2A 3JAMY 3UO0A 3QQCD 3OTOF 1KEKA 1RP5A 3EVWA 4DV7J 4DJBA 3IRWP 2GC8A 1UCNA 3HVAA 2B5JA 1JK9B 4NLTA 2YKQA 3MUMP 4WFZA 2E7VA 4FPRA 2YQ1A 3OTEA 1I3OB 4LF7J 1LW2B 4PEOA 3O5TB 3O44A 1HBMA 3QWUA 2WK4A 4R8UA 4ILRA 2JJ4D 1LV5A 3G9CA 4LVNP 1ZZNA 4ES2A 4OI1A 2B9WA 2HGLA 3U27A 1JJ2R 3QRRA 2NZ4A 3W2VA 4J37A 4B3MJ 4NEYA 4L6V3 4RW4A 2RKIA 3CSKA 1Q16B 3DGVA 2ZZNA 4WP8A 4KTQA 3MAQA 1JJ4A 3L09A 2KJWA 3ILOA 4PYAA 4ZDNA 2NXNA 5DDQC 2MZQA 3E3XA 2Z2MA 3IGNA 5DETA 2MZ1A 4HDGA 3GV8B 2DNYA 1MROA 5LXYA 5H9FJ 3DGPB 4P2FA 4GC7A 1SC1B 3RAXA 4KGZB 2QN6B 2B43A 2DGQA 3LAKA 2UV8G 4LSLA 2VASA 2R42A 2QZ8A 4R25A 3SCJE 2J6TA 3DRYA 4J5OA 1YJNS 3PFEA 4FYXB 4L75A 3TUPA 3H5XA 4I67A 3QAUA 3DLEB 4HVZA 1BY9A 2BJDA 2Z2ZA 3DLKA 3K5OA 4OZ2A 1PG5B 3D7SB 3CB4A 1EAYC 4RUBA 1GNKA 2D9PA 3QNWB 4ID8A 4ZMMA 2RU3A 2V94A 2VBYA 4DXLA 3VALA 1NSPA 3N6LA 5I3QA 3PY8A 1RT4B 1U1PA 3SQGB 6AT1B 1EETB 3D0IE 4KGVB 3T5HA 2VPYB 1YBUA 2QL5B 2QMUB 1SV5B 1NHVA 1R89A 2BE7D 3QO9A 3CD0A 4JI2F 3OSNA 1GK8A 3BBBA 4L76A 3J80Y 1SKSA 5ADZA 3CO0P 2JEIA 3PHEA 2Y1IA 2CPXA 5HBMA 4EI2A 2AU0A 3ZTPA 3RRHA 2WW4A 3C46A 3DOKB 2FJEB 2J7UA 3VZHA 3LP1B 1N33J 3HSDA 2MHEA 4U6PA 3QT6A 2W01A 5HN0A 3KTQA 4MTPA 2VG5B 3J80U 3ILJA 1S9FA 4KV8B 2V6AA 2H54B 2F40A 3JQJA 3GFZA 2MQPA 1T7PA 4TY8A 4B3OB 1LWEA 2A6OA 1X5TA 5E0OA 1XR7A 2VG6B 2KB2A 3MM5B 2GMHA 2O5DA 2N7YA 2HHQA 4ZPBA 1RAOA 1S9GB 2GIQA 4JI4F 1G1XA 1A6LA 3MEDA 3RBZA 4CLUA 4DV7F 1TVRB 2LU2A 2JVMA 2FLOA 1NJIT 2R7TA 3GWCA 1X5PA 3TWZA 2G1DA 4DQPA 4EMDA 3GJRB 2PT0A 4ITSA 1Y4ZB 1NK0A 2DB1A 2IMOA 1FE0A 3H25A 1CC7A 2KKHA 2EWHA 1FE4A 2MY7A 3DHXA 3PRBA 4EUVA 5F3ZA 1U1KA 2UUAF 3EZUA 2R8HA 3DLLQ 1KBRA 2KN4A 2BKPA 2XM3A 1UW9A 1SIZA 4ED5A 1S77D 1PSDA 2EC2A 3ZXWA 1N6QA 5HL7Q 4P52A 5D4LA 1KTQA 4QZVB 2AZ3A 1BMQB 4CYUB 3GILA 1NK7A 1K1SA 1HYSB 2GNKA 2IDEA 1JLQA 4C97A 1YIJS 4CH7A 1U1LA 2N3OA 3QMQA 2H5IB 3HMJG 3FZ2A 1O5JA 1C1BB 2EEYA 3KUGA 4F50A 1NK6A 2CNNB 4OHWA 4OX9J 5KT6A 2QMWA 1O8BA 4H4KC 2KRRA 2VJUA 2C2RA 1OJ4A 3TJ9A 2W24A 1UJ4A 3MPYA 4NA1A 4JI1F 2LA6A 4LFAJ 4MMOA 4X65J 4E98A 2IYGA 3ADAC 2FHKA 2Y0SD 2VQFF 2FHJA 3TAQA 4JI8F 2RE1A 4V1Ak 5E3RA 3NP5A 1KTVA 1OSDA 1HQEA 5IV4A 2IMWP 2HNYA 2O01C 2UV8A 4U96A 2CNKB 3F41A 1X4GA 2AZ1A 1I5OB 1NRKA 3C8YA 1FXDA 3HHLA 8RUCA 2J0XA 3FFIA 1IBLF 1YLXA 1TKTA 2Q6BA 2JZ5A 4U67Q 4K4TA 2BQ3A 1VYAA 1DTQA 2A1BA 1TKZA 5HK4A 2DGXA 4W92B 3IBWA 3FKBA 5C7PA 1C1CB 2X1GA 5E5NA 1GMWA 4BC9A 2CJKA 2DR7A 3K57A 3JTPA 4ZIVA 4ED7A 1HMVA 4M5GA 3VGVA 1TUGB 4DR4J 2KI2A 1RCOB 3M2VB 3S7RA 2IBKA 4IUFA 3CCUS 3J7ZT 2QEXS 3C5XC 2OEKA 1VBXA 4DWIA 1RYRA 2GJFA 4EBDA 4ZCIA 3KOAA 1EZZB 4JI2J 1MWZA 5T7LB 3UPFA 2HS0A 3Q22A 3HHEA 3Q2TC 5D15A 3GONA 4NYOA 3CCSS 1TL1B 4C2MA 2A10A 5KFCA 2AEJA 3ZC4A 5DLGA 4KV8A 1Y7PA 5L1LA 1PJ6A 2B6AA 1H6KX 3AH6A 4C0OC 4F2RA 1WC3A 1SJ1A 1WC1A 4UT4A 2RDJA 4O3RA 3QRPA 4WZMA 3KMSA 1VQ6S 3N6MA 1IJFB 1M5VC 3OFHA 3GSIA 2AEMA 2KG0A 2ZJPQ 2DXDA 2PGCA 5L1KA 3B6BA 2X7IA 3ZNUA 4XO0A 4F8RA 5KOXA 4IYQA 1B64A 2XZDB 3LWMA 2YBVA 2YTCA 2MHNA 2WVDA 1LK7A 4GKJF 1D9AA 3B4MA 2XYHB 2C3MA 4LIRA 4I64A 5HROA 4OYBA 2UUBJ 5A8KB 5U47A 4EK2A 3VVUA 3CDEA 2PN6A 3WZ0A 5BXIA 1QAYA 4RW9A 2XMTA 4ZKAA 4ILMA 1UTAA 1ZPWX 2G1HA 3W62A 2NXUA 3CJ4A 4LFCF 1R0AB 1X31C 2NSCA 5K8PA 1Y5LB 5L9XA 5LMUJ 2AYGA 4X4TA 1E6YB 4AQYJ 1HYSA 5G4DA 4E0DA 2XGQA 2NREA 1YGYA 4NL5A 4CM0A 3Q8UA 1ZA2B 4Q5VA 2EG1A 3AJDA 3W8GA 5JVHQ 1QVGR 3LO3A 4LR7A 2ZHBA 3H4BA 3D67A 4YDDB 1DQ8A 1VCTA 2XMVA 4C8LA 1LFPA 3LPEA 3G96A 1U1MA 1HNZF 1PAEX 2DNNA 3CJ3A 3UE2A 3KUHA 5KFDA 5J2QA 2DR6A 5J2NA 2E66A 2MLZA 1HWLA 2OKQA 3QT7A 2F5GA 4OJ1A 3R5DA 5ETSA 3CCJS 5MAOA 1TL4A 4NLSA 4F7VA 1BQNA 1IQTA 1KVJA 2HNYB 4MIBA 2Q43A 2B4PA 5B08A 2LEAA 2R3VA 2JWNA 3D0GE 3D54A 4EFAC 4WCEQ 1YJWS 3AGZA 2D1CA 5EN1A 2HS4A 3T1HJ 1X60A 4QJVA 2BMBA 1H98A 2XY7A 1O0PA 2LDIA 1RBAA 1U48A 2PEBA 4B02A 2ZH7A 2O3DA 2HRTA 1RXOB 2CZ9A 4KKOB 4DFKA 4N8NA 3T41A 3GG1A 2R7SA 2XBPA 1B70B 1F9HA 3IBFB 3M2VA 5KT5A 4FBTA 3CO9A 5CZVA 4NPOA 2XGPA 2ZEJA 1DQAA 3TVZA 1TELA 2CPJA 3B78A 1T05A 2R7OA 5HMWA 4EGLA 1RTHB 2V2VA 1HBOA 3F0NA 5GMEA 4OX9F 4IFVB 1U2CA 2GHVC 3R7NB 2BKOA 3TX8A 1VIOA 3ZZZA 1L3SA 4P75A 3SDEB 1ZTWA 1M5OC 3PW4A 3QGGA 2LQBA 4IO1A 4CP5A 3L9ZA 4ETZA 3QJPA 4G1QB 4QBUA 2I2YA 2J6SA 2CJXB 4ED0A 3W9JA 3AGXA 1PKUA 3OR2A 2V4QA 3BF4A 2ATCB 4CZCA 4K4ZA 2FUG9 3R97A 4DR3J 1X9SA 1Z4UA 3CEDA 3UVJA 4AYBD 1H73A 3BKFA 5I3UB 2W9CB 1HNWF 2VIHA 3KFWX 1ZZFA 4DX7A 1VBYA 2K06A 2MKKA 4DFMA 4KPYA 2OP5A 2DD8S 1XQIA 1VQLS 3GE9A 3WQPA 1FO1A 2VG6A 1FRLA 3CJQA 4KH1B 5JVGQ 4ZCLA 4P2XA 4IG3A 5F8IA 2RQMA 1B0VA 1N5VA 1GMVA 1RU2A 2POKA 3GMGA 2XWXA 2ZH5A 4OYXA 2AWZA 1KWMA 2WVBA 3I4HX 3Q89A 4BWMA 2V50A 2KM8B 3GCWP 1NDCA 2Q79A 4KJIA 2OSRA 1HI0P 2PE8A 2E9TA 2IM1A 1X9WA 1U2RA 3KDNA 1QTMA 4JI1J 5LSRA 3QZ7A 4ER8A 4Y6IA 1I94J 5DDPC 1U0HA 2DNRA 3AY0A 4N47A 5A0YA 3IRXA 3FBFA 3TNVA 5B7WA 5FLXY 2NPIA 4EZ6A 1CC8A 1Q8BA 1U02A 3QGHA 2CNOB 1CJUB 2UU9J 1NAQA 1LK5A 2BEFA 4F3OA 3ISNC 1IR1A 2DH9A 2V2ZA 3TANA 1T03A 4GRSA 2OGUA 1PC5A 2HBQB 2LU1A 1F5AA 1JLQB 3I5BA 2YPZA 3MCMA 1M0SA 4TY8B 4A4JA 2YKMA 5DGBA 3HP6A 4B3OA 2OI2A 3NOGA 5KT7A 2JDJA 4DCPB 2P8IA 2B7BB 5J2NB 4KO0A 3VAMA 3MZIA 4Y2KA 3OBIA 2BJ9A 5F41A 3IO1A 2RS8A 2B4UA 5ITHA 1OY9A 1LWFB 2MZSA 3NS7B 5J2PB 2HFSA 1S1WA 4QCLA 3WDOA 2ZHAA 4CLYA 3WC2A 3G82B 4KYZA 3C16A 2ADBA 2XLKA 3D6MB 1IM6A 2VC0A 2ZVIA 2B3TB 2EFNA 1OY6A 1LFWA 1N32J 1N88A 5KT4A 4WP9A 2DGWA 1ZA1B 2FGOA 2V8VA 2W2PP 1FHTA 3LALA 4YDXA 2XYPB 2HZCA 2C3UA 1S9EB 2PA3A 4JV0A 4DCOB 5C25A 3HHLB 2HVIA 2HHSA 2ROGA 3HULA 1HW9A 1X8DA 1LEOA 1R43A 3MHYA 3VAGA 1CJKB 1YRUA 2K2PA 3T1AA 2F4VF 3OVAA 1URNA 1CS4A 1N5YB 2W9BB 3P3DA 3JSMA 3MFHA 2F7VA 2AKWB 2FQQB 2IA0A 2LQ9A 2XCAA 1HR0F 2VFRA 3NOCA 1K1QA 2IHR1 4J9OA 4JV5F 2FB0A 2IAJB 3HVTA 1OMSA 2EFOA 4HKQA 2KT2A 2Z0GA 3N79A 3HSZA 3WX4A 4DDFA 1K47A 4K59A 3UD5A 5AXNA 4BBYA 1REVA 4B3TJ 3RG6A 2K3IA 1ZPVA 1RT1A 4X66F 1QM9A 5GAHI 3HSGA 4LQ3A 2YWGA 4WK3A 3NGUA 4OYAA 4DPYA 3NGTA 3V6DB 5A76A 2FGCA 4H54A 5RUBA 1CJVB 3P8BB 3EGVA 2FTRA 3R7BB 3OHAA 4MKYA 3OPKA 1TL1A 3CCTA 3M6XA 1DTTA 3PFOA 4UW2A 3KUEA 1VJWA 2YWWA 5CYQB 5D78A 3UVJB 5I3UA 4WYLA 1UEUA 4NLYA 1QSSA 5KFOA 1Q95G 1SH2A 4CIOA 1WI8A 4Y28C 4WF9Q 3V6KA 2IM3A 2FC9A 3DRXA 1WHXA 5I4MA 2BOPA 4NRTA 3KXDA 4PWUA 3EPIA 1HNZJ 4DF4A 4C98A 2HHTA 3DHWC 2GW8A 1TKXA 4RLEA 1S0MA 1FFWB 1RWUA 4NCGB 3K59A 4TLQA 2BANA 1X0PA 5DM6Q 1G2EA 2OMLA 4NLWA 1Q8KA 3IM9A 4IG0B 5D0RA 3R7SB 4HH0A 3UDCA 3BQ0A 1BHNA 3H20A 1V3RA 2Y1LB 4DSJA 3MCSA 4DSIA 4B3TF 4U7UK 1U0HB 3BN7A 1SQEA 3AJ1A 4EYIB 3IRXB 1SUQA 2DHGA 1ZOTA 2A6MA 4Q2MA 1HPZB 4CTAA 4OX7A 1VC6A 2IA6A 2CDQA 3NNCA 2CADA 4K5RA 3L3CA 3HD1A 3N5FA 1F6TA 3A4TA 1FKAF 1Q7LB 3RB4A 1TQLA 1UL3A 2EI5A 3THVA 4U8YA 3FBEA 2XULA 1PBUA 4KFBA 2B6AB 3OL7A 5L39A 3E01A 3H8YA 5F8LA 3RBXA 4ZPAA 2CPHA 4ELTA 1RHRB 4RNMA 1Q79A 3NWRA 1U2FA 4M5DA 3ZTRA 2ASJA 1K0VA 2CQ2A 2KVQE 3NS6A 2BE2A 4OJHA 5DLFA 2ZBIA 5K8NA 2H65B 2HBZB 2CG4A 2CQ1A 5CYMA 4C4WA 3MPUB 3NXZA 1FEEA 3DMJA 1TU0B 1GH8A 2FJXA 2J5AA 1RAFB 3KYLA 2NLWA 3CF5Q 3TARA 3QPIA 1CULA 2YKAA 4HACB 2BM1A 4PXDA 4C8MA 5C2CA 3NGKA 1N54B 4Z7YA 1CSJA 4DEZA 3MXHP 2NUHA 3LH2S 4CLFA 3M6UA 2FVQA 4LBHA 1WDTA 2EK1A 4MAKA 5ETNA 2HFOA 3M8PB 5IC6B 2VODA 2MKYA 3GJSB 4LR9A 2MKJA 2WBMA 3DOMB 2V8DA 2Y1JA 1IBKJ 3M32B 3JYTB 3I4PA 3HLUA 4FS1A 1Q81T 1C4CA 1FNOA 1GTEA 1YJRA 1RT5B 4AL7A 4YB5A 1CJTB 1NSAA 4DS4A 1XR5A 3HVTB 4MK8A 3WX8A 3BS9A 3QFWA 1W2IA 4L74A 2APOA 4HH1A 1RHQB 4Y2IA 1P1TA 4ID5B 4PG5A 4CO4A 1V6HA 5DDRC 2RVJA 3GFHA 2ZM6F 2WB1D 2J8AA 5LM7E 1JXLA 3MR6A 1D8YA 1QE1B 4HLBA 2KH9A 2HHUA 1C4AA 4DR7J 4CLPA 2QYCA 1N48A 2D69A 4DLEA 3MAAA 4OZ0A 4WTYA 3EGWB 4ZLLA 2ZH3A 1UPMB 4A8XA 1KQFB 2ZUAA 4MYTA 4UTGA 2HIQA 3R6LB 3VHQA 2F63A 2RUSA 5EX3A 4CO2A 1H2UX 3OXLA 4HI2A 1WHVA 2PD1A 2YQ0A 1IUJA 1K8AT 4O0NA 2V9WA 3D6TB 1D09B 3UQSA 4A8KA 4ATNA 1J5OB 3FUYA 2W1BA 5FD1A 2HRYA 2Q6CA 2YWKA 3LTOA 4DV6J 2OAUA 4GVLA 3K5MA 4DV5F 1VC5A 2HEKA 3K5PA 3ZTOA 5LJ3Y 4YB1P 3W3SA 4G3IA 4QU6A 3ZZ0A 3ENWA 4IG0A 5HJYA 2XNRA 3K0JA 1F9EB 4M5MA 3Q86A 3NY0A 1U49A 4KHPF 2OPSB 3MMCA 4N5SA 4B3SF 2UXCJ 2IIHA 1HFEL 1UVLA 1WC5A 4QPXA 2GMLA 3CXCR 2VPWB 3FZBA 4QR1A 4ZVTB 2WSEC 3MM6B 2M3DA 5FDLB 4GMKA 3ENAA 2QSFA 3MPWA 3GR1A 2CWXA 5AE2A 3PW0A 1JLCB 1U25A 2HNZA 1IN0A 4OYOA 1SJRA 2V4RA 2RAQA 4OX8A 4OV1A 4DV0J 2FHJD 5AXLA 4RU9A 1LWXA 4YHHF 1RHUB 1RGVA 3GTYX 4XPEA 3QT5A 3W2WA 3HSJA 1PYOB 2MLYA 5HVGA 4FS2A 4XAKA 5HVHA 1VQ4S 3U7JA 3H5UA 4OZ3A 4UOGA 2GZOA 2F9JA 1FESA 3DLBA 3LQVA 3NG8A 4UUXA 3RU0A 3T5JA 1YJUA 1DY3A 5CZXA 3SXLA 2FLNA 1HLWA 1KKHA 3FSXA 4GVBB 2EFGA 2B51A 1FJEB 3S6EA 4K0KJ 4UZCA 2G0IA 1HD0A 2GFFA 2QSWA 1GMWD 3UCUP 3CC4S 5L38A 4TQSA 4F4WA 2FJDB 5GMDA 1KC8T 4USKA 2RUGA 4Y2AA 1OY8A 4PR6A 2C2OB 3OFEA 3ZZYA 3ZZPA 2Y8YA 2JLFA 2ROPA 3C15A 4E8UA 1HBMB 1X7VA 1SJQA 1VFJA 3HVRA 1X4BA 3I87A 4USIA 4WFYA 3EUNA 4YEAA 1NH7A 3TZZA 2HQIA 4G6VB 1BWEA 3I6PA 3W2VB 3OJUA 2SXLA 4Y3CA 4I6WA 1WKLA 2C22A 4NCBA 2CZ4A 4UOHA 2CG8A 1YHQS 4QIFA 1CQMA 3TZWA 4ZIWA 1PO6A 2HHVA 2PIIA 2VF3A 1CJKA 1JKHB 3CJ5A 3CWJA 4OHYA 4PUOA 3JS9A 4ECUA 4QWAA 2ZHOA 1Y5NB 5G0RB 2KZMA 1V5IB 1V5VA 2ZKUA 3PEHA 3LGNA 4GKKF 5B0AA 2NS1B 2ZD1A 1HR0J 4JV5J 1B4SA 2ILYA 3QSIA 2ADCA 1REVB 2W2NP 2YVSA 3KMQA 1EQ0A 2AIRB 1KONA 3FK4A 3AD8C 2OELA 2DNZA 1RT2B 5B0FA 8AT1B 2CDRB 2JOQA 2W8KA 3SCKE 5IT9Y 1ICEB 4M5HA 5KG4A 4MK7A 1RHMB 4QYZK 3OL9A 2IVYA 3A3NB 3H5YA 1BQMA 2R7QA 3CDBA 3N0VA 2ZBCA 1RZMA 3P96A 1UJ6A 1R7IA 2MQMA 3DLEA 5A2QY 3UNYA 2RHQB 2PO4A 4RNNA 3DM2A 1S9EA 1TZ0A 4NMXA 4LFAF 2Z2LA 2P6SA 4MFBA 4ZITA 2C2DA 3GPAA 3MR2A 3HO1A 1WOOA 2ZWOA 4DX6A 2HZAA 2AQ4A 4PAAA 4I2PB 3FJ2A 5HQLA 1VQPS 1S72S 5DG8A 2DPJA 1CQNA 1UVIA 4IOBA 2HQ3A 4O23A 2RF2B 4IH6A 2G4BA 3N9UC 3US5A 1H7XA 1YRTA 3N01A 3NL0A 4K4SA 2IDLA 2C2ZB 2O67A 2YX7A 3BH7B 1X4AA 3CJ8A 1JLCA 3EICA 2AGPA 3E2EA 2ZM6J 5K20B 1TR0A 1JLBB 1ZM9A 1AROP 1IKWB 2UU9F 1QUVA 2N7CA 5KFJA 4MH8A 5KOWA 3ZNJ1 5A8WB 1LWEB 5DO2A 3LGMA 1IM4A 4ICLB 2HAIA 3GG0A 2Q2GA 3IM8A 2HVEA 3PR5B 5LMNJ 4KFBB 2A18A 1NSQA 2W2MP 4ENOA 2AYEA 2E1PA 3MM5A 3PRVA 2W4PA 4RUHA 4C11B 1KRPA 1DLOB 2FY8A 4PPDA 4JI4J 5FIIA 5KG0A 1KFSA 3I82A 3LA0A 3CJ0A 4DV4F 2CYYA 3UN3A 1WOPA 3JXOA 2R8KA 1MMDA 3MEEA 2YQ3A 3R5GA 2W7PA 1M5KC 4DV1J 1RTZA 1VC0A 1HWJA 3QGPA 1G3OA 3ITHA 1RTDA 2UXDF 2DKOB 1RE1B 2DITA 1NXIA 3MEGB 3IG1A 3NCRA 5MLCV 3EXYA 4CRJA 2E9ZA 2M8DB 4DR5J 3CNQP 4DX5A 3LP2B 3VAFA 2RHSB 4DPXA 2HFNA 3J7YU 1WF1A 3IR5B 1VHIA 2QX0A 3BJYA 3BSAA 1BE4A 3AOCA 4PQAA 4O0IA 4NCAA 1HNIA 2AJ4A 4NOHA 3TEHB 1LW0B 1C1BA 2NYIA 4HTJA 5E7OB 2MQQA 1PJ5A 2OPQB 3PG9A 3QBCA 3C66A 3NGSA 3A8EA 2GO8A 3D4JA 1S1XA 4QOTA 5KFEA 2R4FA 2I5JA 2KXNB 1WG5A 1IBKF 1CJTA 3ULHA 4A8FA 3JQKA 3H4DA 3W1YC 2QA2A 4ZLPA 4M5DB 4QW8A 3EM1A 2E5LF 4OL8A 3J7Z5 1TL7B 2VQEF 1FDNA 3SCIE 3L95X 3AD9C 3C6EC 4PZVA 4HEA9 4KHRA 1C2PA 3PHTA 1NPRA 1UWBA 4EYHB 1W2BR 3AODA 2F4VJ 2CQHA 3DLGA 2Q1LA 5HO4A 2ZUGA 1XEZA 2KT3A 1FJGJ 2DY9A 1HQEB 1ELOA 3EVMA 4WU3A 3W7BA 3ZO7A 3W9HA 3K5LA 1N34F 2IBOA 2KDOA 2V8PA 3T19A 3BSNA 2P9EA 4FKYA 3M8PA 3PW2A 3TUIC 4OI2A 4UOCA 4DZ6A 3BGFA 4WZQA 4I2QA 4PPZA 2MKSA 4ED1A 5D4NA 2OTLS 1JLGB 1KR4A 1YJTA 1LW2A 4O44B 3GIKA 4ZVGA 2IYIA 2D41A 3GCXP 3FVYA 1GAOA 1F5BA 2CVEA 3M2RA 5LL6d 1NNDA 2YX1A 2KL8A 1JXVA 1UVMA 2XSJB 4S0MA 4J9MA 1XNQJ 1FKPA 2DNKA 2NXCA 1WORA 4HHHA 3VWSA 4IRDA 1BD6A 2XLIA 4OYPA 1A7GE 2D74B 2QA1A 2V68A 3BB5A 3AOBA 1YVFA 3DXSX 3GYXB 4M5IA 3RJMB 1DRZA 4LRBA 2CPEA 2QC3A 2QMXA 2DGSA 1HL6A 1IXKA 4EO8A 3D1HA 1ZAWA 2R7RA 2LKZA 2VV5A 2XSFA 1YDLA 4NZ7A 4QPTA 1U0SA 4LSLB 1RAAB 4DL5A 1CPZA 4A8WA 2CPYA 4GKJJ 3DDIA 4IO9Q 1YQHA 2X3GA 3J7A1 2ZOMA 3CC2S 3TO8A 4RNFA 5I42B 2YNGA 5D3GA 2XC9A 3KLFB 4DV1F 2NCKL 1FCAA 3JTNA 3FC9A 1TFYA 1H72C 3MURP 3I38A 1N8RT 2J6UA 5D0EA 4K5SA 2WVCA 3OL8A 4A8SA 1VRQC 2PDAA 3EGNA 4DLGA 3CT9A 4OYWA 1L3KA 2OPSA 3MMCB 1T9XA 4R0EA 4WXWA 2H4YB 2HURA 3OL6A 4JI0J 1IKYB 1NPPA 3MD3A 1XMBA 2ZC3A 3LP2A 4EEYA 4Q0BA 3FSYA 2NUUG 4RW8A 4M8LA 4NA2A 1P9YA 4NWBA 3PO4A 2KHDA 5IM0B 1RA7A 4PG8A 1RJJA 4NEZA 4NXNF 4HTIA 3GLJA 3Q8YA 3MD1A 5HBMB 4Q44A 1X5OA 1XMQF 3DOLA 5J2MB 3EX7B 4KHMA 1HNXF 4CM2A 1G6BA 1XIQA 2IM0A 4LFBJ 1NCLA 1APSA 2VL1A 2LLZA 4DR2J 4F2SA 4LF5F 2BOAA 3AD7C 2UVVA 2HWHA 1JKHA 1R8CA 4NASA 3KWMA 5AE1A 2V2QA 4JYAF 2RSQA 2AJFE 5KFNA 2BABA 3R5BA 3IAM9 4KE5A 2HHHJ 2BE9B 2U2FA 2DIVA 1Y10A 1UFWA 4DFPA 1EX8A 3MECA 3IN5A 1FK9B 5JXSA 2ERRA 2VH7A 3K7RA 1F2HA 2GGPB 3ISND 1RWXB 2YKNB 2ACMA 4QQBA 2QLBB 2VC1A 4GVBA 2GCFA 4NLUA 1WDDA 2M0GB 3JAMU 4I0WA 1RBLA 4CWBA 2V8HA 4JI0F 2LDYA 2UVUA 4XTTA 1NLTA 3EE3A 4XK8C 3BGUA 4BS2A 2C3OA 3C15B 3AT1B 5E3PA 5GADU 4YR0A 3EZ5A 2ZH8A 4LF4F 2E1CA 3T1HF 1UVNA 4I2QB 4PYDA 1KNZA 4LBIA 1A9NB 1L5UA 2M70A 2CJ9A 4FBUA 4QR2A 3OUYA 2JEGA 2JSXA 3L7OA 4JBCA 1FX4A 4KKOA 2AGQA 1OQ3A 4O4GB 2JL9A 2ZNYA 1SJ4P 1N6QB 2WSCC 3MMAA 4FYYB 4BWJA 3UDLA 1FKOB 1Z2ZA 2A3JA 3KNGA 3UR3C 3W63A 2J9DA 2R8GA 2X3DA 3D68A 1VDHA 1YSJA 1FNXH 1NEEA 4WYWA 3DDNA 1D9FA 5DS7A 1VOMA 3O6QA 5DQHA 2Y9HA 3W60A 3VGUA 6FDRA 1S0OA 4IOAQ 1FWKA 3U02A 2ATLA 1R6YA 4RWWA 5KFAA 3OXFA 3SDEA 5H9EJ 3G87A 2WRMA 4CLTA 2DIUA 1IKWA 1LWCA 1NM2A 2UUTA 3SQOP 3HZEA 5EUHA 1NKCA 3I0SB 4OX6A 1HHQA 4LSZB 3TW0A 2LEBA 1GXTA 1HNVA 1WF0A 3RRGA 1XNRJ 1S76D 2LXUA 2EW9A 2VOPA 3NWGA 3G71S 1AT1B 1NDKA 1HNWJ 1B7FA 5T14A 2QLFB 1JLEB 2DRDA 1RLCL 4TN2A 3J81Y 1NJZA 4DV2F 2CPFA 4C8YA 2GHPA 4DZDA 1MW7A 1KHWA 1TKTB 1KP6A 1JXEA 2B8PA 2L48A 2WVFA 4TLRA 4C11A 4CI0B 4IG3B 2R2SA 3Q0AA 3WHIA 2W4CA 3M8QB 2J76E 2C2KB 4L3NA 1WUUA 3MPVA 2L3MA 4I2PA 1RHKB 1R31A 3H5SA 5EWEA 2XY6A 1NK9A 5KG7A 3HJFA 4DPOA 1S6PB 4ZPDA 3S01A 5L1JA 3KJNB 1WC4A 3PW7A 1CJUA 3BGRA 4N77A 1XAOA 2E5HA 3Q83A 3JSBA 1VQOS 1XNQF 3MR3A 2HMIB 1RQ0A 4OFZA 1Y3JA 1JLBA 5D77A 3CCWA 2QV6A 2HNDA 3P49B 2EBGA 4J9LA 5A8WA 4AFFA 4AD6A 2IC3B 2EG2A 2Y3YA 2P5VA 1NHKL 2HSEB 3BGLA 3BR9A 1RT6A 3I5AA 3QIPB 5GAGU 2OMOA 1QTNB 5C42B 3AA9A 3R5AA 4X4PA 5IT4A 3LGHA 4KO0B 4UQGA 1BUXA 2LYVA 4DV3F 1SXLA 7AT1B 1RLDA 2AT1B 5B0CA 5M2PA 2HVZA 1TV6B 2AGOA 1J5EJ 2WHOA 2YKMB 2QJ3A 4P2MA 1PIEA 5J2PA 1SC4B 2FZCB 2CPIA 2ZDPA 3CJTA 4LRDA 3AOAA 1YRXA 2HLUA 4P7TA 5T41A 1DLOA 1X5SA 1YWXA 3WIUA 1WJ9A 2XMAA 2MGZA 3AQPA 4P71A 3U1LA 5A2QU 4MYUA 3HKZD 4A8QA 2ZJQQ 3V81A 3C6UB 2AYBA 4WIQA 1S4FA 2OPPA 2IJFA 4C8OA 3BQ1A 4MIWA 1S0NA 2GVZA 9RUBA 3AFGA 5C25B 3NRBA 3MMBA 5HMXA 3BSCA 5B09A 1RA6A 1PAUB 3V4IB 1ZTTA 4HT5A 4IOCQ 1SKWA 1RT7B 4FPIA 2MKHA 1VQ8S 2W9BA 2L41A 2CA9A 2R2RA 3O3LA 2JRRA 2MSTA 4K4WA 1ACMB 1P6TA 1RISA 1S6UA 2XY5A 3SV3A 3C3LA 2BDPA 1RWOB 3KJVA 3MMAB 4KSEB 5GAEI 4RZRA 1FKOA 4MK9A 3RGIA 2VQEJ 3M1VB 5HATA 4IH5A 3MUVP 2VZ9A 4AUKA 4KR0B 1RT1B 5CCMA 1ZM2A 1MWQA 1WC6A 3R6GB 1RYSA 3CC7S 3GFYA 4W90B 5AXMA 3DOKA 2H4WB 1OQ6A 1EHWA 4C0HA 3BGOP 5LOQA 5KG1A 1YTYA 5LT5A 2MJUA 2BA9A 3FSIA 3KJQB 3OVSA 4DHVA 4NLVA 9ATCB 1T3NA 1XMOF 3D66A 1LWCB 2OFHX 4LF1A 1FD2A 1OIAA 2GS8A 4WFNQ 3ZTSA 4X64F 3OVBA 2BJ3A 2Y0BB 4I1TA 4N41A 4DQSA 3JB9k 2D3O1 3HX9A 3FGVA 3M2UB 4LT6A 3O1LA 5HQMA 4RKUC 2J0WA 3OV7A 3BO2A 1DFDA 3DLJA 2W25A 3GYGA 4BCAA 2HGMA 2ZZTA 7FD1A 4DUYJ 1JMTA 4ZP9A 1U1QA 1FVSA 3TVKA 3ETOA 2OPRB 4DU8A 2GX8A 2BANB 2ZWPA 1WHYA 1KSPA 1XNRF 2RMLA 4YR3A 2E9RX 1I6JA 1HD1A 1S12A 2NR0A 4I4BA 3AGYA 1S6QB 5CH7B 5KFHA 1Y9OA 2YKPA 2C2EA 4DF8A 2LQJA 3VTIA 3RTVA 4QWCA 4B9LA 1UW4A 1RAEB 4OYZA 2VDIA 4C9DA 3V4MA 3TRGA 2F8HA 4P9SA 2EC0A 3H98A 3R5JB 2P6TA 1SUQB 5HI7A 3H90A 5E41A 4B9TA 4LF9J 5KFVA 4CCHA 5GMKa 2CJYB 1NJYA 2RU9A 4QWDA 2NSBA 4F04B 1YZ7A 3CD5A 5AXKA 4B08A 1QVFR 4K50A 1RAIB 2B9EA 2XLJA 1RT6B 2HPUA 2C42A 1TL3A 5CABA 1FWPA 4CLKA 1J2VA 2COLA 4O3SA 3H2UB 4DQIA 2E29A 2M2BA 2PMZD 2Y1RI 4ECRA 3T3FA 4EU0A 2H5EA 3GIJA 3E01B 3NAHA 4ZVEA 2DHAA 2H3EB 2I38A 2ZH6A 4DR1J 3BPSP 4QW9A 5HP1A 1AW0A 3TVYA 2MGZB 4DL4A 2JVOA 3RAQA 2AEFA 2UUAJ 3TUZC 1LXJA 3LF0A 3PXGa 3SSQA 3PKYA 1S99A 1HHSA 4PCQA 2ZJRQ 3IBCB 4A47A 4C8KA 1U8WA 2AJ0A 5F9LA 2QLJB 2K1RB 2OUGA 2HBRB 2VFTA 4ZPTR 2DO0A 3LP0B 3FCWA 2MSSA 3J7YI 4X62J 1AA1B 4Q8EA 2FHMA 4DBQA 4B9NA 4B9UA 5C24B 2E1RA 1X9MA 4K7QA 2ALYB 2FPHX 1VR6A 2UVRA 2Z4PA 4P73A 5IM0A 3CIMA 1Q53A 4X4QA 3LWLA 1WEXA 4LF5J 3UDEA 1SC3B 4JI6J 3M1VA 3AXMA 1GTHA 1IWGA 3VZIA 2YKOA 1UZDA 1DARA 1MU2A 2CQ4A 3CJ2A 3CCRS 2H51B 3HHNB 1WSRA 4O4GA 3M9NB 3EYZA 1BWVA 2ILZA 1FWLA 4Z2XA 2OSQA 2FC8A 5A6WA 2DK2A 1VJQA 2CJQA 4ZA1A 3T5KA 2AJ2A 2GV1A 2W9AA 1VQ9S 5KTQA 3TQEA 4FF1A 2HK3A 3M8YA 4ZOSA 4NLQA 1XN9A 4PXEA 3K58A 1QDUB 2RQKA 2W2OP 3DGPA 4TYBA 1VK8A 1EKRA 3BDEA 2DR9A 4B3MF 1C0TA 2R8IA 2OJ3A 2CXEA 2IPOB 4XDCA 5CAAA 1JLFA 1WOSA 1UA0A 1TK5A 5F8JA 4Y65A 3OJSA 1NO8A 1BXNA 1XBWA 2UXCF 4K2JA 3BO4A 4A8YA 3AQOA 3QJJA 3I0SA 1WKKA 2OPRA 4USVA 4TU9A 2QYGA 3NMRA 3TJ8A 1FFGB 1K44A 2XG8A 4FKXA 1RKIA 3CJKB 2AMCB 2BV3A 3NGDA 4GO7X 2WVEA 1RT4A 2G2YA 4NZ6A 4WBFA 4JI5J 1Q78A 1T9WA 5HAOA 4ZVOB 5K14B 1UZHA 3RYLA 5A8KA 1C0UB 2MEWA 4J9UE 1WTFA 2JC1A 3UFCX 2YNFB 4J9QA 4M94A 3POTB 1J5EF 5BYRA 1UFLA 3AHPA 3M8QA 3UI3A 4NMLA 3CDAA 4DN9A 1TK0A 2VONA 1AYEA 3PYFA 2MB0B 3DYAA 4KC5A 3WBZA 2KFZA 1S1TA 4YP3A 2V9KA 1X0FA 4N76A 2UZAA 3V6HA 5K8OA 2V0NA 4FXDA 1EP4A 2HFUA 4LQ9A 1JJCB 3VAKA 2HVDA 5IT9U 3UNGC 4CLWA 2OEJA 3B8HA 3UDVA 3FEZA 1PC4A 2RH3A 1TUVA 3W5ZA 4QYRA 1VLYA 5ETQA 3LPYA 3UCGA 2ZC4A 2UUCJ 1S7IA 3SZ2A 3A8KA 4F0MA 1SL0A 2RRNA 1SB6A 1RACB 1KLMB 3NBPA 3V81B 5B0BA 4YB7A 1CLFA 4B3RF 4F4XA 4ZHRA 4OZ1A 2LVWA 2A2CA 5L1IA 2MY8A 5BR8J 3HDSA 1HARA 3M7VA 5HVFA 1U1RA 1N32F 2C3YA 1PYTA 2C2NA 5F0UA 4WKRA 2HHWA 1C3GA 1UVJA 1H3DA 4N56A 1RBOB 2DH8A 2DXEA 4OHZA 3I31A 3OD2A 4OZLA 5IQ6A 2JFKA 5DJBA 4YHHJ 1S6PA 4ED6A 1XC9A 4ZVHA 3MMBB 3I55S 3IWXA 2DNPA 2WOMA 3OXGA 2UXBJ 1RWMB 2MQLA 3HF5A 3TAMB 2QIFA 2AF6A 4B17A 2J7WA 2BQRA 1EKSA 1Z1ZA 2LECA 4DR1F 2B9XA 3THPA 2MQOA 3AA8A 2DR5A 4FYVB 4DR6F 2QL9B 3HI9A 3FDSA 4OZNA 5KG6A 3KJVB 3KHLA 4DR6J 4OJ3A 3TZXA 3KLEB 1SH3A 2HQCA 3MEKA 2QT7A 3OTBA 1FDAA 3HFVA 3MOJB 1TL5A 2KJVA 3RUBL 2ASDA 1UWAA 2QL7B 2IM2A 4FXWA 1KVKA 4USJC 3JQMA 4OHXA 4C3MA 3UCZP 3D5MA 2OD4A 3OR2B 3KHGA 4PRFA 1NDPA 4YOEA 2IVFB 4DSLA 4DL3A 1IBLJ 2VBZA 2B4OA 1AUSL 1BQMB 3M05A 4P7VA 4Q7AA 2F9DA 2CQ3A 4ZVPB 5IV3A 1IBCB 1H2VZ 1RT2A 4HDHA 4IDKB 5KAKA 1RK8A 4Y0FA 2W9CA 4FN5A 2YY3A 3DLHA 4LF8F 1RSCA 1BLUA 1WEYA 4PXCA 1YJ9S 2OIHA 4ES1A 4JI3J 1LXNA 2BM0A 2DH7A 3B4DA 1AUDA 3VAIA 5FLXU 3HPOA 5DGAA 1RWWB 1NUEA 2QE5A 3E51A 1DTQB 4X65F 2V4JB 4J7CA 2I0XA 2DHHA 2L9NA 2Z8QA 3M9OB 1RAJA 2RQ4A 5IQQA 1M5HA 3KHHA 4WIIA 3S8SA 4LRFA 3A3OB 3POTA 3PX0A 2VICA 2YWFA 1I51B 4IH7A 1FNMA 3RB3A 2CQCA 4AL5A 1QD1A 1Q82T 4Y2MA 2ZFHA 1S1TB 4LF9F 1WACA 2Q66A 1R27B 3U1NA 1NZ8A 1IKVA 1UMJA 1HMVB 2M5YA 3KJFB 4H4KA 4LSNA 3RZAA 2BJ8A 2HHPA 4FVMA 4YQWA 1HI8A 1RAGB 2HQDA 3D1QA 3MCOA 3NCPA 2GQ2A 4G1PA 4RWXA 2E5JA 1DZ5A 2A2DA 3EZOA 5DZ6A 1XTZA 4MJKA 1U09A 5EX0A 3CPWR 1PJ7A 4J9RA 1QSYA 2XMJA 2XTJP 3HFKA 2DRBA 2YNIB 3M6WA 1VQ7S 1S1UB 1S5ZA 4H4OA 5CQGA 4DU7A 3PJ9A 3KLGA 4KH0B 2AYMA 4OYIA 4F26A 2WSFC 2EVZA 1SQGA 3ICLA 3IMQJ 4X4OA 4X4SA 1LWFA 3ENQA 3C19A 2J9EA 2JLGA 4OI6A 2V67A 3PV8A 5DM7Q 4O4RA 2EPIA 3C16B 1FVQA 1J5OA 2E7XA 3MEGA 2QLXA 3CVKA 1QY7A 4NLRA 3UWTA 5AT1B 4ECSA 1MSWD 1S59A 1WHWA 3D28A 5HROB 3MEEB 2F65A 1K9MT 3B82A 4ZN3A 4ZVSB 3MPDA 2KG1A 1DHMA 4QIWD 4BLGA 4OI3A 1RDRA 1YZ6A 2MKCA 2WW8A 4USTA 1YITS 4ZCMA 1L3TA 1U4BA 2FLPA 1T9VA 2IVMA 3LZ8A 2XS7A 3BPDA 4KIAA 4RNHA 4URGA 5EGYA 1ZAVA 3GFXA 2NZCA 5C24A 3MM6A 5CYJA 3MFIA 1OO0B 3SBMA 5C2GA 2OHDA 1HWIA 2HFZA 3PW5A 3RW6A 5ETOA 3HJVA 4JP8A 1P1LA 2E44A 2VUGA 5D0HA 3OLAA 4DUZF 2WTFA 4DL2A 2ODXA 5CA5A 3Q8SB 2OD6A 2ZE2B 1HWKA 4UOFA 2ACYA 1M90T 1IR0A 4KBIA 1VLOA 1R0CB 4I6YA 4RPFA 5HJXA 4DSFA 3PR4A 1R8AA 3AAWB 3GZ7A 2MZJA 4A8MP 3BH6B 1U8SA 2LXIA 5HP1B 5JJBA 2ABYA 1FRHA 4TY9A 1WG1A 3Q24A 2DPIA 1Y11A 1UEKA 3R27A 3GYNA 5IZHA 3U1MA 2RQCA 2FVCA 4X62F 4IDKA 2PA8D 4EBEA 3R1HA 1RTJB 1N56A 2FVPA 4WWSA 3KKFA 1OSCA 3H0PA 1XWLA 4EWTA 2K7JA 2DVIA 1GMUA 1S9GA 5IS2A 1RTIA 2VG7B 2VPZB 4OLPA 4PABA 5KFFA 2XNQA 4WXOA 1BQNB 3KG1A 3Q8VA 1WI6A 5KG2A 4K8RA 3CE8A 1NH8A 3FMBA 5ETVA 1FFSB 3VR1A 4NXMJ 4DV3J 3VAHA 3UD4P 4JI3F 2FHOB 1RU1A 4Y2CA 4DPTA 2AHOB 4QR0A 1HWUA 2MJNA 2OEMA 2MQ8A 4DR7F 3KG4A 5BJRA 1FXRA 4LRCA 3DI6A 5HLFA 4NX9A 5H9FK 3IC1A 5F3TA 2VOOA 3VAJA 1QAJA 3N4WA 1FTCA 1Q8IA 1YG0A 3MWBA 4NA3A 1T05B 3GJQB 2XMUA 4J80A 4ZVFA 3CW2C 2YWHA 1NK5A 1U45A 4PUOB 1HA1A 3CJSA 4Y34A 5G0RA 5HMYA 3IGVA 2J0SD 2XSJA 1AFJA 2N4CA 3P5BP 3V6JA 3DYAB 5LSLA 3TJAA 2JFDA 3FEYB 1U24A 2UUWA 1DQ9A 1Q86T 4Y00A 4QU7A 3D9BA 4RW6B 2GMJA 4YFUA 1HBUB 3MAHA 2DNLA 4AL6A 5CXTA 2XB2D 4RX6A 3IA0A 1S4EA 4RJVA 4ZN1A 2ZH1A 3PVXA 2EK6A 4NXNJ 1XK8A 4G1QA 3RW7A 2KZZA 4IFYB 2V34A 5D3GB 1Q8LA 3G8QA 3MM8A 5CYMB 5LXRA 3PX6A 1NDLA 5KG3A 2RS2A 2XHCA 5D8HB 3GSDA 2R2TA 3QATA 3RRKA 1Q5VA 2XMKA 1U6ZA 2YNGB 3I5CA 3L4BC 4I7FA 1TMJA 2L9DA 2RDDA 4CLZA 3IS9B 1S7HA 5A8RB 2DNQA 1JLAA 3FFIB 2R7UA 2DHSA 3BYPA 4MFBB 4CT8A 1MN7A 4IRCA 3WC0A 2XQCA 1Y3KA 3N28A 1W7WA 2ASLA 2W7OA 1TKZB 2IRYA 3EWGA 2P9GA 1XMOJ 4JYAJ 3DOMA 2BRLA 1IKYA 4HHUA 1KHVA 3HHLC 2WB4A 4RW8B 2RDIA 3QIDA 1RUSA 4JI7J 2N4DA 5J1EB 1NKEA 4WFXA 3KDOA 3EPGA 2E5IA 1VQMS 2PFDA 1S6OA 1T02A 2MDAA 3M8WA 3MM9A 1D1UA 4ECTA 3JSRA 2X1AA 4LVOP 1Q4RA 3CDUA 2J0QD 3RAMA 4Q43A 2GGPA 3CIZA 2YKNA 1EJ7L 1NK4A 3J81U 5DZ7A 3W61A 1NPKA 3G6XA 2IRXA 3OT9A 1E6VA 2HW3A 1PYSB 1RTJA 1X4DA 2O66A 4KGKA 3CMES 4NZ0A 1NJWA 3RBEA 1G4CA 1VQNS 2CKWA 2DGVA 2FJVA 4RU2A 1ZH5A 3RBDA 2QFJA 2HS3A 4K4UA 3FMWA 3H42A 4LRAA 1VQSA 2DNMA 1OS5A 4ZPCA 3CMAS 3T5LA 2D3ZA 1S1WB 2EKYA 1S97A 4LUBA 2F4FA 4EZ9A 1Q0NA 4UQTA 2YH0A 1N4LA 1RTDB 2DT9A 4DL0C 3PCOB 3TAMA 3D0HE 3M8SA 3H2LA 3LANA 1VS3A 4U9RA 3SQGA 4ECYA 5HLFB 1EETA 2J9DE 3AB4B 5IFMA 1VRUA 1PGZA 1KLNA 1YJ7A 2IAJA 3K8VA 4RW9B 1HNIB 2I1RA 2VFSA 5I3PA 3GIMA 1IVZA 4F4ZA 2KHCA 3ETMA 2HKEA 3KLEA 4Q8FA 2CQBA 4XDDA 3M8RA 4LFCJ 4CLLA 5F0WA 1YKWA 2BXJA 2E1AA 4AXJA 4IQMA 3ZZRA 4MKBA 3TA2A 5KFWA 2HFVA 3DRPB 1VRTA 3H40A 2CNLB 2IJRA 2IRUA 1X4HA 1SPBP 1HNVB 2FVRA 2CQPA 2ZBQA 1TL7A 2FZGB 3P5TL 5LMUF 2XZTB 1RKJA 1F0XA 2PSZA 4ALZA 4M5LA 2WBRA 2EFQA 1SVDA 2AV5A 4KHPJ 3K89A 3BYRA 4MIAA 4URQU 3MM7B 3SIPB 1S1UA 4H4OB 3BZQA 3DRSA 5K9FA 3W5YA 1ZBTA 4ANCA 2K8GA 3NCQA 4ZK7M 3PO5A 3MMJA 3SV4A 2WZ1A 3MEDB 2CZVC 4P72A 5KFTA 1Y00A 4NYPA 3TUJC 4DV5J 2W2QP 4O3PA 2WONB 2BZ2A 4NCGA 5ETTA 1YX2A 5K5MA 5DG9A 3UN5A 3R2DJ 4K0KF 1EARA 1YBTA 1VK3A 1REGX 3BKTA 2IFXA 3DRRA 4OZJA 3R9LA 3BGRB 2W4DA 3CTRA 2BBEA 2HGNA 4X2BA 4O44A 2VA3A 2Z2YB 2CJAA 4RL1A 4ZP7A 3RB6A 4DG1B 2RIJA 5JMNA 2FDNA 1S1VB 4A46A 1ZYQA 2NQPA 5CD4H 4I56A 5H9EK 3MI7X 1UFKA 2NXEA 1FKPB 1SQFA 1HPZA 2MYFA 3HVWA 4CTAB 2MXYA 1U7LA 1KOHA 2CQGA 1FRIA 2HNDB 4L72B 3KK1A 4OJGA 1H2TZ 2CWKA 4BDPA 2ZD1B 2KFNA 3QIPA 3MDFA 4CO5A 2LQ8A 3ISZA 3KLGB 2PMWA 3VF0B 1D0EA 2E7WA 2VFUA 3RR7A 1E6VB 3I0RA 4N7TA 4DN0A 3GQCA 3D2WA 1K73T 1DBDA 2OPPB 5F9NA 4OQJA 3DMJB 4CNYA 4FXVA 4C48A 4XPCA 1NB2A 2M7SA 2FIUA 2U1AA 4C8ZA 1CULB 3JTOA 2BE2B 2FYXA 2LEPA 3AXKA 3OFGA 5KFXA 3KLFA 2UXDJ 3SI8A 3C6UA 2M88A 4WP3A 2X1BA 2KRBA 4FDFA 4ZPVR 4NI2B 4CNZA 1HKAA 4F3MA 2GVZB 3FNNA 2B8QA 3G86A 2E1MC 4DR3F 4PG6A 2HQGA 3C2PA 1JQGA 1M1GA 5KT3A 4G65A 3DC2A 1P27B 2G2OA 2OTJS 1JNZB 2D3UA 2KU7A 3M32A 4DOZA 3Q8RB 2XO6A 3JYTA 4Q0BB 2DCUB 2VQFJ 2CAJA 3CGIA 5IWAJ 3KG0A 2C2MB 4OI0A 4KAIA 3CUNA 2RF2A 4X64J 5L46A 1ZS6A 3GV7B 1WKJA 3A1YG 1FERA 2BJ7A 2LA4A 1SKUB 5KFIA 2FJWA 2ZE2A 3DI6B 2N82B 4NLOA 4ZJLA 4M95A 4UY8T 1W25A 2CRLA 2VFVA 4HL9A 1OWXA 4RUAA 1L3VA 2R7XA 3R1LA 5KFLA 1GFWB 1LOUA 4NYZA 2H5JB 2V8GA 4M1KA 4DUTA 1VRTB 1RADB 3IR7B 4F4YA 2ZZMA 2AW0A 3IR6B 1T03B 3ZZOA 1IJEB 4YY3J 2RD5C 2VBXA 2K7KA 3HD2A 2BUNA 3M2UA 4C7QA 2MLXA 1OYEA 3O2IA 3MECB 4FYWB 4LR8A 4RW7A 3PIOQ 2Z57B 2R7WA 1QE1A 5B0GA 4A8OA 1KS2A 1NHUA 1N0VC 1HBUA 3QYYA 2XMWA 3A12A 3PJWA 1F1BB 3NGRA 3DU6A 5ETLA 5ETRA 1LNQA 3A8IA 3OW2R 3EGZA 2PI4A 2DRAA 4CDIA 1IKXA 2LP4A 2GVDA 2VBWA 1MROB 4TU7A 1DURA 2ZH9A 3J7AN 4PQUB 3DLKB 4X4RA 4KGMA 1TKDA 2E5GA 4QWBA 4HYKA 4TNOA 4Q45A 3G8TA 5FJ4A 4V19X 1U6FA 3CJRA 4ZP8A 2AJQA 2VKRA 3UN2A 5M2UA 2A0FB 4I7FB 5A8RA 4UZBA 1RCXB 3PYGA 1NKBA 8ATCB 4J9SA 2KTQA 1T9TA 2DNGA 4DG1A 2Z56B 3F56A 4OZ5A 5EWFA 5GVQA 3OLBA 1M5PC 5EHHA 2YH1A 1CBKA 1CS4B 1N5YA 3EDQB 1HNXJ 4LFBF 3JSMB 1NMEB 2V63A 2ZOGA 4LBPA 5KFBA 3M9MB 2RT3A 4R0JA 5ETMA 4B3SJ 2YXLA 5A6PA 4PG7A 1LKZA 5KT2A 3G8SA 3SSRA 3QWPA 2AX0A 5FDLA 4Z7CA 2JVRA 1YI2S 1KQGB 4ZCKA 3IWNC 1RI7A 1B3TA 2ALZA 1PCAA 4WJBA 3VGTA 4O3OA 2UVWA 2BJ1A 3KK3B 1KDNA 1O6XA 3R2CJ 2M8HA 2GO9A 3OSPA 4WTOB 2QG9B 4URSA 4ED3A 4FZVA 2XWYA 2UUBF 3V6DA 2L08A 4NXMF 2YNHB 4JI5F 3G6YA 1CJVA 3W2WB 3PJXA 1AFIA 4B3RJ 1Y0HA 3L7UA 1UWBB 5IXUA 2C28A 1OPIA 5J2QB 2AD9A 2DBBA 3MR7A 2I6WA 4AE5A 3I96A 3HT0A 3K17A 3LP0A 4LF7F 1KN6A 2Q3PA 2R8JA 2GHWA 3DXBA 1QSLA 3IS9A 1VQKS 3K5NA 3ZTQA 3HKWA 3ET6A 4NI2A 2QFIA 3TAPA 1GX5A 4YUDA 2UUCF 4DV6F 1MLAA 4PXBA 5BYSA 1HW8A 4WPAA 4JV2A 3FQLA 5J1NA 1P9QC 2GQQA 4P2SA 1TVRA 3W65A 2CIMA 3D3BJ 1BQXA 3CD6S 1Y5IB 3Q23A 4WFAQ 5J1PA 3KK2B 1ZAXA 1MG7A 5J1EA 2D3OR 2G0CA 3M2RB 4DFJA 2VJVA 2ROEA 2HMIA 1SIWB 1NLKL 3OR1B 4ANEA 4EBCA 2BVZA 3V2UC 5GAHU 4USWA 2Z30B 2QA4S 1NK8A 4RR5A 1VRUB 3IAS9 1DJ0A 2G0JA 1V9OA 2P2CB 2ZH4A 2JHEA 1OPZA 3CD7A 1VBKA 2QO3A 3CCVS 2KXHA 4ECQA 4YY3F 2RILA 5EWGA 4USHA 3RR8A 1D8ZA 4ED4A 4BHQA 2RRBA 4W4MA 2KO1A 3NLCA 3TOQA 1JLFB 3MTKA 4JB8B 5F8GA 5CD4A 4J9NA 4ILLA 4ZLNA 2HAFA 3OFFA 4RW7B 4PG4A 4JI7F 3KHRA 4QIGA 1B7YB 3OTOJ 4LMZA 4EO6A 1WELA 2CUYA 4WE1A 3GIIA 3PYDA 1T95A 2PMHA 4USUA 3CMQA 2EFVA 1FJGF 1S79A 3T6BA 4ELVA 1EQMA 3BN4A 5DG7A 1FEHA 4CT9A 3PIPQ 1WNEA 2MZTA 2V5HG 4DL6A 2BR0A 1X4CA 2B56A 4D3GA 5E3CA 2DY1A 1C0UA 2VDHA 5K8MA 1VI7A 2FJBB 4JI8J 2VU5A 1FX2A 3DRSB 5HANA 3CJKA 3SEOA 1U26A 4LIWA 4JV1A 3DU5A 2JLEA 3TZYA 3R5CA 2HYIB 1DAXA 4IKAA 4F67A 3B54A 2WONA 5M2RA 4RNOA 1NJXA 2GIRA 4HI1A 4NE9C 3M30A 3FRYA 1WF2A 4DPUA 2AJ1A 3NAIA 4RBTA 3GV5B 1UETA 3TI0A 1CVJA 2L9WA 1C1CA 3DDKA 2HHHF 1U6BA 3HZGA 5KFGA 5C5JA 2AX1A 3DOLB 1ULRA 2RB7A 4NLPA 4JUZA 3KLHB 1UEVA 2V69A 4H4MB 1KFDA 2XHWA 4DR4F 3BEGB 2PEHA 2GJIA 4DR2F 4ELUA 4V19J 1XERA 1WTBA 4A48A 3QLHA 3KK3A 5GADI 3H2VE 4C6AA 3CDWA 4OV6A 3HM9A 1KLMA 2VPXB 3PEJA 3QSYB 3QJLA 3BKUA 3S1TA 3VV2B 1TAUA 5ETKA 3GB0A 3P6YC 3CULA 3GIRA 3MAAB 5D4OA 2ZITA 2LXFA 3MM7A 1FRKA 2CPZA 5IOLA 1YBAA 1TFWA 3NBPB 2DEJA 1GQEA 2F8EX 1TMMA 3C14A 3F73A 3O8WA 1NBEB 4C3KA 4LF4J 5BR8F 2C1EB 5H1SV 1SJFA 1D9DA 4LF8J 2GAGC 2H9ZA 3BV8A 3BSOA 4JOUA 3ITHB 3CCLS 5LMNF 2FVSA 2B7CB 3H7HB 1S6QA 4ES3A 2G9OA 2HWIA 2VD3A 2LQ5A 3FBCA 2KT5A 2B0GA 1RWKB 3PNIA 5SUHA 3VCDA 2KFYA 1VHFA 2XMMA 3LOUA 4CQ1A 3G4SS 2MZRA 1FTRA 2YX4A 3KK2A 4FNIA 1MNEA 1FA0A 2PFFB 3P4UB 1AZSB 1RT3A 2XI3A 1N33F 1T0TV 2ZH2A 3OR1A 4K4XA 5KFYA 1R0AA 3L7PA 4KRWA 2HG4A 3WIVA 1S1XB 1SH0A 4LF6J 1XR6A 2DEIA 4ZLJA 1N5TA 4U8VA 3MR5A 3HXMA 3ZFVA 1LW0A 2X51A 5IWAF 1L3UA 1TL3B 3TP2A 2OPQA 2ZBPA 3EVOA 4CO1A 3LW5C 1QUPA 3N6NA 5DQGA 3N5BA 2F8MA 1B0TA 5KFRA 3EDRB 4L3KA 2DGOA 2I5JB 2M9KA 3F44A 2Z58B 3R8YA 3VQTA 2VHGA 1HQUA 2OLWA 2QGFB 2VKZG 3SFGA 1VISA 1GT8A 4TU8A 4ED8A 4DSEA 4C3LA 3W5XA 1R8BA 3UD3P 3QAEA 3HT3A 5KFZA 5HSPA 1WD6A 1T3OA 2FD2A 2MTLA 1SJ3P 1NB7A 1O51A 1MMNA 4DUYF 3NNHA 4FNHA 3A3PB 3G6VA 1X4FA 4P10A 5KFMA 3V5RA 1Q7YT 2K1RA 1SL1A 1T94A 3DLGB 4CLSA 4E2FB 1M5SA 3Q8QB 1RHJB 2QLDA 1S57A 3K2YA 2W7AA 3ZZUA 1IKXB 5KFQA 2GVDB 4PQUA 1M1KT 3FCHA 3OHBA 2DGUA 2V4JA 4G1IA 1TKXB 4HHJA 1ZM3A 2KYZA 2BJEA 1VMBA 3A13A 3G2XA 4FVCA 3I56S 1KQKA 4B9SA 3NMAA 2R9LA 2KYXA 2DCLA 4U7CA 1EB0A 1IKVB 2B26A 3K8WA 4KB7A 3SYZA 4IR9A 1JLGA 4K4VA 4C0BA 4DV0F 1MU2B 1FRJA 3QZ8A 1V3ZA 3KLIB 1F2GA 4YMEA 4J9KA 1I1GA 1IWAA 4NRUA 3KLHA 1FRMA 1RTHA 5B0EA 1HBOB 2EXUA 4LSNB 3TEGA 2F1FA 4IFVA 4DS5A 5DQIA 2GAHC 2LFVA 2QTWA 4TYAA 4K4YA 2GIFA 4DQQA 2R7VA 3CCMS 2YNIA 4DUZJ 3QLHB 3W8PA 3IP0A 5C42A 3R3TA 4UY85 2JX2A 1PBAA 1U47A 5KFSA 4ZJOA 2FY1A 4M63A 2UP1A 3BREA 4ZPWR 1KOOA 1Q5YA 1TV6A 3JSYA 4KGXB 3SMZA 2QA4G 1YJVA 1H38A 4PWDB 1A0OB 2JZ8A 3IFEA 3PZPA 4OYMA 1I94F 2DTJA 3C14B 4DV2J 2R2UA 3NNAA 2CQDA 1SI9A 2BYCA 2YNHA 4F3QA 3FRZA 3TA0A 2FZKB 4ECVA 2HIYA 2ZKTA 3NS5A 4N8OA 2OO4A 1N34J 2LCWA 4FP9A 3J81j 4B9MA 1V3SA 1AXQA 3VVTA 3V4IA 1FDBA 2YWEA 1RT7A 1UKUA 1S0VA 4ZVQB 3DM2B 4F36A 4M5JA 3NEKA 1FRXA 3TR5A 3C6TA 1P8GA 3HHKA 2K3KA 4TVAB 4YR2A 2J8SA 3TQ1A 2XS2A 2RRAA 3ILLA 4FF3A 3I9ZA 4F4KA 3HHLD 5E3AA 3ILIA 3PM9A 3MF5A 5A0YB 1LQ9A 2HRUA 2F3JA 4M5NA 4GC6A 1RT5A 2DXFA 2RJZA 2EKNA 3E8OA 4OIXA 1T9UA 2NYHA 2CJBA 1F9FA 4QIVA 3T6JA 1BGXT 4HR2A 5LJ5Y 4DQRA 4IQXA 4OHVA 2ASYA 3MGJA 1XJWB 1S48A 4HT7A 4IR1A 4UF4A 2M52A 5D6GA 3BDPA 2MKIA 2RKIB 1FK9A 3W9IA 1W26A 2HWTA 3PYEA 2BX6A 4ETXA 2H1YA 1MN9A 3I32A 4ICLA 2H48B 2PC6A 1R6VA 1FF2A 1KQSR 5ETPA 5GAGI 5DRKA 2JNJA 4ZHRB 1N52B 1PILA 2X1FA 5B0DA 1HBNB 3ET6B 1VQYA 1H7WA 2DO4A 3DFEA 4O3NA 1WC0A 3ONQA 5EDWA 2XO7A 2W8LA 3T1YJ 3DCAA 1N5QA 1JX4A 1RTIB 1F60B 2VG7A 2B5JB 1VQ5S 4I69A 3MCNA 1R3NA 4WFBQ 3G82A 4F4AA 4KT0C 4ECXA 2BQUA 1TK8A 2ZVSA 1GXLA 2QLWA 3IG1B 5F8NA 5KFPA 2GQCA 4J9PA 4CH1A 1FJCA 2CPDA 4YN3B 3RB0A 4DCJB 3DN9A 3OUYB 3ELHA 2I8EA 4ECWA 1KVIA 1MMLA 1VIXA 1TAQA 3D6HB 4RW4B 1SV5A 4BC7A 5HQ8A 2RNEA 1U1NA 3M30B 4GO5X 4X4VA 2HQFA 2M4MA 1ZM4A 4MKAA 4OLOA 4TXSA 1F3FA 3NKYA 5E33A 4Z37A 3M6VA 4AXIA 3ZZTA 2P9CA 1N5SA 2DR8A 1SBRA 3MUTP 2OFGX 4IFYA 2DJWA 1RABB 3MOZA 4H4MA 1UVKA 2C3PA 4RW6A 3LP1A 4WE1B 4PWDA 2VB6A 1QAXA 3HFZB 1MWYA 3CCES 1JLEA 4U7UD 1GXUA 2KVIA 4OMFG 3PKMA 4X4NA 3W66A 1URRA 4NLXA 4ZP6A 1UA1A 4DI6A 1B99A 5GAEU 7FDRA 3QRQA 1WWHA 1B0PA 2G2ZA 1DTTB 3OQ2A 2DISA 4RBVA 5CYQA 3GP9A 1ROFA 4J9VA 1IBMJ 2XCPA 1G7CB 3PDNA 2OH2A 4CH0S 4DL7A 4I6AA 3PRDA 5CCLA 1FI4A 2KM8C 1JLAB 3C6TB 2D7SA 1RWVB 4ECZA 1UAWA 1SCJB 1RWPB 4PKDB 4O3QA 2XS5A 4J90A 1S49A 1FDDA 1QLNA 2HZVA 1ITPA 3TA1A 2JRSA 5F8MA 4XIUA 4J91A 2JEJA 4DMZA 1UJ5A 1XMQJ 5THWA 3FQKA 4LF2A 4LJMA 1UP1A 1SL2A 2CQ0A 1HHTP 4FF4A 4GKKJ 2E5LJ 4NLDA 5IT0A 4X4UA 5DDOC 2XZWA 4WK1A 1SC6A 3MM9B 3EXCX 1M1HA 2VG5A 2HVHA 5LSOA 4KPCA 1QJHA 1F3VA 4F0HA 4DX8H 4FF2A 1BC6A 1FD8A
chains in the Genus database with same CATH topology
3NXZA 1C3GA 3TJ9A 3NY0A 2Q2GA 2QLDA 3AGYA 1GMWD 3TJ8A 1NLTA 4J80A 1XAOA 1GMVA 1EB0A 4L3KA 3LA0A 2B26A 3TJAA 3LZ8A 1GMUA 1EARA 3AGZA 3L9ZA 3I38A 2HFVA 3AGXA 1GMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXZ A;  1C3G A;  3TJ9 A;  3NY0 A;  2Q2G A;  2QLD A;  3AGY A;  1GMW D;  3TJ8 A;  1NLT A;  4J80 A;  1XAO A;  1GMV A;  1EB0 A;  4L3K A;  3LA0 A;  2B26 A;  3TJA A;  3LZ8 A;  1GMU A;  1EAR A;  3AGZ A;  3L9Z A;  3I38 A;  2HFV A;  3AGX A;  1GMW A; 
#chains in the Genus database with same CATH topology
 1UPP A;  3QFH A;  2IC3 A;  1Q1K A;  3TX0 A;  2I9S A;  4LF6 F;  3BQ2 A;  1C0T B;  4YB6 A;  2LMI A;  3LAM A;  3PTW A;  1HQ2 A;  4ED2 A;  3VQS A;  4CO0 A;  4QWE A;  4P6Q A;  3X3U A;  1NSK L;  1SKR A;  4ZJQ A;  1JIH A;  2DNH A;  1VBZ A;  1HBN A;  3KNA A;  4R5P B;  3M4X A;  6FD1 A;  2EBE A;  3FBB A;  2XYG B;  1JJH A;  1RWN B;  1WSV A;  4PWW A;  2DNO A;  4KY3 A;  5I42 A;  2BKN A;  4CO3 A;  1OYD A;  4P74 A;  2QRR A;  1T8E A;  1GX6 A;  5KFU A;  4RO0 A;  4I68 A;  2J9C A;  5K14 A;  2IJN A;  1JB0 C;  4DV4 J;  3W64 A;  1JWW A;  4HAC A;  3DKD A;  4KQZ A;  2MQN A;  1AZS A;  1IQZ A;  1RT3 B;  2BW7 A;  2YNF A;  4K2X A;  3CCQ S;  5D0G A;  4X66 J;  3CCZ A;  1K0T A;  1J27 A;  1VGY A;  2GJ2 A;  1FT8 A;  4CYU A;  3X1L B;  4FYD A;  2IY5 B;  4AQY F;  3BBC A;  3BM7 A;  1YK9 A;  2KXF A;  3UW1 A;  4AT1 B;  3BBF A;  4R8U B;  3UR0 A;  5KFK A;  2JEF A;  1JNR B;  1N36 F;  3DRP A;  2N3L A;  1KD1 T;  2B4V A;  2WCX A;  1TTH B;  1EP4 B;  4L73 A;  2ZDO A;  3D1O A;  5BYQ A;  5J2M A;  4F0K A;  2DYA A;  3TYT A;  1Z2L A;  2CVI A;  2YPY A;  3THT A;  2AP6 A;  4YS2 A;  3D3C J;  1HQU B;  2XI2 A;  3D6F B;  3BR8 A;  2JH3 A;  4AND A;  4WKY A;  4W98 A;  1ZET A;  5AJ3 F;  5T7L A;  3PX4 A;  4QIE A;  1HIY A;  5D4P A;  3P45 B;  4JI6 F;  2JC0 A;  3AJ2 A;  4ID5 A;  1QAI A;  3HK2 A;  3BO3 A;  3EJM A;  3SSS A;  1R0B G;  1WEZ A;  2XEX A;  4DPW A;  5E3Q A;  3MTJ A;  4MKV A;  3OTD A;  3QGI A;  4DR5 F;  3H59 A;  5AE3 A;  2D9O A;  3OTC A;  3IWL A;  1X4E A;  3ENV A;  1T11 A;  4U95 A;  2HHX A;  2EFP A;  1RAH B;  2HK2 A;  3DRR B;  2ZOF A;  3Q2S C;  4ZVR B;  2HBY B;  2NXJ A;  1CG2 A;  3PAC A;  2DHX A;  4RBU A;  4UUW A;  5IC4 B;  3QT8 A;  1FJ7 A;  1NU4 A;  5SZT A;  1IR2 A;  3HCX A;  1D3W A;  2BAC A;  4IRK A;  4Q2L A;  2Y8W A;  4X84 A;  4WU2 A;  3DNC A;  3M8Z A;  3T9N A;  3FEX B;  4C8N A;  2VA2 A;  1GEH A;  2WOM B;  4ZVU B;  2BRK A;  2FJA B;  2J7K A;  4MT1 A;  3A8J A;  4LRE A;  3Q8P B;  2DGT A;  4USM A;  3KLI A;  3IXQ A;  4TQR A;  3KLV A;  5CHC B;  4F25 A;  2CQI A;  1TUW A;  3QO9 B;  2HLT A;  1RB0 A;  1S1V A;  2WAQ D;  4ZS6 A;  4D3H A;  5L9N A;  3SFU A;  3GU0 A;  3KK1 B;  1S10 A;  2O1P A;  2MMY A;  5L8R C;  5AJ3 J;  4F02 A;  2B9Y A;  2HNZ B;  2FLL A;  4ERD A;  1FXL A;  1CEZ A;  3AB2 B;  1T9Y A;  1E6Y A;  1TP7 A;  2PI5 A;  4OI4 A;  3SCL E;  2NPF A;  4B9V A;  4DSK A;  1R8H A;  3FCV A;  1AB8 A;  4RUC A;  1IBM F;  4TKT A;  1F5C A;  2ZNZ A;  1NZA A;  3GR0 A;  1N36 J;  4QYZ J;  1HI1 A;  2GA7 A;  3EMT A;  2MPU A;  3T9Z A;  1U1O A;  1R8P A;  3I0R B;  1WG4 A;  2V2K A;  3MM8 B;  5E2Q A;  1H74 A;  4M5K A;  4NLG A;  4R5P A;  2UXB F;  5JUM A;  3G6E S;  2ZBR A;  2G13 A;  3AKO B;  3I9V 9;  1H0H B;  3HHD A;  3GJT B;  5KG5 A;  3T1Y F;  1N0U A;  3LUY A;  1EIY B;  3VGS A;  2CFX A;  5HMZ A;  5F8H A;  2BW2 A;  3JAM Y;  3UO0 A;  3QQC D;  3OTO F;  1KEK A;  1RP5 A;  3EVW A;  4DV7 J;  4DJB A;  3IRW P;  2GC8 A;  1UCN A;  3HVA A;  2B5J A;  1JK9 B;  4NLT A;  2YKQ A;  3MUM P;  4WFZ A;  2E7V A;  4FPR A;  2YQ1 A;  3OTE A;  1I3O B;  4LF7 J;  1LW2 B;  4PEO A;  3O5T B;  3O44 A;  1HBM A;  3QWU A;  2WK4 A;  4R8U A;  4ILR A;  2JJ4 D;  1LV5 A;  3G9C A;  4LVN P;  1ZZN A;  4ES2 A;  4OI1 A;  2B9W A;  2HGL A;  3U27 A;  1JJ2 R;  3QRR A;  2NZ4 A;  3W2V A;  4J37 A;  4B3M J;  4NEY A;  4L6V 3;  4RW4 A;  2RKI A;  3CSK A;  1Q16 B;  3DGV A;  2ZZN A;  4WP8 A;  4KTQ A;  3MAQ A;  1JJ4 A;  3L09 A;  2KJW A;  3ILO A;  4PYA A;  4ZDN A;  2NXN A;  5DDQ C;  2MZQ A;  3E3X A;  2Z2M A;  3IGN A;  5DET A;  2MZ1 A;  4HDG A;  3GV8 B;  2DNY A;  1MRO A;  5LXY A;  5H9F J;  3DGP B;  4P2F A;  4GC7 A;  1SC1 B;  3RAX A;  4KGZ B;  2QN6 B;  2B43 A;  2DGQ A;  3LAK A;  2UV8 G;  4LSL A;  2VAS A;  2R42 A;  2QZ8 A;  4R25 A;  3SCJ E;  2J6T A;  3DRY A;  4J5O A;  1YJN S;  3PFE A;  4FYX B;  4L75 A;  3TUP A;  3H5X A;  4I67 A;  3QAU A;  3DLE B;  4HVZ A;  1BY9 A;  2BJD A;  2Z2Z A;  3DLK A;  3K5O A;  4OZ2 A;  1PG5 B;  3D7S B;  3CB4 A;  1EAY C;  4RUB A;  1GNK A;  2D9P A;  3QNW B;  4ID8 A;  4ZMM A;  2RU3 A;  2V94 A;  2VBY A;  4DXL A;  3VAL A;  1NSP A;  3N6L A;  5I3Q A;  3PY8 A;  1RT4 B;  1U1P A;  3SQG B;  6AT1 B;  1EET B;  3D0I E;  4KGV B;  3T5H A;  2VPY B;  1YBU A;  2QL5 B;  2QMU B;  1SV5 B;  1NHV A;  1R89 A;  2BE7 D;  3QO9 A;  3CD0 A;  4JI2 F;  3OSN A;  1GK8 A;  3BBB A;  4L76 A;  3J80 Y;  1SKS A;  5ADZ A;  3CO0 P;  2JEI A;  3PHE A;  2Y1I A;  2CPX A;  5HBM A;  4EI2 A;  2AU0 A;  3ZTP A;  3RRH A;  2WW4 A;  3C46 A;  3DOK B;  2FJE B;  2J7U A;  3VZH A;  3LP1 B;  1N33 J;  3HSD A;  2MHE A;  4U6P A;  3QT6 A;  2W01 A;  5HN0 A;  3KTQ A;  4MTP A;  2VG5 B;  3J80 U;  3ILJ A;  1S9F A;  4KV8 B;  2V6A A;  2H54 B;  2F40 A;  3JQJ A;  3GFZ A;  2MQP A;  1T7P A;  4TY8 A;  4B3O B;  1LWE A;  2A6O A;  1X5T A;  5E0O A;  1XR7 A;  2VG6 B;  2KB2 A;  3MM5 B;  2GMH A;  2O5D A;  2N7Y A;  2HHQ A;  4ZPB A;  1RAO A;  1S9G B;  2GIQ A;  4JI4 F;  1G1X A;  1A6L A;  3MED A;  3RBZ A;  4CLU A;  4DV7 F;  1TVR B;  2LU2 A;  2JVM A;  2FLO A;  1NJI T;  2R7T A;  3GWC A;  1X5P A;  3TWZ A;  2G1D A;  4DQP A;  4EMD A;  3GJR B;  2PT0 A;  4ITS A;  1Y4Z B;  1NK0 A;  2DB1 A;  2IMO A;  1FE0 A;  3H25 A;  1CC7 A;  2KKH A;  2EWH A;  1FE4 A;  2MY7 A;  3DHX A;  3PRB A;  4EUV A;  5F3Z A;  1U1K A;  2UUA F;  3EZU A;  2R8H A;  3DLL Q;  1KBR A;  2KN4 A;  2BKP A;  2XM3 A;  1UW9 A;  1SIZ A;  4ED5 A;  1S77 D;  1PSD A;  2EC2 A;  3ZXW A;  1N6Q A;  5HL7 Q;  4P52 A;  5D4L A;  1KTQ A;  4QZV B;  2AZ3 A;  1BMQ B;  4CYU B;  3GIL A;  1NK7 A;  1K1S A;  1HYS B;  2GNK A;  2IDE A;  1JLQ A;  4C97 A;  1YIJ S;  4CH7 A;  1U1L A;  2N3O A;  3QMQ A;  2H5I B;  3HMJ G;  3FZ2 A;  1O5J A;  1C1B B;  2EEY A;  3KUG A;  4F50 A;  1NK6 A;  2CNN B;  4OHW A;  4OX9 J;  5KT6 A;  2QMW A;  1O8B A;  4H4K C;  2KRR A;  2VJU A;  2C2R A;  1OJ4 A;  3TJ9 A;  2W24 A;  1UJ4 A;  3MPY A;  4NA1 A;  4JI1 F;  2LA6 A;  4LFA J;  4MMO A;  4X65 J;  4E98 A;  2IYG A;  3ADA C;  2FHK A;  2Y0S D;  2VQF F;  2FHJ A;  3TAQ A;  4JI8 F;  2RE1 A;  4V1A k;  5E3R A;  3NP5 A;  1KTV A;  1OSD A;  1HQE A;  5IV4 A;  2IMW P;  2HNY A;  2O01 C;  2UV8 A;  4U96 A;  2CNK B;  3F41 A;  1X4G A;  2AZ1 A;  1I5O B;  1NRK A;  3C8Y A;  1FXD A;  3HHL A;  8RUC A;  2J0X A;  3FFI A;  1IBL F;  1YLX A;  1TKT A;  2Q6B A;  2JZ5 A;  4U67 Q;  4K4T A;  2BQ3 A;  1VYA A;  1DTQ A;  2A1B A;  1TKZ A;  5HK4 A;  2DGX A;  4W92 B;  3IBW A;  3FKB A;  5C7P A;  1C1C B;  2X1G A;  5E5N A;  1GMW A;  4BC9 A;  2CJK A;  2DR7 A;  3K57 A;  3JTP A;  4ZIV A;  4ED7 A;  1HMV A;  4M5G A;  3VGV A;  1TUG B;  4DR4 J;  2KI2 A;  1RCO B;  3M2V B;  3S7R A;  2IBK A;  4IUF A;  3CCU S;  3J7Z T;  2QEX S;  3C5X C;  2OEK A;  1VBX A;  4DWI A;  1RYR A;  2GJF A;  4EBD A;  4ZCI A;  3KOA A;  1EZZ B;  4JI2 J;  1MWZ A;  5T7L B;  3UPF A;  2HS0 A;  3Q22 A;  3HHE A;  3Q2T C;  5D15 A;  3GON A;  4NYO A;  3CCS S;  1TL1 B;  4C2M A;  2A10 A;  5KFC A;  2AEJ A;  3ZC4 A;  5DLG A;  4KV8 A;  1Y7P A;  5L1L A;  1PJ6 A;  2B6A A;  1H6K X;  3AH6 A;  4C0O C;  4F2R A;  1WC3 A;  1SJ1 A;  1WC1 A;  4UT4 A;  2RDJ A;  4O3R A;  3QRP A;  4WZM A;  3KMS A;  1VQ6 S;  3N6M A;  1IJF B;  1M5V C;  3OFH A;  3GSI A;  2AEM A;  2KG0 A;  2ZJP Q;  2DXD A;  2PGC A;  5L1K A;  3B6B A;  2X7I A;  3ZNU A;  4XO0 A;  4F8R A;  5KOX A;  4IYQ A;  1B64 A;  2XZD B;  3LWM A;  2YBV A;  2YTC A;  2MHN A;  2WVD A;  1LK7 A;  4GKJ F;  1D9A A;  3B4M A;  2XYH B;  2C3M A;  4LIR A;  4I64 A;  5HRO A;  4OYB A;  2UUB J;  5A8K B;  5U47 A;  4EK2 A;  3VVU A;  3CDE A;  2PN6 A;  3WZ0 A;  5BXI A;  1QAY A;  4RW9 A;  2XMT A;  4ZKA A;  4ILM A;  1UTA A;  1ZPW X;  2G1H A;  3W62 A;  2NXU A;  3CJ4 A;  4LFC F;  1R0A B;  1X31 C;  2NSC A;  5K8P A;  1Y5L B;  5L9X A;  5LMU J;  2AYG A;  4X4T A;  1E6Y B;  4AQY J;  1HYS A;  5G4D A;  4E0D A;  2XGQ A;  2NRE A;  1YGY A;  4NL5 A;  4CM0 A;  3Q8U A;  1ZA2 B;  4Q5V A;  2EG1 A;  3AJD A;  3W8G A;  5JVH Q;  1QVG R;  3LO3 A;  4LR7 A;  2ZHB A;  3H4B A;  3D67 A;  4YDD B;  1DQ8 A;  1VCT A;  2XMV A;  4C8L A;  1LFP A;  3LPE A;  3G96 A;  1U1M A;  1HNZ F;  1PAE X;  2DNN A;  3CJ3 A;  3UE2 A;  3KUH A;  5KFD A;  5J2Q A;  2DR6 A;  5J2N A;  2E66 A;  2MLZ A;  1HWL A;  2OKQ A;  3QT7 A;  2F5G A;  4OJ1 A;  3R5D A;  5ETS A;  3CCJ S;  5MAO A;  1TL4 A;  4NLS A;  4F7V A;  1BQN A;  1IQT A;  1KVJ A;  2HNY B;  4MIB A;  2Q43 A;  2B4P A;  5B08 A;  2LEA A;  2R3V A;  2JWN A;  3D0G E;  3D54 A;  4EFA C;  4WCE Q;  1YJW S;  3AGZ A;  2D1C A;  5EN1 A;  2HS4 A;  3T1H J;  1X60 A;  4QJV A;  2BMB A;  1H98 A;  2XY7 A;  1O0P A;  2LDI A;  1RBA A;  1U48 A;  2PEB A;  4B02 A;  2ZH7 A;  2O3D A;  2HRT A;  1RXO B;  2CZ9 A;  4KKO B;  4DFK A;  4N8N A;  3T41 A;  3GG1 A;  2R7S A;  2XBP A;  1B70 B;  1F9H A;  3IBF B;  3M2V A;  5KT5 A;  4FBT A;  3CO9 A;  5CZV A;  4NPO A;  2XGP A;  2ZEJ A;  1DQA A;  3TVZ A;  1TEL A;  2CPJ A;  3B78 A;  1T05 A;  2R7O A;  5HMW A;  4EGL A;  1RTH B;  2V2V A;  1HBO A;  3F0N A;  5GME A;  4OX9 F;  4IFV B;  1U2C A;  2GHV C;  3R7N B;  2BKO A;  3TX8 A;  1VIO A;  3ZZZ A;  1L3S A;  4P75 A;  3SDE B;  1ZTW A;  1M5O C;  3PW4 A;  3QGG A;  2LQB A;  4IO1 A;  4CP5 A;  3L9Z A;  4ETZ A;  3QJP A;  4G1Q B;  4QBU A;  2I2Y A;  2J6S A;  2CJX B;  4ED0 A;  3W9J A;  3AGX A;  1PKU A;  3OR2 A;  2V4Q A;  3BF4 A;  2ATC B;  4CZC A;  4K4Z A;  2FUG 9;  3R97 A;  4DR3 J;  1X9S A;  1Z4U A;  3CED A;  3UVJ A;  4AYB D;  1H73 A;  3BKF A;  5I3U B;  2W9C B;  1HNW F;  2VIH A;  3KFW X;  1ZZF A;  4DX7 A;  1VBY A;  2K06 A;  2MKK A;  4DFM A;  4KPY A;  2OP5 A;  2DD8 S;  1XQI A;  1VQL S;  3GE9 A;  3WQP A;  1FO1 A;  2VG6 A;  1FRL A;  3CJQ A;  4KH1 B;  5JVG Q;  4ZCL A;  4P2X A;  4IG3 A;  5F8I A;  2RQM A;  1B0V A;  1N5V A;  1GMV A;  1RU2 A;  2POK A;  3GMG A;  2XWX A;  2ZH5 A;  4OYX A;  2AWZ A;  1KWM A;  2WVB A;  3I4H X;  3Q89 A;  4BWM A;  2V50 A;  2KM8 B;  3GCW P;  1NDC A;  2Q79 A;  4KJI A;  2OSR A;  1HI0 P;  2PE8 A;  2E9T A;  2IM1 A;  1X9W A;  1U2R A;  3KDN A;  1QTM A;  4JI1 J;  5LSR A;  3QZ7 A;  4ER8 A;  4Y6I A;  1I94 J;  5DDP C;  1U0H A;  2DNR A;  3AY0 A;  4N47 A;  5A0Y A;  3IRX A;  3FBF A;  3TNV A;  5B7W A;  5FLX Y;  2NPI A;  4EZ6 A;  1CC8 A;  1Q8B A;  1U02 A;  3QGH A;  2CNO B;  1CJU B;  2UU9 J;  1NAQ A;  1LK5 A;  2BEF A;  4F3O A;  3ISN C;  1IR1 A;  2DH9 A;  2V2Z A;  3TAN A;  1T03 A;  4GRS A;  2OGU A;  1PC5 A;  2HBQ B;  2LU1 A;  1F5A A;  1JLQ B;  3I5B A;  2YPZ A;  3MCM A;  1M0S A;  4TY8 B;  4A4J A;  2YKM A;  5DGB A;  3HP6 A;  4B3O A;  2OI2 A;  3NOG A;  5KT7 A;  2JDJ A;  4DCP B;  2P8I A;  2B7B B;  5J2N B;  4KO0 A;  3VAM A;  3MZI A;  4Y2K A;  3OBI A;  2BJ9 A;  5F41 A;  3IO1 A;  2RS8 A;  2B4U A;  5ITH A;  1OY9 A;  1LWF B;  2MZS A;  3NS7 B;  5J2P B;  2HFS A;  1S1W A;  4QCL A;  3WDO A;  2ZHA A;  4CLY A;  3WC2 A;  3G82 B;  4KYZ A;  3C16 A;  2ADB A;  2XLK A;  3D6M B;  1IM6 A;  2VC0 A;  2ZVI A;  2B3T B;  2EFN A;  1OY6 A;  1LFW A;  1N32 J;  1N88 A;  5KT4 A;  4WP9 A;  2DGW A;  1ZA1 B;  2FGO A;  2V8V A;  2W2P P;  1FHT A;  3LAL A;  4YDX A;  2XYP B;  2HZC A;  2C3U A;  1S9E B;  2PA3 A;  4JV0 A;  4DCO B;  5C25 A;  3HHL B;  2HVI A;  2HHS A;  2ROG A;  3HUL A;  1HW9 A;  1X8D A;  1LEO A;  1R43 A;  3MHY A;  3VAG A;  1CJK B;  1YRU A;  2K2P A;  3T1A A;  2F4V F;  3OVA A;  1URN A;  1CS4 A;  1N5Y B;  2W9B B;  3P3D A;  3JSM A;  3MFH A;  2F7V A;  2AKW B;  2FQQ B;  2IA0 A;  2LQ9 A;  2XCA A;  1HR0 F;  2VFR A;  3NOC A;  1K1Q A;  2IHR 1;  4J9O A;  4JV5 F;  2FB0 A;  2IAJ B;  3HVT A;  1OMS A;  2EFO A;  4HKQ A;  2KT2 A;  2Z0G A;  3N79 A;  3HSZ A;  3WX4 A;  4DDF A;  1K47 A;  4K59 A;  3UD5 A;  5AXN A;  4BBY A;  1REV A;  4B3T J;  3RG6 A;  2K3I A;  1ZPV A;  1RT1 A;  4X66 F;  1QM9 A;  5GAH I;  3HSG A;  4LQ3 A;  2YWG A;  4WK3 A;  3NGU A;  4OYA A;  4DPY A;  3NGT A;  3V6D B;  5A76 A;  2FGC A;  4H54 A;  5RUB A;  1CJV B;  3P8B B;  3EGV A;  2FTR A;  3R7B B;  3OHA A;  4MKY A;  3OPK A;  1TL1 A;  3CCT A;  3M6X A;  1DTT A;  3PFO A;  4UW2 A;  3KUE A;  1VJW A;  2YWW A;  5CYQ B;  5D78 A;  3UVJ B;  5I3U A;  4WYL A;  1UEU A;  4NLY A;  1QSS A;  5KFO A;  1Q95 G;  1SH2 A;  4CIO A;  1WI8 A;  4Y28 C;  4WF9 Q;  3V6K A;  2IM3 A;  2FC9 A;  3DRX A;  1WHX A;  5I4M A;  2BOP A;  4NRT A;  3KXD A;  4PWU A;  3EPI A;  1HNZ J;  4DF4 A;  4C98 A;  2HHT A;  3DHW C;  2GW8 A;  1TKX A;  4RLE A;  1S0M A;  1FFW B;  1RWU A;  4NCG B;  3K59 A;  4TLQ A;  2BAN A;  1X0P A;  5DM6 Q;  1G2E A;  2OML A;  4NLW A;  1Q8K A;  3IM9 A;  4IG0 B;  5D0R A;  3R7S B;  4HH0 A;  3UDC A;  3BQ0 A;  1BHN A;  3H20 A;  1V3R A;  2Y1L B;  4DSJ A;  3MCS A;  4DSI A;  4B3T F;  4U7U K;  1U0H B;  3BN7 A;  1SQE A;  3AJ1 A;  4EYI B;  3IRX B;  1SUQ A;  2DHG A;  1ZOT A;  2A6M A;  4Q2M A;  1HPZ B;  4CTA A;  4OX7 A;  1VC6 A;  2IA6 A;  2CDQ A;  3NNC A;  2CAD A;  4K5R A;  3L3C A;  3HD1 A;  3N5F A;  1F6T A;  3A4T A;  1FKA F;  1Q7L B;  3RB4 A;  1TQL A;  1UL3 A;  2EI5 A;  3THV A;  4U8Y A;  3FBE A;  2XUL A;  1PBU A;  4KFB A;  2B6A B;  3OL7 A;  5L39 A;  3E01 A;  3H8Y A;  5F8L A;  3RBX A;  4ZPA A;  2CPH A;  4ELT A;  1RHR B;  4RNM A;  1Q79 A;  3NWR A;  1U2F A;  4M5D A;  3ZTR A;  2ASJ A;  1K0V A;  2CQ2 A;  2KVQ E;  3NS6 A;  2BE2 A;  4OJH A;  5DLF A;  2ZBI A;  5K8N A;  2H65 B;  2HBZ B;  2CG4 A;  2CQ1 A;  5CYM A;  4C4W A;  3MPU B;  3NXZ A;  1FEE A;  3DMJ A;  1TU0 B;  1GH8 A;  2FJX A;  2J5A A;  1RAF B;  3KYL A;  2NLW A;  3CF5 Q;  3TAR A;  3QPI A;  1CUL A;  2YKA A;  4HAC B;  2BM1 A;  4PXD A;  4C8M A;  5C2C A;  3NGK A;  1N54 B;  4Z7Y A;  1CSJ A;  4DEZ A;  3MXH P;  2NUH A;  3LH2 S;  4CLF A;  3M6U A;  2FVQ A;  4LBH A;  1WDT A;  2EK1 A;  4MAK A;  5ETN A;  2HFO A;  3M8P B;  5IC6 B;  2VOD A;  2MKY A;  3GJS B;  4LR9 A;  2MKJ A;  2WBM A;  3DOM B;  2V8D A;  2Y1J A;  1IBK J;  3M32 B;  3JYT B;  3I4P A;  3HLU A;  4FS1 A;  1Q81 T;  1C4C A;  1FNO A;  1GTE A;  1YJR A;  1RT5 B;  4AL7 A;  4YB5 A;  1CJT B;  1NSA A;  4DS4 A;  1XR5 A;  3HVT B;  4MK8 A;  3WX8 A;  3BS9 A;  3QFW A;  1W2I A;  4L74 A;  2APO A;  4HH1 A;  1RHQ B;  4Y2I A;  1P1T A;  4ID5 B;  4PG5 A;  4CO4 A;  1V6H A;  5DDR C;  2RVJ A;  3GFH A;  2ZM6 F;  2WB1 D;  2J8A A;  5LM7 E;  1JXL A;  3MR6 A;  1D8Y A;  1QE1 B;  4HLB A;  2KH9 A;  2HHU A;  1C4A A;  4DR7 J;  4CLP A;  2QYC A;  1N48 A;  2D69 A;  4DLE A;  3MAA A;  4OZ0 A;  4WTY A;  3EGW B;  4ZLL A;  2ZH3 A;  1UPM B;  4A8X A;  1KQF B;  2ZUA A;  4MYT A;  4UTG A;  2HIQ A;  3R6L B;  3VHQ A;  2F63 A;  2RUS A;  5EX3 A;  4CO2 A;  1H2U X;  3OXL A;  4HI2 A;  1WHV A;  2PD1 A;  2YQ0 A;  1IUJ A;  1K8A T;  4O0N A;  2V9W A;  3D6T B;  1D09 B;  3UQS A;  4A8K A;  4ATN A;  1J5O B;  3FUY A;  2W1B A;  5FD1 A;  2HRY A;  2Q6C A;  2YWK A;  3LTO A;  4DV6 J;  2OAU A;  4GVL A;  3K5M A;  4DV5 F;  1VC5 A;  2HEK A;  3K5P A;  3ZTO A;  5LJ3 Y;  4YB1 P;  3W3S A;  4G3I A;  4QU6 A;  3ZZ0 A;  3ENW A;  4IG0 A;  5HJY A;  2XNR A;  3K0J A;  1F9E B;  4M5M A;  3Q86 A;  3NY0 A;  1U49 A;  4KHP F;  2OPS B;  3MMC A;  4N5S A;  4B3S F;  2UXC J;  2IIH A;  1HFE L;  1UVL A;  1WC5 A;  4QPX A;  2GML A;  3CXC R;  2VPW B;  3FZB A;  4QR1 A;  4ZVT B;  2WSE C;  3MM6 B;  2M3D A;  5FDL B;  4GMK A;  3ENA A;  2QSF A;  3MPW A;  3GR1 A;  2CWX A;  5AE2 A;  3PW0 A;  1JLC B;  1U25 A;  2HNZ A;  1IN0 A;  4OYO A;  1SJR A;  2V4R A;  2RAQ A;  4OX8 A;  4OV1 A;  4DV0 J;  2FHJ D;  5AXL A;  4RU9 A;  1LWX A;  4YHH F;  1RHU B;  1RGV A;  3GTY X;  4XPE A;  3QT5 A;  3W2W A;  3HSJ A;  1PYO B;  2MLY A;  5HVG A;  4FS2 A;  4XAK A;  5HVH A;  1VQ4 S;  3U7J A;  3H5U A;  4OZ3 A;  4UOG A;  2GZO A;  2F9J A;  1FES A;  3DLB A;  3LQV A;  3NG8 A;  4UUX A;  3RU0 A;  3T5J A;  1YJU A;  1DY3 A;  5CZX A;  3SXL A;  2FLN A;  1HLW A;  1KKH A;  3FSX A;  4GVB B;  2EFG A;  2B51 A;  1FJE B;  3S6E A;  4K0K J;  4UZC A;  2G0I A;  1HD0 A;  2GFF A;  2QSW A;  1GMW D;  3UCU P;  3CC4 S;  5L38 A;  4TQS A;  4F4W A;  2FJD B;  5GMD A;  1KC8 T;  4USK A;  2RUG A;  4Y2A A;  1OY8 A;  4PR6 A;  2C2O B;  3OFE A;  3ZZY A;  3ZZP A;  2Y8Y A;  2JLF A;  2ROP A;  3C15 A;  4E8U A;  1HBM B;  1X7V A;  1SJQ A;  1VFJ A;  3HVR A;  1X4B A;  3I87 A;  4USI A;  4WFY A;  3EUN A;  4YEA A;  1NH7 A;  3TZZ A;  2HQI A;  4G6V B;  1BWE A;  3I6P A;  3W2V B;  3OJU A;  2SXL A;  4Y3C A;  4I6W A;  1WKL A;  2C22 A;  4NCB A;  2CZ4 A;  4UOH A;  2CG8 A;  1YHQ S;  4QIF A;  1CQM A;  3TZW A;  4ZIW A;  1PO6 A;  2HHV A;  2PII A;  2VF3 A;  1CJK A;  1JKH B;  3CJ5 A;  3CWJ A;  4OHY A;  4PUO A;  3JS9 A;  4ECU A;  4QWA A;  2ZHO A;  1Y5N B;  5G0R B;  2KZM A;  1V5I B;  1V5V A;  2ZKU A;  3PEH A;  3LGN A;  4GKK F;  5B0A A;  2NS1 B;  2ZD1 A;  1HR0 J;  4JV5 J;  1B4S A;  2ILY A;  3QSI A;  2ADC A;  1REV B;  2W2N P;  2YVS A;  3KMQ A;  1EQ0 A;  2AIR B;  1KON A;  3FK4 A;  3AD8 C;  2OEL A;  2DNZ A;  1RT2 B;  5B0F A;  8AT1 B;  2CDR B;  2JOQ A;  2W8K A;  3SCK E;  5IT9 Y;  1ICE B;  4M5H A;  5KG4 A;  4MK7 A;  1RHM B;  4QYZ K;  3OL9 A;  2IVY A;  3A3N B;  3H5Y A;  1BQM A;  2R7Q A;  3CDB A;  3N0V A;  2ZBC A;  1RZM A;  3P96 A;  1UJ6 A;  1R7I A;  2MQM A;  3DLE A;  5A2Q Y;  3UNY A;  2RHQ B;  2PO4 A;  4RNN A;  3DM2 A;  1S9E A;  1TZ0 A;  4NMX A;  4LFA F;  2Z2L A;  2P6S A;  4MFB A;  4ZIT A;  2C2D A;  3GPA A;  3MR2 A;  3HO1 A;  1WOO A;  2ZWO A;  4DX6 A;  2HZA A;  2AQ4 A;  4PAA A;  4I2P B;  3FJ2 A;  5HQL A;  1VQP S;  1S72 S;  5DG8 A;  2DPJ A;  1CQN A;  1UVI A;  4IOB A;  2HQ3 A;  4O23 A;  2RF2 B;  4IH6 A;  2G4B A;  3N9U C;  3US5 A;  1H7X A;  1YRT A;  3N01 A;  3NL0 A;  4K4S A;  2IDL A;  2C2Z B;  2O67 A;  2YX7 A;  3BH7 B;  1X4A A;  3CJ8 A;  1JLC A;  3EIC A;  2AGP A;  3E2E A;  2ZM6 J;  5K20 B;  1TR0 A;  1JLB B;  1ZM9 A;  1ARO P;  1IKW B;  2UU9 F;  1QUV A;  2N7C A;  5KFJ A;  4MH8 A;  5KOW A;  3ZNJ 1;  5A8W B;  1LWE B;  5DO2 A;  3LGM A;  1IM4 A;  4ICL B;  2HAI A;  3GG0 A;  2Q2G A;  3IM8 A;  2HVE A;  3PR5 B;  5LMN J;  4KFB B;  2A18 A;  1NSQ A;  2W2M P;  4ENO A;  2AYE A;  2E1P A;  3MM5 A;  3PRV A;  2W4P A;  4RUH A;  4C11 B;  1KRP A;  1DLO B;  2FY8 A;  4PPD A;  4JI4 J;  5FII A;  5KG0 A;  1KFS A;  3I82 A;  3LA0 A;  3CJ0 A;  4DV4 F;  2CYY A;  3UN3 A;  1WOP A;  3JXO A;  2R8K A;  1MMD A;  3MEE A;  2YQ3 A;  3R5G A;  2W7P A;  1M5K C;  4DV1 J;  1RTZ A;  1VC0 A;  1HWJ A;  3QGP A;  1G3O A;  3ITH A;  1RTD A;  2UXD F;  2DKO B;  1RE1 B;  2DIT A;  1NXI A;  3MEG B;  3IG1 A;  3NCR A;  5MLC V;  3EXY A;  4CRJ A;  2E9Z A;  2M8D B;  4DR5 J;  3CNQ P;  4DX5 A;  3LP2 B;  3VAF A;  2RHS B;  4DPX A;  2HFN A;  3J7Y U;  1WF1 A;  3IR5 B;  1VHI A;  2QX0 A;  3BJY A;  3BSA A;  1BE4 A;  3AOC A;  4PQA A;  4O0I A;  4NCA A;  1HNI A;  2AJ4 A;  4NOH A;  3TEH B;  1LW0 B;  1C1B A;  2NYI A;  4HTJ A;  5E7O B;  2MQQ A;  1PJ5 A;  2OPQ B;  3PG9 A;  3QBC A;  3C66 A;  3NGS A;  3A8E A;  2GO8 A;  3D4J A;  1S1X A;  4QOT A;  5KFE A;  2R4F A;  2I5J A;  2KXN B;  1WG5 A;  1IBK F;  1CJT A;  3ULH A;  4A8F A;  3JQK A;  3H4D A;  3W1Y C;  2QA2 A;  4ZLP A;  4M5D B;  4QW8 A;  3EM1 A;  2E5L F;  4OL8 A;  3J7Z 5;  1TL7 B;  2VQE F;  1FDN A;  3SCI E;  3L95 X;  3AD9 C;  3C6E C;  4PZV A;  4HEA 9;  4KHR A;  1C2P A;  3PHT A;  1NPR A;  1UWB A;  4EYH B;  1W2B R;  3AOD A;  2F4V J;  2CQH A;  3DLG A;  2Q1L A;  5HO4 A;  2ZUG A;  1XEZ A;  2KT3 A;  1FJG J;  2DY9 A;  1HQE B;  1ELO A;  3EVM A;  4WU3 A;  3W7B A;  3ZO7 A;  3W9H A;  3K5L A;  1N34 F;  2IBO A;  2KDO A;  2V8P A;  3T19 A;  3BSN A;  2P9E A;  4FKY A;  3M8P A;  3PW2 A;  3TUI C;  4OI2 A;  4UOC A;  4DZ6 A;  3BGF A;  4WZQ A;  4I2Q A;  4PPZ A;  2MKS A;  4ED1 A;  5D4N A;  2OTL S;  1JLG B;  1KR4 A;  1YJT A;  1LW2 A;  4O44 B;  3GIK A;  4ZVG A;  2IYI A;  2D41 A;  3GCX P;  3FVY A;  1GAO A;  1F5B A;  2CVE A;  3M2R A;  5LL6 d;  1NND A;  2YX1 A;  2KL8 A;  1JXV A;  1UVM A;  2XSJ B;  4S0M A;  4J9M A;  1XNQ J;  1FKP A;  2DNK A;  2NXC A;  1WOR A;  4HHH A;  3VWS A;  4IRD A;  1BD6 A;  2XLI A;  4OYP A;  1A7G E;  2D74 B;  2QA1 A;  2V68 A;  3BB5 A;  3AOB A;  1YVF A;  3DXS X;  3GYX B;  4M5I A;  3RJM B;  1DRZ A;  4LRB A;  2CPE A;  2QC3 A;  2QMX A;  2DGS A;  1HL6 A;  1IXK A;  4EO8 A;  3D1H A;  1ZAW A;  2R7R A;  2LKZ A;  2VV5 A;  2XSF A;  1YDL A;  4NZ7 A;  4QPT A;  1U0S A;  4LSL B;  1RAA B;  4DL5 A;  1CPZ A;  4A8W A;  2CPY A;  4GKJ J;  3DDI A;  4IO9 Q;  1YQH A;  2X3G A;  3J7A 1;  2ZOM A;  3CC2 S;  3TO8 A;  4RNF A;  5I42 B;  2YNG A;  5D3G A;  2XC9 A;  3KLF B;  4DV1 F;  2NCK L;  1FCA A;  3JTN A;  3FC9 A;  1TFY A;  1H72 C;  3MUR P;  3I38 A;  1N8R T;  2J6U A;  5D0E A;  4K5S A;  2WVC A;  3OL8 A;  4A8S A;  1VRQ C;  2PDA A;  3EGN A;  4DLG A;  3CT9 A;  4OYW A;  1L3K A;  2OPS A;  3MMC B;  1T9X A;  4R0E A;  4WXW A;  2H4Y B;  2HUR A;  3OL6 A;  4JI0 J;  1IKY B;  1NPP A;  3MD3 A;  1XMB A;  2ZC3 A;  3LP2 A;  4EEY A;  4Q0B A;  3FSY A;  2NUU G;  4RW8 A;  4M8L A;  4NA2 A;  1P9Y A;  4NWB A;  3PO4 A;  2KHD A;  5IM0 B;  1RA7 A;  4PG8 A;  1RJJ A;  4NEZ A;  4NXN F;  4HTI A;  3GLJ A;  3Q8Y A;  3MD1 A;  5HBM B;  4Q44 A;  1X5O A;  1XMQ F;  3DOL A;  5J2M B;  3EX7 B;  4KHM A;  1HNX F;  4CM2 A;  1G6B A;  1XIQ A;  2IM0 A;  4LFB J;  1NCL A;  1APS A;  2VL1 A;  2LLZ A;  4DR2 J;  4F2S A;  4LF5 F;  2BOA A;  3AD7 C;  2UVV A;  2HWH A;  1JKH A;  1R8C A;  4NAS A;  3KWM A;  5AE1 A;  2V2Q A;  4JYA F;  2RSQ A;  2AJF E;  5KFN A;  2BAB A;  3R5B A;  3IAM 9;  4KE5 A;  2HHH J;  2BE9 B;  2U2F A;  2DIV A;  1Y10 A;  1UFW A;  4DFP A;  1EX8 A;  3MEC A;  3IN5 A;  1FK9 B;  5JXS A;  2ERR A;  2VH7 A;  3K7R A;  1F2H A;  2GGP B;  3ISN D;  1RWX B;  2YKN B;  2ACM A;  4QQB A;  2QLB B;  2VC1 A;  4GVB A;  2GCF A;  4NLU A;  1WDD A;  2M0G B;  3JAM U;  4I0W A;  1RBL A;  4CWB A;  2V8H A;  4JI0 F;  2LDY A;  2UVU A;  4XTT A;  1NLT A;  3EE3 A;  4XK8 C;  3BGU A;  4BS2 A;  2C3O A;  3C15 B;  3AT1 B;  5E3P A;  5GAD U;  4YR0 A;  3EZ5 A;  2ZH8 A;  4LF4 F;  2E1C A;  3T1H F;  1UVN A;  4I2Q B;  4PYD A;  1KNZ A;  4LBI A;  1A9N B;  1L5U A;  2M70 A;  2CJ9 A;  4FBU A;  4QR2 A;  3OUY A;  2JEG A;  2JSX A;  3L7O A;  4JBC A;  1FX4 A;  4KKO A;  2AGQ A;  1OQ3 A;  4O4G B;  2JL9 A;  2ZNY A;  1SJ4 P;  1N6Q B;  2WSC C;  3MMA A;  4FYY B;  4BWJ A;  3UDL A;  1FKO B;  1Z2Z A;  2A3J A;  3KNG A;  3UR3 C;  3W63 A;  2J9D A;  2R8G A;  2X3D A;  3D68 A;  1VDH A;  1YSJ A;  1FNX H;  1NEE A;  4WYW A;  3DDN A;  1D9F A;  5DS7 A;  1VOM A;  3O6Q A;  5DQH A;  2Y9H A;  3W60 A;  3VGU A;  6FDR A;  1S0O A;  4IOA Q;  1FWK A;  3U02 A;  2ATL A;  1R6Y A;  4RWW A;  5KFA A;  3OXF A;  3SDE A;  5H9E J;  3G87 A;  2WRM A;  4CLT A;  2DIU A;  1IKW A;  1LWC A;  1NM2 A;  2UUT A;  3SQO P;  3HZE A;  5EUH A;  1NKC A;  3I0S B;  4OX6 A;  1HHQ A;  4LSZ B;  3TW0 A;  2LEB A;  1GXT A;  1HNV A;  1WF0 A;  3RRG A;  1XNR J;  1S76 D;  2LXU A;  2EW9 A;  2VOP A;  3NWG A;  3G71 S;  1AT1 B;  1NDK A;  1HNW J;  1B7F A;  5T14 A;  2QLF B;  1JLE B;  2DRD A;  1RLC L;  4TN2 A;  3J81 Y;  1NJZ A;  4DV2 F;  2CPF A;  4C8Y A;  2GHP A;  4DZD A;  1MW7 A;  1KHW A;  1TKT B;  1KP6 A;  1JXE A;  2B8P A;  2L48 A;  2WVF A;  4TLR A;  4C11 A;  4CI0 B;  4IG3 B;  2R2S A;  3Q0A A;  3WHI A;  2W4C A;  3M8Q B;  2J76 E;  2C2K B;  4L3N A;  1WUU A;  3MPV A;  2L3M A;  4I2P A;  1RHK B;  1R31 A;  3H5S A;  5EWE A;  2XY6 A;  1NK9 A;  5KG7 A;  3HJF A;  4DPO A;  1S6P B;  4ZPD A;  3S01 A;  5L1J A;  3KJN B;  1WC4 A;  3PW7 A;  1CJU A;  3BGR A;  4N77 A;  1XAO A;  2E5H A;  3Q83 A;  3JSB A;  1VQO S;  1XNQ F;  3MR3 A;  2HMI B;  1RQ0 A;  4OFZ A;  1Y3J A;  1JLB A;  5D77 A;  3CCW A;  2QV6 A;  2HND A;  3P49 B;  2EBG A;  4J9L A;  5A8W A;  4AFF A;  4AD6 A;  2IC3 B;  2EG2 A;  2Y3Y A;  2P5V A;  1NHK L;  2HSE B;  3BGL A;  3BR9 A;  1RT6 A;  3I5A A;  3QIP B;  5GAG U;  2OMO A;  1QTN B;  5C42 B;  3AA9 A;  3R5A A;  4X4P A;  5IT4 A;  3LGH A;  4KO0 B;  4UQG A;  1BUX A;  2LYV A;  4DV3 F;  1SXL A;  7AT1 B;  1RLD A;  2AT1 B;  5B0C A;  5M2P A;  2HVZ A;  1TV6 B;  2AGO A;  1J5E J;  2WHO A;  2YKM B;  2QJ3 A;  4P2M A;  1PIE A;  5J2P A;  1SC4 B;  2FZC B;  2CPI A;  2ZDP A;  3CJT A;  4LRD A;  3AOA A;  1YRX A;  2HLU A;  4P7T A;  5T41 A;  1DLO A;  1X5S A;  1YWX A;  3WIU A;  1WJ9 A;  2XMA A;  2MGZ A;  3AQP A;  4P71 A;  3U1L A;  5A2Q U;  4MYU A;  3HKZ D;  4A8Q A;  2ZJQ Q;  3V81 A;  3C6U B;  2AYB A;  4WIQ A;  1S4F A;  2OPP A;  2IJF A;  4C8O A;  3BQ1 A;  4MIW A;  1S0N A;  2GVZ A;  9RUB A;  3AFG A;  5C25 B;  3NRB A;  3MMB A;  5HMX A;  3BSC A;  5B09 A;  1RA6 A;  1PAU B;  3V4I B;  1ZTT A;  4HT5 A;  4IOC Q;  1SKW A;  1RT7 B;  4FPI A;  2MKH A;  1VQ8 S;  2W9B A;  2L41 A;  2CA9 A;  2R2R A;  3O3L A;  2JRR A;  2MST A;  4K4W A;  1ACM B;  1P6T A;  1RIS A;  1S6U A;  2XY5 A;  3SV3 A;  3C3L A;  2BDP A;  1RWO B;  3KJV A;  3MMA B;  4KSE B;  5GAE I;  4RZR A;  1FKO A;  4MK9 A;  3RGI A;  2VQE J;  3M1V B;  5HAT A;  4IH5 A;  3MUV P;  2VZ9 A;  4AUK A;  4KR0 B;  1RT1 B;  5CCM A;  1ZM2 A;  1MWQ A;  1WC6 A;  3R6G B;  1RYS A;  3CC7 S;  3GFY A;  4W90 B;  5AXM A;  3DOK A;  2H4W B;  1OQ6 A;  1EHW A;  4C0H A;  3BGO P;  5LOQ A;  5KG1 A;  1YTY A;  5LT5 A;  2MJU A;  2BA9 A;  3FSI A;  3KJQ B;  3OVS A;  4DHV A;  4NLV A;  9ATC B;  1T3N A;  1XMO F;  3D66 A;  1LWC B;  2OFH X;  4LF1 A;  1FD2 A;  1OIA A;  2GS8 A;  4WFN Q;  3ZTS A;  4X64 F;  3OVB A;  2BJ3 A;  2Y0B B;  4I1T A;  4N41 A;  4DQS A;  3JB9 k;  2D3O 1;  3HX9 A;  3FGV A;  3M2U B;  4LT6 A;  3O1L A;  5HQM A;  4RKU C;  2J0W A;  3OV7 A;  3BO2 A;  1DFD A;  3DLJ A;  2W25 A;  3GYG A;  4BCA A;  2HGM A;  2ZZT A;  7FD1 A;  4DUY J;  1JMT A;  4ZP9 A;  1U1Q A;  1FVS A;  3TVK A;  3ETO A;  2OPR B;  4DU8 A;  2GX8 A;  2BAN B;  2ZWP A;  1WHY A;  1KSP A;  1XNR F;  2RML A;  4YR3 A;  2E9R X;  1I6J A;  1HD1 A;  1S12 A;  2NR0 A;  4I4B A;  3AGY A;  1S6Q B;  5CH7 B;  5KFH A;  1Y9O A;  2YKP A;  2C2E A;  4DF8 A;  2LQJ A;  3VTI A;  3RTV A;  4QWC A;  4B9L A;  1UW4 A;  1RAE B;  4OYZ A;  2VDI A;  4C9D A;  3V4M A;  3TRG A;  2F8H A;  4P9S A;  2EC0 A;  3H98 A;  3R5J B;  2P6T A;  1SUQ B;  5HI7 A;  3H90 A;  5E41 A;  4B9T A;  4LF9 J;  5KFV A;  4CCH A;  5GMK a;  2CJY B;  1NJY A;  2RU9 A;  4QWD A;  2NSB A;  4F04 B;  1YZ7 A;  3CD5 A;  5AXK A;  4B08 A;  1QVF R;  4K50 A;  1RAI B;  2B9E A;  2XLJ A;  1RT6 B;  2HPU A;  2C42 A;  1TL3 A;  5CAB A;  1FWP A;  4CLK A;  1J2V A;  2COL A;  4O3S A;  3H2U B;  4DQI A;  2E29 A;  2M2B A;  2PMZ D;  2Y1R I;  4ECR A;  3T3F A;  4EU0 A;  2H5E A;  3GIJ A;  3E01 B;  3NAH A;  4ZVE A;  2DHA A;  2H3E B;  2I38 A;  2ZH6 A;  4DR1 J;  3BPS P;  4QW9 A;  5HP1 A;  1AW0 A;  3TVY A;  2MGZ B;  4DL4 A;  2JVO A;  3RAQ A;  2AEF A;  2UUA J;  3TUZ C;  1LXJ A;  3LF0 A;  3PXG a;  3SSQ A;  3PKY A;  1S99 A;  1HHS A;  4PCQ A;  2ZJR Q;  3IBC B;  4A47 A;  4C8K A;  1U8W A;  2AJ0 A;  5F9L A;  2QLJ B;  2K1R B;  2OUG A;  2HBR B;  2VFT A;  4ZPT R;  2DO0 A;  3LP0 B;  3FCW A;  2MSS A;  3J7Y I;  4X62 J;  1AA1 B;  4Q8E A;  2FHM A;  4DBQ A;  4B9N A;  4B9U A;  5C24 B;  2E1R A;  1X9M A;  4K7Q A;  2ALY B;  2FPH X;  1VR6 A;  2UVR A;  2Z4P A;  4P73 A;  5IM0 A;  3CIM A;  1Q53 A;  4X4Q A;  3LWL A;  1WEX A;  4LF5 J;  3UDE A;  1SC3 B;  4JI6 J;  3M1V A;  3AXM A;  1GTH A;  1IWG A;  3VZI A;  2YKO A;  1UZD A;  1DAR A;  1MU2 A;  2CQ4 A;  3CJ2 A;  3CCR S;  2H51 B;  3HHN B;  1WSR A;  4O4G A;  3M9N B;  3EYZ A;  1BWV A;  2ILZ A;  1FWL A;  4Z2X A;  2OSQ A;  2FC8 A;  5A6W A;  2DK2 A;  1VJQ A;  2CJQ A;  4ZA1 A;  3T5K A;  2AJ2 A;  2GV1 A;  2W9A A;  1VQ9 S;  5KTQ A;  3TQE A;  4FF1 A;  2HK3 A;  3M8Y A;  4ZOS A;  4NLQ A;  1XN9 A;  4PXE A;  3K58 A;  1QDU B;  2RQK A;  2W2O P;  3DGP A;  4TYB A;  1VK8 A;  1EKR A;  3BDE A;  2DR9 A;  4B3M F;  1C0T A;  2R8I A;  2OJ3 A;  2CXE A;  2IPO B;  4XDC A;  5CAA A;  1JLF A;  1WOS A;  1UA0 A;  1TK5 A;  5F8J A;  4Y65 A;  3OJS A;  1NO8 A;  1BXN A;  1XBW A;  2UXC F;  4K2J A;  3BO4 A;  4A8Y A;  3AQO A;  3QJJ A;  3I0S A;  1WKK A;  2OPR A;  4USV A;  4TU9 A;  2QYG A;  3NMR A;  3TJ8 A;  1FFG B;  1K44 A;  2XG8 A;  4FKX A;  1RKI A;  3CJK B;  2AMC B;  2BV3 A;  3NGD A;  4GO7 X;  2WVE A;  1RT4 A;  2G2Y A;  4NZ6 A;  4WBF A;  4JI5 J;  1Q78 A;  1T9W A;  5HAO A;  4ZVO B;  5K14 B;  1UZH A;  3RYL A;  5A8K A;  1C0U B;  2MEW A;  4J9U E;  1WTF A;  2JC1 A;  3UFC X;  2YNF B;  4J9Q A;  4M94 A;  3POT B;  1J5E F;  5BYR A;  1UFL A;  3AHP A;  3M8Q A;  3UI3 A;  4NML A;  3CDA A;  4DN9 A;  1TK0 A;  2VON A;  1AYE A;  3PYF A;  2MB0 B;  3DYA A;  4KC5 A;  3WBZ A;  2KFZ A;  1S1T A;  4YP3 A;  2V9K A;  1X0F A;  4N76 A;  2UZA A;  3V6H A;  5K8O A;  2V0N A;  4FXD A;  1EP4 A;  2HFU A;  4LQ9 A;  1JJC B;  3VAK A;  2HVD A;  5IT9 U;  3UNG C;  4CLW A;  2OEJ A;  3B8H A;  3UDV A;  3FEZ A;  1PC4 A;  2RH3 A;  1TUV A;  3W5Z A;  4QYR A;  1VLY A;  5ETQ A;  3LPY A;  3UCG A;  2ZC4 A;  2UUC J;  1S7I A;  3SZ2 A;  3A8K A;  4F0M A;  1SL0 A;  2RRN A;  1SB6 A;  1RAC B;  1KLM B;  3NBP A;  3V81 B;  5B0B A;  4YB7 A;  1CLF A;  4B3R F;  4F4X A;  4ZHR A;  4OZ1 A;  2LVW A;  2A2C A;  5L1I A;  2MY8 A;  5BR8 J;  3HDS A;  1HAR A;  3M7V A;  5HVF A;  1U1R A;  1N32 F;  2C3Y A;  1PYT A;  2C2N A;  5F0U A;  4WKR A;  2HHW A;  1C3G A;  1UVJ A;  1H3D A;  4N56 A;  1RBO B;  2DH8 A;  2DXE A;  4OHZ A;  3I31 A;  3OD2 A;  4OZL A;  5IQ6 A;  2JFK A;  5DJB A;  4YHH J;  1S6P A;  4ED6 A;  1XC9 A;  4ZVH A;  3MMB B;  3I55 S;  3IWX A;  2DNP A;  2WOM A;  3OXG A;  2UXB J;  1RWM B;  2MQL A;  3HF5 A;  3TAM B;  2QIF A;  2AF6 A;  4B17 A;  2J7W A;  2BQR A;  1EKS A;  1Z1Z A;  2LEC A;  4DR1 F;  2B9X A;  3THP A;  2MQO A;  3AA8 A;  2DR5 A;  4FYV B;  4DR6 F;  2QL9 B;  3HI9 A;  3FDS A;  4OZN A;  5KG6 A;  3KJV B;  3KHL A;  4DR6 J;  4OJ3 A;  3TZX A;  3KLE B;  1SH3 A;  2HQC A;  3MEK A;  2QT7 A;  3OTB A;  1FDA A;  3HFV A;  3MOJ B;  1TL5 A;  2KJV A;  3RUB L;  2ASD A;  1UWA A;  2QL7 B;  2IM2 A;  4FXW A;  1KVK A;  4USJ C;  3JQM A;  4OHX A;  4C3M A;  3UCZ P;  3D5M A;  2OD4 A;  3OR2 B;  3KHG A;  4PRF A;  1NDP A;  4YOE A;  2IVF B;  4DSL A;  4DL3 A;  1IBL J;  2VBZ A;  2B4O A;  1AUS L;  1BQM B;  3M05 A;  4P7V A;  4Q7A A;  2F9D A;  2CQ3 A;  4ZVP B;  5IV3 A;  1IBC B;  1H2V Z;  1RT2 A;  4HDH A;  4IDK B;  5KAK A;  1RK8 A;  4Y0F A;  2W9C A;  4FN5 A;  2YY3 A;  3DLH A;  4LF8 F;  1RSC A;  1BLU A;  1WEY A;  4PXC A;  1YJ9 S;  2OIH A;  4ES1 A;  4JI3 J;  1LXN A;  2BM0 A;  2DH7 A;  3B4D A;  1AUD A;  3VAI A;  5FLX U;  3HPO A;  5DGA A;  1RWW B;  1NUE A;  2QE5 A;  3E51 A;  1DTQ B;  4X65 F;  2V4J B;  4J7C A;  2I0X A;  2DHH A;  2L9N A;  2Z8Q A;  3M9O B;  1RAJ A;  2RQ4 A;  5IQQ A;  1M5H A;  3KHH A;  4WII A;  3S8S A;  4LRF A;  3A3O B;  3POT A;  3PX0 A;  2VIC A;  2YWF A;  1I51 B;  4IH7 A;  1FNM A;  3RB3 A;  2CQC A;  4AL5 A;  1QD1 A;  1Q82 T;  4Y2M A;  2ZFH A;  1S1T B;  4LF9 F;  1WAC A;  2Q66 A;  1R27 B;  3U1N A;  1NZ8 A;  1IKV A;  1UMJ A;  1HMV B;  2M5Y A;  3KJF B;  4H4K A;  4LSN A;  3RZA A;  2BJ8 A;  2HHP A;  4FVM A;  4YQW A;  1HI8 A;  1RAG B;  2HQD A;  3D1Q A;  3MCO A;  3NCP A;  2GQ2 A;  4G1P A;  4RWX A;  2E5J A;  1DZ5 A;  2A2D A;  3EZO A;  5DZ6 A;  1XTZ A;  4MJK A;  1U09 A;  5EX0 A;  3CPW R;  1PJ7 A;  4J9R A;  1QSY A;  2XMJ A;  2XTJ P;  3HFK A;  2DRB A;  2YNI B;  3M6W A;  1VQ7 S;  1S1U B;  1S5Z A;  4H4O A;  5CQG A;  4DU7 A;  3PJ9 A;  3KLG A;  4KH0 B;  2AYM A;  4OYI A;  4F26 A;  2WSF C;  2EVZ A;  1SQG A;  3ICL A;  3IMQ J;  4X4O A;  4X4S A;  1LWF A;  3ENQ A;  3C19 A;  2J9E A;  2JLG A;  4OI6 A;  2V67 A;  3PV8 A;  5DM7 Q;  4O4R A;  2EPI A;  3C16 B;  1FVQ A;  1J5O A;  2E7X A;  3MEG A;  2QLX A;  3CVK A;  1QY7 A;  4NLR A;  3UWT A;  5AT1 B;  4ECS A;  1MSW D;  1S59 A;  1WHW A;  3D28 A;  5HRO B;  3MEE B;  2F65 A;  1K9M T;  3B82 A;  4ZN3 A;  4ZVS B;  3MPD A;  2KG1 A;  1DHM A;  4QIW D;  4BLG A;  4OI3 A;  1RDR A;  1YZ6 A;  2MKC A;  2WW8 A;  4UST A;  1YIT S;  4ZCM A;  1L3T A;  1U4B A;  2FLP A;  1T9V A;  2IVM A;  3LZ8 A;  2XS7 A;  3BPD A;  4KIA A;  4RNH A;  4URG A;  5EGY A;  1ZAV A;  3GFX A;  2NZC A;  5C24 A;  3MM6 A;  5CYJ A;  3MFI A;  1OO0 B;  3SBM A;  5C2G A;  2OHD A;  1HWI A;  2HFZ A;  3PW5 A;  3RW6 A;  5ETO A;  3HJV A;  4JP8 A;  1P1L A;  2E44 A;  2VUG A;  5D0H A;  3OLA A;  4DUZ F;  2WTF A;  4DL2 A;  2ODX A;  5CA5 A;  3Q8S B;  2OD6 A;  2ZE2 B;  1HWK A;  4UOF A;  2ACY A;  1M90 T;  1IR0 A;  4KBI A;  1VLO A;  1R0C B;  4I6Y A;  4RPF A;  5HJX A;  4DSF A;  3PR4 A;  1R8A A;  3AAW B;  3GZ7 A;  2MZJ A;  4A8M P;  3BH6 B;  1U8S A;  2LXI A;  5HP1 B;  5JJB A;  2ABY A;  1FRH A;  4TY9 A;  1WG1 A;  3Q24 A;  2DPI A;  1Y11 A;  1UEK A;  3R27 A;  3GYN A;  5IZH A;  3U1M A;  2RQC A;  2FVC A;  4X62 F;  4IDK A;  2PA8 D;  4EBE A;  3R1H A;  1RTJ B;  1N56 A;  2FVP A;  4WWS A;  3KKF A;  1OSC A;  3H0P A;  1XWL A;  4EWT A;  2K7J A;  2DVI A;  1GMU A;  1S9G A;  5IS2 A;  1RTI A;  2VG7 B;  2VPZ B;  4OLP A;  4PAB A;  5KFF A;  2XNQ A;  4WXO A;  1BQN B;  3KG1 A;  3Q8V A;  1WI6 A;  5KG2 A;  4K8R A;  3CE8 A;  1NH8 A;  3FMB A;  5ETV A;  1FFS B;  3VR1 A;  4NXM J;  4DV3 J;  3VAH A;  3UD4 P;  4JI3 F;  2FHO B;  1RU1 A;  4Y2C A;  4DPT A;  2AHO B;  4QR0 A;  1HWU A;  2MJN A;  2OEM A;  2MQ8 A;  4DR7 F;  3KG4 A;  5BJR A;  1FXR A;  4LRC A;  3DI6 A;  5HLF A;  4NX9 A;  5H9F K;  3IC1 A;  5F3T A;  2VOO A;  3VAJ A;  1QAJ A;  3N4W A;  1FTC A;  1Q8I A;  1YG0 A;  3MWB A;  4NA3 A;  1T05 B;  3GJQ B;  2XMU A;  4J80 A;  4ZVF A;  3CW2 C;  2YWH A;  1NK5 A;  1U45 A;  4PUO B;  1HA1 A;  3CJS A;  4Y34 A;  5G0R A;  5HMY A;  3IGV A;  2J0S D;  2XSJ A;  1AFJ A;  2N4C A;  3P5B P;  3V6J A;  3DYA B;  5LSL A;  3TJA A;  2JFD A;  3FEY B;  1U24 A;  2UUW A;  1DQ9 A;  1Q86 T;  4Y00 A;  4QU7 A;  3D9B A;  4RW6 B;  2GMJ A;  4YFU A;  1HBU B;  3MAH A;  2DNL A;  4AL6 A;  5CXT A;  2XB2 D;  4RX6 A;  3IA0 A;  1S4E A;  4RJV A;  4ZN1 A;  2ZH1 A;  3PVX A;  2EK6 A;  4NXN J;  1XK8 A;  4G1Q A;  3RW7 A;  2KZZ A;  4IFY B;  2V34 A;  5D3G B;  1Q8L A;  3G8Q A;  3MM8 A;  5CYM B;  5LXR A;  3PX6 A;  1NDL A;  5KG3 A;  2RS2 A;  2XHC A;  5D8H B;  3GSD A;  2R2T A;  3QAT A;  3RRK A;  1Q5V A;  2XMK A;  1U6Z A;  2YNG B;  3I5C A;  3L4B C;  4I7F A;  1TMJ A;  2L9D A;  2RDD A;  4CLZ A;  3IS9 B;  1S7H A;  5A8R B;  2DNQ A;  1JLA A;  3FFI B;  2R7U A;  2DHS A;  3BYP A;  4MFB B;  4CT8 A;  1MN7 A;  4IRC A;  3WC0 A;  2XQC A;  1Y3K A;  3N28 A;  1W7W A;  2ASL A;  2W7O A;  1TKZ B;  2IRY A;  3EWG A;  2P9G A;  1XMO J;  4JYA J;  3DOM A;  2BRL A;  1IKY A;  4HHU A;  1KHV A;  3HHL C;  2WB4 A;  4RW8 B;  2RDI A;  3QID A;  1RUS A;  4JI7 J;  2N4D A;  5J1E B;  1NKE A;  4WFX A;  3KDO A;  3EPG A;  2E5I A;  1VQM S;  2PFD A;  1S6O A;  1T02 A;  2MDA A;  3M8W A;  3MM9 A;  1D1U A;  4ECT A;  3JSR A;  2X1A A;  4LVO P;  1Q4R A;  3CDU A;  2J0Q D;  3RAM A;  4Q43 A;  2GGP A;  3CIZ A;  2YKN A;  1EJ7 L;  1NK4 A;  3J81 U;  5DZ7 A;  3W61 A;  1NPK A;  3G6X A;  2IRX A;  3OT9 A;  1E6V A;  2HW3 A;  1PYS B;  1RTJ A;  1X4D A;  2O66 A;  4KGK A;  3CME S;  4NZ0 A;  1NJW A;  3RBE A;  1G4C A;  1VQN S;  2CKW A;  2DGV A;  2FJV A;  4RU2 A;  1ZH5 A;  3RBD A;  2QFJ A;  2HS3 A;  4K4U A;  3FMW A;  3H42 A;  4LRA A;  1VQS A;  2DNM A;  1OS5 A;  4ZPC A;  3CMA S;  3T5L A;  2D3Z A;  1S1W B;  2EKY A;  1S97 A;  4LUB A;  2F4F A;  4EZ9 A;  1Q0N A;  4UQT A;  2YH0 A;  1N4L A;  1RTD B;  2DT9 A;  4DL0 C;  3PCO B;  3TAM A;  3D0H E;  3M8S A;  3H2L A;  3LAN A;  1VS3 A;  4U9R A;  3SQG A;  4ECY A;  5HLF B;  1EET A;  2J9D E;  3AB4 B;  5IFM A;  1VRU A;  1PGZ A;  1KLN A;  1YJ7 A;  2IAJ A;  3K8V A;  4RW9 B;  1HNI B;  2I1R A;  2VFS A;  5I3P A;  3GIM A;  1IVZ A;  4F4Z A;  2KHC A;  3ETM A;  2HKE A;  3KLE A;  4Q8F A;  2CQB A;  4XDD A;  3M8R A;  4LFC J;  4CLL A;  5F0W A;  1YKW A;  2BXJ A;  2E1A A;  4AXJ A;  4IQM A;  3ZZR A;  4MKB A;  3TA2 A;  5KFW A;  2HFV A;  3DRP B;  1VRT A;  3H40 A;  2CNL B;  2IJR A;  2IRU A;  1X4H A;  1SPB P;  1HNV B;  2FVR A;  2CQP A;  2ZBQ A;  1TL7 A;  2FZG B;  3P5T L;  5LMU F;  2XZT B;  1RKJ A;  1F0X A;  2PSZ A;  4ALZ A;  4M5L A;  2WBR A;  2EFQ A;  1SVD A;  2AV5 A;  4KHP J;  3K89 A;  3BYR A;  4MIA A;  4URQ U;  3MM7 B;  3SIP B;  1S1U A;  4H4O B;  3BZQ A;  3DRS A;  5K9F A;  3W5Y A;  1ZBT A;  4ANC A;  2K8G A;  3NCQ A;  4ZK7 M;  3PO5 A;  3MMJ A;  3SV4 A;  2WZ1 A;  3MED B;  2CZV C;  4P72 A;  5KFT A;  1Y00 A;  4NYP A;  3TUJ C;  4DV5 J;  2W2Q P;  4O3P A;  2WON B;  2BZ2 A;  4NCG A;  5ETT A;  1YX2 A;  5K5M A;  5DG9 A;  3UN5 A;  3R2D J;  4K0K F;  1EAR A;  1YBT A;  1VK3 A;  1REG X;  3BKT A;  2IFX A;  3DRR A;  4OZJ A;  3R9L A;  3BGR B;  2W4D A;  3CTR A;  2BBE A;  2HGN A;  4X2B A;  4O44 A;  2VA3 A;  2Z2Y B;  2CJA A;  4RL1 A;  4ZP7 A;  3RB6 A;  4DG1 B;  2RIJ A;  5JMN A;  2FDN A;  1S1V B;  4A46 A;  1ZYQ A;  2NQP A;  5CD4 H;  4I56 A;  5H9E K;  3MI7 X;  1UFK A;  2NXE A;  1FKP B;  1SQF A;  1HPZ A;  2MYF A;  3HVW A;  4CTA B;  2MXY A;  1U7L A;  1KOH A;  2CQG A;  1FRI A;  2HND B;  4L72 B;  3KK1 A;  4OJG A;  1H2T Z;  2CWK A;  4BDP A;  2ZD1 B;  2KFN A;  3QIP A;  3MDF A;  4CO5 A;  2LQ8 A;  3ISZ A;  3KLG B;  2PMW A;  3VF0 B;  1D0E A;  2E7W A;  2VFU A;  3RR7 A;  1E6V B;  3I0R A;  4N7T A;  4DN0 A;  3GQC A;  3D2W A;  1K73 T;  1DBD A;  2OPP B;  5F9N A;  4OQJ A;  3DMJ B;  4CNY A;  4FXV A;  4C48 A;  4XPC A;  1NB2 A;  2M7S A;  2FIU A;  2U1A A;  4C8Z A;  1CUL B;  3JTO A;  2BE2 B;  2FYX A;  2LEP A;  3AXK A;  3OFG A;  5KFX A;  3KLF A;  2UXD J;  3SI8 A;  3C6U A;  2M88 A;  4WP3 A;  2X1B A;  2KRB A;  4FDF A;  4ZPV R;  4NI2 B;  4CNZ A;  1HKA A;  4F3M A;  2GVZ B;  3FNN A;  2B8Q A;  3G86 A;  2E1M C;  4DR3 F;  4PG6 A;  2HQG A;  3C2P A;  1JQG A;  1M1G A;  5KT3 A;  4G65 A;  3DC2 A;  1P27 B;  2G2O A;  2OTJ S;  1JNZ B;  2D3U A;  2KU7 A;  3M32 A;  4DOZ A;  3Q8R B;  2XO6 A;  3JYT A;  4Q0B B;  2DCU B;  2VQF J;  2CAJ A;  3CGI A;  5IWA J;  3KG0 A;  2C2M B;  4OI0 A;  4KAI A;  3CUN A;  2RF2 A;  4X64 J;  5L46 A;  1ZS6 A;  3GV7 B;  1WKJ A;  3A1Y G;  1FER A;  2BJ7 A;  2LA4 A;  1SKU B;  5KFI A;  2FJW A;  2ZE2 A;  3DI6 B;  2N82 B;  4NLO A;  4ZJL A;  4M95 A;  4UY8 T;  1W25 A;  2CRL A;  2VFV A;  4HL9 A;  1OWX A;  4RUA A;  1L3V A;  2R7X A;  3R1L A;  5KFL A;  1GFW B;  1LOU A;  4NYZ A;  2H5J B;  2V8G A;  4M1K A;  4DUT A;  1VRT B;  1RAD B;  3IR7 B;  4F4Y A;  2ZZM A;  2AW0 A;  3IR6 B;  1T03 B;  3ZZO A;  1IJE B;  4YY3 J;  2RD5 C;  2VBX A;  2K7K A;  3HD2 A;  2BUN A;  3M2U A;  4C7Q A;  2MLX A;  1OYE A;  3O2I A;  3MEC B;  4FYW B;  4LR8 A;  4RW7 A;  3PIO Q;  2Z57 B;  2R7W A;  1QE1 A;  5B0G A;  4A8O A;  1KS2 A;  1NHU A;  1N0V C;  1HBU A;  3QYY A;  2XMW A;  3A12 A;  3PJW A;  1F1B B;  3NGR A;  3DU6 A;  5ETL A;  5ETR A;  1LNQ A;  3A8I A;  3OW2 R;  3EGZ A;  2PI4 A;  2DRA A;  4CDI A;  1IKX A;  2LP4 A;  2GVD A;  2VBW A;  1MRO B;  4TU7 A;  1DUR A;  2ZH9 A;  3J7A N;  4PQU B;  3DLK B;  4X4R A;  4KGM A;  1TKD A;  2E5G A;  4QWB A;  4HYK A;  4TNO A;  4Q45 A;  3G8T A;  5FJ4 A;  4V19 X;  1U6F A;  3CJR A;  4ZP8 A;  2AJQ A;  2VKR A;  3UN2 A;  5M2U A;  2A0F B;  4I7F B;  5A8R A;  4UZB A;  1RCX B;  3PYG A;  1NKB A;  8ATC B;  4J9S A;  2KTQ A;  1T9T A;  2DNG A;  4DG1 A;  2Z56 B;  3F56 A;  4OZ5 A;  5EWF A;  5GVQ A;  3OLB A;  1M5P C;  5EHH A;  2YH1 A;  1CBK A;  1CS4 B;  1N5Y A;  3EDQ B;  1HNX J;  4LFB F;  3JSM B;  1NME B;  2V63 A;  2ZOG A;  4LBP A;  5KFB A;  3M9M B;  2RT3 A;  4R0J A;  5ETM A;  4B3S J;  2YXL A;  5A6P A;  4PG7 A;  1LKZ A;  5KT2 A;  3G8S A;  3SSR A;  3QWP A;  2AX0 A;  5FDL A;  4Z7C A;  2JVR A;  1YI2 S;  1KQG B;  4ZCK A;  3IWN C;  1RI7 A;  1B3T A;  2ALZ A;  1PCA A;  4WJB A;  3VGT A;  4O3O A;  2UVW A;  2BJ1 A;  3KK3 B;  1KDN A;  1O6X A;  3R2C J;  2M8H A;  2GO9 A;  3OSP A;  4WTO B;  2QG9 B;  4URS A;  4ED3 A;  4FZV A;  2XWY A;  2UUB F;  3V6D A;  2L08 A;  4NXM F;  2YNH B;  4JI5 F;  3G6Y A;  1CJV A;  3W2W B;  3PJX A;  1AFI A;  4B3R J;  1Y0H A;  3L7U A;  1UWB B;  5IXU A;  2C28 A;  1OPI A;  5J2Q B;  2AD9 A;  2DBB A;  3MR7 A;  2I6W A;  4AE5 A;  3I96 A;  3HT0 A;  3K17 A;  3LP0 A;  4LF7 F;  1KN6 A;  2Q3P A;  2R8J A;  2GHW A;  3DXB A;  1QSL A;  3IS9 A;  1VQK S;  3K5N A;  3ZTQ A;  3HKW A;  3ET6 A;  4NI2 A;  2QFI A;  3TAP A;  1GX5 A;  4YUD A;  2UUC F;  4DV6 F;  1MLA A;  4PXB A;  5BYS A;  1HW8 A;  4WPA A;  4JV2 A;  3FQL A;  5J1N A;  1P9Q C;  2GQQ A;  4P2S A;  1TVR A;  3W65 A;  2CIM A;  3D3B J;  1BQX A;  3CD6 S;  1Y5I B;  3Q23 A;  4WFA Q;  5J1P A;  3KK2 B;  1ZAX A;  1MG7 A;  5J1E A;  2D3O R;  2G0C A;  3M2R B;  4DFJ A;  2VJV A;  2ROE A;  2HMI A;  1SIW B;  1NLK L;  3OR1 B;  4ANE A;  4EBC A;  2BVZ A;  3V2U C;  5GAH U;  4USW A;  2Z30 B;  2QA4 S;  1NK8 A;  4RR5 A;  1VRU B;  3IAS 9;  1DJ0 A;  2G0J A;  1V9O A;  2P2C B;  2ZH4 A;  2JHE A;  1OPZ A;  3CD7 A;  1VBK A;  2QO3 A;  3CCV S;  2KXH A;  4ECQ A;  4YY3 F;  2RIL A;  5EWG A;  4USH A;  3RR8 A;  1D8Z A;  4ED4 A;  4BHQ A;  2RRB A;  4W4M A;  2KO1 A;  3NLC A;  3TOQ A;  1JLF B;  3MTK A;  4JB8 B;  5F8G A;  5CD4 A;  4J9N A;  4ILL A;  4ZLN A;  2HAF A;  3OFF A;  4RW7 B;  4PG4 A;  4JI7 F;  3KHR A;  4QIG A;  1B7Y B;  3OTO J;  4LMZ A;  4EO6 A;  1WEL A;  2CUY A;  4WE1 A;  3GII A;  3PYD A;  1T95 A;  2PMH A;  4USU A;  3CMQ A;  2EFV A;  1FJG F;  1S79 A;  3T6B A;  4ELV A;  1EQM A;  3BN4 A;  5DG7 A;  1FEH A;  4CT9 A;  3PIP Q;  1WNE A;  2MZT A;  2V5H G;  4DL6 A;  2BR0 A;  1X4C A;  2B56 A;  4D3G A;  5E3C A;  2DY1 A;  1C0U A;  2VDH A;  5K8M A;  1VI7 A;  2FJB B;  4JI8 J;  2VU5 A;  1FX2 A;  3DRS B;  5HAN A;  3CJK A;  3SEO A;  1U26 A;  4LIW A;  4JV1 A;  3DU5 A;  2JLE A;  3TZY A;  3R5C A;  2HYI B;  1DAX A;  4IKA A;  4F67 A;  3B54 A;  2WON A;  5M2R A;  4RNO A;  1NJX A;  2GIR A;  4HI1 A;  4NE9 C;  3M30 A;  3FRY A;  1WF2 A;  4DPU A;  2AJ1 A;  3NAI A;  4RBT A;  3GV5 B;  1UET A;  3TI0 A;  1CVJ A;  2L9W A;  1C1C A;  3DDK A;  2HHH F;  1U6B A;  3HZG A;  5KFG A;  5C5J A;  2AX1 A;  3DOL B;  1ULR A;  2RB7 A;  4NLP A;  4JUZ A;  3KLH B;  1UEV A;  2V69 A;  4H4M B;  1KFD A;  2XHW A;  4DR4 F;  3BEG B;  2PEH A;  2GJI A;  4DR2 F;  4ELU A;  4V19 J;  1XER A;  1WTB A;  4A48 A;  3QLH A;  3KK3 A;  5GAD I;  3H2V E;  4C6A A;  3CDW A;  4OV6 A;  3HM9 A;  1KLM A;  2VPX B;  3PEJ A;  3QSY B;  3QJL A;  3BKU A;  3S1T A;  3VV2 B;  1TAU A;  5ETK A;  3GB0 A;  3P6Y C;  3CUL A;  3GIR A;  3MAA B;  5D4O A;  2ZIT A;  2LXF A;  3MM7 A;  1FRK A;  2CPZ A;  5IOL A;  1YBA A;  1TFW A;  3NBP B;  2DEJ A;  1GQE A;  2F8E X;  1TMM A;  3C14 A;  3F73 A;  3O8W A;  1NBE B;  4C3K A;  4LF4 J;  5BR8 F;  2C1E B;  5H1S V;  1SJF A;  1D9D A;  4LF8 J;  2GAG C;  2H9Z A;  3BV8 A;  3BSO A;  4JOU A;  3ITH B;  3CCL S;  5LMN F;  2FVS A;  2B7C B;  3H7H B;  1S6Q A;  4ES3 A;  2G9O A;  2HWI A;  2VD3 A;  2LQ5 A;  3FBC A;  2KT5 A;  2B0G A;  1RWK B;  3PNI A;  5SUH A;  3VCD A;  2KFY A;  1VHF A;  2XMM A;  3LOU A;  4CQ1 A;  3G4S S;  2MZR A;  1FTR A;  2YX4 A;  3KK2 A;  4FNI A;  1MNE A;  1FA0 A;  2PFF B;  3P4U B;  1AZS B;  1RT3 A;  2XI3 A;  1N33 F;  1T0T V;  2ZH2 A;  3OR1 A;  4K4X A;  5KFY A;  1R0A A;  3L7P A;  4KRW A;  2HG4 A;  3WIV A;  1S1X B;  1SH0 A;  4LF6 J;  1XR6 A;  2DEI A;  4ZLJ A;  1N5T A;  4U8V A;  3MR5 A;  3HXM A;  3ZFV A;  1LW0 A;  2X51 A;  5IWA F;  1L3U A;  1TL3 B;  3TP2 A;  2OPQ A;  2ZBP A;  3EVO A;  4CO1 A;  3LW5 C;  1QUP A;  3N6N A;  5DQG A;  3N5B A;  2F8M A;  1B0T A;  5KFR A;  3EDR B;  4L3K A;  2DGO A;  2I5J B;  2M9K A;  3F44 A;  2Z58 B;  3R8Y A;  3VQT A;  2VHG A;  1HQU A;  2OLW A;  2QGF B;  2VKZ G;  3SFG A;  1VIS A;  1GT8 A;  4TU8 A;  4ED8 A;  4DSE A;  4C3L A;  3W5X A;  1R8B A;  3UD3 P;  3QAE A;  3HT3 A;  5KFZ A;  5HSP A;  1WD6 A;  1T3O A;  2FD2 A;  2MTL A;  1SJ3 P;  1NB7 A;  1O51 A;  1MMN A;  4DUY F;  3NNH A;  4FNH A;  3A3P B;  3G6V A;  1X4F A;  4P10 A;  5KFM A;  3V5R A;  1Q7Y T;  2K1R A;  1SL1 A;  1T94 A;  3DLG B;  4CLS A;  4E2F B;  1M5S A;  3Q8Q B;  1RHJ B;  2QLD A;  1S57 A;  3K2Y A;  2W7A A;  3ZZU A;  1IKX B;  5KFQ A;  2GVD B;  4PQU A;  1M1K T;  3FCH A;  3OHB A;  2DGU A;  2V4J A;  4G1I A;  1TKX B;  4HHJ A;  1ZM3 A;  2KYZ A;  2BJE A;  1VMB A;  3A13 A;  3G2X A;  4FVC A;  3I56 S;  1KQK A;  4B9S A;  3NMA A;  2R9L A;  2KYX A;  2DCL A;  4U7C A;  1EB0 A;  1IKV B;  2B26 A;  3K8W A;  4KB7 A;  3SYZ A;  4IR9 A;  1JLG A;  4K4V A;  4C0B A;  4DV0 F;  1MU2 B;  1FRJ A;  3QZ8 A;  1V3Z A;  3KLI B;  1F2G A;  4YME A;  4J9K A;  1I1G A;  1IWA A;  4NRU A;  3KLH A;  1FRM A;  1RTH A;  5B0E A;  1HBO B;  2EXU A;  4LSN B;  3TEG A;  2F1F A;  4IFV A;  4DS5 A;  5DQI A;  2GAH C;  2LFV A;  2QTW A;  4TYA A;  4K4Y A;  2GIF A;  4DQQ A;  2R7V A;  3CCM S;  2YNI A;  4DUZ J;  3QLH B;  3W8P A;  3IP0 A;  5C42 A;  3R3T A;  4UY8 5;  2JX2 A;  1PBA A;  1U47 A;  5KFS A;  4ZJO A;  2FY1 A;  4M63 A;  2UP1 A;  3BRE A;  4ZPW R;  1KOO A;  1Q5Y A;  1TV6 A;  3JSY A;  4KGX B;  3SMZ A;  2QA4 G;  1YJV A;  1H38 A;  4PWD B;  1A0O B;  2JZ8 A;  3IFE A;  3PZP A;  4OYM A;  1I94 F;  2DTJ A;  3C14 B;  4DV2 J;  2R2U A;  3NNA A;  2CQD A;  1SI9 A;  2BYC A;  2YNH A;  4F3Q A;  3FRZ A;  3TA0 A;  2FZK B;  4ECV A;  2HIY A;  2ZKT A;  3NS5 A;  4N8O A;  2OO4 A;  1N34 J;  2LCW A;  4FP9 A;  3J81 j;  4B9M A;  1V3S A;  1AXQ A;  3VVT A;  3V4I A;  1FDB A;  2YWE A;  1RT7 A;  1UKU A;  1S0V A;  4ZVQ B;  3DM2 B;  4F36 A;  4M5J A;  3NEK A;  1FRX A;  3TR5 A;  3C6T A;  1P8G A;  3HHK A;  2K3K A;  4TVA B;  4YR2 A;  2J8S A;  3TQ1 A;  2XS2 A;  2RRA A;  3ILL A;  4FF3 A;  3I9Z A;  4F4K A;  3HHL D;  5E3A A;  3ILI A;  3PM9 A;  3MF5 A;  5A0Y B;  1LQ9 A;  2HRU A;  2F3J A;  4M5N A;  4GC6 A;  1RT5 A;  2DXF A;  2RJZ A;  2EKN A;  3E8O A;  4OIX A;  1T9U A;  2NYH A;  2CJB A;  1F9F A;  4QIV A;  3T6J A;  1BGX T;  4HR2 A;  5LJ5 Y;  4DQR A;  4IQX A;  4OHV A;  2ASY A;  3MGJ A;  1XJW B;  1S48 A;  4HT7 A;  4IR1 A;  4UF4 A;  2M52 A;  5D6G A;  3BDP A;  2MKI A;  2RKI B;  1FK9 A;  3W9I A;  1W26 A;  2HWT A;  3PYE A;  2BX6 A;  4ETX A;  2H1Y A;  1MN9 A;  3I32 A;  4ICL A;  2H48 B;  2PC6 A;  1R6V A;  1FF2 A;  1KQS R;  5ETP A;  5GAG I;  5DRK A;  2JNJ A;  4ZHR B;  1N52 B;  1PIL A;  2X1F A;  5B0D A;  1HBN B;  3ET6 B;  1VQY A;  1H7W A;  2DO4 A;  3DFE A;  4O3N A;  1WC0 A;  3ONQ A;  5EDW A;  2XO7 A;  2W8L A;  3T1Y J;  3DCA A;  1N5Q A;  1JX4 A;  1RTI B;  1F60 B;  2VG7 A;  2B5J B;  1VQ5 S;  4I69 A;  3MCN A;  1R3N A;  4WFB Q;  3G82 A;  4F4A A;  4KT0 C;  4ECX A;  2BQU A;  1TK8 A;  2ZVS A;  1GXL A;  2QLW A;  3IG1 B;  5F8N A;  5KFP A;  2GQC A;  4J9P A;  4CH1 A;  1FJC A;  2CPD A;  4YN3 B;  3RB0 A;  4DCJ B;  3DN9 A;  3OUY B;  3ELH A;  2I8E A;  4ECW A;  1KVI A;  1MML A;  1VIX A;  1TAQ A;  3D6H B;  4RW4 B;  1SV5 A;  4BC7 A;  5HQ8 A;  2RNE A;  1U1N A;  3M30 B;  4GO5 X;  4X4V A;  2HQF A;  2M4M A;  1ZM4 A;  4MKA A;  4OLO A;  4TXS A;  1F3F A;  3NKY A;  5E33 A;  4Z37 A;  3M6V A;  4AXI A;  3ZZT A;  2P9C A;  1N5S A;  2DR8 A;  1SBR A;  3MUT P;  2OFG X;  4IFY A;  2DJW A;  1RAB B;  3MOZ A;  4H4M A;  1UVK A;  2C3P A;  4RW6 A;  3LP1 A;  4WE1 B;  4PWD A;  2VB6 A;  1QAX A;  3HFZ B;  1MWY A;  3CCE S;  1JLE A;  4U7U D;  1GXU A;  2KVI A;  4OMF G;  3PKM A;  4X4N A;  3W66 A;  1URR A;  4NLX A;  4ZP6 A;  1UA1 A;  4DI6 A;  1B99 A;  5GAE U;  7FDR A;  3QRQ A;  1WWH A;  1B0P A;  2G2Z A;  1DTT B;  3OQ2 A;  2DIS A;  4RBV A;  5CYQ A;  3GP9 A;  1ROF A;  4J9V A;  1IBM J;  2XCP A;  1G7C B;  3PDN A;  2OH2 A;  4CH0 S;  4DL7 A;  4I6A A;  3PRD A;  5CCL A;  1FI4 A;  2KM8 C;  1JLA B;  3C6T B;  2D7S A;  1RWV B;  4ECZ A;  1UAW A;  1SCJ B;  1RWP B;  4PKD B;  4O3Q A;  2XS5 A;  4J90 A;  1S49 A;  1FDD A;  1QLN A;  2HZV A;  1ITP A;  3TA1 A;  2JRS A;  5F8M A;  4XIU A;  4J91 A;  2JEJ A;  4DMZ A;  1UJ5 A;  1XMQ J;  5THW A;  3FQK A;  4LF2 A;  4LJM A;  1UP1 A;  1SL2 A;  2CQ0 A;  1HHT P;  4FF4 A;  4GKK J;  2E5L J;  4NLD A;  5IT0 A;  4X4U A;  5DDO C;  2XZW A;  4WK1 A;  1SC6 A;  3MM9 B;  3EXC X;  1M1H A;  2VG5 A;  2HVH A;  5LSO A;  4KPC A;  1QJH A;  1F3V A;  4F0H A;  4DX8 H;  4FF2 A;  1BC6 A;  1FD8 A; 
#chains in the Genus database with same CATH homology
 3NXZ A;  1C3G A;  3TJ9 A;  3NY0 A;  2Q2G A;  2QLD A;  3AGY A;  1GMW D;  3TJ8 A;  1NLT A;  4J80 A;  1XAO A;  1GMV A;  1EB0 A;  4L3K A;  3LA0 A;  2B26 A;  3TJA A;  3LZ8 A;  1GMU A;  1EAR A;  3AGZ A;  3L9Z A;  3I38 A;  2HFV A;  3AGX A;  1GMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...