1GNSA

Subtilisin bpn'
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
262
Chain Sequence
GPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPALKVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIWSTLPGNKYGAKSGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Thermostability. Analysis of Stabilizing Mutations in Subtilisin Bpn'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords SUBTILISIN BPN'
total genus 93
structure length 262
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2001-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gnsA00
1T1GA 1AK9A 1AU9A 1GNSA 3BX1A 3BPSA 3A3PA 3I30X 3UNXA 1Y1KE 3EDYA 4WOBA 1Y3FE 1KDZA 4J94A 3H42B 3P5BA 2Z57A 1SBHA 2ZWOA 1TM4E 1R64A 2XTJA 1Y9ZA 3DE6X 3T41A 2IXTA 3LXUX 3QFHA 1YU6A 1AH2A 1IC6A 2Z2ZA 3EIFA 4LVOA 1WMEA 1GTL1 1GA1A 4JP8A 2X8JA 1PTKA 1SVNA 3WQBA 3QTLA 2E1PA 5AVJA 1BE6A 4HX2A 1SUBA 5JXGA 4OV6B 2GKOA 1Y3CE 3AJ9A 1SUAA 1AV7A 2W2NA 3CNQS 1PEKE 1OYOA 4H6WA 5JMOA 2IY9A 1P8JA 1NDUA 5AQEA 1R0RE 1WVMA 1KE2A 3DDZX 3I37X 1TM7E 1Y4AE 3DVSX 2XRMA 5K7SA 2X8JB 1R6VA 1C3LA 1Q5PA 2Z58A 4HVLA 3LPDA 3GCXA 3LPCA 2B6NA 1ZVKA 4OMCA 2PKCA 5FAXA 1BFKA 1ZVJA 5B1EA 1LW6E 3D43A 5JXHA 2SNIE 5AVKA 2PQ2A 2W2MA 4NMXB 1Y48E 1T1EA 1CSEE 1GT91 3VV2A 1TM1E 1HT3A 3I34X 1S2NA 2PWAA 1ST3A 2HD4A 1XF1A 2P4EA 3Q40A 2Z2XA 2W2PA 1UBNA 4K8RB 5ARDA 4ZOQI 5JXIA 3DE3X 3OSZA 3PRKE 4GI3A 1WMDA 1SCBA 3F49S 1YJCA 4KB5A 1P7VA 1BH6A 1NLUA 2PWBA 2W2QA 2DP4E 3F7OA 4CFYA 1SCNE 3CO0S 4BWGA 2V8BA 2ID4A 3GCWA 3GT4A 4CG0A 4DJ5X 1GA4A 1T1IA 1MEEA 3AJ8A 1AF4A 1BE8A 3DE0X 3DE7X 2DUJA 1TO1E 3GT3A 5FBZA 4M1ZA 4NE9A 4DZTA 3DE2X 3LPAA 1GTG1 5ARBA 1SUDA 1SUCA 1TM3E 1Y34E 1SBCA 1NDQA 2SBTA 2Z56A 4KG7A 3D9QX 1KDVA 4H6XA 1SPBS 2WUWE 5CW1A 1TK2A 3PTLA 1ST2A 1TMGE 3L1KA 4WOCA 2W2OA 1SCJA 1SBTA 3I2YX 1SIOA 2DQKA 2G4VA 3SQOA 4B5LA 1TM5E 1AVTA 3EE6A 1Y4DE 1SELA 1SCDA 1SCAA 4CFZA 4I0WB 1SIBE 4C3UA 1BJRE 1EGQA 1WMFA 1SUEA 1KDYA 1Y33E 2PYZA 1KE1A 4RYDA 3DW3X 1DBIA 1GTJ1 3VTAA 1GCIA 4OMDA 1VSBA 1S02A 5ARCA 3A3NA 1GA6A 2QTWB 4ZARA 2ZRQA 3TI9A 3WIVA 4AKSA 2WUVA 1SBIA 1SN7A 3A3OA 5B1DA 1YJBA 3TECE 5AMXA 1MPTA 1Y3DE 4MZDA 5FFNA 3ZXYA 1GNVA 4LVNA 2PRKA 4NE7A 3VHQA 4AKTA 4Z2AA 1C9JA 1P7WA 4YN3A 5SICE 1Y3BE 1V5IA 4FONA 1SH7A 2SECE 1OYVA 1SBNE 1TECE 2ZWPA 1AQNA 1V6CA 3WIUA 3DE5X 1SIUA 3DVRX 3Q5GA 3VYVA 3SICE 1TO2E 4DWWA 2SICE 3AFGA 3DE1X 1SUPA 2Z2YA 2ST1A 3WHIA 1THMA 1WSDA 3ZXXA 1PJ8A 5I9SA 4KPGA 3DYBA 3QMPA 3TI7A 3BGOS 3DE4X 1S01A 2WWTA 3DWEX 1JEAA 3DW1X 3DVQX 2Z30A 1A2QA 5JXJA 3F7MA 1EA7A 1DUIA 1OT5A 2ID8A 1PFGA 3VV3A 2TECE 1CNMA 2HPZA 2WV7A 1IAVA 1YJAA 4C3VA 3HJRA 1BFUA 2PMWB 3VSBA 1C9MA 1C9NA 4H6VA
chains in the Genus database with same CATH superfamily
2BR3A 1AK9A 2Q99A 3BX1A 3HM2A 4MVJE 3ADBA 1K66A 2YV1A 1F9EA 3KV1A 1ATZA 1XMXA 3SZRA 2Q9UA 4MYTA 1CW2B 1QG6A 3NBZC 4IIEA 4F6RB 3RRZA 4PFJA 1H2BA 2A3NA 5IJ0B 4IIBA 2YFQA 4QEZA 3WLAA 1R9MA 1N0UA 4Z9XA 3P8ZA 4L2IA 3DONA 2VNAA 3VAAA 3OKFA 3PNYA 2VYND 2NO7A 2AOXA 2PV7A 2GCNA 3BWCA 3O9MA 3OE5A 2CDNA 4M9UA 3FIJA 4DGQA 5H9WA 3ZV7A 1M2VA 3F6PA 4O2BB 1DRWA 3LJKA 5BP7A 2Q5FA 4C7KA 2IXFA 4NJEA 5JY1A 5E6SA 1VRVA 3AVQA 4D98A 4FDLA 4ZI7B 1N1EA 1NSFA 3QVGA 3VH3A 3SXUB 1CQPA 1LWOA 1NW3A 3DFMA 1R74A 3IPXA 3MLEA 1OJ7A 4PZ9A 3TOZA 1A27A 2JK0A 5JSQA 3TZHA 1G1MA 3LPNA 5J4KA 3W9SA 5F4ZA 5DIFA 4X97A 4QGGA 1YCFA 2OV3A 1GL3A 5JS8A 2B36A 3HXPA 2GLXA 2NTNA 1JLLA 5LBUA 2H4HA 2FPSA 3IDFA 2HIHA 4YRPA 5CBKA 3T1VA 1PQPA 4FFWA 3T5GA 4G0YA 1J8FA 5JYDA 3G17A 2YZGA 3H0EA 1YULA 1V3TA 3ZI7A 4KQFA 1QG0A 2OXEA 3MMXA 1XRJA 3TR0A 3UXEA 4U0KA 4ABYA 4DXAA 3BRWA 1OXXK 5AM2A 3M6MD 1V9CA 1E9CA 3VYSB 1I7SB 2NGRA 2Z9DA 4BMYA 4WY5A 4RVUA 2VF5X 3GP5A 1NDQA 1VG1A 1X6VA 1W59A 4V0ME 1OTYA 2X6TA 1XHFA 4LZAA 5DBFA 5FH9A 1PKXA 2BFBB 1WG8A 1P7YA 2XMBA 1F2VA 3BF7A 4NAHA 4TSFD 3PXAA 4MI1A 5F78A 3UWOA 4A3SA 1M33A 4DPMA 3GFSA 4Z53A 3PQ7A 4DHWA 2DY1A 3S3TA 3S6JA 3U61B 2A1UB 4YNBA 2HNAA 3VSEA 5LWHA 3LHKA 4IV0A 3OCWA 5IU6A 2YMPA 3C85A 1DJPA 2F3PA 1Z0ZA 3SDBA 3MT9A 4BLWA 5D51S 5TPZD 4Y2QA 3TW8A 4J4BA 2XB9A 1CVIA 1P2DA 1Z5GA 3PE6A 1KJ8A 1C7QA 1LKZA 3LOQA 5DNUA 4O8ZA 2XEDA 1U04A 2JNWA 2NV6A 2A4MA 2IX9A 4BNNA 4R51A 4RWZA 2E37A 3GR6A 3H8SA 5DNYB 1B2RA 3AESB 4DSZA 3EA0A 3K5PA 3LCCA 5TARA 4JI5B 3NASA 4OJYA 1JEQB 4BMOB 5JD5A 3K9FC 5K03A 1KNXA 2VSOA 4NHOA 4RKQA 1L5KA 1VGQA 2A9PA 2REBA 2QTTA 2HWKA 2X58A 1E92A 1OREA 3CV3A 3DE1X 4TROA 1QP8A 1F3OA 1O4WA 2ZRGA 3HZZA 3IQGX 5L45A 1QFMA 2R6AA 4QUBA 2O2GA 3DWEX 3B6KA 4WN3A 3FIUA 4GXTA 3NNNA 4N7JA 2C7QA 3HKBA 1IG0A 3L6UA 5DM0A 1CNMA 2CNNA 1XN4A 4H16A 1AHIA 1AU9A 4OB6A 1NW6A 2H5JA 3PLRA 1IZZA 1MA0A 3GBSA 1A9RA 4PONA 1R4MA 3W2TA 4COOA 5F23A 2AFVA 4MHOA 4C87A 3KEMA 3CPEA 5KX5B 4L5BA 5HE8A 2IS4A 2QJOA 1GU0A 4H7DA 4ZAFA 5ITZB 2ATVA 1KC1A 3LGAA 4RMJA 3SS8A 1XKTA 3WNCA 3V4LA 4A0FA 4BVHA 4YR9A 2ZJ1A 1M7HA 2RG7A 4CMJA 1SQFA 2Y0PA 2A1TR 1MOSA 3U7IA 4EG0A 1GTL1 1PNVA 4KJZA 4PYOA 3PPIA 4J0GA 2V7QD 3LT4A 3OQ6A 4BTLA 5L3VA 3FGNA 3EA5A 4LECA 4B3RB 1BQ4A 3REQA 1LDBA 1E6EA 1P2SA 3CF2A 3WB1A 5AXCA 1NPYA 1HX7A 1Z18A 1JHRA 2PCJA 3EVCA 1T8UA 1UINA 3LT0A 1YJ8A 1DEOA 2BP7A 1MIHA 2D54A 1I4WA 1HG0A 5AJZA 5IH7A 2XNCA 3AJEA 3TSAA 5ADVA 3UOWA 2FPOA 3GAMA 4G56A 4WLNA 5CU7A 2MINB 2H18A 2CDCA 3U3XA 1IEXA 4MJXA 2X5KO 1QQBA 3D7SA 1C9KA 1U2TA 5IJXA 4PAOA 4ZAZA 1RXYA 2XYPA 5E0KB 5I7OA 3TWOA 1DT3A 2E85A 2ESRA 1Z16A 3Q10A 4RH0A 4CMIB 1UBNA 1R8JA 4N1AA 4JI1B 1H23A 1JB9A 3P9SA 1Q83A 1WXIA 4CNQA 2AZXA 2PWBA 1VRWA 3D6VA 4FS3A 2ZRDA 3VJMA 1SCNE 2HUPA 2OCPA 4JP5A 1U7ZA 1XUOA 3H5NA 2W6JA 3L7IA 4BECA 3DM9B 4DDMA 3WGZA 3C6BA 3NJRA 3F5SA 2ERYA 3VTKA 3LQFA 3TOSA 4WFKA 1Z5PA 3HYTA 4B7XA 4IF6A 4O2BF 3GLFA 5IP5A 2XA9A 2GX6A 5A5VA 4QPCA 3UWMA 4F85A 5BV2P 1SWWA 2CXPA 2ZITA 3C6ZA 4N3GA 1K5HA 5EEGA 1R37A 4C05A 4LF4B 3IUEA 1T3GA 4KQKA 2CMKA 4OHFA 1UPAA 1QKJA 3JQDA 3JRNA 4QJ4A 5CVVA 3RFXA 4F5YA 4AQDA 4BNLA 4WSOA 3KALA 1KP3A 3KPJA 2E21A 2MT9A 2ZB4A 2R1VB 3EAGA 4GKJB 1ZMXA 3V4ZA 4LF5B 1NBAA 3FFAA 5AVXA 4BN5A 1DT5A 1NY6A 3EGCA 4P93A 3KBOA 3KJEA 1Y4UA 2GD0A 4WKNA 2B78A 2BMFA 4J7AA 2I76A 1YJBA 1E77A 4G0QA 5TGZA 1KSHA 1MBZA 1TUBB 1E6WA 1TPZA 1DINA 1UK6A 4I50F 3ZHOA 1LDGA 4B09A 4ZYTA 3PQ4A 3MMPA 1CIVA 4XFDA 3N0RA 5B55A 4BVGA 1V5IA 3T12A 2J3QA 3ANNA 2Z43A 3FCSB 2XECA 3KPWA 4HLNA 1ABEA 4IJMA 2F1JA 2QLLA 1PS8A 3ZGZA 1RI3A 1WW8A 5K0JA 3WYAA 4PN7A 3CCCA 4A1OA 1H8EA 1J49A 2JLZA 3OU6A 1QCCA 4JEIA 1LVGA 1G63A 3JQFC 4C4OA 2YIVX 4AC9A 1D9XA 4BEJA 3FPEA 4IUYA 4F11A 1YZGA 3PR3A 4R7ZA 2ZJ8A 4UHDA 4RF2A 3HP4A 4QZVA 5CYOA 1ORIA 1BGWA 4I1VA 3HB9A 4OSEA 5ALTA 1ZL2A 1IJEA 4W5WA 3HB4X 5TJHA 3WX0A 2NXEA 3O3OB 1JQ3A 4MV4A 4HDMB 3ONVA 3IBFA 4ENRA 5KINB 3GA0A 4X6YA 4YRFA 1GYQA 621PA 13PKA 4GU5A 4P7BA 2I7CA 3BA1A 2YFYA 5DTEA 4R0MA 3ZHUA 4NXNB 3QQ5A 4JUCA 3PICA 3RT1A 4JKIA 3JQBC 1Z07A 1P0CA 4UD2A 1NQWA 2EYQA 3GFGA 3WS7A 2PSSA 1A69A 1HYEA 1U28C 5IKOA 4DCJA 4Q66C 4TS4A 1PAUA 1YZHA 2OGTA 3QEJA 1DVRA 1HL7A 1O89A 2DAPA 2LDBA 3LUKA 4HX2A 4L85A 3AJ9A 5C35A 2IUUA 1D2NA 1CQIA 5CGQB 3PJDA 4BNJA 1Z3CA 2GCOA 4RA6B 3HXOA 2V7WA 2VK4A 3EYAA 3LUHA 4MRMB 5LA6F 3DVAA 1V41E 3MCVA 4I4TF 4QLBA 2JL1A 3K8ZA 3DCYA 1IHOA 5DLQC 2CNBA 3OH8A 5FHRA 1D9ZA 2BI4A 4ZAGA 2V96A 5DNVA 2NVBA 3P2YA 1JRLA 1KIFA 5HF6A 4N3BA 4A8JC 1MGOA 1PL8A 4H27A 2DGDA 2W48A 1ID1A 5J2UB 1TMKA 2FMFA 2PBZA 3OZWA 2B37A 4MP8A 3UPDA 5BV0A 3EAFA 4L28A 2OCGA 2QD5A 3T3NA 1J39A 4RD2A 2GEJA 1QHIA 3BXGA 1DARA 2O7RA 3CO0S 1Y98A 4DLSA 2ID4A 1VLZA 2XWJI 3QW2A 5H8WA 1OA1A 1NKTA 2D5AA 1NOIA 2QM8A 4I9HA 4LC0A 1FE8A 3I61A 1PJZA 1TF5A 3KXDA 4M22A 2VDWA 3BZUA 2E3JA 2GZ1A 3OQIB 4GI7A 4JBGA 4Y2GA 4IFEA 3C3CA 3K92A 1QV7A 4R40A 1E1NA 3HC7A 1GFSA 2FUG1 1LQUA 3VC2A 1ZIOA 3EXG2 5FI0B 5TIIA 1P5JA 3L5OA 4GSKA 3R3WA 2E4YA 2X42A 3FYSA 1C8KA 3IMCA 1RZRD 1K98A 1J7KA 2WJ3A 2WG0A 3O4FA 5P8WA 2E7ZA 2DR3A 3H4IA 3QVUA 1QJ4A 5HK9A 2CZCA 3G5UA 1J33A 1DU4A 1GZUA 4CF6A 1A88A 2OYSA 4IDDA 5I9IA 5JQGF 1OSNA 1KJJA 1MEOA 2VKTA 3AT1A 5GM1A 4LF7B 1ACLA 4MMZB 1RWMA 2JIBA 3A3OA 1P73A 2FFHA 1PFQA 4OXRA 2OKCA 2OK8A 3EZLA 1OZ0A 2M2IA 1BMFD 2D4HA 3NH6A 4BVAA 3E18A 5AM0A 2Y1LA 2W6MA 3CHYA 4MRSA 5JMOA 3PEEA 2EL9A 4BU0A 5KJ1A 2VQFB 3CY6A 1E3MA 3S28A 1H1DA 1GRCA 1SUPA 1M8KA 2G63A 1PK9A 4OBWA 4B35A 4IDOA 3N6RA 1LRLA 3R44A 4QUAA 3COYA 1NN5A 2A9VA 4KJXA 2HU5A 4RGVA 1MZPA 2H8KA 4IDPA 5AI9A 4BO6A 5E8JA 3SSNA 2WVAA 5E38A 3FYTA 1Q1NA 2RBEA 1E0SA 2YICA 3SCZA 1SMKA 3WYDA 1F17A 3I04M 2OG2A 3DZ8A 1X39A 2W70A 3CF0A 3HI6A 1ISRA 4NONA 1OAOA 1BTOA 3B7WA 3BSSA 3CZCA 3MQ2A 4OXIA 4DYHA 5KB3A 1NQUA 4J94A 5BNTA 5TDHA 2F2TA 1AXRA 1JG7A 4JN6B 4KPUA 4PM4A 3GPDG 1KJIA 4ZKDA 2I8LA 5FO0A 5AH0A 2ZRPA 1PD1A 3LXUX 4P7KA 1NWHA 2I6TA 3IR7A 3HXMA 2XHEA 1A82A 1YAJA 2D7CA 3CKKA 3HUFA 3OLVA 2QW1A 2XCLA 1EE9A 5PNTA 3HCFA 4YAEA 5JHGB 3PBKA 1KO4A 2WSYB 4F5ZA 2XT6A 1DKPA 3MIIA 4RHCA 1DC6A 3C6QA 2AWOA 2I67A 1WNTA 2Q0XA 3OCJA 2RAVA 4G86A 4N82A 5ALOA 2BFWA 3E0QA 1S3SA 2EFYA 3LU1A 5T64A 3UJPA 3MCTA 3NTVA 1E62A 3HWX1 4KE6A 5LLSA 2P6UA 2X7HA 5K0EA 1V16A 3PI6A 5BMVF 4FC6A 3CX8A 1L5HA 2M98A 2F3SA 2HA0A 3GLKA 4LQCA 3D64A 2REQB 5AVKA 1CY7A 2RSLA 1PFKA 4L4UA 4LHXA 4UNQA 4NZ9A 1PI3A 1RYBA 4PCUA 1MQAA 1YL5A 4O2AA 2YOHA 4MUFA 4ZOQI 1XWWA 4AJHA 3QEMA 4Z9FA 2CLFB 2NPIA 1IK4A 2Z3ZA 3M5PA 4I8IA 2ZS7A 4OGGA 4J9UE 5GV7A 5MFZA 1NKVA 4CMAA 4LW8A 1HYHA 3ICWA 5AKXA 5LP6C 4U6NA 4YRDA 2DB3A 4UZSA 1GA4A 5H5JA 2WQ7A 4WESB 3HZHA 4C2BA 3NBYC 3OZAA 4CJXA 10MHA 1DC4A 4QXQA 5CNMA 1QF9A 3VVMA 1N0WA 3FPGA 1KDVA 1IYZA 1GDDA 2MHCA 2J9FA 4R83A 4NE2A 3OIDA 3AI3A 3GA7A 3HKEB 3ONFA 5D87A 4DR3B 4DADA 4RIHA 4UMEA 5G2OA 3LHDA 4JOQA 4F3NA 4XQ9A 4CIBA 1VPDA 2GAIA 3UVEA 4JROA 2IUFA 2VJOA 4GAEA 3GXOA 3TLGB 5FNZA 1OI3A 5IBRA 1U28A 4I46A 2WI8A 3JVUA 3LRXA 4EGSA 3AIOA 4MLCA 3HLTA 1ZN7A 2HNBA 1UPFA 2ZT5A 3LW8A 1DLIA 3A1VA 1IDN1 2JIZD 2V8OA 4G9BA 4RVNA 4G6ZA 3TQCA 3ZWCA 1HBJA 1OA0A 2OFWA 1RYZA 2RC6A 2WAMA 3C87A 4MXDA 3RGGA 3E9DA 3X44A 3FOEC 1SD1A 1SC3A 2FMIA 821PA 1E6UA 1QHGA 2CLLB 2FG7C 4E07A 1UOEA 1WCIB 2H1VA 1GSIA 1QVWA 2HH9A 2FWIA 5FFFA 1X2EA 1R16A 3HJAA 3N3BC 1U0FA 4PTYA 1PJ8A 4AQ7A 2GK7A 3ZNNA 4IHJA 1Z5WA 3ULKA 2XA2A 5CA1F 4HBGA 3D31A 1B23P 1K5GA 3EGOA 4LDAA 3DT8A 2DCUA 2Q1UA 1J1IA 1KDPA 3WMWA 3C2QA 2HPZA 2R3SA 3EJ6A 1PDOA 2QSZA 4GYKA 5BN1A 1LUAA 4TYNA 5ALPA 2PKXA 2XVMA 5CA0A 1FSPA 2CL6X 4PC2A 2I4MA 1GNSA 1RQGA 4RPCA 1IJKA 3H6HA 5L4LA 4QPNA 3MIZA 2QTMA 2WJVA 1ZJZA 4JNCA 4OFWA 3VR4A 2FW7A 1V1MB 1ZIXA 1R9NA 4C4PA 4F9EA 3WGKA 3IE1A 1EHIA 1VGRA 2WINI 4GNRA 1ITZA 3TXAA 1T91A 2CVFA 2QBYA 3KDPA 2CJWB 2OZLA 2ENUA 4WNCA 2AG1A 2FPIB 1L7MA 2X8BA 2WYHA 3F3KA 1Z73A 2O2SA 2Q2VA 4OGLA 2ZUFA 2OLKA 3RUDA 1R18A 2FKNA 1ZXLA 4XH9B 3S1AB 5KNDH 3B1FA 4E7OA 3OIWA 3TH5A 1KFEB 4R3UC 5TMBA 4GX0A 4U5XA 5D6NA 3KKLA 4KLCA 4KGZA 4BMXA 4DLWA 2JARA 4DQLA 1R27A 5EMLA 1FJXA 1E98A 4V39A 2C5HA 3NETA 2WAAA 3DGEC 3ZWNA 3TBHA 4AXBA 2IYLD 2UZ3A 2YJ5A 3VVCA 4RMNA 5C18A 4C7JA 5JH7F 1HZZC 3A6KA 3OPMA 4KQ9A 1PL6A 3LPDA 1JEYA 1NLZA 4OAOA 1NUUA 2DX7A 3OCXA 2PJDA 3RIXA 3A1EA 3JYLA 1KMHB 3GHYA 3OT5A 4RXUA 5EN4A 3PUHA 1Z0JA 5HM6A 5KMGA 1OBOA 1G6KA 2SKDA 1LVHA 2ZUTA 1ZN2A 1RC8A 3V4OA 3EVBA 1H9BA 4WJZA 4Q5IA 1I30A 3WYFA 1JG1A 4MGKR 3PJGA 1WULS 4N47A 3GLHA 1KMNA 3TSCA 2A3RA 4QAQA 2R6HA 3CEPB 4JBNA 2C83A 5K3FA 4C5AA 4F91B 1GTVA 3AF2A 1A2BA 3A2NA 1X1CA 3V1MA 4YV2A 4C03A 4ZOEA 1E8MA 4W8HA 1NC3A 4CQMB 3DEIA 1GNQA 3ZCXA 1AX9A 2VJLA 5ILQA 3KEGA 2QE7D 1U31A 2QRVA 2W6CX 1BXRA 4GMGA 4OUDA 4GLLA 2F7SA 3AKDA 1K8RA 4LAFA 4TWIA 4ZANA 4DJEC 5A9SB 3LAWA 4WBSA 3RAJA 2FAXA 1X7WB 4EYGA 2VJQA 3ZXSA 4XIJA 1L5VA 2WJGA 2ZSFA 2QDKA 5DJ5A 1FUIA 3EIHA 4ZYZA 2PTHA 2OCXA 1O5IA 2WYIA 4FZVA 4EUNA 4K6FA 2X0FA 2DWPA 1PLLA 1V8DA 2VHWA 2WUGA 2Y92A 3M9XA 4PLCA 5JO0A 1N6NA 5LQCA 4E08A 1PFWA 4TXLA 2VNHA 1N7GA 3W5AA 2ZT6A 8LDHA 2EJBA 1G5PA 2ZI5A 2NNLD 4F7WA 3F3MA 3P9PA 3GVXA 4Z0NA 4CXMA 1J22A 1Z5ZA 4FB4A 5BQPA 2P79A 4U6SA 2B34A 2GO7A 4ITUA 1Q95A 4QOIA 4BJ1A 1R0XA 1RLTA 3ORQA 1XTKA 3CXUA 1HF3A 1TKBA 3CT6A 5LKAA 3UWSA 1U2DA 4I1RA 3TKYA 1J2UA 3ZNPA 4LISA 5LD2C 5IJWA 3D0RA 1YZ3A 1ZH8A 1N0IA 4NYMR 3C5HA 4UMVA 4MUNA 3GY0A 5HM8A 3MK31 2HFJA 3LUBA 3LS2A 4BFSA 1AZTA 1NUSA 3O8NA 5A6SB 5JANA 3OQMA 1HOXA 4GYYA 4BUZA 4TKLA 2VNIA 2VJNA 1EWQA 5CDYA 2E18A 3FVQA 4XGNA 4DIEA 4GL2A 4K87A 2BKLA 4OQFA 4W5TA 5A4DA 4JJGA 4JFRA 1IVNA 3OUTA 3UNXA 1Y1KE 4U7WA 2BKEA 5BYJA 4PS0A 4Q12A 1M6EX 4II2A 1YFZA 1FZQA 4HNRA 4R1MA 1KO5A 1C9YA 3GLHE 4XJTA 4PO8A 4FX2A 3T41A 4UOEA 1G9TA 3QXSA 3PUJA 1Z36A 4ITRC 4KR9A 2ZUCA 4EGFA 2CDRA 1YUBA 2FDRA 1USWA 1I4TD 2IHUA 1H4VB 4I1UA 4I6JA 2GETA 3WQBA 5CITA 1KH2A 2H0QA 4TRRA 3W0LB 4YT4A 2H9AA 4Q3BA 4CIYA 2ZXUA 1YGYA 4ND8B 1ECJA 1E3SA 4PSCA 1GCGA 2WTAA 4AYXA 1U1CA 1SURA 2H1WA 2BUBA 5JNUA 3R3JA 4DM4A 2V55B 2X7JA 3F90A 1SZPA 3WGVA 2P62A 2PNFA 4ARZB 1N2HA 2JFYA 4GUAA 3LPCA 3LWNA 2C59A 1MUUA 4BP9A 1U8XX 2N3ZA 2AZDA 4LK3A 5EA2A 4DKJA 3DNPA 2OQRA 3UHFA 2QN6A 4CYMA 4R1UA 1UBKS 1SD2A 5ISMA 2CHGA 1Z13A 4KTTE 5CFMA 1A72A 3IUPA 5EHGA 4REQA 1JDVA 4IOJA 3E03A 2XQKA 2FMKA 1FYWA 1NYLA 3HVKA 4X65B 1FQJA 4KN6A 4V1CB 1PHPA 1QKIA 4M2LA 1PQ4A 2YYAA 3NVMB 1HLGA 4TUYB 4AZ0B 3W8RA 2YY6A 3H3JA 2JPDA 1ZVVA 5JAHA 4PN3A 5CBPA 1Y63A 5JNRA 3NRJA 4QASA 3F7OA 4MW9A 3ZJTA 2XNSA 3JD1A 3HBFA 3KKPA 1XKLA 4YT8A 4F2DA 1Q17A 3P9QA 5LC1A 3KAQA 1TIPA 4I1OA 4GF5A 3SFVA 3P27A 1AHNA 4ZYUA 2OAP1 4K05A 1DAKA 1ZINA 3SC3A 3P9IA 3TX2A 4BMCA 2IYOA 4DA8A 1KF0A 2VSNA 1P1BA 3QQPA 1UC8A 5HPYB 5JVDF 2ZW9A 4ALKA 3IP3A 2HK8A 3F5QA 2WF7A 3DBRA 1U5BB 4HAYA 1U02A 2Y0DA 3D7MA 3FI0A 3P97A 1NNSA 2ECFA 3REFA 2Y1GA 2O1WA 4NMLA 3RS8A 1AVTA 3IR6A 4R6XA 1X7XA 1RHQA 3N53A 3G49A 3NKFA 3VH4A 1IULA 1SIBE 4ZXPA 2C92A 4NNJA 5EWMA 2J3JA 1I0LA 2M1ZA 3NGMA 3RRYA 4BMNA 1YQXA 1TQHA 2J6HA 2PR7A 3ADOA 1M8PA 3WQQA 3LDGA 2HJWA 3JZMA 3O8DA 4WLFA 5EIWA 3NRBA 2JFZA 2VP9A 1KEUA 3IUJA 4IVNA 3UJ8A 4UXHA 4TKMA 1W581 1WDMA 2VAPA 3DA8A 3GEDA 4X7PA 3T6KA 3HHPA 3VHQA 2JBAA 4HY3A 2JHAA 5ALHA 3TPFA 2O8EB 3FCCA 5EKXA 5LZ5A 2YWCA 4RK6A 2XGMA 4HUTA 4UTPA 2NUPB 4YC7A 1GPBA 1NDHA 2IITA 2Q2NA 4RV5A 3WHIA 4CL2A 1BXKA 1YZUA 4IHQA 3TRJA 3QMPA 2IOFA 4WOJA 4F38A 3DW1X 1G8FA 3HDYA 2B69A 5FWAA 5C1OA 4R1SA 1EQ2A 2AI1A 2RBGA 3EJWA 5IN5A 4YDRA 4OXXA 4IIGA 1DXHA 1WUHS 1Y89A 2VWQA 3LCVB 4EQZA 3AMVA 2OCKA 5IJ0A 2QWXA 4PNEA 2LPMA 2P2CA 3O47A 3R8FA 3K9WA 4FD2A 4BFLA 9LDBA 1FS6A 3ABOB 1Z0UA 2ZJ0A 3K0SA 1JJ7A 3N2IA 1XEXB 5I5GA 3E8XA 3B3AA 1ZL0A 1HSOA 1W8IA 3H2IA 1QE0A 2BZSA 1N5IA 4FR5A 3RODA 2CHUA 3D4LA 5JBIA 3AVPA 1BNCA 1QO7A 1WNFA 3H9CA 2FR0A 1AH2A 3T5MA 3DDHA 2X6RA 1VIMA 1XMIA 2ZIXA 3H5LA 5AHOA 5KTMA 4ZI7A 3KTAA 2HO5A 5AI6A 3LV8A 1OPXA 3DZDA 3EFOA 4FZ3A 4YDQA 3H3XA 2J9ZB 3ZHCA 2ROQA 1QO0A 3R3VA 3HDQA 5FWNA 5ABPA 1PT9A 2C5AA 2IOFK 1VKRA 4OJMX 5E4TA 3HCPA 5EPUA 1MO4A 1JDBC 2VPTA 3R6TA 4KLZA 2CZGA 3MUNA 4F1JA 2V7TA 2DE0X 2BMWA 4I19A 2H5EA 4ND2A 4ZYLA 4P1ZA 3EEFA 1CF9A 2GZ2A 5A4FS 3FWPA 3BDIA 3CLRC 3ILSA 4I5DA 4LJYA 1BXGB 1QYDA 3VHRA 2M6SA 3PRHA 3WP0A 4LXHA 1NASA 4LRTB 3S8EA 4PAGA 2WSSA 3UYKA 4RCYA 1WLSA 1M1NB 2YL2A 4PZYA 4CV1A 3KL2A 2Q7XA 2AR0A 1KAOA 2GR9A 2HI0A 4M0FA 1D3AA 2H4JA 4X94A 1Y9EA 4IHJF 4MZXA 2ZRLA 1YMUA 1TKCA 1ZJ6A 5F2EA 3SF8B 4X20A 2W2XA 1CJBA 3CB2A 5JPCA 1WOYA 3SHFA 4M46A 4RZUA 3KSMA 2IZOA 4AJLA 2ID7A 3EIUA 4L74A 1ABFA 4XQCA 3ZWBA 2XUKA 4CMEA 4U7DA 1M2FA 1MOQA 1T4CA 1W36C 3E9NA 4L0DA 4EO9A 3IAEA 3IKMB 3OM9A 5K3OA 4CNBA 2XOKA 1VDZA 2PFSA 4FUTA 3CZRA 1CULC 2EGUA 2P6RA 2FEPA 1QIKA 2KI5A 3KLPX 1FFCA 1MO2A 2J33A 4MS1A 5FLKA 1S1CA 1T25A 4ZV9A 3ZG6A 2VJDA 2PL5A 3IOBA 2PX0A 1VMIA 3DEKA 1U0TA 1JLRA 3FDJA 4LFBB 3H8JA 5JASA 3VDRA 3DL7A 4A5SA 2BM8A 5JNTA 4FFOA 1TEVA 2QT0A 2CMHA 2JCXA 3OC6A 1D6NA 3LBAA 4XJVA 3ZV5A 3HM9A 3VI3B 1ML4A 1H2AS 1M6NA 4M4SA 2Z2IA 2J9RA 3NHZA 1XZPA 2C2OA 4PHGA 5JSZB 3KE9A 3DBOB 1AC5A 2Y0EA 2IU6A 3Q5GA 3VZQA 3CB4A 1OPRA 2HIGA 4DJAA 3FNQA 4HWTA 4WN9A 1LPSA 3FVVA 4JVMA 4IO1A 1M74A 4KPGA 2FPKA 1K9SA 3AR9A 1R4MB 3GYGA 3ODPA 1JEAA 1P61B 2UAGA 3QVXA 3WMRA 3MPOA 4NCBA 4KXNA 2Q27A 1RFGE 3LHFA 8GPBA 2O6HA 3WGLA 2X0EA 3BIOA 3TLXA 4EKGA 1CEEA 1IOVA 3EHDA 1T36B 4ZT7A 2PUHA 2GBFA 3TIXB 4NPCA 4P36A 1QV9A 4I7EA 4KQJA 3CNEA 3W6PA 5JYEA 3FNFA 2EG9A 4R84A 1PJ4A 2VDVE 4LGCA 1QIEA 4R5MA 1NJ8A 2C99A 3HY6A 4O4JA 1R2QA 2ZTUA 3S8MA 2GSDA 4Z2YA 1RHMA 5DULA 3LUGA 3GRVA 3H65A 4F4JA 2XI4A 4R4JA 4Y6LA 3DLHA 4F4UA 2Z83A 5DRYA 5ADUS 2VDNB 3PDIB 2IDKA 3NHRA 4EY4A 3UPTA 3ZGNA 4UMFA 4PZ0A 5IAJA 1PGNA 3QF4B 2OBNA 2RGBA 4TKUB 3ER6A 2SCUB 2E5LB 3JS5A 1CCWA 2MINA 1Z4LA 1GSOA 5D1NA 1EVZA 1MV8A 3LX5A 4K9OA 2O8BA 4QATA 2AN3A 3H2JA 4WVLA 4TUYF 3Q72A 1KDRA 3V9PA 5FBWB 5BQOA 2FQ1A 3LIPA 3KXPA 2CK3D 1XZNA 2ECOA 4F3CA 1JXOA 5ALRA 1L5NA 4HJRA 5EJMA 1A9XA 1ULTA 3G2IA 4BVBA 2CNDA 2CWWA 4BDTA 2P3QA 1T2FA 4POOA 2QVGA 4A03A 2HTEA 3WRYC 1OWOA 3ZU4A 4XM1A 2EKBA 3H4TA 4QUEA 1SUWA 5AJHA 4G0VA 5BQ5A 3VSDA 4HLUA 3KQOA 4IIXA 4P8RA 1BGXT 4UOZA 3CUYA 5H7XA 1U1DA 1M54A 2ZQ5A 3ZV6A 3KG2A 4O4HA 5GZ6A 1PJCA 1RIFA 3NPMA 4A23A 1T5SA 3KVOA 1ZJWA 3PEUA 3OM0A 4IH4A 3WGYA 3GK3A 2BEVB 1V1RB 2ZWMA 4BNUA 4ID9A 1BVRA 1NV8A 5CM9C 2JGNA 5ENVA 1BROA 3TQTA 3ENWA 3NOQA 1ES9A 2ZAGA 3W8NA 2AN5A 2GKGA 4JYCA 1NXWA 4J49A 3B38A 1TZCA 1S2GA 4PZUA 2X0KA 2NUAB 3MTEA 4IEFB 2A7XA 3MRVA 3QHQA 1QGUB 3PKJA 4B5LA 2UYCA 3F0TA 1ZNXA 2X4IA 4P3NA 3VU8A 5DP2A 3P1JA 9ATCA 1YHNA 3B6IA 3P20A 5F76A 121PA 4UPVA 1BDMA 1NQ5A 4YGXB 1V2HE 2A88A 4L6CA 3IP9A 4FLFA 5L7TA 1VKJA 4ZZ2A 1E9FA 1KS9A 1ZICA 3S2IA 3QENA 5D5HA 4ZRMA 2J3EA 1FDWA 1XLUA 4RYDA 1BQ3A 4Q9DA 3CCBA 3RT7A 5H3LA 2GTPA 1A4RA 3MN1A 2Z6VA 1OBCA 5CT4A 1KO7A 2HQBA 1B6GA 2PPLA 3ANLA 4I9UA 1OWMA 1BHQ1 1PHRA 1E2LA 1C4KA 2JB9A 2XUHA 3DKVA 3MBKA 4LDRA 1BCRB 3A37A 4AAYA 5GGYA 1SH7A 5HOQA 3BVPA 1XRQA 3DZCA 1FP4A 4AIIA 1W5FA 5HWSA 1C4XA 1H2RS 1Y7HA 1Y5IA 2VRWA 1J8VA 3LW7A 4K81B 3TNDA 4C7MA 4ZGGA 1S1MA 3D81A 3AM4A 1VL0A 1Q12A 3E5NA 4RD6A 4LNHA 1ND6A 4N7RA 3SVTA 4H08A 4WCFC 1FDSA 1OT5A 4HSGA 4WXYB 2JJ1D 1ORVA 3IQXA 4PZLA 2VLBA 4QHYA 2YQZA 2HWYA 5GOZA 2OPHA 2PZKA 4GPTA 1TK9A 5DVZA 3EPHA 5E3IA 2A86A 5JUWA 1PNOA 4NDZA 2WTXA 3ZIAA 4Q4DA 1GKKA 3G2PA 3STXA 4ERXA 2VRCD 4OHOA 3TM5A 3Q5DA 5A2QA 4RTMA 1E9SA 2CL7X 1UZLA 2VCYA 2ZBGA 5EIHA 1ZZEA 3BCRA 2ZSIA 3UAOA 1ZM7A 2YWHA 1CR6A 2IXTA 3LKVA 4CG3A 4YA6A 2QAGC 5FQOA 3T7AA 3TVDA 3ZW8A 3BC1A 1HT1E 2WFAA 4DQXA 3GUZA 1PZEA 2O8FA 4PYJA 4CF4A 4MKRA 4FDTA 5FWXA 2P69A 3QTLA 2Q8PA 1JIIA 2IHTA 3IL2A 1G98A 3IEPA 2HT1A 2XLCA 2JRLA 3KU1A 2BEUB 3DMPA 3KOOA 1AQIA 2C0QA 1L8AA 5IH3A 1XQYA 1Z5OA 1K6XA 3MERA 4BV9A 4QM6A 2DSNA 1P0MA 2HB6A 4Q1FA 4RESA 1FMCA 2ORIA 3SQMA 4DCSA 4WXRA 4OQYA 4BC0A 1GPWB 4M9ZA 4FXPA 4NBUA 4MIKA 1R9JA 2Z58A 1HT2E 3FMPB 1RAIA 2Q3CA 4ZC8A 5LP6A 3GHHA 221PA 5TT0A 8ABPA 1K6MA 4ND4A 1WQ3A 1V1JA 1HH4A 5KTSA 4ETNA 2R6DA 3KSRA 4PCAA 1NZDA 1RKUA 2OYRA 1JG3A 2FSHA 2FSVA 3BEOA 3HADA 3OMLA 3M70A 5ADHA 3JZAA 3I34X 3F97A 3JQEA 4AUEA 4BP1A 4ETIA 4NL4H 4UVHA 2BI7A 1GAJA 2HCTA 2BH9A 3K9LA 5LA6B 1Q0UA 4LMBA 2XE6A 3DDCA 5JAQA 1YJCA 2IPLA 2JJ2A 4KB5A 1H2ZA 1X9HA 1NX9A 2J85A 1IAQA 2CHVA 2PLRA 3WO1A 1D0VA 4IO0A 1UR5A 2VK2A 3TNYA 3W9BA 3RUCA 4K9MA 4F3TA 2Y1WA 1QU3A 4X60A 2HSGA 2XUOA 2JGDB 1DFGA 1Q7TA 2YQ5A 4QARA 4TYPA 4LJLA 1GSAA 3SX2A 1XP8A 1LZLA 5JJBA 2WY2D 2J5XA 3GEBA 3C14C 5L4SA 4QXRA 4E70A 1QP4A 4I2VA 2IYZA 2QQEA 3KZ1E 3WIDA 1UBMS 5G4KB 1LH0A 2JIQA 2WT4A 4NR0A 5EMHA 1IG3A 2B92A 4KSCA 1L9XA 1P4SA 1Y4DE 4Q3KA 5CIQA 4YJGB 5JVDB 4D9IA 4AVYA 2AC4A 5LXTB 4Y1RB 1S9HA 1ATIA 3TJRA 4KH1A 2H4ZA 4Z0PA 3T1OA 3CH5A 3GJTA 3CURA 1O5TA 2FSPA 3EMDA 1Y0BA 4V02A 5DK6A 1CQZA 3JR3A 4F1WA 3DD1A 3UAGA 4LUCA 4YJGA 4XTRA 5EJIA 1WZNA 5AMXA 3T0IA 2ZSHA 4D6PA 5JW6A 2ZU0C 4GWKA 2CT8A 1PJQA 4OB8A 2J3KA 1DGQA 5THKA 4JI7B 4GBMA 5CMLA 3TDKA 5HYVA 1BYUA 4OB7A 3REOA 1BEZA 1HDYA 1K7XB 1M2VB 1S3GA 2OQ2A 4GE3A 4KXXA 3GFPA 1E5XA 1PX2A 1JI0A 2ZDHA 4KUEA 4MS3A 1W4CA 5PGMA 3L7BA 4EOGA 4MR8A 2UKDA 1SEPA 4YUWA 1U8FO 2WYUA 2QP9X 3DMTC 3G9UA 3TMKA 1GKYA 2PLAA 1LU9A 1A2QA 2NYAA 1N1DA 2Z30A 2AOTA 3I32A 2V3WA 4LI0A 2AC7A 2IVZA 2OHOA 4UTVA 4MMXB 3DMYA 5A4JA 3QBJA 1JSXA 1ZK2A 1CRWG 1MXFA 3DMGA 1QB8A 2AJ8A 5AESA 1D7OA 2BEWB 3DPUA 3OLCX 4J1SA 4QQNA 3LKDA 5C80A 1NULA 2DKFA 3F6YA 4JEMA 1JG6A 3DO6A 4RENA 1A9SA 1T4DA 4IUCS 2GASA 1O95D 5DK4A 1HZZA 5KVCA 1FFSA 5HKOA 5IJZA 3ZY4A 1JBQA 1PJSA 1GGVA 1XOIA 3K6SB 3FKSD 3VYWA 1FJHA 2N75A 2PGXA 5FUYA 1LCIA 2XQJA 3ESDA 3W2HA 1SQ5A 3CSDA 1T8WA 3FOAA 5EWLA 3CSUA 1FSGA 3ZE1B 4H1WA 3PRJA 4U8GA 4UAGA 7ADHA 1PRYA 3BEDA 1C9EA 4UEQA 5DNEA 5FPYA 1N78A 2REQA 2OXRA 4G63A 4RS4A 2V0CA 4TSFA 2Q6KA 3SYLA 2B83A 2FR8C 2ZXFA 2JDIA 2Y1OA 4MWCA 2VK1A 5G0VA 4JLOA 3EQZA 2L69A 5EWLB 4CW7A 4OP1A 1UXIA 3LC0A 4J0DA 3TZEA 3T4UA 3OPNA 3BXEA 5B4VA 3O92A 4ZT4A 3R9IA 5ESXA 2GT1A 5AK3A 2B1GA 3ETJA 4YRZA 3TGWA 1JSCA 2BE7A 3HXQA 1K8ZB 3QP9A 1Q7GA 1ZGJA 2AFIB 2PMKA 4HLDA 4PHHA 3UW1A 4BFUA 2VYQA 3G23A 2WKPA 5CH3A 1L8XA 5BMVB 4IIFA 2YRWA 1G2QA 4RLFA 1YR6A 4MTCA 4DQKA 1XI2A 4LF9B 3DUFB 3N39C 2J9FB 5D3ZA 4QU8A 4K03A 4QC2A 4BO2A 1H0RA 1ZLYA 2E9SA 2QORA 2VUSA 3MOSA 2XR1A 3HKDA 4K6OA 3TQQA 4DJTA 3QX8A 4HNGA 4LWZA 2EKPA 1GADO 1R0KA 2DU8A 3N7TA 1Q3HA 1DC7A 2XD4A 1E89A 4AJNA 4C6SA 4EDHA 2ZAYA 2JGIA 3E9CA 2UVDA 3HU1A 2HJSA 2Q3DA 4S04A 2G1PA 1J2EA 2DFNA 1KIAA 1VGVA 1YQWA 1Z08A 3I9JA 4IFTA 4X8OA 3ABSB 3AFMA 1XK6A 3JV7A 1TLLA 1UANA 4FFSA 3NRCA 2H1LA 4F86A 4R01A 5DE3A 5EINA 1IHXA 3FWKA 4MAFA 5FOSA 3TM4A 5JNWA 1FK8A 1THGA 5KX5A 1N2CE 2VJYA 4WXMA 2W6ID 1A95A 1ZS9A 4Q39A 2C82A 1TPYA 2IHZA 3D7NA 3IVRA 4PGFA 2H2DA 3ROEA 1U8EA 2IZ6A 1MOZA 5GMOA 1KAGA 4ZT6A 1OIVA 2BGWA 3GLGA 3BSYA 1W9HA 2PU7A 3KXIA 4N0MA 3CC8A 3ZD7A 3T3OA 1KFBB 2PVPA 2ZWIA 3NDRA 2BHRA 2POQX 3SJBA 3W2EA 4D92A 3IBCA 4TLCA 2FA9A 2X2PA 4Q7JB 3N2KB 1JWAB 2BFFA 1YL7A 3NHWA 4Y6PA 3REQB 4QE3A 2ZWPA 4Z4QA 1G38A 3N2YA 3ZWVA 4EHKA 1LLDA 1GG5A 2NO4A 1ZNQO 4PSVA 4YROA 2Z8ZA 1SZJG 3GLGB 4BEBA 2Q1WA 2I34A 4MW0A 5M2QA 2R65A 1PJAA 3ESRA 2WIBA 1QS0A 4IICA 1HDEA 1SXPA 1E79A 1DBWA 1L5SA 1RLUA 1YBMA 1UKZA 3C5WP 4IGAA 4ZN6A 2G70A 4OHYA 4YTEA 4FHGA 2IP1A 4DC1A 3E53A 4LYFA 2HGZA 4ZOCA 5E3HA 2CFRA 3DB2A 3C39A 3SBXA 2JJYA 3SZUA 1JIJA 3E61A 1L1QA 1E58A 1KZ9A 1MKYA 4L51A 2XNHA 3THOA 3GFOA 1GNTA 2A1IA 1XVLA 5EIEA 3OX1A 5SZHB 2VR1A 4YAIA 1FSSA 3E82A 3IH5A 4H77A 4OI2A 4RHEA 4XEHA 3UCFA 3RYIB 4D82A 1L5OA 1COWD 1N9GA 1WZIA 3HEBA 3SQXA 2AOVA 2PHZA 3EY9A 4N49A 5AJVB 3RNLA 3TLYA 1R15A 1DBRA 5J4HA 1GN9A 3KHKA 1RI1A 2C8KA 4G41A 2BMVA 1QUEA 3C6KA 3QNUA 4WY8A 4BNVA 1U0BB 3WA6A 4BQNA 2WNIA 3MGCA 4C2TA 2X9VA 1YO6A 1G5FA 1AGRA 1MT0A 2XYQA 1E32A 4JDUA 3WQHA 5DM4A 1EUZA 1E1QD 3AF3A 4LN1A 1KMHA 3WKCA 1JIXA 1WE2A 3QE4A 1JQBA 2H52A 3KB1A 1NG9A 1EUDA 4RX1A 5KQPA 1GPAA 1D1QA 2J6CA 2V3CC 4KPEC 1YVPA 4QEKA 1GVHA 3IAS6 1PYDA 1VDMA 3A4IA 3JR7A 3WLOA 5BPFA 4MRNA 4I5EA 4V3CA 4BYMA 4F5DA 2W71A 3UT5B 7YASA 5JXHA 1ZP6A 2CXQA 1G8JA 1QFJA 2RJNA 3HYCA 4HAWA 1IPHA 4R9VA 5H3CA 1QVAA 1ZW6A 3M1IA 4JK3A 1M0EA 3RIEA 1TMOA 4UUAA 4AY6A 1W0KD 1TQ2A 3PQ6A 4ZRDA 1IXSB 3H2BA 2C58A 5FNVB 2Y1EA 4P4NA 1OTXA 4F71A 1SCIA 3NVAA 1LFAA 4BXOA 4D02A 2AKAB 2YBDA 1MDFA 4U9HS 2XNKA 3LZ6A 3ZXIA 1YS6A 2P5SA 3C24A 4YS6A 3EXIA 2EWMA 3M2PA 5DGIA 4LRXA 4HDQB 1BX1A 2VWGA 4X54A 2JH9A 3SR3A 4CM8B 3AFIA 5F1PA 1NFQA 1U1IA 1ZA1A 3FYUB 3DAGA 3JZDA 3RFUA 3U7QA 5KO2A 2Y27A 2Q0SA 3RBVA 4X8HA 5F1YA 1Y8AA 2CJYA 1U3UA 1KYQA 1C1DA 2IEIA 2VYVA 1G3UA 4RVSA 421PA 2R68A 3VPSA 4II7A 3MWGA 3DMDA 4C29A 5I8PA 4JVLA 4WOPA 3MPUA 4LY9A 3CPHA 4B4KA 5DNAA 4YAFA 2ZIWB 4ZWNA 1BJRE 4H60A 5JISA 1P72A 4DG5A 1N1GA 1W0JA 1PWXA 3V9AA 3WLLA 4KSBA 4X3OA 3U81A 2Q8QA 3EUAA 3DYVA 5LFAA 4DYDA 3B51X 1KFJB 5LU9A 3WK6A 4FIZA 4M7WA 5EC8A 1G8HA 1Z3IX 4K0KB 1JQ5A 4B4OA 4R8KA 5K6TA 2FR8A 4Y8VA 1KI7A 1YR1A 2PTGA 3V4VB 2G17A 1XK7A 2CKMA 2RK3A 3RDPA 5I7AA 3Q6IA 4PYNA 3CRW1 5IJAA 1OI4A 3VZRA 4WRRA 4DSOA 2AJBA 2G76A 2J59A 3IHWA 3VFDA 3L7AA 1J0AA 3I09A 1ZNWA 2XMGA 3EQ2A 3DFIA 5A6VA 4RE6A 3JZIA 2GCEA 5BT9A 4G2NA 1YJQA 4YHHB 1S2LA 2C2WA 4LKOA 2HREA 3G02A 4ZEMA 4BPBA 5HUQA 5E1MA 3PFKA 2Z8YM 2QR3A 3ADPA 3Q3CA 5ER6A 4UDXX 3H2GA 1XRPA 3IELA 5A7HA 3ELDA 4RDHA 1TT5B 3NATA 4D96A 3IJPA 4Q4AA 1O6GA 3MCZA 3S8YA 3I6BA 3PFGA 2G9QA 5JRJA 3IUQA 4DY4A 3U5ZB 4TYQA 5FBHA 3RUIA 4FDMA 1CZHA 1O9HA 1RPTA 721PA 4NFHA 5LQJA 1XN1A 4J0IA 4II3A 4BOYA 4DLRA 4UHFA 1N77A 3H1FA 4QYSA 1MRNA 3QKIA 4RIGA 4TX1A 2A6PA 1XRSB 3RM3A 2P5TB 3U26A 4W7SA 4EA9A 4EFKA 1RWOA 1T1RA 2ZRKA 3QBDA 4ZU3A 4JODA 1QFSA 2FFQA 2D7DA 2G3YA 1PE0A 2R6JA 1WW3A 2YOFA 2YVLA 3BGIA 4DG9A 1MAHA 1U6KA 1VE7A 4FE4A 1A1VA 2RJOA 5D01A 3H2KA 4AKEA 4HK4A 3O8RA 3I9KA 1Y4AE 1NU6A 1GARA 2IK8A 2FZCA 2NAPA 1JHQA 4MUMA 4QDTA 3F6RA 2HYIC 3SXJA 2ERCA 2JA2A 3DUWA 3SN6A 1Y8CA 3IDQA 4AMUA 1Y48E 2NADA 5F7OA 2OCYC 3STVA 3Q7PA 3AOGA 2FN7A 1NBME 1CQJB 4HTFB 3SNHA 4D42A 5LJLA 1SKUA 3A9TA 3Q40A 1RQRA 1Y8QB 1YTLA 2IU3A 2WJIA 3DE3X 3OSZA 4WT7A 4L4ZA 4HNUA 3VQTA 3DFUA 3L1JA 1LNSA 2ZYTX 4DSTA 2AR9A 1Q21A 3I01M 2FN3A 3SEQA 1I14A 2Q41A 3FOBA 3GT4A 3ONWA 1H3FA 5BRAA 1WL8A 5F3WB 4KXMA 5LCXA 1G4AE 3A28A 2OSVA 5DN9A 3IKTA 1DG3A 4JLKA 1M5RA 3N2EA 4AO7A 5HKAA 3Q11A 1JGTA 2F43A 3OJCA 3I39X 5EG5A 3GDHA 3Q3GE 4LVUA 3WL3A 1NOJA 4JYZA 1UXOA 2EAUA 2XDWA 5KQLA 4EG6A 1Q1QA 2ZCVA 1DRJA 4F60A 4YJ2A 4BY9E 4Z1MA 1VJGA 4PZAA 1R8YA 2VOEA 2BH2A 1URPA 2YNMD 3RK0A 1XTQA 1D8AA 2XQFA 3CVXA 3CKYA 4IJQA 2NO9A 3ZOZA 1XNGA 4QOGA 1OE0A 2QAIA 4OJTA 3GV0A 1OFHA 3QXCA 1Y9AA 1Y6QA 4XFKA 4AD8A 3EOBI 3IPRA 2AFHA 1YSCA 2HRBA 3PKZA 4Q24A 4X85A 1Z8FA 2ASEA 3ANMA 4NIMA 2QPTA 3V7UA 4EH1A 4YWJA 4ESEA 4MVYA 4H7HA 5KSWB 3PUYA 2QW0X 2QW8A 4HRAA 4ZK6A 4ZQGA 3HP7A 3TZQA 4HWPA 1CJMA 3H2HA 3T3MB 1USKA 1C9JA 1L5LA 1NX6A 4Y2VA 1Y4SA 1UP6A 3ZJYA 3D8BA 3E8MA 3N0TA 4DCMA 2Y9PB 1G3MA 1I3NA 3PFCA 3QPCA 4K26A 8ATCA 1FX1A 2GSWA 3P9NA 2CY0A 2A94A 3EIOA 4KX5A 4B2IA 3G0CA 1YHYA 2XCOA 2BFAA 4MJ7A 1NVVR 2QYTA 5FOVA 3BMNA 1NT4A 4P5DA 1EFUA 3CNLA 3KSDO 3LYHA 4UZFA 3GZTB 5H3HA 3ZY6A 1PR5A 1X1BA 1UMDA 4U7FA 7MDHA 2PBRA 2CMDA 1H0SA 3GNQA 1B4DA 2A5DA 1K86A 1PJRA 4IDNA 4LNUA 2HA4A 3PPXA 4KXWA 4O4JF 4S05A 4BRWA 3ORHA 4EI8A 2NAFA 4LFCB 3FPLA 3F9CA 1R4NB 4RVFA 5C8XA 2YVQA 4P58A 5DXJA 2B3DA 5KDLA 2GXUA 4DTCA 1OH5A 2EX0A 2H2FA 5SY9A 1FTWA 4MR9A 2RH9B 1T3HA 3ZWAA 2GWRA 4MNTA 5JYCA 4EPYA 5T4EA 2PKQO 1OWNA 2YJTD 1WPXA 3L0BA 3LY7A 1VPTA 2OV6A 4ICIA 2ZYDA 5TXGA 4BQPA 3U16A 3MAJA 4ZGWA 2PDAA 3FR8A 4A26A 3DBLB 3RIYA 3ND7A 4NU6A 5SYMA 4DCVA 2FUCA 2AZ4A 3MJTA 4FOOA 1FMFA 2QQGA 1XZJA 2W5UA 3BERA 3MRSA 3QKTA 4PRLA 4TV8A 4XUEA 2GHRA 1W5SA 3WLNA 4OAQA 4CKZA 1DRVA 1X7YB 4OSPA 1JTEA 1CNFA 3OQ1A 1PW5A 3AG6A 4U3JB 5FPQA 3U7GA 4A8JB 5CYPA 3O0TA 2F3QA 2V5VA 4EDFA 1CUCA 4QL3A 1ZRNA 3D0QA 5IVHA 1EP9A 1PR1A 3ET4A 1DBVO 1NHWA 3MWKA 4KDCA 4BO9A 2JFQA 1K4MA 4RZHA 2GF0A 3K73O 4L5CA 1J09A 1PFUA 5AVVA 3DVAB 4REOA 1CP3A 1O54A 3I9MA 2EEZA 2AG5A 2VEOA 3QFTA 3BMCB 3NHUA 1L7RA 3PHHA 2BFMA 3IBGA 2WTMA 3Q41A 1LD3A 3I2FA 4PNZA 5DT9A 4BNYA 1J2TA 4D4JA 4F3YA 3A36A 2N1BA 2C77A 1U0RA 4MKFA 3VOTA 1Q74A 1X9IA 1SOAA 2RCYA 3UJCA 1ZEJA 3W1VA 3ZCRA 5KSYA 2MR6A 3KQLA 3A31A 3E8SA 3MJSA 4X24A 5FOUA 2FWNA 3U17A 4IHJB 1F8UA 4ZREA 2GPAA 5CB6A 2AEJA 3FSEA 1WZ2A 4JJIA 2Q21A 1K6JA 1OFTA 3D6MA 4I5IA 4UHCA 5L4NA 1XZ8A 3R9WA 5IAEA 1QIDA 2RGCA 3A25A 5TSDA 2FEMA 3SYRA 2P77A 5EESA 4MVXA 4PZCA 4Q82A 1N5LA 1DEHA 2ZIFA 1D4FA 5IDQA 1SY7A 4YH1A 1OH7A 2ZJ6A 2IKQA 4PAQA 4KNWA 3NAMA 3MTBA 5B12A 4DVJA 3PUKA 3FLBA 4KFUA 5FI1B 2WR8A 1XVAA 3NOOA 4OG2A 1CUGA 4GMHA 2CJWA 1R9GA 2OZLB 1XNHA 1P6UA 5HJ2A 1VFPA 4YB8A 1DXOA 1XALA 4MR7B 1LQTA 3IHKA 3O1LA 2O52A 2O5VA 3PK0A 3T95A 3WSTA 4TL6A 4K9PA 1PT6A 2FW0A 4TTSA 3R4CA 2JLQA 3FPJA 3CZ9A 1Y3BE 4KTVE 2JGJA 3HN7A 3NVDA 5KTYA 2JFNA 4IIUA 1D4OA 1I1OA 1M10A 2QU7A 1S6YA 3SOPA 5JSHA 4ACBA 1Y7TA 1F8YA 3HSKA 1ZCAA 4OLJA 2C5SA 1J8DA 5E8RA 4DXDA 3N6XA 2EIHA 1VMAA 3AL3A 4HZUA 1UP7A 1BE1A 4HLQB 4D3FA 3AUKA 3ET5A 4D4KA 2GN9A 5C9ZA 5H1YA 2ZI7A 3G2LA 4HDCA 1YQQA 3V8MA 4HRYA 2HQSA 4MV5A 4OOFA 1T4GA 5EFZA 5JARA 1M66A 3RRXA 4L15A 3ZHXA 2H9IA 4H7IA 3W5SA 2ZZMA 1E2DA 3PL1A 3QI7A 4B40A 4L7VA 3FLAA 5LYJB 1YL6A 4EQ6A 4TVKA 3DMRA 1LI7A 2EFEB 1OX5A 3PQ2A 3R20A 1D6SA 2IGTA 3TR6A 3EGEA 5TQJA 3C5VA 3JTEA 1P2BA 4AP5A 3W04A 3PTAA 1XU9A 1GRRA 2GBLC 3Q0EA 4LXYA 5LQSA 4W82A 4CMKA 4C0HA 3PEFA 3WAJA 3DTVD 4YRKA 2QE7A 4XSVA 3C7KA 4IIYA 2VI5A 4NFLA 3WR5A 3GRFA 4D3SA 4JR0A 3NYWA 1F51E 3OEED 1B6SA 1C8BA 1Z88A 1GN8A 2F1RA 4NDAA 3DXYA 1F2TA 3P9RA 1NNUA 4E5YA 4E14A 1U4SA 4HFMA 5GZ3A 5DBGA 1P7ZA 3T7KA 1LB1B 4DV5B 3HXLA 1HK7A 1AG9A 2WT9A 1Z2CA 5A06A 2VUUA 3EGDA 3IP8A 1D1SA 3FUXA 4XIYA 4W5OA 3BK2A 3HO1A 1L3BA 4JQSA 2R6FA 5FAKA 3Q3IA 4ZV4A 1NBMD 5EYPA 4H18A 3GJ0A 1L5YA 3SZMA 4GIBA 2V98A 1EEHA 1W34A 3HI4A 2OHHA 2OORC 3GEIA 4L5YA 2JBWA 1DOHA 4R2KA 4RUKA 4C4XA 1YB5A 4KHZA 5IUJC 4EKYA 1SCBA 1ZN9A 1O1YA 5FA5A 4B3HA 1CY6A 4EI9A 3OE7D 1I7LA 1ZGAA 3GLVA 5B7GA 2XZOA 2ZCJA 4XIGS 4AX8A 3LFUA 4RACA 1B8UA 1D8TA 1QDEA 1H05A 1T9ZA 3DR3A 5EZ6B 4I1IA 1NL3A 4YRCA 2J4DA 3V1NA 5F1OA 1AE1A 1MP0A 4PFKA 1X8XA 4U2GA 3ZY2A 2O8CA 1H3NA 3KUDA 3K1ZA 2GJKA 1WD7A 4KG7A 2WPNA 4UW9A 3UTCA 4DQVA 2BFCA 2VPXA 3GH1A 2CFIA 3TQFA 1PR6A 1WQ4A 1YS2X 3EVAA 1T9AA 3IBYA 4LWPA 3ZS8A 3MT7A 3KSBC 1RJFA 1YXMA 3QVLA 1H6DA 1L4KA 1JHPA 1LK0A 1XMOB 1I6KA 4RLSA 2GF2A 2P2YA 4GGPA 4UXJA 1WSWA 1RQXA 2DJIA 1SUFA 3K4PA 2WDPA 3TSZA 3PUIA 2G9UA 5I4CA 2DC1A 3DFFA 1BXZA 2H85A 2QNRA 1ECBA 4Q15A 1GA6A 4KBGA 1U3CA 3HKEA 3MWDB 2CD7A 1OZFA 3AUXA 5EP4A 3R6DA 2B82A 1F4LA 5FOQA 2ZQYA 4DB2A 2LCQA 2Q9AA 1V5GA 3L7YA 2YYYA 1P60A 4S24A 3G8DA 1W47A 2V1XA 3QKSB 2IPAB 3RVKA 4WH0A 4MYUA 2GOYA 1KY5A 2Q1TA 3JQGB 1RXEA 4KXYA 2WVJA 3L7LA 3JVVA 1JTFA 3TLGA 2XIQA 2O3UA 5I8ZA 4CEJA 3MWDA 3LHIA 3QMMA 2R6ZA 4P08A 4JA0A 2NYUA 4RETA 5EE5B 4JXJA 1T6ZA 3NDPA 2OFOA 2VQ6A 4C88A 5EXEA 5BOVA 2HGSA 1Z2AA 3DVQX 3R75A 5HBRA 2ZRBA 1X3LA 2R8EA 4UTRA 3H1PA 4LG1A 1GU1A 3OPYA 5EPEA 4WMLA 3EGVA 3O93A 1YCDA 3BPSA 4HYTA 4UBOA 4TLDA 5IPFA 1M6HA 3HCNA 5JBNA 3AXTA 4YREA 4D8XA 1LTQA 2IYWA 3B2QA 1CPYA 1M8GA 3QY9A 3DOIA 2GJAA 4MCHA 1M6VA 3HK2A 3NDJA 3WNVA 3CA8A 3DE6X 4EFLA 1SVSA 1RT9A 3MMSA 4LTMA 3NBQA 4N12A 4TYYA 5CA0B 3W5HA 3ZKWB 1RM4A 4P22A 2QMYA 3E7DA 1SZDA 4B8ZA 2GGSA 4JI4B 1PWZA 4QAJA 1ZOPA 3H2ZA 5LP6B 3CW8X 1UMCA 5HRUA 3D8HA 2FSVC 1KPIA 2AOUB 1JAIA 3QA9A 4MKGA 3L1UA 3C8DA 3OTHA 1BE6A 1CF2O 4CLXA 3BIFA 3R3ZA 3W1WA 1G64A 3WHLA 1NN1A 3HCCA 4LHZA 1SWVA 2OCIA 2YHAA 4H6PA 4L76A 3WMFA 1QR6A 1YVRA 1VE1A 1MB4A 3GJQA 2VLIA 1B00A 2WU4A 3OU7A 1RP1A 4X00A 4RC9A 1JYEA 3WP1B 3U31A 1UDCA 4OL0A 4GXNA 2A59A 3LK6A 4WFJA 4OI1A 4U63A 1P17A 1W76A 2BMDA 3U80A 4CLOB 5CFPA 2NN3C 4XCXA 1IU9A 1LV8A 1ZZGA 2IEBA 2PGLA 3NALA 5I51A 4EW3A 5IRCD 3QF7A 2JJ1A 2O7NA 3CZPA 4UJ5A 1IY1A 3RADC 1QP0A 3AUAA 1JEYB 1RJ9A 1XQ9A 3TEJA 1NP6A 3R7DA 4NSNA 3IV9A 1W1IA 4D8TA 4INJA 3ESQA 3UT6A 5CB8A 4CLOA 1CS0A 2PANA 1ZEMA 3OZSA 2FP4B 2NVOA 3FAZA 3SHTA 4C9BA 3L8DA 1JI3A 4CV0A 2O14A 2I9KA 3L7DA 4NOKA 1UBCA 5KDOA 5KOYA 2Y68A 3G3EA 4GOLD 1KXZA 3C4JA 1K8YB 1Z4PX 2LBPA 2ZI9A 1Z26A 3D6JA 5IDYA 5M29A 1KERA 1SBTA 4TRNA 3DV2A 2UU9B 4PG5A 1YCGA 2B94A 4XD7A 5E7MA 5E9AA 1MABB 4ESVA 5EKTA 1XHLA 2A78A 3GZNA 5EEHA 5FORA 3IRVA 3RABA 4ER6A 5L95A 4MX8A 3U1BA 3EXFB 3EVNA 1FQOA 3WKDA 3N6VA 4P34A 4TZKA 4EVQA 3USCS 2F3UA 3G7NA 4YMHA 4JA2A 1G3QA 3LX4A 5F33A 5GJWC 4IBOA 3V7YA 4EG3A 4RK1A 5CAEA 3CH6A 5A9SA 2X1MA 3R0VA 4E3WA 3ZHSA 3UC5A 2Z6QA 2OC4A 4MR8B 4D41A 2G08A 4LZZA 5DF1A 1IHUA 5DGCA 1MABA 1W35A 3KB8A 1L7PA 1QSGA 2P27A 3GNSA 4Y2TA 1JAZA 3EXFA 1X38A 1L5QA 5IAKA 2W2TA 4CG1A 3WGIA 4XLZA 4JH0A 2Z8YA 1STOA 3DCJA 1JDSA 4YPOA 3K6JA 3A9SA 1IJFA 1ZRHA 4RIFA 1H5UA 1L8LA 4P4GA 1IN6A 3BL8A 2JH3A 5KX5F 1M75A 5J4VA 2IXDA 3DYBA 3L4KA 3HUTA 3RNOA 2FFRA 5KYYA 4EEXA 4FE7A 4HR7A 3ECCA 1ZXXA 1V7PC 3Q98A 2R7AA 1ZM9A 2HXSA 1FMLA 2PXAA 2PRJA 2HMAA 2DH5A 4UNSA 3VPGA 4Q4JA 2JLCA 2WDZA 5LQDA 1ZRMA 1QH8B 5JBQA 1M1NA 2ATXA 1KZ4A 2ABWA 2OD2A 2VPYA 1G19A 3DLCA 3WBKA 1J1UA 1VJ0A 1U4NA 3OZCA 4D25A 3V7FA 1JNYA 2CZQA 2QLBA 4LSZA 4A7PA 1ZH0A 5CA1A 5DPMA 4H1TA 4DIUA 2C7OA 4FLMA 4MGHA 4GI2A 3WMXA 3FRHA 1AS3A 2AXEA 1D07A 1II8B 3EIFA 1YFJA 3IV6A 3Q7QA 4LVOA 1GGMA 3E4DA 2FLVA 3GC6A 1D5WA 3QPDA 5FLEX 2OBMA 3THRA 3UFXB 3FOFC 2AF4C 1U7OA 4FYJA 2ILTA 4D4HA 1T4CB 3G6WA 2JLVA 3PIRA 1AV7A 5AUOB 3ND6A 3MVEA 2ZWAA 3Q9NA 2DYKA 4KRYA 5JEDA 2Q7DA 4R7TA 1XCGB 4OHBA 1KO1A 4PXSA 3THWA 3T52A 2XBUA 3BWBA 2RHWA 2Q3LA 2B2NA 2VHXA 3NTRA 4OAPA 4D6XA 1V45E 1D2AA 4ND8A 2I22A 4MUBA 2A14A 1GGHA 1F8FA 1SKQA 2PQ2A 1JDNA 2IF0A 2H00A 3CUEF 3HKDB 1CWUA 3DZIA 5CLLA 2OECA 2ZBPA 3LKBA 4HX9A 3LP6A 2GM3A 4D5EA 2Z2XA 3BMQA 3WB9A 3ZVLA 2C5FA 5EJ5A 3GUYA 3PRKE 5IMBA 2WE7A 3D8RA 1KXJA 1UAGA 4FCTA 4OIFA 1BH6A 1DIBA 4ESHA 2GMWA 1GR1A 1QHSA 2QJWA 3WGHA 4E6PA 1ZH4A 1QNFA 3BJRA 2C03A 4X8LA 3BJIC 4ZZ0A 1YE5A 2WIAA 3SC6A 4FMCF 5ALFA 4MVJD 3QE9Y 3AO0B 3X1JA 1FX0B 4LDNA 4DDVA 3TPZA 4ND5A 5A04A 4REMA 2EZ4A 1UADA 4KI0A 4TMKA 1O94A 3G0GA 3VM6A 3IEXA 4AZSA 1P5FA 3DLBA 4UNRA 5ALMA 4ZP1A 1TZJA 1XD2B 2J3DA 3KB2A 1R7RA 3DH0A 1VJDA 1PR0A 1EU1A 4KU4A 3WJ7A 5FPTA 3EXHA 5BN4A 1NMZA 4FCWA 1VBKA 2EWVA 3RO7A 2QMZA 4G5SA 5CVDA 3TMAA 2P0EA 4L07A 4B7ZA 3MJDA 5LL6P 3BFVA 3QUTA 1XD2A 4MHSA 4XLLA 1YNSA 4FFPA 4A0QA 1Y42X 3T9BA 1CNEA 3K70B 4XVQA 4HO1X 3TVYA 1GNVA 5T4BA 2R0QC 3Q8KA 1G18A 1O08A 1Q0QA 3H84A 2JIPA 1RNLA 4OH1A 5EWMB 5KSZA 1N1MA 3V3TA 3KB6A 4L5JA 3F78A 4OXYA 4DA6A 2GYUA 4P82A 3FZGA 3V80A 3P0JA 3DE5X 4X41A 5ILGA 2PLWA 4ZAXA 4C4SA 4CDMA 5KHLB 1KHHA 1TO2E 4HAIA 3V2IA 3F9RA 4IDEA 3VOSA 3TSYA 4LFAB 1G8MA 4HH3C 4L27A 4PICA 4TXMA 2HHCA 1YIAA 1OTHA 5KNCH 4IOMA 3NGXA 4DR5B 2JBAB 4JBYA 1PG2A 3HB1A 1CQWA 2P11A 4RPKA 1H1LA 1QCDA 2NUPA 1XMSA 4WLEA 2C04A 2WV7A 4S35A 2C4NA 5I7FA 1ACJA 4CZ2A 3LBNA 4DG8A 1XR3A 1SU7A 3GZJA 4FDUA 4K6HA 2D2VA 1HT0A 4QGSA 3QFRA 2QGFA 1PUXA 3KDSE 3AF5A 5EXPA 2OK7A 2O8NA 4RY0A 2K4MA 1EGHA 4JXKA 5CTJA 4Q1BA 4C0LA 4Z8XA 3R74A 3OZRA 3MWEA 3DOJA 3H8WA 4I4TB 5D86A 4BP3A 2XYRA 1D6JA 1F6DA 5CDGA 2O19A 2CBXA 4JFAA 3P4YA 2I8CA 1H8HD 5FA8A 2OILA 2PX6A 3GRYA 4HQOA 4EBFA 2PH3A 5H82A 3UMVA 4B3JA 3DB1A 3HE3A 4OHZA 2QV0A 3QOXA 3CNBA 5BQ3A 4N5LA 2P2SA 1DOZA 4FT2A 4OI4A 4WXHA 5ER9A 4P5EA 1K8QA 3D3WA 3KD2A 4MV3A 5EJ2A 5I9BA 1RI5A 3DZJA 2GXAA 1WVGA 4A15A 5C31A 3X1YA 2QTLA 4NZOA 3I37X 4N0EA 4M76B 4GMFA 3PNSA 5AXBA 2GEVA 1Q2XA 2I2CA 2Z2JA 2OBYA 1C3EA 2GBGA 2QVXX 4KQXA 5FNVA 3T15A 4ZMBA 3KDAA 4L78A 5DISB 1NR7A 4GSYA 3D3WB 3LLVA 1E1KA 1U2GC 4JJAA 4AJ4A 4ATNA 3E22A 4HF7A 2RGYA 3CMMA 2XMSA 5KZMB 2YWJA 4CT5A 3EZGA 1E99A 5FIUA 1D4ZA 2G5CA 2J46A 1BWRA 2Q1XA 2ZKLA 3EIEA 1ZDMA 2G1AA 2IWHA 4C0XA 4N01A 3U7QB 4XWGA 3U3ZA 2XX3A 2CE2X 1WMDA 2I4LA 3CYFA 4LJ5A 2DFVA 5T6BA 3VUEA 3UMMA 2GBIA 3EOZA 4ZTUB 1V48A 3Q0IA 4MQMA 3FRJA 4IF4A 5I9LA 4TTRA 1JEOA 2QVYX 3DCIA 3IAUA 4KYIB 3RR2A 3RRBA 2IU4A 2IQ5A 4GGMX 3L07A 1YB4A 2P4UA 4J1TA 5UKDA 1VLVA 4LEIA 1P2GA 4M54A 4G5RA 3WJ1A 4DMHA 1Q22A 3B5IA 1NA5A 3JSXA 5EKDA 2EP5A 3C41J 4Q4HA 1SVLA 1SCJA 3SF8A 2R8RA 3VSCA 2ETVA 2F1IA 1C2YA 3PFFA 2AGVA 4DV7B 1AO3A 1XCJA 5EWJB 3R77A 4E94A 2PS0A 3F71A 5HG0A 1KKUA 4J3FA 1CJSA 1I33A 1HV8A 4E3ZA 4DUYB 1SD5A 2XKBA 3NTOA 2EKDA 2Y77A 4Y1FA 1QFXA 2W8ZA 1Z15A 3ZE8A 3RUPA 3JYQA 4QTYA 1ZUNA 2G5TA 4HNSA 5TGTA 2YJ4A 2OKGA 3JZFA 4NMHA 1NBMA 2JEOA 4BLQA 3BTVA 4D6YA 2A1UA 1E7QA 4JLUA 5CR9A 3D6UA 1L7VC 3NHSA 1Z2NX 5HBGA 3V8VA 1NATA 4OA8A 4DA9A 5LN1A 4YUXA 1LA2A 3R6GA 3EF3A 2RHCA 4JHLA 5WRFA 3CKMA 4HEQA 3TW8B 4AULA 4G5XA 3RWMB 3C1OA 1JHDA 3S1SA 3SAJA 5JCPA 4X61A 1TT5A 1EM8B 3QKUA 1B0UA 4IVPA 1YC2A 3MYRA 4QDZA 4F46A 2CXXA 5DCWA 3T34A 3GVIA 1M1YE 5FPSA 5FTKA 4Q1VA 3OBBA 5DMHA 3TQRA 1Q0PA 4WI1A 1NF8A 3H5OA 5JRDS 3WV5A 1VTKA 1FVFA 1JR3A 2QD2A 2XE8A 2BGMA 3GU3A 2PS9A 4A2CA 4BV3A 3TIIA 3PX7A 2VHJA 3WK8A 1CQXA 3RAGA 4ACAA 1X1QA 3ENQA 3JQAD 4TMXA 5I9TA 3R9KA 3VZSA 3CVYA 2JJ2D 2MWMA 2LRHA 2Y1DA 1ILWA 1XFAA 3BGDA 2OHXA 5C4IA 2D5IA 4KDRA 2ZRCA 1TDJA 3JQ8A 3U4CA 2QJRA 2CHQA 1Y5NA 3O8CA 1T0JB 5IXJA 4TVBA 3O82A 3TLKA 2G6TA 1ZR4A 3KQYA 1S2MA 2R2GA 3CKLA 2AZMA 3PE3A 1XYGA 2ACKA 4U39A 3HDHA 2ORYA 5CDFA 1UBHS 4QBTA 2YV4A 5GOTA 4OU5A 1L4UA 1KMQA 1K08A 1ZK3A 2JGAA 3H19A 3O8OB 4FUQA 1NDUA 4OQQA 4UTXA 5DCYA 2KWIA 2JLSA 3UK6A 3EVGA 1CUWA 5C7YA 8AT1A 1RHUA 3TB4A 2B6NA 3MRXA 4TKUA 4AKGA 2SCUA 1YK0A 2IS2A 2QG4A 3VAYA 2DTXA 1R0YA 1KORA 4XEUA 3ZCSA 4XW2A 1AB6A 1XTBA 3VV2A 5B1HA 2HF8A 3GOQA 4MEJA 3JATA 3WSVA 2CGEA 2VPQA 1RS0A 3ZUGA 1HEYA 2W2LD 1TNDA 4MPDA 1WXFA 3EQ8A 4ROSA 2O4UX 5DTJA 5E1OA 3R1IA 1P45A 2VQDA 4IKEA 4WAUA 4BWGA 2WM9B 3ZXUB 2PKEA 2KBEA 3AJ8A 1OXTA 3JATB 1GFWA 5I7EA 4RZ3A 1IBMB 1CUFA 1AURA 2RGRA 1VHJA 5TC4A 3VNSA 1O77A 1SHLA 4J6FA 4K0RA 3PNPA 2FUKA 3IALA 5A05A 3FVTA 1X80A 2PRSA 4MCJA 3OO1A 1NG1A 3DZGA 2CFSA 1R0CA 2VUIB 1L8QA 1JAYA 1XHEA 1YOBA 3E7XA 4R5HA 3FA2A 2REOA 3BRSA 4RHXA 4ALLA 4B32A 3CWCA 3IDZA 2W22A 3UGKA 1PZMA 4EG4A 2ZJ4A 4M0UA 2FY8A 4YMSA 3RCBA 5LZ7A 4DKXA 4KQWA 1H4QA 2OY0A 4QOSA 2RI6A 4EGQA 1ULBA 1EDDA 1D6MA 5B1DA 4N39A 4X0EA 3QKRA 1SHJA 3P9YA 4PX9A 3G13A 1W48A 1TGYA 3K9NA 4R3WA 1UBSB 1F0NA 5ALWA 3VC3A 4QYTA 4F92B 2ZYWX 4B17A 4BE4A 1W73A 2ZP1A 5CDFE 4WKBA 1JVBA 4ZTBA 3HRKA 1CUSA 2ADOA 2O2XA 3M3HA 3GX1A 3OQBA 2FGJA 4O0LA 3V8BA 3VSAA 1HI9A 3EZFA 4DLBA 3GVCA 3A11A 4CCYA 3B1KA 2CFOA 5GGXA 3VDMA 4XGQA 1FQKA 1U2GA 3WNQA 1BCRA 2PLFA 3IDOA 5A1TA 3C5CA 2IYAA 2J0SA 1L4HA 3OESA 4NVRA 3SP1A 4RS3A 2VP6A 3RT9A 3DLTA 5KYTA 1GZ6A 1UPCA 3V33A 3UATA 2EDCA 3GROA 2K6GA 2WHQA 3V8QA 1JBEA 1ZD8A 4BNXA 3MJVA 3O8LA 3AW8A 4F12A 4AMYA 4NECA 4N3NA 1XRLA 4JUDX 4BO5A 5BO5A 5JCJD 2G5PA 2BRUA 1WVIA 1QG4A 1XJ0A 2D13A 1KDZA 4ZOLF 3V3KA 5IAAA 3E7PA 3KKMA 1M1XB 3Q8WA 5EJ4A 4NI5A 3AR3A 3JQ6A 2A9RA 3OPXA 3R5FA 3W7BA 2AL7A 3RVDA 4OKSA 4L57A 2BGNA 4NPHA 4E5SA 4Q6BA 3V00A 4KVZA 2ZE8A 4EG8A 5KYUA 5JNLA 1V5WA 5KTPA 5J23A 1TVKB 1Z4OA 2HKIA 3ESYA 3OEHA 5B37A 2YHUA 1L4EA 3L6EA 3U56A 3BIJA 2W2NA 3SIRA 3CNQS 4W1PA 3ORFA 1D0IA 5AKYA 5EXDA 3RKSA 1AO0A 1JA9A 4M0LA 1G2OA 3GCDA 3T38A 2O8FB 2D0OB 2PRZA 5K7SA 3KQPA 1YNOA 3NW9A 1HDRA 3RYTC 3KSZO 5KQSA 4Y2YA 3TCKA 1PZNA 2HRDA 2W6IA 3HDVA 2RH8A 3EPLA 2PUFA 2XV1A 1SXGA 3VTZA 2NQ2C 3PYXA 1QOZA 3D0KA 3FZNA 1K0FA 4JHXA 1GYPA 4I3GA 2XWPA 4C20A 2CJFA 4RA6A 2JLUA 5JCZA 4NEHB 4HN4B 1MT3A 3VR5H 4XVCA 1F7UA 4AK9A 1G9XA 1M2EA 4EPTA 1UFKA 1Z9BA 4IQ0A 3HCBA 4ZI7F 5KNDA 1H9CA 3IP7A 5SZJA 4FQ5A 1MLDA 2QPAA 1U3WA 2RK6A 1A8HA 1FTQA 2E5FA 3TCXB 3KR9A 3JQ9A 1ZQ9A 2NG1A 1C9DB 4BP8A 3I6QA 5MDHA 5HNKA 3K3PA 2QBYB 5YASA 4CG0A 1JHMA 2Q3JA 2P9CA 3BB1A 4KDFA 3S7ZA 1BE8A 5J2UA 1EBBA 1NRWA 4M1ZA 5LOVB 3GFTA 5I4IA 2DFTA 2BTEA 4HWKA 2WEKA 2WYOA 1DLJA 2X0JA 5AUQA 3BMOA 4BBZA 2X76A 4TYMA 1S9DA 3X1XA 2DFPA 2GLTA 4TLMB 3KZCA 3VXKA 5GZ1A 1P18A 4MDYA 4PCLA 3GL9A 3ML1A 2X6QA 2QY6A 2ZBVA 5LWQA 3GLIE 3VYTB 3PXBA 4QUKA 5D84A 1CFZA 1SJ9A 3SFTA 4LDPA 1N3IA 2OUKA 5KREA 4PGAA 1ORDA 2OFPA 2RJ3A 2WTEA 2O4CA 3DXFA 5BN5B 3V2GA 1EVLA 3ZV3A 4EB3A 3NBUA 1CZKA 1HYQA 1K06A 1ZD1A 4HEA1 3FETA 4KL8S 1IMOA 4G1EB 2J4FA 1Z47A 2XRYA 1AUVA 4LBZA 4ML3A 3QX3A 4P0TA 3HCOA 5G4KA 3V34A 1YRYE 1V71A 2SHKA 1LVUA 4RKEA 3T06B 4D0SA 3MCAA 3ANSA 3LUCA 3Q7EA 3MA0A 4J76A 4ZVKA 1NY5A 1QO0D 2TSYB 4INAA 4QO7A 4TRJA 2NT3A 3W8EA 2OYCA 2QM3A 3EXEB 3IQDB 3A6LA 2VQSA 3KYIB 2R86A 3VYVA 4Z4EA 4DWVA 2PUJA 4YIHA 3I52A 2NO6A 3K31A 1KJYA 4MGIR 1RBMA 1G21E 1UJ5A 2WWXA 1LTHR 1NBIA 1TLFA 2HIAA 3F5MA 3PGKA 4GI5A 4YCBA 3M49A 3HB5X 4G97A 2O2YA 2C4VA 1UL1X 1QZXA 2W93A 3VSBA 5FOTA 1C81A 1E2QA 1WHTA 5KMGB 4DL9A 2OAEA 3E2MA 4YMUA 3GWGA 4XR4A 4FZJA 3TAXA 3DHWC 3TPCA 4LV8B 1B15A 4O02B 1OFGA 3X1DA 4LE1A 4L9SA 3P26A 3SZLA 2FHPA 3V1TC 4BXOB 1ZFNA 4I55F 4MA4A 4WLVA 2OV8A 1IQ0A 2G9RA 4I14A 3ZBQA 2OM2A 5K3FB 4QU9A 1KY2A 2OXTA 3FH0A 4N3CA 3D4PA 4AUNA 1DTWA 5ICCA 3QFSA 2NU7A 2AS0A 4L5AA 4JBLA 2EZTA 2YWXA 1JDJA 2OO7A 2H54A 1WV1A 3PHIA 3JRXA 3P0EA 3FUWA 1N2SA 4ZOAA 3RAFC 3GAAA 5DWVA 4AJOA 3OTGA 3K1AA 4G1FA 3OD5A 4H31A 3M8KA 4TOIA 4F2PA 4P0PB 1J5PA 3BA6A 1FDOA 1BCSA 2H1IA 4UXIA 2O8DA 3L46A 2YHSA 4FYYA 4C6TB 4Q01A 1LK7A 1S8NA 2BUCA 3KL4A 3AY6A 4U2BA 3UCXA 1MAUA 3DKKA 1PCXA 2YWBA 5HA5A 1USIA 5T5QA 2BT4A 2GEBA 2LIPA 1KBOA 1AKWA 1I2BA 3W05A 1FY2A 1H2WA 5KTOA 1BCSB 2Y66A 4IKPA 1OIXA 4L72A 1GQFA 1QLJA 3H6GA 3N0VA 4M87A 1IXKA 3D3QA 1FFBA 3PVZA 5JD6A 1H1TA 3FUCA 6ABPA 1EXNA 2MU1A 3CLUD 2BFDA 3H2YA 5ELXA 4OSOA 3GCWA 4FQ8A 4MWTA 1POWA 4MQUA 2IA5A 1Y1LA 3S5JA 2E4ZA 2BCGY 2GN2A 3GT3A 3VGJA 4NE9A 3CVOA 4RGBA 2R4QA 5DT2A 1BIFA 1NVFA 1S7CA 2XIJA 3E3MA 3Q6MA 4WX2B 4AT1A 4EUEA 4LGMA 2QZ4A 1SHTX 2FPWA 2J08A 1TD9A 4WDQA 4X5OA 4JJ4A 5DN6A 2VA8A 1BJKA 5EJ7A 4K7JA 2QTVB 1E3TA 3UCEA 1P4RA 1MX5A 3T8YA 2WOJA 1K2VN 3FMOB 3HR7A 4NV0A 5A0VA 2C2MA 4KHPB 3RRJA 2DPYA 4ZYWA 3FGZA 2B98A 3N86A 3QUBA 2W00A 2P4SA 1IN1A 2AK3A 1JV2B 2QMEA 3MJ4A 2J3MA 1HOTA 3T4XA 4BL5A 1P1IA 2LKCA 3EXG1 1IIRA 1Y3DE 4GXQA 3ZJVA 4E1VA 1Y81A 1ZUD1 4RE5A 2QTBA 2BFEA 4P4UA 3C6YA 4HQFA 4IJUA 4YAUA 1XZIA 4XX0A 3LDAA 4TT3A 1E5QA 2X5XA 3BTOA 5M3BA 1UWKA 5D3MB 3TBFA 3AVTA 3SX4A 1TZKA 2C61A 2QTCA 4J0QA 3ZBUA 1NI4B 1GFIA 2DCMA 1EUCA 2MOKA 5ALVA 3W5CA 1J00A 3A3YA 3JW8A 3DE4X 2QX4A 3QBTA 4H1UA 1E7MA 5FA6A 2G1JA 2W4QA 4PRYA 2YWEA 3C3AA 4W8GA 1YTUA 3N2KA 3NVKI 3TJZA 4AM8A 3S7TA 4GKBA 4MUYA 4U2EA 1WCIA 2MJLA 2OOSA 2QIOA 2WD9A 5CIWA 3ZDZB 3FF1A 5FTWA