1GMWA

Structure of uree
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
b'MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREE
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Chaperone
total genus 36
structure length 138
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmwA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmwA01
3LA0A 1GMWD 1EARA 3I38A 1NLTA 3TJAA 1C3GA 2B26A 3NY0A 1GMUA 3AGXA 3AGZA 3L9ZA 3AGYA 1GMVA 2Q2GA 3LZ8A 2QLDA 3TJ9A 1GMWA 3NXZA 2HFVA 3TJ8A 1XAOA 4J80A 4L3KA 1EB0A
chains in the Genus database with same CATH superfamily
3C6UA 1PG5B 2J0WA 2RF2B 5A0YA 3CCWA 4WK1A 1S1WA 2CWKA 2J9DA 1HARA 1FFGB 2H5JB 2ZZTA 3QIDA 2LU1A 2HWIA 1R8PA 2CJQA 3CC7S 3A3OB 1ZTTA 1F0XA 3UCGA 3G82B 5G0RA 3EE3A 1JJ2R 2DH9A 1JIHA 2ZOFA 4LIWA 2XMUA 3NGSA 4J9LA 4F67A 3GV8B 3US5A 2AQ4A 3JTOA 1IBLJ 1MNEA 3D7SB 4CM0A 2DR9A 2MZQA 4DV6F 4OI1A 2BOAA 4X4UA 4GKKF 2V50A 1HA1A 1X7VA 2XS2A 1L3TA 3K5LA 4Q5VA 2DR8A 3TUPA 3UDEA 2ZFHA 1MROB 3HCXA 4HR2A 1B64A 2HQFA 2J6SA 1UVIA 2A0FB 1QAYA 3T6BA 4DEZA 5A8RA 2YH1A 2QA4G 1R0CB 2LDYA 2CG8A 1D09B 1O6XA 4NCAA 1RWOB 1TKZA 3OR2A 3PCOB 3OJUA 2CJYB 3T1HJ 1RBOB 5KFLA 1GXLA 2IDLA 2HMIA 3E51A 3ZNJ1 4YDDB 2XC9A 1VRUA 4JYAF 1FWLA 3HHLC 4O0IA 4FYWB 3R7SB 2JNJA 2I1RA 3W61A 2Z56B 2JDJA 2BM1A 3WBZA 3PVXA 2OFGX 4ETZA 3HT0A 2HFSA 4LR7A 1CQNA 4Z2XA 3R6GB 2UXCF 2V68A 2L48A 1ICEB 4UUXA 3UFCX 3T1HF 3R5JB 3IRWP 2BANA 2YPZA 3O2IA 1RT1B 2JC0A 3U27A 1VIXA 2GQCA 4AL5A 1N88A 3LPEA 4NMLA 3HFVA 4O44B 4ZPTR 4RW7A 4PG6A 2L41A 4JI3F 1NHKL 4O4GB 1X4AA 1RAGB 2OMLA 1VQLS 4RX6A 1GH8A 4ECWA 2R2UA 1H98A 2OD4A 1VBYA 3KXDA 3CJSA 4RNOA 3CF5Q 1GMUA 1NSKL 5GMKa 1BXNA 3OVAA 3BYRA 3GV5B 4ECSA 2YQ3A 3L4BC 1TL7A 4HT5A 1RYRA 2VKZG 3MD1A 3E01A 3OTOJ 2J6UA 3LP0B 5GMEA 1HWKA 2EG2A 3QGHA 4OI2A 5ADZA 4OFZA 2GMJA 4ANCA 2MZTA 4P6QA 3M2VB 3ENQA 2CNKB 2MZJA 2WZ1A 2VBXA 1S72S 5KFVA 2MLYA 3Q89A 2FZCB 4B08A 1WEZA 2HRTA 2HGLA 4J5OA 5DG7A 2AEJA 2H5EA 1FX4A 3MHYA 1FF2A 3OTOF 3OQ2A 4ID5A 2WBRA 1PAEX 5CH7B 2RUSA 2CUYA 4ZJQA 2R7XA 5HLFA 2V2QA 1LW2A 1KWMA 1HBOA 1CJUB 2MQMA 2YY3A 2CDQA 1H0HB 1X5PA 1CC8A 3BJYA 3CCQS 3GIKA 5KFPA 2OPSA 3C15A 1HNWJ 4BHQA 3CDUA 2AJ4A 1M1GA 3A3NB 1Y3KA 2CJXB 3D6FB 1S1XA 3PXGa 2EI5A 3Q24A 3H5SA 3PYDA 2DGUA 5KG6A 1X31C 5FDLB 3PRVA 1CPZA 1LXJA 4DZDA 4USWA 1IBCB 2WVCA 1T9VA 1GXTA 4USTA 3BH7B 4CI0B 3SCLE 2DO4A 2AW0A 3G9CA 4PUOA 4KHMA 4RZRA 5LMNJ 4KGVB 3GIIA 3SCKE 4AYBD 1XTZA 5F8GA 3GJTB 4DUZF 3MEDA 2GA7A 3O44A 1HNWF 4CLLA 3GB0A 2MGZA 2VUGA 1ACMB 2OELA 1BLUA 3HKZD 2W9AA 4BCAA 2DR7A 3IR7B 4PWDA 1T0TV 3OHAA 2FLNA 5KT4A 2OTLS 3OTCA 2MKYA 2CPDA 3RTVA 4CCHA 2X51A 5D15A 3GMGA 5CCLA 1XIQA 3HVTA 4DR2F 1C4CA 2ASLA 3DOMB 4ECTA 4LRFA 4WFYA 3L09A 3ZTRA 1CS4B 5IFMA 1G7CB 3LP2B 3WIUA 1RE1B 3H7HB 5CA5A 4CO1A 2PC6A 2HS3A 1G6BA 2DGXA 4PPDA 4XTTA 1DQAA 2DHGA 3DDKA 5DQGA 1HHTP 4X4PA 2JOQA 1KTVA 3VHQA 3CCLS 3IA0A 4NLGA 4P2XA 1LWCA 3TZWA 3I4PA 2K1RA 2GJ2A 2ZH4A 4USHA 1U1QA 4LF8F 2EVZA 1VK8A 2BW7A 4OZJA 3G6YA 2DBBA 2DGVA 1ROFA 2A6OA 1NB2A 3WIVA 3HHKA 5GVQA 1VQOS 4GVLA 3NKYA 3MPDA 4RW4A 3MM5A 4MK8A 4JI5F 4ZCMA 4NCGA 1TU0B 1HHQA 3W9JA 2XO7A 1SC6A 2D3ZA 3K58A 3ITHA 2HQGA 1U2CA 4OJGA 2APOA 2XGPA 2E1AA 3R9LA 1MW7A 3KK3A 3KLIB 2XULA 4KRWA 4A47A 3I87A 4XK8C 3TA0A 3UQSA 1G4CA 2VFSA 1NH7A 2M8DB 2R2RA 1G2EA 4CTAA 5KG1A 2WW8A 1X4BA 2OPQB 1ZAXA 3CJ3A 3IXQA 1V6HA 1S99A 3TEGA 4DR6F 3ILJA 2RU3A 3IBCB 4LT6A 3KG0A 3CCRS 4IUFA 3SIPB 1UPMB 2V0NA 4B3RF 4WFBQ 5GADU 2W9CB 1LQ9A 1JLFB 2H65B 2YTCA 2PD1A 4K5SA 1CC7A 1FO1A 3CCES 1IN0A 2NYHA 4O23A 3QIPA 3NEKA 4FKXA 1VJQA 2ZC4A 1ZM3A 1NSPA 1RTIA 2QTWA 3S01A 4KYZA 4DR3J 2RJZA 1Q81T 3NY0A 3HHLA 2CQGA 1NK6A 5I3PA 4QWBA 3PW5A 2VDHA 5DQHA 2IAJA 4LFBJ 2IJRA 4JV5F 2Q79A 3ZTSA 4CLFA 1YJNS 2DT9A 3DOKA 2VOPA 2YWHA 2IRYA 4OIXA 3MEEB 2QLXA 3MR6A 1IBMF 1RWKB 3I31A 2H9ZA 1VC0A 3TJAA 1DLOA 4BC9A 2UZAA 4OQJA 4X4RA 2RDDA 1NHVA 3HP6A 3ZFVA 2FLPA 3GCXP 1BQXA 3OD2A 2ZJQQ 1J5EJ 3C16A 1PAUB 4LFBF 1S7HA 3CO0P 2B6AA 2RH3A 3GFZA 3T6JA 3IAS9 4ECVA 3EVOA 3BKTA 2HIQA 5AE3A 4K4YA 2AIRB 3HD1A 5K8MA 1JLGA 1WTBA 1U48A 1O51A 2PI4A 1S6QB 5DG9A 3DRPA 2JVRA 2WONA 4DWIA 2KI2A 2B4OA 1N0UA 3W2VA 3GQCA 2HRUA 2CQ2A 3PZPA 1S77D 2B9YA 1JJ4A 4Y3CA 4OYAA 1RADB 4PXEA 1N36J 3ZNUA 1X60A 4HI2A 3GG0A 1J5EF 2H4YB 1QLNA 1S1VB 1NK5A 4OV6A 2MKCA 3IC1A 1JLCB 4AQYF 4FBTA 3LP1A 2CIMA 3HF5A 2QC3A 2YPYA 1WTFA 3C66A 4ZCLA 2HHTA 3Q2SC 2WRMA 3R5BA 5JMNA 1DQ8A 5HSPA 1TZ0A 1NJXA 2OSQA 4AFFA 5H9FJ 3BF4A 2B5JA 2Y1LB 3JSYA 1T03A 1JLEB 3I0RB 2W7AA 3W8PA 5KFGA 1R6VA 1CJVA 3WHIA 1KP6A 1CJTB 3TAPA 2O67A 2Z2LA 1S49A 3LGMA 2LEAA 2PN6A 3M8RA 1REGX 2NR0A 1XK8A 3OSPA 2WHOA 2IM0A 4X4OA 4WFNQ 1B3TA 4OJ1A 4JI4J 1R0AB 1UVNA 2QN6B 1Y00A 3KJQB 1JWWA 1PBUA 1NAQA 1TKTB 1DTTB 3TJ9A 4I1TA 3MECB 4YS2A 1T9TA 1IKWB 1WKJA 1X4CA 1FNXH 4HHJA 4RNNA 2XYHB 4LRCA 3K57A 3RG6A 2YKPA 4I2QA 1UA1A 4YDXA 3OR1B 1ZM9A 4A8SA 1H6KX 3NGRA 5HMWA 2EC0A 4WK3A 1NPPA 5D6GA 4LR8A 4JUZA 3NL0A 4WZMA 1UAWA 3BBBA 2FY1A 4A46A 4QWAA 4ANDA 4YY3J 2IVFB 4I0WA 1NSQA 1YIJS 3NBPB 2HPUA 4ZLLA 1FTCA 3ILIA 3H20A 3LTOA 3BQ0A 1YWXA 3SMZA 1ZAWA 4OZ0A 3JYTB 4DG1A 4YHHJ 3QO9B 3KJNB 2C3UA 3BSAA 4FS1A 3KHRA 3DFEA 3CULA 3UD4P 2B4VA 3OFGA 2VPYB 4K7QA 2VC1A 1QVGR 3D0IE 2BR0A 3RB3A 3OBIA 2HLTA 4DFPA 3JAMY 2RQMA 4G1PA 1RT2B 2MLXA 3HHLD 2YNIA 1FE4A 1ZPVA 4OZ3A 2HAFA 1XMOJ 3RR8A 3D1QA 1RSCA 2QLDA 1SKWA 1JLQB 3GLJA 4B3MJ 4OYMA 5B0AA 2MEWA 4DUYF 5DM7Q 2KDOA 5ITHA 2Z57B 4NCBA 5H9EJ 2HHQA 2VD3A 4U6PA 3O5TB 1TV6A 2E1RA 4WXOA 3SQOP 2LYVA 2JX2A 4DSKA 1AW0A 2VFRA 2HK3A 3I56S 5L8RC 3DYAA 4RW9B 2MPUA 1KNZA 2HHSA 1LKZA 1OIAA 1XMOF 2ZVIA 1RT7A 1FX2A 4AL7A 2HK2A 3ADAC 4M1KA 4I64A 4GO5X 5E7OB 1AUSL 1KQKA 5HROB 4CO0A 4OHZA 2BX6A 5IZHA 1FXRA 1QE1A 3TVKA 3G8QA 3TAMB 2FGCA 3CD6S 3Q23A 1Q5YA 3QRPA 4G65A 2JEJA 1UETA 3RB0A 4X65J 2B56A 7FDRA 3JQMA 2GGPB 1H7XA 2XHCA 3UCZP 3LAMA 1IR2A 1HNZJ 2IY5B 2IRUA 3DOLA 2VIHA 2PMWA 1LWFB 3I9ZA 3A8JA 4K4TA 1AYEA 2DEIA 9ATCB 4IR1A 1NJZA 2XBPA 4ID8A 4NLRA 4DPYA 4MH8A 3OVSA 1I5OB 2F1FA 1Z4UA 3DLEA 4PYAA 2KT2A 1S4EA 2EBGA 2BACA 2JVMA 3BYPA 2VFVA 1CQMA 1EHWA 2Z0GA 4R8UA 2IYGA 1WHVA 2M9KA 3OXGA 3BGRA 2YNHB 2VONA 2GVDA 1RT5A 3AQPA 3S6EA 4N47A 4X4SA 1ZTWA 1OPZA 2XMMA 1HBNB 4H4OA 1HNZF 5J2NA 4K2XA 2BJ3A 1Q79A 3HJFA 1MU2A 1F60B 5KFXA 1RHUB 1E6VA 3PJWA 3SYZA 3FQLA 5IXUA 3M9MB 2G9OA 1RWUA 3AAWB 1CULA 3KHHA 4ILRA 2XS7A 4DV4J 1TL3A 4A8KA 1RA7A 4ILMA 3ISNC 3JAMU 4C97A 2R9LA 1SV5B 1U0HA 4ZS6A 4QU6A 4DS4A 4O3NA 1B70B 4BBYA 1SUQB 2XMWA 3H25A 1DHMA 2LP4A 1S1UA 4OYBA 2BE2B 3H5YA 3IBWA 2FPHX 4PWUA 4WKYA 3M8PA 1K1SA 2OEKA 3AJ1A 3OW2R 3SZ2A 1FRIA 2J9DE 2E44A 5T7LA 3ILOA 1KRPA 1RKIA 2HIYA 5E3RA 4WP9A 2BMBA 3KK1B 2K3IA 4Y00A 3B78A 2F63A 3MCMA 2WVBA 1EP4B 3V6JA 2J7KA 2GIQA 1WG5A 3C3LA 3SSQA 4RUHA 1XMBA 3BDEA 4ERDA 4LF6J 1SC3B 1L3UA 2MZ1A 3DNCA 4LSLB 4USVA 3MR5A 3MMBA 1VYAA 2GFFA 2HVIA 1GNKA 3TR5A 4C3LA 2X1GA 1FWKA 3L7UA 4R0JA 1Q5VA 4ECXA 1HQ2A 1FJ7A 3HHEA 2ZBPA 2J9EA 2VFTA 5HATA 4CQ1A 4X2BA 1VQ6S 3PW7A 3O6QA 1R8CA 3K5OA 2K06A 3AXKA 4QWEA 1QVFR 2YVSA 3V81A 1IKVB 2MDAA 5F0UA 4OHXA 4NA1A 2WTFA 1N48A 3OSNA 2RUGA 4ITSA 2VPXB 2Y3YA 5HP1B 3FRYA 4DR7J 5J1EB 5MAOA 5B0DA 2P6TA 5IM0B 1RAOA 4P10A 2OH2A 2Z2ZA 2RRNA 4LF6F 3W9HA 4DV0J 1SH3A 1VC5A 2M88A 3R8YA 3C46A 1VQSA 5KAKA 2ZHBA 1FTRA 1MMDA 2NCKL 4LF9J 5EDWA 3MXHP 2RQ4A 1FRKA 2AJ1A 4TN2A 2AP6A 4PYDA 2OEJA 1IJEB 3ZZ0A 4M5GA 2OGUA 5DDOC 3IRXA 2H5IB 1HWUA 4DR5F 2FVRA 1RGVA 3BO4A 5D0RA 2J0SD 3RRKA 4A8QA 1VGYA 3VCDA 2ACMA 4QIFA 4LSNA 3J80Y 4LR9A 3BV8A 4LFAJ 4ZVGA 1NZ8A 1H7WA 5M2RA 4DJBA 4YR3A 5K14A 3W63A 2BJ1A 1FJGF 1XWLA 4G1IA 3OUYA 4NRUA 3OVBA 2PIIA 4Z37A 2NPFA 5CAAA 3AQOA 3H5XA 4QIGA 4F7VA 1RK8A 2E7WA 4C4WA 3KK2A 2POKA 4KFBA 1UPPA 4PZVA 4CO2A 3ISZA 3VV2B 2UXDJ 5HVHA 3CJ4A 3TA2A 2RF2A 5DDQC 1VQNS 4ZCIA 4EWTA 1WELA 3V4MA 1M1HA 5DZ7A 1RACB 1VS3A 1VQKS 4LBIA 2DXEA 4XPEA 2M70A 4C0BA 2BQUA 4CYUA 1NCLA 2H1YA 2CDRB 2M4MA 3TOQA 2XMAA 4KT0C 4OYWA 3MM6B 1G3OA 1FEEA 1SL0A 2HNYA 9RUBA 3AGZA 1C4AA 1HKAA 2V94A 2IC3A 3C5XC 3QGPA 2XMVA 3QZ7A 3P45B 5FLXY 3CUNA 3H5UA 1PKUA 2RILA 2MKIA 1XERA 2XLKA 2J9CA 1H72C 4DV7F 4QR0A 2E7VA 1RUSA 2OSRA 1FNMA 3GJRB 3QGGA 1WG4A 3PY8A 2G0JA 2VQEJ 3MF5A 5D0HA 3M05A 4DMZA 5CABA 3I38A 2EFVA 1N33J 2MB0B 1T3NA 3UDLA 2Z4PA 2B7BB 3AKOB 4Y2KA 3HK2A 1U8SA 3M6VA 1DBDA 4A8OA 5B09A 4KH0B 3J7ZT 4IG3A 2AWZA 5AT1B 1UEVA 2LLZA 3NWRA 2LECA 2LU2A 1IBKJ 2HQCA 2RS8A 4LJMA 3ZZTA 3DRXA 4HACB 1R31A 1VMBA 2KRBA 2PFDA 1I1GA 2RHQB 4N7TA 4MJKA 2IIHA 2FLLA 2KZZA 1V5IB 5D4LA 4WWSA 2OPPB 4O3OA 1RT1A 2YNFB 2W2OP 4Q7AA 2DHSA 2AEMA 2NXJA 1A7GE 1TP7A 3RW6A 1KQGB 2AMCB 4X4TA 1R6YA 2KT3A 3E2EA 1YGYA 5EX3A 4K4VA 5E3CA 3TYTA 5LOQA 1IBKF 3J80U 2PSZA 3TX8A 3M2RA 2GQQA 2C2OB 1S48A 1YKWA 5JJBA 2F8HA 3CCZA 3ZTOA 2MSSA 3IS9A 2DHXA 4PG5A 3PYGA 3W2WB 2FJEB 1X4HA 2ZH2A 2Y9HA 2AJQA 3PJ9A 4RU2A 3IAM9 2QYGA 1NHUA 4FPIA 3GWCA 2MQOA 1YJ7A 3HULA 4DI6A 2EC2A 3UO0A 2MQPA 5CYMB 1HQUA 3WZ0A 2ROPA 5L9XA 3FGVA 2V2ZA 3M2VA 3L3CA 4ZN1A 4X4QA 3CCTA 2XYGB 4Y34A 2F8EX 2KYXA 3MCNA 2XLJA 5IT4A 4TXSA 1WC5A 1NKCA 4NZ6A 3EVMA 5CD4H 1L5UA 3A12A 1Y5IB 2JEIA 4NXMJ 2P5VA 4ZP6A 2J76E 3MOJB 3SCJE 2XCPA 4OZLA 5D0EA 1WC4A 4B9LA 3BM7A 4YB5A 4ELUA 4HDGA 5HBMB 4C3KA 4PQUB 1VR6A 3VQSA 2RHSB 3LWMA 1A6LA 4NLVA 2BM0A 3N79A 3MWBA 2CPHA 5L1LA 1SQFA 2ILYA 4NLOA 2KH9A 1NDLA 2NXNA 4USMA 4WCEQ 2KRRA 4B02A 5L9NA 2DNOA 1CJUA 2HVZA 4KH1B 2RS2A 4P9SA 3KUGA 5HQ8A 5FLXU 4ECZA 4ETXA 4PR6A 2VL1A 4MIAA 5DGAA 2FIUA 2XYPB 2RDIA 4NXMF 3EGZA 3QQCD 2FDNA 4ZPAA 2KT5A 2FC9A 4USUA 3EYZA 3M1VB 5KFBA 2CPYA 2ZUAA 4RWWA 1F2GA 4J80A 1RWMB 3MZIA 4PAAA 4OLPA 2YBVA 3CJRA 5E5NA 1URNA 2YQ1A 4TU9A 3CJKB 4YEAA 1BQNB 1QAJA 1FDNA 3BR9A 5KFSA 1LWEB 2C2DA 4WKRA 2QE5A 5L1KA 1IXKA 4WU3A 2HS0A 2YH0A 3F56A 4DQPA 4DSIA 4ZDNA 4DBQA 2P9CA 4KO0B 2XLIA 3PYFA 4FDFA 4DSFA 2DH8A 4K4SA 5LSRA 3I96A 2E1MC 2Z2YB 3DRYA 3P5TL 2YKQA 3TO8A 1GMVA 3THVA 3PX0A 1F5CA 3MEGB 2O01C 4BDPA 2GIFA 3QLHA 4DV2J 2JLEA 4CIOA 4ECRA 1S10A 3CXCR 2DRAA 2GS8A 1R27B 1RYSA 1KOHA 5A8WB 2CJ9A 3MM8B 3QBCA 3TP2A 2ZH9A 3PG9A 3LP2A 4DUTA 4P2SA 3L7OA 1FNOA 5CZVA 2N4CA 2WB1D 3HT3A 4C8NA 2R4FA 1AT1B 3GG1A 4I69A 4F2SA 1WUUA 3QWUA 1JKHA 1X0PA 2NZCA 5B0EA 5J2QB 2IVYA 3W9IA 5LXYA 3ETOA 1AZSB 4NMXA 4UOGA 3MURP 2MKHA 2BQ3A 2CADA 4YN3B 2KN4A 4QOTA 2M5YA 3RRGA 4RU9A 4BWJA 3MCSA 2CG4A 3SCIE 2QO3A 2I5JB 4DF4A 4B3OB 2VOOA 4B9SA 2XGQA 3ZTQA 4A8WA 4C0HA 4LF5J 1PYOB 2MTLA 3FK4A 4DV5F 3G96A 5ETLA 1D9DA 1E6YB 3DLGA 2DKOB 2DK2A 1FKPA 4KAIA 3PR4A 4LF7F 3FSIA 2NQPA 4NLTA 3TARA 1R8AA 4BS2A 3JSMB 2GZOA 3AA9A 5E0OA 4QJVA 4K8RA 2DNPA 2CJKA 4DQRA 1JB0C 3D5MA 3W65A 1C2PA 2Q43A 3DI6B 1UWAA 5BYQA 5FD1A 2W9CA 4CLSA 2XM3A 1KLMA 4HLBA 1TAQA 2OIHA 2KU7A 3KLEB 3R2CJ 1OS5A 2W8LA 4A48A 4LF5F 3KDOA 4QWCA 3IO1A 2RQKA 3JTNA 4FYVB 4X64F 2UUCJ 1DURA 2V6AA 3KLFB 1EKRA 2CQBA 2KXFA 1UFWA 5F8LA 2V69A 1W7WA 5E3PA 1JNRB 2BUNA 1N5QA 4DF8A 3PACA 5EGYA 2CZ4A 3R2DJ 2HVDA 2PO4A 1S1TB 4NXNJ 2ILZA 1WHYA 4P72A 1ZZNA 1CG2A 3G8TA 3K59A 4L74A 1HNVA 2HSEB 1WC1A 2LA4A 1V3SA 5F3TA 3EWGA 1SIZA 4UUWA 2UVWA 2HHWA 3AOCA 2NZ4A 2LKZA 3MEEA 3U7JA 4CWBA 2UUCF 1S9EB 2NSBA 3ZZRA 4RR5A 1P1LA 5F8JA 3LA0A 3DM2B 2FLOA 1S6UA 4K4WA 4V19X 3RW7A 1RA6A 3OT9A 4J9OA 2IFXA 1RABB 2JLFA 1RT3B 4NI2A 3MD3A 3KUHA 3HX9A 5L39A 1BGXT 3NCQA 3RZAA 1U6BA 2QT7A 3DRRB 2F8MA 4J9UE 4JI7F 4IDKA 3S7RA 5I42B 3KLHA 2NXCA 1S6QA 3IFEA 1S6OA 2Q3PA 3IGVA 1OQ6A 2ZBRA 1PILA 4B9NA 4GKJJ 3DXSX 4YFUA 3A13A 4Q44A 1NSAA 2W2PP 5C2CA 4OYPA 4C11B 4IFVB 2C3MA 2UUBJ 4OI3A 2AF6A 3C6EC 4ES1A 4OZ5A 4Q2MA 1RHRB 2V34A 2ROGA 2QFJA 3NP5A 4IO9Q 3T1AA 2QA4S 3NAIA 1F2HA 1Q95G 4NRTA 1VIOA 2A1BA 3RBEA 2DVIA 2MKKA 3DLHA 2YNGB 4USKA 2BVZA 4EK2A 4DQSA 5KOXA 1VQMS 1VBZA 1DAXA 4KJIA 1JLEA 1UEUA 2UV8A 2E7XA 4GKJF 1NPKA 4FS2A 3CJ2A 1JLBA 2ZE2B 4U95A 3KDNA 2OO4A 3MAHA 1TQLA 2P9GA 2X3GA 2BJDA 5DM6Q 4I56A 5IV4A 5KG4A 4NEZA 3DHXA 2VPWB 4RL1A 3O3LA 1HD1A 1MLAA 4HTJA 3C6UB 2HHXA 1Q82T 2CZVC 1FFWB 2ROEA 5A0YB 1T7PA 1FEHA 3ZO7A 1TKTA 1S1WB 2C3PA 1IKWA 3N0VA 5C24B 2P9EA 2OAUA 3I4HX 1XR6A 3EXYA 2UUAJ 2GO8A 1Q4RA 2NLWA 1AFJA 3A8IA 3HD2A 1VQ4S 1FT8A 5HJYA 1PJ5A 3H8YA 3OR1A 5EWEA 3FEXB 1KVIA 1HNIB 4K50A 3QPIA 1LOUA 5U47A 3MR7A 1TTHB 3CSKA 4OHWA 3D68A 3PFOA 4ES2A 1NK4A 3KMSA 3GV7B 4IOCQ 1PSDA 2CNNB 3EGNA 4IH6A 2G2YA 3M30A 1P6TA 4J9QA 3MPYA 5LXRA 2R2SA 1U49A 3C19A 2E9ZA 1YRTA 2A6MA 3NBPA 2VQFF 3BBFA 2EPIA 1BWVA 2XSJA 3VTIA 3KTQA 1QSSA 1R7IA 2UUAF 2Q2GA 2WAQD 3JYTA 4NOHA 1U2FA 5HQLA 2VJVA 2HKEA 4Q8EA 3QO9A 1TKZB 5BJRA 1GAOA 1TL5A 5H9FK 1SH2A 2ERRA 4HH0A 1X9MA 1XBWA 4D3GA 2HMIB 1WKKA 3VWSA 2CQ3A 2E9TA 4NYZA 2VG5B 2Z2MA 1U6ZA 2YXLA 1X0FA 2AJ2A 1UW4A 3HXMA 1GMWA 2HBRB 3PJXA 3EDRB 2IJNA 4Y2AA 1UJ5A 4F4KA 4LF4J 4ICLA 1EAYC 3FCWA 2QL5B 3NRBA 4GC6A 1GEHA 2W24A 4ILLA 1MWYA 2M52A 1RT2A 3B82A 3SFGA 1M5VC 5HVGA 1KD1T 2GIRA 2LQ8A 2XS5A 1WF2A 5KG7A 4TVAB 2D3OR 1RAHB 4LFCF 3EX7B 4LRAA 4TY8A 1J5OA 3OFFA 1YITS 2BANB 1RHQB 4LRDA 3Q8PB 3S8SA 4Y28C 3ZZOA 2M8HA 4WJBA 3M8ZA 3VAGA 1R8BA 4RW7B 5B7WA 3FUYA 4DHVA 2X7IA 2AT1B 4RBVA 2C2KB 3ZXWA 3AOAA 4TLQA 1UW9A 3D66A 2MKSA 2K7KA 3OPKA 3CIZA 1Y0HA 4C8YA 4DV3J 3PR5B 4AD6A 3V6KA 3OXFA 1OQ3A 3V4IB 3MTJA 3E01B 4X84A 2BKOA 3M6WA 3DU6A 3HMJG 3B4DA 2ZHAA 5HROA 1C1CB 2QG9B 2WSFC 3TAMA 4OX9J 1WWHA 3EICA 2YX4A 4ZVTB 4B9VA 2ALYB 2AX0A 4G3IA 1RTDA 4PXCA 8RUCA 5M2PA 1MSWD 1U1PA 4F3MA 1TK5A 2ZVSA 1KHWA 5J2PB 3J7A1 1QUPA 3HHDA 4NZ7A 1D8ZA 1ELOA 1U1MA 2H54B 4M5LA 3IP0A 4F02A 2Y8WA 1VBXA 3WC0A 2DNNA 4ID5B 3TQ1A 2G2OA 4IH7A 2K2PA 3V6DA 3AOBA 2QFIA 4UT4A 2G4BA 2WSCC 4NYPA 3P3DA 1HBOB 3OL7A 4D3HA 1HR0J 2BDPA 4QIWD 4EI2A 4WFAQ 1M90T 3FNNA 2GHWA 5HJXA 1ZA2B 1YSJA 5H9EK 4ED4A 3G6ES 4QZVB 3W1YC 3TRGA 3H0PA 1Y5LB 2ATCB 2HQIA 4WBFA 5JVHQ 1S1XB 3Q8QB 3EUNA 1F5AA 4ZVSB 1WDDA 2HGNA 4KGMA 3CE8A 4FYXB 4IOAQ 4DSEA 1HMVB 1IKYA 3NNAA 2LEBA 1YJWS 2HG4A 4NLWA 2W01A 2EFOA 1EIYB 4DCOB 3QFWA 4J7CA 2CWXA 2IHR1 4H54A 4PUOB 3QT7A 3VAIA 5I3UA 4IR9A 1SV5A 4QPTA 1FVSA 2C2MB 3PM9A 4RW6B 5GADI 4FKYA 3MEDB 4OYZA 2DH7A 3HZGA 3IWXA 3BZQA 2MGZB 1RBAA 2BZ2A 2R7VA 4OHYA 4E8UA 2FHJD 5HMYA 2OJ3A 2QLJB 1P8GA 4I7FA 3CMQA 3CC4S 3G2XA 5GAEU 1HNXF 2A3JA 1RAEB 1ZBTA 3Q8VA 3TZZA 2XTJP 1BHNA 3U1NA 2VBWA 3DLJA 1U8WA 3I5BA 4UQTA 1L3SA 3HVTB 3ICLA 3QYYA 1JXVA 2RB7A 3KK1A 4JI0F 1VC6A 2PMHA 5MLCV 3BH6B 1EP4A 3RBDA 2RRAA 1S4FA 1S0MA 1V3RA 3D67A 4ZLNA 3DXBA 2FJXA 1EB0A 4AT1B 1GMWD 2X3DA 4P71A 2COLA 4NWBA 3PO4A 2ZBQA 4Q8FA 3ETMA 2YKMB 3OTDA 5KT5A 1LWCB 4IG0A 1FK9A 1B0PA 2K1RB 1YLXA 5LT5A 1FCAA 2E66A 2JC1A 3X1LB 2AZ3A 4ED7A 3RAXA 2ZNZA 2FHKA 1CEZA 3M8SA 4HKQA 4F36A 2LFVA 4DX8H 3IN5A 2MZRA 4RW4B 3MM5B 4QQBA 1IBLF 5HP1A 2W7OA 1WACA 5J1EA 3LPYA 2QLFB 2GV1A 1NMEB 1OSCA 3GSDA 4DSJA 2MHEA 3Q83A 1R3NA 2KVIA 4P2FA 3FCVA 3JTPA 3MCOA 2FC8A 2XB2D 2DPIA 5G4DA 2YWGA 2XI3A 1U47A 5DJBA 3PW0A 2NUUG 1YK9A 4A8FA 3AD8C 1K44A 1I51B 3UDVA 1VK3A 2WOMB 3IWLA 5D3GA 1LK5A 3TVZA 4LSZB 4CLUA 1VJWA 1UMJA 2B4PA 2UXBJ 2XSFA 3SQGB 4Z7CA 3DLKB 3T9ZA 2QSWA 3C14B 2RAQA 2W7PA 1RBLA 4RUBA 3A4TA 1C0UA 4CH7A 1S6PA 3AD9C 2F5GA 2XZWA 1H2VZ 3Q0AA 3GSIA 1SI9A 3QIPB 2HWHA 2GC8A 1NUEA 4EO6A 8ATCB 1HHSA 2R3VA 3BSCA 2OPRB 1J2VA 3TQEA 1RTIB 3QNWB 2M0GB 2LXFA 2CQHA 3CVKA 2CQCA 5ETVA 2J8AA 2IAJB 2F40A 2RKIA 1EKSA 4DL7A 5IOLA 3G6XA 1SJ1A 1YZ6A 2HHHJ 4FBUA 1ULRA 1TELA 4A4JA 1IWAA 3MM6A 4H4KC 2ZNYA 2E1CA 3P6YC 3LQVA 3NGDA 4DLGA 1UVKA 1JJCB 3V5RA 3M8YA 4F3QA 1M5HA 2CPEA 4DS5A 3HDSA 4GMKA 4ZVRB 2PEBA 3MAAB 1IQTA 4FYYB 5ETRA 4F50A 1DLOB 4JB8B 2X1FA 2E5GA 4LQ9A 2E5HA 4B3SJ 3HI9A 3V2UC 2DD8S 2WW4A 1VQ5S 2W9BB 3C16B 4JV1A 4AUKA 2B51A 3MGJA 2CKWA 2GJFA 2DTJA 2V9KA 3D6HB 1NK8A 1UFLA 5FJ4A 2CQ0A 4DL4A 3NGKA 3POTA 3VGTA 3W60A 1JLGB 1HBUA 4ZKAA 3J7Z5 3DRPB 1UZDA 4RNMA 2ZBCA 3W66A 4N41A 4DX6A 4KGXB 2BJ9A 1FA0A 4MKBA 3MI7X 3W62A 1KS2A 2AD9A 4J9MA 2DCLA 4DXLA 3RAQA 4CLWA 1TK8A 5BYSA 2M3DA 3V6HA 3IM8A 1KSPA 2UU9J 4GC7A 1APSA 3MUVP 3ZZPA 2HRYA 2AYMA 1WJ9A 2DIUA 2EG1A 4DX7A 1NM2A 2BEFA 4U96A 5J1NA 1F9FA 1ZZFA 4J90A 1XNQJ 1F9EB 2B5JB 3U02A 4ZPVR 4V1Ak 3BBCA 2U2FA 4J9NA 3FMWA 5J2MB 3ILLA 1NPRA 3BN7A 4ZIWA 5KFOA 2ZOMA 1YJTA 2Y1RI 3M9NB 1U25A 5LMNF 4DV1J 4LIRA 4AL6A 2NXEA 4DU7A 2JEGA 1SJ4P 4YMEA 2JJ4D 1U1NA 4WIQA 4IH5A 1XR7A 2AYEA 3W2WA 4WTOB 4OYIA 5D77A 1RHKB 4CP5A 2VB6A 3KOAA 3GIRA 4HL9A 2HVHA 4I2QB 3RR7A 2XZTB 3IMQJ 6AT1B 2GMHA 2KM8C 4CDIA 3DRSB 2ZJRQ 2LA6A 2JFKA 3Q86A 1BE4A 2NUHA 3UN2A 1WHWA 2QMWA 3BPDA 4K2JA 5E2QA 5ETMA 4WE1B 2DNLA 2ZH1A 4CT8A 1YDLA 1DJ0A 4ELTA 1YRXA 3M8WA 4K0KJ 4UF4A 4O3QA 4DFKA 2I0XA 3N6LA 3BEGB 3NS6A 3G4SS 5HBMA 1KVJA 1WF1A 3PFEA 2KZMA 4A8YA 5I4MA 4HTIA 3LWLA 1LW0A 3TA1A 1WOSA 3GYNA 4DG1B 1UP1A 2D74B 1K0VA 4KV8A 4J91A 3CC2S 1SCJB 5RUBA 1FD8A 1WI6A 4NL5A 3PHTA 4PXDA 2QL7B 4P74A 2W4DA 4QYZJ 1CSJA 3ENAA 3BR8A 2QV6A 4K0KF 4URGA 1SJ3P 1WORA 2Q6CA 3CGIA 2B8PA 4PPZA 5AJ3J 3M1VA 3CJ5A 3M4XA 3P8BB 1U02A 5F3ZA 2B3TB 2GNKA 2HNZB 2W2QP 2Y1JA 1QD1A 4N76A 1JX4A 2C28A 5EN1A 5D8HB 5KT3A 2P8IA 1BQNA 1GFWB 5KFQA 1LWEA 2MJUA 4EBEA 2IA6A 1YX2A 2L9NA 1PBAA 4O3RA 5KG3A 5M2UA 3PEJA 3EVWA 3FJ2A 4XIUA 4F4YA 4KO0A 2ZM6J 1Y5NB 1M5OC 2DXDA 6FDRA 4U7UD 3QWPA 1URRA 4H4MA 3L95X 3H2VE 1RLDA 4RWXA 3A8KA 3K0JA 2H4WB 3MEGA 4FN5A 4X62J 2CPIA 3D4JA 3GR0A 2W25A 2MMYA 3MMAA 4MKVA 1SC1B 4FP9A 2B9WA 3CW2C 5A8WA 3CMAS 1NDKA 3EJMA 1R0BG 3ZC4A 3T5HA 3BS9A 4F4ZA 2OTJS 4IYQA 4UZBA 2W8KA 3P4UB 1N54B 1NEEA 1U6FA 3VGVA 1KFDA 5KFHA 3BGOP 2HYIB 1H3DA 1T9YA 3U1LA 3VAKA 3GU0A 5KFAA 1X4FA 1MMNA 2HFUA 4B3TJ 2KB2A 2DB1A 2KL8A 5AXLA 4DR3F 2QEXS 4DR1J 1T9XA 1HWIA 1G1XA 4MYTA 4I2PB 2A18A 2ZH7A 4P52A 4RUAA 1HI8A 2VBZA 2A2DA 4ZP7A 2FHOB 3R27A 4L6V3 1LV5A 1PJ6A 3ZZYA 1AFIA 1F3FA 5J2QA 2HBQB 2N3LA 2E5LJ 3BGFA 4ZVEA 2NSCA 1IM4A 1KTQA 1IUJA 2GW8A 4L75A 1WC3A 2GAHC 2O5DA 1Y4ZB 1U1OA 3BO2A 2DGOA 4R8UB 3OL9A 3CCSS 2QGFB 1REVA 3BGRB 2G0CA 2C3OA 4ZP9A 1RT5B 4B3OA 4F3OA 2JH3A 4DPXA 3FZ2A 4ZHRB 5KG5A 4H4OB 5J2NB 1NO8A 2GQ2A 1RU1A 4RKUC 2Y8YA 2CQDA 1FJCA 1S12A 1E6YA 2L9WA 4ED1A 4H4KA 2K3KA 1VDHA 3KKFA 4N8NA 1MG7A 2E5LF 4GRSA 2OKQA 2I8EA 1RTHA 2R8HA 5A8KB 3CD0A 2R2TA 3DCAA 2YWWA 1N6QA 3VAJA 2ZC3A 4U9RA 1UZHA 4B9MA 1CULB 3DGPB 3K5NA 2C2RA 2IM2A 1ITPA 2VG6A 2D7SA 1TL3B 1XMQJ 1MN9A 1R8HA 4DL3A 3FFIB 2Q6BA 1S0VA 1FKOB 1VHIA 3AJDA 2QA1A 3KLGB 4DR4J 3UD3P 4P75A 3VALA 1Q78A 1FJEB 3UD5A 1N36F 3GYGA 3O8WA 3QT6A 4CRJA 4KHPJ 1T05B 1B0VA 4DU8A 1YJ9S 2FGOA 3KLFA 4C9DA 4YOEA 3JSRA 4L3NA 1C1BB 3M8PB 4UTGA 3PIOQ 5DRKA 1TKDA 3LH2S 5T7LB 1RCXB 3D2WA 4OI6A 1S1TA 1QUVA 4BLGA 3M9OB 1JJHA 5LMUJ 2JWNA 2V8PA 4KR0B 4ED8A 2HW3A 1X9WA 2WVEA 3OXLA 3KG4A 1VQYA 3D9BA 2CAJA 2EK6A 4YQWA 4YR0A 1F9HA 4OHVA 3SSSA 2ZZMA 3GIMA 3MEKA 3DDIA 4G1QA 4K4UA 5E33A 5D4OA 2X1AA 1S9FA 3CCMS 2QX0A 1S9EA 4KHPF 4JI4F 5FIIA 1CJKB 3VR1A 1K1QA 2V4JA 3AD7C 3D0HE 2IRXA 3WQPA 3HFKA 3OJSA 2ADCA 4BWMA 3ONQA 4NLUA 4F04B 3QT8A 3M6XA 1HQEA 2G1HA 3B54A 5KFJA 1NKBA 1C0TA 5C7PA 2AJFE 5C2GA 4QR2A 4KKOA 3THTA 1N32J 3LO3A 3V81B 1RDRA 2JVOA 2J5AA 1HYSA 4DCPB 1RT3A 3EM1A 4OI0A 2R7UA 4MTPA 2GJIA 4YB1P 1TFYA 3DRRA 3JQKA 2LVWA 1QSYA 3D6MB 1RAJA 4MMOA 5E3AA 1DRZA 2HEKA 3UCUP 3CJQA 4W98A 5I42A 4JI2J 2MQLA 2B0GA 3QT5A 4LQ3A 1FKAF 2C2NA 4CT9A 4ZJLA 3K2YA 4W90B 4RW8A 2CXEA 2JZ8A 3CEDA 4F0KA 4YY3F 2IJFA 4C11A 1RT4B 2IBOA 1XAOA 4R5PA 2FJVA 4M5KA 1EARA 1RZMA 1EETA 4YHHF 3K8VA 3KLVA 1EZZB 1N32F 1X5SA 5C42B 3BB5A 2KXHA 1WSRA 3IRXB 2Y0BB 2OHDA 3MM9B 4CH1A 2YNGA 2FJBB 5A6WA 3K7RA 1S9GA 2QSFA 2VZ9A 4IKAA 2ACYA 2UVUA 1I94J 3H2UB 4LSNB 4ER8A 2B7CB 4CO5A 2K8GA 5THWA 2LXIA 5K14B 2OD6A 4R0EA 1Z2LA 2ZE2A 5K9FA 2G2ZA 3OUYB 2DITA 2B9EA 5IC4B 2EFPA 4DV6J 1FXLA 4L73A 4B9UA 1SJQA 4GKKJ 3F41A 1N5VA 4YR2A 1PC4A 4DL6A 3EXCX 4EBCA 4B3MF 1WD6A 2YKNB 3GPAA 4MKYA 5C24A 3HHNB 1I94F 3FDSA 2EW9A 3MAQA 1Q7LB 3FEYB 1UWBB 4U8YA 1XJWB 3J81U 3H40A 4CO3A 1UKUA 3KG1A 4L76A 3GFYA 4CYUB 4GVBB 1HNIA 5AXKA 4RBTA 1YVFA 3ZTPA 2ZH6A 3BN4A 3G86A 2HNYB 1NK7A 4JYAJ 3HFZB 3R5DA 4ZMMA 3OTEA 5C5JA 1VRTB 3TEHB 3SXLA 3FBCA 4NX9A 4NZ0A 2HWTA 5IT9Y 5KT6A 1HFEL 2IC3B 5HO4A 3ET6B 5KFCA 5GMDA 4J37A 3HZEA 1SQEA 4ED3A 2UXCJ 4C8ZA 4CM2A 1OYDA 4ED2A 4DLEA 3IWNC 4ZJOA 4X65F 4DOZA 1WEXA 3PKMA 1RT6A 5DLFA 2WSEC 1NB7A 1QTNB 3D1HA 3MPVA 2VA2A 2VG5A 2AGQA 1N5TA 4KPYA 1U09A 1VFJA 3A8EA 4JI3J 4K4ZA 2XZDB 1TMJA 3X3UA 5JVGQ 1QAIA 4IG3B 4CLPA 5CCMA 2EEYA 2FVCA 1F5BA 1SPBP 1BY9A 1YJRA 3W5YA 2H48B 5C25B 4JOUA 3QZ8A 2DNKA 4HT7A 3OFHA 4NLQA 2MYFA 2GVZA 4LF1A 2KFYA 3SEOA 1TUWA 1ZOTA 3DMJA 2DNHA 1Q0NA 3DKDA 1BQMB 2XY7A 2DXFA 2LQJA 4UY85 3CTRA 3TWZA 2ZJPQ 1QM9A 3CJ8A 4EUVA 2ATLA 2ZDOA 4WPAA 3TZXA 4FXVA 5LSOA 3KUEA 2BW2A 3PX6A 5DDPC 2XMTA 3N6MA 2XI2A 4JI8J 4N5SA 1OJ4A 1IKXB 2CQ4A 3M2RB 4DV4F 3M2UB 4CLYA 4WF9Q 5AXNA 3MDFA 5KG0A 4TU7A 3WC2A 4URSA 3MOZA 2XQCA 2N82B 2HFZA 1FD2A 3V4IA 2HAIA 3IS9B 2DEJA 4KY3A 5B0FA 7AT1B 5IQQA 2B43A 2AU0A 2ASDA 5BXIA 3IR6B 4RBUA 2DYAA 1C1CA 4UOHA 1HQUB 3M7VA 2V4QA 3LALA 2DGSA 3CCUS 3PW2A 1ZM2A 3H98A 2QMXA 5A76A 1U45A 4Y2CA 4DCJB 5J2PA 4ZIVA 3CPWR 2WK4A 2R7TA 4JI8F 4AE5A 1TK0A 2Z58B 1VI7A 1T02A 2DRBA 1OY9A 1X9SA 1VLYA 1WC6A 1TL1A 2XG8A 1NRKA 4WFZA 4FF2A 3J7YU 4E2FB 2AYBA 2L08A 2DGQA 2J7UA 3UVJA 1AB8A 2HNDA 3D0GE 5IT9U 3T5LA 5DGBA 4ZP8A 2BXJA 2W2NP 2R7RA 2KFNA 4DUZJ 1FWPA 3F44A 4DFMA 2XY5A 4F8RA 1U26A 3N5FA 3TAQA 3PHEA 4HI1A 2HS4A 1ZAVA 2V2KA 2HQDA 3DGVA 4NEYA 2LMIA 2D3UA 4DR7F 4OX8A 3Q8UA 1HMVA 1JLAB 4DV0F 4ZVHA 2VG7A 1DTQB 2V63A 3M8QB 4DR2J 1T11A 3W7BA 2QLWA 2AGOA 4LF9F 3PKYA 2DGTA 4RW6A 3GZ7A 4WFXA 1VQ7S 1SKUB 2V8DA 2FTRA 2BQRA 3M32B 3OL8A 4NA2A 2QJ3A 1UVJA 5CHCB 1TL4A 4TYAA 3RBZA 5KTQA 3TJ8A 4LF8J 4LFAF 3QLHB 2KXNB 3QAUA 3MFHA 1P9YA 2JRSA 4PKDB 1I6JA 3G82A 3CB4A 2I9SA 1F3VA 1Q8LA 4K4XA 4M95A 3PTWA 1PYTA 3AFGA 2FYXA 2DJWA 3G87A 1ZM4A 4F0MA 1RXOB 2M7SA 4JI5J 1AROP 3GFXA 2R8GA 1RP5A 2UV8G 3DN9A 3HVAA 3K89A 3FVYA 3WX4A 2ZBIA 3P49B 2M2BA 2UXDF 1MROA 3HJVA 4U67Q 3WX8A 3KWMA 2YKMA 3NG8A 2J8SA 4TLRA 3SDEB 2CNLB 4G6VB 4ZPDA 4MFBB 2EXUA 2KG1A 1YQHA 2XMJA 1JKHB 4ZN3A 1NZAA 2EKYA 1PGZA 1N5YB 1KLNA 2EFNA 1NKEA 1T94A 3UN3A 2HBYB 4DPOA 4HEA9 4EGLA 3UW1A 4EZ9A 3AH6A 4DR6J 4OL8A 4M5DB 1UJ6A 1VBKA 1B7YB 3R3TA 3S1TA 2YX7A 2BRKA 3GYXB 5IQ6A 1U1LA 3CT9A 2OEMA 1XNRJ 4B3RJ 2V8GA 4A8MP 1GTHA 2D9OA 1YTYA 4CNZA 4YUDA 1LFWA 1TVRB 3H59A 2ZKTA 5HQMA 1M1KT 3R1HA 2HHUA 5A2QY 3DLGB 4PXBA 1RTJB 3N5BA 2G13A 2C3YA 1FKPB 4EU0A 1DY3A 2VQEF 4OV1A 4DL5A 4RLEA 2W1BA 1Q86T 3IG1B 2PMZD 5CXTA 2WOMA 1N33F 4O44A 4W92B 3RB4A 4FZVA 2Q1LA 1IQZA 1T9UA 2DNMA 2GAGC 3BSNA 1MN7A 3SQGA 4JV5J 2MHNA 5KOWA 2VODA 4O4GA 3DLKA 1XNRF 3HLUA 4PG4A 3GJSB 3FQKA 3C14A 1D9AA 3IGNA 1VHFA 1KLMB 1Q1KA 4TQSA 1YHQS 3MMCB 3QSIA 4I6AA 5CYJA 1CBKA 3H90A 2JHEA 3OFEA 3LGHA 3C6TB 5KG2A 1IBMJ 3MR3A 5KFDA 3GP9A 1P9QC 2OPRA 2DNGA 4ED6A 3NMRA 3LP0A 3N9UC 4FF4A 2QZ8A 3FBBA 3KJVB 1HNVB 3FBFA 3I5AA 1B7FA 1QSLA 4Q2LA 5AE1A 1PJ7A 1O5JA 4I4BA 4URQU 2RD5C 3CDAA 4F26A 3UNGC 1FXDA 2ZKUA 3FCHA 2JEFA 3N4WA 4X4NA 3MAAA 4E98A 1T3OA 4EZ6A 2AJ0A 2FJAB 3MM7B 4FVCA 3AT1B 2F9JA 1AXQA 4YP3A 2ZD1B 4LREA 1WOOA 2F4FA 4M5NA 2FVSA 4DPTA 2MZSA 4TYBA 2W9BA 3I0SB 1VQ9S 2MJNA 4NI2B 4ED5A 1X4GA 4AQYJ 3L7PA 3G71S 3EZ5A 4CH0S 2DY1A 5DZ6A 2VICA 2HFVA 4IDKB 1JNZB 4Z7YA 1KEKA 4WP3A 3MUMP 4M5IA 4KPCA 5CZXA 2F65A 3KLHB 4KGZB 1SQGA 2VBYA 2CVEA 3K8WA 4FF1A 3DC2A 1B99A 2BJ8A 4DZ6A 4LMZA 1IWGA 4TKTA 4C2MA 4WYWA 5FDLA 1FHTA 4CO4A 2GCFA 3CO9A 3HVRA 1D3WA 3NNHA 3LAKA 5KFKA 4Q0BB 1I3OB 5KFIA 2C2ZB 5HVFA 2BV3A 1PC5A 1KQFB 2IYIA 4UOFA 2RE1A 3HO1A 5A2QU 1SIWB 1QDUB 1SJRA 3O1LA 4DDFA 3GIJA 5J2MA 1JLBB 2RQCA 4DPWA 2MKJA 2KJWA 5L1IA 2CJAA 2YKAA 3GE9A 3R6LB 3VAMA 2KVQE 4RNFA 3QGIA 1X4DA 5A6PA 3B8HA 1P27B 1ZPWX 2OP5A 3DOMA 1PCAA 3Q2TC 4U8VA 1HW8A 1CS4A 3D3BJ 2V2VA 2XY6A 2BKNA 1YBAA 1BWEA 4OZ2A 3ENWA 3P5BP 2ZH8A 5KFEA 2Q66A 4B17A 3AB4B 1BMQB 1SXLA 1VLOA 1Y3JA 1SJFA 1N0VC 1NK0A 1Q16B 4ZLPA 3NGUA 3DRSA 4JI1J 2HHPA 3ZZUA 4DL2A 1S97A 2C2EA 1AUDA 3UR0A 4DV2F 2W4PA 4WE1A 3DU5A 3M30B 1J27A 2DHAA 2CVIA 4K5RA 4DL0C 4EYHB 3BO3A 3UR3C 2RMLA 3N28A 1TAUA 1F6TA 4OMFG 1M0SA 2XSJB 2IBKA 4M63A 4NA3A 3J81j 3TUJC 1Q7YT 3KLIA 1FRLA 1X8DA 3T3FA 4KE5A 4JI1F 4DQIA 5AE2A 3FC9A 1FRJA 2I38A 2PFFB 3I6PA 2LQ9A 4DUYJ 2V5HG 3PIPQ 3GTYX 2EK1A 3B6BA 5DDRC 1N4LA 2N7CA 4ICLB 2OPQA 4EBDA 5L1JA 3NS5A 3BREA 5CYQB 2R42A 1MMLA 2QLBB 1V5VA 4K59A 3FEZA 1IM6A 1RWNB 1XEZA 3CDBA 2HNZA 3DLLQ 3UWTA 1AA1B 1Q53A 3QJPA 3D54A 1JLFA 4TY8B 1J5OB 2O1PA 3PRBA 4N56A 3NMAA 1W2IA 5T41A 4C6AA 1U2RA 4N8OA 2CPXA 1YI2S 1NLKL 1DFDA 1WF0A 2KTQA 1U4BA 4A8XA 1NU4A 1SVDA 1W26A 4OZNA 2RNEA 1BD6A 3VGSA 2IPOB 4I6WA 4C48A 2KO1A 2ZWPA 4IRKA 3EGWB 4NLXA 3VAFA 5KFUA 4Q43A 5GAEI 4O3PA 1K9MT 2XEXA 4OX7A 2CPJA 3PX4A 1WDTA 2D69A 1HWJA 3TW0A 1M5KC 3PEHA 1WKLA 5KT7A 1O8BA 4L72B 4M8LA 3W8GA 1HBMB 3N6NA 4M94A 3B4MA 2GO9A 5HI7A 1RTDB 2FUG9 1FERA 3TNVA 4QYZK 4JI6J 3UI3A 1KOOA 4NXNF 2VV5A 2R8JA 4I2PA 2W2MP 3RYLA 2VASA 1WSVA 4X66J 2PT0A 4J9PA 2DGWA 1Q8KA 1RHJB 3CDWA 3QAEA 5F8MA 2GHVC 4WU2A 1KR4A 4C3MA 4PCQA 3QMQA 4ZK7M 2IM3A 2PEHA 1KVKA 3V6DB 1SBRA 1K47A 3LUYA 4LBHA 4Q45A 3L9ZA 4XDCA 4MYUA 2AZ1A 3HVWA 1RWXB 1S57A 2DRDA 2ZEJA 4JI6F 5SUHA 2X1BA 2CFXA 3UNYA 4ZHRA 2YQ0A 4BC7A 1ZETA 1GX6A 1Y7PA 1IR0A 3I32A 3TI0A 4ED0A 1S1VA 4X66F 1CLFA 2V9WA 1EX8A 5GAGI 1JLCA 3DDNA 1RAAB 2JFDA 2MY7A 4ELVA 2ALZA 1B4SA 2DCUB 4DN9A 4FXDA 5JXSA 1YBTA 5D78A 5A8KA 1JMTA 2J7WA 1TFWA 5H1SV 2NREA 2ZH3A 4R25A 1IKYB 3F0NA 3DGPA 1PYSB 1TKXB 4C8LA 2FJDB 3I0RA 3FFIA 5I3UB 1L3KA 2B9XA 1FKOA 1CJTA 3KLGA 2DHHA 2UUBF 2DNZA 4C8MA 4IFYB 3CIMA 3J7AN 2GMLA 1QJHA 1M5PC 2YWFA 1BUXA 2VH7A 2ADBA 3MFIA 1T05A 3HPOA 1HPZB 2CQIA 1R0AA 1RI7A 3HSDA 4Y65A 1T8EA 4I7FB 1C1BA 1DTTA 3MECA 3PDNA 4HYKA 2PE8A 3ENVA 2D41A 4TY9A 1TUVA 2VU5A 1YJUA 1YZ7A 2R7OA 3R5AA 4P7TA 1U0SA 4FXWA 5G0RB 1H2UX 2YKOA 1N56A 3NS7B 2KHCA 5IC6B 5B0CA 3QRQA 3BDPA 1HW9A 1S5ZA 2FHJA 4LUBA 1NBEB 1CJKA 1PO6A 5T14A 5DG8A 2HGMA 1XQIA 1N8RT 3PW4A 5A8RB 1HI1A 3RJMB 4IG0B 1HI0P 3DHWC 5GAHI 1FK9B 2Z30B 4EMDA 2KJVA 4MK9A 4UQGA 4F2RA 3OR2B 2EFQA 3R97A 3UPFA 4DR5J 3T5KA 4WXWA 4YB7A 4XPCA 2BKPA 4F0HA 1OWXA 4WYLA 4RUCA 1VRUB 2GX8A 3BQ2A 2XO6A 1KONA 3VQTA 2WCXA 4E0DA 1HL6A 1W2BR 1RWPB 2PA3A 2Y1IA 2H3EB 1FJGJ 1RT4A 3WDOA 4NASA 4ZPBA 2HFNA 2QRRA 2D9PA 3BSOA 1YG0A 4KIAA 5K8OA 4FF3A 2HURA 4DN0A 2RT3A 5C42A 2CJBA 2DO0A 3G8SA 4OZ1A 3MM9A 1JLQA 4C98A 1WNEA 5D3GB 8AT1B 1S79A 2FD2A 4TQRA 1H38A 2AEFA 1VCTA 1N34J 4LF4F 4LF2A 4KSEB 3LGNA 3K17A 1JK9B 1C0UB 1S6PB 3CCVS 2KHDA 1YBUA 2E29A 5E41A 4RW9A 5ETPA 2VPZB 3FBEA 3UDCA 1TL7B 3RBXA 3D3CJ 4Y2IA 4ZA1A 2VF3A 4XAKA 5DQIA 4ANEA 5ETOA 2BBEA 3CCJS 2YKNA 2KKHA 5ETKA 3NCRA 4IOBA 1UWBA 1N34F 3SI8A 3ULHA 2WB4A 4IRCA 3VVUA 3W5XA 4DV7J 1S0OA 2RKIB 4V19J 1ZA1B 4S0MA 2GGPA 1RWWB 3UN5A 4GVBA 2BRLA 1LWFA 4EYIB 4HDHA 4DX5A 2E1PA 2LQBA 3CNQP 4NLPA 3G6VA 4DV3F 2K7JA 3ZZZA 5HMZA 2FJWA 2QYCA 1XR5A 1VRTA 5CD4A 1VRQC 2E5JA 2CA9A 4Y6IA 3ET6A 1D1UA 2ZZNA 2A2CA 2RDJA 5HLFB 2BOPA 1LW2B 1S0NA 2WVDA 4OX9F 5IS2A 3MUTP 2HZVA 2CQPA 2ZWOA 2YNHA 5HMXA 3POTB 2OPSB 1HBNA 5DO2A 4ENOA 2BE7D 2DISA 2FVPA 3C15B 4QBUA 4ZOSA 3JSBA 2FY8A 1HBUB 2RSQA 2AKWB 5KFRA 2R7WA 1XC9A 1UL3A 3EZUA 4ECYA 2OLWA 1FRHA 2I2YA 5EX0A 4DSLA 2G0IA 3CMES 2ASYA 1R43A 5F41A 3A1YG 5C25A 1FE0A 1H73A 3BPSP 1FI4A 4OLOA 2PI5A 2YWEA 1HR0F 2A10A 3IM9A 5B08A 2F4VJ 2IVMA 3I55S 4DFJA 1RU2A 1SUQA 5BR8J 4ALZA 2QIFA 1BQMA 3GCWP 3QSYB 1NJIT 2BE2A 2VFUA 4PG7A 4X4VA 2GHPA 1FRXA 4PWDB 2E9RX 1SL2A 5K8NA 3A3PB 4J9KA 3SV3A 2BYCA 4KBIA 2MQ8A 2P6SA 2N4DA 2XWXA 2N3OA 1U1RA 1IKXA 2DIVA 1H2TZ 3M2UA 1EQ0A 4QU7A 3SFUA 2F4VF 3W5ZA 1Z2ZA 4QCLA 4IRDA 5DETA 1K0TA 4UOCA 3H4DA 5BR8F 1RB0A 4ZVUB 2J6TA 3RB6A 1OPIA 2DNRA 1A0OB 2D1CA 1MWQA 4U7UK 4LSLA 4YB6A 2JLGA 2O3DA 3NGTA 2IMOA 4F4AA 2B26A 3Q22A 3AY0A 5LSLA 4USIA 1IKVA 4Y0FA 1D8YA 1Y9OA 4NLSA 3D6TB 4IO1A 5I3QA 5LM7E 4P73A 4J9RA 5IM0A 1K8AT 1X5OA 4NCGB 2XCAA 3C2PA 1LW0B 1A9NB 7FD1A 3ITHB 5AXMA 5LJ5Y 4KV8B 5DS7A 5SZTA 3KK3B 4ZCKA 2HLUA 2OFHX 2VDIA 3SBMA 5GAGU 2Y0SD 1MWZA 3LANA 4AXIA 1QY7A 4CNYA 2HVEA 4CTAB 3W3SA 1EQMA 1KBRA 1JQGA 2EWHA 5CQGA 4HVZA 5ETNA 4UZCA 1SB6A 2MY8A 2HBZB 3P96A 5KFYA 2L9DA 3JS9A 4EFAC 1T95A 2HZAA 3TANA 4F25A 2MQNA 4MAKA 1JLAA 4QW8A 1DTQA 2FHMA 2MSTA 4ES3A 2BJ7A 3M8QA 5EWGA 3NLCA 2UUTA 1NXIA 2F9DA 1U1KA 5F9NA 4QW9A 4C8OA 1NDCA 2ZH5A 2LXUA 4OYXA 2IM1A 2KYZA 2W4CA 5K20B 3CDEA 3JXOA 4MT1A 3M32A 4ZVFA 3Q8SB 4ATNA 1DZ5A 4QPXA 4H4MB 2P2CB 3HHLB 4PRFA 5EWFA 2UVVA 5KT2A 2CZ9A 2UXBF 4KTQA 1M5SA 4WTYA 2C42A 5K8PA 3GJQB 3BKFA 3MMAB 2QA2A 3DOKB 2CYYA 1RLCL 1Y11A 4ZPCA 2O66A 2R8KA 5HAOA 3NXZA 1RJJA 2BJEA 1UVMA 2ABYA 1HWLA 2CQ1A 2L3MA 2UP1A 3HSGA 2VJUA 1WHXA 2AGPA 3AGYA 3FRZA 5D0GA 5GAHU 4KHRA 2MLZA 3LZ8A 3OL6A 2VHGA 4F4WA 3FSYA 5F0WA 4RPFA 3SDEA 3PYEA 2FZGB 4M5HA 4MFBA 1GK8A 5B0GA 2B6AB 2R7SA 2ZITA 3R7BB 2RRBA 2FB0A 2U1AA 4WP8A 4DV5J 4RO0A 3H2LA 1N5YA 1CVJA 4LF7J 4J9VA 1LEOA 2HHHF 3N01A 2LCWA 5EUHA 4P2MA 4B9TA 4M5DA 2AX1A 2WONB 1SH0A 1K73T 3FZBA 1D9FA 1YRUA 3W2VB 2V67A 1REVB 1X5TA 3MMJA 3VGUA 2KFZA 5J1PA 5HK4A 4TU8A 4B3SF 3FKBA 3AGXA 4HACA 1TVRA 1UJ4A 5D4NA 3NOGA 4CLKA 4ZITA 4X64J 2LEPA 1OMSA 3HKWA 1RTJA 3LP1B 3HSJA 4FNIA 3M6UA 3UE2A 3Q8YA 3DLBA 2RU9A 2OPPA 3T9NA 3KHGA 3CD5A 3IG1A 4MIWA 2YNFA 1RTHB 3GILA 3VAHA 1N6QB 3D1OA 4OI4A 4FNHA 4C8KA 2VG6B 1T03B 1IJFB 1SKRA 3AJ2A 1NLTA 3VZHA 3TZYA 1CJVB 4ZVPB 5L46A 1YJVA 3MPUB 1WI8A 3ISND 3LW5C 2FQQB 3MMCA 2LQ5A 1LK7A 1UFKA 5F8NA 2UU9F 2ZHOA 2C22A 4QIEA 4C0OC 1JXEA 3C6TA 1RKJA 3AODA 4M5JA 1OO0B 1T9WA 2XMKA 4W4MA 4I67A 2E5IA 4DPUA 1WEYA 1VOMA 3OLAA 3PO5A 3LOUA 4EO8A 1KFSA 2R8IA 4U7CA 1XNQF 1KC8T 2CRLA 1SKSA 5CYMA 3KJVA 4ZVQB 4J9SA 1P1TA 1KQSR 3CJ0A 1R89A 4NLYA 4C7QA 1Z1ZA 4JI7J 1SC4B 5HL7Q 1C3GA 4G1QB 1ZYQA 4O4RA 1GTEA 3CWJA 3EDQB 1LNQA 4I68A 2HFOA 5LJ3Y 4DV1F 5F9LA 1U24A 3NWGA 1FDDA 4IQMA 1KN6A 2V4JB 5ETSA 4PQUA 2HQ3A 3MM7A 1UA0A 4KGKA 1VQ8S 2DY9A 3GONA 1HQEB 2ZD1A 1C0TB 4CLZA 3PRDA 4KKOB 4L3KA 4QWDA 3I0SA 1W25A 1RTZA 4ECUA 4KC5A 2XHWA 1LWXA 1HYSB 3SSRA 1HLWA 1UVLA 1UCNA 4OJ3A 3T41A 4PABA 3U1MA 2XNQA 4WZQA 3KNAA 2I6WA 2N7YA 3HM9A 1TR0A 4RW8B 2IMWP 1GXUA 3C8YA 3AA8A 3VZIA 3MTKA 3MR2A 2YNIB 4ZPWR 4GO7X 4ZVOB 3H42A 4CLTA 4R5PB 3CJTA 5D4PA 3FMBA 3VF0B 2NS1B 1RCOB 4FVMA 4F4XA 1EETB 2KM8B 3ELHA 3IBFB 2R7QA 3CJKA 1JXLA 4JV2A 4Q0BA 3QATA 3PNIA 3MPWA 2DNQA 5F8HA 1LFPA 3I82A 4NYOA 3D28A 4LRBA 4IQXA 1QAXA 1Y10A 1S9GB 1QTMA 1RAFB 3KYLA 4I6YA 4FPRA 2UUWA 1S7IA 3EZOA 2DNYA 3OLBA 2FZKB 3EPIA 1TV6B 2ZDPA 4OX6A 3AHPA 5AJ3F 4JV0A 2VA3A 3RAMA 3DYAB 3K5PA 1NJWA 2EKNA 4RJVA 3KJFB 1FDBA 3NAHA 1UEKA 1RT7B 2NXUA 1FRMA 3EPGA 1S59A 3QJLA 2DR5A 3MM8A 3OV7A 3TVYA 3BQ1A 1OY8A 1X4EA 3HSZA 1FFSB 1OYEA 3TUZC 5IV3A 2VQFJ 2D3O1 2OI2A 1QE1B 1TMMA 3Q8RB 3JQJA 4RNHA 2ZOGA 4HHUA 1BC6A 2ZM6F 2BABA 4MK7A 4M5MA 1KKHA 1NH8A 1V3ZA 5BYRA 2SXLA 1EJ7L 4KB7A 3BGLA 3DOLB 1L3VA 4LVOP 4X62F 1RISA 5KFWA 2UVRA 5E3QA 4CZCA 3JB9k 3LF0A 2BA9A 3RU0A 3PV8A 2NPIA 2MXYA 1N5SA 1RHMB 3H4BA 1AZSA 4QIVA 5KFZA 1RQ0A 3DLEB 5DLGA 2YX1A 1U7LA 3BKUA 3T1YJ 1OY6A 1Q8IA 2I5JA 1ZH5A 4ZLJA 4HHHA 3J7YI 2GVDB 2LDIA 4LFCJ 3E8OA 4B3TF 1RT6B 4PG8A 3NCPA 5HN0A 4DR1F 3EMTA 2BE9B 3R5GA 1SL1A 3RUBL 1H74A 2QMUB 5K5MA 4NLDA 1MU2B 2B4UA 1KHVA 1HIYA 4WIIA 2IA0A 2EFGA 1RWVB 1E6VB 4N77A 3JSMA 4JP8A 5CYQA 1S76D 2PGCA 3T1YF 3RGIA 4AXJA 3T5JA 2RIJA 3OHBA 2FVQA 2HZCA 1DARA 2Z8QA 5F8IA 1NJYA 3DI6A 5EHHA 1VQPS 2C1EB 1U0HB 1XN9A 3F73A 3QRRA 2GVZB 2YWKA 5ETTA 5KFTA 2MQQA 3KLEA 3DMJB 4QYRA 2AYGA 1S1UB 2F3JA 3FSXA 3KFWX 3I5CA 1FESA 2PA8D 1PIEA 3CD7A 3J81Y 4LVNP 3AB2B 4UY8T 5IT0A 1V9OA 5KFFA 4JBCA 4NE9C 5B0BA 3OTBA 2XWYA 3VVTA 4UW2A 4O0NA 1IVZA 3TX0A 2B8QA 1XMQF 1GQEA 4LBPA 3GFHA 4OYOA 5JUMA 1NDPA 3I9V9 4DR4F 3NNCA 4FYDA 2CPZA 4O3SA 3KHLA 4MIBA 2VKRA 1N52B 6FD1A 2NYIA 3TUIC 2KG0A 2OMOA 3E3XA 3MMBB 1HBMA 3EGVA 3DM2A 3KMQA 3SV4A 5ETQA 1FDAA 4QR1A 3NOCA 3THPA 1GT8A 1TUGB 1DQ9A 5LMUF 2CNOB 4XO0A 1LXNA 5KFMA 3T19A 1IR1A 1UTAA 5KFNA 2G1DA 1HD0A 2JL9A 2ODXA 5HANA 2V4RA 2WVFA 4PWWA 2V8VA 1TL1B 1B0TA 1VISA 4XDDA 3AXMA 3GR1A 1OSDA 2IDEA 2ASJA 4ECQA 4TNOA 1WOPA 2F7VA 1D0EA 3UVJB 5IWAJ 2HNDB 5L38A 2J0XA 4IFVA 2OUGA 5LL6d 1NNDA 1F1BB 2EBEA 1NK9A 1FVQA 4DQQA 2DR6A 1KDNA 2V8HA 3R7NB 1Q8BA 2PDAA 4NPOA 4OJHA 4EEYA 1HNXJ 1O0PA 4Y2MA 4USJC 4PEOA 3RRHA 2RVJA 2JZ5A 4MKAA 4HH1A 3R1LA 2AHOB 4JI2F 1ZS6A 2HHVA 2H51B 3QJJA 2AV5A 1RAIB 1TKXA 2VG7B 2ZUGA 3KNGA 5IWAF 3K5MA 2JSXA 4JI0J 2DPJA 3IR5B 1WC0A 2J0QD 3W64A 2XNRA 2VC0A 3BGUA 4IFYA 4P7VA 2CPFA 4PQAA 4KQZA 3QFHA 3R5CA 1WG1A 1GX5A 2JRRA 3KK2B 2QL9B 4KFBB 2WBMA 1HPZA
chains in the Genus database with same CATH topology
3LA0A 1GMWD 1EARA 3I38A 1NLTA 3TJAA 1C3GA 2B26A 3NY0A 1GMUA 3AGXA 3AGZA 3L9ZA 3AGYA 1GMVA 2Q2GA 3LZ8A 2QLDA 3TJ9A 1GMWA 3NXZA 2HFVA 3TJ8A 1XAOA 4J80A 4L3KA 1EB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA0 A;  1GMW D;  1EAR A;  3I38 A;  1NLT A;  3TJA A;  1C3G A;  2B26 A;  3NY0 A;  1GMU A;  3AGX A;  3AGZ A;  3L9Z A;  3AGY A;  1GMV A;  2Q2G A;  3LZ8 A;  2QLD A;  3TJ9 A;  1GMW A;  3NXZ A;  2HFV A;  3TJ8 A;  1XAO A;  4J80 A;  4L3K A;  1EB0 A; 
#chains in the Genus database with same CATH topology
 3C6U A;  1PG5 B;  2J0W A;  2RF2 B;  5A0Y A;  3CCW A;  4WK1 A;  1S1W A;  2CWK A;  2J9D A;  1HAR A;  1FFG B;  2H5J B;  2ZZT A;  3QID A;  2LU1 A;  2HWI A;  1R8P A;  2CJQ A;  3CC7 S;  3A3O B;  1ZTT A;  1F0X A;  3UCG A;  3G82 B;  5G0R A;  3EE3 A;  1JJ2 R;  2DH9 A;  1JIH A;  2ZOF A;  4LIW A;  2XMU A;  3NGS A;  4J9L A;  4F67 A;  3GV8 B;  3US5 A;  2AQ4 A;  3JTO A;  1IBL J;  1MNE A;  3D7S B;  4CM0 A;  2DR9 A;  2MZQ A;  4DV6 F;  4OI1 A;  2BOA A;  4X4U A;  4GKK F;  2V50 A;  1HA1 A;  1X7V A;  2XS2 A;  1L3T A;  3K5L A;  4Q5V A;  2DR8 A;  3TUP A;  3UDE A;  2ZFH A;  1MRO B;  3HCX A;  4HR2 A;  1B64 A;  2HQF A;  2J6S A;  1UVI A;  2A0F B;  1QAY A;  3T6B A;  4DEZ A;  5A8R A;  2YH1 A;  2QA4 G;  1R0C B;  2LDY A;  2CG8 A;  1D09 B;  1O6X A;  4NCA A;  1RWO B;  1TKZ A;  3OR2 A;  3PCO B;  3OJU A;  2CJY B;  3T1H J;  1RBO B;  5KFL A;  1GXL A;  2IDL A;  2HMI A;  3E51 A;  3ZNJ 1;  4YDD B;  2XC9 A;  1VRU A;  4JYA F;  1FWL A;  3HHL C;  4O0I A;  4FYW B;  3R7S B;  2JNJ A;  2I1R A;  3W61 A;  2Z56 B;  2JDJ A;  2BM1 A;  3WBZ A;  3PVX A;  2OFG X;  4ETZ A;  3HT0 A;  2HFS A;  4LR7 A;  1CQN A;  4Z2X A;  3R6G B;  2UXC F;  2V68 A;  2L48 A;  1ICE B;  4UUX A;  3UFC X;  3T1H F;  3R5J B;  3IRW P;  2BAN A;  2YPZ A;  3O2I A;  1RT1 B;  2JC0 A;  3U27 A;  1VIX A;  2GQC A;  4AL5 A;  1N88 A;  3LPE A;  4NML A;  3HFV A;  4O44 B;  4ZPT R;  4RW7 A;  4PG6 A;  2L41 A;  4JI3 F;  1NHK L;  4O4G B;  1X4A A;  1RAG B;  2OML A;  1VQL S;  4RX6 A;  1GH8 A;  4ECW A;  2R2U A;  1H98 A;  2OD4 A;  1VBY A;  3KXD A;  3CJS A;  4RNO A;  3CF5 Q;  1GMU A;  1NSK L;  5GMK a;  1BXN A;  3OVA A;  3BYR A;  3GV5 B;  4ECS A;  2YQ3 A;  3L4B C;  1TL7 A;  4HT5 A;  1RYR A;  2VKZ G;  3MD1 A;  3E01 A;  3OTO J;  2J6U A;  3LP0 B;  5GME A;  1HWK A;  2EG2 A;  3QGH A;  4OI2 A;  5ADZ A;  4OFZ A;  2GMJ A;  4ANC A;  2MZT A;  4P6Q A;  3M2V B;  3ENQ A;  2CNK B;  2MZJ A;  2WZ1 A;  2VBX A;  1S72 S;  5KFV A;  2MLY A;  3Q89 A;  2FZC B;  4B08 A;  1WEZ A;  2HRT A;  2HGL A;  4J5O A;  5DG7 A;  2AEJ A;  2H5E A;  1FX4 A;  3MHY A;  1FF2 A;  3OTO F;  3OQ2 A;  4ID5 A;  2WBR A;  1PAE X;  5CH7 B;  2RUS A;  2CUY A;  4ZJQ A;  2R7X A;  5HLF A;  2V2Q A;  1LW2 A;  1KWM A;  1HBO A;  1CJU B;  2MQM A;  2YY3 A;  2CDQ A;  1H0H B;  1X5P A;  1CC8 A;  3BJY A;  3CCQ S;  3GIK A;  5KFP A;  2OPS A;  3C15 A;  1HNW J;  4BHQ A;  3CDU A;  2AJ4 A;  1M1G A;  3A3N B;  1Y3K A;  2CJX B;  3D6F B;  1S1X A;  3PXG a;  2EI5 A;  3Q24 A;  3H5S A;  3PYD A;  2DGU A;  5KG6 A;  1X31 C;  5FDL B;  3PRV A;  1CPZ A;  1LXJ A;  4DZD A;  4USW A;  1IBC B;  2WVC A;  1T9V A;  1GXT A;  4UST A;  3BH7 B;  4CI0 B;  3SCL E;  2DO4 A;  2AW0 A;  3G9C A;  4PUO A;  4KHM A;  4RZR A;  5LMN J;  4KGV B;  3GII A;  3SCK E;  4AYB D;  1XTZ A;  5F8G A;  3GJT B;  4DUZ F;  3MED A;  2GA7 A;  3O44 A;  1HNW F;  4CLL A;  3GB0 A;  2MGZ A;  2VUG A;  1ACM B;  2OEL A;  1BLU A;  3HKZ D;  2W9A A;  4BCA A;  2DR7 A;  3IR7 B;  4PWD A;  1T0T V;  3OHA A;  2FLN A;  5KT4 A;  2OTL S;  3OTC A;  2MKY A;  2CPD A;  3RTV A;  4CCH A;  2X51 A;  5D15 A;  3GMG A;  5CCL A;  1XIQ A;  3HVT A;  4DR2 F;  1C4C A;  2ASL A;  3DOM B;  4ECT A;  4LRF A;  4WFY A;  3L09 A;  3ZTR A;  1CS4 B;  5IFM A;  1G7C B;  3LP2 B;  3WIU A;  1RE1 B;  3H7H B;  5CA5 A;  4CO1 A;  2PC6 A;  2HS3 A;  1G6B A;  2DGX A;  4PPD A;  4XTT A;  1DQA A;  2DHG A;  3DDK A;  5DQG A;  1HHT P;  4X4P A;  2JOQ A;  1KTV A;  3VHQ A;  3CCL S;  3IA0 A;  4NLG A;  4P2X A;  1LWC A;  3TZW A;  3I4P A;  2K1R A;  2GJ2 A;  2ZH4 A;  4USH A;  1U1Q A;  4LF8 F;  2EVZ A;  1VK8 A;  2BW7 A;  4OZJ A;  3G6Y A;  2DBB A;  2DGV A;  1ROF A;  2A6O A;  1NB2 A;  3WIV A;  3HHK A;  5GVQ A;  1VQO S;  4GVL A;  3NKY A;  3MPD A;  4RW4 A;  3MM5 A;  4MK8 A;  4JI5 F;  4ZCM A;  4NCG A;  1TU0 B;  1HHQ A;  3W9J A;  2XO7 A;  1SC6 A;  2D3Z A;  3K58 A;  3ITH A;  2HQG A;  1U2C A;  4OJG A;  2APO A;  2XGP A;  2E1A A;  3R9L A;  1MW7 A;  3KK3 A;  3KLI B;  2XUL A;  4KRW A;  4A47 A;  3I87 A;  4XK8 C;  3TA0 A;  3UQS A;  1G4C A;  2VFS A;  1NH7 A;  2M8D B;  2R2R A;  1G2E A;  4CTA A;  5KG1 A;  2WW8 A;  1X4B A;  2OPQ B;  1ZAX A;  3CJ3 A;  3IXQ A;  1V6H A;  1S99 A;  3TEG A;  4DR6 F;  3ILJ A;  2RU3 A;  3IBC B;  4LT6 A;  3KG0 A;  3CCR S;  4IUF A;  3SIP B;  1UPM B;  2V0N A;  4B3R F;  4WFB Q;  5GAD U;  2W9C B;  1LQ9 A;  1JLF B;  2H65 B;  2YTC A;  2PD1 A;  4K5S A;  1CC7 A;  1FO1 A;  3CCE S;  1IN0 A;  2NYH A;  4O23 A;  3QIP A;  3NEK A;  4FKX A;  1VJQ A;  2ZC4 A;  1ZM3 A;  1NSP A;  1RTI A;  2QTW A;  3S01 A;  4KYZ A;  4DR3 J;  2RJZ A;  1Q81 T;  3NY0 A;  3HHL A;  2CQG A;  1NK6 A;  5I3P A;  4QWB A;  3PW5 A;  2VDH A;  5DQH A;  2IAJ A;  4LFB J;  2IJR A;  4JV5 F;  2Q79 A;  3ZTS A;  4CLF A;  1YJN S;  2DT9 A;  3DOK A;  2VOP A;  2YWH A;  2IRY A;  4OIX A;  3MEE B;  2QLX A;  3MR6 A;  1IBM F;  1RWK B;  3I31 A;  2H9Z A;  1VC0 A;  3TJA A;  1DLO A;  4BC9 A;  2UZA A;  4OQJ A;  4X4R A;  2RDD A;  1NHV A;  3HP6 A;  3ZFV A;  2FLP A;  3GCX P;  1BQX A;  3OD2 A;  2ZJQ Q;  1J5E J;  3C16 A;  1PAU B;  4LFB F;  1S7H A;  3CO0 P;  2B6A A;  2RH3 A;  3GFZ A;  3T6J A;  3IAS 9;  4ECV A;  3EVO A;  3BKT A;  2HIQ A;  5AE3 A;  4K4Y A;  2AIR B;  3HD1 A;  5K8M A;  1JLG A;  1WTB A;  1U48 A;  1O51 A;  2PI4 A;  1S6Q B;  5DG9 A;  3DRP A;  2JVR A;  2WON A;  4DWI A;  2KI2 A;  2B4O A;  1N0U A;  3W2V A;  3GQC A;  2HRU A;  2CQ2 A;  3PZP A;  1S77 D;  2B9Y A;  1JJ4 A;  4Y3C A;  4OYA A;  1RAD B;  4PXE A;  1N36 J;  3ZNU A;  1X60 A;  4HI2 A;  3GG0 A;  1J5E F;  2H4Y B;  1QLN A;  1S1V B;  1NK5 A;  4OV6 A;  2MKC A;  3IC1 A;  1JLC B;  4AQY F;  4FBT A;  3LP1 A;  2CIM A;  3HF5 A;  2QC3 A;  2YPY A;  1WTF A;  3C66 A;  4ZCL A;  2HHT A;  3Q2S C;  2WRM A;  3R5B A;  5JMN A;  1DQ8 A;  5HSP A;  1TZ0 A;  1NJX A;  2OSQ A;  4AFF A;  5H9F J;  3BF4 A;  2B5J A;  2Y1L B;  3JSY A;  1T03 A;  1JLE B;  3I0R B;  2W7A A;  3W8P A;  5KFG A;  1R6V A;  1CJV A;  3WHI A;  1KP6 A;  1CJT B;  3TAP A;  2O67 A;  2Z2L A;  1S49 A;  3LGM A;  2LEA A;  2PN6 A;  3M8R A;  1REG X;  2NR0 A;  1XK8 A;  3OSP A;  2WHO A;  2IM0 A;  4X4O A;  4WFN Q;  1B3T A;  4OJ1 A;  4JI4 J;  1R0A B;  1UVN A;  2QN6 B;  1Y00 A;  3KJQ B;  1JWW A;  1PBU A;  1NAQ A;  1TKT B;  1DTT B;  3TJ9 A;  4I1T A;  3MEC B;  4YS2 A;  1T9T A;  1IKW B;  1WKJ A;  1X4C A;  1FNX H;  4HHJ A;  4RNN A;  2XYH B;  4LRC A;  3K57 A;  3RG6 A;  2YKP A;  4I2Q A;  1UA1 A;  4YDX A;  3OR1 B;  1ZM9 A;  4A8S A;  1H6K X;  3NGR A;  5HMW A;  2EC0 A;  4WK3 A;  1NPP A;  5D6G A;  4LR8 A;  4JUZ A;  3NL0 A;  4WZM A;  1UAW A;  3BBB A;  2FY1 A;  4A46 A;  4QWA A;  4AND A;  4YY3 J;  2IVF B;  4I0W A;  1NSQ A;  1YIJ S;  3NBP B;  2HPU A;  4ZLL A;  1FTC A;  3ILI A;  3H20 A;  3LTO A;  3BQ0 A;  1YWX A;  3SMZ A;  1ZAW A;  4OZ0 A;  3JYT B;  4DG1 A;  4YHH J;  3QO9 B;  3KJN B;  2C3U A;  3BSA A;  4FS1 A;  3KHR A;  3DFE A;  3CUL A;  3UD4 P;  2B4V A;  3OFG A;  2VPY B;  4K7Q A;  2VC1 A;  1QVG R;  3D0I E;  2BR0 A;  3RB3 A;  3OBI A;  2HLT A;  4DFP A;  3JAM Y;  2RQM A;  4G1P A;  1RT2 B;  2MLX A;  3HHL D;  2YNI A;  1FE4 A;  1ZPV A;  4OZ3 A;  2HAF A;  1XMO J;  3RR8 A;  3D1Q A;  1RSC A;  2QLD A;  1SKW A;  1JLQ B;  3GLJ A;  4B3M J;  4OYM A;  5B0A A;  2MEW A;  4DUY F;  5DM7 Q;  2KDO A;  5ITH A;  2Z57 B;  4NCB A;  5H9E J;  2HHQ A;  2VD3 A;  4U6P A;  3O5T B;  1TV6 A;  2E1R A;  4WXO A;  3SQO P;  2LYV A;  2JX2 A;  4DSK A;  1AW0 A;  2VFR A;  2HK3 A;  3I56 S;  5L8R C;  3DYA A;  4RW9 B;  2MPU A;  1KNZ A;  2HHS A;  1LKZ A;  1OIA A;  1XMO F;  2ZVI A;  1RT7 A;  1FX2 A;  4AL7 A;  2HK2 A;  3ADA C;  4M1K A;  4I64 A;  4GO5 X;  5E7O B;  1AUS L;  1KQK A;  5HRO B;  4CO0 A;  4OHZ A;  2BX6 A;  5IZH A;  1FXR A;  1QE1 A;  3TVK A;  3G8Q A;  3TAM B;  2FGC A;  3CD6 S;  3Q23 A;  1Q5Y A;  3QRP A;  4G65 A;  2JEJ A;  1UET A;  3RB0 A;  4X65 J;  2B56 A;  7FDR A;  3JQM A;  2GGP B;  1H7X A;  2XHC A;  3UCZ P;  3LAM A;  1IR2 A;  1HNZ J;  2IY5 B;  2IRU A;  3DOL A;  2VIH A;  2PMW A;  1LWF B;  3I9Z A;  3A8J A;  4K4T A;  1AYE A;  2DEI A;  9ATC B;  4IR1 A;  1NJZ A;  2XBP A;  4ID8 A;  4NLR A;  4DPY A;  4MH8 A;  3OVS A;  1I5O B;  2F1F A;  1Z4U A;  3DLE A;  4PYA A;  2KT2 A;  1S4E A;  2EBG A;  2BAC A;  2JVM A;  3BYP A;  2VFV A;  1CQM A;  1EHW A;  2Z0G A;  4R8U A;  2IYG A;  1WHV A;  2M9K A;  3OXG A;  3BGR A;  2YNH B;  2VON A;  2GVD A;  1RT5 A;  3AQP A;  3S6E A;  4N47 A;  4X4S A;  1ZTW A;  1OPZ A;  2XMM A;  1HBN B;  4H4O A;  1HNZ F;  5J2N A;  4K2X A;  2BJ3 A;  1Q79 A;  3HJF A;  1MU2 A;  1F60 B;  5KFX A;  1RHU B;  1E6V A;  3PJW A;  3SYZ A;  3FQL A;  5IXU A;  3M9M B;  2G9O A;  1RWU A;  3AAW B;  1CUL A;  3KHH A;  4ILR A;  2XS7 A;  4DV4 J;  1TL3 A;  4A8K A;  1RA7 A;  4ILM A;  3ISN C;  3JAM U;  4C97 A;  2R9L A;  1SV5 B;  1U0H A;  4ZS6 A;  4QU6 A;  4DS4 A;  4O3N A;  1B70 B;  4BBY A;  1SUQ B;  2XMW A;  3H25 A;  1DHM A;  2LP4 A;  1S1U A;  4OYB A;  2BE2 B;  3H5Y A;  3IBW A;  2FPH X;  4PWU A;  4WKY A;  3M8P A;  1K1S A;  2OEK A;  3AJ1 A;  3OW2 R;  3SZ2 A;  1FRI A;  2J9D E;  2E44 A;  5T7L A;  3ILO A;  1KRP A;  1RKI A;  2HIY A;  5E3R A;  4WP9 A;  2BMB A;  3KK1 B;  2K3I A;  4Y00 A;  3B78 A;  2F63 A;  3MCM A;  2WVB A;  1EP4 B;  3V6J A;  2J7K A;  2GIQ A;  1WG5 A;  3C3L A;  3SSQ A;  4RUH A;  1XMB A;  3BDE A;  4ERD A;  4LF6 J;  1SC3 B;  1L3U A;  2MZ1 A;  3DNC A;  4LSL B;  4USV A;  3MR5 A;  3MMB A;  1VYA A;  2GFF A;  2HVI A;  1GNK A;  3TR5 A;  4C3L A;  2X1G A;  1FWK A;  3L7U A;  4R0J A;  1Q5V A;  4ECX A;  1HQ2 A;  1FJ7 A;  3HHE A;  2ZBP A;  2J9E A;  2VFT A;  5HAT A;  4CQ1 A;  4X2B A;  1VQ6 S;  3PW7 A;  3O6Q A;  1R8C A;  3K5O A;  2K06 A;  3AXK A;  4QWE A;  1QVF R;  2YVS A;  3V81 A;  1IKV B;  2MDA A;  5F0U A;  4OHX A;  4NA1 A;  2WTF A;  1N48 A;  3OSN A;  2RUG A;  4ITS A;  2VPX B;  2Y3Y A;  5HP1 B;  3FRY A;  4DR7 J;  5J1E B;  5MAO A;  5B0D A;  2P6T A;  5IM0 B;  1RAO A;  4P10 A;  2OH2 A;  2Z2Z A;  2RRN A;  4LF6 F;  3W9H A;  4DV0 J;  1SH3 A;  1VC5 A;  2M88 A;  3R8Y A;  3C46 A;  1VQS A;  5KAK A;  2ZHB A;  1FTR A;  1MMD A;  2NCK L;  4LF9 J;  5EDW A;  3MXH P;  2RQ4 A;  1FRK A;  2AJ1 A;  4TN2 A;  2AP6 A;  4PYD A;  2OEJ A;  1IJE B;  3ZZ0 A;  4M5G A;  2OGU A;  5DDO C;  3IRX A;  2H5I B;  1HWU A;  4DR5 F;  2FVR A;  1RGV A;  3BO4 A;  5D0R A;  2J0S D;  3RRK A;  4A8Q A;  1VGY A;  3VCD A;  2ACM A;  4QIF A;  4LSN A;  3J80 Y;  4LR9 A;  3BV8 A;  4LFA J;  4ZVG A;  1NZ8 A;  1H7W A;  5M2R A;  4DJB A;  4YR3 A;  5K14 A;  3W63 A;  2BJ1 A;  1FJG F;  1XWL A;  4G1I A;  3OUY A;  4NRU A;  3OVB A;  2PII A;  4Z37 A;  2NPF A;  5CAA A;  3AQO A;  3H5X A;  4QIG A;  4F7V A;  1RK8 A;  2E7W A;  4C4W A;  3KK2 A;  2POK A;  4KFB A;  1UPP A;  4PZV A;  4CO2 A;  3ISZ A;  3VV2 B;  2UXD J;  5HVH A;  3CJ4 A;  3TA2 A;  2RF2 A;  5DDQ C;  1VQN S;  4ZCI A;  4EWT A;  1WEL A;  3V4M A;  1M1H A;  5DZ7 A;  1RAC B;  1VS3 A;  1VQK S;  4LBI A;  2DXE A;  4XPE A;  2M70 A;  4C0B A;  2BQU A;  4CYU A;  1NCL A;  2H1Y A;  2CDR B;  2M4M A;  3TOQ A;  2XMA A;  4KT0 C;  4OYW A;  3MM6 B;  1G3O A;  1FEE A;  1SL0 A;  2HNY A;  9RUB A;  3AGZ A;  1C4A A;  1HKA A;  2V94 A;  2IC3 A;  3C5X C;  3QGP A;  2XMV A;  3QZ7 A;  3P45 B;  5FLX Y;  3CUN A;  3H5U A;  1PKU A;  2RIL A;  2MKI A;  1XER A;  2XLK A;  2J9C A;  1H72 C;  4DV7 F;  4QR0 A;  2E7V A;  1RUS A;  2OSR A;  1FNM A;  3GJR B;  3QGG A;  1WG4 A;  3PY8 A;  2G0J A;  2VQE J;  3MF5 A;  5D0H A;  3M05 A;  4DMZ A;  5CAB A;  3I38 A;  2EFV A;  1N33 J;  2MB0 B;  1T3N A;  3UDL A;  2Z4P A;  2B7B B;  3AKO B;  4Y2K A;  3HK2 A;  1U8S A;  3M6V A;  1DBD A;  4A8O A;  5B09 A;  4KH0 B;  3J7Z T;  4IG3 A;  2AWZ A;  5AT1 B;  1UEV A;  2LLZ A;  3NWR A;  2LEC A;  2LU2 A;  1IBK J;  2HQC A;  2RS8 A;  4LJM A;  3ZZT A;  3DRX A;  4HAC B;  1R31 A;  1VMB A;  2KRB A;  2PFD A;  1I1G A;  2RHQ B;  4N7T A;  4MJK A;  2IIH A;  2FLL A;  2KZZ A;  1V5I B;  5D4L A;  4WWS A;  2OPP B;  4O3O A;  1RT1 A;  2YNF B;  2W2O P;  4Q7A A;  2DHS A;  2AEM A;  2NXJ A;  1A7G E;  1TP7 A;  3RW6 A;  1KQG B;  2AMC B;  4X4T A;  1R6Y A;  2KT3 A;  3E2E A;  1YGY A;  5EX3 A;  4K4V A;  5E3C A;  3TYT A;  5LOQ A;  1IBK F;  3J80 U;  2PSZ A;  3TX8 A;  3M2R A;  2GQQ A;  2C2O B;  1S48 A;  1YKW A;  5JJB A;  2F8H A;  3CCZ A;  3ZTO A;  2MSS A;  3IS9 A;  2DHX A;  4PG5 A;  3PYG A;  3W2W B;  2FJE B;  1X4H A;  2ZH2 A;  2Y9H A;  2AJQ A;  3PJ9 A;  4RU2 A;  3IAM 9;  2QYG A;  1NHU A;  4FPI A;  3GWC A;  2MQO A;  1YJ7 A;  3HUL A;  4DI6 A;  2EC2 A;  3UO0 A;  2MQP A;  5CYM B;  1HQU A;  3WZ0 A;  2ROP A;  5L9X A;  3FGV A;  2V2Z A;  3M2V A;  3L3C A;  4ZN1 A;  4X4Q A;  3CCT A;  2XYG B;  4Y34 A;  2F8E X;  2KYX A;  3MCN A;  2XLJ A;  5IT4 A;  4TXS A;  1WC5 A;  1NKC A;  4NZ6 A;  3EVM A;  5CD4 H;  1L5U A;  3A12 A;  1Y5I B;  2JEI A;  4NXM J;  2P5V A;  4ZP6 A;  2J76 E;  3MOJ B;  3SCJ E;  2XCP A;  4OZL A;  5D0E A;  1WC4 A;  4B9L A;  3BM7 A;  4YB5 A;  4ELU A;  4HDG A;  5HBM B;  4C3K A;  4PQU B;  1VR6 A;  3VQS A;  2RHS B;  3LWM A;  1A6L A;  4NLV A;  2BM0 A;  3N79 A;  3MWB A;  2CPH A;  5L1L A;  1SQF A;  2ILY A;  4NLO A;  2KH9 A;  1NDL A;  2NXN A;  4USM A;  4WCE Q;  2KRR A;  4B02 A;  5L9N A;  2DNO A;  1CJU A;  2HVZ A;  4KH1 B;  2RS2 A;  4P9S A;  3KUG A;  5HQ8 A;  5FLX U;  4ECZ A;  4ETX A;  4PR6 A;  2VL1 A;  4MIA A;  5DGA A;  2FIU A;  2XYP B;  2RDI A;  4NXM F;  3EGZ A;  3QQC D;  2FDN A;  4ZPA A;  2KT5 A;  2FC9 A;  4USU A;  3EYZ A;  3M1V B;  5KFB A;  2CPY A;  2ZUA A;  4RWW A;  1F2G A;  4J80 A;  1RWM B;  3MZI A;  4PAA A;  4OLP A;  2YBV A;  3CJR A;  5E5N A;  1URN A;  2YQ1 A;  4TU9 A;  3CJK B;  4YEA A;  1BQN B;  1QAJ A;  1FDN A;  3BR9 A;  5KFS A;  1LWE B;  2C2D A;  4WKR A;  2QE5 A;  5L1K A;  1IXK A;  4WU3 A;  2HS0 A;  2YH0 A;  3F56 A;  4DQP A;  4DSI A;  4ZDN A;  4DBQ A;  2P9C A;  4KO0 B;  2XLI A;  3PYF A;  4FDF A;  4DSF A;  2DH8 A;  4K4S A;  5LSR A;  3I96 A;  2E1M C;  2Z2Y B;  3DRY A;  3P5T L;  2YKQ A;  3TO8 A;  1GMV A;  3THV A;  3PX0 A;  1F5C A;  3MEG B;  2O01 C;  4BDP A;  2GIF A;  3QLH A;  4DV2 J;  2JLE A;  4CIO A;  4ECR A;  1S10 A;  3CXC R;  2DRA A;  2GS8 A;  1R27 B;  1RYS A;  1KOH A;  5A8W B;  2CJ9 A;  3MM8 B;  3QBC A;  3TP2 A;  2ZH9 A;  3PG9 A;  3LP2 A;  4DUT A;  4P2S A;  3L7O A;  1FNO A;  5CZV A;  2N4C A;  2WB1 D;  3HT3 A;  4C8N A;  2R4F A;  1AT1 B;  3GG1 A;  4I69 A;  4F2S A;  1WUU A;  3QWU A;  1JKH A;  1X0P A;  2NZC A;  5B0E A;  5J2Q B;  2IVY A;  3W9I A;  5LXY A;  3ETO A;  1AZS B;  4NMX A;  4UOG A;  3MUR P;  2MKH A;  2BQ3 A;  2CAD A;  4YN3 B;  2KN4 A;  4QOT A;  2M5Y A;  3RRG A;  4RU9 A;  4BWJ A;  3MCS A;  2CG4 A;  3SCI E;  2QO3 A;  2I5J B;  4DF4 A;  4B3O B;  2VOO A;  4B9S A;  2XGQ A;  3ZTQ A;  4A8W A;  4C0H A;  4LF5 J;  1PYO B;  2MTL A;  3FK4 A;  4DV5 F;  3G96 A;  5ETL A;  1D9D A;  1E6Y B;  3DLG A;  2DKO B;  2DK2 A;  1FKP A;  4KAI A;  3PR4 A;  4LF7 F;  3FSI A;  2NQP A;  4NLT A;  3TAR A;  1R8A A;  4BS2 A;  3JSM B;  2GZO A;  3AA9 A;  5E0O A;  4QJV A;  4K8R A;  2DNP A;  2CJK A;  4DQR A;  1JB0 C;  3D5M A;  3W65 A;  1C2P A;  2Q43 A;  3DI6 B;  1UWA A;  5BYQ A;  5FD1 A;  2W9C A;  4CLS A;  2XM3 A;  1KLM A;  4HLB A;  1TAQ A;  2OIH A;  2KU7 A;  3KLE B;  3R2C J;  1OS5 A;  2W8L A;  4A48 A;  4LF5 F;  3KDO A;  4QWC A;  3IO1 A;  2RQK A;  3JTN A;  4FYV B;  4X64 F;  2UUC J;  1DUR A;  2V6A A;  3KLF B;  1EKR A;  2CQB A;  2KXF A;  1UFW A;  5F8L A;  2V69 A;  1W7W A;  5E3P A;  1JNR B;  2BUN A;  1N5Q A;  4DF8 A;  3PAC A;  5EGY A;  2CZ4 A;  3R2D J;  2HVD A;  2PO4 A;  1S1T B;  4NXN J;  2ILZ A;  1WHY A;  4P72 A;  1ZZN A;  1CG2 A;  3G8T A;  3K59 A;  4L74 A;  1HNV A;  2HSE B;  1WC1 A;  2LA4 A;  1V3S A;  5F3T A;  3EWG A;  1SIZ A;  4UUW A;  2UVW A;  2HHW A;  3AOC A;  2NZ4 A;  2LKZ A;  3MEE A;  3U7J A;  4CWB A;  2UUC F;  1S9E B;  2NSB A;  3ZZR A;  4RR5 A;  1P1L A;  5F8J A;  3LA0 A;  3DM2 B;  2FLO A;  1S6U A;  4K4W A;  4V19 X;  3RW7 A;  1RA6 A;  3OT9 A;  4J9O A;  2IFX A;  1RAB B;  2JLF A;  1RT3 B;  4NI2 A;  3MD3 A;  3KUH A;  3HX9 A;  5L39 A;  1BGX T;  3NCQ A;  3RZA A;  1U6B A;  2QT7 A;  3DRR B;  2F8M A;  4J9U E;  4JI7 F;  4IDK A;  3S7R A;  5I42 B;  3KLH A;  2NXC A;  1S6Q A;  3IFE A;  1S6O A;  2Q3P A;  3IGV A;  1OQ6 A;  2ZBR A;  1PIL A;  4B9N A;  4GKJ J;  3DXS X;  4YFU A;  3A13 A;  4Q44 A;  1NSA A;  2W2P P;  5C2C A;  4OYP A;  4C11 B;  4IFV B;  2C3M A;  2UUB J;  4OI3 A;  2AF6 A;  3C6E C;  4ES1 A;  4OZ5 A;  4Q2M A;  1RHR B;  2V34 A;  2ROG A;  2QFJ A;  3NP5 A;  4IO9 Q;  3T1A A;  2QA4 S;  3NAI A;  1F2H A;  1Q95 G;  4NRT A;  1VIO A;  2A1B A;  3RBE A;  2DVI A;  2MKK A;  3DLH A;  2YNG B;  4USK A;  2BVZ A;  4EK2 A;  4DQS A;  5KOX A;  1VQM S;  1VBZ A;  1DAX A;  4KJI A;  1JLE A;  1UEU A;  2UV8 A;  2E7X A;  4GKJ F;  1NPK A;  4FS2 A;  3CJ2 A;  1JLB A;  2ZE2 B;  4U95 A;  3KDN A;  2OO4 A;  3MAH A;  1TQL A;  2P9G A;  2X3G A;  2BJD A;  5DM6 Q;  4I56 A;  5IV4 A;  5KG4 A;  4NEZ A;  3DHX A;  2VPW B;  4RL1 A;  3O3L A;  1HD1 A;  1MLA A;  4HTJ A;  3C6U B;  2HHX A;  1Q82 T;  2CZV C;  1FFW B;  2ROE A;  5A0Y B;  1T7P A;  1FEH A;  3ZO7 A;  1TKT A;  1S1W B;  2C3P A;  1IKW A;  3N0V A;  5C24 B;  2P9E A;  2OAU A;  3I4H X;  1XR6 A;  3EXY A;  2UUA J;  2GO8 A;  1Q4R A;  2NLW A;  1AFJ A;  3A8I A;  3HD2 A;  1VQ4 S;  1FT8 A;  5HJY A;  1PJ5 A;  3H8Y A;  3OR1 A;  5EWE A;  3FEX B;  1KVI A;  1HNI B;  4K50 A;  3QPI A;  1LOU A;  5U47 A;  3MR7 A;  1TTH B;  3CSK A;  4OHW A;  3D68 A;  3PFO A;  4ES2 A;  1NK4 A;  3KMS A;  3GV7 B;  4IOC Q;  1PSD A;  2CNN B;  3EGN A;  4IH6 A;  2G2Y A;  3M30 A;  1P6T A;  4J9Q A;  3MPY A;  5LXR A;  2R2S A;  1U49 A;  3C19 A;  2E9Z A;  1YRT A;  2A6M A;  3NBP A;  2VQF F;  3BBF A;  2EPI A;  1BWV A;  2XSJ A;  3VTI A;  3KTQ A;  1QSS A;  1R7I A;  2UUA F;  2Q2G A;  2WAQ D;  3JYT A;  4NOH A;  1U2F A;  5HQL A;  2VJV A;  2HKE A;  4Q8E A;  3QO9 A;  1TKZ B;  5BJR A;  1GAO A;  1TL5 A;  5H9F K;  1SH2 A;  2ERR A;  4HH0 A;  1X9M A;  1XBW A;  4D3G A;  2HMI B;  1WKK A;  3VWS A;  2CQ3 A;  2E9T A;  4NYZ A;  2VG5 B;  2Z2M A;  1U6Z A;  2YXL A;  1X0F A;  2AJ2 A;  1UW4 A;  3HXM A;  1GMW A;  2HBR B;  3PJX A;  3EDR B;  2IJN A;  4Y2A A;  1UJ5 A;  4F4K A;  4LF4 J;  4ICL A;  1EAY C;  3FCW A;  2QL5 B;  3NRB A;  4GC6 A;  1GEH A;  2W24 A;  4ILL A;  1MWY A;  2M52 A;  1RT2 A;  3B82 A;  3SFG A;  1M5V C;  5HVG A;  1KD1 T;  2GIR A;  2LQ8 A;  2XS5 A;  1WF2 A;  5KG7 A;  4TVA B;  2D3O R;  1RAH B;  4LFC F;  3EX7 B;  4LRA A;  4TY8 A;  1J5O A;  3OFF A;  1YIT S;  2BAN B;  1RHQ B;  4LRD A;  3Q8P B;  3S8S A;  4Y28 C;  3ZZO A;  2M8H A;  4WJB A;  3M8Z A;  3VAG A;  1R8B A;  4RW7 B;  5B7W A;  3FUY A;  4DHV A;  2X7I A;  2AT1 B;  4RBV A;  2C2K B;  3ZXW A;  3AOA A;  4TLQ A;  1UW9 A;  3D66 A;  2MKS A;  2K7K A;  3OPK A;  3CIZ A;  1Y0H A;  4C8Y A;  4DV3 J;  3PR5 B;  4AD6 A;  3V6K A;  3OXF A;  1OQ3 A;  3V4I B;  3MTJ A;  3E01 B;  4X84 A;  2BKO A;  3M6W A;  3DU6 A;  3HMJ G;  3B4D A;  2ZHA A;  5HRO A;  1C1C B;  2QG9 B;  2WSF C;  3TAM A;  4OX9 J;  1WWH A;  3EIC A;  2YX4 A;  4ZVT B;  4B9V A;  2ALY B;  2AX0 A;  4G3I A;  1RTD A;  4PXC A;  8RUC A;  5M2P A;  1MSW D;  1U1P A;  4F3M A;  1TK5 A;  2ZVS A;  1KHW A;  5J2P B;  3J7A 1;  1QUP A;  3HHD A;  4NZ7 A;  1D8Z A;  1ELO A;  1U1M A;  2H54 B;  4M5L A;  3IP0 A;  4F02 A;  2Y8W A;  1VBX A;  3WC0 A;  2DNN A;  4ID5 B;  3TQ1 A;  2G2O A;  4IH7 A;  2K2P A;  3V6D A;  3AOB A;  2QFI A;  4UT4 A;  2G4B A;  2WSC C;  4NYP A;  3P3D A;  1HBO B;  3OL7 A;  4D3H A;  1HR0 J;  2BDP A;  4QIW D;  4EI2 A;  4WFA Q;  1M90 T;  3FNN A;  2GHW A;  5HJX A;  1ZA2 B;  1YSJ A;  5H9E K;  4ED4 A;  3G6E S;  4QZV B;  3W1Y C;  3TRG A;  3H0P A;  1Y5L B;  2ATC B;  2HQI A;  4WBF A;  5JVH Q;  1S1X B;  3Q8Q B;  3EUN A;  1F5A A;  4ZVS B;  1WDD A;  2HGN A;  4KGM A;  3CE8 A;  4FYX B;  4IOA Q;  4DSE A;  1HMV B;  1IKY A;  3NNA A;  2LEB A;  1YJW S;  2HG4 A;  4NLW A;  2W01 A;  2EFO A;  1EIY B;  4DCO B;  3QFW A;  4J7C A;  2CWX A;  2IHR 1;  4H54 A;  4PUO B;  3QT7 A;  3VAI A;  5I3U A;  4IR9 A;  1SV5 A;  4QPT A;  1FVS A;  2C2M B;  3PM9 A;  4RW6 B;  5GAD I;  4FKY A;  3MED B;  4OYZ A;  2DH7 A;  3HZG A;  3IWX A;  3BZQ A;  2MGZ B;  1RBA A;  2BZ2 A;  2R7V A;  4OHY A;  4E8U A;  2FHJ D;  5HMY A;  2OJ3 A;  2QLJ B;  1P8G A;  4I7F A;  3CMQ A;  3CC4 S;  3G2X A;  5GAE U;  1HNX F;  2A3J A;  1RAE B;  1ZBT A;  3Q8V A;  3TZZ A;  2XTJ P;  1BHN A;  3U1N A;  2VBW A;  3DLJ A;  1U8W A;  3I5B A;  4UQT A;  1L3S A;  3HVT B;  3ICL A;  3QYY A;  1JXV A;  2RB7 A;  3KK1 A;  4JI0 F;  1VC6 A;  2PMH A;  5MLC V;  3BH6 B;  1EP4 A;  3RBD A;  2RRA A;  1S4F A;  1S0M A;  1V3R A;  3D67 A;  4ZLN A;  3DXB A;  2FJX A;  1EB0 A;  4AT1 B;  1GMW D;  2X3D A;  4P71 A;  2COL A;  4NWB A;  3PO4 A;  2ZBQ A;  4Q8F A;  3ETM A;  2YKM B;  3OTD A;  5KT5 A;  1LWC B;  4IG0 A;  1FK9 A;  1B0P A;  2K1R B;  1YLX A;  5LT5 A;  1FCA A;  2E66 A;  2JC1 A;  3X1L B;  2AZ3 A;  4ED7 A;  3RAX A;  2ZNZ A;  2FHK A;  1CEZ A;  3M8S A;  4HKQ A;  4F36 A;  2LFV A;  4DX8 H;  3IN5 A;  2MZR A;  4RW4 B;  3MM5 B;  4QQB A;  1IBL F;  5HP1 A;  2W7O A;  1WAC A;  5J1E A;  3LPY A;  2QLF B;  2GV1 A;  1NME B;  1OSC A;  3GSD A;  4DSJ A;  2MHE A;  3Q83 A;  1R3N A;  2KVI A;  4P2F A;  3FCV A;  3JTP A;  3MCO A;  2FC8 A;  2XB2 D;  2DPI A;  5G4D A;  2YWG A;  2XI3 A;  1U47 A;  5DJB A;  3PW0 A;  2NUU G;  1YK9 A;  4A8F A;  3AD8 C;  1K44 A;  1I51 B;  3UDV A;  1VK3 A;  2WOM B;  3IWL A;  5D3G A;  1LK5 A;  3TVZ A;  4LSZ B;  4CLU A;  1VJW A;  1UMJ A;  2B4P A;  2UXB J;  2XSF A;  3SQG B;  4Z7C A;  3DLK B;  3T9Z A;  2QSW A;  3C14 B;  2RAQ A;  2W7P A;  1RBL A;  4RUB A;  3A4T A;  1C0U A;  4CH7 A;  1S6P A;  3AD9 C;  2F5G A;  2XZW A;  1H2V Z;  3Q0A A;  3GSI A;  1SI9 A;  3QIP B;  2HWH A;  2GC8 A;  1NUE A;  4EO6 A;  8ATC B;  1HHS A;  2R3V A;  3BSC A;  2OPR B;  1J2V A;  3TQE A;  1RTI B;  3QNW B;  2M0G B;  2LXF A;  2CQH A;  3CVK A;  2CQC A;  5ETV A;  2J8A A;  2IAJ B;  2F40 A;  2RKI A;  1EKS A;  4DL7 A;  5IOL A;  3G6X A;  1SJ1 A;  1YZ6 A;  2HHH J;  4FBU A;  1ULR A;  1TEL A;  4A4J A;  1IWA A;  3MM6 A;  4H4K C;  2ZNY A;  2E1C A;  3P6Y C;  3LQV A;  3NGD A;  4DLG A;  1UVK A;  1JJC B;  3V5R A;  3M8Y A;  4F3Q A;  1M5H A;  2CPE A;  4DS5 A;  3HDS A;  4GMK A;  4ZVR B;  2PEB A;  3MAA B;  1IQT A;  4FYY B;  5ETR A;  4F50 A;  1DLO B;  4JB8 B;  2X1F A;  2E5G A;  4LQ9 A;  2E5H A;  4B3S J;  3HI9 A;  3V2U C;  2DD8 S;  2WW4 A;  1VQ5 S;  2W9B B;  3C16 B;  4JV1 A;  4AUK A;  2B51 A;  3MGJ A;  2CKW A;  2GJF A;  2DTJ A;  2V9K A;  3D6H B;  1NK8 A;  1UFL A;  5FJ4 A;  2CQ0 A;  4DL4 A;  3NGK A;  3POT A;  3VGT A;  3W60 A;  1JLG B;  1HBU A;  4ZKA A;  3J7Z 5;  3DRP B;  1UZD A;  4RNM A;  2ZBC A;  3W66 A;  4N41 A;  4DX6 A;  4KGX B;  2BJ9 A;  1FA0 A;  4MKB A;  3MI7 X;  3W62 A;  1KS2 A;  2AD9 A;  4J9M A;  2DCL A;  4DXL A;  3RAQ A;  4CLW A;  1TK8 A;  5BYS A;  2M3D A;  3V6H A;  3IM8 A;  1KSP A;  2UU9 J;  4GC7 A;  1APS A;  3MUV P;  3ZZP A;  2HRY A;  2AYM A;  1WJ9 A;  2DIU A;  2EG1 A;  4DX7 A;  1NM2 A;  2BEF A;  4U96 A;  5J1N A;  1F9F A;  1ZZF A;  4J90 A;  1XNQ J;  1F9E B;  2B5J B;  3U02 A;  4ZPV R;  4V1A k;  3BBC A;  2U2F A;  4J9N A;  3FMW A;  5J2M B;  3ILL A;  1NPR A;  3BN7 A;  4ZIW A;  5KFO A;  2ZOM A;  1YJT A;  2Y1R I;  3M9N B;  1U25 A;  5LMN F;  4DV1 J;  4LIR A;  4AL6 A;  2NXE A;  4DU7 A;  2JEG A;  1SJ4 P;  4YME A;  2JJ4 D;  1U1N A;  4WIQ A;  4IH5 A;  1XR7 A;  2AYE A;  3W2W A;  4WTO B;  4OYI A;  5D77 A;  1RHK B;  4CP5 A;  2VB6 A;  3KOA A;  3GIR A;  4HL9 A;  2HVH A;  4I2Q B;  3RR7 A;  2XZT B;  3IMQ J;  6AT1 B;  2GMH A;  2KM8 C;  4CDI A;  3DRS B;  2ZJR Q;  2LA6 A;  2JFK A;  3Q86 A;  1BE4 A;  2NUH A;  3UN2 A;  1WHW A;  2QMW A;  3BPD A;  4K2J A;  5E2Q A;  5ETM A;  4WE1 B;  2DNL A;  2ZH1 A;  4CT8 A;  1YDL A;  1DJ0 A;  4ELT A;  1YRX A;  3M8W A;  4K0K J;  4UF4 A;  4O3Q A;  4DFK A;  2I0X A;  3N6L A;  3BEG B;  3NS6 A;  3G4S S;  5HBM A;  1KVJ A;  1WF1 A;  3PFE A;  2KZM A;  4A8Y A;  5I4M A;  4HTI A;  3LWL A;  1LW0 A;  3TA1 A;  1WOS A;  3GYN A;  4DG1 B;  1UP1 A;  2D74 B;  1K0V A;  4KV8 A;  4J91 A;  3CC2 S;  1SCJ B;  5RUB A;  1FD8 A;  1WI6 A;  4NL5 A;  3PHT A;  4PXD A;  2QL7 B;  4P74 A;  2W4D A;  4QYZ J;  1CSJ A;  3ENA A;  3BR8 A;  2QV6 A;  4K0K F;  4URG A;  1SJ3 P;  1WOR A;  2Q6C A;  3CGI A;  2B8P A;  4PPZ A;  5AJ3 J;  3M1V A;  3CJ5 A;  3M4X A;  3P8B B;  1U02 A;  5F3Z A;  2B3T B;  2GNK A;  2HNZ B;  2W2Q P;  2Y1J A;  1QD1 A;  4N76 A;  1JX4 A;  2C28 A;  5EN1 A;  5D8H B;  5KT3 A;  2P8I A;  1BQN A;  1GFW B;  5KFQ A;  1LWE A;  2MJU A;  4EBE A;  2IA6 A;  1YX2 A;  2L9N A;  1PBA A;  4O3R A;  5KG3 A;  5M2U A;  3PEJ A;  3EVW A;  3FJ2 A;  4XIU A;  4F4Y A;  4KO0 A;  2ZM6 J;  1Y5N B;  1M5O C;  2DXD A;  6FDR A;  4U7U D;  3QWP A;  1URR A;  4H4M A;  3L95 X;  3H2V E;  1RLD A;  4RWX A;  3A8K A;  3K0J A;  2H4W B;  3MEG A;  4FN5 A;  4X62 J;  2CPI A;  3D4J A;  3GR0 A;  2W25 A;  2MMY A;  3MMA A;  4MKV A;  1SC1 B;  4FP9 A;  2B9W A;  3CW2 C;  5A8W A;  3CMA S;  1NDK A;  3EJM A;  1R0B G;  3ZC4 A;  3T5H A;  3BS9 A;  4F4Z A;  2OTJ S;  4IYQ A;  4UZB A;  2W8K A;  3P4U B;  1N54 B;  1NEE A;  1U6F A;  3VGV A;  1KFD A;  5KFH A;  3BGO P;  2HYI B;  1H3D A;  1T9Y A;  3U1L A;  3VAK A;  3GU0 A;  5KFA A;  1X4F A;  1MMN A;  2HFU A;  4B3T J;  2KB2 A;  2DB1 A;  2KL8 A;  5AXL A;  4DR3 F;  2QEX S;  4DR1 J;  1T9X A;  1HWI A;  1G1X A;  4MYT A;  4I2P B;  2A18 A;  2ZH7 A;  4P52 A;  4RUA A;  1HI8 A;  2VBZ A;  2A2D A;  4ZP7 A;  2FHO B;  3R27 A;  4L6V 3;  1LV5 A;  1PJ6 A;  3ZZY A;  1AFI A;  1F3F A;  5J2Q A;  2HBQ B;  2N3L A;  2E5L J;  3BGF A;  4ZVE A;  2NSC A;  1IM4 A;  1KTQ A;  1IUJ A;  2GW8 A;  4L75 A;  1WC3 A;  2GAH C;  2O5D A;  1Y4Z B;  1U1O A;  3BO2 A;  2DGO A;  4R8U B;  3OL9 A;  3CCS S;  2QGF B;  1REV A;  3BGR B;  2G0C A;  2C3O A;  4ZP9 A;  1RT5 B;  4B3O A;  4F3O A;  2JH3 A;  4DPX A;  3FZ2 A;  4ZHR B;  5KG5 A;  4H4O B;  5J2N B;  1NO8 A;  2GQ2 A;  1RU1 A;  4RKU C;  2Y8Y A;  2CQD A;  1FJC A;  1S12 A;  1E6Y A;  2L9W A;  4ED1 A;  4H4K A;  2K3K A;  1VDH A;  3KKF A;  4N8N A;  1MG7 A;  2E5L F;  4GRS A;  2OKQ A;  2I8E A;  1RTH A;  2R8H A;  5A8K B;  3CD0 A;  2R2T A;  3DCA A;  2YWW A;  1N6Q A;  3VAJ A;  2ZC3 A;  4U9R A;  1UZH A;  4B9M A;  1CUL B;  3DGP B;  3K5N A;  2C2R A;  2IM2 A;  1ITP A;  2VG6 A;  2D7S A;  1TL3 B;  1XMQ J;  1MN9 A;  1R8H A;  4DL3 A;  3FFI B;  2Q6B A;  1S0V A;  1FKO B;  1VHI A;  3AJD A;  2QA1 A;  3KLG B;  4DR4 J;  3UD3 P;  4P75 A;  3VAL A;  1Q78 A;  1FJE B;  3UD5 A;  1N36 F;  3GYG A;  3O8W A;  3QT6 A;  4CRJ A;  4KHP J;  1T05 B;  1B0V A;  4DU8 A;  1YJ9 S;  2FGO A;  3KLF A;  4C9D A;  4YOE A;  3JSR A;  4L3N A;  1C1B B;  3M8P B;  4UTG A;  3PIO Q;  5DRK A;  1TKD A;  3LH2 S;  5T7L B;  1RCX B;  3D2W A;  4OI6 A;  1S1T A;  1QUV A;  4BLG A;  3M9O B;  1JJH A;  5LMU J;  2JWN A;  2V8P A;  4KR0 B;  4ED8 A;  2HW3 A;  1X9W A;  2WVE A;  3OXL A;  3KG4 A;  1VQY A;  3D9B A;  2CAJ A;  2EK6 A;  4YQW A;  4YR0 A;  1F9H A;  4OHV A;  3SSS A;  2ZZM A;  3GIM A;  3MEK A;  3DDI A;  4G1Q A;  4K4U A;  5E33 A;  5D4O A;  2X1A A;  1S9F A;  3CCM S;  2QX0 A;  1S9E A;  4KHP F;  4JI4 F;  5FII A;  1CJK B;  3VR1 A;  1K1Q A;  2V4J A;  3AD7 C;  3D0H E;  2IRX A;  3WQP A;  3HFK A;  3OJS A;  2ADC A;  4BWM A;  3ONQ A;  4NLU A;  4F04 B;  3QT8 A;  3M6X A;  1HQE A;  2G1H A;  3B54 A;  5KFJ A;  1NKB A;  1C0T A;  5C7P A;  2AJF E;  5C2G A;  4QR2 A;  4KKO A;  3THT A;  1N32 J;  3LO3 A;  3V81 B;  1RDR A;  2JVO A;  2J5A A;  1HYS A;  4DCP B;  1RT3 A;  3EM1 A;  4OI0 A;  2R7U A;  4MTP A;  2GJI A;  4YB1 P;  1TFY A;  3DRR A;  3JQK A;  2LVW A;  1QSY A;  3D6M B;  1RAJ A;  4MMO A;  5E3A A;  1DRZ A;  2HEK A;  3UCU P;  3CJQ A;  4W98 A;  5I42 A;  4JI2 J;  2MQL A;  2B0G A;  3QT5 A;  4LQ3 A;  1FKA F;  2C2N A;  4CT9 A;  4ZJL A;  3K2Y A;  4W90 B;  4RW8 A;  2CXE A;  2JZ8 A;  3CED A;  4F0K A;  4YY3 F;  2IJF A;  4C11 A;  1RT4 B;  2IBO A;  1XAO A;  4R5P A;  2FJV A;  4M5K A;  1EAR A;  1RZM A;  1EET A;  4YHH F;  3K8V A;  3KLV A;  1EZZ B;  1N32 F;  1X5S A;  5C42 B;  3BB5 A;  2KXH A;  1WSR A;  3IRX B;  2Y0B B;  2OHD A;  3MM9 B;  4CH1 A;  2YNG A;  2FJB B;  5A6W A;  3K7R A;  1S9G A;  2QSF A;  2VZ9 A;  4IKA A;  2ACY A;  2UVU A;  1I94 J;  3H2U B;  4LSN B;  4ER8 A;  2B7C B;  4CO5 A;  2K8G A;  5THW A;  2LXI A;  5K14 B;  2OD6 A;  4R0E A;  1Z2L A;  2ZE2 A;  5K9F A;  2G2Z A;  3OUY B;  2DIT A;  2B9E A;  5IC4 B;  2EFP A;  4DV6 J;  1FXL A;  4L73 A;  4B9U A;  1SJQ A;  4GKK J;  3F41 A;  1N5V A;  4YR2 A;  1PC4 A;  4DL6 A;  3EXC X;  4EBC A;  4B3M F;  1WD6 A;  2YKN B;  3GPA A;  4MKY A;  5C24 A;  3HHN B;  1I94 F;  3FDS A;  2EW9 A;  3MAQ A;  1Q7L B;  3FEY B;  1UWB B;  4U8Y A;  1XJW B;  3J81 U;  3H40 A;  4CO3 A;  1UKU A;  3KG1 A;  4L76 A;  3GFY A;  4CYU B;  4GVB B;  1HNI A;  5AXK A;  4RBT A;  1YVF A;  3ZTP A;  2ZH6 A;  3BN4 A;  3G86 A;  2HNY B;  1NK7 A;  4JYA J;  3HFZ B;  3R5D A;  4ZMM A;  3OTE A;  5C5J A;  1VRT B;  3TEH B;  3SXL A;  3FBC A;  4NX9 A;  4NZ0 A;  2HWT A;  5IT9 Y;  5KT6 A;  1HFE L;  2IC3 B;  5HO4 A;  3ET6 B;  5KFC A;  5GMD A;  4J37 A;  3HZE A;  1SQE A;  4ED3 A;  2UXC J;  4C8Z A;  4CM2 A;  1OYD A;  4ED2 A;  4DLE A;  3IWN C;  4ZJO A;  4X65 F;  4DOZ A;  1WEX A;  3PKM A;  1RT6 A;  5DLF A;  2WSE C;  1NB7 A;  1QTN B;  3D1H A;  3MPV A;  2VA2 A;  2VG5 A;  2AGQ A;  1N5T A;  4KPY A;  1U09 A;  1VFJ A;  3A8E A;  4JI3 J;  4K4Z A;  2XZD B;  1TMJ A;  3X3U A;  5JVG Q;  1QAI A;  4IG3 B;  4CLP A;  5CCM A;  2EEY A;  2FVC A;  1F5B A;  1SPB P;  1BY9 A;  1YJR A;  3W5Y A;  2H48 B;  5C25 B;  4JOU A;  3QZ8 A;  2DNK A;  4HT7 A;  3OFH A;  4NLQ A;  2MYF A;  2GVZ A;  4LF1 A;  2KFY A;  3SEO A;  1TUW A;  1ZOT A;  3DMJ A;  2DNH A;  1Q0N A;  3DKD A;  1BQM B;  2XY7 A;  2DXF A;  2LQJ A;  4UY8 5;  3CTR A;  3TWZ A;  2ZJP Q;  1QM9 A;  3CJ8 A;  4EUV A;  2ATL A;  2ZDO A;  4WPA A;  3TZX A;  4FXV A;  5LSO A;  3KUE A;  2BW2 A;  3PX6 A;  5DDP C;  2XMT A;  3N6M A;  2XI2 A;  4JI8 J;  4N5S A;  1OJ4 A;  1IKX B;  2CQ4 A;  3M2R B;  4DV4 F;  3M2U B;  4CLY A;  4WF9 Q;  5AXN A;  3MDF A;  5KG0 A;  4TU7 A;  3WC2 A;  4URS A;  3MOZ A;  2XQC A;  2N82 B;  2HFZ A;  1FD2 A;  3V4I A;  2HAI A;  3IS9 B;  2DEJ A;  4KY3 A;  5B0F A;  7AT1 B;  5IQQ A;  2B43 A;  2AU0 A;  2ASD A;  5BXI A;  3IR6 B;  4RBU A;  2DYA A;  1C1C A;  4UOH A;  1HQU B;  3M7V A;  2V4Q A;  3LAL A;  2DGS A;  3CCU S;  3PW2 A;  1ZM2 A;  3H98 A;  2QMX A;  5A76 A;  1U45 A;  4Y2C A;  4DCJ B;  5J2P A;  4ZIV A;  3CPW R;  2WK4 A;  2R7T A;  4JI8 F;  4AE5 A;  1TK0 A;  2Z58 B;  1VI7 A;  1T02 A;  2DRB A;  1OY9 A;  1X9S A;  1VLY A;  1WC6 A;  1TL1 A;  2XG8 A;  1NRK A;  4WFZ A;  4FF2 A;  3J7Y U;  4E2F B;  2AYB A;  2L08 A;  2DGQ A;  2J7U A;  3UVJ A;  1AB8 A;  2HND A;  3D0G E;  5IT9 U;  3T5L A;  5DGB A;  4ZP8 A;  2BXJ A;  2W2N P;  2R7R A;  2KFN A;  4DUZ J;  1FWP A;  3F44 A;  4DFM A;  2XY5 A;  4F8R A;  1U26 A;  3N5F A;  3TAQ A;  3PHE A;  4HI1 A;  2HS4 A;  1ZAV A;  2V2K A;  2HQD A;  3DGV A;  4NEY A;  2LMI A;  2D3U A;  4DR7 F;  4OX8 A;  3Q8U A;  1HMV A;  1JLA B;  4DV0 F;  4ZVH A;  2VG7 A;  1DTQ B;  2V63 A;  3M8Q B;  4DR2 J;  1T11 A;  3W7B A;  2QLW A;  2AGO A;  4LF9 F;  3PKY A;  2DGT A;  4RW6 A;  3GZ7 A;  4WFX A;  1VQ7 S;  1SKU B;  2V8D A;  2FTR A;  2BQR A;  3M32 B;  3OL8 A;  4NA2 A;  2QJ3 A;  1UVJ A;  5CHC B;  1TL4 A;  4TYA A;  3RBZ A;  5KTQ A;  3TJ8 A;  4LF8 J;  4LFA F;  3QLH B;  2KXN B;  3QAU A;  3MFH A;  1P9Y A;  2JRS A;  4PKD B;  1I6J A;  3G82 A;  3CB4 A;  2I9S A;  1F3V A;  1Q8L A;  4K4X A;  4M95 A;  3PTW A;  1PYT A;  3AFG A;  2FYX A;  2DJW A;  3G87 A;  1ZM4 A;  4F0M A;  1RXO B;  2M7S A;  4JI5 J;  1ARO P;  3GFX A;  2R8G A;  1RP5 A;  2UV8 G;  3DN9 A;  3HVA A;  3K89 A;  3FVY A;  3WX4 A;  2ZBI A;  3P49 B;  2M2B A;  2UXD F;  1MRO A;  3HJV A;  4U67 Q;  3WX8 A;  3KWM A;  2YKM A;  3NG8 A;  2J8S A;  4TLR A;  3SDE B;  2CNL B;  4G6V B;  4ZPD A;  4MFB B;  2EXU A;  2KG1 A;  1YQH A;  2XMJ A;  1JKH B;  4ZN3 A;  1NZA A;  2EKY A;  1PGZ A;  1N5Y B;  1KLN A;  2EFN A;  1NKE A;  1T94 A;  3UN3 A;  2HBY B;  4DPO A;  4HEA 9;  4EGL A;  3UW1 A;  4EZ9 A;  3AH6 A;  4DR6 J;  4OL8 A;  4M5D B;  1UJ6 A;  1VBK A;  1B7Y B;  3R3T A;  3S1T A;  2YX7 A;  2BRK A;  3GYX B;  5IQ6 A;  1U1L A;  3CT9 A;  2OEM A;  1XNR J;  4B3R J;  2V8G A;  4A8M P;  1GTH A;  2D9O A;  1YTY A;  4CNZ A;  4YUD A;  1LFW A;  1TVR B;  3H59 A;  2ZKT A;  5HQM A;  1M1K T;  3R1H A;  2HHU A;  5A2Q Y;  3DLG B;  4PXB A;  1RTJ B;  3N5B A;  2G13 A;  2C3Y A;  1FKP B;  4EU0 A;  1DY3 A;  2VQE F;  4OV1 A;  4DL5 A;  4RLE A;  2W1B A;  1Q86 T;  3IG1 B;  2PMZ D;  5CXT A;  2WOM A;  1N33 F;  4O44 A;  4W92 B;  3RB4 A;  4FZV A;  2Q1L A;  1IQZ A;  1T9U A;  2DNM A;  2GAG C;  3BSN A;  1MN7 A;  3SQG A;  4JV5 J;  2MHN A;  5KOW A;  2VOD A;  4O4G A;  3DLK A;  1XNR F;  3HLU A;  4PG4 A;  3GJS B;  3FQK A;  3C14 A;  1D9A A;  3IGN A;  1VHF A;  1KLM B;  1Q1K A;  4TQS A;  1YHQ S;  3MMC B;  3QSI A;  4I6A A;  5CYJ A;  1CBK A;  3H90 A;  2JHE A;  3OFE A;  3LGH A;  3C6T B;  5KG2 A;  1IBM J;  3MR3 A;  5KFD A;  3GP9 A;  1P9Q C;  2OPR A;  2DNG A;  4ED6 A;  3NMR A;  3LP0 A;  3N9U C;  4FF4 A;  2QZ8 A;  3FBB A;  3KJV B;  1HNV B;  3FBF A;  3I5A A;  1B7F A;  1QSL A;  4Q2L A;  5AE1 A;  1PJ7 A;  1O5J A;  4I4B A;  4URQ U;  2RD5 C;  3CDA A;  4F26 A;  3UNG C;  1FXD A;  2ZKU A;  3FCH A;  2JEF A;  3N4W A;  4X4N A;  3MAA A;  4E98 A;  1T3O A;  4EZ6 A;  2AJ0 A;  2FJA B;  3MM7 B;  4FVC A;  3AT1 B;  2F9J A;  1AXQ A;  4YP3 A;  2ZD1 B;  4LRE A;  1WOO A;  2F4F A;  4M5N A;  2FVS A;  4DPT A;  2MZS A;  4TYB A;  2W9B A;  3I0S B;  1VQ9 S;  2MJN A;  4NI2 B;  4ED5 A;  1X4G A;  4AQY J;  3L7P A;  3G71 S;  3EZ5 A;  4CH0 S;  2DY1 A;  5DZ6 A;  2VIC A;  2HFV A;  4IDK B;  1JNZ B;  4Z7Y A;  1KEK A;  4WP3 A;  3MUM P;  4M5I A;  4KPC A;  5CZX A;  2F65 A;  3KLH B;  4KGZ B;  1SQG A;  2VBY A;  2CVE A;  3K8W A;  4FF1 A;  3DC2 A;  1B99 A;  2BJ8 A;  4DZ6 A;  4LMZ A;  1IWG A;  4TKT A;  4C2M A;  4WYW A;  5FDL A;  1FHT A;  4CO4 A;  2GCF A;  3CO9 A;  3HVR A;  1D3W A;  3NNH A;  3LAK A;  5KFK A;  4Q0B B;  1I3O B;  5KFI A;  2C2Z B;  5HVF A;  2BV3 A;  1PC5 A;  1KQF B;  2IYI A;  4UOF A;  2RE1 A;  3HO1 A;  5A2Q U;  1SIW B;  1QDU B;  1SJR A;  3O1L A;  4DDF A;  3GIJ A;  5J2M A;  1JLB B;  2RQC A;  4DPW A;  2MKJ A;  2KJW A;  5L1I A;  2CJA A;  2YKA A;  3GE9 A;  3R6L B;  3VAM A;  2KVQ E;  4RNF A;  3QGI A;  1X4D A;  5A6P A;  3B8H A;  1P27 B;  1ZPW X;  2OP5 A;  3DOM A;  1PCA A;  3Q2T C;  4U8V A;  1HW8 A;  1CS4 A;  3D3B J;  2V2V A;  2XY6 A;  2BKN A;  1YBA A;  1BWE A;  4OZ2 A;  3ENW A;  3P5B P;  2ZH8 A;  5KFE A;  2Q66 A;  4B17 A;  3AB4 B;  1BMQ B;  1SXL A;  1VLO A;  1Y3J A;  1SJF A;  1N0V C;  1NK0 A;  1Q16 B;  4ZLP A;  3NGU A;  3DRS A;  4JI1 J;  2HHP A;  3ZZU A;  4DL2 A;  1S97 A;  2C2E A;  1AUD A;  3UR0 A;  4DV2 F;  2W4P A;  4WE1 A;  3DU5 A;  3M30 B;  1J27 A;  2DHA A;  2CVI A;  4K5R A;  4DL0 C;  4EYH B;  3BO3 A;  3UR3 C;  2RML A;  3N28 A;  1TAU A;  1F6T A;  4OMF G;  1M0S A;  2XSJ B;  2IBK A;  4M63 A;  4NA3 A;  3J81 j;  3TUJ C;  1Q7Y T;  3KLI A;  1FRL A;  1X8D A;  3T3F A;  4KE5 A;  4JI1 F;  4DQI A;  5AE2 A;  3FC9 A;  1FRJ A;  2I38 A;  2PFF B;  3I6P A;  2LQ9 A;  4DUY J;  2V5H G;  3PIP Q;  3GTY X;  2EK1 A;  3B6B A;  5DDR C;  1N4L A;  2N7C A;  4ICL B;  2OPQ A;  4EBD A;  5L1J A;  3NS5 A;  3BRE A;  5CYQ B;  2R42 A;  1MML A;  2QLB B;  1V5V A;  4K59 A;  3FEZ A;  1IM6 A;  1RWN B;  1XEZ A;  3CDB A;  2HNZ A;  3DLL Q;  3UWT A;  1AA1 B;  1Q53 A;  3QJP A;  3D54 A;  1JLF A;  4TY8 B;  1J5O B;  2O1P A;  3PRB A;  4N56 A;  3NMA A;  1W2I A;  5T41 A;  4C6A A;  1U2R A;  4N8O A;  2CPX A;  1YI2 S;  1NLK L;  1DFD A;  1WF0 A;  2KTQ A;  1U4B A;  4A8X A;  1NU4 A;  1SVD A;  1W26 A;  4OZN A;  2RNE A;  1BD6 A;  3VGS A;  2IPO B;  4I6W A;  4C48 A;  2KO1 A;  2ZWP A;  4IRK A;  3EGW B;  4NLX A;  3VAF A;  5KFU A;  4Q43 A;  5GAE I;  4O3P A;  1K9M T;  2XEX A;  4OX7 A;  2CPJ A;  3PX4 A;  1WDT A;  2D69 A;  1HWJ A;  3TW0 A;  1M5K C;  3PEH A;  1WKL A;  5KT7 A;  1O8B A;  4L72 B;  4M8L A;  3W8G A;  1HBM B;  3N6N A;  4M94 A;  3B4M A;  2GO9 A;  5HI7 A;  1RTD B;  2FUG 9;  1FER A;  3TNV A;  4QYZ K;  4JI6 J;  3UI3 A;  1KOO A;  4NXN F;  2VV5 A;  2R8J A;  4I2P A;  2W2M P;  3RYL A;  2VAS A;  1WSV A;  4X66 J;  2PT0 A;  4J9P A;  2DGW A;  1Q8K A;  1RHJ B;  3CDW A;  3QAE A;  5F8M A;  2GHV C;  4WU2 A;  1KR4 A;  4C3M A;  4PCQ A;  3QMQ A;  4ZK7 M;  2IM3 A;  2PEH A;  1KVK A;  3V6D B;  1SBR A;  1K47 A;  3LUY A;  4LBH A;  4Q45 A;  3L9Z A;  4XDC A;  4MYU A;  2AZ1 A;  3HVW A;  1RWX B;  1S57 A;  2DRD A;  2ZEJ A;  4JI6 F;  5SUH A;  2X1B A;  2CFX A;  3UNY A;  4ZHR A;  2YQ0 A;  4BC7 A;  1ZET A;  1GX6 A;  1Y7P A;  1IR0 A;  3I32 A;  3TI0 A;  4ED0 A;  1S1V A;  4X66 F;  1CLF A;  2V9W A;  1EX8 A;  5GAG I;  1JLC A;  3DDN A;  1RAA B;  2JFD A;  2MY7 A;  4ELV A;  2ALZ A;  1B4S A;  2DCU B;  4DN9 A;  4FXD A;  5JXS A;  1YBT A;  5D78 A;  5A8K A;  1JMT A;  2J7W A;  1TFW A;  5H1S V;  2NRE A;  2ZH3 A;  4R25 A;  1IKY B;  3F0N A;  3DGP A;  1PYS B;  1TKX B;  4C8L A;  2FJD B;  3I0R A;  3FFI A;  5I3U B;  1L3K A;  2B9X A;  1FKO A;  1CJT A;  3KLG A;  2DHH A;  2UUB F;  2DNZ A;  4C8M A;  4IFY B;  3CIM A;  3J7A N;  2GML A;  1QJH A;  1M5P C;  2YWF A;  1BUX A;  2VH7 A;  2ADB A;  3MFI A;  1T05 A;  3HPO A;  1HPZ B;  2CQI A;  1R0A A;  1RI7 A;  3HSD A;  4Y65 A;  1T8E A;  4I7F B;  1C1B A;  1DTT A;  3MEC A;  3PDN A;  4HYK A;  2PE8 A;  3ENV A;  2D41 A;  4TY9 A;  1TUV A;  2VU5 A;  1YJU A;  1YZ7 A;  2R7O A;  3R5A A;  4P7T A;  1U0S A;  4FXW A;  5G0R B;  1H2U X;  2YKO A;  1N56 A;  3NS7 B;  2KHC A;  5IC6 B;  5B0C A;  3QRQ A;  3BDP A;  1HW9 A;  1S5Z A;  2FHJ A;  4LUB A;  1NBE B;  1CJK A;  1PO6 A;  5T14 A;  5DG8 A;  2HGM A;  1XQI A;  1N8R T;  3PW4 A;  5A8R B;  1HI1 A;  3RJM B;  4IG0 B;  1HI0 P;  3DHW C;  5GAH I;  1FK9 B;  2Z30 B;  4EMD A;  2KJV A;  4MK9 A;  4UQG A;  4F2R A;  3OR2 B;  2EFQ A;  3R97 A;  3UPF A;  4DR5 J;  3T5K A;  4WXW A;  4YB7 A;  4XPC A;  2BKP A;  4F0H A;  1OWX A;  4WYL A;  4RUC A;  1VRU B;  2GX8 A;  3BQ2 A;  2XO6 A;  1KON A;  3VQT A;  2WCX A;  4E0D A;  1HL6 A;  1W2B R;  1RWP B;  2PA3 A;  2Y1I A;  2H3E B;  1FJG J;  1RT4 A;  3WDO A;  4NAS A;  4ZPB A;  2HFN A;  2QRR A;  2D9P A;  3BSO A;  1YG0 A;  4KIA A;  5K8O A;  4FF3 A;  2HUR A;  4DN0 A;  2RT3 A;  5C42 A;  2CJB A;  2DO0 A;  3G8S A;  4OZ1 A;  3MM9 A;  1JLQ A;  4C98 A;  1WNE A;  5D3G B;  8AT1 B;  1S79 A;  2FD2 A;  4TQR A;  1H38 A;  2AEF A;  1VCT A;  1N34 J;  4LF4 F;  4LF2 A;  4KSE B;  3LGN A;  3K17 A;  1JK9 B;  1C0U B;  1S6P B;  3CCV S;  2KHD A;  1YBU A;  2E29 A;  5E41 A;  4RW9 A;  5ETP A;  2VPZ B;  3FBE A;  3UDC A;  1TL7 B;  3RBX A;  3D3C J;  4Y2I A;  4ZA1 A;  2VF3 A;  4XAK A;  5DQI A;  4ANE A;  5ETO A;  2BBE A;  3CCJ S;  2YKN A;  2KKH A;  5ETK A;  3NCR A;  4IOB A;  1UWB A;  1N34 F;  3SI8 A;  3ULH A;  2WB4 A;  4IRC A;  3VVU A;  3W5X A;  4DV7 J;  1S0O A;  2RKI B;  4V19 J;  1ZA1 B;  4S0M A;  2GGP A;  1RWW B;  3UN5 A;  4GVB A;  2BRL A;  1LWF A;  4EYI B;  4HDH A;  4DX5 A;  2E1P A;  2LQB A;  3CNQ P;  4NLP A;  3G6V A;  4DV3 F;  2K7J A;  3ZZZ A;  5HMZ A;  2FJW A;  2QYC A;  1XR5 A;  1VRT A;  5CD4 A;  1VRQ C;  2E5J A;  2CA9 A;  4Y6I A;  3ET6 A;  1D1U A;  2ZZN A;  2A2C A;  2RDJ A;  5HLF B;  2BOP A;  1LW2 B;  1S0N A;  2WVD A;  4OX9 F;  5IS2 A;  3MUT P;  2HZV A;  2CQP A;  2ZWO A;  2YNH A;  5HMX A;  3POT B;  2OPS B;  1HBN A;  5DO2 A;  4ENO A;  2BE7 D;  2DIS A;  2FVP A;  3C15 B;  4QBU A;  4ZOS A;  3JSB A;  2FY8 A;  1HBU B;  2RSQ A;  2AKW B;  5KFR A;  2R7W A;  1XC9 A;  1UL3 A;  3EZU A;  4ECY A;  2OLW A;  1FRH A;  2I2Y A;  5EX0 A;  4DSL A;  2G0I A;  3CME S;  2ASY A;  1R43 A;  5F41 A;  3A1Y G;  5C25 A;  1FE0 A;  1H73 A;  3BPS P;  1FI4 A;  4OLO A;  2PI5 A;  2YWE A;  1HR0 F;  2A10 A;  3IM9 A;  5B08 A;  2F4V J;  2IVM A;  3I55 S;  4DFJ A;  1RU2 A;  1SUQ A;  5BR8 J;  4ALZ A;  2QIF A;  1BQM A;  3GCW P;  3QSY B;  1NJI T;  2BE2 A;  2VFU A;  4PG7 A;  4X4V A;  2GHP A;  1FRX A;  4PWD B;  2E9R X;  1SL2 A;  5K8N A;  3A3P B;  4J9K A;  3SV3 A;  2BYC A;  4KBI A;  2MQ8 A;  2P6S A;  2N4D A;  2XWX A;  2N3O A;  1U1R A;  1IKX A;  2DIV A;  1H2T Z;  3M2U A;  1EQ0 A;  4QU7 A;  3SFU A;  2F4V F;  3W5Z A;  1Z2Z A;  4QCL A;  4IRD A;  5DET A;  1K0T A;  4UOC A;  3H4D A;  5BR8 F;  1RB0 A;  4ZVU B;  2J6T A;  3RB6 A;  1OPI A;  2DNR A;  1A0O B;  2D1C A;  1MWQ A;  4U7U K;  4LSL A;  4YB6 A;  2JLG A;  2O3D A;  3NGT A;  2IMO A;  4F4A A;  2B26 A;  3Q22 A;  3AY0 A;  5LSL A;  4USI A;  1IKV A;  4Y0F A;  1D8Y A;  1Y9O A;  4NLS A;  3D6T B;  4IO1 A;  5I3Q A;  5LM7 E;  4P73 A;  4J9R A;  5IM0 A;  1K8A T;  1X5O A;  4NCG B;  2XCA A;  3C2P A;  1LW0 B;  1A9N B;  7FD1 A;  3ITH B;  5AXM A;  5LJ5 Y;  4KV8 B;  5DS7 A;  5SZT A;  3KK3 B;  4ZCK A;  2HLU A;  2OFH X;  2VDI A;  3SBM A;  5GAG U;  2Y0S D;  1MWZ A;  3LAN A;  4AXI A;  1QY7 A;  4CNY A;  2HVE A;  4CTA B;  3W3S A;  1EQM A;  1KBR A;  1JQG A;  2EWH A;  5CQG A;  4HVZ A;  5ETN A;  4UZC A;  1SB6 A;  2MY8 A;  2HBZ B;  3P96 A;  5KFY A;  2L9D A;  3JS9 A;  4EFA C;  1T95 A;  2HZA A;  3TAN A;  4F25 A;  2MQN A;  4MAK A;  1JLA A;  4QW8 A;  1DTQ A;  2FHM A;  2MST A;  4ES3 A;  2BJ7 A;  3M8Q A;  5EWG A;  3NLC A;  2UUT A;  1NXI A;  2F9D A;  1U1K A;  5F9N A;  4QW9 A;  4C8O A;  1NDC A;  2ZH5 A;  2LXU A;  4OYX A;  2IM1 A;  2KYZ A;  2W4C A;  5K20 B;  3CDE A;  3JXO A;  4MT1 A;  3M32 A;  4ZVF A;  3Q8S B;  4ATN A;  1DZ5 A;  4QPX A;  4H4M B;  2P2C B;  3HHL B;  4PRF A;  5EWF A;  2UVV A;  5KT2 A;  2CZ9 A;  2UXB F;  4KTQ A;  1M5S A;  4WTY A;  2C42 A;  5K8P A;  3GJQ B;  3BKF A;  3MMA B;  2QA2 A;  3DOK B;  2CYY A;  1RLC L;  1Y11 A;  4ZPC A;  2O66 A;  2R8K A;  5HAO A;  3NXZ A;  1RJJ A;  2BJE A;  1UVM A;  2ABY A;  1HWL A;  2CQ1 A;  2L3M A;  2UP1 A;  3HSG A;  2VJU A;  1WHX A;  2AGP A;  3AGY A;  3FRZ A;  5D0G A;  5GAH U;  4KHR A;  2MLZ A;  3LZ8 A;  3OL6 A;  2VHG A;  4F4W A;  3FSY A;  5F0W A;  4RPF A;  3SDE A;  3PYE A;  2FZG B;  4M5H A;  4MFB A;  1GK8 A;  5B0G A;  2B6A B;  2R7S A;  2ZIT A;  3R7B B;  2RRB A;  2FB0 A;  2U1A A;  4WP8 A;  4DV5 J;  4RO0 A;  3H2L A;  1N5Y A;  1CVJ A;  4LF7 J;  4J9V A;  1LEO A;  2HHH F;  3N01 A;  2LCW A;  5EUH A;  4P2M A;  4B9T A;  4M5D A;  2AX1 A;  2WON B;  1SH0 A;  1K73 T;  3FZB A;  1D9F A;  1YRU A;  3W2V B;  2V67 A;  1REV B;  1X5T A;  3MMJ A;  3VGU A;  2KFZ A;  5J1P A;  5HK4 A;  4TU8 A;  4B3S F;  3FKB A;  3AGX A;  4HAC A;  1TVR A;  1UJ4 A;  5D4N A;  3NOG A;  4CLK A;  4ZIT A;  4X64 J;  2LEP A;  1OMS A;  3HKW A;  1RTJ A;  3LP1 B;  3HSJ A;  4FNI A;  3M6U A;  3UE2 A;  3Q8Y A;  3DLB A;  2RU9 A;  2OPP A;  3T9N A;  3KHG A;  3CD5 A;  3IG1 A;  4MIW A;  2YNF A;  1RTH B;  3GIL A;  3VAH A;  1N6Q B;  3D1O A;  4OI4 A;  4FNH A;  4C8K A;  2VG6 B;  1T03 B;  1IJF B;  1SKR A;  3AJ2 A;  1NLT A;  3VZH A;  3TZY A;  1CJV B;  4ZVP B;  5L46 A;  1YJV A;  3MPU B;  1WI8 A;  3ISN D;  3LW5 C;  2FQQ B;  3MMC A;  2LQ5 A;  1LK7 A;  1UFK A;  5F8N A;  2UU9 F;  2ZHO A;  2C22 A;  4QIE A;  4C0O C;  1JXE A;  3C6T A;  1RKJ A;  3AOD A;  4M5J A;  1OO0 B;  1T9W A;  2XMK A;  4W4M A;  4I67 A;  2E5I A;  4DPU A;  1WEY A;  1VOM A;  3OLA A;  3PO5 A;  3LOU A;  4EO8 A;  1KFS A;  2R8I A;  4U7C A;  1XNQ F;  1KC8 T;  2CRL A;  1SKS A;  5CYM A;  3KJV A;  4ZVQ B;  4J9S A;  1P1T A;  1KQS R;  3CJ0 A;  1R89 A;  4NLY A;  4C7Q A;  1Z1Z A;  4JI7 J;  1SC4 B;  5HL7 Q;  1C3G A;  4G1Q B;  1ZYQ A;  4O4R A;  1GTE A;  3CWJ A;  3EDQ B;  1LNQ A;  4I68 A;  2HFO A;  5LJ3 Y;  4DV1 F;  5F9L A;  1U24 A;  3NWG A;  1FDD A;  4IQM A;  1KN6 A;  2V4J B;  5ETS A;  4PQU A;  2HQ3 A;  3MM7 A;  1UA0 A;  4KGK A;  1VQ8 S;  2DY9 A;  3GON A;  1HQE B;  2ZD1 A;  1C0T B;  4CLZ A;  3PRD A;  4KKO B;  4L3K A;  4QWD A;  3I0S A;  1W25 A;  1RTZ A;  4ECU A;  4KC5 A;  2XHW A;  1LWX A;  1HYS B;  3SSR A;  1HLW A;  1UVL A;  1UCN A;  4OJ3 A;  3T41 A;  4PAB A;  3U1M A;  2XNQ A;  4WZQ A;  3KNA A;  2I6W A;  2N7Y A;  3HM9 A;  1TR0 A;  4RW8 B;  2IMW P;  1GXU A;  3C8Y A;  3AA8 A;  3VZI A;  3MTK A;  3MR2 A;  2YNI B;  4ZPW R;  4GO7 X;  4ZVO B;  3H42 A;  4CLT A;  4R5P B;  3CJT A;  5D4P A;  3FMB A;  3VF0 B;  2NS1 B;  1RCO B;  4FVM A;  4F4X A;  1EET B;  2KM8 B;  3ELH A;  3IBF B;  2R7Q A;  3CJK A;  1JXL A;  4JV2 A;  4Q0B A;  3QAT A;  3PNI A;  3MPW A;  2DNQ A;  5F8H A;  1LFP A;  3I82 A;  4NYO A;  3D28 A;  4LRB A;  4IQX A;  1QAX A;  1Y10 A;  1S9G B;  1QTM A;  1RAF B;  3KYL A;  4I6Y A;  4FPR A;  2UUW A;  1S7I A;  3EZO A;  2DNY A;  3OLB A;  2FZK B;  3EPI A;  1TV6 B;  2ZDP A;  4OX6 A;  3AHP A;  5AJ3 F;  4JV0 A;  2VA3 A;  3RAM A;  3DYA B;  3K5P A;  1NJW A;  2EKN A;  4RJV A;  3KJF B;  1FDB A;  3NAH A;  1UEK A;  1RT7 B;  2NXU A;  1FRM A;  3EPG A;  1S59 A;  3QJL A;  2DR5 A;  3MM8 A;  3OV7 A;  3TVY A;  3BQ1 A;  1OY8 A;  1X4E A;  3HSZ A;  1FFS B;  1OYE A;  3TUZ C;  5IV3 A;  2VQF J;  2D3O 1;  2OI2 A;  1QE1 B;  1TMM A;  3Q8R B;  3JQJ A;  4RNH A;  2ZOG A;  4HHU A;  1BC6 A;  2ZM6 F;  2BAB A;  4MK7 A;  4M5M A;  1KKH A;  1NH8 A;  1V3Z A;  5BYR A;  2SXL A;  1EJ7 L;  4KB7 A;  3BGL A;  3DOL B;  1L3V A;  4LVO P;  4X62 F;  1RIS A;  5KFW A;  2UVR A;  5E3Q A;  4CZC A;  3JB9 k;  3LF0 A;  2BA9 A;  3RU0 A;  3PV8 A;  2NPI A;  2MXY A;  1N5S A;  1RHM B;  3H4B A;  1AZS A;  4QIV A;  5KFZ A;  1RQ0 A;  3DLE B;  5DLG A;  2YX1 A;  1U7L A;  3BKU A;  3T1Y J;  1OY6 A;  1Q8I A;  2I5J A;  1ZH5 A;  4ZLJ A;  4HHH A;  3J7Y I;  2GVD B;  2LDI A;  4LFC J;  3E8O A;  4B3T F;  1RT6 B;  4PG8 A;  3NCP A;  5HN0 A;  4DR1 F;  3EMT A;  2BE9 B;  3R5G A;  1SL1 A;  3RUB L;  1H74 A;  2QMU B;  5K5M A;  4NLD A;  1MU2 B;  2B4U A;  1KHV A;  1HIY A;  4WII A;  2IA0 A;  2EFG A;  1RWV B;  1E6V B;  4N77 A;  3JSM A;  4JP8 A;  5CYQ A;  1S76 D;  2PGC A;  3T1Y F;  3RGI A;  4AXJ A;  3T5J A;  2RIJ A;  3OHB A;  2FVQ A;  2HZC A;  1DAR A;  2Z8Q A;  5F8I A;  1NJY A;  3DI6 A;  5EHH A;  1VQP S;  2C1E B;  1U0H B;  1XN9 A;  3F73 A;  3QRR A;  2GVZ B;  2YWK A;  5ETT A;  5KFT A;  2MQQ A;  3KLE A;  3DMJ B;  4QYR A;  2AYG A;  1S1U B;  2F3J A;  3FSX A;  3KFW X;  3I5C A;  1FES A;  2PA8 D;  1PIE A;  3CD7 A;  3J81 Y;  4LVN P;  3AB2 B;  4UY8 T;  5IT0 A;  1V9O A;  5KFF A;  4JBC A;  4NE9 C;  5B0B A;  3OTB A;  2XWY A;  3VVT A;  4UW2 A;  4O0N A;  1IVZ A;  3TX0 A;  2B8Q A;  1XMQ F;  1GQE A;  4LBP A;  3GFH A;  4OYO A;  5JUM A;  1NDP A;  3I9V 9;  4DR4 F;  3NNC A;  4FYD A;  2CPZ A;  4O3S A;  3KHL A;  4MIB A;  2VKR A;  1N52 B;  6FD1 A;  2NYI A;  3TUI C;  2KG0 A;  2OMO A;  3E3X A;  3MMB B;  1HBM A;  3EGV A;  3DM2 A;  3KMQ A;  3SV4 A;  5ETQ A;  1FDA A;  4QR1 A;  3NOC A;  3THP A;  1GT8 A;  1TUG B;  1DQ9 A;  5LMU F;  2CNO B;  4XO0 A;  1LXN A;  5KFM A;  3T19 A;  1IR1 A;  1UTA A;  5KFN A;  2G1D A;  1HD0 A;  2JL9 A;  2ODX A;  5HAN A;  2V4R A;  2WVF A;  4PWW A;  2V8V A;  1TL1 B;  1B0T A;  1VIS A;  4XDD A;  3AXM A;  3GR1 A;  1OSD A;  2IDE A;  2ASJ A;  4ECQ A;  4TNO A;  1WOP A;  2F7V A;  1D0E A;  3UVJ B;  5IWA J;  2HND B;  5L38 A;  2J0X A;  4IFV A;  2OUG A;  5LL6 d;  1NND A;  1F1B B;  2EBE A;  1NK9 A;  1FVQ A;  4DQQ A;  2DR6 A;  1KDN A;  2V8H A;  3R7N B;  1Q8B A;  2PDA A;  4NPO A;  4OJH A;  4EEY A;  1HNX J;  1O0P A;  4Y2M A;  4USJ C;  4PEO A;  3RRH A;  2RVJ A;  2JZ5 A;  4MKA A;  4HH1 A;  3R1L A;  2AHO B;  4JI2 F;  1ZS6 A;  2HHV A;  2H51 B;  3QJJ A;  2AV5 A;  1RAI B;  1TKX A;  2VG7 B;  2ZUG A;  3KNG A;  5IWA F;  3K5M A;  2JSX A;  4JI0 J;  2DPJ A;  3IR5 B;  1WC0 A;  2J0Q D;  3W64 A;  2XNR A;  2VC0 A;  3BGU A;  4IFY A;  4P7V A;  2CPF A;  4PQA A;  4KQZ A;  3QFH A;  3R5C A;  1WG1 A;  1GX5 A;  2JRR A;  3KK2 B;  2QL9 B;  4KFB B;  2WBM A;  1HPZ A; 
#chains in the Genus database with same CATH homology
 3LA0 A;  1GMW D;  1EAR A;  3I38 A;  1NLT A;  3TJA A;  1C3G A;  2B26 A;  3NY0 A;  1GMU A;  3AGX A;  3AGZ A;  3L9Z A;  3AGY A;  1GMV A;  2Q2G A;  3LZ8 A;  2QLD A;  3TJ9 A;  1GMW A;  3NXZ A;  2HFV A;  3TJ8 A;  1XAO A;  4J80 A;  4L3K A;  1EB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...