1GNUA

Gaba(a) receptor associated protein gabarap
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABARAP
publication title The X-Ray Crystal Structure and Putative Ligand-Derived Peptide Binding Properties of Gamma-Aminobutyric Acid Receptor Type a Receptor-Associated Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport
total genus 37
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2001-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gnuA00
1WGGA 3VFKA 1A5RA 3PGEA 1EO6A 2IO0B 2MWSB 2KNBA 3A4RA 2DYBA 3B0AA 4BKSD 1ISNA 4PS7A 1SE9A 2YLMA 4E71A 5J18A 1E8WA 2MBHA 1TZ1A 2N1VA 3ZRCA 4M0WB 4E74A 3R3MA 3BY4B 2D2QA 1Y8RC 5DPWA 2KOXA 2MBOA 4JQWC 3L17A 4MJSA 1E8XA 4IWPA 1Q0WB 4WAAA 1E8ZA 2LD9A 2KXJA 4W9EA 4WWOA 2BPSA 3RT3B 4HCPB 4M8NA 3LJ3A 4GDKA 2XK5A 2KVRA 2ZPNA 3L13A 1HE8A 1GNUA 1RFAA 3WAMA 1RAXA 2FCNA 3RZFA 1Q1OA 2EMSA 4NPNA 3ZIMA 1V5TA 4IC7B 2JZZA 1XQQA 2KFJA 3T8MA 3DDCB 2M0XA 2G4SA 1WJNA 3Q3JA 3PV1A 3VUYA 2LUEA 3A9KA 3L08A 2LZ6A 3ZTCA 2O2VB 5G2NA 1TTNA 4MGZE 1WZ0A 5DPRA 2JUOA 1KLVA 1WGHA 1YIWA 2K39A 5L95C 3AU4A 4J6IA 4IWOA 3DBRI 4GN1A 4RM8A 2J0KA 2KQ7A 3KUDB 4BKGA 3IBEA 5KHQA 4KVGB 2JVCA 3RCZA 5CX3A 3QA8A 3CSTA 4A20A 4FJVB 1Z5SB 2C5LC 1V49A 2NPTA 2NS5A 3RULA 2D07B 2ZJDA 1I35A 3DPDA 2GBKA 3X23A 3ZKJC 4MELA 4NQKE 4ANXA 4XC2A 2LI5A 2BWFA 3V62A 3A1QA 3ZNGC 3JW0X 2KDIA 2KTRB 4IM0A 3TMPB 2AYOB 1M94A 4ANUA 1UGMA 2KANA 2B3AA 3ECIA 3GZNI 5D7GA 2LXCA 4B6WA 2KMAA 3ZLZA 1V9JA 4W9CA 2G3QB 2IY1B 2CU1A 3TCAA 4KSLC 4IW0A 2MBQA 2KDBA 2N7DA 4IUMB 4ANVA 3NOBA 2BKFA 2XK5B 2C60A 4B95A 3B08A 2G45B 1OGWA 1WH3A 2GBJA 1EF1A 2K1FA 3PRPB 4K81A 3N3KB 3KYCD 3QCAA 3SD5A 1WFYA 4EUTA 2DZIA 4CO7A 2HE7A 3I3TB 3AU5A 2DAJA 2LGYA 3K9PB 2KLCA 1E7VA 4BBNF 3PLVA 5AZGA 3UIPB 4ANWA 3PS6A 1WGYA 2WWZA 4OVUA 2KHWB 5DPSA 2D11A 1YD8U 4RMAA 1LM8B 3X0WA 4GOCA 3SDLC 1TGZB 2O2VA 4WJQA 1P0RA 3R7RA 1U4AA 4WJPA 4GU2A 4EKUA 3H7SA 3PRZA 3ZNID 3UF8A 1V2YA 1J8CA 4AOFA 2RSUA 3L10B 4EZJA 4W9JA 1WIAA 2NR2A 3W1YA 2Z59B 3L16A 2FCQA 3TBLD 5AZHA 4WJOA 1V81A 2V3SA 1QZEA 1NI2A 2DHZA 1PQSA 2IBIB 2I1KA 4FJYA 4BKSA 3EHVA 1WX9A 3R7QA 3VVWB 1LFDA 4II2B 4IM3A 1Z2MA 1KM7A 2KN5A 3M62B 2BKRB 4G50A 3AULA 3PZDA 4TV3A 3CF6E 4MDKE 5AEKB 3JSVB 2L05A 4K7UA 2KWCA 3ENEA 5D6JB 1NBFC 1P98A 3W1SA 5EDSA 3QQ8B 4MGYE 2JRHA 4WWNA 1WI0A 1WE7A 1V6EA 3A33B 4BOSC 1UZXB 2FUHB 3UGBB 2KTRA 2QHOA 2A5UA 3N32A 2WDTB 3WA0A 4GXBA 1J19A 4LJOB 4G0NB 1WXAA 2PEAA 2IZVB 4E3CA 2L0TA 4W9LA 2BGFA 1E90A 4BVUC 2OJRA 2AWTA 3R66C 4NQLB 1WF9A 3OJ3A 5G55A 3PHXB 2BWES 4HLEA 4IWQA 2KKCA 4AP4C 2KJHB 3KW5B 3T9LA 2BYEA 2DENB 2MW5A 4HWIB 4PS3A 4HDOA 1T0YA 2N7EA 1XD3B 5CHVC 4YL8A 2KJ6A 4WJNA 1YJ1A 3PREA 1K8RB 4ZYNA 2KO3A 2MSED 1KOTA 4GGQA 2J0JA 1E7UA 4URKA 1L2NA 2KWUB 4M8MA 4FHKA 2O6VD 4FN2A 4FA6A 1WJUA 4GDLB 1H4RA 1P9DU 2BYVE 3ZVVA 1UBQA 1GUAB 3VUWA 5AZFA 4DHJD 4K7WA 2UYZB 2HTHA 1WX8A 4BFRA 1WGDA 3QJZA 2ZNVB 2GBMA 1ZGUB 2M4NA 1L7YA 5FR6A 3UIOB 4KV2A 3ZDTA 1E5WA 3HM3A 2Z0EB 2JRIB 3LDZE 3H7PA 3JYUA 1WXMA 4KZ0A 3V6EB 3A4SC 1WJ6A 1UELA 1WRDB 1WR1A 4ZRJA 2REXA 1Q5WB 1WE6A 1GC7A 1WGRA 2DZJA 2FAZA 3V60A 5D94A 5DCNA 4EOYA 5D2MB 2D10A 3EECA 2C7NB 1C1YB 1WR6E 2PE9A 3AI5A 3JSVA 3V61A 3OLMD 3NZUA 3AXCA 4WWPA 4W9FA 3QAQA 1F9JA 3Q3FA 4I6PA 3S2AA 2MRPA 2KD0A 2O6VB 3IFWB 2KX3A 2LXAA 1XT9B 4KDLB 2DYMA 4CYEA 2ZZPB 4DHJB 2CR5A 2C7HA 2DZKA 3DVNV 4TKNA 5CHWA 4GB9A 4XX5A 3TL5A 1X1MA 5J17A 4FJZA 3ZO5B 3OJ4B 4LDTD 4G3XB 4NJ6A 2NCNA 5LXIB 1G6JA 2LVOA 1V80A 3NY5A 4HJKA 2GBNA 3ZNZB 3DBSA 2K6DB 2PJHA 3U30A 3MJWA 2MQJA 1RRBA 2L76A 3H6NA 3QIJA 1GJZA 1OEYA 1RLFA 3NZSA 1FXTB 2K25A 2XBBC 5IAAC 2VRRB 4FULA 2MCNB 1P1AA 3PPAA 3ZDMC 4GDLA 3ZUNA 1R4NI 3D32A 3VAWA 3M63B 2Z0DB 4RM9A 4NNJB 1I42A 3ML8A 3RUIB 3WANA 1P3QU 3APFA 3ALBA 3VXWA 1WXVA 5E6NA 3H7PB 3KUCB 4KZCA 2KJRA 2KTFA 3APDA 3VTWA 4BKTA 2IYDB 2LRUA 2MLBA 4NAWB 3PTFC 3VQIA 3DOWA 1KJTA 5JH5C 2LRWA 4A3OA 4JL9A 4ZDVA 4KDIC 3VHTC 5CTRC 2I1JA 2FCMA 2JT4B 2FIDA 4ZRIA 2KC2A 2OOBB 4LDTB 1V86A 3W1SC 5J2RA 4IG7B 3RYTA 4DWFA 4W9KA 2KK8A 4HPMB 4F8CB 2L7RA 3QC8B 4DK5A 2K8BA 3VTVA 2V1YA 5C23A 2BF8B 4ASWC 2CS4A 3WAOA 2KDEB 4GIVA 2ZCBA 4GSWA 1D3ZA 2K8HA 2GBRA 4TQ0A 2O6VA 2NBWB 3C0RB 5HKHA 1WZ3A 1S3SG 2W9NA 3PT2B 2MP2A 3DVNU 3RD2A 1UD7A 2KLGA 4DBGA 3DBLI 3ZTDA 3ONSA 3WIMA 4OVVA 4ZRKA 1IP9A 2CHXA 2KMCA 2RR9A 3GOEA 4MEMA 4W9HA 1OTRB 4FHJA 4MGIE 3B1LX 2CKHB 4LCDE 1UH6A 2G4DB 2N4FA 2Y5BB 2ZVNA 4TQ1A 1YQBA 2ZEQA 4MH0E 1AARA 2JF5A 5TR5A 4DDGD 2EMTA 1VD2A 1C3TA 1SGHA 2DAFA 2M8SA 1WMHB 4AJYB 4AUQC 3RZWC 2N9PC 3HIZA 4AJWA 4NJ7A 4BOZB 5LLIA 2GOWA 3HHMA 4HCNB 3UQAA 4JLCA 3O65B 4I6LB 2JY6A 2FIFA 2RPQA 3WAPA 3CSFA 2AL6A 4W9IA 2M17A 3OAWA 1EF5A 1YX5B 3KH0A 4X57B 3IHPC 1YX6B 1WYWB 2ZVOA 4K7SA 3U7DA 2MBEA 4IM2A 2EKEC 2JXXA 3N30A 4EEWA 4JGHB 3U8ZA 2L8JA 4NAWA 3UINB 2NBVB 1LXDA 2K8CA 2IO3B 2LWPA 2IY0B 5E6OA 4A3PA 5DPTA 2ZCCA 3DBHI 1GC6A 5JHAA 2UWQA 3L0WB 1ZKHA 3VH3B 3ZRFA 2IO1B 1WM2A 4CHKA 2R2QA 4TUUA 2MBBB 1WX7A 3A9JB 3JVZX 3PSEB 1NDDA 2XEWA 3QK0A 2KFKA 2FNJB 2WX0A 2JZ3B 2KQSA 4EZLA 2LGXA 4FBJB 2FCSA 3HK0A 1CMXB 2MP2B 2NBUA 3QARA 4G11A 4ICVA 4XZ4A 3CMMB 3TJPA 1J0GA 3NHEB 4DDID 4FLHA 2AEHA 4W9GA 4AWJA 3M3JA 4KIKB 2KZRA 2IO2B 4FADA 2J0MA 3ZW3A 1BT0A 4WQOB 2HD5B 2J7QB 1WY8A 2KWVB 2MA9B 4MM3A 5E6PA 4DXAB 1S1QB 3EC8A 3H9DA 3ML9A 2R2OA 5L83A 5JZEB 2LVQA 2N1WA 3PRMB 3HM6X 4N9F4 3TIXA 3QWZB 5KHOA 1WJ4A 4DHZE 3DVGY 4KSKC 3PHWB 2DZMA 2M1MA 5CHFA 4PYUA 1IYFA 4HXDA 2BYFA 2WX1A 1EUVB 2KX0A 4JIOU 1OQYA 2RD0A 2PE6B 4MJSB 4MGKE 4W9DA 2D3GA 2WYQA 4HK2A 2ASQA 3DQVA 2HJ8A 3P2BA 4F7ZA 4HPLB 3KVFB 1V5OA 2A4ZA 3L54A 1WMHA 2YVCA 3DCGA 4MSMB 4EFOA 4GDKB 3APCA 2C7MB 3VUXA 2N9EB 2JPHA 2LJ5A 2L0FA 4HDQA 5GMVA 2JWZA 3EFUA 3H1UA 1MG8A 2ZNVC 3IG3A 4GMVA 3M95A 1IPGA 4K1RB 3UQBA 1ZW7A 2K6QA 3V6CB 2GMIC 2NVUI 3A9KB 3KUZA 3SU8X 2L00B 3QHTA 1TBEA 2AL3A 3ZNHB 3K9OB 1OEYJ 2CHZA 2LGDA 4P7IA 1JRUA 1WXSA 2LASA 3IVFA 3PVLA 4I6NB 3VH4B 1WM3A 2RGFA 4B9KA 2V4LA 3QX1A 5LXHA 3BINA 4BBNC 3VTUA 2KFKB 3KYDD 2KDFB 4PYZA 2C9WB 4MSQB 1R4MI 2NPTB 5IA7A 2DX5B 5C1ZA 3MHSD 1GG3A 4LJPB 3A9JA 1UBIA 4PS8A 5BO4B 1LQBA 2DYOA 3NS8A 4DHZB 3VDZA 1E8YA 3WALA 1H8CA 3A1QB 4HVBA 3DVGX 1VCBA 5JHBA 2CHWA 2N9XA 1SIFA 2L3ZA 2KC1A 2PPHA 3SHQA 2MX2A 4EZKA 4KIKA 4ICUA 3PLUA 3MTNB 4NY0A 2ZPYA 4F1SA 2LVPA 4II3B
chains in the Genus database with same CATH superfamily
1WGGA 1ZE3D 1BMLC 1A5RA 4RF0A 4REZA 2KNBA 2K0PA 3GE8C 3ZRCA 3R3MA 5FK9C 4TMAB 1Q0WB 3PZ8A 2BPSA 3J9CA 4M8NA 3L13A 1GNUA 3WAMA 1Q1OA 1XQQA 2NTSA 3T8MA 1EM7A 4RNAA 4PT5A 3LYYA 3Q3JA 2BQQA 3PV1A 3A9KA 2LZ6A 5G2NA 4HROA 1KLVA 1ZOYB 2K39A 5L95C 3DBRI 2KWDA 2J0KA 4OZCA 4LNIA 5CX3A 4DXGA 1R7SA 4A20A 3LXFA 3T3NA 1I35A 2ZJDA 2GBKA 3X23A 4ANXA 4XC2A 1FRRA 4WAFA 3ZNGC 3TMPB 2WXQA 1M94A 3ABVB 5EE1A 2B3AA 3ECIA 5EE3A 3ZYYX 4NJCA 3AE8B 2KMAA 3KQ4A 3SR6A 2WLBA 3PZ7A 4XWWA 1EWCA 3MHZA 4M0WA 4A8XC 4IW0A 2KDBA 2N7DA 4IUMB 1TT5B 1HZ5A 1SF0A 2G45B 3WCQA 4OW0A 3EFCA 2K1FA 3PRPB 3QCAA 1WFYA 3FC4A 3P4SB 4EUTA 3AU5A 1UF0A 4RFBA 4ANWA 4OVUA 2WWZA 4AQ7A 4JPSA 4GOCA 2O2VA 4WJQA 1P0RA 1U4AA 4ZOHC 4GU2A 4EKUA 1TS2A 3ZNID 3EUB2 2BT6A 2RSUA 1ZUD2 1C76A 4WJOA 3AE1B 1QZEA 1PQSA 4FJYA 2LEKA 1AW7A 3VVWB 3PZDA 3CF6E 1SB3C 3JSVB 3QQ8B 2JRHA 2X38A 1WI0A 4P6VF 3WA0A 1J19A 3ZGZA 2IZVB 2L0TA 5AUIA 2V9HA 2BGFA 1E90A 5I4DA 2GLSA 4IWQA 3GE3C 2DENB 2MW5A 4LNFA 4HWIB 4PS3A 5BYRA 1T3QA 1XD3B 2H89B 3PREA 2TSSA 4GGQA 1L2NA 1E7UA 2KWUB 1N63A 4FN2A 3U7ZA 1WJUA 3ZVVA 1GUAB 4K7WA 3AV8A 5HHDG 2ZNVB 2JX5A 2KMMA 2RDGA 1FMAD 1XCTL 1WGKA 3HRDD 4TSSA 2JRIB 2W54A 3LDZE 1XO3A 1WXMA 3TSSA 4KZ0A 3U4EG 2WXGA 1UELA 1WRDB 2H88B 4RGOS 1WE6A 2NTTA 2DZJA 2FAZA 3V60A 4EOYA 5D2MB 1WR6E 3AI5A 4FXCA 4LK0M 1F9JA 3Q3FA 2Y5CA 1T6BX 2D5GA 1B1ZA 4HEA1 4DQOC 2KX3A 3P4PB 2RDBC 3BK2A 2ZZPB 3DVNV 1NVID 4GB9A 5CHWA 1TKYA 4NJ6A 1EU3A 2DWQA 1G6JA 3NJTA 4N59A 3ZNZB 2K6DB 2PJHA 1YJJA 3FILB 3NZSA 2K25A 2XBBC 1WSPA 2MCNB 3PPAA 1JROA 1JCKB 3M63B 1MHXA 4NNJB 1P3QU 3APFA 1XXGA 3AE5B 5E6NA 4M00A 2LFIA 3APDA 3B2GA 5GXGB 3VTWA 4BKTA 2MLBA 5JH5C 2QJLA 3V3XA 2J42A 5CTRC 2JT4B 2FCMA 4ZRIA 1TS4A 2QC8A 2MJ3A 1AWDA 3AEBB 2L7RA 2W3SA 1PYWD 4YXDB 4ASWC 3WAOA 1TY0A 3DWMA 1T0SC 1N62A 2GBRA 2NBWB 3C0RB 1L6UA 3DVNU 2KLGA 3ONSA 4OVVA 2KMCA 1OTRB 4MGIE 1E0ZA 1ZDVA 1UH6A 5IKCM 2N4FA 2HDEA 1HZ6A 2ZEQA 2EMTA 1SSNA 1VD2A 3T3OA 2GRIA 3RZWC 2N9PC 4NJ7A 2AQ1B 1Y56A 3UQAA 4JLCA 2BB6A 2LHDA 4I6LB 2JY6A 2AL6A 4S0RA 2WXHA 2INNE 2EKIA 2MBEA 1A70A 1T0QC 3NS1A 1LXDA 2IY0B 2WU2B 3L0WB 4DXFA 3ZRFA 1E6EB 4TUUA 1WX7A 1P7FA 1TS5A 2FNJB 2WX0A 4WH4A 1FXIA 2NBUA 3TJPA 1J0GA 4DDID 1V8CA 3M3JA 1Q10A 2NMQA 2J0MA 3N1YC 1WY8A 2KWVB 3AE7B 1EWYC 3H9DA 1XLOA 2R2OA 5JZEB 4JWUC 5KHOA 3DWGC 3DVGY 2PW9A 5CHFA 1IYFA 2K5PA 4HXDA 3N20C 5IOIA 1JQ4A 3KVFB 1V5OA 2A4ZA 3APCA 2C7MB 3VUXA 2JPHA 2LJ5A 4C4VA 3RI7C 2ZNVC 1I7HA 3SEBA 3UQBA 1IPGA 1ZW7A 2K6QA 2GMIC 1MFWA 2L52A 1TKEA 2JWUA 1OEYJ 3CWIA 3GZNB 1XLNA 4P7IA 2QCZA 2RGFA 4B9KA 3BINA 4BBNC 3KYDD 1C79A 2C9WB 2NPTB 2WP9B 1JRPA 1YOVB 1KTKA 3VDZA 3WALA 1F2RI 1J7CA 1VCBA 4YWGG 2CHWA 2PPHA 4HRSA 4EZKA 2WXFA 3NVZA 2ZW0A 3CIRB 2HJ1A 2RPVA 4BKSD 1WWTA 2YLMA 4E71A 2LGIA 1TZ1A 2MBHA 3BY4B 3H8HA 3PO0A 1FNVA 5DPWA 4A9AA 3L17A 2LJIA 4MJSA 3Q8CA 4IWPA 1E8ZA 2LD9A 4W9EA 4WWOA 1L4DB 2IGDA 4HCPB 4GDKA 2XK5A 3RZFA 2WXIA 3AMZA 2PIAA 2EELA 2VZKB 3ZTCA 2ONQA 1TTNA 1K50A 1PGAA 1YIWA 3AU4A 4RM8A 3IBEA 4PK1A 2K9XA 3RCZA 3ZJUA 1IGCA 1Z5SB 2W3RA 4OZBA 1TYGB 3DPDA 1QOAA 4NQKE 2BS4B 4LNKA 1D4BA 2INDC 2LI5A 3V62A 1JALA 3A1QA 2KQ4X 2KANA 5D7GA 2LXCA 2JQRB 4B6WA 2VH2A 3ZLZA 1V9JA 2IY1B 4A6QA 2AQ2B 2WNMA 4ZHPA 1TY2A 3GP7A 2XK5B 1WH3A 1EF1A 3KYCD 3N9YC 2DZIA 4CO7A 1ZDXA 1YN5A 4XWTA 4IDIA 3AECB 3UIPB 3PS6A 1NENB 2QILA 1LM8B 1FXAA 3B9JA 2PVGC 3ZJVA 2JYTA 1N6ZA 3H7SA 4WQMA 1LGRA 3UF8A 4AOFA 3L10B 4EZJA 4W9JA 1YQ3B 3L16A 2FCQA 5AZHA 3HVZA 1V81A 1F77A 1NI2A 2DHZA 2KYWA 2I1KA 4BKSA 5FR3A 4HJGE 3ZXVA 3AULA 4TV3A 4K7UA 3ENEA 5D6JB 1P98A 4XE0A 3U52E 1UZXB 2FUHB 2WS3B 2QHOA 2SAKA 1R4NB 5EE0A 2LHEA 4S17A 1MPEA 2PEAA 2Y5PA 2M19A 4BVUC 4NQLB 1CZPA 1WF9A 3OJ3A 3AEDB 4HLEA 2KKCA 1YN3A 3KW5B 3T9LA 4YSZB 1KLGD 4A90A 1VZ8A 2N7EA 2KJ6A 1KOTA 2J52A 2QMTA 2J0JA 3N1ZC 4YTMB 4M8MA 1F1HA 1XLPA 4GDLB 2ZW1A 2XNAC 1YJIA 3VUWA 4NAMA 3Q8FA 2N7JA 3IT6B 3QJZA 2WGSA 4QAYA 1ZGUB 4YTPB 4KV2A 1E5WA 3HM3A 2Z0EB 3H7PA 3JYUA 1FNWA 2QSDA 2D10A 3JSVA 3V61A 3OLMD 4WWPA 4W9FA 4I6PA 4ARIA 1UGJA 2LXAA 1XT9B 4KDLB 2CR5A 3IT4B 2C7HA 4TKNA 5BMGA 3O13A 4WURA 3TL5A 4LTUA 3LB8C 4G3XB 5LXIB 2LVOA 3NY5A 4HJKA 3U30A 2MQJA 3QIJA 2JSVX 1GJZA 1UUPA 1FCLA 4FULA 3D32A 3VAWA 3B2FA 1SJHD 1QF6A 2YEPF 2Z0DB 1E10A 3ML8A 4KKJA 3VXWA 1WXVA 3H7PB 5HG2A 2E6XA 3KUCB 2KJRA 2IGHA 1NYRA 1ZPSA 2IYDB 3DOWA 1KJTA 4D2KA 2KC2A 2OOBB 3AE3B 4LDTB 3RYTA 2BS3B 4DWFA 4W9KA 2KK8A 5H92C 1L4ZB 4JE3B 2K8BA 2BF8B 3IAM1 2ZCBA 1D3ZA 2QIEB 4TQ0A 5HKHA 4EE2A 2IPKD 2MP2A 3ZTDA 3I63C 4MM3B 1IP9A 2G1EA 2RR9A 2MH7A 4USAA 4RGNA 1VZ7A 3R2IA 1AARA 1EU4A 3Q8AA 1WRIA 1HTQA 2M8SA 1WMHB 4BOZB 3FILA 3O65B 1L0VB 1BUIC 3BVZA 2WDVB 4N58A 3VR9B 2RPQA 1JWMD 1D5MC 4HKZE 1MHHE 2M17A 3OAWA 1YX5B 3DBLB 3KH0A 3SFDB 3IHPC 4K7SA 2PKOA 4IM2A 2EKEC 1STEA 3N30A 2CU3A 1QQRA 2CJNA 2L8JA 2NBVB 2LWPA 2UU7A 3DBHI 5JHAA 1SBBB 4JWSC 3VH3B 2IO1B 2R2QA 3A9JB 3QK0A 2PVOD 2JZ3B 2KQSA 4FBJB 3HK0A 1CMXB 2MP2B 3NHEB 3P42A 1RM6C 4AWJA 2IO2B 2PTLA 3BYYB 3Q2AC 2N9KA 1NEKB 2HD5B 2KT7A 3RFZB 2J7QB 3L4PA 3ML9A 1C4CA 3TIXA 2V4IB 2DZMA 4PYUA 2BW2A 1EUVB 2KX0A 1N60A 2RD0A 1FD6A 2E3TA 1HA5A 1NI3A 3MC9A 2YVCA 3DCGA 4MSMB 4EFOA 3Q69A 2L0FA 2JWZA 5TSSA 2DNFA 2DLBA 3M95A 2NVUI 3KUZA 3SU8X 3BWUD 3QHTA 1TBEA 1QKZA 3PVLA 3AE4B 1WM3A 1NYQA 3HUIA 2WXMA 2WU5B 1VLBA 1TZOA 2MJEA 1R4MI 4RGMA 1FPYA 1LQBA 2DYOA 3NS8A 3TEZA 1C78A 2VZKD 4C56C 3DVGX 2D3BA 2I2YA 4ICUA 4NY0A 1FFUA 3WIMA 2LVPA 4CQNA 1M4VA 1EO6A 4KGSA 2MWSB 3A4RA 1UWMA 3B0AA 1ISNA 3MC8A 4PS7A 1SE9A 5J18A 1CJEA 4E74A 3Q3OC 5G5HA 1KFYB 1J7AA 1K53A 1KRHA 1VRAB 2KOXA 1E8XA 4WAAA 1FO4A 2ON8A 3RT3B 3W2DA 1TKGA 3LJ3A 2ZPNA 3GS2A 1KLUD 1RFAA 4US9A 4IC7B 3ZIMA 3DDCB 3VRBB 1XF5L 3VUYA 3KWLA 5DPRA 1GAQB 4IWOA 4GN1A 3MJ5A 2KQ7A 4BKGA 3BVGA 5KHQA 4KVGB 3NVYA 2WDQB 3CSTA 4XDDA 4FJVB 2C5LC 1V49A 2NPTA 3RULA 2D07B 3RNBC 4MELA 3AE6B 1L5PA 1HTOA 2KDIA 2KTRB 2JXTA 1UGMA 2BB5A 3W9CB 2G3QB 1B9RA 1IBXB 2CU1A 2QDFA 4ANVA 4BAXA 2BKFA 4Q2JA 3VR8B 2C60A 2AQ3B 2KDMA 3B08A 1OGWA 2L1AA 2GBJA 3N3KB 2N0SB 3I3TB 2DAJA 2LGYA 1E7VA 4BBNF 1RWSA 1WYGA 3V05A 1YD8U 2D11A 4RMAA 1K51A 4WIPA 3KWVA 3R7RA 4WJPA 1FM0D 3PRZA 1V2YA 2BBCA 1ENFA 3W1YA 1WIAA 3UI3A 4GLSC 1WX9A 3R7QA 1LFDA 2KN5A 5AEKB 2KWCA 1NBFC 5EDSA 4WWNA 3A33B 2FUG1 4BOSC 3UGBB 2A5UA 3N32A 4A55A 4GXBA 3KLSX 4AS1A 4LJOB 2IDYA 1DGJA 1WXAA 4W9LA 4ZHOA 2OJRA 1C77A 3R66C 3SFEB 5G55A 4AP4C 2DBYA 2KJHB 3HVDA 3FAHA 1T0YA 5CHVC 4YL8A 4WJNA 1K8RB 4ZYNA 3TEXA 2MSED 2J4XA 4URKA 2VH1A 4FHKA 1IGDA 1TJEA 1D6EC 2BYVE 3RN9C 1UBQA 5FKAC 2HTHA 1WX8A 4BFRA 2MEKA 5G5GA 2M4NA 3UIOB 4P1BC 3E9SA 4RF1A 1T0RC 2FE8A 1WJ6A 1WR1A 1Q5WB 1WGRA 3EECA 2C7NB 2PE9A 3NZUA 5C3JB 1QLBB 3S2AA 1ROEA 2O6VB 3IFWB 2BTEA 1JWBD 2DYMA 1L6VA 4DHJB 2DZKA 1J7BA 3OJ4B 4LDTD 1E9MA 3AN1A 2N9LA 2NCNA 1PFDA 2GBNA 1JWUD 3OG5A 4MT5A 3GB1A 3MJWA 5T8IA 2L76A 2R61A 1HXYD 1RLFA 1FXTB 4GDLA 3P63A 3W5UB 2IGGA 2MJDA 3RUIB 3AEAB 3ALBA 3Q14C 3EGRA 1SE2A 2KTFA 3C8YA 2LRUA 4NAWB 3PTFC 3VQIA 2D3AA 4KDIC 3VHTC 2I1JA 3TUOA 2FIDA 1N61A 3W1SC 1DOXA 4HPMB 4F8CB 4P1CC 3QC8B 4DK5A 2V1YA 1SXTA 2KDEB 4GIVA 1WZ3A 1S3SG 2W9NA 3DHHC 3RD2A 1UD7A 4DBGA 3DBLI 1I4HA 4US8A 2CHXA 1RYJA 3GOEA 4FHJA 2KVZA 4TQ1A 1YQBA 3ETRA 1PDXA 1MVKA 4MH0E 5H8YE 2BYTA 3MC0B 4DDGD 1ZXIA 3RMKC 1YMHE 2DAFA 4AUQC 3HIZA 1D5ZC 4AJWA 3NZ3A 2GOWA 3WAPA 3RNCC 1I4GA 2RDHA 4W9IA 4X57B 1EF5A 2L83A 2ZVOA 5BYSA 4EEWA 1V1PB 1IUEA 3ZJTA 3UINB 2K8CA 5IO9A 3NUHB 5E6OA 4RGTA 2ZCCA 1GC6A 1XEEA 2UWQA 1ZKHA 3W5VB 3N1XC 1V1OA 1WM2A 2MBBB 3PSEB 4KGRA 2XEWA 4EZLA 3BYTB 3QARA 4XZ4A 4ICVA 4FLHA 2AEHA 4W9GA 4KIKB 2KZRA 4B0EA 4FADA 1BT0A 4WQOB 1KH0A 1FRDA 2W82A 4MM3A 5E6PA 4H2AA 4YSYB 5JXVA 3EC8A 3I9V1 4OVZA 5L83A 2WXRA 2LVQA 2N1WA 4NZLB 4N9F4 3QWZB 2WXOA 5HI1A 3PHWB 4XYCA 3VRAB 2WX1A 1OQYA 2WYQA 3P2BA 4F7ZA 3Q6BA 1WMHA 1WXQA 2W55A 4HDQA 3H1UA 1MG8A 3IG3A 4K1RB 3V6CB 3ZXRA 3A9KB 4C7ZA 2L00B 4KGTA 3ZNHB 3K9OB 1GPXA 5C2TB 2CHZA 4YSXB 1JRUA 1QOFA 2LASA 3IVFA 4I6NB 3AE9B 4ITKA 2V4LA 3QX1A 5LXHA 1UNSA 5LNK1 3VTUA 4PYZA 1L0XB 4LNOA 5IA7A 2DX5B 4LJPB 3A9JA 1UBIA 3RNGC 4DHZB 1E8YA 4IKGA 1H8CA 3IAS1 4LLGM 4HVBA 1N5WA 1XLQA 1SIFA 2GB1A 2KC1A 3SHQA 2MX2A 3PLUA 3MTNB 4F1SA 2ZPYA 1PUTA 3AB5A 3Q3MC 3VFKA 3PGEA 2IO0B 2DYBA 2QEJC 1MI0A 4L1BA 2I38A 1E8WA 2N1VA 4M0WB 4L2YA 2D2QA 1MG4A 1Y8RC 1YQ4B 2MBOA 2Q5WD 4JQWC 3AEEB 2KXJA 2LUMA 1VJKA 2GI9A 2M56B 3AE2B 1GOZA 2KVRA 2ICIA 1JWSD 1HE8A 1ET6A 1RAXA 2FCNA 2EMSA 4NPNA 1V5TA 2JZZA 2KFJA 2M0XA 1K52A 2G4SA 1WJNA 2LUEA 3L08A 2O2VB 1VR9A 2MHJA 4MGZE 1WZ0A 2D3CA 2JUOA 1WGHA 4J6IA 3KUDB 4P16A 2AX5A 2JVCA 3QA8A 5IN7A 2NS5A 3ZKJC 2BWFA 1N5XA 3JW0X 1HQRD 2V3PA 4IM0A 2PLPA 5BMHA 3AH7A 2AYOB 4ANUA 2HTME 3GZNI 2OJWA 4UDUC 4W9CA 1F52A 4C80A 3P4QB 3DBRB 3I57A 2V3NA 2X8XX 3TCAA 4KSLC 1YNTE 2MBQA 3NOBA 3E56A 4B95A 2LMCA 4K81A 2WQYB 3SD5A 1F2RC 1QOGA 2HE7A 3Q3NC 3K9PB 2KLCA 1L0YB 3PLVA 5AZGA 1PGXA 1WGYA 2KHWB 5DPSA 4YTNB 4RH6A 3X0WA 3SDLC 2KACA 1TGZB 1FNUA 4LNNA 1J8CA 1OFFA 2NR2A 4O1NA 5D3DA 2Z59B 1C4PA 3TBLD 2V3SA 3P4RB 2IBIB 1PGBA 3EHVA 2WXPA 1CK1A 4II2B 4IM3A 1Z2MA 1KM7A 3BZDB 3M62B 2BKRB 1SIJA 4G50A 4MDKE 2L05A 3RNEC 3BIID 1FCCC 3W1SA 4MGYE 1WE7A 1V6EA 2KTRA 2WDTB 1C9FA 3OWEB 4G0NB 2V0GA 1I4PA 4E3CA 4XDCA 1E7PB 2INCC 2WDRB 4BZAA 2AWTA 4JX1C 3PHXB 4ACFA 2BWES 1IBXA 2WXJA 4C7YA 1BXTA 2BYEA 3BVMA 1SE4A 4HDOA 1ZXHA 1SE3A 1YJ1A 1DOYA 2K3UA 2KO3A 2CJOA 3BK1A 2INPE 1C4AA 4XGAB 5BYQA 1AYFA 2O6VD 4FA6A 1H4RA 2WHIA 3Q8BA 1P9DU 5AZFA 4DHJD 2UYZB 5BMIA 3AEGB 3TEYA 1WGDA 2GBMA 1P7EA 1L7YA 5FR6A 3ZDTA 1GB4A 4R3DA 2PMVA 1DOIA 3V6EB 1DYQA 3A4SC 4ZRJA 4OZAA 2L32A 2REXA 1GC7A 1JMLA 5D94A 5DCNA 1XCQL 3DHIC 4ZRPA 1C1YB 3AXCA 2RMMA 3QAQA 2MRPA 3TEWA 2K22A 2KD0A 3MP9A 2OEDA 4J3OD 4CYEA 1FEHA 3EA6A 3NVVA 1YN4A 1LO5D 4XX5A 1TIFA 3MFGA 1X1MA 5J17A 4FJZA 3ZO5B 5E6JA 1I4RA 2KN4A 1V80A 3DBSA 1RRBA 2JZPA 3H6NA 3DBHB 1OEYA 2M0AA 1HEZE 2VRRB 5IAAC 1P1AA 3ZDMC 3ZUNA 1R4NI 4RM9A 4N6EB 1I42A 3WANA 4ZYSA 1VZ6A 4KZCA 1RFKA 1ZP0B 1T5XD 2LRWA 4A3OA 4JL9A 4ZDVA 3R8BA 5HFYA 1V86A 5J2RA 4IG7B 1GB1A 2SEBD 2WXKA 4B0MA 3VTVA 5C23A 2CS4A 4ZRQA 4GSWA 2K8HA 2O6VA 1D5XC 3PT2B 2B76B 1VDVA 4HPPA 2KAJA 3IXSA 4ZRKA 4W9HA 4MEMA 4IOIE 1AN8A 3B1LX 2CKHB 4LCDE 2G4DB 2Y5BB 1V97A 1QT9A 2ZVNA 1TS3A 2JF5A 5TR5A 2FBWB 2OHFA 4KKIA 1JWAD 1C3TA 1SGHA 4WWMA 2WXNA 4AJYB 3DHGC 2J53A 5EE9A 1R4MB 5LLIA 3HHMA 4HCNB 4C4VB 3RPFC 4YT0B 2FIFA 3CSFA 2BS2B 3I5JC 4MACA 1YX6B 1WYWB 1MJDA 1QILA 4KX6B 5D3IB 2Z8LA 3U7DA 2JXXA 4JGHB 3U8ZA 4NAWA 5IP4D 2IO3B 3R2TA 4A3PA 5DPTA 1ESFA 1I4XA 1JW9D 4K3CA 5MPOA 4CHKA 2JYEA 3JVZX 2YEPB 4M01A 1NDDA 2KFKA 3NVWA 1KF6B 3AM9A 1SEBD 2LGXA 2ACZB 2FCSA 4RCOA 4G11A 3CMMB 3NRZA 2WXLA 4C00A 3NG0A 3ZW3A 3C19A 1OQRA 3AEFB 2MA9B 4K3BA 4L23A 4DXAB 1S1QB 3PRMB 3HM6X 1FFVA 1ET9A 1ACCA 1WJ4A 4KSKC 3URYA 2M1MA 1FIQA 2BYFA 4JIOU 4W9DA 3FKYA 2PE6B 4MJSB 4MGKE 1OQQA 1UWXA 2D3GA 1F0ZA 4HK2A 2ASQA 3DQVA 2HJ8A 4HPLB 3L54A 2G9HD 4OHJA 3ZQ4A 4GDKB 4MH8A 3RNAC 2N9EB 3P1MA 5GMVA 1CQVA 3EFUA 4GMVA 2Y3AA 2AL3A 2LGDA 4HKQA 3RNFC 3Q8EA 3U2SC 1WXSA 2XN9C 1V1PA 3VH4B 2BVCA 4ARCA 2IJ0A 4M02A 1SJED 2JU6X 2KFKB 2KDFB 4MSQB 5C1ZA 3MHSD 1GG3A 4PS8A 5AUKA 5BO4B 3A1QB 5JHBA 2N9XA 2LGSA 2L3ZA 1QOBA 4KIKA 4DHZE 1I4QA 4II3B
chains in the Genus database with same CATH topology
1WGGA 3VFKA 1A5RA 3PGEA 1EO6A 2IO0B 2MWSB 2KNBA 3A4RA 2DYBA 3B0AA 4BKSD 1ISNA 4PS7A 1SE9A 2YLMA 4E71A 5J18A 1E8WA 2MBHA 1TZ1A 2N1VA 3ZRCA 4M0WB 4E74A 3R3MA 3BY4B 2D2QA 1Y8RC 5DPWA 2KOXA 2MBOA 4JQWC 3L17A 4MJSA 1E8XA 4IWPA 1Q0WB 4WAAA 1E8ZA 2LD9A 2KXJA 4W9EA 4WWOA 2BPSA 3RT3B 4HCPB 4M8NA 3LJ3A 4GDKA 2XK5A 2KVRA 2ZPNA 3L13A 1HE8A 1GNUA 1RFAA 3WAMA 1RAXA 2FCNA 3RZFA 1Q1OA 2EMSA 4NPNA 3ZIMA 1V5TA 4IC7B 2JZZA 1XQQA 2KFJA 3T8MA 3DDCB 2M0XA 2G4SA 1WJNA 3Q3JA 3PV1A 3VUYA 2LUEA 3A9KA 3L08A 2LZ6A 3ZTCA 2O2VB 5G2NA 1TTNA 4MGZE 1WZ0A 5DPRA 2JUOA 1KLVA 1WGHA 1YIWA 2K39A 5L95C 3AU4A 4J6IA 4IWOA 3DBRI 4GN1A 4RM8A 2J0KA 2KQ7A 3KUDB 4BKGA 3IBEA 5KHQA 4KVGB 2JVCA 3RCZA 5CX3A 3QA8A 3CSTA 4A20A 4FJVB 1Z5SB 2C5LC 1V49A 2NPTA 2NS5A 3RULA 2D07B 2ZJDA 1I35A 3DPDA 2GBKA 3X23A 3ZKJC 4MELA 4NQKE 4ANXA 4XC2A 2LI5A 2BWFA 3V62A 3A1QA 3ZNGC 3JW0X 2KDIA 2KTRB 4IM0A 3TMPB 2AYOB 1M94A 4ANUA 1UGMA 2KANA 2B3AA 3ECIA 3GZNI 5D7GA 2LXCA 4B6WA 2KMAA 3ZLZA 1V9JA 4W9CA 2G3QB 2IY1B 2CU1A 3TCAA 4KSLC 4IW0A 2MBQA 2KDBA 2N7DA 4IUMB 4ANVA 3NOBA 2BKFA 2XK5B 2C60A 4B95A 3B08A 2G45B 1OGWA 1WH3A 2GBJA 1EF1A 2K1FA 3PRPB 4K81A 3N3KB 3KYCD 3QCAA 3SD5A 1WFYA 4EUTA 2DZIA 4CO7A 2HE7A 3I3TB 3AU5A 2DAJA 2LGYA 3K9PB 2KLCA 1E7VA 4BBNF 3PLVA 5AZGA 3UIPB 4ANWA 3PS6A 1WGYA 2WWZA 4OVUA 2KHWB 5DPSA 2D11A 1YD8U 4RMAA 1LM8B 3X0WA 4GOCA 3SDLC 1TGZB 2O2VA 4WJQA 1P0RA 3R7RA 1U4AA 4WJPA 4GU2A 4EKUA 3H7SA 3PRZA 3ZNID 3UF8A 1V2YA 1J8CA 4AOFA 2RSUA 3L10B 4EZJA 4W9JA 1WIAA 2NR2A 3W1YA 2Z59B 3L16A 2FCQA 3TBLD 5AZHA 4WJOA 1V81A 2V3SA 1QZEA 1NI2A 2DHZA 1PQSA 2IBIB 2I1KA 4FJYA 4BKSA 3EHVA 1WX9A 3R7QA 3VVWB 1LFDA 4II2B 4IM3A 1Z2MA 1KM7A 2KN5A 3M62B 2BKRB 4G50A 3AULA 3PZDA 4TV3A 3CF6E 4MDKE 5AEKB 3JSVB 2L05A 4K7UA 2KWCA 3ENEA 5D6JB 1NBFC 1P98A 3W1SA 5EDSA 3QQ8B 4MGYE 2JRHA 4WWNA 1WI0A 1WE7A 1V6EA 3A33B 4BOSC 1UZXB 2FUHB 3UGBB 2KTRA 2QHOA 2A5UA 3N32A 2WDTB 3WA0A 4GXBA 1J19A 4LJOB 4G0NB 1WXAA 2PEAA 2IZVB 4E3CA 2L0TA 4W9LA 2BGFA 1E90A 4BVUC 2OJRA 2AWTA 3R66C 4NQLB 1WF9A 3OJ3A 5G55A 3PHXB 2BWES 4HLEA 4IWQA 2KKCA 4AP4C 2KJHB 3KW5B 3T9LA 2BYEA 2DENB 2MW5A 4HWIB 4PS3A 4HDOA 1T0YA 2N7EA 1XD3B 5CHVC 4YL8A 2KJ6A 4WJNA 1YJ1A 3PREA 1K8RB 4ZYNA 2KO3A 2MSED 1KOTA 4GGQA 2J0JA 1E7UA 4URKA 1L2NA 2KWUB 4M8MA 4FHKA 2O6VD 4FN2A 4FA6A 1WJUA 4GDLB 1H4RA 1P9DU 2BYVE 3ZVVA 1UBQA 1GUAB 3VUWA 5AZFA 4DHJD 4K7WA 2UYZB 2HTHA 1WX8A 4BFRA 1WGDA 3QJZA 2ZNVB 2GBMA 1ZGUB 2M4NA 1L7YA 5FR6A 3UIOB 4KV2A 3ZDTA 1E5WA 3HM3A 2Z0EB 2JRIB 3LDZE 3H7PA 3JYUA 1WXMA 4KZ0A 3V6EB 3A4SC 1WJ6A 1UELA 1WRDB 1WR1A 4ZRJA 2REXA 1Q5WB 1WE6A 1GC7A 1WGRA 2DZJA 2FAZA 3V60A 5D94A 5DCNA 4EOYA 5D2MB 2D10A 3EECA 2C7NB 1C1YB 1WR6E 2PE9A 3AI5A 3JSVA 3V61A 3OLMD 3NZUA 3AXCA 4WWPA 4W9FA 3QAQA 1F9JA 3Q3FA 4I6PA 3S2AA 2MRPA 2KD0A 2O6VB 3IFWB 2KX3A 2LXAA 1XT9B 4KDLB 2DYMA 4CYEA 2ZZPB 4DHJB 2CR5A 2C7HA 2DZKA 3DVNV 4TKNA 5CHWA 4GB9A 4XX5A 3TL5A 1X1MA 5J17A 4FJZA 3ZO5B 3OJ4B 4LDTD 4G3XB 4NJ6A 2NCNA 5LXIB 1G6JA 2LVOA 1V80A 3NY5A 4HJKA 2GBNA 3ZNZB 3DBSA 2K6DB 2PJHA 3U30A 3MJWA 2MQJA 1RRBA 2L76A 3H6NA 3QIJA 1GJZA 1OEYA 1RLFA 3NZSA 1FXTB 2K25A 2XBBC 5IAAC 2VRRB 4FULA 2MCNB 1P1AA 3PPAA 3ZDMC 4GDLA 3ZUNA 1R4NI 3D32A 3VAWA 3M63B 2Z0DB 4RM9A 4NNJB 1I42A 3ML8A 3RUIB 3WANA 1P3QU 3APFA 3ALBA 3VXWA 1WXVA 5E6NA 3H7PB 3KUCB 4KZCA 2KJRA 2KTFA 3APDA 3VTWA 4BKTA 2IYDB 2LRUA 2MLBA 4NAWB 3PTFC 3VQIA 3DOWA 1KJTA 5JH5C 2LRWA 4A3OA 4JL9A 4ZDVA 4KDIC 3VHTC 5CTRC 2I1JA 2FCMA 2JT4B 2FIDA 4ZRIA 2KC2A 2OOBB 4LDTB 1V86A 3W1SC 5J2RA 4IG7B 3RYTA 4DWFA 4W9KA 2KK8A 4HPMB 4F8CB 2L7RA 3QC8B 4DK5A 2K8BA 3VTVA 2V1YA 5C23A 2BF8B 4ASWC 2CS4A 3WAOA 2KDEB 4GIVA 2ZCBA 4GSWA 1D3ZA 2K8HA 2GBRA 4TQ0A 2O6VA 2NBWB 3C0RB 5HKHA 1WZ3A 1S3SG 2W9NA 3PT2B 2MP2A 3DVNU 3RD2A 1UD7A 2KLGA 4DBGA 3DBLI 3ZTDA 3ONSA 3WIMA 4OVVA 4ZRKA 1IP9A 2CHXA 2KMCA 2RR9A 3GOEA 4MEMA 4W9HA 1OTRB 4FHJA 4MGIE 3B1LX 2CKHB 4LCDE 1UH6A 2G4DB 2N4FA 2Y5BB 2ZVNA 4TQ1A 1YQBA 2ZEQA 4MH0E 1AARA 2JF5A 5TR5A 4DDGD 2EMTA 1VD2A 1C3TA 1SGHA 2DAFA 2M8SA 1WMHB 4AJYB 4AUQC 3RZWC 2N9PC 3HIZA 4AJWA 4NJ7A 4BOZB 5LLIA 2GOWA 3HHMA 4HCNB 3UQAA 4JLCA 3O65B 4I6LB 2JY6A 2FIFA 2RPQA 3WAPA 3CSFA 2AL6A 4W9IA 2M17A 3OAWA 1EF5A 1YX5B 3KH0A 4X57B 3IHPC 1YX6B 1WYWB 2ZVOA 4K7SA 3U7DA 2MBEA 4IM2A 2EKEC 2JXXA 3N30A 4EEWA 4JGHB 3U8ZA 2L8JA 4NAWA 3UINB 2NBVB 1LXDA 2K8CA 2IO3B 2LWPA 2IY0B 5E6OA 4A3PA 5DPTA 2ZCCA 3DBHI 1GC6A 5JHAA 2UWQA 3L0WB 1ZKHA 3VH3B 3ZRFA 2IO1B 1WM2A 4CHKA 2R2QA 4TUUA 2MBBB 1WX7A 3A9JB 3JVZX 3PSEB 1NDDA 2XEWA 3QK0A 2KFKA 2FNJB 2WX0A 2JZ3B 2KQSA 4EZLA 2LGXA 4FBJB 2FCSA 3HK0A 1CMXB 2MP2B 2NBUA 3QARA 4G11A 4ICVA 4XZ4A 3CMMB 3TJPA 1J0GA 3NHEB 4DDID 4FLHA 2AEHA 4W9GA 4AWJA 3M3JA 4KIKB 2KZRA 2IO2B 4FADA 2J0MA 3ZW3A 1BT0A 4WQOB 2HD5B 2J7QB 1WY8A 2KWVB 2MA9B 4MM3A 5E6PA 4DXAB 1S1QB 3EC8A 3H9DA 3ML9A 2R2OA 5L83A 5JZEB 2LVQA 2N1WA 3PRMB 3HM6X 4N9F4 3TIXA 3QWZB 5KHOA 1WJ4A 4DHZE 3DVGY 4KSKC 3PHWB 2DZMA 2M1MA 5CHFA 4PYUA 1IYFA 4HXDA 2BYFA 2WX1A 1EUVB 2KX0A 4JIOU 1OQYA 2RD0A 2PE6B 4MJSB 4MGKE 4W9DA 2D3GA 2WYQA 4HK2A 2ASQA 3DQVA 2HJ8A 3P2BA 4F7ZA 4HPLB 3KVFB 1V5OA 2A4ZA 3L54A 1WMHA 2YVCA 3DCGA 4MSMB 4EFOA 4GDKB 3APCA 2C7MB 3VUXA 2N9EB 2JPHA 2LJ5A 2L0FA 4HDQA 5GMVA 2JWZA 3EFUA 3H1UA 1MG8A 2ZNVC 3IG3A 4GMVA 3M95A 1IPGA 4K1RB 3UQBA 1ZW7A 2K6QA 3V6CB 2GMIC 2NVUI 3A9KB 3KUZA 3SU8X 2L00B 3QHTA 1TBEA 2AL3A 3ZNHB 3K9OB 1OEYJ 2CHZA 2LGDA 4P7IA 1JRUA 1WXSA 2LASA 3IVFA 3PVLA 4I6NB 3VH4B 1WM3A 2RGFA 4B9KA 2V4LA 3QX1A 5LXHA 3BINA 4BBNC 3VTUA 2KFKB 3KYDD 2KDFB 4PYZA 2C9WB 4MSQB 1R4MI 2NPTB 5IA7A 2DX5B 5C1ZA 3MHSD 1GG3A 4LJPB 3A9JA 1UBIA 4PS8A 5BO4B 1LQBA 2DYOA 3NS8A 4DHZB 3VDZA 1E8YA 3WALA 1H8CA 3A1QB 4HVBA 3DVGX 1VCBA 5JHBA 2CHWA 2N9XA 1SIFA 2L3ZA 2KC1A 2PPHA 3SHQA 2MX2A 4EZKA 4KIKA 4ICUA 3PLUA 3MTNB 4NY0A 2ZPYA 4F1SA 2LVPA 4II3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGG A;  3VFK A;  1A5R A;  3PGE A;  1EO6 A;  2IO0 B;  2MWS B;  2KNB A;  3A4R A;  2DYB A;  3B0A A;  4BKS D;  1ISN A;  4PS7 A;  1SE9 A;  2YLM A;  4E71 A;  5J18 A;  1E8W A;  2MBH A;  1TZ1 A;  2N1V A;  3ZRC A;  4M0W B;  4E74 A;  3R3M A;  3BY4 B;  2D2Q A;  1Y8R C;  5DPW A;  2KOX A;  2MBO A;  4JQW C;  3L17 A;  4MJS A;  1E8X A;  4IWP A;  1Q0W B;  4WAA A;  1E8Z A;  2LD9 A;  2KXJ A;  4W9E A;  4WWO A;  2BPS A;  3RT3 B;  4HCP B;  4M8N A;  3LJ3 A;  4GDK A;  2XK5 A;  2KVR A;  2ZPN A;  3L13 A;  1HE8 A;  1GNU A;  1RFA A;  3WAM A;  1RAX A;  2FCN A;  3RZF A;  1Q1O A;  2EMS A;  4NPN A;  3ZIM A;  1V5T A;  4IC7 B;  2JZZ A;  1XQQ A;  2KFJ A;  3T8M A;  3DDC B;  2M0X A;  2G4S A;  1WJN A;  3Q3J A;  3PV1 A;  3VUY A;  2LUE A;  3A9K A;  3L08 A;  2LZ6 A;  3ZTC A;  2O2V B;  5G2N A;  1TTN A;  4MGZ E;  1WZ0 A;  5DPR A;  2JUO A;  1KLV A;  1WGH A;  1YIW A;  2K39 A;  5L95 C;  3AU4 A;  4J6I A;  4IWO A;  3DBR I;  4GN1 A;  4RM8 A;  2J0K A;  2KQ7 A;  3KUD B;  4BKG A;  3IBE A;  5KHQ A;  4KVG B;  2JVC A;  3RCZ A;  5CX3 A;  3QA8 A;  3CST A;  4A20 A;  4FJV B;  1Z5S B;  2C5L C;  1V49 A;  2NPT A;  2NS5 A;  3RUL A;  2D07 B;  2ZJD A;  1I35 A;  3DPD A;  2GBK A;  3X23 A;  3ZKJ C;  4MEL A;  4NQK E;  4ANX A;  4XC2 A;  2LI5 A;  2BWF A;  3V62 A;  3A1Q A;  3ZNG C;  3JW0 X;  2KDI A;  2KTR B;  4IM0 A;  3TMP B;  2AYO B;  1M94 A;  4ANU A;  1UGM A;  2KAN A;  2B3A A;  3ECI A;  3GZN I;  5D7G A;  2LXC A;  4B6W A;  2KMA A;  3ZLZ A;  1V9J A;  4W9C A;  2G3Q B;  2IY1 B;  2CU1 A;  3TCA A;  4KSL C;  4IW0 A;  2MBQ A;  2KDB A;  2N7D A;  4IUM B;  4ANV A;  3NOB A;  2BKF A;  2XK5 B;  2C60 A;  4B95 A;  3B08 A;  2G45 B;  1OGW A;  1WH3 A;  2GBJ A;  1EF1 A;  2K1F A;  3PRP B;  4K81 A;  3N3K B;  3KYC D;  3QCA A;  3SD5 A;  1WFY A;  4EUT A;  2DZI A;  4CO7 A;  2HE7 A;  3I3T B;  3AU5 A;  2DAJ A;  2LGY A;  3K9P B;  2KLC A;  1E7V A;  4BBN F;  3PLV A;  5AZG A;  3UIP B;  4ANW A;  3PS6 A;  1WGY A;  2WWZ A;  4OVU A;  2KHW B;  5DPS A;  2D11 A;  1YD8 U;  4RMA A;  1LM8 B;  3X0W A;  4GOC A;  3SDL C;  1TGZ B;  2O2V A;  4WJQ A;  1P0R A;  3R7R A;  1U4A A;  4WJP A;  4GU2 A;  4EKU A;  3H7S A;  3PRZ A;  3ZNI D;  3UF8 A;  1V2Y A;  1J8C A;  4AOF A;  2RSU A;  3L10 B;  4EZJ A;  4W9J A;  1WIA A;  2NR2 A;  3W1Y A;  2Z59 B;  3L16 A;  2FCQ A;  3TBL D;  5AZH A;  4WJO A;  1V81 A;  2V3S A;  1QZE A;  1NI2 A;  2DHZ A;  1PQS A;  2IBI B;  2I1K A;  4FJY A;  4BKS A;  3EHV A;  1WX9 A;  3R7Q A;  3VVW B;  1LFD A;  4II2 B;  4IM3 A;  1Z2M A;  1KM7 A;  2KN5 A;  3M62 B;  2BKR B;  4G50 A;  3AUL A;  3PZD A;  4TV3 A;  3CF6 E;  4MDK E;  5AEK B;  3JSV B;  2L05 A;  4K7U A;  2KWC A;  3ENE A;  5D6J B;  1NBF C;  1P98 A;  3W1S A;  5EDS A;  3QQ8 B;  4MGY E;  2JRH A;  4WWN A;  1WI0 A;  1WE7 A;  1V6E A;  3A33 B;  4BOS C;  1UZX B;  2FUH B;  3UGB B;  2KTR A;  2QHO A;  2A5U A;  3N32 A;  2WDT B;  3WA0 A;  4GXB A;  1J19 A;  4LJO B;  4G0N B;  1WXA A;  2PEA A;  2IZV B;  4E3C A;  2L0T A;  4W9L A;  2BGF A;  1E90 A;  4BVU C;  2OJR A;  2AWT A;  3R66 C;  4NQL B;  1WF9 A;  3OJ3 A;  5G55 A;  3PHX B;  2BWE S;  4HLE A;  4IWQ A;  2KKC A;  4AP4 C;  2KJH B;  3KW5 B;  3T9L A;  2BYE A;  2DEN B;  2MW5 A;  4HWI B;  4PS3 A;  4HDO A;  1T0Y A;  2N7E A;  1XD3 B;  5CHV C;  4YL8 A;  2KJ6 A;  4WJN A;  1YJ1 A;  3PRE A;  1K8R B;  4ZYN A;  2KO3 A;  2MSE D;  1KOT A;  4GGQ A;  2J0J A;  1E7U A;  4URK A;  1L2N A;  2KWU B;  4M8M A;  4FHK A;  2O6V D;  4FN2 A;  4FA6 A;  1WJU A;  4GDL B;  1H4R A;  1P9D U;  2BYV E;  3ZVV A;  1UBQ A;  1GUA B;  3VUW A;  5AZF A;  4DHJ D;  4K7W A;  2UYZ B;  2HTH A;  1WX8 A;  4BFR A;  1WGD A;  3QJZ A;  2ZNV B;  2GBM A;  1ZGU B;  2M4N A;  1L7Y A;  5FR6 A;  3UIO B;  4KV2 A;  3ZDT A;  1E5W A;  3HM3 A;  2Z0E B;  2JRI B;  3LDZ E;  3H7P A;  3JYU A;  1WXM A;  4KZ0 A;  3V6E B;  3A4S C;  1WJ6 A;  1UEL A;  1WRD B;  1WR1 A;  4ZRJ A;  2REX A;  1Q5W B;  1WE6 A;  1GC7 A;  1WGR A;  2DZJ A;  2FAZ A;  3V60 A;  5D94 A;  5DCN A;  4EOY A;  5D2M B;  2D10 A;  3EEC A;  2C7N B;  1C1Y B;  1WR6 E;  2PE9 A;  3AI5 A;  3JSV A;  3V61 A;  3OLM D;  3NZU A;  3AXC A;  4WWP A;  4W9F A;  3QAQ A;  1F9J A;  3Q3F A;  4I6P A;  3S2A A;  2MRP A;  2KD0 A;  2O6V B;  3IFW B;  2KX3 A;  2LXA A;  1XT9 B;  4KDL B;  2DYM A;  4CYE A;  2ZZP B;  4DHJ B;  2CR5 A;  2C7H A;  2DZK A;  3DVN V;  4TKN A;  5CHW A;  4GB9 A;  4XX5 A;  3TL5 A;  1X1M A;  5J17 A;  4FJZ A;  3ZO5 B;  3OJ4 B;  4LDT D;  4G3X B;  4NJ6 A;  2NCN A;  5LXI B;  1G6J A;  2LVO A;  1V80 A;  3NY5 A;  4HJK A;  2GBN A;  3ZNZ B;  3DBS A;  2K6D B;  2PJH A;  3U30 A;  3MJW A;  2MQJ A;  1RRB A;  2L76 A;  3H6N A;  3QIJ A;  1GJZ A;  1OEY A;  1RLF A;  3NZS A;  1FXT B;  2K25 A;  2XBB C;  5IAA C;  2VRR B;  4FUL A;  2MCN B;  1P1A A;  3PPA A;  3ZDM C;  4GDL A;  3ZUN A;  1R4N I;  3D32 A;  3VAW A;  3M63 B;  2Z0D B;  4RM9 A;  4NNJ B;  1I42 A;  3ML8 A;  3RUI B;  3WAN A;  1P3Q U;  3APF A;  3ALB A;  3VXW A;  1WXV A;  5E6N A;  3H7P B;  3KUC B;  4KZC A;  2KJR A;  2KTF A;  3APD A;  3VTW A;  4BKT A;  2IYD B;  2LRU A;  2MLB A;  4NAW B;  3PTF C;  3VQI A;  3DOW A;  1KJT A;  5JH5 C;  2LRW A;  4A3O A;  4JL9 A;  4ZDV A;  4KDI C;  3VHT C;  5CTR C;  2I1J A;  2FCM A;  2JT4 B;  2FID A;  4ZRI A;  2KC2 A;  2OOB B;  4LDT B;  1V86 A;  3W1S C;  5J2R A;  4IG7 B;  3RYT A;  4DWF A;  4W9K A;  2KK8 A;  4HPM B;  4F8C B;  2L7R A;  3QC8 B;  4DK5 A;  2K8B A;  3VTV A;  2V1Y A;  5C23 A;  2BF8 B;  4ASW C;  2CS4 A;  3WAO A;  2KDE B;  4GIV A;  2ZCB A;  4GSW A;  1D3Z A;  2K8H A;  2GBR A;  4TQ0 A;  2O6V A;  2NBW B;  3C0R B;  5HKH A;  1WZ3 A;  1S3S G;  2W9N A;  3PT2 B;  2MP2 A;  3DVN U;  3RD2 A;  1UD7 A;  2KLG A;  4DBG A;  3DBL I;  3ZTD A;  3ONS A;  3WIM A;  4OVV A;  4ZRK A;  1IP9 A;  2CHX A;  2KMC A;  2RR9 A;  3GOE A;  4MEM A;  4W9H A;  1OTR B;  4FHJ A;  4MGI E;  3B1L X;  2CKH B;  4LCD E;  1UH6 A;  2G4D B;  2N4F A;  2Y5B B;  2ZVN A;  4TQ1 A;  1YQB A;  2ZEQ A;  4MH0 E;  1AAR A;  2JF5 A;  5TR5 A;  4DDG D;  2EMT A;  1VD2 A;  1C3T A;  1SGH A;  2DAF A;  2M8S A;  1WMH B;  4AJY B;  4AUQ C;  3RZW C;  2N9P C;  3HIZ A;  4AJW A;  4NJ7 A;  4BOZ B;  5LLI A;  2GOW A;  3HHM A;  4HCN B;  3UQA A;  4JLC A;  3O65 B;  4I6L B;  2JY6 A;  2FIF A;  2RPQ A;  3WAP A;  3CSF A;  2AL6 A;  4W9I A;  2M17 A;  3OAW A;  1EF5 A;  1YX5 B;  3KH0 A;  4X57 B;  3IHP C;  1YX6 B;  1WYW B;  2ZVO A;  4K7S A;  3U7D A;  2MBE A;  4IM2 A;  2EKE C;  2JXX A;  3N30 A;  4EEW A;  4JGH B;  3U8Z A;  2L8J A;  4NAW A;  3UIN B;  2NBV B;  1LXD A;  2K8C A;  2IO3 B;  2LWP A;  2IY0 B;  5E6O A;  4A3P A;  5DPT A;  2ZCC A;  3DBH I;  1GC6 A;  5JHA A;  2UWQ A;  3L0W B;  1ZKH A;  3VH3 B;  3ZRF A;  2IO1 B;  1WM2 A;  4CHK A;  2R2Q A;  4TUU A;  2MBB B;  1WX7 A;  3A9J B;  3JVZ X;  3PSE B;  1NDD A;  2XEW A;  3QK0 A;  2KFK A;  2FNJ B;  2WX0 A;  2JZ3 B;  2KQS A;  4EZL A;  2LGX A;  4FBJ B;  2FCS A;  3HK0 A;  1CMX B;  2MP2 B;  2NBU A;  3QAR A;  4G11 A;  4ICV A;  4XZ4 A;  3CMM B;  3TJP A;  1J0G A;  3NHE B;  4DDI D;  4FLH A;  2AEH A;  4W9G A;  4AWJ A;  3M3J A;  4KIK B;  2KZR A;  2IO2 B;  4FAD A;  2J0M A;  3ZW3 A;  1BT0 A;  4WQO B;  2HD5 B;  2J7Q B;  1WY8 A;  2KWV B;  2MA9 B;  4MM3 A;  5E6P A;  4DXA B;  1S1Q B;  3EC8 A;  3H9D A;  3ML9 A;  2R2O A;  5L83 A;  5JZE B;  2LVQ A;  2N1W A;  3PRM B;  3HM6 X;  4N9F 4;  3TIX A;  3QWZ B;  5KHO A;  1WJ4 A;  4DHZ E;  3DVG Y;  4KSK C;  3PHW B;  2DZM A;  2M1M A;  5CHF A;  4PYU A;  1IYF A;  4HXD A;  2BYF A;  2WX1 A;  1EUV B;  2KX0 A;  4JIO U;  1OQY A;  2RD0 A;  2PE6 B;  4MJS B;  4MGK E;  4W9D A;  2D3G A;  2WYQ A;  4HK2 A;  2ASQ A;  3DQV A;  2HJ8 A;  3P2B A;  4F7Z A;  4HPL B;  3KVF B;  1V5O A;  2A4Z A;  3L54 A;  1WMH A;  2YVC A;  3DCG A;  4MSM B;  4EFO A;  4GDK B;  3APC A;  2C7M B;  3VUX A;  2N9E B;  2JPH A;  2LJ5 A;  2L0F A;  4HDQ A;  5GMV A;  2JWZ A;  3EFU A;  3H1U A;  1MG8 A;  2ZNV C;  3IG3 A;  4GMV A;  3M95 A;  1IPG A;  4K1R B;  3UQB A;  1ZW7 A;  2K6Q A;  3V6C B;  2GMI C;  2NVU I;  3A9K B;  3KUZ A;  3SU8 X;  2L00 B;  3QHT A;  1TBE A;  2AL3 A;  3ZNH B;  3K9O B;  1OEY J;  2CHZ A;  2LGD A;  4P7I A;  1JRU A;  1WXS A;  2LAS A;  3IVF A;  3PVL A;  4I6N B;  3VH4 B;  1WM3 A;  2RGF A;  4B9K A;  2V4L A;  3QX1 A;  5LXH A;  3BIN A;  4BBN C;  3VTU A;  2KFK B;  3KYD D;  2KDF B;  4PYZ A;  2C9W B;  4MSQ B;  1R4M I;  2NPT B;  5IA7 A;  2DX5 B;  5C1Z A;  3MHS D;  1GG3 A;  4LJP B;  3A9J A;  1UBI A;  4PS8 A;  5BO4 B;  1LQB A;  2DYO A;  3NS8 A;  4DHZ B;  3VDZ A;  1E8Y A;  3WAL A;  1H8C A;  3A1Q B;  4HVB A;  3DVG X;  1VCB A;  5JHB A;  2CHW A;  2N9X A;  1SIF A;  2L3Z A;  2KC1 A;  2PPH A;  3SHQ A;  2MX2 A;  4EZK A;  4KIK A;  4ICU A;  3PLU A;  3MTN B;  4NY0 A;  2ZPY A;  4F1S A;  2LVP A;  4II3 B; 
#chains in the Genus database with same CATH topology
 1WGG A;  1ZE3 D;  1BML C;  1A5R A;  4RF0 A;  4REZ A;  2KNB A;  2K0P A;  3GE8 C;  3ZRC A;  3R3M A;  5FK9 C;  4TMA B;  1Q0W B;  3PZ8 A;  2BPS A;  3J9C A;  4M8N A;  3L13 A;  1GNU A;  3WAM A;  1Q1O A;  1XQQ A;  2NTS A;  3T8M A;  1EM7 A;  4RNA A;  4PT5 A;  3LYY A;  3Q3J A;  2BQQ A;  3PV1 A;  3A9K A;  2LZ6 A;  5G2N A;  4HRO A;  1KLV A;  1ZOY B;  2K39 A;  5L95 C;  3DBR I;  2KWD A;  2J0K A;  4OZC A;  4LNI A;  5CX3 A;  4DXG A;  1R7S A;  4A20 A;  3LXF A;  3T3N A;  1I35 A;  2ZJD A;  2GBK A;  3X23 A;  4ANX A;  4XC2 A;  1FRR A;  4WAF A;  3ZNG C;  3TMP B;  2WXQ A;  1M94 A;  3ABV B;  5EE1 A;  2B3A A;  3ECI A;  5EE3 A;  3ZYY X;  4NJC A;  3AE8 B;  2KMA A;  3KQ4 A;  3SR6 A;  2WLB A;  3PZ7 A;  4XWW A;  1EWC A;  3MHZ A;  4M0W A;  4A8X C;  4IW0 A;  2KDB A;  2N7D A;  4IUM B;  1TT5 B;  1HZ5 A;  1SF0 A;  2G45 B;  3WCQ A;  4OW0 A;  3EFC A;  2K1F A;  3PRP B;  3QCA A;  1WFY A;  3FC4 A;  3P4S B;  4EUT A;  3AU5 A;  1UF0 A;  4RFB A;  4ANW A;  4OVU A;  2WWZ A;  4AQ7 A;  4JPS A;  4GOC A;  2O2V A;  4WJQ A;  1P0R A;  1U4A A;  4ZOH C;  4GU2 A;  4EKU A;  1TS2 A;  3ZNI D;  3EUB 2;  2BT6 A;  2RSU A;  1ZUD 2;  1C76 A;  4WJO A;  3AE1 B;  1QZE A;  1PQS A;  4FJY A;  2LEK A;  1AW7 A;  3VVW B;  3PZD A;  3CF6 E;  1SB3 C;  3JSV B;  3QQ8 B;  2JRH A;  2X38 A;  1WI0 A;  4P6V F;  3WA0 A;  1J19 A;  3ZGZ A;  2IZV B;  2L0T A;  5AUI A;  2V9H A;  2BGF A;  1E90 A;  5I4D A;  2GLS A;  4IWQ A;  3GE3 C;  2DEN B;  2MW5 A;  4LNF A;  4HWI B;  4PS3 A;  5BYR A;  1T3Q A;  1XD3 B;  2H89 B;  3PRE A;  2TSS A;  4GGQ A;  1L2N A;  1E7U A;  2KWU B;  1N63 A;  4FN2 A;  3U7Z A;  1WJU A;  3ZVV A;  1GUA B;  4K7W A;  3AV8 A;  5HHD G;  2ZNV B;  2JX5 A;  2KMM A;  2RDG A;  1FMA D;  1XCT L;  1WGK A;  3HRD D;  4TSS A;  2JRI B;  2W54 A;  3LDZ E;  1XO3 A;  1WXM A;  3TSS A;  4KZ0 A;  3U4E G;  2WXG A;  1UEL A;  1WRD B;  2H88 B;  4RGO S;  1WE6 A;  2NTT A;  2DZJ A;  2FAZ A;  3V60 A;  4EOY A;  5D2M B;  1WR6 E;  3AI5 A;  4FXC A;  4LK0 M;  1F9J A;  3Q3F A;  2Y5C A;  1T6B X;  2D5G A;  1B1Z A;  4HEA 1;  4DQO C;  2KX3 A;  3P4P B;  2RDB C;  3BK2 A;  2ZZP B;  3DVN V;  1NVI D;  4GB9 A;  5CHW A;  1TKY A;  4NJ6 A;  1EU3 A;  2DWQ A;  1G6J A;  3NJT A;  4N59 A;  3ZNZ B;  2K6D B;  2PJH A;  1YJJ A;  3FIL B;  3NZS A;  2K25 A;  2XBB C;  1WSP A;  2MCN B;  3PPA A;  1JRO A;  1JCK B;  3M63 B;  1MHX A;  4NNJ B;  1P3Q U;  3APF A;  1XXG A;  3AE5 B;  5E6N A;  4M00 A;  2LFI A;  3APD A;  3B2G A;  5GXG B;  3VTW A;  4BKT A;  2MLB A;  5JH5 C;  2QJL A;  3V3X A;  2J42 A;  5CTR C;  2JT4 B;  2FCM A;  4ZRI A;  1TS4 A;  2QC8 A;  2MJ3 A;  1AWD A;  3AEB B;  2L7R A;  2W3S A;  1PYW D;  4YXD B;  4ASW C;  3WAO A;  1TY0 A;  3DWM A;  1T0S C;  1N62 A;  2GBR A;  2NBW B;  3C0R B;  1L6U A;  3DVN U;  2KLG A;  3ONS A;  4OVV A;  2KMC A;  1OTR B;  4MGI E;  1E0Z A;  1ZDV A;  1UH6 A;  5IKC M;  2N4F A;  2HDE A;  1HZ6 A;  2ZEQ A;  2EMT A;  1SSN A;  1VD2 A;  3T3O A;  2GRI A;  3RZW C;  2N9P C;  4NJ7 A;  2AQ1 B;  1Y56 A;  3UQA A;  4JLC A;  2BB6 A;  2LHD A;  4I6L B;  2JY6 A;  2AL6 A;  4S0R A;  2WXH A;  2INN E;  2EKI A;  2MBE A;  1A70 A;  1T0Q C;  3NS1 A;  1LXD A;  2IY0 B;  2WU2 B;  3L0W B;  4DXF A;  3ZRF A;  1E6E B;  4TUU A;  1WX7 A;  1P7F A;  1TS5 A;  2FNJ B;  2WX0 A;  4WH4 A;  1FXI A;  2NBU A;  3TJP A;  1J0G A;  4DDI D;  1V8C A;  3M3J A;  1Q10 A;  2NMQ A;  2J0M A;  3N1Y C;  1WY8 A;  2KWV B;  3AE7 B;  1EWY C;  3H9D A;  1XLO A;  2R2O A;  5JZE B;  4JWU C;  5KHO A;  3DWG C;  3DVG Y;  2PW9 A;  5CHF A;  1IYF A;  2K5P A;  4HXD A;  3N20 C;  5IOI A;  1JQ4 A;  3KVF B;  1V5O A;  2A4Z A;  3APC A;  2C7M B;  3VUX A;  2JPH A;  2LJ5 A;  4C4V A;  3RI7 C;  2ZNV C;  1I7H A;  3SEB A;  3UQB A;  1IPG A;  1ZW7 A;  2K6Q A;  2GMI C;  1MFW A;  2L52 A;  1TKE A;  2JWU A;  1OEY J;  3CWI A;  3GZN B;  1XLN A;  4P7I A;  2QCZ A;  2RGF A;  4B9K A;  3BIN A;  4BBN C;  3KYD D;  1C79 A;  2C9W B;  2NPT B;  2WP9 B;  1JRP A;  1YOV B;  1KTK A;  3VDZ A;  3WAL A;  1F2R I;  1J7C A;  1VCB A;  4YWG G;  2CHW A;  2PPH A;  4HRS A;  4EZK A;  2WXF A;  3NVZ A;  2ZW0 A;  3CIR B;  2HJ1 A;  2RPV A;  4BKS D;  1WWT A;  2YLM A;  4E71 A;  2LGI A;  1TZ1 A;  2MBH A;  3BY4 B;  3H8H A;  3PO0 A;  1FNV A;  5DPW A;  4A9A A;  3L17 A;  2LJI A;  4MJS A;  3Q8C A;  4IWP A;  1E8Z A;  2LD9 A;  4W9E A;  4WWO A;  1L4D B;  2IGD A;  4HCP B;  4GDK A;  2XK5 A;  3RZF A;  2WXI A;  3AMZ A;  2PIA A;  2EEL A;  2VZK B;  3ZTC A;  2ONQ A;  1TTN A;  1K50 A;  1PGA A;  1YIW A;  3AU4 A;  4RM8 A;  3IBE A;  4PK1 A;  2K9X A;  3RCZ A;  3ZJU A;  1IGC A;  1Z5S B;  2W3R A;  4OZB A;  1TYG B;  3DPD A;  1QOA A;  4NQK E;  2BS4 B;  4LNK A;  1D4B A;  2IND C;  2LI5 A;  3V62 A;  1JAL A;  3A1Q A;  2KQ4 X;  2KAN A;  5D7G A;  2LXC A;  2JQR B;  4B6W A;  2VH2 A;  3ZLZ A;  1V9J A;  2IY1 B;  4A6Q A;  2AQ2 B;  2WNM A;  4ZHP A;  1TY2 A;  3GP7 A;  2XK5 B;  1WH3 A;  1EF1 A;  3KYC D;  3N9Y C;  2DZI A;  4CO7 A;  1ZDX A;  1YN5 A;  4XWT A;  4IDI A;  3AEC B;  3UIP B;  3PS6 A;  1NEN B;  2QIL A;  1LM8 B;  1FXA A;  3B9J A;  2PVG C;  3ZJV A;  2JYT A;  1N6Z A;  3H7S A;  4WQM A;  1LGR A;  3UF8 A;  4AOF A;  3L10 B;  4EZJ A;  4W9J A;  1YQ3 B;  3L16 A;  2FCQ A;  5AZH A;  3HVZ A;  1V81 A;  1F77 A;  1NI2 A;  2DHZ A;  2KYW A;  2I1K A;  4BKS A;  5FR3 A;  4HJG E;  3ZXV A;  3AUL A;  4TV3 A;  4K7U A;  3ENE A;  5D6J B;  1P98 A;  4XE0 A;  3U52 E;  1UZX B;  2FUH B;  2WS3 B;  2QHO A;  2SAK A;  1R4N B;  5EE0 A;  2LHE A;  4S17 A;  1MPE A;  2PEA A;  2Y5P A;  2M19 A;  4BVU C;  4NQL B;  1CZP A;  1WF9 A;  3OJ3 A;  3AED B;  4HLE A;  2KKC A;  1YN3 A;  3KW5 B;  3T9L A;  4YSZ B;  1KLG D;  4A90 A;  1VZ8 A;  2N7E A;  2KJ6 A;  1KOT A;  2J52 A;  2QMT A;  2J0J A;  3N1Z C;  4YTM B;  4M8M A;  1F1H A;  1XLP A;  4GDL B;  2ZW1 A;  2XNA C;  1YJI A;  3VUW A;  4NAM A;  3Q8F A;  2N7J A;  3IT6 B;  3QJZ A;  2WGS A;  4QAY A;  1ZGU B;  4YTP B;  4KV2 A;  1E5W A;  3HM3 A;  2Z0E B;  3H7P A;  3JYU A;  1FNW A;  2QSD A;  2D10 A;  3JSV A;  3V61 A;  3OLM D;  4WWP A;  4W9F A;  4I6P A;  4ARI A;  1UGJ A;  2LXA A;  1XT9 B;  4KDL B;  2CR5 A;  3IT4 B;  2C7H A;  4TKN A;  5BMG A;  3O13 A;  4WUR A;  3TL5 A;  4LTU A;  3LB8 C;  4G3X B;  5LXI B;  2LVO A;  3NY5 A;  4HJK A;  3U30 A;  2MQJ A;  3QIJ A;  2JSV X;  1GJZ A;  1UUP A;  1FCL A;  4FUL A;  3D32 A;  3VAW A;  3B2F A;  1SJH D;  1QF6 A;  2YEP F;  2Z0D B;  1E10 A;  3ML8 A;  4KKJ A;  3VXW A;  1WXV A;  3H7P B;  5HG2 A;  2E6X A;  3KUC B;  2KJR A;  2IGH A;  1NYR A;  1ZPS A;  2IYD B;  3DOW A;  1KJT A;  4D2K A;  2KC2 A;  2OOB B;  3AE3 B;  4LDT B;  3RYT A;  2BS3 B;  4DWF A;  4W9K A;  2KK8 A;  5H92 C;  1L4Z B;  4JE3 B;  2K8B A;  2BF8 B;  3IAM 1;  2ZCB A;  1D3Z A;  2QIE B;  4TQ0 A;  5HKH A;  4EE2 A;  2IPK D;  2MP2 A;  3ZTD A;  3I63 C;  4MM3 B;  1IP9 A;  2G1E A;  2RR9 A;  2MH7 A;  4USA A;  4RGN A;  1VZ7 A;  3R2I A;  1AAR A;  1EU4 A;  3Q8A A;  1WRI A;  1HTQ A;  2M8S A;  1WMH B;  4BOZ B;  3FIL A;  3O65 B;  1L0V B;  1BUI C;  3BVZ A;  2WDV B;  4N58 A;  3VR9 B;  2RPQ A;  1JWM D;  1D5M C;  4HKZ E;  1MHH E;  2M17 A;  3OAW A;  1YX5 B;  3DBL B;  3KH0 A;  3SFD B;  3IHP C;  4K7S A;  2PKO A;  4IM2 A;  2EKE C;  1STE A;  3N30 A;  2CU3 A;  1QQR A;  2CJN A;  2L8J A;  2NBV B;  2LWP A;  2UU7 A;  3DBH I;  5JHA A;  1SBB B;  4JWS C;  3VH3 B;  2IO1 B;  2R2Q A;  3A9J B;  3QK0 A;  2PVO D;  2JZ3 B;  2KQS A;  4FBJ B;  3HK0 A;  1CMX B;  2MP2 B;  3NHE B;  3P42 A;  1RM6 C;  4AWJ A;  2IO2 B;  2PTL A;  3BYY B;  3Q2A C;  2N9K A;  1NEK B;  2HD5 B;  2KT7 A;  3RFZ B;  2J7Q B;  3L4P A;  3ML9 A;  1C4C A;  3TIX A;  2V4I B;  2DZM A;  4PYU A;  2BW2 A;  1EUV B;  2KX0 A;  1N60 A;  2RD0 A;  1FD6 A;  2E3T A;  1HA5 A;  1NI3 A;  3MC9 A;  2YVC A;  3DCG A;  4MSM B;  4EFO A;  3Q69 A;  2L0F A;  2JWZ A;  5TSS A;  2DNF A;  2DLB A;  3M95 A;  2NVU I;  3KUZ A;  3SU8 X;  3BWU D;  3QHT A;  1TBE A;  1QKZ A;  3PVL A;  3AE4 B;  1WM3 A;  1NYQ A;  3HUI A;  2WXM A;  2WU5 B;  1VLB A;  1TZO A;  2MJE A;  1R4M I;  4RGM A;  1FPY A;  1LQB A;  2DYO A;  3NS8 A;  3TEZ A;  1C78 A;  2VZK D;  4C56 C;  3DVG X;  2D3B A;  2I2Y A;  4ICU A;  4NY0 A;  1FFU A;  3WIM A;  2LVP A;  4CQN A;  1M4V A;  1EO6 A;  4KGS A;  2MWS B;  3A4R A;  1UWM A;  3B0A A;  1ISN A;  3MC8 A;  4PS7 A;  1SE9 A;  5J18 A;  1CJE A;  4E74 A;  3Q3O C;  5G5H A;  1KFY B;  1J7A A;  1K53 A;  1KRH A;  1VRA B;  2KOX A;  1E8X A;  4WAA A;  1FO4 A;  2ON8 A;  3RT3 B;  3W2D A;  1TKG A;  3LJ3 A;  2ZPN A;  3GS2 A;  1KLU D;  1RFA A;  4US9 A;  4IC7 B;  3ZIM A;  3DDC B;  3VRB B;  1XF5 L;  3VUY A;  3KWL A;  5DPR A;  1GAQ B;  4IWO A;  4GN1 A;  3MJ5 A;  2KQ7 A;  4BKG A;  3BVG A;  5KHQ A;  4KVG B;  3NVY A;  2WDQ B;  3CST A;  4XDD A;  4FJV B;  2C5L C;  1V49 A;  2NPT A;  3RUL A;  2D07 B;  3RNB C;  4MEL A;  3AE6 B;  1L5P A;  1HTO A;  2KDI A;  2KTR B;  2JXT A;  1UGM A;  2BB5 A;  3W9C B;  2G3Q B;  1B9R A;  1IBX B;  2CU1 A;  2QDF A;  4ANV A;  4BAX A;  2BKF A;  4Q2J A;  3VR8 B;  2C60 A;  2AQ3 B;  2KDM A;  3B08 A;  1OGW A;  2L1A A;  2GBJ A;  3N3K B;  2N0S B;  3I3T B;  2DAJ A;  2LGY A;  1E7V A;  4BBN F;  1RWS A;  1WYG A;  3V05 A;  1YD8 U;  2D11 A;  4RMA A;  1K51 A;  4WIP A;  3KWV A;  3R7R A;  4WJP A;  1FM0 D;  3PRZ A;  1V2Y A;  2BBC A;  1ENF A;  3W1Y A;  1WIA A;  3UI3 A;  4GLS C;  1WX9 A;  3R7Q A;  1LFD A;  2KN5 A;  5AEK B;  2KWC A;  1NBF C;  5EDS A;  4WWN A;  3A33 B;  2FUG 1;  4BOS C;  3UGB B;  2A5U A;  3N32 A;  4A55 A;  4GXB A;  3KLS X;  4AS1 A;  4LJO B;  2IDY A;  1DGJ A;  1WXA A;  4W9L A;  4ZHO A;  2OJR A;  1C77 A;  3R66 C;  3SFE B;  5G55 A;  4AP4 C;  2DBY A;  2KJH B;  3HVD A;  3FAH A;  1T0Y A;  5CHV C;  4YL8 A;  4WJN A;  1K8R B;  4ZYN A;  3TEX A;  2MSE D;  2J4X A;  4URK A;  2VH1 A;  4FHK A;  1IGD A;  1TJE A;  1D6E C;  2BYV E;  3RN9 C;  1UBQ A;  5FKA C;  2HTH A;  1WX8 A;  4BFR A;  2MEK A;  5G5G A;  2M4N A;  3UIO B;  4P1B C;  3E9S A;  4RF1 A;  1T0R C;  2FE8 A;  1WJ6 A;  1WR1 A;  1Q5W B;  1WGR A;  3EEC A;  2C7N B;  2PE9 A;  3NZU A;  5C3J B;  1QLB B;  3S2A A;  1ROE A;  2O6V B;  3IFW B;  2BTE A;  1JWB D;  2DYM A;  1L6V A;  4DHJ B;  2DZK A;  1J7B A;  3OJ4 B;  4LDT D;  1E9M A;  3AN1 A;  2N9L A;  2NCN A;  1PFD A;  2GBN A;  1JWU D;  3OG5 A;  4MT5 A;  3GB1 A;  3MJW A;  5T8I A;  2L76 A;  2R61 A;  1HXY D;  1RLF A;  1FXT B;  4GDL A;  3P63 A;  3W5U B;  2IGG A;  2MJD A;  3RUI B;  3AEA B;  3ALB A;  3Q14 C;  3EGR A;  1SE2 A;  2KTF A;  3C8Y A;  2LRU A;  4NAW B;  3PTF C;  3VQI A;  2D3A A;  4KDI C;  3VHT C;  2I1J A;  3TUO A;  2FID A;  1N61 A;  3W1S C;  1DOX A;  4HPM B;  4F8C B;  4P1C C;  3QC8 B;  4DK5 A;  2V1Y A;  1SXT A;  2KDE B;  4GIV A;  1WZ3 A;  1S3S G;  2W9N A;  3DHH C;  3RD2 A;  1UD7 A;  4DBG A;  3DBL I;  1I4H A;  4US8 A;  2CHX A;  1RYJ A;  3GOE A;  4FHJ A;  2KVZ A;  4TQ1 A;  1YQB A;  3ETR A;  1PDX A;  1MVK A;  4MH0 E;  5H8Y E;  2BYT A;  3MC0 B;  4DDG D;  1ZXI A;  3RMK C;  1YMH E;  2DAF A;  4AUQ C;  3HIZ A;  1D5Z C;  4AJW A;  3NZ3 A;  2GOW A;  3WAP A;  3RNC C;  1I4G A;  2RDH A;  4W9I A;  4X57 B;  1EF5 A;  2L83 A;  2ZVO A;  5BYS A;  4EEW A;  1V1P B;  1IUE A;  3ZJT A;  3UIN B;  2K8C A;  5IO9 A;  3NUH B;  5E6O A;  4RGT A;  2ZCC A;  1GC6 A;  1XEE A;  2UWQ A;  1ZKH A;  3W5V B;  3N1X C;  1V1O A;  1WM2 A;  2MBB B;  3PSE B;  4KGR A;  2XEW A;  4EZL A;  3BYT B;  3QAR A;  4XZ4 A;  4ICV A;  4FLH A;  2AEH A;  4W9G A;  4KIK B;  2KZR A;  4B0E A;  4FAD A;  1BT0 A;  4WQO B;  1KH0 A;  1FRD A;  2W82 A;  4MM3 A;  5E6P A;  4H2A A;  4YSY B;  5JXV A;  3EC8 A;  3I9V 1;  4OVZ A;  5L83 A;  2WXR A;  2LVQ A;  2N1W A;  4NZL B;  4N9F 4;  3QWZ B;  2WXO A;  5HI1 A;  3PHW B;  4XYC A;  3VRA B;  2WX1 A;  1OQY A;  2WYQ A;  3P2B A;  4F7Z A;  3Q6B A;  1WMH A;  1WXQ A;  2W55 A;  4HDQ A;  3H1U A;  1MG8 A;  3IG3 A;  4K1R B;  3V6C B;  3ZXR A;  3A9K B;  4C7Z A;  2L00 B;  4KGT A;  3ZNH B;  3K9O B;  1GPX A;  5C2T B;  2CHZ A;  4YSX B;  1JRU A;  1QOF A;  2LAS A;  3IVF A;  4I6N B;  3AE9 B;  4ITK A;  2V4L A;  3QX1 A;  5LXH A;  1UNS A;  5LNK 1;  3VTU A;  4PYZ A;  1L0X B;  4LNO A;  5IA7 A;  2DX5 B;  4LJP B;  3A9J A;  1UBI A;  3RNG C;  4DHZ B;  1E8Y A;  4IKG A;  1H8C A;  3IAS 1;  4LLG M;  4HVB A;  1N5W A;  1XLQ A;  1SIF A;  2GB1 A;  2KC1 A;  3SHQ A;  2MX2 A;  3PLU A;  3MTN B;  4F1S A;  2ZPY A;  1PUT A;  3AB5 A;  3Q3M C;  3VFK A;  3PGE A;  2IO0 B;  2DYB A;  2QEJ C;  1MI0 A;  4L1B A;  2I38 A;  1E8W A;  2N1V A;  4M0W B;  4L2Y A;  2D2Q A;  1MG4 A;  1Y8R C;  1YQ4 B;  2MBO A;  2Q5W D;  4JQW C;  3AEE B;  2KXJ A;  2LUM A;  1VJK A;  2GI9 A;  2M56 B;  3AE2 B;  1GOZ A;  2KVR A;  2ICI A;  1JWS D;  1HE8 A;  1ET6 A;  1RAX A;  2FCN A;  2EMS A;  4NPN A;  1V5T A;  2JZZ A;  2KFJ A;  2M0X A;  1K52 A;  2G4S A;  1WJN A;  2LUE A;  3L08 A;  2O2V B;  1VR9 A;  2MHJ A;  4MGZ E;  1WZ0 A;  2D3C A;  2JUO A;  1WGH A;  4J6I A;  3KUD B;  4P16 A;  2AX5 A;  2JVC A;  3QA8 A;  5IN7 A;  2NS5 A;  3ZKJ C;  2BWF A;  1N5X A;  3JW0 X;  1HQR D;  2V3P A;  4IM0 A;  2PLP A;  5BMH A;  3AH7 A;  2AYO B;  4ANU A;  2HTM E;  3GZN I;  2OJW A;  4UDU C;  4W9C A;  1F52 A;  4C80 A;  3P4Q B;  3DBR B;  3I57 A;  2V3N A;  2X8X X;  3TCA A;  4KSL C;  1YNT E;  2MBQ A;  3NOB A;  3E56 A;  4B95 A;  2LMC A;  4K81 A;  2WQY B;  3SD5 A;  1F2R C;  1QOG A;  2HE7 A;  3Q3N C;  3K9P B;  2KLC A;  1L0Y B;  3PLV A;  5AZG A;  1PGX A;  1WGY A;  2KHW B;  5DPS A;  4YTN B;  4RH6 A;  3X0W A;  3SDL C;  2KAC A;  1TGZ B;  1FNU A;  4LNN A;  1J8C A;  1OFF A;  2NR2 A;  4O1N A;  5D3D A;  2Z59 B;  1C4P A;  3TBL D;  2V3S A;  3P4R B;  2IBI B;  1PGB A;  3EHV A;  2WXP A;  1CK1 A;  4II2 B;  4IM3 A;  1Z2M A;  1KM7 A;  3BZD B;  3M62 B;  2BKR B;  1SIJ A;  4G50 A;  4MDK E;  2L05 A;  3RNE C;  3BII D;  1FCC C;  3W1S A;  4MGY E;  1WE7 A;  1V6E A;  2KTR A;  2WDT B;  1C9F A;  3OWE B;  4G0N B;  2V0G A;  1I4P A;  4E3C A;  4XDC A;  1E7P B;  2INC C;  2WDR B;  4BZA A;  2AWT A;  4JX1 C;  3PHX B;  4ACF A;  2BWE S;  1IBX A;  2WXJ A;  4C7Y A;  1BXT A;  2BYE A;  3BVM A;  1SE4 A;  4HDO A;  1ZXH A;  1SE3 A;  1YJ1 A;  1DOY A;  2K3U A;  2KO3 A;  2CJO A;  3BK1 A;  2INP E;  1C4A A;  4XGA B;  5BYQ A;  1AYF A;  2O6V D;  4FA6 A;  1H4R A;  2WHI A;  3Q8B A;  1P9D U;  5AZF A;  4DHJ D;  2UYZ B;  5BMI A;  3AEG B;  3TEY A;  1WGD A;  2GBM A;  1P7E A;  1L7Y A;  5FR6 A;  3ZDT A;  1GB4 A;  4R3D A;  2PMV A;  1DOI A;  3V6E B;  1DYQ A;  3A4S C;  4ZRJ A;  4OZA A;  2L32 A;  2REX A;  1GC7 A;  1JML A;  5D94 A;  5DCN A;  1XCQ L;  3DHI C;  4ZRP A;  1C1Y B;  3AXC A;  2RMM A;  3QAQ A;  2MRP A;  3TEW A;  2K22 A;  2KD0 A;  3MP9 A;  2OED A;  4J3O D;  4CYE A;  1FEH A;  3EA6 A;  3NVV A;  1YN4 A;  1LO5 D;  4XX5 A;  1TIF A;  3MFG A;  1X1M A;  5J17 A;  4FJZ A;  3ZO5 B;  5E6J A;  1I4R A;  2KN4 A;  1V80 A;  3DBS A;  1RRB A;  2JZP A;  3H6N A;  3DBH B;  1OEY A;  2M0A A;  1HEZ E;  2VRR B;  5IAA C;  1P1A A;  3ZDM C;  3ZUN A;  1R4N I;  4RM9 A;  4N6E B;  1I42 A;  3WAN A;  4ZYS A;  1VZ6 A;  4KZC A;  1RFK A;  1ZP0 B;  1T5X D;  2LRW A;  4A3O A;  4JL9 A;  4ZDV A;  3R8B A;  5HFY A;  1V86 A;  5J2R A;  4IG7 B;  1GB1 A;  2SEB D;  2WXK A;  4B0M A;  3VTV A;  5C23 A;  2CS4 A;  4ZRQ A;  4GSW A;  2K8H A;  2O6V A;  1D5X C;  3PT2 B;  2B76 B;  1VDV A;  4HPP A;  2KAJ A;  3IXS A;  4ZRK A;  4W9H A;  4MEM A;  4IOI E;  1AN8 A;  3B1L X;  2CKH B;  4LCD E;  2G4D B;  2Y5B B;  1V97 A;  1QT9 A;  2ZVN A;  1TS3 A;  2JF5 A;  5TR5 A;  2FBW B;  2OHF A;  4KKI A;  1JWA D;  1C3T A;  1SGH A;  4WWM A;  2WXN A;  4AJY B;  3DHG C;  2J53 A;  5EE9 A;  1R4M B;  5LLI A;  3HHM A;  4HCN B;  4C4V B;  3RPF C;  4YT0 B;  2FIF A;  3CSF A;  2BS2 B;  3I5J C;  4MAC A;  1YX6 B;  1WYW B;  1MJD A;  1QIL A;  4KX6 B;  5D3I B;  2Z8L A;  3U7D A;  2JXX A;  4JGH B;  3U8Z A;  4NAW A;  5IP4 D;  2IO3 B;  3R2T A;  4A3P A;  5DPT A;  1ESF A;  1I4X A;  1JW9 D;  4K3C A;  5MPO A;  4CHK A;  2JYE A;  3JVZ X;  2YEP B;  4M01 A;  1NDD A;  2KFK A;  3NVW A;  1KF6 B;  3AM9 A;  1SEB D;  2LGX A;  2ACZ B;  2FCS A;  4RCO A;  4G11 A;  3CMM B;  3NRZ A;  2WXL A;  4C00 A;  3NG0 A;  3ZW3 A;  3C19 A;  1OQR A;  3AEF B;  2MA9 B;  4K3B A;  4L23 A;  4DXA B;  1S1Q B;  3PRM B;  3HM6 X;  1FFV A;  1ET9 A;  1ACC A;  1WJ4 A;  4KSK C;  3URY A;  2M1M A;  1FIQ A;  2BYF A;  4JIO U;  4W9D A;  3FKY A;  2PE6 B;  4MJS B;  4MGK E;  1OQQ A;  1UWX A;  2D3G A;  1F0Z A;  4HK2 A;  2ASQ A;  3DQV A;  2HJ8 A;  4HPL B;  3L54 A;  2G9H D;  4OHJ A;  3ZQ4 A;  4GDK B;  4MH8 A;  3RNA C;  2N9E B;  3P1M A;  5GMV A;  1CQV A;  3EFU A;  4GMV A;  2Y3A A;  2AL3 A;  2LGD A;  4HKQ A;  3RNF C;  3Q8E A;  3U2S C;  1WXS A;  2XN9 C;  1V1P A;  3VH4 B;  2BVC A;  4ARC A;  2IJ0 A;  4M02 A;  1SJE D;  2JU6 X;  2KFK B;  2KDF B;  4MSQ B;  5C1Z A;  3MHS D;  1GG3 A;  4PS8 A;  5AUK A;  5BO4 B;  3A1Q B;  5JHB A;  2N9X A;  2LGS A;  2L3Z A;  1QOB A;  4KIK A;  4DHZ E;  1I4Q A;  4II3 B; 
#chains in the Genus database with same CATH homology
 1WGG A;  3VFK A;  1A5R A;  3PGE A;  1EO6 A;  2IO0 B;  2MWS B;  2KNB A;  3A4R A;  2DYB A;  3B0A A;  4BKS D;  1ISN A;  4PS7 A;  1SE9 A;  2YLM A;  4E71 A;  5J18 A;  1E8W A;  2MBH A;  1TZ1 A;  2N1V A;  3ZRC A;  4M0W B;  4E74 A;  3R3M A;  3BY4 B;  2D2Q A;  1Y8R C;  5DPW A;  2KOX A;  2MBO A;  4JQW C;  3L17 A;  4MJS A;  1E8X A;  4IWP A;  1Q0W B;  4WAA A;  1E8Z A;  2LD9 A;  2KXJ A;  4W9E A;  4WWO A;  2BPS A;  3RT3 B;  4HCP B;  4M8N A;  3LJ3 A;  4GDK A;  2XK5 A;  2KVR A;  2ZPN A;  3L13 A;  1HE8 A;  1GNU A;  1RFA A;  3WAM A;  1RAX A;  2FCN A;  3RZF A;  1Q1O A;  2EMS A;  4NPN A;  3ZIM A;  1V5T A;  4IC7 B;  2JZZ A;  1XQQ A;  2KFJ A;  3T8M A;  3DDC B;  2M0X A;  2G4S A;  1WJN A;  3Q3J A;  3PV1 A;  3VUY A;  2LUE A;  3A9K A;  3L08 A;  2LZ6 A;  3ZTC A;  2O2V B;  5G2N A;  1TTN A;  4MGZ E;  1WZ0 A;  5DPR A;  2JUO A;  1KLV A;  1WGH A;  1YIW A;  2K39 A;  5L95 C;  3AU4 A;  4J6I A;  4IWO A;  3DBR I;  4GN1 A;  4RM8 A;  2J0K A;  2KQ7 A;  3KUD B;  4BKG A;  3IBE A;  5KHQ A;  4KVG B;  2JVC A;  3RCZ A;  5CX3 A;  3QA8 A;  3CST A;  4A20 A;  4FJV B;  1Z5S B;  2C5L C;  1V49 A;  2NPT A;  2NS5 A;  3RUL A;  2D07 B;  2ZJD A;  1I35 A;  3DPD A;  2GBK A;  3X23 A;  3ZKJ C;  4MEL A;  4NQK E;  4ANX A;  4XC2 A;  2LI5 A;  2BWF A;  3V62 A;  3A1Q A;  3ZNG C;  3JW0 X;  2KDI A;  2KTR B;  4IM0 A;  3TMP B;  2AYO B;  1M94 A;  4ANU A;  1UGM A;  2KAN A;  2B3A A;  3ECI A;  3GZN I;  5D7G A;  2LXC A;  4B6W A;  2KMA A;  3ZLZ A;  1V9J A;  4W9C A;  2G3Q B;  2IY1 B;  2CU1 A;  3TCA A;  4KSL C;  4IW0 A;  2MBQ A;  2KDB A;  2N7D A;  4IUM B;  4ANV A;  3NOB A;  2BKF A;  2XK5 B;  2C60 A;  4B95 A;  3B08 A;  2G45 B;  1OGW A;  1WH3 A;  2GBJ A;  1EF1 A;  2K1F A;  3PRP B;  4K81 A;  3N3K B;  3KYC D;  3QCA A;  3SD5 A;  1WFY A;  4EUT A;  2DZI A;  4CO7 A;  2HE7 A;  3I3T B;  3AU5 A;  2DAJ A;  2LGY A;  3K9P B;  2KLC A;  1E7V A;  4BBN F;  3PLV A;  5AZG A;  3UIP B;  4ANW A;  3PS6 A;  1WGY A;  2WWZ A;  4OVU A;  2KHW B;  5DPS A;  2D11 A;  1YD8 U;  4RMA A;  1LM8 B;  3X0W A;  4GOC A;  3SDL C;  1TGZ B;  2O2V A;  4WJQ A;  1P0R A;  3R7R A;  1U4A A;  4WJP A;  4GU2 A;  4EKU A;  3H7S A;  3PRZ A;  3ZNI D;  3UF8 A;  1V2Y A;  1J8C A;  4AOF A;  2RSU A;  3L10 B;  4EZJ A;  4W9J A;  1WIA A;  2NR2 A;  3W1Y A;  2Z59 B;  3L16 A;  2FCQ A;  3TBL D;  5AZH A;  4WJO A;  1V81 A;  2V3S A;  1QZE A;  1NI2 A;  2DHZ A;  1PQS A;  2IBI B;  2I1K A;  4FJY A;  4BKS A;  3EHV A;  1WX9 A;  3R7Q A;  3VVW B;  1LFD A;  4II2 B;  4IM3 A;  1Z2M A;  1KM7 A;  2KN5 A;  3M62 B;  2BKR B;  4G50 A;  3AUL A;  3PZD A;  4TV3 A;  3CF6 E;  4MDK E;  5AEK B;  3JSV B;  2L05 A;  4K7U A;  2KWC A;  3ENE A;  5D6J B;  1NBF C;  1P98 A;  3W1S A;  5EDS A;  3QQ8 B;  4MGY E;  2JRH A;  4WWN A;  1WI0 A;  1WE7 A;  1V6E A;  3A33 B;  4BOS C;  1UZX B;  2FUH B;  3UGB B;  2KTR A;  2QHO A;  2A5U A;  3N32 A;  2WDT B;  3WA0 A;  4GXB A;  1J19 A;  4LJO B;  4G0N B;  1WXA A;  2PEA A;  2IZV B;  4E3C A;  2L0T A;  4W9L A;  2BGF A;  1E90 A;  4BVU C;  2OJR A;  2AWT A;  3R66 C;  4NQL B;  1WF9 A;  3OJ3 A;  5G55 A;  3PHX B;  2BWE S;  4HLE A;  4IWQ A;  2KKC A;  4AP4 C;  2KJH B;  3KW5 B;  3T9L A;  2BYE A;  2DEN B;  2MW5 A;  4HWI B;  4PS3 A;  4HDO A;  1T0Y A;  2N7E A;  1XD3 B;  5CHV C;  4YL8 A;  2KJ6 A;  4WJN A;  1YJ1 A;  3PRE A;  1K8R B;  4ZYN A;  2KO3 A;  2MSE D;  1KOT A;  4GGQ A;  2J0J A;  1E7U A;  4URK A;  1L2N A;  2KWU B;  4M8M A;  4FHK A;  2O6V D;  4FN2 A;  4FA6 A;  1WJU A;  4GDL B;  1H4R A;  1P9D U;  2BYV E;  3ZVV A;  1UBQ A;  1GUA B;  3VUW A;  5AZF A;  4DHJ D;  4K7W A;  2UYZ B;  2HTH A;  1WX8 A;  4BFR A;  1WGD A;  3QJZ A;  2ZNV B;  2GBM A;  1ZGU B;  2M4N A;  1L7Y A;  5FR6 A;  3UIO B;  4KV2 A;  3ZDT A;  1E5W A;  3HM3 A;  2Z0E B;  2JRI B;  3LDZ E;  3H7P A;  3JYU A;  1WXM A;  4KZ0 A;  3V6E B;  3A4S C;  1WJ6 A;  1UEL A;  1WRD B;  1WR1 A;  4ZRJ A;  2REX A;  1Q5W B;  1WE6 A;  1GC7 A;  1WGR A;  2DZJ A;  2FAZ A;  3V60 A;  5D94 A;  5DCN A;  4EOY A;  5D2M B;  2D10 A;  3EEC A;  2C7N B;  1C1Y B;  1WR6 E;  2PE9 A;  3AI5 A;  3JSV A;  3V61 A;  3OLM D;  3NZU A;  3AXC A;  4WWP A;  4W9F A;  3QAQ A;  1F9J A;  3Q3F A;  4I6P A;  3S2A A;  2MRP A;  2KD0 A;  2O6V B;  3IFW B;  2KX3 A;  2LXA A;  1XT9 B;  4KDL B;  2DYM A;  4CYE A;  2ZZP B;  4DHJ B;  2CR5 A;  2C7H A;  2DZK A;  3DVN V;  4TKN A;  5CHW A;  4GB9 A;  4XX5 A;  3TL5 A;  1X1M A;  5J17 A;  4FJZ A;  3ZO5 B;  3OJ4 B;  4LDT D;  4G3X B;  4NJ6 A;  2NCN A;  5LXI B;  1G6J A;  2LVO A;  1V80 A;  3NY5 A;  4HJK A;  2GBN A;  3ZNZ B;  3DBS A;  2K6D B;  2PJH A;  3U30 A;  3MJW A;  2MQJ A;  1RRB A;  2L76 A;  3H6N A;  3QIJ A;  1GJZ A;  1OEY A;  1RLF A;  3NZS A;  1FXT B;  2K25 A;  2XBB C;  5IAA C;  2VRR B;  4FUL A;  2MCN B;  1P1A A;  3PPA A;  3ZDM C;  4GDL A;  3ZUN A;  1R4N I;  3D32 A;  3VAW A;  3M63 B;  2Z0D B;  4RM9 A;  4NNJ B;  1I42 A;  3ML8 A;  3RUI B;  3WAN A;  1P3Q U;  3APF A;  3ALB A;  3VXW A;  1WXV A;  5E6N A;  3H7P B;  3KUC B;  4KZC A;  2KJR A;  2KTF A;  3APD A;  3VTW A;  4BKT A;  2IYD B;  2LRU A;  2MLB A;  4NAW B;  3PTF C;  3VQI A;  3DOW A;  1KJT A;  5JH5 C;  2LRW A;  4A3O A;  4JL9 A;  4ZDV A;  4KDI C;  3VHT C;  5CTR C;  2I1J A;  2FCM A;  2JT4 B;  2FID A;  4ZRI A;  2KC2 A;  2OOB B;  4LDT B;  1V86 A;  3W1S C;  5J2R A;  4IG7 B;  3RYT A;  4DWF A;  4W9K A;  2KK8 A;  4HPM B;  4F8C B;  2L7R A;  3QC8 B;  4DK5 A;  2K8B A;  3VTV A;  2V1Y A;  5C23 A;  2BF8 B;  4ASW C;  2CS4 A;  3WAO A;  2KDE B;  4GIV A;  2ZCB A;  4GSW A;  1D3Z A;  2K8H A;  2GBR A;  4TQ0 A;  2O6V A;  2NBW B;  3C0R B;  5HKH A;  1WZ3 A;  1S3S G;  2W9N A;  3PT2 B;  2MP2 A;  3DVN U;  3RD2 A;  1UD7 A;  2KLG A;  4DBG A;  3DBL I;  3ZTD A;  3ONS A;  3WIM A;  4OVV A;  4ZRK A;  1IP9 A;  2CHX A;  2KMC A;  2RR9 A;  3GOE A;  4MEM A;  4W9H A;  1OTR B;  4FHJ A;  4MGI E;  3B1L X;  2CKH B;  4LCD E;  1UH6 A;  2G4D B;  2N4F A;  2Y5B B;  2ZVN A;  4TQ1 A;  1YQB A;  2ZEQ A;  4MH0 E;  1AAR A;  2JF5 A;  5TR5 A;  4DDG D;  2EMT A;  1VD2 A;  1C3T A;  1SGH A;  2DAF A;  2M8S A;  1WMH B;  4AJY B;  4AUQ C;  3RZW C;  2N9P C;  3HIZ A;  4AJW A;  4NJ7 A;  4BOZ B;  5LLI A;  2GOW A;  3HHM A;  4HCN B;  3UQA A;  4JLC A;  3O65 B;  4I6L B;  2JY6 A;  2FIF A;  2RPQ A;  3WAP A;  3CSF A;  2AL6 A;  4W9I A;  2M17 A;  3OAW A;  1EF5 A;  1YX5 B;  3KH0 A;  4X57 B;  3IHP C;  1YX6 B;  1WYW B;  2ZVO A;  4K7S A;  3U7D A;  2MBE A;  4IM2 A;  2EKE C;  2JXX A;  3N30 A;  4EEW A;  4JGH B;  3U8Z A;  2L8J A;  4NAW A;  3UIN B;  2NBV B;  1LXD A;  2K8C A;  2IO3 B;  2LWP A;  2IY0 B;  5E6O A;  4A3P A;  5DPT A;  2ZCC A;  3DBH I;  1GC6 A;  5JHA A;  2UWQ A;  3L0W B;  1ZKH A;  3VH3 B;  3ZRF A;  2IO1 B;  1WM2 A;  4CHK A;  2R2Q A;  4TUU A;  2MBB B;  1WX7 A;  3A9J B;  3JVZ X;  3PSE B;  1NDD A;  2XEW A;  3QK0 A;  2KFK A;  2FNJ B;  2WX0 A;  2JZ3 B;  2KQS A;  4EZL A;  2LGX A;  4FBJ B;  2FCS A;  3HK0 A;  1CMX B;  2MP2 B;  2NBU A;  3QAR A;  4G11 A;  4ICV A;  4XZ4 A;  3CMM B;  3TJP A;  1J0G A;  3NHE B;  4DDI D;  4FLH A;  2AEH A;  4W9G A;  4AWJ A;  3M3J A;  4KIK B;  2KZR A;  2IO2 B;  4FAD A;  2J0M A;  3ZW3 A;  1BT0 A;  4WQO B;  2HD5 B;  2J7Q B;  1WY8 A;  2KWV B;  2MA9 B;  4MM3 A;  5E6P A;  4DXA B;  1S1Q B;  3EC8 A;  3H9D A;  3ML9 A;  2R2O A;  5L83 A;  5JZE B;  2LVQ A;  2N1W A;  3PRM B;  3HM6 X;  4N9F 4;  3TIX A;  3QWZ B;  5KHO A;  1WJ4 A;  4DHZ E;  3DVG Y;  4KSK C;  3PHW B;  2DZM A;  2M1M A;  5CHF A;  4PYU A;  1IYF A;  4HXD A;  2BYF A;  2WX1 A;  1EUV B;  2KX0 A;  4JIO U;  1OQY A;  2RD0 A;  2PE6 B;  4MJS B;  4MGK E;  4W9D A;  2D3G A;  2WYQ A;  4HK2 A;  2ASQ A;  3DQV A;  2HJ8 A;  3P2B A;  4F7Z A;  4HPL B;  3KVF B;  1V5O A;  2A4Z A;  3L54 A;  1WMH A;  2YVC A;  3DCG A;  4MSM B;  4EFO A;  4GDK B;  3APC A;  2C7M B;  3VUX A;  2N9E B;  2JPH A;  2LJ5 A;  2L0F A;  4HDQ A;  5GMV A;  2JWZ A;  3EFU A;  3H1U A;  1MG8 A;  2ZNV C;  3IG3 A;  4GMV A;  3M95 A;  1IPG A;  4K1R B;  3UQB A;  1ZW7 A;  2K6Q A;  3V6C B;  2GMI C;  2NVU I;  3A9K B;  3KUZ A;  3SU8 X;  2L00 B;  3QHT A;  1TBE A;  2AL3 A;  3ZNH B;  3K9O B;  1OEY J;  2CHZ A;  2LGD A;  4P7I A;  1JRU A;  1WXS A;  2LAS A;  3IVF A;  3PVL A;  4I6N B;  3VH4 B;  1WM3 A;  2RGF A;  4B9K A;  2V4L A;  3QX1 A;  5LXH A;  3BIN A;  4BBN C;  3VTU A;  2KFK B;  3KYD D;  2KDF B;  4PYZ A;  2C9W B;  4MSQ B;  1R4M I;  2NPT B;  5IA7 A;  2DX5 B;  5C1Z A;  3MHS D;  1GG3 A;  4LJP B;  3A9J A;  1UBI A;  4PS8 A;  5BO4 B;  1LQB A;  2DYO A;  3NS8 A;  4DHZ B;  3VDZ A;  1E8Y A;  3WAL A;  1H8C A;  3A1Q B;  4HVB A;  3DVG X;  1VCB A;  5JHB A;  2CHW A;  2N9X A;  1SIF A;  2L3Z A;  2KC1 A;  2PPH A;  3SHQ A;  2MX2 A;  4EZK A;  4KIK A;  4ICU A;  3PLU A;  3MTN B;  4NY0 A;  2ZPY A;  4F1S A;  2LVP A;  4II3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...