1GNSA

Subtilisin bpn'
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
262
Chain Sequence
b'GPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPALKVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIWSTLPGNKYGAKSGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVEAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
publication title Structural Basis of Thermostability. Analysis of Stabilizing Mutations in Subtilisin Bpn'.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 93
structure length 262
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2001-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gnsA00
3PTLA 1WMEA 3WQBA 1V5IA 1TECE 1P8JA 1WMDA 4B5LA 1SCDA 1TK2A 4J94A 5AVKA 1R0RE 3SICE 1IAVA 3QMPA 4C3VA 4HX2A 1MEEA 1Y4AE 1GT91 1SUEA 1T1EA 4CFZA 2TECE 4DZTA 2W2OA 3DYBA 2PKCA 2DQKA 3DE2X 4RYDA 4DJ5X 3I34X 1T1GA 1BFKA 2X8JA 1CSEE 3DE6X 4LVOA 1Y4DE 3DE5X 5B1DA 1R64A 3VHQA 3BX1A 3TI9A 1GTL1 3H42B 1A2QA 3I2YX 1AU9A 2W2PA 3SQOA 1Y1KE 2ST1A 1BJRE 4OMCA 2W2NA 3DVQX 1Y48E 4OV6B 3F7MA 5JXJA 3DE1X 3DW1X 2SECE 1WVMA 1KE2A 2PQ2A 3I30X 3AJ9A 4YN3A 2ZWOA 2ZWPA 3DE3X 2Z58A 3DE7X 1NDQA 1KDYA 3CO0S 1VSBA 1Y34E 4FONA 2ID8A 3EE6A 1Y3CE 1SBNE 4LVNA 4WOBA 3LPCA 3LPDA 4H6WA 3DDZX 1TM4E 4I0WB 1ZVJA 2WUWE 1EA7A 3QTLA 1GA1A 2HPZA 1TMGE 3ZXYA 1P7VA 1KE1A 4MZDA 2WWTA 1SH7A 1SUAA 4Z2AA 5ARCA 3DWEX 3I37X 2Z30A 1ZVKA 2X8JB 1V6CA 1GNSA 5FFNA 1YJAA 4ZOQI 1THMA 3VYVA 1SELA 2ZRQA 2WUVA 2PMWB 5B1EA 1OYOA 1NLUA 2WV7A 1SUDA 1AVTA 1BFUA 3VV2A 2SNIE 1BE8A 1WSDA 3A3OA 1AF4A 3DVRX 1S2NA 1UBNA 1TM1E 1AV7A 3VSBA 5FAXA 4WOCA 3DE0X 1Y33E 1SIBE 3DW3X 3F7OA 4K8RB 1S01A 3OSZA 1GTG1 5JXGA 3HJRA 1SVNA 5AVJA 3P5BA 1WMFA 3TI7A 3AJ8A 5FBZA 3GT3A 1TO2E 4NMXB 1C9MA 1TM3E 3F49S 1BH6A 4BWGA 3WHIA 1MPTA 2SICE 1SCBA 2PYZA 1ST2A 2XRMA 4KG7A 3VTAA 2Z2YA 2Z2ZA 1XF1A 3AFGA 3LXUX 1ST3A 1T1IA 3T41A 2PRKA 4KB5A 1PFGA 1GA6A 2Z56A 3D9QX 2W2MA 3PRKE 1GCIA 1SIOA 1SIUA 1DBIA 4C3UA 1EGQA 4M1ZA 4NE9A 4HVLA 2XTJA 4DWWA 1PEKE 4H6XA 3ZXXA 3DE4X 1GA4A 1KDZA 1TO1E 3CNQS 1OYVA 2Z2XA 4CFYA 1YU6A 1AK9A 1PJ8A 3UNXA 2GKOA 3Q40A 1TM5E 4NE7A 3VV3A 1AQNA 2DP4E 1SUCA 3GCXA 1Q5PA 2IXTA 2E1PA 3A3NA 5JXHA 1SBCA 1SCAA 3D43A 2P4EA 5ARDA 3GCWA 1SPBS 1KDVA 4AKTA 2SBTA 4AKSA 1GTJ1 5SICE 2IY9A 4GI3A 1JEAA 3QFHA 2G4VA 3DVSX 1SBHA 4OMDA 1P7WA 2Z57A 2ID4A 3Q5GA 3WIUA 3TECE 3L1KA 1BE6A 3EDYA 1HT3A 1LW6E 2HD4A 1IC6A 3A3PA 2QTWB 5AQEA 1YJBA 5JXIA 4KPGA 4CG0A 5CW1A 1Y3DE 5ARBA 1AH2A 4H6VA 1OT5A 1SCJA 3WIVA 1C9NA 3LPAA 1C9JA 1C3LA 2V8BA 4JP8A 1Y3FE 1Y9ZA 3EIFA 1NDUA 1DUIA 1PTKA 3BPSA 1S02A 5JMOA 2DUJA 1SBTA 1TM7E 1SBIA 5K7SA 1SCNE 1GNVA 4ZARA 3GT4A 1YJCA 1CNMA 1R6VA 1SUPA 2PWBA 3BGOS 5AMXA 5I9SA 2W2QA 1Y3BE 1SN7A 2B6NA 2PWAA 1SUBA
chains in the Genus database with same CATH superfamily
1RM5A 4P4UA 1WMEA 1UC9A 3DBVO 5BMVA 5KJFA 3N5CA 2YHIB 3OPYA 4IIUA 1SBQA 5DMHA 4OL0A 3VNAA 2MU1A 4L0QA 2Z8XA 1FFYA 4B7AA 3NJ4A 4EJSA 1AUXA 1KVUA 1LZKA 3JQ6A 1F8GA 1ZX1A 1R5OA 4BFUA 3H6GA 3I73A 4LDZA 3S68A 3AR8A 3FCSB 1NW4A 3HUEA 1JKIA 3MJSA 4MKZA 4AY6A 1W4AA 4D9IA 3IBCA 1UMDA 2FA9A 2DGDA 3H16A 1NN1A 1H6CA 4URUR 4C3VA 2GN1A 2QUAA 4NZ9A 1ZG3A 3E8SA 3B6EA 2XE8A 3H2ZA 1NRIA 4IDFA 2QAIA 4ZHQA 3M4XA 4G4IA 2WF5A 2YN4A 1WR8A 3PF8A 4MWBA 3O1JC 1JVBA 2C2ZA 3JWJA 1OMOA 3HR4A 5KOJA 1W96A 4LPSA 2HREA 2AMVA 3QNUA 3N6VA 5DNVA 5HZMA 1A96A 2PKCA 2B30A 1QKKA 4ZI7B 1J2YA 3PQCA 1BC5A 2VVTA 4QU0A 3BJIC 2GRUA 5JG7A 1QGAA 1X74A 3O4JA 4K6FA 4K6MA 3NDBB 4R2MA 5BN1A 3SIRA 4E4YA 1USVA 2PJDA 2XV1A 2WNIA 2J87A 4RK6A 1XZDA 3O4FA 4KR6A 1Y9JA 3BXFA 4I5FA 4JEHA 3B82A 1SD1A 3CNNA 4EKNB 5JAHA 3E8XA 3OMXA 2BI4A 1P0PA 5E8RA 3S1AB 4NONA 1JHXA 1V45E 3EDQA 3KG2A 1WOMA 3NCHA 4N4AA 4A6PA 4BECA 2DX7A 4Z4QA 1LDBA 3R3ZA 5DX1A 4JJ7A 1NLMA 1ZD2P 4WL0A 3U37A 1MDFA 1NURA 1S4MA 2AX3A 3HVUA 3OG9A 4DJDC 3RYCB 2OQIA 4IAOA 3M0EA 1V25A 2IYRA 3Q10A 3GRYA 2CLIB 3U9TA 2EFJA 4OI4A 1B6GA 5CB8A 4EHLA 2FZ4A 2PO7A 3OX3A 4HZUA 1HFKA 3AF6A 4QM6A 1N2OA 3BTUA 4EP1A 2ID7A 1E92A 3OF3A 4WXHA 1N2IA 2JGDA 1E9RA 4G26A 4M87A 3FOAA 3UCXA 4RXMA 4HNTA 5JAOA 5T5QA 1R6TA 3L8HA 4UNIA 1MB4A 3RAJA 1RPNA 5ICSA 1J7JA 4LCJA 4R2JA 1B0ZA 3BRWD 3RODA 1ZD3A 3ITDA 4DIFA 4ARCA 4MW1A 4LS3A 3WV4A 1G59A 4JLMA 5HCUA 2OECA 4ZAXA 3VKFA 1NBHA 2W2VA 2HA3A 2JHAA 1Y5IA 3QOWA 7REQB 4Y6OA 1U7ZA 2D0PB 3F7TA 2WF9A 1PR9A 3BMOA 4GPEA 5TLSA 2LDXA 4OQEA 4PHHA 3WFJA 2H4FA 3P5SA 4LHSA 3ROZA 3BJEA 3G5TA 1BHJA 4CKWB 3GIDA 2RMKA 3LUAA 1OWLA 5B7NA 1G19A 4DQUA 4EFNA 2I2DA 3WL6A 3DE7X 3ENQA 1N5KA 4FYWA 4G9BA 4LGMA 2W2XA 2UUCB 3F71A 3CO0S 3O31A 4D0RA 4EJMA 4FXPA 1RXVA 2I03A 1PZEA 2B8NA 1DJLA 1V2GA 1WDLA 1KC1A 4JYPA 3LSTA 4WN3A 2G7MC 5KTNA 5KYXA 4X7RA 4JJZA 4LE2A 3C0KA 1WP4A 2EDAA 2YOFA 1AQ6A 1N0VC 1CRZA 1EVYA 1ZJYA 2A7QA 2QNIA 1PN3A 3FTCA 1TCCA 5LNK1 1E4VA 2H2FA 1Y1SA 2NU9B 1P18A 1Z0ZA 1XP8A 2DBVO 1E69A 4LZLA 1V2HE 1N6RA 3LCMA 5DXJA 3P9SA 2VK1A 2INGX 3FYSA 2PX4A 4PPYA 3T7AA 1NF9A 3QWHA 4WKNA 2HA5A 4MUNA 4PO3X 4QFCA 4I0WB 1SOVA 2RHGB 3N2KA 1D6SA 1W1WA 2FK7A 2GFQA 4HWSA 4RKQA 1X9GA 4WE3A 4D9HA 3HVJA 4RMJA 1JPJA 2CBGA 4KAJA 3KEQA 3AEUB 2YWEA 2C82A 1GTZA 4ZO9A 2CUKA 5EJ5A 3T38A 4GLFA 2W71A 5E2BA 3DAPA 1CLEA 1UKBA 4G0OA 4TZKA 2F3TA 3M34A 3NT4A 3TRKA 3IO3A 3EW9A 4GOND 4X20B 4A8TA 3S2YA 4XSGA 5AW9A 2O8CA 3G1WA 2NTJA 1NQUA 1T3TA 2NSDA 4MIKA 1I4TD 5HQTA 3SE7A 1H2FA 1PLKA 2B1JA 4WT7A 4KO1S 1GNSA 4ZVOA 4PLYA 1ULUA 3QLTA 1QGZA 2GCOB 1SULA 5G40A 2ON6A 1RWOA 1TIPA 1M6HA 2WYWA 3NUZA 5BW6B 4EG4A 4FYPA 4C7KA 3TW6A 1THGA 1IRIA 2EW8A 3F6PA 4E5UA 1QIHA 2CL7X 3JQ8B 2A35A 2C7RA 4CTJA 3BWXA 2NTEA 2IYZA 4Z1OA 3AGPA 3HXQA 3GLHA 2GLTA 5EESA 2QBYA 2OFXA 3R3XA 2OXIA 2ZAOA 4NNPA 2IZ6A 4NOLA 5B58T 5TEWA 3ZC3A 1Q0QA 3NB0A 4IWYA 1GZDA 4POAA 2O23A 4DY6A 2RGEA 1KVSA 5E8JA 2ZSHA 3EDOA 4CN9A 4MMXB 4QAQA 1L4HA 3G5UA 2FN9A 3IOEA 3OJLA 1P5JA 1XEWX 4YY3B 4EBBA 3ZVKA 5GONB 2ACWA 1FP1D 2O2EA 1NN3A 4M1YA 3PIIA 1L5HB 1LGYA 3EBPA 3I6QA 3R0JA 2VSQA 1BFUA 3V1LA 4DR2B 1WSDA 1EHYA 1N3YA 3LBFA 1L0BA 4GICA 1AF4A 4IHQA 2BY4A 4MKHA 1ITZA 4MCHA 3EPJA 2ANCA 4KP7A 1LVUA 1TU3A 1C3VA 3QLUC 4YI3A 2C84A 1EDDA 3P0EA 1UBNA 2AOUB 3HRKA 1X1QA 3PUWA 4MITA 3ELYA 4YECA 1ZC3A 3T9BA 2QE7D 3W3AD 1NNSA 2VP3A 3EGWA 5FAXA 3TVTA 1XVAA 1PZHA 4F6CA 2A5YB 4X84A 1TYCA 3IKLA 2J9ZB 3D3NA 2RONA 4XM0A 1V8BA 3L8YA 3F90A 3LD9A 3CF4A 1OLSB 2D0OB 2VUIB 5DU2A 1WHTB 2Y6VA 2CVZA 5DP1A 2BGRA 2FFBA 2O14A 2PKQP 3VYTB 5CJPA 1QCYA 1CJSA 1AN0A 3AYZB 1CV2A 3QHAA 2BH9A 5IC5A 1N7GA 2J33A 3KKMA 5FL7A 2JVKA 4MINA 5ALFA 2ZQ5A 3EG9A 1KYQA 3FCEA 1D2HA 3PZRA 3TZHA 4YCNA 4M98A 2XB6A 4Q1AA 1J00A 1IWPB 2V1UA 1DRKA 2EX4A 3KAQA 4BWGA 3KAPA 4GOMD 2JNWA 3TOXA 3O26A 1M2GA 3PQ2A 3C3MA 1EFUA 2DFLA 1YTUA 2ZJ0A 5K51A 4I8DA 5DT2A 5DK6A 4O4IF 3RIEA 4GH5A 4DEXA 1X2EA 5JFTA 4FMPA 5BYBA 4QUAA 2C4UA 5CPBA 1MO3A 2P2LA 3L3BA 4RS3A 5KNDD 1GILA 1YSCA 2G25A 3GF4A 3RSOA 2PXCA 1SUIA 2FRDC 1JQ3A 3QTBA 1UFQA 2Z2YA 5HIJA 3QXXA 2GOYA 1Z33A 3HCCA 4K9SA 2DUNA 4L8FA 4R1UA 4M21A 3W6PA 4AZ3B 2RHJA 3C85A 1JTVA 4G4SO 1X1DA 2CCJA 4NFLA 1ABBA 3P32A 4K7JA 4A8JC 4YAKA 5EJ6A 4J7XA 3GPCA 4RE6A 4G67A 5JWHA 4NBKA 4DV5B 3GRAA 2J41A 2NAPA 1KSFX 1LC0A 1PFGA 4RORA 5ADHA 2NTYC 4Q9NA 5ADUS 5DYIA 1UM9B 3K5WA 2OZLB 2Y0CA 4QATA 3D9QX 4EVQA 4PZPA 2W2MA 4GQIA 2IPAB 2UZ3A 1NXXA 2C77A 1ESEA 1IATA 1QHNA 1Q16A 2YCLA 1HV8A 2EVWX 2ZT8A 4EQ6B 4QAJA 1OLUB 2VL7A 1OXSC 1FQOA 4I5GA 3ADOA 3OIDA 4XGKA 4P2BA 3ROMA 2DTEA 1H8ED 4M0FA 3K0CA 4UHBA 5T64A 1ZGZA 4R7TA 4F2GA 3DAFA 2V8OA 4IS3A 2P1RA 4KC0A 3FYDA 5FKJA 3V34A 3UPUA 4RKYA 3IQWA 5ALWA 1XEAA 4UAJA 1NYTA 2O2IA 3JWHA 2ZAGA 3T12A 1AMOA 4DXDA 5SY4A 1L8AA 4DCUA 4ZI7F 2CUTA 4A73A 5D3QA 3VU1A 1MJGA 1IONA 2PIAA 1IBKB 2QTHA 2ZYDA 3LBHA 1X1BA 4WXEA 4FS3A 1KJIA 5IS2A 1VECA 4ALJA 3A1DA 1ODTC 4P1ZA 1FNDA 3GC6A 2I6TA 4TUYB 5LLDA 1T4CA 1VE1A 2GEDA 2VO1A 5ALVA 3SC2A 1EU1A 1UIRA 1IRXA 2ENUA 1PNVA 1C4KA 3NAZA 3UNXA 4MVCA 4L6AA 1CEQA 1BRMA 4E5PA 1KMHB 2J7PD 4HWTA 4AS3A 5BOSA 1EG7A 3ZPXA 2PSJA 3OO0A 1EGHA 1ORTA 4HUQB 1DOZA 1HL7A 1AHPA 3HEMA 1TUEA 4C4TA 1PWZA 1KS2A 3NHPA 4L4UA 5HTOA 1SGWA 3P2OA 2DRIA 3MCUA 2CLDX 2MDTA 4QPZA 4F3TA 1W1IA 3MJDA 2GN2A 4OL9A 3O2QB 3V7WA 5GINE 1H1LA 2HMTA 4I2NA 2GBLC 2QUHA 5EIBD 1RAEA 3JYLA 2QR2A 1R4ZA 3F8SA 3I3SR 4RWEA 3SVZA 3ZNNA 4V1CI 3GH3A 1JUDA 2DHDA 3K1JA 1EXMA 1GFZA 1SUSA 3IDOA 1JSRA 1Z2NX 1R16A 3JD2A 3UW3A 2O2GA 3H1TA 3A4VA 3HFRA 3DZDA 4YEDA 2O0MA 1L7XA 3OWXA 5FPKA 2C2KA 3P96A 3AUAA 4HMPA 4KQWA 1YMVA 3MUEA 2GPNA 3AHCA 3OJOA 4N5DA 4O2BA 3DAHA 1G3IA 3WLJA 1ZK1A 4ZC1A 3S28A 2DHQA 4B8WA 3DOOA 3EEIA 4GI3A 4JT4A 3TAUA 1EE2A 1N9KA 3UAOA 4B4KA 4YXWD 4MS1A 4OMDA 4Y2PA 4OHWA 3EIXA 4YLEA 2JFHA 3EQ6A 1NYLA 2WR8A 5DGTA 4BPRA 3IXQA 4ND8B 5JSQA 2BH2A 2OBLA 1WX1A 2VHVA 5IKXA 1TXGA 3PQ7A 2GYUA 3KQSA 2IODA 3GAMA 1I5EA 3RFFA 4CM3A 1Z35A 2F4NA 4Z5XA 2PBLA 1BE6A 4MMZB 2QM8A 4GI1A 2V74B 3D8RA 1G6Q1 3ESZA 3K9LA 3EFHA 3TM4A 4BLVA 3NORA 1F20A 2PTGA 3FNGA 3KSBC 5LBUA 5FOVA 4I4TA 1I0ZA 2C03A 1FJGB 2O4CA 1SHZA 3CSUA 3W8EA 4QM7A 4FOSA 4G5RA 4HSEA 3PWTA 2EJUA 2VDPB 1N9GB 4WJKB 3EFBA 4JVOA 4F71A 5K8IA 2WWYA 1K8ZB 2QN3A 1OGJA 4Z9XA 1NT4A 4KPGA 1XEXA 3OT5A 1UWVA 3OWHA 1FW8A 5LP6C 3D8UA 4C0BA 4D8UA 5IDQA 4B74A 4R1OA 2PUFA 3NGLA 4IJ5A 1JQEA 2BBSA 5FOTA 5FOXA 1TIKA 4R1TA 3L7CA 1JLKA 1GUYA 2HI0A 3ICPA 1Z4JA 1LF5A 4XX0A 5T4BA 3H75A 4UVIA 5L3QB 1ENYA 2AXQA 2ZRLA 1ZSNA 3BXGA 3NBUA 4C7BA 1X9HA 4KQ2A 3T94A 1YC2A 1L6IA 4RVUA 4XDHA 4U2GA 4WD3A 3ROTA 3MA0A 5LFAA 1F8FA 1UCFA 3TLMA 2RI1A 5KJ1A 4CFSA 1L4EA 3THYB 1NASA 3VTKA 1C2YA 3K3PA 3TPZA 3ORSA 3GLFB 1KJZA 3ZE8A 5PNTA 4C0JA 8OHMA 4C6TA 4NQRA 2ZR7A 5DYYA 5G0SA 4DDTA 2Q07A 3WK8A 4ARBA 4DPKA 4D8XA 3BAZA 4HAVA 1D4ZA 3JQAD 4FUTA 4TXJA 4PG4A 4R2HA 3PNSA 3KPVA 4LZWA 3ILHA 1B0AA 1P1KA 2PZMA 2RSLA 1VMEA 3EZYA 4B6SA 3GT4A 5D3KA 4UU7A 2YXEA 2OCGA 4KR2A 1WABA 2D1RA 4QUGA 4B5KA 4CBVA 2X0DA 2C4KA 1K6XA 2J6HA 4R2WA 3QBJA 3K2QA 5AI6A 3I5UA 1QH8A 4G81A 1E2BA 1IVSA 2Y1LA 1H22A 4MW0A 1U0RA 3T7RA 2ZRCA 5I7WA 1MIHA 4L7QA 3VDQA 2ONYA 3NS7A 2HMWA 3RYIA 4ZAFA 4EF6A 5LQMA 1T0BA 3M6UA 5D2CA 3E22B 3ZK8A 5GONF 2QZZA 3KVRA 4BN0A 1LEHA 3S0JA 3JWEA 2CD7A 3INTA 1IHOA 1KO1A 2WINI 1RJDA 1YZQA 2C97A 3BEOA 2FHPA 3CZCA 3F5DA 1Y5LA 3VI4B 4I1PA 2JLYA 2F8SA 1QTIA 1AZTA 3PGA1 1TCBA 1QJ4A 5LDDC 2BZ1A 3PTLA 1AM4D 2YQZA 4DM4A 1EFRA 2H1WA 3TWOA 4MIYA 4Y6QA 4ZAVA 5BVGB 4EX7A 1OZ0A 4TKLA 4JLOA 1QQTA 3KZOA 2VJBA 4M88A 3U7JA 4EHIA 5CLHA 3CNEA 4MWSA 4P3OA 4WXRA 4CU2A 3THXA 2ZT6A 2FFAA 4CKZA 2PUEA 4JFAA 3U0VA 1NQXA 2JS7A 2QX4A 4IGAA 2PD4A 3NRJA 3HJTA 4X6YA 5EL0A 3PUHA 3ZE0B 2QRVB 3HR7A 4MVJM 5JVDA 1KDTA 2O50A 1FFXA 2A67A 2OMKA 1U0BB 2H00A 4BMXA 1IAVA 3QMPA 1KPHA 1XALA 4A1FA 1N2SA 1PT9A 2GNPA 5EJ7A 1J49A 2Q4BA 1DG9A 3KKNA 2WYIA 3LECA 4GEGA 2ZB8A 3RSFA 3M70A 2HDNB 5EXSA 1RKQA 2IKSA 3RYFA 3HUUA 4TLAA 4NMWA 4YRFA 2BF4A 1YVPA 4UCQA 1U0SY 1UK7A 3MGCA 3PA6A 5EHGA 1KWGA 4L5JA 4MYTA 4TVBA 4EAAA 1FTSA 2PIDA 4IQGA 1T24A 1Z4NA 2Q0XA 1NVFA 4YCDA 3K9WA 1ZZGA 3K2BA 3PT5A 1DQSA 2EJBA 1Z28A 1Z3IX 3MERA 5A0FA 4OGKA 4Q3EA 2VQSA 3I34X 2BJVA 1JFVA 5JZVA 2R48A 1BFKA 3D3WB 4TV8A 5EJFA 4MVYA 4S12A 2F43A 4B17A 3HLKA 1KDPA 2F67A 2CB9A 1SR8A 2XYQA 1B0PA 4OGWA 4YHBA 5B1DA 5BN3B 1N32B 2VTDA 5G41A 1OB5A 4A0FA 3AEZA 3JAWB 3EB9A 3PDCA 1DT3A 4ZU1X 2ZANA 1KPGA 1TEVA 3TIGA 5JCJA 3H42B 3KCNA 4TKUB 1VMDA 1UWKA 1CUBA 1N75A 2WIGA 4Y6RA 3A6EA 1EK6A 2EQ5A 4Q7MB 2YY7A 5HMLA 1VTKA 4ABTA 1EPUA 121PA 4KXLA 4O0MA 2O8BB 5A2QA 4YMVA 2A30A 4ZV4A 1PNOA 3TL2A 2JLVA 3DMPA 1Z6YA 4M1EA 2VBIA 1M34E 2JASA 4Q82A 1WZNA 2JB9A 2Y9MB 5KOHA 2H3EA 5HIAA 2ZI4A 3LX5A 5A4AA 1KH1A 1PFYA 2O7SA 3RF6A 3OZBA 1KZGB 1GNTA 1F8XA 1MAVA 1PL6A 2XY4A 4JBNA 1Z3CA 1F17A 4A26A 3LA6A 3A25A 1M6EX 3KXPA 3IT2A 4GI7A 4OLFA 5TT0A 5EY5B 3ZVNA 1WKVA 3ECSA 3IVXA 1QUEA 1X8XA 1NQWA 4XB1A 3SJUA 6AT1A 2X9QA 5FV4A 2I9KA 1GZUA 3DVLA 3B7WA 3L1VA 4JL8A 4UM8B 3EVZA 3AJAA 3P9CA 3PPXA 5AW7A 1P1CA 3TW4A 4AULA 4EFDA 4W5TA 3TZCA 1YBAA 2PT9A 3K8OE 3UMSA 3ZI4A 3AJ9A 4NRDA 3WDKA 3QE2A 4TUYF 2V03A 4AJKA 1ECPA 4J0QA 5LLTA 1GPDG 3DE3X 3EVAA 3TLGA 3QITA 3OE7D 3H5TA 3ZCQA 2Z58A 1I9CA 4LKRA 2O3TA 4JN6B 1ZBQA 1V8FA 4UHCA 5HMMA 2MYUA 3L4BA 5GAJA 5AXDA 1IMOA 2PGLA 3I32A 4XQ0A 1YFJA 4DDHA 3EISA 5FX2A 3BHNA 2A5GA 2UVQA 2O2JA 3S4YA 3JQQA 4RQTA 2JHCA 3CX6A 4EYKA 5B7QA 1EWRA 3BFKA 3T1NA 3U49A 5ENZA 3X2EA 3AVOA 4KSCA 5ECDA 5B30A 1MTOA 1NF2A 3C3BA 3JZFA 4QJBA 5KO2A 4GD3Q 2YV4A 2JGNA 4F5YA 3WJ7A 4U4AA 1YB7A 3KTAA 3B1FA 3M89A 3R9XB 1F6BA 4DVGA 2XQGA 3LPDA 4FXOA 4X6LA 4A2WA 3EZNA 3PYLA 4CDRA 3OI7A 1DBQA 3TQFA 3AYXB 3GUHA 3KT8A 3WLOA 4AUNA 5JH7B 4HATA 2JARA 1RAGA 3M2TA 2PWPA 5I8PA 3GELA 1E77A 3ME5A 4J0EA 5E4JA 1N78A 3T4PA 2G8NA 5TQVA 2A9QA 2RG1A 4LOHA 3EFOA 4IDOA 3FR8A 2I4NA 4G5SA 3KDPA 1R50A 2HPZA 2V4MA 4QD3A 1N3LA 1GR1A 1QKIA 2DYKA 1WUYA 1D7AA 3QPBA 2ZE5A 1NJ1A 1EFVA 4LC9A 5IG2A 3CVVA 1L5RA 3NASA 4PYNA 4CF5A 1K6MA 3EVDA 1GUZA 1XRLA 3KUKA 1P3Y1 3LCRA 3AMVA 4G23A 4MUBA 1QV6A 2EWMA 1L7MA 1PGJA 1YB5A 1YL7A 2E6KA 4IJMA 3UB3A 5HWSA 1W6UA 2HSWA 2ZB4A 5BV7A 2VJAA 5KNBD 1DCKA 3L4EA 1DINA 2PMKA 2O1SA 3O8LA 1Z5UA 2NXNA 3QYAA 4KFSA 1IB6A 1W48A 1UF9A 3ENWA 3CLHA 3SC4A 1OLXA 4LJ5A 2Q3DA 1H3EA 1QRSA 3RHTA 2ZKIA 2DQZA 3AY6A 2K6GA 2AB0A 3QXGA 3TXYA 3EGIA 4ZZ1A 1NF8A 4EF4A 1PX0A 1W9HA 5HIMA 4XIGS 5CIQA 2GETA 3NBFA 5CT5A 1M8JA 3SQNA 4EO4A 3WTBA 4ZGBA 2XWJI 2KJQA 1VJDA 4WLVA 3ADPA 4ASUD 3UJCA 4C0LA 2C3PA 1FK8A 1V1RB 4KFRA 4JI6B 5BQXA 1K97A 2EC5A 2G1AA 3IYLW 4JUFA 2BM8A 4H7FA 5JDIC 4HO1X 4QYMA 5ICCA 5C2JB 1LPBB 3GY0A 1NVVQ 3T3HA 2AD5A 1GEEA 1U8FO 1UBJS 2EKQA 2XMPA 5EJ9A 1KL7A 1N2ZA 2WDPA 1LPAB 3KT3A 5AOAA 3K9GA 4ND7A 2PUDA 3EPLA 5JRDS 3NM5A 4R9NA 1KARA 3KEGA 4PG5A 4C08A 10MHA 3SC6A 3NKFA 2DZDA 3R7WA 4G8DA 4HYYA 3K32A 2E2WA 3IV9A 3IUJA 3PVSA 2VJQA 4CF3A 1YZ3A 4F6RA 5DPMA 4Z53A 5ITVA 5TQ2A 1VLZA 5GIOE 4ZOLB 2R8RA 5IBRA 2ORED 1TM1E 1DSSG 4LHVA 4AICA 3GJZA 1XZGA 1N2EA 1W88A 4OH7A 1WCWA 5ERYA 2R1TA 3LOQA 3AP3A 4BVFA 4EGQA 1CEYA 2QRMA 3F4KA 4AMUA 3LBAA 3KTOA 4FQ8A 4MW9A 3T7JA 3HDTA 4YDSA 4HEHA 3LU1A 1EK1A 4C03A 4M4SA 1I33A 2H2DA 3OTQA 5CT6A 4LYDA 2YKGA 1O95A 2CFSA 2RGXA 3KJFA 3OSZA 1OA0A 4S2EA 2PNJA 3ZKAA 1QYXA 1GTG1 2XRYA 3B52X 3ILVA 4TL6A 2WWRA 5IYZA 2F90A 4MV4A 4ZDWA 1YGPA 1SVNA 2FK8A 3BB1A 4Q03A 5GADl 1BXRB 2A0UA 5COBA 1LH0A 4UNPA 4D5GA 1AZSC 2AN9A 2DC1A 2G9QA 4BVEA 2X5XA 4CLRB 3G23A 3RYHA 1OR8A 2CDRA 1CQZA 1OBVA 4KK3A 1O96A 1Z6XA 3PXDA 1GKUB 2HMAA 4MWOA 4FB4A 1Z4PX 1P6UA 2DSNA 1DO2A 3QUSA 4MRPA 1SCBA 1O94D 1BEEA 5H82A 4GKJB 4E5NA 1KMNA 3G0BA 2PSEA 2IPLA 3BWEA 2G28A 4J9UE 2B78A 3ITKA 1OH6A 2C3UA 2OZEA 2J4DA 3ESYA 1NVMB 3FRJA 4KNVA 4EPWA 1K8YB 2AFHA 2OBFA 5G4KA 4BNKA 3W2EA 4DRXA 4FK8A 2WZCA 4PCAA 3DLBA 2X15A 5EWJA 1GGEA 2JLBA 4HYEA 2AK2A 5FR1A 3WB9A 1G3UA 1U7WA 5SY9A 3GLIE 1FJ2A 2TMGA 3H1BA 4X64B 1XK7A 5LU8A 7ABPA 1SZPA 4MX8A 2QR5A 4X9XA 3I0NA 3UYLA 1HDZA 5KYYA 4PZCA 4G56A 3NXKA 2PZLA 3PC8A 4WGGA 1FP2A 2JBHA 2A0YA 4TSKA 221PA 4F60A 1JILA 3L8MA 3QNWA 1E1KA 4RACA 2FN4A 3AR5A 5B2EA 3RGWS 1KZYC 3GLHE 4C3UA 3AV3A 1XQVA 2P68A 1KHTA 3ESAA 3OU2A 3QPCA 3RV4A 2WJGA 1UFKA 2X3FA 1QDLB 2ZRAA 1ZL2A 4I55B 4WINA 1EFAA 3VAZA 1IPHA 3PE3A 1CUUA 4V0KA 3T3DA 3RW9A 1YONA 2VQ3A 3PWKA 4UOEA 1TM2A 3TCKA 4GE0A 4L8LA 1T6YA 2I1VB 4FNAA 4PYMA 5KYKA 4JMPA 2HGSA 2IXAA 2O06A 1W46A 4DREA 3ZXXA 3S2IA 2XE6A 2D62A 4G5YA 4GWKA 1F60A 4JC5A 1ND6A 2HEIA 3BM5A 1TLTA 1T0HB 3OPXA 4GKBA 3CNQS 5KKAA 2AGVA 1YCGA 1VLVA 2VBFA 2X9NA 1D2AA 1BGVA 1TVEA 1X86B 4X91A 2XDQB 2JVJA 1CS0B 1RPAA 1WP9A 3RKRA 3HDYA 4MVJP 3KQTA 2DPYA 4AY2A 3OUZA 4X44A 4OQLA 5T4EA 1YZNA 1CQIA 1VJCA 2HX1A 3NHJA 4NE7A 4J16C 3ZGZA 1F3LA 2QI9C 1BAPA 1ACMA 1KI6A 1H65A 2O8NA 3ZI0A 2Q3FA 4HRAA 4P0TA 3CE9A 3ROKA 1YQ9A 4EZIA 1CLUA 2WJPA 1UUFA 2QY6A 1V5EA 3GRRA 4XX1A 5A7FA 2QTVB 4G8CA 3IKTA 3K0AB 3K72B 3OA2A 4LYGA 1GG9A 1QS0A 4E5VA 4NBTA 1N2JA 2AR7A 2DPXA 4RAOA 3W2IA 1YKSA 4NY1A 1K8RA 4EZBA 4QTTB 3EQ2A 3VAYA 5CIYA 2AZTA 3GFRA 3OO1A 3QW4B 2WUEA 3T54A 3RJ9A 5AI4A 4LYEA 4KZKA 1HMPA 2Z1MA 2AH5A 4EG1A 1H0RA 1E3IA 3VH2A 4EJ6A 1TUIA 4YH1A 3KDSE 1HZJA 5CYOA 4MKFA 4DTIA 1T0PA 5GPBA 1JVSA 2VNHA 4RHFA 2AOWA 4ENWA 4ZI2A 3TR0A 1M3SA 4C88A 3JYHA 4UDOA 2JANA 4HH0A 4C1NA 4HAZA 2A58A 5H68A 5TV2A 3DL4A 4C7OA 3GARA 3JARA 2E4VA 3K92A 1ZUD1 2EYUA 4NS1A 4N5MA 4OY3A 4F6RB 1P77A 2RGBA 4PZ9A 4XPIA 2OG2A 4S3MA 5TC4A 5J2TA 1U31A 2WK1A 3RQIA 2DR3A 3KHTA 1PVDA 4K26A 1D1QA 1KAQA 4DSNA 3JYNA 4JP2A 1BHO1 5DYNA 3DMFA 1KFCB 2NXCA 4BLQA 1EX1A 1V9CA 1ZQ9A 1PJAA 2FPXA 2Y1KA 3I53A 2B21A 4BWFB 3DFMA 3WRYA 5AI8A 4LY9A 1WLSA 3G8AA 4BZWA 3PFFA 1XC7A 3B1ZA 3P0JA 2IZ5A 1E2IA 4KXXA 1DJOA 2RCNA 3FDXA 4RNDB 5DEOA 3W79A 5LYJB 1G5TA 4QYWA 1KK3A 1V5FA 1XF9A 2PD3A 1UK8A 4YMHA 4ZCIA 5JH7F 4NLLA 1XDGA 2W2LD 5B3LA 2E87A 2WIDA 3VH1A 2XQVA 3LQYA 4PLPA 1ODSA 1YZFA 2F6RA 4Y9DA 4ZVNA 5TARA 3R7NA 3WYGA 1HTWA 2WSBA 1RJWA 2ADFA 1PFWA 1QK4A 2MSDB 4LGVA 4I46A 4NCBA 2GZMA 1M0WA 1RYFA 3D81A 2D13A 5EXTA 4W63A 4IOKA 5F1PA 3B8EA 3RRNA 4EBFA 2RBGA 1SCUB 4F7DA 2D74A 1E9FA 1KAGA 4PFSA 3ZVLA 2XXJA 3HWRA 3PCTA 4BNDA 5I7FA 1HYBA 3VYSB 2PCLA 4L57A 4OVKA 5DBFA 5DCYA 3TTYA 2AKEA 1NDUA 1Y3IA 3EX7C 4KTTE 3U13A 3MM4A 2Z5VA 4BLTA 3ABRB 3DHEA 3BPSA 3LLMA 1TDJA 3ZHYA 4KQXA 2HUNA 4MDEA 1SBTA 3HYLA 5SYAA 2VYCA 4DZRA 4Q4LA 4QGBA 3P4UA 4TL9A 5EE9A 5K7SA 1VLHA 4TQAA 2F3RA 3WL4A 2G71A 3PPIA 3U3RA 3H3JA 2EQAA 1RWWA 2N42A 4KWTA 4ZARA 2HUPA 5HKBA 3GXBA 4M3NA 4PLVA 4U7JA 3U44B 1E9VA 1OFTA 2XNSA 2YXNA 1SQ0A 1WUIS 2QJTA 3Q8WA 3K5PA 4BXOB 4C87A 4DA0A 1EJ6A 3AU8A 1U65A 4CT0A 3W8FA 4B0PA 2YX1A 5HE8A 2P41A 5T6MA 2J0SA 4B34A 3KYIB 3DLAA 5C5CA 4EY5A 4L9SA 2WE7A 1VBFA 3L6UA 1WUHS 2QJOA 3EXHA 3IILA 4FDLA 3WKAA 1NRXA 1PJBA 1NN5A 1T36A 3CUEF 3KYDA 5F4ZA 3VO1A 2JA2A 4QYSA 5F9FA 4B6PA 1MJFA 2A1UA 4WOJA 1OGIA 1SN7A 3MOSA 4Q3KA 4ENVA 4DCMA 1AKNA 3O8NA 3LKDA 5JJBA 2H54A 1EX7A 1IZYA 2W6JD 4Z4IA 6NULA 1SHKA 1EVIA 4U7PB 3V8MA 4GC9A 3ZWYA 3P9YA 1AGYA 1DBVO 4O0LA 4ZOLF 4FDAA 3STTA 4KE7A 1OAKA 1WBBA 4F3KA 3DXZA 1V5IA 2G82A 2QJFA 1OFHA 3LBIA 4IJQA 4UATA 4X61A 3UT0A 1TF7A 2UUBB 4NWIA 3OQBA 2BEWB 1JFSA 3CISA 4AWXA 3C3CA 5FBLB 2JI9A 2R751 3RC8A 1NXTA 3RVOA 1GPNA 3G2NA 4YJFB 2PVCA 2DUMA 1P0IA 4NAUA 3WTCA 5JSHA 2G7ZA 4GI5A 3LOPA 1VI6A 4V24A 3I62A 1USWA 1E9BA 1D09A 2CL6X 4FOLA 3R1IA 4K86A 3EOBI 2QRNA 4QLBA 1XKTA 2BFDB 1WW3A 4C7JA 1VZ2A 4XIFA 1KKMA 1DWQA 4KVAA 1MEEA 2ZBQA 1YB1A 4NCAA 3DDCA 3OEHA 4IOMA 3SZGA 4H4EA 4M0UA 2Q3MA 1B4DA 1TD1A 1JYEA 2R6ZA 3ZD9A 3S7ZA 3ZDZB 6YASA 4RVHA 1A1VA 3JQ7A 3PV0A 2IPOA 3KQNA 2AW3A 5THXA 3HLTA 2ZR8A 5BSFA 5AUNB 4ZN6A 4KH0A 2JGRA 2Y0PA 3PL5A 1POWA 2XCLA 1RQPA 3RUIA 2GBGA 2WVAA 5K3SA 4KGVA 5L95A 2HCJB 5B6PA 3CXRA 1OIWA 3RTBA 5JMTA 4RVOA 1EFKA 3DT8A 3IP7A 3QFCA 1Z0IA 4WCFC 5DYTA 2PJUA 1L7BA 3URKA 5L53A 1THZA 1Q14A 1UP4A 3DBOB 4P3PA 2UYGA 3DE5X 4FZRA 1EVZA 4GZ3A 4P3NA 4RGYA 1XL0A 2V54A 5CB4B 1PW7A 3NTUA 1KZHA 1T13A 4OK3A 3IEKA 2XCTB 2HSGA 2YW2A 3RS5A 1ZM2A 3HCPA 3IAM6 5BUSA 4IX9A 3N74A 2CJYA 3K1ZA 1CUIA 3AI3A 3TLCA 3C6BA 5JJIA 3PFHA 4XGNA 3AKEA 4GSLA 4NEHB 1BWQA 4ZZIA 1TT7A 4MXDA 1OH5A 4BCBA 3FMOB 3QEMA 1FMCA 2XMCA 3C98A 2WM8A 2JGLA 2PEYA 5IJWA 3GCDA 1VFPA 1XA4A 5BSWA 3EXIB 4WBNB 1NVAA 3AR3A 4HGQA 2LKDA 1W9MA 5FTMA 4XWYA 4QBHA 3ZBUA 1FYVA 4YJHA 3HU1A 2XMZA 2REBA 4I55F 5JU6A 4CODB 5LOVB 3W2HA 4KACA 1QQAA 1E5LA 1QC5B 2O5VA 3PS9A 1LCIA 4NOJA 5L3ZA 3GA0A 3CLSC 2VT6A 3EZ6A 4Q1VA 1J9GA 2PMBA 4DANA 4J03A 4OBEA 3G68A 4FFOA 1Z4OA 4KR7A 4FWBA 3RHFA 2ZRNA 3NWBA 3U39A 3ZHSA 3SYTA 2ZWOA 3MJFA 4D43A 1OXXK 1X1RA 4ZALA 3X0DA 3FPKA 1AUOA 1AA9A 1ISSA 1F0KA 3ITNA 3LFUA 1GPWB 1RHQA 2HYDA 4EPYA 5F9HA 2P9CA 4HGNA 3FW1A 4EG0A 1UJBA 1X80A 4LXTA 1IY1A 1A8QA 3EGCA 5DTIA 5KX5A 4ODIA 2FX3A 4XEHA 5IT0A 2XRZA 4BNJA 1GR0A 1IIBA 4CKBB 4FONA 1XQYA 3SVTA 2K7FA 3H5LA 4FW9A 4QU8A 4CL0A 3GLUA 1GP2A 1XD9A 1OC2A 4JMLA 2ZJBA 1VJTA 3FTNA 1C3XA 3OPYI 1GVHA 1PR5A 2CK3D 2HNAA 3TQOA 2PX6A 5KKNB 3O95A 3OQHA 4LDRA 1I4OA 4AX4A 5K09A 1SC1A 4ZJPA 2YS6A 3JRNA 1G8SA 1IPFA 5DSXA 3G8DA 1FVHA 2PFGA 2Y1FA 1PVVA 2C58A 2V3VA 3QVWA 1P0QA 2J5XA 3L8CA 4JC4A 5HPYB 1QZTA 4IM7A 1U0TA 5DXFA 2ZTUA 5JNRA 1WUKS 2GZRA 4RADA 1TM4E 5P21A 3IAAA 4FKZA 5HJ7A 3RABA 3I5AA 1KSHA 4PAQA 3OT1B 3QVXA 3QTLA 1JU9A 3KZ1E 4ITRC 3DULA 5ALDA 4BNVA 2W0MA 1G5PA 1CJCA 4X66B 2GILA 2LDBA 4MVWA 2XKJE 4G37A 3ZWKA 2R00A 2ZI6A 4GIBA 2O5CA 4OSPA 2H51A 4IIVA 4YV0A 2BDUA 5GWXA 1KOLA 4ZVLA 3OJXA 1SH7A 3FD8A 1CFZA 1M1YB 2ZYGA 3UK7A 1AHNA 1MVOA 3CM0A 4M36A 2IS4A 2Y92A 3ZX4A 2TRSB 3I37X 3CX7A 3OJCA 4FYJA 4QVKA 3S27A 4PF1A 2E4YA 1U2GC 2R6AA 1BX1A 1C3OB 3N7TA 3HCNA 4INZA 4WKGA 1HE4A 4TTAA 4XQEA 2OR3A 2QZPA 2M2IA 5FFNA 3KSDO 1F5NA 1Q0SA 2YHUA 3ON5A 4DDWA 5ESRA 3AERB 4RPIA 2C92A 3EXFB 1IUKA 1OFUX 4C76A 2PFSA 2A5JA 4PRLA 1VKJA 3JSAA 1RW4A 3ANSA 1EZZA 2GFHA 2Z5GA 5CM8B 4ERNA 5AW8A 4ZRNA 1L8OA 1JNXX 3NAQA 3BZWA 2P9FA 5CTJA 4CMEC 2I29A 5CB0A 5C8XA 5LYJF 1JT9A 3DPIA 2O8EA 2GWRA 2E18A 4FFWA 3COVA 4XEUA 4UAGA 2FW1A 3U09A 1VKNA 1X94A 4PHFA 1IBCA 4INOA 2IVZA 4IWNA 3RE1A 1EHIA 2AOTA 1NZFA 4F56A 3NDPA 3DDNA 4HY3A 3OAAD 4JR0A 4RTNA 3EUAA 4Z4FA 1HE2A 3ZKWA 2FR8A 1AC5A 3NO4A 4JSTA 4R05A 4TT3A 3VO9A 1M6YA 3N6XA 5FI1B 4D0SA 3FNHA 2YFYA 1RC1A 1W4CA 3C5WP 4TMVA 4YJ2B 4GWGA 3CWQA 4A27A 4N3BA 3JXEA 4K8OA 1EINA 2EKLA 4IVPA 4Q02A 5HCNA 4Z9FA 5BR4A 3CG0A 1PX2A 4CIVA 1VCHA 2ZIZA 5HBGA 1O77A 2CXHA 4IHAA 4YACA 5FFMA 2AFIB 2NUAA 2ZTLA 4HYQA 1ZK2A 2GDZA 4R9RA 4IMIB 2WWVD 4DJTA 4RKRA 4XLTA 4LYHA 2G36A 3MWLA 3W5SA 1HZZC 1BJKA 4OMUA 1BGXT 3MGKA 4Y0AA 1ZHOA 4FFRA 1CT9A 4TMWA 2WT4A 3AR7A 4RL6A 3W34A 2X86A 4OB7A 1ZCAA 3QG5A 2I6FA 3DW3X 3ESBA 1PT7A 4ME6A 3UFXB 3ZGOA 2O8VA 5CGQB 2PL5A 2HQBA 1E0KA 4QT0A 1U1GA 3OBIA 1S01A 4XWAA 5H80A 2VJMB 1JKMA 4CL8A 4N03A 1YL6A 2OSVA 4IGKA 4NX2A 3KX2A 3QVSA 4ZKEA 2J5KA 1RHMA 5J59A 2ZUTA 4BY9E 1VI2A 2DFNA 1WTCA 1WMFA 2J32A 3I1IA 3CUUA 3A6HA 4ZA2A 5U4QA 3TI7A 4C5AA 4IRXA 3HM2A 4MQFB 2X5OA 1T2FA 3QJGA 4FQ7A 1AQIA 4OQMA 3SYRA 4NMXB 4YRRA 3O21A 4X94A 3RS7A 2H4XA 1P4RA 2OVBA 5EGSA 3WQHA 5GZ3A 4P9NA 3ZDYB 4LHZA 1P3JA 3BL8A 3MB8A 3BERA 4XVHA 5EJGA 3ZE1B 5SZKB 2BGGA 1K2WA 2AVDA 2YWHA 3HSYA 4OJMX 4F4JA 1EFDN 1OKKA 1V26A 2XRMA 4HWKA 5IM4A 1Z83A 1R0YA 3BWBA 3U4IA 3IR5A 4XIJA 2R66A 2DQ4A 3KHUA 3FGNA 2CDBA 3GUZA 2GK7A 5T3UA 3CUTA 2CNOA 3A9TA 4A36A 3R9WA 2UYOA 4B46A 2QS9A 3FWYA 1IE3A 5BMVB 2V4UA 3FWNA 3U7QB 1YR8A 3G9UA 2COEA 1GGFA 1L3IA 1X3SA 3AXTA 3FJYA 4QPDA 2R8ZA 2QGZA 5H8WA 4UZFA 4A4DA 5KMGB 2HA7A 2ZIUB 5LMZA 3P9PA 3T8YA 2FQYA 3EQ8A 3PC6A 2RARA 1CU1A 4PTLA 3TTXA 2Y1XA 4UE2A 4Z1MA 2HF8A 5IN4A 4RTMA 4CU5A 1YQEA 3TLXA 2J45A 3U4GA 2QENA 4DNQA 3HNOA 4I99A 2AN5A 5HGJA 1C0PA 1PT6A 4IL5A 3R0VA 3ZUPA 1BGWA 5D1HA 2LE0A 1C0IA 1H6AA 2QQ5A 1XL1A 2HDHA 2FWRA 2WDZA 4LWQA 2CCGA 1W5BA 1ZN8A 1MO6A 4L27A 4U7TB 4V0OA 4ZO4A 3LCVB 2JLXA 1VPEA 2GB4A 2BR3A 3NRCA 1K7EB 3W8NA 2H65A 4ZHQB 2FFJA 4LBYA 4RTJA 1C7QA 1VPDA 3EVGA 1XWWA 2BEVB 1VDMA 1CF9A 1YA4A 4CGZA 4G0MA 3WYFA 2YZGA 4EG5A 5ER6A 3U4QB 3LPMA 2QMZA 3ZLJA 1R0WA 3C2QA 5LXTA 4EQZA 2J1LA 1JAIA 2IYAA 2KLBA 2VA9A 3HYRA 3PICA 4JOBA 4B3HA 1LDGA 1TKCA 3OPVA 1OYVA 3M4JA 3E6AA 5INTA 2XT6A 3OCJA 1LK5A 1XKLA 4J1NA 5IDYA 2W90A 2JKZA 3J81k 1OTXA 4MI9A 1US8A 1UFOA 4WCVA 5CB4F 3LVFO 4YCAA 3KEOA 5KPDA 2QX9A 3AFHA 1I6KA 3ANNA 3PQFA 3RVSA 1F7VA 1RS0A 5MDHA 1L5GB 2NIPA 1TM5E 4ROTA 4DV7B 2WY2D 1JIUA 3EZLA 3FOBA 1X39A 3H97A 4HWOA 3T7DA 4LQLA 5IASA 1ZD1A 4IHJA 3PK0A 5C1DA 5CDTA 1QVAA 4PYKA 5ECYA 5HFNA 1H3NA 4C0SA 2HIMA 4BLSA 4K40A 1R9GA 2CLCX 3E5HA 3T35A 4GKAA 3MSCA 1AHIA 4JLNA 1MVNA 4YFVA 2GEJA 3UHFA 4RVFA 3VHRA 4WBNF 3ZJ5A 4EWLA 1R8SA 1N5JA 2I3BA 1QKJA 4FCTA 4OBWA 3DH0A 2YN0A 1W2WB 3O38A 1XCGB 4JVLA 3TZEA 1SPBS 1NA5A 4UBMA 1RP7A 5LOVF 5AVYA 4CDMA 4JVSB 5DASA 3V1TC 1KI2A 1ZIPA 1KEEB 5FOUA 1JA9A 1ULTA 2OK7A 3MB5A 1FU4A 3WGZA 4B32A 1WXIA 1VE9A 4OUDA 5D3MA 3RUDA 3RAPR 1MHTA 1F2DA 4AKSA 5KVCA 2QT0A 5CDSA 1KTVA 3FXAA 4D1YA 4PRZA 2RK6A 4Q4JA 4IIEA 2FN7A 2FR0A 1QZUA 4WASA 4R3WA 3PEUA 3DMHA 2C78A 3BILA 3OQ6A 1ZM7A 5DTEA 5AT1A 2AFHE 4R8MA 4BBAA 4UMEA 4DLSA 4MQ6A 2ATXA 4JWKA 2JEYA 1X7ZB 2CMDA 2A88A 3FKSD 1ZO8A 2PY6A 1LDEA 4FZJA 2ID4A 4XVCA 1LSOA 5IEBA 3Q8KA 3FMGA 4DAOA 3QU4A 5AK3A 1YCFA 5EKUA 3LC2O 2BEJA 3K0HA 2GN9A 3TEFA 4LV6A 4B75A 4ZKDA 3DG9A 3PQ3A 5JNSA 1G64A 2C7BA 4EYOA 3RQSA 2GTIA 4MRVA 1JJBA 3IEUA 2DETA 3N3BC 4E30A 1X7WA 1JTEA 5DCLA 2R25B 5BQFA 4MGEA 3WMWA 2AJCA 2EX1A 2Q1UA 4KNWA 2IY8A 4ACAA 1XPRA 3UJ9A 2PBFA 1U4OA 1XNHA 3P2EA 5AW3A 2G4LA 2NAFA 2C4TA 3AVQA 1W36D 1CB0A 3D0OA 3ND6A 3SZOA 3UMMA 2P9YA 1M5UA 2I8CA 1BW9B 3N2KB 4Y6LA 2WP0A 3ZGLA 5AM2A 5EZSA 4DHWA 1S8OA 4MWEA 2Q62A 4XRRA 2J9GA 4HEQA 4M7PA 4WKCA 4TWIA 2P11A 1PR3A 4EZEA 4LXHA 1SOWA 1T9GR 2WF8A 2YOHA 3HCDA 2V96A 2XPCA 2FZVA 3OZVA 2Y2UA 3P71T 1PTKA 5CHEA 3TR5A 3H99A 4A1OA 2RHMA 3DFKA 3A6FA 1PTJA 1VYVA 1XLUA 2F64A 1W8IA 3AKYA 1GL7A 3G0OA 2G9NA 3U1VA 2FSHA 4CMCA 5A6SA 4EFKA 2O8CB 2FWJA 1GGVA 2NVBA 5BWLA 3IUMA 3L43A 4JOSA 3ANLA 1G5IA 4JLPA 3UH0A 1ABEA 4F46A 3RS3A 3OIWA 1HDRA 5I9IA 3C87A 5CVJA 1GNVA 3R3YA 4Y2RA 4BYGA 3TOZA 1EUZA 1Z25A 3HCFA 1FF9A 1B3RA 4CI9A 4KW7A 3IH5A 2J31A 4QRIA 3O4IA 2FPIB 4S05A 3ZIDA 4N5LA 4R2LA 1YJCA 2A1IA 2FEMA 3O8CA 4AJLA 2EERA 2ZI7A 4L72A 2AK3A 3CY6A 3IE0A 5C8ZA 1ZMXA 1GGJA 2DKNA 1ZCFA 3A26A 2QBYB 5C46F 4OREX 4D3YA 2B92A 2G88A 1WSBA 4MO2A 5F4BA 3KQYA 1H2YA 1WVIA 3CLSD 5T41A 1ZWLA 1LXCA 3QYFA 5LMNB 1GDDA 4JL6A 1RJEA 4M0CA 1MT3A 3T3GA 4MR8A 4E2ZA 4MKXA 3AKZA 3DD5A 2YC4C 1V7QA 4YJ2F 5B3KA 1ENZA 4DJEC 4KQ1A 4QHYA 3TR6A 3JQFA 5K8LA 4RZUA 2XVAA 1QPBA 2XAAA 3FJOA 1PRYA 3K6SB 3HJAA 1E9DA 4Q4DA 1L1EA 2Q6LA 1MC8A 3LWDA 4JGIA 4KXVA 5JJCA 1CEEA 3KM0A 4NOKA 4ZD6A 4MZXA 3D1JA 5KJEA 1GWNA 1G20B 4Y1RB 4A0SA 1W0CA 5LBIA 1A8IA 1P4AA 3H4MA 1T1JA 4JBXA 1P9RA 1S2OA 2IHZA 1IEVA 3K7EA 4G0ZA 1K3TA 1Q15A 1USGA 3GA5A 3JWPA 1BWRA 3EOZA 3ENZA 3K5IA 4HQKA 1IQUA 2WD7A 3EJ6A 4NCJA 4RK0A 2DPGA 1GKKA 3VPCA 4NBLA 3CR3C 1SVOA 4B4UA 3C15C 3KT0A 4X00A 3EWNA 3GJ8A 3GLTA 4XOIA 5IFLA 4MK4A 4TZ0A 3N7UA 1ZM3A 2DSTA 1HEIA 3SZRA 2GO7A 1F6DA 3B20A 3R6GA 5BW5A 2O7QA 5JQGB 4PPFA 3ZK9A 2IX3A 1NMYA 3KOYA 1FCJA 5J63A 1A5AB 2R84A 3O8QA 1ZPDA 4I1RA 2VATA 2CNLA 5A71A 3N8NA 3VYRB 1YZVA 4LYAA 2UZAA 3DLHA 3NXSA 1NUHA 2XWPA 3V80A 1M0SA 4TTSA 1LPMA 5EP2A 4CFZA 1NNEA 5C53B 5JZOA 1EFPA 2XBLA 3IAM1 4JY7A 4IG4A 2OE2A 3RSSA 2ZVJA 4W9MC 1PYGA 1DS6A 2IY7A 4RDIA 4F11A 1EGVB 1K92A 4J9VA 4IDNA 4TXHA 1DC6A 1K7XB 1QQ5A 1W59A 3QELB 5AI9A 1HTBA 4QBIA 4JP1A 4Z9AA 4BFVA 3S8YA 2F2TA 2O2ZA 1DCMA 2GMWA 3ZDRA 1D4AA 1NONA 1Y6QA 3IHLA 4FGLA 3LT2A 1SWVA 2PZKA 2WTUA 4O4LB 4OX9B 1F38A 1RWPA 2I6GA 2X5NA 3GJTA 4DR4B 2UVPB 3D4OA 2W98A 4L4RA 4YIKA 3F3SA 3SU8A 1K75A 2M6RA 2H1HA 3TSOA 5D01A 4PLFA 5BMVF 2Q28A 3PDHA 4HGOA 3Q9UA 4EO9A 3H1PA 3T9EA 1UJ5A 1G9SA 1UPTA 3CF2A 3NNDA 3LC0A 3U0BA 2RI6A 3LUPA 1GPAA 3E58A 1X0XA 4JQOA 5LWQA 4W1PA 4C4RA 3NEAA 2PLNA 5CLLA 5MFPA 4QDTA 3LHIA 4ZHSA 4PZZA 1WMSA 4JROA 1X19A 3R0ZA 5AVZA 1CETA 2F1IA 3C6QA 4GF5A 4X1KA 4R6WA 2XEDA 3A1TA 4P83A 2K7ZA 2PZFA 4HXYA 3QFTA 3ADDA 3HKDA 1FFEA 1Z75A 2Y0DA 2B37A 2D3WA 4GX5A 4JVMA 4K2HA 3MJVA 3RM3A 1N1GA 4ZHQF 3COWA 4Z4GA 4NSNA 1W44A 2VCHA 3AFOA 2VPQA 4PGFA 3C8HA 5FPSA 1I13A 1XRPA 4RLQA 1GL3A 1KE2A 1JDUA 1Y37A 2HBZA 3MBIA 2AI2A 5EQTA 3TAHA 1EJ2A 4OFBA 1XPJA 4DIBA 2ZE7A 8ATCA 2FEXA 1AMUA 2R79A 1UJ6A 3EPRA 1HPLA 2XIQA 1T4CB 1WKCA 2I80A 3SLKA 1KDYA 4EGJA 2CXSA 4CEJA 1Y34E 3AHEA 2NQTA 3WDMA 2JRLA 4RJLA 4RW0A 5BOSB 2NO4A 4ZC8A 3REQA 4BL5A 4BX2A 1AJEA 2AKAB 1FRQA 3GL9A 3Q7QA 4MUYA 1JU4A 3N8KA 2F8LA 3GGDA 2BAGA 4FOTA 4HVTA 1OI4A 4ESEA 3PDJA 3GZJA 2GN0A 1BYIA 3KOMA 2IE0A 1OH8A 4WN9A 2ZK7A 2C98A 1KR2A 1OH7A 1CY6A 2QX7A 5TT1A 2GD1O 1LX7A 3BA6A 3AB7A 5CT4A 2LNDA 1XRMA 9MHTA 5AXAA 1VP3A 1ZVJA 3R77A 1JG4A 1E2JA 2NNWB 4BJ1A 5IJZA 3DUFA 3IQFA 3PI6A 5B64A 1DX6A 3VDNB 3SQWA 2ZM5A 1DAGA 1T5TA 3L7DA 4OA8A 4N12A 4LRTB 1JZSA 2IX9A 2JJ8A 2MOKA 3D4PA 2LIPA 1DC7A 3C1AA 3DPSA 1F2UA 2EFGA 3FLBA 4G4SP 1RC0A 3TG2A 4RA6B 2D2XA 2GSDA 3H2KA 1RJGA 4FYVA 1SUAA 1TT5B 2PUHA 3W2FA 4YXFA 3EK2A 2WQ6A 2EKBA 2IDZA 3DWEX 2AJBA 3MIIA 1NOIA 3AR2A 3MTEA 3QRWA 4MS1B 2AEEA 4PR3A 1D4FA 2W22A 3GRFA 1PHRA 4OIMA 2X22A 5C81A 1QHEA 2N47A 1ETUA 4Q05A 1R6XA 1PYDA 3CC8A 5F2EA 1ZHFA 4N3AA 5EPEA 2X9LA 2IYTA 1PT5A 1CJUC 2W93A 3FF4A 4D0GA 4EOGA 5BYJA 1YQTA 3MMXA 1YACA 1E2LA 3DM5A 3GZTB 3KXIA 4V3BA 3RU3A 1M75A 2UXDB 1XRRA 5JZ9A 2RGNA 4JR2A 3IUSA 5MGNA 2ERXA 2AKYA 1QIJA 3GCZA 4I4TB 3K20A 1CK4A 3FPHA 3JTMA 2GASA 6Q21A 3ONWA 1H4QA 2ZB2A 1G1AA 1M7GA 5LQDA 3PLAE 1FFBA 1E8NA 2IZZA 3E1KA 1KH2A 4D0LB 1VPWA 4IXMA 1Y1TA 3KEFA 2QSUA 1P1HA 4TRJA 1XEXB 3DV2A 4R98A 2XA9A 1AOXA 3TMYA 1RRFA 3A7EA 1NLUA 1QHGA 2HU5A 2DR0A 3RUAA 2XR1A 2B0CA 1TFRA 4R68A 1NSTA 2NU7A 2QL9A 3JTEA 1NUUA 1P73A 1W49A 4QFMA 4EY6A 4CCWA 1L9KA 2C9MA 3H2GA 4OFZA 3ZLUA 4BQFA 1A9XA 1KSJA 4KPUB 3FZNA 5AKGA 3WL7A 1A97A 3VPXA 3VNSA 1DKMA 3GJYA 5J58A 1FMLA 2ODQA 1S2NA 3IHTA 1FUKA 4HAYA 3BQNB 4URHA 1COZA 4WECA 5MFZA 3KR1A 4BFCA 2XDYA 2HWUA 3AEKA 3HA3A 4FNGA 4ECEA 1CR2A 1CJBA 3BXPA 1RVDA 4JX8A 1WPXA 3OFSA 2X0RA 2D5AA 3CF4G 3PZBA 2P9EA 1KOJA 2GHIA 3A28A 4NJMA 4MAMA 3BC1A 2DWUA 2ZPAA 3LY9A 4NFSA 3BRWA 3F7OA 5TS2A 4F06A 5CFQA 4MHOA 4WEQA 3TIFA 4Q15A 4E2YA 5BP7A 3NDIA 5FOWA 1N5MA 2VF4X 1B8PA 1JDBB 2GA9A 4FS8A 5BSMA 3RVMA 3O93A 3V8BA 1L3CA 4FE7A 4IFIA 1OQAA 4AO6A 4BGEA 3S8EA 2PRJA 1O9BA 4JVNA 4CLEA 1JDNA 5KSOA 3K09C 1LBIA 4LHXA 5TEVA 3IP3A 1TF2A 2G8LA 4KYTA 4U6NA 3MF4A 5L6MB 1RADA 1UBTS 3QWIA 4JJEA 4LRQA 1OYYA 1H6BA 3B1JA 4HNHA 1CKEA 4TGLA 5KQGA 3LY5A 2IH4A 2I7XA 3SVLA 4DNOA 1HKHA 4YRJA 2FVXA 1ADJA 2IDKA 4RPKA 3AOGA 3CWZA 4XQ9A 1JB1A 4MW2A 5BN5B 4A3SA 3BD6A 4B3SB 2K2WA 4MB2A 1MW9X 1NXWA 1SCIA 1JI3A 1IHDA 2NLOA 3GGJA 4QXQA 4RLFA 3VHLB 1VKRA 3IJ5A 2QU8A 3OP1A 4WLEA 4PO9A 3LUKA 3BFPA 3WRXC 4B4VA 3S2FA 1KORA 5K05A 5T4HA 2WB2A 3IAHA 2XE4A 3AFIA 3DQPA 4J2HA 4NF2A 4PLGA 1IUOA 4WZBB 4RY8A 3MAAC 2QZ9A 3P9RA 4EHDA 4A5SA 2BI8A 2J6IA 4J49A 4DQKA 2FDCA 4TQ9A 4W7HA 1OWMA 2UZ1A 5A4FS 5DWVA 4RCZA 3DZJA 3E5RA 4FD2A 5J2UA 3FUXA 1ZYUA 1B00A 1DAEA 1AKWA 1OU4A 3C6MA 3VSDA 5M5BA 1MIOB 4Q1EA 3THXB 5K3FA 4Z3KA 5FA8A 4KQFA 3HBJA 2D2IA 2A1TS 1LI4A 4BVKA 1JMKC 4EG8A 1E6EA 1TK9A 2CYBA 2W2KB 5JQGF 3CCCA 1FFXB 5CT9A 5G0TA 4FNMA 3B3AA 1AS0A 2YYSA 4KBFA 1E7MA 3IE2A 2NSLA 4GBMA 1VMIA 1G1MA 2JIMA 1TF5A 3M1LA 2Z3VA 3FVVA 1U7XA 2BKVA 2V7QA 4R6XA 5HG0A 3UK1A 3G8BA 2BHLA 1XD8A 2CVPA 3DTVB 4MHSA 4TTVA 5LZ7A 3DYVA 2IELA 2RC6A 3FBGA 1YMQA 3FMIA 3L0IB 3MC1A 1LTHR 4NU0A 5GJWC 2GPYA 3STVA 5LA6B 4BV2A 1EAYA 3EA5A 3QKRB 1ZWKA 5LQJA 2J3EA 3WQRA 1MOSA 3A6GA 3A11A 5IBPA 2ODAA 1V11B 1RKBA 3ILYA 1GAEO 4F4FA 4JBYA 1U3WA 1W87A 4EATA 1EVLA 4CFYA 3PWZA 1QFXA 3QFRA 1CPYA 4CCYB 3GPLA 3GEDA 3W9YA 4O4LF 5E4FA 2F43B 2YZ7A 4P4GA 4DV6B 3ECCA 5E38A 2HL6A 3IMEA 4RVGA 3GUCA 3OU7A 2GKOA 2R1UA 1VBKA 4H08A 3DL0A 3NATA 4KLNA 4Q7LA 3QE9Y 3MNFA 3CKMA 5L7YA 3WDSA 4CEIA 3UUGA 1JFLA 2NZ8A 3UMGA 1KKUA 2XVMA 2XT0A 1DC8A 2DP4E 1BKYA 4OHRA 4EG6A 5JSUA 1SOMA 1ZRSA 4C4OA 3DMDA 1VIYA 2AUTA 3ICEA 1NM5A 2CYAA 1JIKA 2FW9A 2IXTA 2IHNA 1HF3A 1FNCA 4TYPA 5CX1A 3I61A 3BULA 4UM5A 3BKWA 3E3OA 1DEOA 1B1CA 1FDVA 5A5FA 1QK5A 1MOQA 2DKFA 4M2LA 5TPWB 3TQRA 2HCFA 3O6VA 2ZT5A 3R24A 3WOVA 1F12A 5LQAA 3O03A 5KINB 3TE7A 5HDBB 1LC3A 3NCTA 4JZYA 3WMGA 5GV7A 1R6DA 2OCDA 4MW7A 3K2EA 3ORRA 4MKIA 3LAWA 4KR0A 4EIWA 3FOEC 1O0BA 4YRBA 2QE7A 3W3AA 4OK6A 1NVTA 1B93A 1GAJA 2C83A 3IRUA 3ETNA 3GGCA 1QLJA 2Y93A 3H2JA 4OAPA 4NV1A 4PBTA 3WK4A 1EUQA 1CRLA 3OIFA 3P0IA 5I7UA 2IY9A 3IL2A 1T5HX 1Q0ZA 1YS2X 5KYGA 3N2NA 4PM4A 1P74A 2PU7A 3WWYA 5HM6A 3T7SA 3DF9A 2Q5EA 1I6LA 2C96A 2FPGB 4TVOA 3EMBA 5DEIA 4ZRMA 3IC5A 2IIVA 3RK1A 2HMVA 3ETJA 4C7XA 2DKOA 4MEAA 4G1FA 3JQEA 1E32A 4LJ9A 1U3CA 4C7VA 3P20A 3EWAA 5HUQA 4OTZA 1JHZA 4UHEA 3ZWMA 4S1NA 3NHUA 2RGGA 1UC5B 5KC9A 1EE1A 1T26A 2C5SA 4RPGA 3R3SA 4BGVA 5K2OA 1PEAA 2QP9X 4N9WA 2BKEA 2IF0A 4G0YA 3BGSA 4LZZA 5H4GA 3KYJB 2FOXA 5YASA 3TIVA 2V0NA 4EARA 1U9IA 2PGIA 4GOOD 2BISA 4DABA 4YV2A 1F4VA 4EDHA 4P34A 5CT8A 4II3A 2AUNA 5KC8A 2X1HA 2POQX 2BMFA 1YB4A 1KQ3A 1NBOA 4U9UA 1WB5A 1DXYA 4YPOA 4I50A 5E0KB 3OT4A 4HDKA 1AKQA 4D4HA 3B53X 1WMBA 1D03A 1Q22A 1RQNA 3JQDA 4KIGA 4URXR 2XCRB 1RP1A 2FN3A 5JADA 5UKDA 1Z8HA 1N1DA 1YS7A 2FSSA 4GR4A 1G291 4U1RA 4GLLA 4MUIA 4YRPA 1HDEA 1NQAO 3EOAI 3IHKA 4CIXA 1O57A 3OZXA 2G9UA 3B9RA 3MXTA 4GBJA 4RESA 4DHEA 1FE8A 1NXQA 1QWOA 2GM3A 3NHAA 1U8EA 1Y3FE 2IOFA 4IJ6A 5GY7A 3UAZA 3A0UA 1QRDA 2HV9A 3KZXA 4BMZA 3D02A 1S6YA 5IVKA 3EXEA 4EKGA 2GF9A 1L5YA 4F0JA 2QPAA 2A5FA 3SKXA 1FU8A 1MQ9A 4KO4S 3RBAA 4MKRA 1RM4A 4GT1A 2Q3HA 5AIBA 1CS4C 4OHYA 3OMLA 1YRYE 4EG7A 1XCLA 2EV9A 2XB2A 2O1XA 1MQ8B 1H2HA 4LOKA 2VPWA 4DFDA 3Q72A 5EPUA 1OLXB 2YY5A 3L92A 3R0IA 1POXA 3R5TA 4MMYB 5E4YA 3FFBA 4MDYA 3FAKA 4BU0A 2PYIA 1ILWA 3RKSA 2SCUA 1U3GA 2DULA 3FFXA 4I1VA 2I33A 2XUZA 3NWPA 1N2CA 1ONNA 2N1BA 3PFIA 3IPLA 2GJ9A 3QE4A 4V2UA 2KM1A 4I4TF 1XDUA 3VUFA 5B6IA 1UJ2A 3AIMA 3G1UA 2AQ8A 2X8WA 4B82A 1A04A 1CEXA 3UAWA 1IQPA 1QCDA 3EIHA 2HJGA 1X1TA 5TDHA 4DGSA 3GZ4A 3KIPA 4CL3A 3T5AA 4FFNA 5JS6A 3F67A 4JCOA 4DIMA 5A5EA 2FPLA 3DBIA 4LX8A 4PPNA 3RLIA 3HU3A 4RCVA 1P2SA 1XTPA 2WI8A 3THSA 2Y9PB 3AX6A 4E3ZA 1WZCA 2VQFB 5EJMA 3RVKA 5K6RA 1OFVA 2DH6A 2B6NA 2V6IA 2HHLA 1CQXA 1JU3A 1TVMA 3FNEA 4L1KA 3P8ZA 3IAS6 3R7WB 4OKNA 2XXBA 2H5EA 3WIBA 2OT3B 2N46A 3ROEA 4Q4CA 3I2HA 1XTRA 2W4IA 1P3DA 5TQ2B 3FNIA 1CZUA 3NR2A 1K3FA 4PINA 3WGJA 3B9PA 1E3TA 5A2GA 5KBYA 3TO5A 3ZU4A 1CUJA 3EIUA 4H1VA 2X4LA 4WNAB 5FHRA 1W88B 1WMDA 1Z15A 3PUXA 1YRBA 3PBKA 2QTAA 5E9QA 5CFRA 3BZUA 4I4LA 2XUJA 2W0SA 4PN3A 3OIUA 2Q6VA 4XQGA 4O1HA 5JWRA 4TX1A 3MWJA 2FSFA 2Q3LA 3N2GA 2Q4DA 3SICE 2YNMC 4YRKA 4GZ6A 4G9GA 4MUMA 4KYIB 3AM1A 3E53A 1QK3A 2Q3BA 2VPYA 2ZRJA 4KIUA 2X1LA 3C3AA 4UUMA 2PUGA 5AR1A 3EDMA 4BFTA 4KQHA 2BL4A 3OKFA 1PL7A 1REQA 4L02A 3C8ZA 1GT91 2H2HA 1T1EA 4PPQA 1WXDA 5ELXA 3C3XA 3R8FA 4JKIA 4ZEVA 2KMLA 3DGFC 3VC7A 1G6KA 2JK0A 3H5WA 5E2IA 5HIKA 2XAUA 2YV1A 1XAHA 2ZBRA 5GVRA 5JS2A 4UE6A 1G2QA 2B7CA 2NXJA 2HPVA 2ZRGA 5DHQA 3CVXA 1DRJA 5C4IA 5CXQA 2CHGA 4RSGA 4DLYA 1U7OA 3WV5A 4Q4HB 1IPEA 1UDCA 4PBSA 1ETHA 1LW7A 2CL5A 3UK2A 2ZIXA 4LNUB 4NICA 1RWVA 1QOQB 2TMYA 2Q5JA 3MPUA 5HJ5A 2ZB3A 1UQUA 4DRXB 1C4OA 3I72A 1BJTA 3I2YX 4NBNA 2HIAA 2ZYVX 3LZCA 2OCBA 3TJRA 5KQSA 4MWCA 1PYOA 4E32A 4BRSA 3A05A 3OJEA 4D9JA 1ULSA 2ZSKA 2VHQA 4FJ0A 2V7BA 1U9CA 1SWWA 2IYSA 3E05A 1E7QA 1LA2A 2Z5FA 3U3DA 4BKQA 3WO0A 1YCDA 2GZHA 2CXRA 3CH5A 4KXQA 9ATCA 3F74A 1H2BA 4XOUA 2XOKD 1Z26A 2MMGA 3AV0B 3G0IA 1OIXA 3KJNA 4KWEA 3VDXA 1B8VA 4FDVA 4DLWA 3OM9A 5JR3A 5JLAA 4KR9A 5K0JA 2GHTA 1CJTC 2Y3IA 3E81A 4YR9A 4FYYA 1QLHA 2VK8A 2Z0MA 3FZQA 4K88A 4RDCA 1LLFA 2OHHA 3TK1A 3V5NA 2SKCA 1V5GA 1E58A 3K70C 3VR0A 1XMOB 3FFTA 2H6EA 5KTYA 4DEVA 2HAEA 4HQNA 4ZWNA 5JV5A 3EIQA 2WEKA 4BP1A 1J8VA 1XE3A 5LA6F 2ZG6A 1I3KA 4LBZA 4YS6A 3Q6NA 5AWFC 4B33A 4C0XA 3UG6A 2VF7A 3PFWO 3JQAA 2GXQA 3GCGA 2P69A 4OU5A 3VVCA 3B3JA 1ECBA 2YN2A 5DI3A 1AGNA 4FMBB 4AQ7A 4B4WA 5JJKA 4NYMQ 1X9IA 4RHTA 3VAAA 1GYRA 2QD4A 2RGAA 4L5AA 2ZUUA 1LV7A 2DECA 2BSAA 3PSAA 1YUBA 1GN9A 4O5OA 3DMYA 3LYHA 2RGDA 5JAIA 3KDAA 1UMCA 1EQUA 5FR2A 1G2PA 5FULA 3N39C 4J1SA 5K2MA 2JEZA 3AW9A 2N75A 3IP8A 3MWFA 1U7TA 4Y2XA 5EE3A 2FWIA 3MGGA 4H7KA 3W1WA 1I1OA 1AQYA 3U80A 1RYYA 4LVNA 1C7JA 1K4MA 1X8JA 2H8GA 1DEAA 1QIKA 1E6LA 2HSZA 2D2EA 3B1WA 3QW2A 3V3KA 4LOIA 3AETB 3ZI7A 3MD0A 3ZQ6A 5F73A 4NEQA 5KB3A 5KWJA 1OHHD 4Q7QA 1GUBA 1V47A 4G85A 1UBGA 1M0TA 3O8RA 1CUDA 1WXXA 5BR1A 2CLSA 1FYXA 1XKXA 1G3RA 4GLJA 1E6UA 3TVDA 3EMDA 1V8DA 1YRQA 2R4QA 4IJWA 3NOOA 4PS0A 1T0IA 4R8VA 4UE3S 4AURA 4R8LA 2QLFA 4AJ2A 3ETCA 4KLZA 4L95C 3O5AA 2P5UA 1U81A 4O08A 1Z38A 3RVQA 5HGXA 3HJUA 4FCWA 1HNXB 1U99A 3FROA 4ZVKA 1DKLA 3UK0A 3QBVA 4PSUA 2ZSEA 4RUKA 1RAFA 2OGZA 3ZDBA 3WB0A 2YYYA 2QT1A 1KRHA 3PXCX 3O8BA 3Q7EA 3W1EA 1HKUA 4PE5B 4JQCA 1V4BA 4HNVA 4QYXA 4Q16A 2O1EA 4PZLA 3GA7A 2JLWA 1WL8A 4EPXA 3JW8A 2H1CA 1G0OA 2BRUA 4C7OB 1B8UA 3I9FA 1SRRA 2B2CA 4UU8A 3UT5A 8LDHA 5LMUB 2G72A 4D9NA 4QOEA 1Z0JA 4WZAA 1MU0A 4A82A 3VA7A 4HX5A 1VCMA 1SHTX 3H1GA 2J08A 2L17A 5SZJA 1TGVA 2CE7A 1O54A 1RLMA 2AN4A 2C04A 1H66A 1MGOA 3OICA 5DHFA 2OFFA 5KAPA 5I4BA 3VH4A 1LQUA 1ZAYA 4IEIA 1CYDA 2RFLA 3CWCA 1KBZA 2FUCA 4AMVA 2UVDA 3AHIA 4K28A 3MLEA 4GMHA 2DHEA 2W6PA 4PU0A 4RF3A 5FBWB 2BFOA 4Q9IA 1WEHA 1AD2A 2M6LA 5AVTA 4RENA 4TVKA 2I4MA 3H0CA 5E0OA 3WLKX 1EFRD 2OQRA 3TL6A 1EBBA 4YASA 1JQJC 1X7YB 3D4IA 5D1NA 3J81A 3G2OA 1C1DA 1V4VA 3OTIA 1E2HA 2QX8A 3WLSA 3U81A 4ZDIA 3JATB 2JGEA 3RRYA 1A5SB 3V8RA 4WBSA 4DC1A 4PG7A 5AVQA 4S1TA 5ESXA 2GD2A 4D44A 4OEHA 5H4HA 5F12A 3KKZA 4H3HB 4IIJA 1NRJB 3FOCA 4RLHA 3GLRA 3JQBA 3RRJA 3HY3A 2IP4A 3M83A 4O8CA 3P9ZA 2FMIA 4DR1B 1SVMA 1M8KA 4JQYA 1R66A 4MQEA 3QU7A 4AJJA 4XE5A 1ARZA 5SYNA 2RG7A 4ILEA 2QVYX 1UBUS 4CQLA 2IYNA 2EL9A 3ZTYA 3FVTA 1G55A 3CGWA 1WXHA 2BFCA 5D5PA 4D9MA 3M81A 4Z0PA 4WMLA 1FPMA 5DNDA 5DSZA 1SXQA 2L42A 1DQRA 1OBHA 1WIWA 2OD9A 2OM2A 2Z3WA 2VUTA 3DCNA 3JZDA 3M6LA 4ICIA 5KYTA 2VAPA 5E7MA 3T5BA 4AWBA 1G21B 1IG3A 1V7ZA 3OY7A 1OSNA 5FV7A 3E9NA 2RHOA 5THKA 2C4NA 4R8KA 3REOA 1NSYA 1RRMA 4TWZA 4F4HA 1P19A 3BCSA 3PNKA 1ZW1A 1GKLA 3LBYA 3QYPA 4YUXA 2QUZA 4OYLA 3KOWA 2GHQA 4D57A 4U02A 4W1RA 1EFLA 3IPAA 1A7AA 4D3XA 3TGWA 3VR1A 3QLUA 3C4QA 3F4BA 5FBZA 3W7BA 2AHOA 2C2XA 2Y66A 4BV8A 1GDTA 3HO8A 3OE7A 3TSZA 3CTPA 2QW8A 4JNCA 5BWCA 3HMKA 3DGEC 5LLSA 5AI0A 3KYDB 2D5LA 2QMEA 4NYJQ 3D7SA 1GL6A 3RFTA 2EJWA 1LD3A 1ZH8A 3OX1A 3WGGA 3ZY5A 4PO8A 1RACA 3CPEA 4ZQCB 4KG7A 2HTFA 2HFJA 3ZCSA 2JGIA 4RH3A 5LKAA 4JB2A 3ESXA 5K03A 3HB5X 1U28A 4XLZA 4NYIR 2Z2ZA 5KI6A 4JYZA 4GMGA 1H05A 4D3SA 4HWGA 4IY1A 1L9XA 5IJ0B 2BUCA 3H9BA 4Q39A 2BUAA 3QPUA 2OC9A 3EGDA 2DF8A 3QLJA 4W5JA 3AHDA 3DZBA 2AN3A 1PIWA 1EVJA 3QMWA 3T41A 5K1ZA 2HDOA 3HABA 1EA5A 3FA2A 1P5RA 3HKCB 4R0VA 3D8BA 3X1JA 3BVPA 3HFJA 5JPCA 2EG9A 1O6BA 3CH4B 2HBYA 4RPCA 2AOXA 4FHEA 1E9SA 2GF0A 2YIMA 3BWVA 1PJ4A 2NSYA 3CQ9A 1A9TA 4I7EA 4P4SB 4WLFA 3RVPA 3FWZA 4L8GA 2ADOA 2ZXUA 4WOPA 4CM1A 5CVEA 4L75A 4ZVPA 2X2OA 5I7AA 2ORVA 1HT0A 5EVJA 2FRDA 3LXRA 5EMLA 5KDLA 1D2EA 5G0VA 4DSUA 4N76A 2IYPA 3TQCA 1AS2A 1RPZA 1U1DA 1QANA 4H3VA 1O08A 3OZEA 3JQ7B 4BUCA 5KNBA 1V8PA 1V9SA 2X8AA 1XMIA 2P30A 3R6DA 4A8JA 1HUQA 2WIAA 4ZAZA 1JECA 2IZOA 2X3YA 4OOFA 5FNVA 5BSTA 3TZKA 3UMBA 5J3JA 1EWQA 1WDTA 2DBYA 1PZNA 3GIWA 3EG5A 4UMVA 3L1UA 2PMDA 5G53C 5M3BA 1SK9A 4AP9A 4RGBA 2R60A 2WSSD 4LTMA 4PGHA 4NMMA 2GZ2A 3IKVA 1RC8A 2XW6A 5JW6A 1PZGA 4L2IB 4KQ9A 1BDBA 3A4LA 4XIYA 1RNLA 2FXVA 3ELWA 4G1BA 4PHGA 4R1MA 4XDYA 4ZYVA 4ASUA 4JXXA 5AHWA 3DEHA 4DYDA 2VG8A 2WYHA 2ZFUA 5BWOA 3NVKI 1ZAKA 4BN4A 5B58C 5IKMA 1A95A 1TTHA 4L76A 3JS5A 4HNRA 3LXXA 4YB8A 1UDXA 2CMHA 2H1SA 2VPIA 1SBZA 3LDUA 2HZBA 1DRVA 4MYSA 5CP8A 3ZN2A 2R6HA 4C0HA 3TQSA 1MH9A 1MQAA 1U5CA 2VDKB 2Z98A 3ACDA 1YS4A 2RHTA 1TZBA 2J3HA 1X15A 1CUWA 2FZ5A 3GBPA 4JBGA 4TLEA 4ARUA 4IF6A 1L5SA 1JT2A 3QLVC 5LJLA 4FGUA 4ONEA 4IKEA 4D4MA 4QG7A 5IULC 4IEEA 1RFGE 4ENSA 2PRSA 5EFOA 3CEMA 3SBXA 5AD1A 3D31A 1ECFA 2VHXA 4CTOA 4F2DA 2Q5QA 4GPIB 3PNPA 4HLNA 1FY2A 4UM9D 3PFKA 5H1YA 3R7SA 3VZSA 1UADA 2BEUA 2VWGA 3HJGA 4N01A 4WY2A 2JHGA 1D6MA 2QN8A 4D9CA 3BOSA 3FFAA 4WKPA 2UXCB 1GTJ1 4M89A 3V4LA 4O3FA 1NFFA 4L4XA 3E2MA 3HBLA 1BX3A 2XVZA 4G41A 5DLPA 3H65A 1M2HA 3SP1A 4IJVA 2YR0A 1MB3A 1SXGA 2GBLA 1FX1A 2B61A 2I66A 2Z5LA 3FWPA 3PNOA 3VR5A 5JD6A 1ZKMA 2Z2JA 3TLZA 3LUDA 4LTDA 4R1SA 3OLVA 2FXIA 2X0NA 3NIBA 3GLGE 3NETA 1UL1X 1X80B 3TECE 2IBTA 2J85A 3E3AA 3U31A 3NJRA 5KX5B 4KQMA 3QE3A 3X1YA 2CEKA 3TDKA 3X43A 4DY4A 4POOA 1YU9A 2QRPA 5K0BA 2ZRFA 4LXIA 5JDCA 4U5QA 4YROA 4PYRA 1K7YA 2R5WA 1ECLA 1E62A 3LJKA 4K9NA 5JZBA 2Y67A 3CUSA 1NMXA 2HMSA 3PUJA 4BMNA 1ODLA 4IUBS 2B9EA 1QH1A 3MT0A 5JXIA 3I04A 4ZMSA 2FPPA 2GAIA 1LSUA 2VK4A 5JMWA 4MS4A 2X2FA 1T4MA 1Z0FA 2EZ4A 3HHPA 3ZWOA 2G77B 3AILA 5AVVA 5D7BA 2AEFA 4QFBA 3IVGA 1SXJB 2HHAA 5EUMA 4AUMA 2VWHA 5KSZA 1ZEJA 1BD4A 3G59A 4F1JA 1YJ8A 3WIVA 2ANBA 1WDWB 3M4NA 4MO9A 4TS3A 3BFVA 5EVCA 3RKUA 3T9DA 3V55A 2LPMA 3BD8A 3JRXA 1OXMA 4AJNA 5IF3A 2F8TA 4NZMA 1DWUA 1PZFA 3ZHOA 3I6IA 1BXKA 1T3LA 2D2VA 2O20A 1DPGA 1T3ZA 4OUKX 2IV3A 3TB6A 2QNRA 4CV2A 4ER0A 4IZOA 5IKOA 3GG2A 3FB4A 4J75A 4AL4A 3ICQB 1P1IA 3U40A 4KPEC 5EJAA 1A9OA 1EK0A 2JFOA 3A8TA 3C6YA 1JEYA 5BMOA 5LP6A 4JL5A 3ZQUA 4P08A 4EW3A 3UV6A 3OF2A 3TSWA 4RKFA 3W5HA 4LDAA 4D3DA 3NOQA 3KELA 2PA3A 1NJGA 4JXKA 4MV0A 4ZCRA 1RWXA 3Q7RA 4KODA 3H8VA 3DL2A 5C3UA 4GWLA 2ZBUA 3HNPA 1QGED 1O89A 4FSXA 1CUZA 1QVVA 2DFPA 4RGQA 2GT1A 2XWQA 2RGYA 4EK9A 3QVGA 4HS9A 1GKIA 3IAS1 2DR2A 5EJ4A 2D59A 3B1XA 3K70D 2XMSA 4MUAA 5EWMB 5IZ4A 3IMGA 4BO1A 3IHWA 1GFWA 4MPPA 4QFDA 1OI2A 4R7GA 5NULA 5BURA 4JR1A 1OFUA 3VKGA 1ACLA 4M8LA 5C1IA 4BP8A 3Q12A 3L0SA 2EBUA 4CDNA 4YUZA 3WLMA 1GHTA 3WRWA 1VCIA 1VG0B 2WTXA 4X7MA 3VNBA 1R3DA 3H17A 5AW5A 2B9VA 2X7HA 1W29A 4CM4A 3T1OA 4MYHA 1XKQA 2NSHA 3DFZA 2EFCB 3WYCA 1M7BA 4U6SA 2AR0A 1R12A 5AJTA 3ZZ1A 3LK6A 4I3HA 2PBRA 2ATCA 2FGJA 3ANYB 3D2CA 1F2TB 4DMHA 3JVVA 1W4RA 4DNFA 4OJQA 3CJTA 4E4RA 1Z36A 2BFNA 4KIWA 3WGMA 1IN1A 4HPWA 1GPMA 1PGPA 3F6CA 1MABA 3EN0A 3IFSA 5CK5A 3P9KA 2Z43A 1QCZA 3HVKA 4Q6WA 4W99A 1QORA 2QTRA 4BNIA 5FWNA 4QQNA 4DRYA 1T5IA 3V48A 1KYTA 1CZOA 3KBOA 5AVOA 5TMDA 3WZ2A 5H83A 2IV7A 1BFDA 4TYYA 1ZMRA 3FPGA 1SC6A