1GNWA

Structure of glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of glutathione S-transferase from Arabidopsis thaliana at 2.2 A resolution: structural characterization of herbicide-conjugating plant glutathione S-transferases and a novel active site architecture.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 78
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gnwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gnwA01
3KP8A 5COHA 4GTUA 4NMUA 1GH2A 3BD2A 2GSRA 1HQOA 4JR6A 3BOAA 2HRNA 3CXGA 2H66A 2KP2A 3ZVJA 2DJ0A 1GSFA 5IMFA 2L6CA 3PR8A 4RI7A 4HU9A 2CVBA 3QCPA 4DSSB 4JU5A 1IYHA 5G1LA 4DSQA 1AAZA 2YANA 4WR5A 2OE3A 4L0WA 4ZL8A 2B6MA 5B6MA 2P31A 4I2TA 5IMCA 4GWRA 3PGTA 1V40A 6GSXA 3FEUA 3ZFBA 4V2NA 4GRFA 2LNTA 1RK4A 1WE0A 1YF1A 3TKSE 5DCGA 3M3MA 3IAS2 3M9KA 3GMFA 5HR2A 3FZ5A 2R5GA 4PQ1A 2VL2C 1JZDA 2PERA 4JEDA 2KLXA 4KAEA 4HDEA 4HOJA 3QFBC 3VI7A 2H1DA 2C4JA 5E4WA 6GSUA 2GT6A 1TI1A 2XC2A 3GL5A 1TP9A 5KN1A 4KA0A 2AB6A 2IFQA 2VCQA 1TKDB 2H1GA 2OBIA 4HJMA 2GTUA 1GTAA 1AIUA 1TW9A 1XOBA 2B5YA 2LJAA 3UVTA 1M99A 4FIWA 4WEYA 3LG6A 4OD7A 2C80A 3KZQA 2PVOC 1JLWA 5IOWA 1PN9A 2VLUA 3EMPA 1NM3A 3FZ4A 5IMDA 4KDYA 1OVNA 2OADA 3KD0A 1T1VA 3F9UA 1R7HA 1A2JA 2CVKA 1EV9A 1TRUA 1NW2A 3FKFA 2Z9SA 1SYRA 2F9SA 5D9TA 1Z6MA 1OAZA 4ML6A 5DJMA 1JZWA 2MMZA 4KF9A 5H5RA 1VF1A 4MPFA 3C1RA 1YDKA 2X8GA 4LMVA 4K1FA 1NSWA 1GLPA 2VCTA 3H93A 4HI7A 1YF0A 2C0DA 1XW9A 1JLVA 1MDJA 2OA7A 2VL2A 4DSRA 2N5AA 2PGTA 1TJDA 3CMIA 4JBBA 2H71A 4PNGA 3VWXA 3H1NA 1AUCA 4MLYA 4RI6A 2CZ3A 3DIEA 4TR1A 2L59A 3PH9A 5J5NA 4ZIJA 1ABAA 2O89A 5CAXA 3WGEA 2HXKA 4POMA 2P0GA 4CDOA 1A2LA 4OCEA 4MP4A 2O87A 3ERWA 3LFLA 2L5OA 2VL3A 3VWVA 5HR0A 3CRUA 1V9WA 3FYGA 1ZZYA 4ZBBA 4IVFA 1QK8A 2DJ2A 2PN8A 1XWAA 4Z7XA 3VFIA 3HY2A 1J08A 1ZCPA 3L9UA 4JRRA 3A5WA 1JZOA 3IC8A 4MF6A 4V1Ap 2H75A 1ZMAA 13GSA 2ZUPA 1FVKA 2ON7A 2M46A 1WRYA 1AW9A 3LORA 7GSSA 2OBKA 3ZIVA 1PRXA 3TJFA 3C7MA 4N30A 2V41A 1E6BA 4FH8A 3FRCA 4DEJA 3ZMLA 2GSQA 3F4TA 4ZB6A 2H0GA 5HFGA 4LL1B 2H74A 2ES7A 3QMXA 5CRGA 1N8JA 4PQIA 1GP1A 3GA4A 4G0LA 2H6XA 2YV7A 3ISOA 3GURA 1YKAA 4IJ3A 2NBSA 1DBYA 3PPUA 1M2DA 1T8EB 5C00A 2B3SA 4OFNA 1EWXA 4N11A 4HJ2A 3CTFA 3I43A 3FK8A 1K0DA 4IP6A 2H19A 2E2MA 4ECJA 4TRXA 1SK2A 4H86A 3H79A 1AC1A 1OC8A 1QQ2A 4FYBA 3QOUA 4BL7A 1X5DA 1KEBA 2HLSA 16GSA 1W4VA 1V98A 1TDIA 3HJOA 2FHEA 5B7CA 2VOCA 5D93A 2GVPA 4XS4B 2P5RA 5ECKB 5ECIB 3VI5A 1J9BA 3EVIA 2JZRA 5CNWA 1MD3A 2IL3A 2WB9A 3I69A 2IMKA 2O7KA 4JZQA 2DLXA 5A4WA 3E3EA 1AXDA 4E8HA 2G0FA 2GDRA 2HYXA 2JSYA 2IWTA 1SJIA 1KBNA 4FYUA 4ZB9A 1A0FA 2IMDA 3KGKA 5ECLB 3QFAC 3D21A 4GCIA 1S3DA 4FYCA 1PKWA 4D73A 4G9HA 2E7PA 3AY8A 2QC7A 4TN8A 1U87A 3RAZA 2WULA 4X0XA 4BA7A 1A8LA 3VWWA 2BTOT 3GV1A 4NHZA 2DIZA 5A4UA 1SKSB 4MDCA 3LSZA 2IIYA 5B8BA 2CX3A 2E2GA 2YWIA 2RUFA 2B7JA 4HEA2 3GHAA 4J2FA 4AGSA 4AF2A 4K8MA 2I9HA 5JWRB 1WMJA 4PX1A 1T4YA 3ME7A 5ECHB 1XXUA 3RDWA 5D96A 1MEKA 1SKRB 2VUPA 4PNFA 1ERVA 2EIRA 2H6YA 4G19A 3FW2A 2C3NA 2R4VA 4WKWA 3VWUA 1XBSA 4KH7A 2IPAA 3VPQA 4F2IA 1GTIA 1ACVA 4KW6A 2XBQA 2YN1A 3E9JB 5CREA 2H1AA 5DAKB 5F8BA 4YQVA 4V2LA 1FB0A 3EWLA 3LXTA 1YQ1A 1VGLA 3A2WA 4EL1A 4KB3A 3VURA 4USSA 3CYNA 1DUGA 5GZZB 3SBCA 1I9DA 2RM6A 3QDNA 3LJRA 4YH2A 3JCML 3IPZA 3G7YA 2UZ8A 3UL3A 2HZEA 2KHPA 3RHBA 1QMVA 4EUYA 2C0FA 5ABRA 5ECOB 4AJ7A 4PXOA 1PX7A 4MH2A 3TOTA 3IRAA 1NHOA 4KSMA 1XOAA 2NPBA 4GQCA 2WJUA 4EVMA 1M0UA 4X1UA 4WF5A 2GLRA 1YY7A 4BVXB 1SKWB 1TXXA 2AV4A 4ILFA 3UIWA 2TRCP 4OO5A 10GSA 4O32A 5E59A 4ZL9A 1BYEA 2MBTA 2DC5A 2YWOA 2YWNA 4HU7A 4DSSA 3GKNA 3DVWA 4TVEA 3RPNA 5JWOB 1OE7A 2CT6A 3UMAA 2HSMA 5FHIA 1OKTA 3ERFA 3WT1A 2N5BA 2DBCA 1SD8A 2O85A 4N10A 2A2RA 3IDVA 1X0RA 3RPPA 1GSYA 2J9HA 2A2SA 4Q5NA 4NHWA 2RM5A 1TRSA 4OMVA 3NOFA 4Q5QA 3IHQA 5KN0A 1T7PB 4K0NA 2P5QA 4KGIA 3O76A 3TKRA 1LJRA 5C04A 1A0RP 1A2MA 5D8IA 2JL4A 4O5RA 1EP7A 1EGRA 2HRAA 2HSMB 2B5XA 2FWHA 2WCIA 3KH9A 1GUHA 1Z3EA 5A4VA 1PKZA 1Q98A 3WT2A 5IO2A 5LCZA 2LQQA 3A2VA 3F6FA 4XRDA 3O3TA 3BBYA 1Z7PA 3APQA 3IXRA 1GUMA 2M80A 3IC4A 3MNGA 1GULA 3ZL5A 5ECRB 2R3XA 2AHEA 5D9VA 4DVCA 3GNJA 4I97A 4I6XA 1FHEA 3HZ8A 3UJ1A 4IELA 5DALB 1TK8B 1MTCA 4N0ZA 3APSA 5J4UA 2JU5A 1N2AA 2PBJA 3W8SA 3VPTA 2DIYA 3ZREA 3U6VA 4MZBA 4X43A 2C0EA 2GQLA 3ZLPA 4NXIA 3ZFLA 1QXHA 1GUKA 1GWCA 4ZILA 4ZL7A 2R2JA 2VLVA 2H8LA 2MBSA 3W6GA 3Q18A 5IOXA 3GKKA 1PL2A 3DXBA 3DWVA 5ELAA 3WYWA 3O6TA 3P8WA 3QAVA 2LV3A 3DRNA 3HVXA 4GSNA 4YQMA 3VLNA 4GF0A 4QQ7A 2NVLA 2LUSA 1GL8A 3ZYWA 3QD9A 5ID2B 1G6WA 3KM6A 1PA3A 4TXOA 4GXZA 11GSA 2FWEA 2EIOA 1XWCA 2HRFA 2OJLA 5D9XA 3KEBA 1SL2B 3UOMA 2PPTA 2GQKA 1XCCA 4QL9A 5ECQB 1FB6A 3EU4A 4L8EA 4BVYB 1YEXA 1WWJA 2VCWA 4JR4A 1K0OA 3ZITA 5F05A 2H0IA 5CO3A 4TXOB 5FT3A 3L9VA 1AQVA 4KNDA 5G5EA 1T3BA 2AUVA 4WBJA 4K9ZA 4ECBA 6GSTA 2NTOA 3ZRDA 4O7HA 4K7NA 3P7XA 3M8NA 1FW1A 2JSZA 5ECMB 4EKZA 5HFIA 4XIHA 1XVQA 2RLIA 2L5LA 2VIMA 2YPMA 1K0CA 3NZNA 4MJCA 4PURA 1UN2A 4MH3A 1TTZA 3HXSA 1RW1A 2XHFA 3GKMA 4IHUA 2AJQB 1QGVA 1WP0A 4ZXGA 3TB2A 4NV2A 4IW9A 3DKSA 5IO0A 1U3AA 3KMNA 2IMIA 3KTLA 4J56E 1YKCA 1YEPA 1TOFA 1ZYEA 2AYTA 2K9FA 1E2YA 4MMMA 3TUEA 4NWYA 5D73A 2VCXA 2LRNA 6GSSA 4TKYA 1QFNA 5HQPA 3F0IA 3LQ7A 2O8VB 2WFCA 5LD0A 2IN3A 1S3CA 2FY6A 4I5QA 1XVWA 3A3TA 4LLRA 5AN1A 5EPFA 2QGVA 3RBTA 1SK1A 4OCFA 3UEMA 1USBA 1H75A 3FZAA 5B8AA 1K3LA 2B1LA 1XWGA 4MPGA 3EE2A 5AISA 3ZIJA 1MD4A 1V57A 4XS4A 5HFKA 3C8EA 2WDUA 1M7TA 4PGTA 3WGXA 4NPBA 3ZMKA 4IKHA 3D5JA 3TGZA 4V1Ag 4G10A 2H01A 4KDUA 2V32A 1WJKA 3G7IA 2LJRA 1FAAA 3C71A 3H8QA 1SU9A 3LWAA 1SENA 5IQYA 2H70A 1THOA 1FOVA 2RIIA 4IP1A 1TI3A 2PWJA 2C3QA 2KOKA 2DJJA 3TKSC 2XPEA 4PTSA 3TRXA 2QSIA 5G1KA 4Q5RA 2B7KA 2C8UA 3IK9A 1I5GA 4KX4A 4G2EA 3TCOA 3VK9A 1EOHA 2H6ZA 5DBQA 2H1BA 2FWFA 4TW5A 3G9BA 5CRDA 1GSSA 2FWGA 4ID0A 1O81A 2LKUA 3CSIA 2BJXA 2GGTA 2FLSA 1X9SB 1O6JA 3UVHA 3L9SA 4POLA 1GNEA 4F0BA 1G7EA 3APOA 1ERUA 3IA1A 2J23A 1O8XA 3F4SA 1LBKA 2H30A 1T00A 2IJYA 3QAGA 1C72A 4QL7A 3MWHA 4L5LA 3FR3A 3LYKA 5DAKA 3F3RA 4KCEA 1PD21 4ECCA 2YOIA 3GTUB 2MMAA 1TRWA 2HNLA 3GKXA 1Z6NA 2VD0A 1G7OA 2JADA 4MJAA 1ERWA 1EV4A 2I81A 2V2GA 3J7Yb 3TRQA 2MYGA 2EC4A 2BMXA 2X8CA 5DCHA 3F3QA 3IV4A 3IE3A 2ALBA 1UA5A 2V1MA 3EU3A 1IYIA 2WS2A 1RQMA 2I4AA 5ENUA 3TKSA 4O92A 3UBLA 1PX6A 3ERGA 4NAXA 2FCHA 4MZWA 2DJKA 3CSHA 3GUSA 2DJ3A 3GYKA 2QKEA 1Z9HA 2REMA 4TR3A 4XS6A 1B4QA 2F8FA 3GSTA 4IJIA 4BVXA 1EZKA 5FWGA 2M72A 1DE1A 1TK0B 2HE3A 3SWLA 2X99A 3BCKA 3TJJA 3TRPA 1XWKA 2CV4A 4NV5A 1G6YA 3CBUA 3HHVA 1BAYA 1F6MC 3CRTA 3WGDA 4RQXA 2YZUA 4KCAA 2HSNB 4EDZA 3GL3A 3GH9A 3HZ4A 1KTEA 1XW6A 1HYUA 1QUWA 1SJZA 2K8SA 4IQ1A 5DJLA 3TDGA 2YZHA 2FUG2 4ML1A 2JZSA 2FGXA 3EINA 2HFDA 3PINA 3CSJA 5JCWA 1DSBA 5F07A 1K3OA 1K0AA 2V6OA 3H4KA 4MF7A 2R6KA 3ED3A 2MMOA 4MCUA 1EEJA 3NIVA 1EOGA 3R2QA 3D4MA 2GS3A 4N0VA 2OKAA 5BMUA 3U5RE 3KJYA 1JFUA 5AGYA 4EXJA 1V58A 4F82A 2GSTA 1JHBA 1K0NA 4XHMA 4TR0A 3HDCA 2AAWA 3D22A 12GSA 1FVJA 2MMNA 2ON5A 1EEMA 5GAND 3I9V2 2WGRA 4WBRD 1XZOA 5G2ZA 2C1YA 2YJHA 2TIRA 2DMMA 5GSSA 3N9JA 3HVVA 5GSTA 1DE2A 3L4NA 2OE1A 5HR3A 1THXA 2C0GA 5DALA 2IMFA 1O7UA 4LMWA 3FZ9A 4IS0A 1EP8A 5G30A 2VM2A 6GSYA 1K0MA 3N5OA 2FD3A 4I8BA 3IOSA 5DDLA 2LRTA 1KNGA 3UARA 4CHSA 3KP9A 2B1KA 1SYXA 4EF0A 4ZB8A 2FA4A 1OE8A 5HR1A 5JCGA 5J9BA 3QAWA 3ZZXA 2MZCA 2K8VA 5J41A 2XPDA 1PGTA 3RHCA 1PMTA 3TJKA 2I3YA 2DSAA 3HA9A 3S9FA 2HSHA 4YAPA 2FNOA 2F3MA 1ZL9A 18GSA 1OC9A 5ID2A 1M9BA 3KCMA 3ZTLA 4HUAA 5GAPD 1GSDA 3IAM2 1PSQA 1OYJA 2VAFA 1X9MB 1GNWA 4F0CA 3IR4A 5H5QA 4BVYA 2LJKA 1R5PA 4OFTA 1MDIA 2H76A 2E0QA 3D6IA 1OC9B 4BWQA 3BJ5A 2VD1A 2K18A 1B4PA 1TRVA 1HNAA 2ZNMA 4OO4A 1UC7A 4YAVA 4GSSA 1B48A 3D4TA 3GX8A 2LNSA 4E8EA 5D9WA 5IMZA 4ECIA 4CW9A 3W8JA 2IFQB 4MA9A 2HT9A 2L4QA 1SK0A 1F37A 1GRXA 2PU9C 1AQXA 1SJ6A 3US3A 4IN0A 1Z5YE 2CAIA 1Y25A 4EDYA 3FY7A 1GSEA 1VF3A 2GQMA 1TK5B 1BX9A 2YV9A 2KUCA 2PVQA 5H5SA 2WZ9A 2H72A 1URMA 5EVOA 4JE1A 4KE3A 4PQHA 4HS1A 5DQYA 2G2QA 3KH7A 3F63A 3KIJA 4K7IA 3P2AA 4POKA 5L71A 2VCZA 1U88A 1FO5A 1GTUA 2JACA 1B9XC 3MSZA 1WOUA 3K8NA 4K0GA 3DEXA 3WD6A 6GSWA 2VL9A 4XTSA 3TKPA 2DJ1A 3GSSA 1AQWA 1YJ6A 4IQAA 5JCUA 1ILOA 4KSOA 2EIQA 2PUKC 4MJEA 5EY6A 5A5KA 3C73A 3TKQA 2LSTA 1WPIA 3L0HA 4RUVA 5IM9A 5KN2A 2GSSA 3EURA 3LGCA 3EC3A 1K3YA 1Y6EA 3HKRA 5DVBA 3UAPA 4GSTA 1GSUA 2GZPA 2VO4A 1VF4A 3GRXA 4IBPA 3UBKA 1F2EA 1HNCA 2R37A 4TR1B 1OKDA 4RQRA 3KXOA 4IGJA 14GSA 1EGOA 3CTGA 1MDKA 3R3EA 3IBHA 1XIYA 2WRTA 3FHKA 4WF4A 3MDKA 4MK3A 1F3AA 3J7Yk 2CA8A 3V1WA 3FR9A 4P3YB 1B9YC 1SD9A 1X5EA 3F8UA 4HQZA 8GSSA 1XPVA 2LTKA 3DYRA 3EMXA 3ME8A 1K0BA 1A23A 3DVXA 2YNXA 4OWYA 1GLQA 3BCIA 2HQTA 3QR6A 2ZCTA 4HQSA 2DMLA 1BG5A 3C1SA 2N5FA 2LEGA 3OR5A 4EC0A 4XS1A 1H4OA 5IPGA 4ACSA 2X8HA 3HCZA 4KDXA 3LEFA 3MAKA 4I2UA 3GIXA 3Q19A 1GTBA 1YZXA 4XRAA 4POBA 2L57A 1CQHA 3M1GA 5AIXA 1R5AA 4PUFC 5CP1A 3I6AA 1FG4A 3EYTA 1ZYQB 2TRXA 3P90A 5J9CA 2HSYA 4XCSA 3FR6A 3LXZA 3KTBA 2VLTA 5F0GA 3Q6OA 1J0FA 1VRSD 2VCVA 4AJ8A 2GZYA 2YP6A 5G5FA 1OC3A 4EE0A 4F03A 3TJGA 1Z7RA 5EL8A 1LU4A 1A24A 3GX0A 1XW5A 4AJ6A 4EO3A 5ECSA 4L0UA 4BWSA 4MJBA 1PQNA 4K7OA 3M0FA 1X9WB 5JWQB 3D0ZA 2HZFA 2YWMA 2OACA 1X5CA 1XWBA 4K6XA 4HZ4A 3DGQA 1XFLA 3IK7A 5CYYA 2XBIA 1U3IA 3ZVJD 9GSSA 1G0TA 2K6VA 2LS5A 5KN3A 4TR4A 1O73A 4BL7B 4MF5A 5DQSA 2FA8A 4KUNA 3KMOA 4ZBAA 4F9ZA 1BJXA 3GTUA 3F6DA 4GQFA 2NDOA 5CRWA 5LNKe 2V6KA 4J57E 5J3RA 1U6TA 1TU8A 5ECNB 2RUEA 4K2DA 3DD3A 4V2MA 2F8AA 5F06A 2F51A 4GLTA 3GFKA 3DMLA 2B5EA 2H0HA 2PMTA 4TXVA 2YJ7A 5AIVA 4ZBDA 5IMAA 4D73B 4L5OA 4YQUA 4G0KA 5IPHA 2LRCA 5B6NA 5INYA 3L78A 3A2XA 2X64A 1SL0B 1ST9A 2L4CA 1VF2A 3F4RA 1BEDA 2GT5A 1R26A 4G0IA 2D2ZA 1T4ZA 3M9JA 2A4VA 2CZ2A 4BPYA 1HD2A 4LL4B 4TOPA 3Q74A 4FO5A 2HRKA 2KP1A 2H73A 3GN3A 1PL1A 2C3TA 3E0UA 1ZOFA 5G31A 2IMEA 3HJMA 2YCDA 1V2AA 4HZ2A 4PUAA 2CQ9A 2CAQA 1NHYA 3GH6A 4MABA 2GZZA 5CRHA 1BQ7A 3G7JA 1O8WA 4WETA 3HVSA 1TU7A 1O85A 3TOUA 2LQOA 1SL1B 4Q5FA 5ELGA 3QPMA 19GSA 2OE0A 3LYPA 2VM1A 1B8XA 3HJPA 2JZTA 1S3AA 2HRKB 1ZGNA 4LA1A 1GSQA 1A8YA 1UVZA 1JZRA 1M9AA 1HNBA 1CQGA 5KEJA 1ERTA 5IIZA 1ML6A 5IMVA 1Q4JA 1F3BA 17GSA 4WR4A 1W89A 4OFMA 4ULXA 1M2BA 1F9MA 4MZCA 2CX4A 1ON4A 4WXTA 2I1UA 2HI7A 1R4WA 6GSVA 2HZEB 3TJBA 5ECPB 4FQUA 2CVDA 4ISDA 1WIKA 22GSA 3HYPA 3HD5A 20GSA 1M2AA 2L6DA
chains in the Genus database with same CATH superfamily
3KP8A 5COHA 4GTUA 4NMUA 1GH2A 3BD2A 4Z2TA 2GSRA 1HQOA 4JR6A 3BOAA 2HRNA 3CXGA 2H66A 2KP2A 3ZVJA 2DJ0A 1GSFA 5A34A 2L6CA 5IMFA 3PR8A 4RI7A 4HU9A 2CVBA 3QCPA 4DSSB 4JU5A 1IYHA 5G1LA 4DSQA 1AAZA 2YANA 4WR5A 2OE3A 4L0WA 4ZL8A 2B6MA 5B6MA 2P31A 4I2TA 5IMCA 4GWRA 3PGTA 1V40A 6GSXA 3FEUA 3ZFBA 4V2NA 4GRFA 2LNTA 1RK4A 1WE0A 1YF1A 4BIKA 3TKSE 5DCGA 3M3MA 3IAS2 3M9KA 3GMFA 5HR2A 3FZ5A 2R5GA 4PQ1A 2VL2C 1JZDA 4CY8A 2PERA 4JEDA 2KLXA 4Z2RA 4KAEA 4HDEA 4HOJA 3QFBC 3VI7A 2H1DA 2C4JA 5E4WA 6GSUA 2GT6A 1TI1A 2XC2A 3GL5A 1TP9A 5KN1A 4KA0A 2AB6A 2IFQA 2VCQA 1TKDB 2H1GA 1SVMA 2OBIA 4HJMA 2GTUA 1GTAA 1AIUA 1TW9A 1XOBA 2B5YA 2LJAA 3UVTA 1M99A 4FIWA 4WEYA 3LG6A 4OD7A 2C80A 3KZQA 2PVOC 1JLWA 5IOWA 1PN9A 2VLUA 3EMPA 1NM3A 3FZ4A 5IMDA 4KDYA 1OVNA 2OADA 3KD0A 1T1VA 3F9UA 1R7HA 1A2JA 2CVKA 1EV9A 1TRUA 1NW2A 3FKFA 2Z9SA 1SYRA 1YEWC 2F9SA 5D9TA 1Z6MA 1OAZA 4ML6A 5DJMA 1JZWA 5KOXA 2MMZA 4KF9A 5H5RA 1VF1A 4MPFA 3C1RA 1YDKA 2X8GA 4LMVA 4K1FA 1NSWA 1GLPA 2VCTA 3H93A 4HI7A 1YF0A 2C0DA 1XW9A 1JLVA 1MDJA 1ZYNA 2OA7A 2VL2A 4DSRA 2N5AA 2PGTA 1TJDA 3CMIA 4JBBA 2H71A 4PNGA 3VWXA 3H1NA 1AUCA 4MLYA 4RI6A 2CZ3A 3DIEA 4TR1A 2L59A 3PH9A 5J5NA 4ZIJA 1ABAA 2O89A 5CAXA 3WGEA 2HXKA 4YKGA 4POMA 2P0GA 4CDOA 2A2PA 1A2LA 4OCEA 4MP4A 2O87A 4A5PA 3ERWA 3LFLA 2L5OA 2VL3A 3VWVA 5HR0A 3CRUA 1V9WA 3FYGA 1ZZYA 4ZBBA 4IVFA 1BF5A 1QK8A 2DJ2A 2PN8A 1XWAA 4Z7XA 3VFIA 3HY2A 4G01A 1J08A 1ZCPA 3L9UA 4JRRA 3A5WA 1JZOA 3IC8A 5BRTA 4MF6A 4V1Ap 2H75A 1ZMAA 13GSA 2ZUPA 1FVKA 2ON7A 2M46A 1WRYA 1AW9A 2EFEA 3LORA 7GSSA 2OBKA 3ZIVA 1PRXA 3TJFA 3C7MA 4N30A 2V41A 1E6BA 4FH8A 3FRCA 4DEJA 3ZMLA 2GSQA 3F4TA 4ZB6A 2H0GA 5HFGA 4LL1B 2H74A 2ES7A 3QMXA 5CRGA 5J47A 1N8JA 4PQIA 1GP1A 3GA4A 4G0LA 2H6XA 2YV7A 3ISOA 3GURA 1YKAA 4IJ3A 2NBSA 1DBYA 3PPUA 1M2DA 3LW9A 1T8EB 5C00A 2B3SA 4OFNA 1EWXA 4N11A 4HJ2A 3CTFA 3I43A 3FK8A 4FXYP 1K0DA 4IP6A 2H19A 2E2MA 4ECJA 4TRXA 1SK2A 4H86A 3H79A 1AC1A 5A1NB 1OC8A 4MNNA 1QQ2A 4FYBA 3QOUA 4BL7A 1X5DA 1KEBA 2HLSA 3EPTA 16GSA 1W4VA 1V98A 1TDIA 3HJOA 2FHEA 5B7CA 2VOCA 5D93A 2GVPA 3MIXA 2P5RA 5ECKB 5ECIB 3VI5A 4XS4B 1J9BA 3EVIA 2JZRA 5CNWA 1MD3A 2IL3A 2WB9A 3I69A 2IMKA 2O7KA 4JZQA 2DLXA 5A4WA 2WVZA 3E3EA 1AXDA 4E8HA 2G0FA 2GDRA 2HYXA 2JSYA 2IWTA 1ZYPA 1SJIA 1KBNA 4FYUA 4ZB9A 1A0FA 2IMDA 3KGKA 5ECLB 3QFAC 3D21A 4GCIA 1S3DA 4FYCA 1PKWA 4D73A 4G9HA 2E7PA 3AY8A 2QC7A 4TN8A 1U87A 3RAZA 2WULA 4X0XA 4BA7A 1A8LA 3VWWA 2BTOT 3GV1A 2QA2A 4NHZA 2DIZA 5A4UA 1SKSB 4MDCA 3LSZA 2IIYA 5B8BA 2CX3A 2E2GA 2YWIA 2RUFA 2B7JA 4HEA2 3GHAA 3A5IA 3CQFA 4J2FA 1M3JA 4AI6A 1SVLA 4AGSA 4AF2A 4K8MA 2WW3A 2I9HA 5JWRB 1WMJA 4PX1A 1T4YA 3ME7A 5ECHB 1XXUA 3RDWA 5D96A 1MEKA 1XG8A 1SKRB 2VUPA 4PNFA 1ERVA 2EIRA 2H6YA 4G19A 3FW2A 2C3NA 2UV8G 2R4VA 4WKWA 3VWUA 1XBSA 4KH7A 2IPAA 3VPQA 4F2IA 1GTIA 1ACVA 4KW6A 2XBQA 2YN1A 3E9JB 5CREA 2H1AA 5DAKB 5F8BA 4YQVA 4V2LA 1FB0A 3EWLA 3LXTA 4AKIA 1YQ1A 1VGLA 3A2WA 4EL1A 4KB3A 3VURA 4USSA 3CYNA 1DUGA 5GZZB 3SBCA 1I9DA 2RM6A 3QDNA 3LJRA 4YH2A 3JCML 3IPZA 3G7YA 2UZ8A 3UL3A 2HZEA 2KHPA 3RHBA 1QMVA 4EUYA 2C0FA 5ABRA 5ECOB 4AJ7A 4PXOA 1PX7A 4MH2A 3TOTA 3IRAA 1NHOA 4KSMA 1XOAA 4ZB7A 2NPBA 4GQCA 2WJUA 4EVMA 1M0UA 4X1UA 4WF5A 2GLRA 1YY7A 4BVXB 1SKWB 1TXXA 2AV4A 4ILFA 3UIWA 2TRCP 4OO5A 10GSA 4O32A 5E59A 4ZL9A 1BYEA 2MBTA 2DC5A 2YWOA 2YWNA 4HU7A 4DSSA 3GKNA 3DVWA 4TVEA 3RPNA 5JWOB 1OE7A 2CT6A 3UMAA 2HSMA 5FHIA 4YKFA 1OKTA 3ERFA 3WT1A 2N5BA 2DBCA 1SD8A 2O85A 4N10A 2A2RA 3IDVA 1X0RA 3RPPA 1GSYA 2J9HA 2A2SA 4Q5NA 4NHWA 2RM5A 1TRSA 4OMVA 3NOFA 4Q5QA 3IHQA 5KN0A 1T7PB 1S3RA 4K0NA 2P5QA 4KGIA 3O76A 3TKRA 1LJRA 5C04A 2O3EA 1A0RP 1A2MA 5D8IA 2JL4A 4O5RA 1EP7A 1EGRA 2HRAA 2HSMB 2B5XA 2DKIA 1S4BP 2FWHA 2WCIA 3KH9A 1GUHA 1Z3EA 5A4VA 1PKZA 1Q98A 3WT2A 5IO2A 5LCZA 2LQQA 3A2VA 3F6FA 4XRDA 3O3TA 3BBYA 1Z7PA 3APQA 3IXRA 1GUMA 2M80A 3IC4A 2O36A 3MNGA 1GULA 3ZL5A 5ECRB 2R3XA 2AHEA 5D9VA 4DVCA 3GNJA 4I97A 4I6XA 1FHEA 3HZ8A 3UJ1A 4IELA 5DALB 1TK8B 1MTCA 2WVYA 4N0ZA 3APSA 5J4UA 2JU5A 1N2AA 2PBJA 1N25A 3W8SA 3VPTA 2DIYA 3ZREA 3U6VA 4MZBA 4X43A 2C0EA 2GQLA 3ZLPA 4NXIA 3ZFLA 1QXHA 1GUKA 1GWCA 4ZILA 4ZL7A 2R2JA 2VLVA 2H8LA 2MBSA 3W6GA 3Q18A 5IOXA 3GKKA 1PL2A 3DXBA 3DWVA 5ELAA 3WYWA 3O6TA 3P8WA 3TU3B 3DRNA 3QAVA 2LV3A 1M3IA 1YVLA 3HVXA 4GSNA 4YQMA 3VLNA 4GF0A 4QQ7A 2NVLA 2LUSA 1GL8A 3ZYWA 3QD9A 5A5HB 5J4VA 5ID2B 1G6WA 3KM6A 3FMWA 1PA3A 4TXOA 4GXZA 11GSA 2FWEA 2EIOA 1XWCA 2HRFA 2OJLA 4PI2C 5D9XA 3KEBA 1SL2B 3UOMA 2PPTA 2GQKA 1XCCA 4QL9A 5ECQB 1FB6A 3EU4A 4L8EA 4BVYB 1YEXA 4CY6A 1WWJA 2VCWA 4JR4A 1K0OA 3ZITA 5F05A 2H0IA 5CO3A 4TXOB 5FT3A 3L9VA 1AQVA 4KNDA 5G5EA 1T3BA 2AUVA 4WBJA 4K9ZA 4ECBA 6GSTA 2NTOA 3ZRDA 4W66A 4O7HA 4K7NA 3P7XA 3M8NA 1FW1A 2JSZA 5ECMB 4EKZA 5HFIA 4XIHA 1XVQA 2RLIA 2L5LA 3RGBC 2VIMA 2YPMA 1K0CA 3NZNA 4MJCA 4PURA 4PHZC 1UN2A 4MH3A 1TTZA 3HXSA 1RW1A 2XHFA 3GKMA 4IHUA 2AJQB 1QGVA 1WP0A 4ZXGA 3TB2A 4NV2A 4IW9A 3DKSA 5IO0A 1U3AA 3KMNA 2IMIA 3KTLA 4J56E 1YKCA 1YEPA 1TOFA 1ZYEA 2AYTA 2K9FA 1E2YA 4MMMA 3TUEA 4NWYA 5D73A 2VCXA 2LRNA 6GSSA 4TKYA 1QFNA 5HQPA 3F0IA 3LQ7A 2O8VB 2WFCA 5LD0A 2IN3A 1S3CA 2FY6A 4I5QA 1XVWA 3A3TA 4LLRA 5AN1A 5EPFA 2QGVA 3RBTA 1SK1A 5A1NA 4OCFA 3UEMA 1USBA 1H75A 3FZAA 5B8AA 1K3LA 2B1LA 1XWGA 4MPGA 3EE2A 5AISA 3ZIJA 1MD4A 1V57A 4XS4A 5HFKA 3C8EA 2WDUA 1M7TA 4PGTA 3WGXA 4NPBA 3ZMKA 4IKHA 3D5JA 2EFCA 2X49A 3TGZA 4V1Ag 4G10A 2H01A 4KDUA 2V32A 1WJKA 3G7IA 2LJRA 1FAAA 2R0CA 5J4YA 3C71A 3H8QA 1SU9A 3LWAA 1SENA 5IQYA 2H70A 1THOA 1FOVA 2RIIA 4IP1A 1TI3A 2PWJA 2C3QA 2KOKA 2DJJA 3TKSC 2XPEA 1PN0A 4PTSA 3TRXA 2QSIA 5G1KA 4Q5RA 2B7KA 2C8UA 3IK9A 1I5GA 4KX4A 4G2EA 3TCOA 3VK9A 1EOHA 2H6ZA 5DBQA 2H1BA 2FWFA 4TW5A 3G9BA 5CRDA 1GSSA 2FWGA 4ID0A 1O81A 2LKUA 3CSIA 2BJXA 2GGTA 2FLSA 1X9SB 1O6JA 3UVHA 3L9SA 4POLA 1GNEA 4EIQA 4F0BA 1G7EA 3APOA 1ERUA 3IA1A 2J23A 1O8XA 3F4SA 1LBKA 2H30A 1T00A 2IJYA 3QAGA 1C72A 4QL7A 3MWHA 4L5LA 3FR3A 3LYKA 5DAKA 2WW1A 3F3RA 4KCEA 1PD21 4ECCA 2YOIA 3GTUB 2MMAA 1TRWA 2HNLA 3GKXA 1Z6NA 2EFDA 2VD0A 1G7OA 2JADA 4MJAA 1ERWA 1EV4A 2I81A 2V2GA 3J7Yb 3TRQA 2MYGA 2EC4A 2BMXA 2X8CA 5DCHA 2WZSA 3F3QA 3IV4A 3IE3A 2ALBA 1UA5A 2V1MA 3EU3A 1IYIA 2WS2A 1RQMA 2I4AA 5ENUA 3TKSA 4O92A 3UBLA 1PX6A 3ERGA 4NAXA 2FCHA 4MZWA 2DJKA 3CSHA 3GUSA 4N3ZA 2DJ3A 3GYKA 2QKEA 2WVXB 1Z9HA 2REMA 4TR3A 4XS6A 1B4QA 2F8FA 3GSTA 4IJIA 4BVXA 1EZKA 5FWGA 2M72A 1DE1A 1TK0B 2HE3A 3SWLA 2X99A 3BCKA 3TJJA 3TRPA 1XWKA 2CV4A 4NV5A 1G6YA 3CBUA 3HHVA 1BAYA 1F6MC 3CRTA 3WGDA 4RQXA 2YZUA 4KCAA 2HSNB 4EDZA 3GL3A 3GH9A 3HZ4A 1KTEA 1XW6A 1HYUA 1QUWA 1SJZA 2K8SA 4IQ1A 5DJLA 3TDGA 2YZHA 2FUG2 4ML1A 2JZSA 2FGXA 3EINA 2HFDA 3PINA 3CSJA 5JCWA 1DSBA 5F07A 1K3OA 1K0AA 2V6OA 3H4KA 4MF7A 2R6KA 3ED3A 2MMOA 4MCUA 1EEJA 3NIVA 1EOGA 3R2QA 3D4MA 2GS3A 4N0VA 2OKAA 2QA1A 1FOHA 5BMUA 3U5RE 3KJYA 1JFUA 5AGYA 4EXJA 1V58A 4F82A 2GSTA 1JHBA 1K0NA 4XHMA 4TR0A 3HDCA 2AAWA 3D22A 12GSA 1FVJA 2MMNA 2ON5A 1EEMA 5GAND 3I9V2 2WGRA 4WBRD 1XZOA 5G2ZA 2C1YA 2YJHA 4O5UA 2TIRA 2DMMA 5GSSA 3N9JA 3HVVA 5GSTA 4AKXB 1DE2A 3L4NA 2OE1A 3HVNA 5HR3A 1THXA 2C0GA 5DALA 2IMFA 5BMUB 1O7UA 4LMWA 3FZ9A 4IS0A 1EP8A 5G30A 2VM2A 2R0GA 6GSYA 1K0MA 3N5OA 2FD3A 4I8BA 3IOSA 5DDLA 2LRTA 1KNGA 3UARA 4CHSA 3KP9A 4GDFA 2B1KA 1SYXA 2H1LA 4EF0A 1TXUA 4ZB8A 2FA4A 1OE8A 5HR1A 5JCGA 5J9BA 3QAWA 3ZZXA 2MZCA 2K8VA 5J41A 5A34B 4HSCX 2XPDA 1PGTA 3RHCA 1PMTA 3TJKA 2I3YA 2DSAA 3HA9A 5A5HA 3S9FA 2HSHA 4YAPA 2FNOA 2F3MA 1ZL9A 18GSA 1OC9A 4AKGA 3IHGA 5ID2A 1M9BA 3KCMA 3ZTLA 4HUAA 5GAPD 1GSDA 3IAM2 2WW0A 1PSQA 1OYJA 2VAFA 1PFOA 1GNWA 1X9MB 4F0CA 3IR4A 4Z2UA 5H5QA 4BVYA 2LJKA 1R5PA 4OFTA 1MDIA 2H76A 4ICYA 2E0QA 3D6IA 1OC9B 4BWQA 3BJ5A 2VD1A 2K18A 1B4PA 1TRVA 1HNAA 4QMKA 2ZNMA 4OO4A 1UC7A 4YAVA 4GSSA 1B48A 3D4TA 3MYDA 3GX8A 2LNSA 4E8EA 5D9WA 3RFRC 5IMZA 4ECIA 4CW9A 3W8JA 2O5VA 2IFQB 4MA9A 2HT9A 2L4QA 1SK0A 1F37A 1GRXA 2PU9C 1AQXA 1SJ6A 3US3A 4IN0A 1Z5YE 2CAIA 1Y25A 4EDYA 4K5RA 3FY7A 1GSEA 1VF3A 5KOWA 2GQMA 1TK5B 1BX9A 2YV9A 2KUCA 2PVQA 5H5SA 2WZ9A 2H72A 1URMA 4O5QA 5EVOA 4JE1A 4KE3A 4PQHA 4HS1A 5DQYA 2G2QA 3KH7A 3F63A 3KIJA 3HMJG 4K7IA 2VKZG 3P2AA 4POKA 5L71A 2X4AA 2VCZA 1U88A 1FO5A 1GTUA 2JACA 1B9XC 2A4HA 3MSZA 1WOUA 3K8NA 4K0GA 3DEXA 3WD6A 6GSWA 2VL9A 4XTSA 4PI0C 3TKPA 2DJ1A 3GSSA 1AQWA 1YJ6A 4IQAA 5JCUA 1ILOA 4KSOA 2EIQA 2PUKC 4MJEA 5EY6A 5A5KA 3C73A 3TKQA 2LSTA 1WPIA 3L0HA 4RUVA 5IM9A 5KN2A 2GSSA 3EURA 3LGCA 3EC3A 1K3YA 1Y6EA 3HKRA 5DVBA 1BG1A 3UAPA 4GSTA 1GSUA 2GZPA 2VO4A 1VF4A 3GRXA 4IBPA 3UBKA 1F2EA 1HNCA 2R37A 4TR1B 1OKDA 4RQRA 3KXOA 4IGJA 14GSA 1EGOA 3CTGA 1MDKA 3R3EA 3IBHA 1XIYA 2WRTA 3FHKA 4WF4A 3MDKA 4MK3A 4E68A 1F3AA 3J7Yk 2CA8A 3V1WA 4X4JA 3FR9A 4P3YB 1B9YC 1SD9A 2R0PA 1X5EA 3F8UA 4HQZA 8GSSA 1XPVA 3EMXA 2LTKA 3DYRA 3ME8A 1K0BA 1A23A 3DVXA 2YNXA 4OWYA 1GLQA 3BCIA 2HQTA 3QR6A 2ZCTA 4HQSA 2DMLA 1BG5A 3C1SA 2N5FA 2LEGA 3OR5A 4EC0A 2WW2A 4XS1A 1H4OA 5IPGA 4ACSA 2X8HA 3HCZA 4KDXA 3LEFA 3MAKA 4I2UA 3GIXA 3Q19A 1GTBA 1YZXA 4XRAA 4POBA 2L57A 1CQHA 3M1GA 5AIXA 1R5AA 4PUFC 5CP1A 3I6AA 2EFHA 1FG4A 3EYTA 1ZYQB 2TRXA 3P90A 5J9CA 2HSYA 4XCSA 3FR6A 3LXZA 3KTBA 2VLTA 5F0GA 3Q6OA 1J0FA 1VRSD 2VCVA 4AJ8A 2GZYA 2YP6A 5G5FA 1OC3A 4EE0A 4F03A 3TJGA 1Z7RA 5EL8A 1LU4A 1A24A 3GX0A 1XW5A 4AJ6A 4EO3A 5ECSA 4L0UA 4BWSA 4MJBA 1PQNA 4K7OA 3M0FA 1X9WB 5JWQB 3D0ZA 2HZFA 2YWMA 2OACA 1X5CA 1XWBA 4K6XA 4HZ4A 3DGQA 1XFLA 3IK7A 5CYYA 2XBIA 1U3IA 3ZVJD 9GSSA 1G0TA 2K6VA 2LS5A 5KN3A 5J40A 4TR4A 1O73A 4BL7B 4MF5A 5DQSA 2FA8A 4KUNA 3KMOA 4ZBAA 4F9ZA 1BJXA 3GTUA 3F6DA 4GQFA 2NDOA 5CRWA 5LNKe 2V6KA 4J57E 5J3RA 1U6TA 1TU8A 5ECNB 1Y1UA 2RUEA 4K2DA 3DD3A 4V2MA 2F8AA 4K2XA 5F06A 2F51A 4GLTA 3GFKA 3DMLA 2B5EA 2H0HA 2PMTA 4TXVA 2YJ7A 5AIVA 4ZBDA 5IMAA 4D73B 4L5OA 4YQUA 4G0KA 2WVXA 5IPHA 2LRCA 5B6NA 5INYA 2OT3A 3A2XA 3L78A 2X64A 1SL0B 1ST9A 2L4CA 1VF2A 3F4RA 1BEDA 2GT5A 1R26A 4G0IA 2D2ZA 1T4ZA 1I1IP 3M9JA 2A4VA 4AKHA 2CZ2A 4BPYA 1HD2A 2HSNA 4LL4B 4TOPA 3Q74A 4FO5A 2HRKA 2KP1A 2H73A 3GN3A 4EIPA 1PL1A 2C3TA 3E0UA 1ZOFA 5G31A 2IMEA 3HJMA 2YCDA 1V2AA 4HZ2A 4PUAA 2CQ9A 2CAQA 1NHYA 3GH6A 4MABA 2GZZA 5CRHA 4K5SA 1BQ7A 3CWGA 3G7JA 1O8WA 4WETA 3HVSA 1TU7A 1O85A 3TOUA 2LQOA 1SL1B 4Q5FA 5ELGA 3QPMA 19GSA 2OE0A 3LYPA 2VM1A 1B8XA 3HJPA 2JZTA 1S3AA 2HRKB 1ZGNA 4LA1A 1GSQA 1A8YA 1UVZA 1JZRA 1M9AA 1HNBA 1CQGA 5KEJA 1ERTA 5IIZA 2DKHA 1ML6A 5IMVA 1Q4JA 1F3BA 17GSA 4WR4A 1W89A 4OFMA 3CHXC 4ULXA 1M2BA 1F9MA 4MZCA 2CX4A 1ON4A 4WXTA 2I1UA 2HI7A 1R4WA 6GSVA 2HZEB 3TJBA 5ECPB 1SVOA 4FQUA 2CVDA 4ISDA 1WIKA 22GSA 3HYPA 3HD5A 20GSA 1M2AA 2L6DA
chains in the Genus database with same CATH topology
3KP8A 5COHA 4GTUA 4NMUA 1GH2A 3BD2A 4Z2TA 2GSRA 1HQOA 4JR6A 3BOAA 2HRNA 3CXGA 2H66A 2KP2A 3ZVJA 2DJ0A 1GSFA 5A34A 2L6CA 5IMFA 3PR8A 4RI7A 4HU9A 2CVBA 3QCPA 4DSSB 4JU5A 1IYHA 5G1LA 4DSQA 1AAZA 2YANA 4WR5A 2OE3A 4L0WA 4ZL8A 2B6MA 5B6MA 2P31A 4I2TA 5IMCA 4GWRA 3PGTA 1V40A 6GSXA 3FEUA 3ZFBA 4V2NA 4GRFA 2LNTA 1RK4A 1WE0A 1YF1A 3TKSE 5DCGA 3M3MA 3IAS2 3M9KA 3GMFA 5HR2A 3FZ5A 2R5GA 4PQ1A 2VL2C 1JZDA 4CY8A 2PERA 4JEDA 2KLXA 4Z2RA 4KAEA 4HDEA 4HOJA 3QFBC 3VI7A 2H1DA 2C4JA 5E4WA 6GSUA 2GT6A 1TI1A 2XC2A 3GL5A 1TP9A 5KN1A 4KA0A 2AB6A 2IFQA 2VCQA 1TKDB 2H1GA 1SVMA 2OBIA 4HJMA 2GTUA 1GTAA 1AIUA 1TW9A 1XOBA 2B5YA 2LJAA 3UVTA 1M99A 4FIWA 4WEYA 3LG6A 4OD7A 2C80A 3KZQA 2PVOC 1JLWA 5IOWA 1PN9A 2VLUA 3EMPA 1NM3A 3FZ4A 5IMDA 4KDYA 1OVNA 2OADA 3KD0A 1T1VA 3F9UA 1R7HA 1A2JA 2CVKA 1EV9A 1TRUA 1NW2A 3FKFA 2Z9SA 1SYRA 2F9SA 5D9TA 1Z6MA 1OAZA 4ML6A 5DJMA 1JZWA 5KOXA 2MMZA 4KF9A 5H5RA 1VF1A 4MPFA 3C1RA 1YDKA 2X8GA 4LMVA 4K1FA 1NSWA 1GLPA 2VCTA 3H93A 4HI7A 1YF0A 2C0DA 1XW9A 1JLVA 1MDJA 1ZYNA 2OA7A 2VL2A 4DSRA 2N5AA 2PGTA 1TJDA 3CMIA 4JBBA 2H71A 4PNGA 3VWXA 3H1NA 1AUCA 4MLYA 4RI6A 2CZ3A 3DIEA 4TR1A 2L59A 3PH9A 5J5NA 4ZIJA 1ABAA 2O89A 5CAXA 3WGEA 2HXKA 4YKGA 4POMA 2P0GA 4CDOA 2A2PA 1A2LA 4OCEA 4MP4A 2O87A 4A5PA 3ERWA 3LFLA 2L5OA 2VL3A 3VWVA 5HR0A 3CRUA 1V9WA 3FYGA 1ZZYA 4ZBBA 4IVFA 1BF5A 1QK8A 2DJ2A 2PN8A 1XWAA 4Z7XA 3VFIA 3HY2A 4G01A 1J08A 1ZCPA 3L9UA 4JRRA 3A5WA 1JZOA 3IC8A 5BRTA 4MF6A 4V1Ap 2H75A 1ZMAA 13GSA 2ZUPA 1FVKA 2ON7A 2M46A 1WRYA 1AW9A 2EFEA 3LORA 7GSSA 2OBKA 3ZIVA 1PRXA 3TJFA 3C7MA 4N30A 2V41A 1E6BA 4FH8A 3FRCA 4DEJA 3ZMLA 2GSQA 3F4TA 4ZB6A 2H0GA 5HFGA 4LL1B 2H74A 2ES7A 3QMXA 5CRGA 5J47A 1N8JA 4PQIA 1GP1A 3GA4A 4G0LA 2H6XA 2YV7A 3ISOA 3GURA 1YKAA 4IJ3A 2NBSA 1DBYA 3PPUA 1M2DA 3LW9A 1T8EB 5C00A 2B3SA 4OFNA 1EWXA 4N11A 4HJ2A 3CTFA 3I43A 3FK8A 1K0DA 4IP6A 2H19A 2E2MA 4ECJA 4TRXA 1SK2A 4H86A 3H79A 1AC1A 5A1NB 1OC8A 4MNNA 1QQ2A 4FYBA 3QOUA 4BL7A 1X5DA 1KEBA 2HLSA 3EPTA 16GSA 1W4VA 1V98A 1TDIA 3HJOA 2FHEA 5B7CA 2VOCA 5D93A 2GVPA 3MIXA 2P5RA 5ECKB 5ECIB 3VI5A 4XS4B 1J9BA 3EVIA 2JZRA 5CNWA 1MD3A 2IL3A 2WB9A 3I69A 2IMKA 2O7KA 4JZQA 2DLXA 5A4WA 3E3EA 1AXDA 4E8HA 2G0FA 2GDRA 2HYXA 2JSYA 2IWTA 1ZYPA 1SJIA 1KBNA 4FYUA 4ZB9A 1A0FA 2IMDA 3KGKA 5ECLB 3QFAC 3D21A 4GCIA 1S3DA 4FYCA 1PKWA 4D73A 4G9HA 2E7PA 3AY8A 2QC7A 4TN8A 1U87A 3RAZA 2WULA 4X0XA 4BA7A 1A8LA 3VWWA 2BTOT 3GV1A 2QA2A 4NHZA 2DIZA 5A4UA 1SKSB 4MDCA 3LSZA 2IIYA 5B8BA 2CX3A 2E2GA 2YWIA 2RUFA 2B7JA 4HEA2 3GHAA 3A5IA 4J2FA 4AI6A 1SVLA 4AGSA 4AF2A 4K8MA 2I9HA 5JWRB 1WMJA 4PX1A 1T4YA 3ME7A 5ECHB 1XXUA 3RDWA 5D96A 1MEKA 1SKRB 2VUPA 4PNFA 1ERVA 2EIRA 2H6YA 4G19A 3FW2A 2C3NA 2UV8G 2R4VA 4WKWA 3VWUA 1XBSA 4KH7A 2IPAA 3VPQA 4F2IA 1GTIA 1ACVA 4KW6A 2XBQA 2YN1A 3E9JB 5CREA 2H1AA 5DAKB 5F8BA 4YQVA 4V2LA 1FB0A 3EWLA 3LXTA 4AKIA 1YQ1A 1VGLA 3A2WA 4EL1A 4KB3A 3VURA 4USSA 3CYNA 1DUGA 5GZZB 3SBCA 1I9DA 2RM6A 3QDNA 3LJRA 4YH2A 3JCML 3IPZA 3G7YA 2UZ8A 3UL3A 2HZEA 2KHPA 3RHBA 1QMVA 4EUYA 2C0FA 5ABRA 5ECOB 4AJ7A 4PXOA 1PX7A 4MH2A 3TOTA 3IRAA 1NHOA 4KSMA 1XOAA 4ZB7A 2NPBA 4GQCA 2WJUA 4EVMA 1M0UA 4X1UA 4WF5A 2GLRA 1YY7A 4BVXB 1SKWB 1TXXA 2AV4A 4ILFA 3UIWA 2TRCP 4OO5A 10GSA 4O32A 5E59A 4ZL9A 1BYEA 2MBTA 2DC5A 2YWOA 2YWNA 4HU7A 4DSSA 3GKNA 3DVWA 4TVEA 3RPNA 5JWOB 1OE7A 2CT6A 3UMAA 2HSMA 5FHIA 4YKFA 1OKTA 3ERFA 3WT1A 2N5BA 2DBCA 1SD8A 2O85A 4N10A 2A2RA 3IDVA 1X0RA 3RPPA 1GSYA 2J9HA 2A2SA 4Q5NA 4NHWA 2RM5A 1TRSA 4OMVA 3NOFA 4Q5QA 3IHQA 5KN0A 1T7PB 4K0NA 2P5QA 4KGIA 3O76A 3TKRA 1LJRA 5C04A 1A0RP 1A2MA 5D8IA 2JL4A 4O5RA 1EP7A 1EGRA 2HRAA 2HSMB 2B5XA 2DKIA 2FWHA 2WCIA 3KH9A 1GUHA 1Z3EA 5A4VA 1PKZA 1Q98A 3WT2A 5IO2A 5LCZA 2LQQA 3A2VA 3F6FA 4XRDA 3O3TA 3BBYA 1Z7PA 3APQA 3IXRA 1GUMA 2M80A 3IC4A 3MNGA 1GULA 3ZL5A 5ECRB 2R3XA 2AHEA 5D9VA 4DVCA 3GNJA 4I97A 4I6XA 1FHEA 3HZ8A 3UJ1A 4IELA 5DALB 1TK8B 1MTCA 4N0ZA 3APSA 5J4UA 2JU5A 1N2AA 2PBJA 1N25A 3W8SA 3VPTA 2DIYA 3ZREA 3U6VA 4MZBA 4X43A 2C0EA 2GQLA 3ZLPA 4NXIA 3ZFLA 1QXHA 1GUKA 1GWCA 4ZILA 4ZL7A 2R2JA 2VLVA 2H8LA 2MBSA 3W6GA 3Q18A 5IOXA 3GKKA 1PL2A 3DXBA 3DWVA 5ELAA 3WYWA 3O6TA 3P8WA 3TU3B 3QAVA 2LV3A 3DRNA 1YVLA 3HVXA 4GSNA 4YQMA 3VLNA 4GF0A 4QQ7A 2NVLA 2LUSA 1GL8A 3ZYWA 3QD9A 5A5HB 5J4VA 5ID2B 1G6WA 3KM6A 3FMWA 1PA3A 4TXOA 4GXZA 11GSA 2FWEA 2EIOA 1XWCA 2HRFA 2OJLA 5D9XA 3KEBA 1SL2B 3UOMA 2PPTA 2GQKA 1XCCA 4QL9A 5ECQB 1FB6A 3EU4A 4L8EA 4BVYB 1YEXA 4CY6A 1WWJA 2VCWA 4JR4A 1K0OA 3ZITA 5F05A 2H0IA 5CO3A 4TXOB 5FT3A 3L9VA 1AQVA 4KNDA 5G5EA 1T3BA 2AUVA 4WBJA 4K9ZA 4ECBA 6GSTA 2NTOA 3ZRDA 4W66A 4O7HA 4K7NA 3P7XA 3M8NA 1FW1A 2JSZA 5ECMB 4EKZA 5HFIA 4XIHA 1XVQA 2RLIA 2L5LA 2VIMA 2YPMA 1K0CA 3NZNA 4MJCA 4PURA 1UN2A 4MH3A 1TTZA 3HXSA 1RW1A 2XHFA 3GKMA 4IHUA 2AJQB 1QGVA 1WP0A 4ZXGA 3TB2A 4NV2A 4IW9A 3DKSA 5IO0A 1U3AA 3KMNA 2IMIA 3KTLA 4J56E 1YKCA 1YEPA 1TOFA 1ZYEA 2AYTA 2K9FA 1E2YA 4MMMA 3TUEA 4NWYA 5D73A 2VCXA 2LRNA 6GSSA 4TKYA 1QFNA 5HQPA 3F0IA 3LQ7A 2O8VB 2WFCA 5LD0A 2IN3A 1S3CA 2FY6A 4I5QA 1XVWA 3A3TA 4LLRA 5AN1A 5EPFA 2QGVA 3RBTA 1SK1A 5A1NA 4OCFA 3UEMA 1USBA 1H75A 3FZAA 5B8AA 1K3LA 2B1LA 1XWGA 4MPGA 3EE2A 5AISA 3ZIJA 1MD4A 1V57A 4XS4A 5HFKA 3C8EA 2WDUA 1M7TA 4PGTA 3WGXA 4NPBA 3ZMKA 4IKHA 3D5JA 2EFCA 2X49A 3TGZA 4V1Ag 4G10A 2H01A 4KDUA 2V32A 1WJKA 3G7IA 2LJRA 1FAAA 2R0CA 5J4YA 3C71A 3H8QA 1SU9A 3LWAA 1SENA 5IQYA 2H70A 1THOA 1FOVA 2RIIA 4IP1A 1TI3A 2PWJA 2C3QA 2KOKA 2DJJA 3TKSC 2XPEA 1PN0A 4PTSA 3TRXA 2QSIA 5G1KA 4Q5RA 2B7KA 2C8UA 3IK9A 1I5GA 4KX4A 4G2EA 3TCOA 3VK9A 1EOHA 2H6ZA 5DBQA 2H1BA 2FWFA 4TW5A 3G9BA 5CRDA 1GSSA 2FWGA 4ID0A 1O81A 2LKUA 3CSIA 2BJXA 2GGTA 2FLSA 1X9SB 1O6JA 3UVHA 3L9SA 4POLA 1GNEA 4EIQA 4F0BA 1G7EA 3APOA 1ERUA 3IA1A 2J23A 1O8XA 3F4SA 1LBKA 2H30A 1T00A 2IJYA 3QAGA 1C72A 4QL7A 3MWHA 4L5LA 3FR3A 3LYKA 5DAKA 3F3RA 4KCEA 1PD21 4ECCA 2YOIA 3GTUB 2MMAA 1TRWA 2HNLA 3GKXA 1Z6NA 2EFDA 2VD0A 1G7OA 2JADA 4MJAA 1ERWA 1EV4A 2I81A 2V2GA 3J7Yb 3TRQA 2MYGA 2EC4A 2BMXA 2X8CA 5DCHA 3F3QA 3IV4A 3IE3A 2ALBA 1UA5A 2V1MA 3EU3A 1IYIA 2WS2A 1RQMA 2I4AA 5ENUA 3TKSA 4O92A 3UBLA 1PX6A 3ERGA 4NAXA 2FCHA 4MZWA 2DJKA 3CSHA 3GUSA 4N3ZA 2DJ3A 3GYKA 2QKEA 1Z9HA 2REMA 4TR3A 4XS6A 1B4QA 2F8FA 3GSTA 4IJIA 4BVXA 1EZKA 5FWGA 2M72A 1DE1A 1TK0B 2HE3A 3SWLA 2X99A 3BCKA 3TJJA 3TRPA 1XWKA 2CV4A 4NV5A 1G6YA 3CBUA 3HHVA 1BAYA 1F6MC 3CRTA 3WGDA 4RQXA 2YZUA 4KCAA 2HSNB 4EDZA 3GL3A 3GH9A 3HZ4A 1KTEA 1XW6A 1HYUA 1QUWA 1SJZA 2K8SA 4IQ1A 5DJLA 3TDGA 2YZHA 2FUG2 4ML1A 2JZSA 2FGXA 3EINA 2HFDA 3PINA 3CSJA 5JCWA 1DSBA 5F07A 1K3OA 1K0AA 2V6OA 3H4KA 4MF7A 2R6KA 3ED3A 2MMOA 4MCUA 1EEJA 3NIVA 1EOGA 3R2QA 3D4MA 2GS3A 4N0VA 2OKAA 2QA1A 1FOHA 5BMUA 3U5RE 3KJYA 1JFUA 5AGYA 4EXJA 1V58A 4F82A 2GSTA 1JHBA 1K0NA 4XHMA 4TR0A 3HDCA 2AAWA 3D22A 12GSA 1FVJA 2MMNA 2ON5A 1EEMA 5GAND 3I9V2 2WGRA 4WBRD 1XZOA 5G2ZA 2C1YA 2YJHA 4O5UA 2TIRA 2DMMA 5GSSA 3N9JA 3HVVA 5GSTA 4AKXB 1DE2A 3L4NA 2OE1A 5HR3A 1THXA 2C0GA 5DALA 2IMFA 5BMUB 1O7UA 4LMWA 3FZ9A 4IS0A 1EP8A 5G30A 2VM2A 2R0GA 6GSYA 1K0MA 3N5OA 2FD3A 4I8BA 3IOSA 5DDLA 2LRTA 1KNGA 3UARA 4CHSA 3KP9A 4GDFA 2B1KA 1SYXA 2H1LA 4EF0A 1TXUA 4ZB8A 2FA4A 1OE8A 5HR1A 5JCGA 5J9BA 3QAWA 3ZZXA 2MZCA 2K8VA 5J41A 5A34B 2XPDA 1PGTA 3RHCA 1PMTA 3TJKA 2I3YA 2DSAA 3HA9A 5A5HA 3S9FA 2HSHA 4YAPA 2FNOA 2F3MA 1ZL9A 18GSA 1OC9A 4AKGA 3IHGA 5ID2A 1M9BA 3KCMA 3ZTLA 4HUAA 5GAPD 1GSDA 3IAM2 1PSQA 1OYJA 2VAFA 1X9MB 1GNWA 4F0CA 3IR4A 4Z2UA 5H5QA 4BVYA 2LJKA 1R5PA 4OFTA 1MDIA 2H76A 4ICYA 2E0QA 3D6IA 1OC9B 4BWQA 3BJ5A 2VD1A 2K18A 1B4PA 1TRVA 1HNAA 4QMKA 2ZNMA 4OO4A 1UC7A 4YAVA 4GSSA 1B48A 3D4TA 3MYDA 3GX8A 2LNSA 4E8EA 5D9WA 5IMZA 4ECIA 4CW9A 3W8JA 2O5VA 2IFQB 4MA9A 2HT9A 2L4QA 1SK0A 1F37A 1GRXA 2PU9C 1AQXA 1SJ6A 3US3A 4IN0A 1Z5YE 2CAIA 1Y25A 4EDYA 4K5RA 3FY7A 1GSEA 1VF3A 5KOWA 2GQMA 1TK5B 1BX9A 2YV9A 2KUCA 2PVQA 5H5SA 2WZ9A 2H72A 1URMA 4O5QA 5EVOA 4JE1A 4KE3A 4PQHA 4HS1A 5DQYA 2G2QA 3KH7A 3F63A 3KIJA 3HMJG 4K7IA 2VKZG 3P2AA 4POKA 5L71A 2X4AA 2VCZA 1U88A 1FO5A 1GTUA 2JACA 1B9XC 2A4HA 3MSZA 1WOUA 3K8NA 4K0GA 3DEXA 3WD6A 6GSWA 2VL9A 4XTSA 3TKPA 2DJ1A 3GSSA 1AQWA 1YJ6A 4IQAA 5JCUA 1ILOA 4KSOA 2EIQA 2PUKC 4MJEA 5EY6A 5A5KA 3C73A 3TKQA 2LSTA 1WPIA 3L0HA 4RUVA 5IM9A 5KN2A 2GSSA 3EURA 3LGCA 3EC3A 1K3YA 1Y6EA 3HKRA 5DVBA 1BG1A 3UAPA 4GSTA 1GSUA 2GZPA 2VO4A 1VF4A 3GRXA 4IBPA 3UBKA 1F2EA 1HNCA 2R37A 4TR1B 1OKDA 4RQRA 3KXOA 4IGJA 14GSA 1EGOA 3CTGA 1MDKA 3R3EA 3IBHA 1XIYA 2WRTA 3FHKA 4WF4A 3MDKA 4MK3A 4E68A 1F3AA 3J7Yk 2CA8A 3V1WA 4X4JA 3FR9A 4P3YB 1B9YC 1SD9A 2R0PA 1X5EA 3F8UA 4HQZA 8GSSA 1XPVA 2LTKA 3DYRA 3EMXA 3ME8A 1K0BA 1A23A 3DVXA 2YNXA 4OWYA 1GLQA 3BCIA 2HQTA 3QR6A 2ZCTA 4HQSA 2DMLA 1BG5A 3C1SA 2N5FA 2LEGA 3OR5A 4EC0A 4XS1A 1H4OA 5IPGA 4ACSA 2X8HA 3HCZA 4KDXA 3LEFA 3MAKA 4I2UA 3GIXA 3Q19A 1GTBA 1YZXA 4XRAA 4POBA 2L57A 1CQHA 3M1GA 5AIXA 1R5AA 4PUFC 5CP1A 3I6AA 2EFHA 1FG4A 3EYTA 1ZYQB 2TRXA 3P90A 5J9CA 2HSYA 4XCSA 3FR6A 3LXZA 3KTBA 2VLTA 5F0GA 3Q6OA 1J0FA 1VRSD 2VCVA 4AJ8A 2GZYA 2YP6A 5G5FA 1OC3A 4EE0A 4F03A 3TJGA 1Z7RA 5EL8A 1LU4A 1A24A 3GX0A 1XW5A 4AJ6A 4EO3A 5ECSA 4L0UA 4BWSA 4MJBA 1PQNA 4K7OA 3M0FA 1X9WB 5JWQB 3D0ZA 2HZFA 2YWMA 2OACA 1X5CA 1XWBA 4K6XA 4HZ4A 3DGQA 1XFLA 3IK7A 5CYYA 2XBIA 1U3IA 3ZVJD 9GSSA 1G0TA 2K6VA 2LS5A 5KN3A 5J40A 4TR4A 1O73A 4BL7B 4MF5A 5DQSA 2FA8A 4KUNA 3KMOA 4ZBAA 4F9ZA 1BJXA 3GTUA 3F6DA 4GQFA 2NDOA 5CRWA 5LNKe 2V6KA 4J57E 5J3RA 1U6TA 1TU8A 5ECNB 1Y1UA 2RUEA 4K2DA 3DD3A 4V2MA 2F8AA 4K2XA 5F06A 2F51A 4GLTA 3GFKA 3DMLA 2B5EA 2H0HA 2PMTA 4TXVA 2YJ7A 5AIVA 4ZBDA 5IMAA 4D73B 4L5OA 4YQUA 4G0KA 5IPHA 2LRCA 5B6NA 5INYA 2OT3A 3A2XA 3L78A 2X64A 1SL0B 1ST9A 2L4CA 1VF2A 3F4RA 1BEDA 2GT5A 1R26A 4G0IA 2D2ZA 1T4ZA 3M9JA 2A4VA 4AKHA 2CZ2A 4BPYA 1HD2A 2HSNA 4LL4B 4TOPA 3Q74A 4FO5A 2HRKA 2KP1A 2H73A 3GN3A 4EIPA 1PL1A 2C3TA 3E0UA 1ZOFA 5G31A 2IMEA 3HJMA 2YCDA 1V2AA 4HZ2A 4PUAA 2CQ9A 2CAQA 1NHYA 3GH6A 4MABA 2GZZA 5CRHA 4K5SA 1BQ7A 3CWGA 3G7JA 1O8WA 4WETA 3HVSA 1TU7A 1O85A 3TOUA 2LQOA 1SL1B 4Q5FA 5ELGA 3QPMA 19GSA 2OE0A 3LYPA 2VM1A 1B8XA 3HJPA 2JZTA 1S3AA 2HRKB 1ZGNA 4LA1A 1GSQA 1A8YA 1UVZA 1JZRA 1M9AA 1HNBA 1CQGA 5KEJA 1ERTA 5IIZA 2DKHA 1ML6A 5IMVA 1Q4JA 1F3BA 17GSA 4WR4A 1W89A 4OFMA 4ULXA 1M2BA 1F9MA 4MZCA 2CX4A 1ON4A 4WXTA 2I1UA 2HI7A 1R4WA 6GSVA 2HZEB 3TJBA 5ECPB 1SVOA 4FQUA 2CVDA 4ISDA 1WIKA 22GSA 3HYPA 3HD5A 20GSA 1M2AA 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP8 A;  5COH A;  4GTU A;  4NMU A;  1GH2 A;  3BD2 A;  2GSR A;  1HQO A;  4JR6 A;  3BOA A;  2HRN A;  3CXG A;  2H66 A;  2KP2 A;  3ZVJ A;  2DJ0 A;  1GSF A;  5IMF A;  2L6C A;  3PR8 A;  4RI7 A;  4HU9 A;  2CVB A;  3QCP A;  4DSS B;  4JU5 A;  1IYH A;  5G1L A;  4DSQ A;  1AAZ A;  2YAN A;  4WR5 A;  2OE3 A;  4L0W A;  4ZL8 A;  2B6M A;  5B6M A;  2P31 A;  4I2T A;  5IMC A;  4GWR A;  3PGT A;  1V40 A;  6GSX A;  3FEU A;  3ZFB A;  4V2N A;  4GRF A;  2LNT A;  1RK4 A;  1WE0 A;  1YF1 A;  3TKS E;  5DCG A;  3M3M A;  3IAS 2;  3M9K A;  3GMF A;  5HR2 A;  3FZ5 A;  2R5G A;  4PQ1 A;  2VL2 C;  1JZD A;  2PER A;  4JED A;  2KLX A;  4KAE A;  4HDE A;  4HOJ A;  3QFB C;  3VI7 A;  2H1D A;  2C4J A;  5E4W A;  6GSU A;  2GT6 A;  1TI1 A;  2XC2 A;  3GL5 A;  1TP9 A;  5KN1 A;  4KA0 A;  2AB6 A;  2IFQ A;  2VCQ A;  1TKD B;  2H1G A;  2OBI A;  4HJM A;  2GTU A;  1GTA A;  1AIU A;  1TW9 A;  1XOB A;  2B5Y A;  2LJA A;  3UVT A;  1M99 A;  4FIW A;  4WEY A;  3LG6 A;  4OD7 A;  2C80 A;  3KZQ A;  2PVO C;  1JLW A;  5IOW A;  1PN9 A;  2VLU A;  3EMP A;  1NM3 A;  3FZ4 A;  5IMD A;  4KDY A;  1OVN A;  2OAD A;  3KD0 A;  1T1V A;  3F9U A;  1R7H A;  1A2J A;  2CVK A;  1EV9 A;  1TRU A;  1NW2 A;  3FKF A;  2Z9S A;  1SYR A;  2F9S A;  5D9T A;  1Z6M A;  1OAZ A;  4ML6 A;  5DJM A;  1JZW A;  2MMZ A;  4KF9 A;  5H5R A;  1VF1 A;  4MPF A;  3C1R A;  1YDK A;  2X8G A;  4LMV A;  4K1F A;  1NSW A;  1GLP A;  2VCT A;  3H93 A;  4HI7 A;  1YF0 A;  2C0D A;  1XW9 A;  1JLV A;  1MDJ A;  2OA7 A;  2VL2 A;  4DSR A;  2N5A A;  2PGT A;  1TJD A;  3CMI A;  4JBB A;  2H71 A;  4PNG A;  3VWX A;  3H1N A;  1AUC A;  4MLY A;  4RI6 A;  2CZ3 A;  3DIE A;  4TR1 A;  2L59 A;  3PH9 A;  5J5N A;  4ZIJ A;  1ABA A;  2O89 A;  5CAX A;  3WGE A;  2HXK A;  4POM A;  2P0G A;  4CDO A;  1A2L A;  4OCE A;  4MP4 A;  2O87 A;  3ERW A;  3LFL A;  2L5O A;  2VL3 A;  3VWV A;  5HR0 A;  3CRU A;  1V9W A;  3FYG A;  1ZZY A;  4ZBB A;  4IVF A;  1QK8 A;  2DJ2 A;  2PN8 A;  1XWA A;  4Z7X A;  3VFI A;  3HY2 A;  1J08 A;  1ZCP A;  3L9U A;  4JRR A;  3A5W A;  1JZO A;  3IC8 A;  4MF6 A;  4V1A p;  2H75 A;  1ZMA A;  13GS A;  2ZUP A;  1FVK A;  2ON7 A;  2M46 A;  1WRY A;  1AW9 A;  3LOR A;  7GSS A;  2OBK A;  3ZIV A;  1PRX A;  3TJF A;  3C7M A;  4N30 A;  2V41 A;  1E6B A;  4FH8 A;  3FRC A;  4DEJ A;  3ZML A;  2GSQ A;  3F4T A;  4ZB6 A;  2H0G A;  5HFG A;  4LL1 B;  2H74 A;  2ES7 A;  3QMX A;  5CRG A;  1N8J A;  4PQI A;  1GP1 A;  3GA4 A;  4G0L A;  2H6X A;  2YV7 A;  3ISO A;  3GUR A;  1YKA A;  4IJ3 A;  2NBS A;  1DBY A;  3PPU A;  1M2D A;  1T8E B;  5C00 A;  2B3S A;  4OFN A;  1EWX A;  4N11 A;  4HJ2 A;  3CTF A;  3I43 A;  3FK8 A;  1K0D A;  4IP6 A;  2H19 A;  2E2M A;  4ECJ A;  4TRX A;  1SK2 A;  4H86 A;  3H79 A;  1AC1 A;  1OC8 A;  1QQ2 A;  4FYB A;  3QOU A;  4BL7 A;  1X5D A;  1KEB A;  2HLS A;  16GS A;  1W4V A;  1V98 A;  1TDI A;  3HJO A;  2FHE A;  5B7C A;  2VOC A;  5D93 A;  2GVP A;  4XS4 B;  2P5R A;  5ECK B;  5ECI B;  3VI5 A;  1J9B A;  3EVI A;  2JZR A;  5CNW A;  1MD3 A;  2IL3 A;  2WB9 A;  3I69 A;  2IMK A;  2O7K A;  4JZQ A;  2DLX A;  5A4W A;  3E3E A;  1AXD A;  4E8H A;  2G0F A;  2GDR A;  2HYX A;  2JSY A;  2IWT A;  1SJI A;  1KBN A;  4FYU A;  4ZB9 A;  1A0F A;  2IMD A;  3KGK A;  5ECL B;  3QFA C;  3D21 A;  4GCI A;  1S3D A;  4FYC A;  1PKW A;  4D73 A;  4G9H A;  2E7P A;  3AY8 A;  2QC7 A;  4TN8 A;  1U87 A;  3RAZ A;  2WUL A;  4X0X A;  4BA7 A;  1A8L A;  3VWW A;  2BTO T;  3GV1 A;  4NHZ A;  2DIZ A;  5A4U A;  1SKS B;  4MDC A;  3LSZ A;  2IIY A;  5B8B A;  2CX3 A;  2E2G A;  2YWI A;  2RUF A;  2B7J A;  4HEA 2;  3GHA A;  4J2F A;  4AGS A;  4AF2 A;  4K8M A;  2I9H A;  5JWR B;  1WMJ A;  4PX1 A;  1T4Y A;  3ME7 A;  5ECH B;  1XXU A;  3RDW A;  5D96 A;  1MEK A;  1SKR B;  2VUP A;  4PNF A;  1ERV A;  2EIR A;  2H6Y A;  4G19 A;  3FW2 A;  2C3N A;  2R4V A;  4WKW A;  3VWU A;  1XBS A;  4KH7 A;  2IPA A;  3VPQ A;  4F2I A;  1GTI A;  1ACV A;  4KW6 A;  2XBQ A;  2YN1 A;  3E9J B;  5CRE A;  2H1A A;  5DAK B;  5F8B A;  4YQV A;  4V2L A;  1FB0 A;  3EWL A;  3LXT A;  1YQ1 A;  1VGL A;  3A2W A;  4EL1 A;  4KB3 A;  3VUR A;  4USS A;  3CYN A;  1DUG A;  5GZZ B;  3SBC A;  1I9D A;  2RM6 A;  3QDN A;  3LJR A;  4YH2 A;  3JCM L;  3IPZ A;  3G7Y A;  2UZ8 A;  3UL3 A;  2HZE A;  2KHP A;  3RHB A;  1QMV A;  4EUY A;  2C0F A;  5ABR A;  5ECO B;  4AJ7 A;  4PXO A;  1PX7 A;  4MH2 A;  3TOT A;  3IRA A;  1NHO A;  4KSM A;  1XOA A;  2NPB A;  4GQC A;  2WJU A;  4EVM A;  1M0U A;  4X1U A;  4WF5 A;  2GLR A;  1YY7 A;  4BVX B;  1SKW B;  1TXX A;  2AV4 A;  4ILF A;  3UIW A;  2TRC P;  4OO5 A;  10GS A;  4O32 A;  5E59 A;  4ZL9 A;  1BYE A;  2MBT A;  2DC5 A;  2YWO A;  2YWN A;  4HU7 A;  4DSS A;  3GKN A;  3DVW A;  4TVE A;  3RPN A;  5JWO B;  1OE7 A;  2CT6 A;  3UMA A;  2HSM A;  5FHI A;  1OKT A;  3ERF A;  3WT1 A;  2N5B A;  2DBC A;  1SD8 A;  2O85 A;  4N10 A;  2A2R A;  3IDV A;  1X0R A;  3RPP A;  1GSY A;  2J9H A;  2A2S A;  4Q5N A;  4NHW A;  2RM5 A;  1TRS A;  4OMV A;  3NOF A;  4Q5Q A;  3IHQ A;  5KN0 A;  1T7P B;  4K0N A;  2P5Q A;  4KGI A;  3O76 A;  3TKR A;  1LJR A;  5C04 A;  1A0R P;  1A2M A;  5D8I A;  2JL4 A;  4O5R A;  1EP7 A;  1EGR A;  2HRA A;  2HSM B;  2B5X A;  2FWH A;  2WCI A;  3KH9 A;  1GUH A;  1Z3E A;  5A4V A;  1PKZ A;  1Q98 A;  3WT2 A;  5IO2 A;  5LCZ A;  2LQQ A;  3A2V A;  3F6F A;  4XRD A;  3O3T A;  3BBY A;  1Z7P A;  3APQ A;  3IXR A;  1GUM A;  2M80 A;  3IC4 A;  3MNG A;  1GUL A;  3ZL5 A;  5ECR B;  2R3X A;  2AHE A;  5D9V A;  4DVC A;  3GNJ A;  4I97 A;  4I6X A;  1FHE A;  3HZ8 A;  3UJ1 A;  4IEL A;  5DAL B;  1TK8 B;  1MTC A;  4N0Z A;  3APS A;  5J4U A;  2JU5 A;  1N2A A;  2PBJ A;  3W8S A;  3VPT A;  2DIY A;  3ZRE A;  3U6V A;  4MZB A;  4X43 A;  2C0E A;  2GQL A;  3ZLP A;  4NXI A;  3ZFL A;  1QXH A;  1GUK A;  1GWC A;  4ZIL A;  4ZL7 A;  2R2J A;  2VLV A;  2H8L A;  2MBS A;  3W6G A;  3Q18 A;  5IOX A;  3GKK A;  1PL2 A;  3DXB A;  3DWV A;  5ELA A;  3WYW A;  3O6T A;  3P8W A;  3QAV A;  2LV3 A;  3DRN A;  3HVX A;  4GSN A;  4YQM A;  3VLN A;  4GF0 A;  4QQ7 A;  2NVL A;  2LUS A;  1GL8 A;  3ZYW A;  3QD9 A;  5ID2 B;  1G6W A;  3KM6 A;  1PA3 A;  4TXO A;  4GXZ A;  11GS A;  2FWE A;  2EIO A;  1XWC A;  2HRF A;  2OJL A;  5D9X A;  3KEB A;  1SL2 B;  3UOM A;  2PPT A;  2GQK A;  1XCC A;  4QL9 A;  5ECQ B;  1FB6 A;  3EU4 A;  4L8E A;  4BVY B;  1YEX A;  1WWJ A;  2VCW A;  4JR4 A;  1K0O A;  3ZIT A;  5F05 A;  2H0I A;  5CO3 A;  4TXO B;  5FT3 A;  3L9V A;  1AQV A;  4KND A;  5G5E A;  1T3B A;  2AUV A;  4WBJ A;  4K9Z A;  4ECB A;  6GST A;  2NTO A;  3ZRD A;  4O7H A;  4K7N A;  3P7X A;  3M8N A;  1FW1 A;  2JSZ A;  5ECM B;  4EKZ A;  5HFI A;  4XIH A;  1XVQ A;  2RLI A;  2L5L A;  2VIM A;  2YPM A;  1K0C A;  3NZN A;  4MJC A;  4PUR A;  1UN2 A;  4MH3 A;  1TTZ A;  3HXS A;  1RW1 A;  2XHF A;  3GKM A;  4IHU A;  2AJQ B;  1QGV A;  1WP0 A;  4ZXG A;  3TB2 A;  4NV2 A;  4IW9 A;  3DKS A;  5IO0 A;  1U3A A;  3KMN A;  2IMI A;  3KTL A;  4J56 E;  1YKC A;  1YEP A;  1TOF A;  1ZYE A;  2AYT A;  2K9F A;  1E2Y A;  4MMM A;  3TUE A;  4NWY A;  5D73 A;  2VCX A;  2LRN A;  6GSS A;  4TKY A;  1QFN A;  5HQP A;  3F0I A;  3LQ7 A;  2O8V B;  2WFC A;  5LD0 A;  2IN3 A;  1S3C A;  2FY6 A;  4I5Q A;  1XVW A;  3A3T A;  4LLR A;  5AN1 A;  5EPF A;  2QGV A;  3RBT A;  1SK1 A;  4OCF A;  3UEM A;  1USB A;  1H75 A;  3FZA A;  5B8A A;  1K3L A;  2B1L A;  1XWG A;  4MPG A;  3EE2 A;  5AIS A;  3ZIJ A;  1MD4 A;  1V57 A;  4XS4 A;  5HFK A;  3C8E A;  2WDU A;  1M7T A;  4PGT A;  3WGX A;  4NPB A;  3ZMK A;  4IKH A;  3D5J A;  3TGZ A;  4V1A g;  4G10 A;  2H01 A;  4KDU A;  2V32 A;  1WJK A;  3G7I A;  2LJR A;  1FAA A;  3C71 A;  3H8Q A;  1SU9 A;  3LWA A;  1SEN A;  5IQY A;  2H70 A;  1THO A;  1FOV A;  2RII A;  4IP1 A;  1TI3 A;  2PWJ A;  2C3Q A;  2KOK A;  2DJJ A;  3TKS C;  2XPE A;  4PTS A;  3TRX A;  2QSI A;  5G1K A;  4Q5R A;  2B7K A;  2C8U A;  3IK9 A;  1I5G A;  4KX4 A;  4G2E A;  3TCO A;  3VK9 A;  1EOH A;  2H6Z A;  5DBQ A;  2H1B A;  2FWF A;  4TW5 A;  3G9B A;  5CRD A;  1GSS A;  2FWG A;  4ID0 A;  1O81 A;  2LKU A;  3CSI A;  2BJX A;  2GGT A;  2FLS A;  1X9S B;  1O6J A;  3UVH A;  3L9S A;  4POL A;  1GNE A;  4F0B A;  1G7E A;  3APO A;  1ERU A;  3IA1 A;  2J23 A;  1O8X A;  3F4S A;  1LBK A;  2H30 A;  1T00 A;  2IJY A;  3QAG A;  1C72 A;  4QL7 A;  3MWH A;  4L5L A;  3FR3 A;  3LYK A;  5DAK A;  3F3R A;  4KCE A;  1PD2 1;  4ECC A;  2YOI A;  3GTU B;  2MMA A;  1TRW A;  2HNL A;  3GKX A;  1Z6N A;  2VD0 A;  1G7O A;  2JAD A;  4MJA A;  1ERW A;  1EV4 A;  2I81 A;  2V2G A;  3J7Y b;  3TRQ A;  2MYG A;  2EC4 A;  2BMX A;  2X8C A;  5DCH A;  3F3Q A;  3IV4 A;  3IE3 A;  2ALB A;  1UA5 A;  2V1M A;  3EU3 A;  1IYI A;  2WS2 A;  1RQM A;  2I4A A;  5ENU A;  3TKS A;  4O92 A;  3UBL A;  1PX6 A;  3ERG A;  4NAX A;  2FCH A;  4MZW A;  2DJK A;  3CSH A;  3GUS A;  2DJ3 A;  3GYK A;  2QKE A;  1Z9H A;  2REM A;  4TR3 A;  4XS6 A;  1B4Q A;  2F8F A;  3GST A;  4IJI A;  4BVX A;  1EZK A;  5FWG A;  2M72 A;  1DE1 A;  1TK0 B;  2HE3 A;  3SWL A;  2X99 A;  3BCK A;  3TJJ A;  3TRP A;  1XWK A;  2CV4 A;  4NV5 A;  1G6Y A;  3CBU A;  3HHV A;  1BAY A;  1F6M C;  3CRT A;  3WGD A;  4RQX A;  2YZU A;  4KCA A;  2HSN B;  4EDZ A;  3GL3 A;  3GH9 A;  3HZ4 A;  1KTE A;  1XW6 A;  1HYU A;  1QUW A;  1SJZ A;  2K8S A;  4IQ1 A;  5DJL A;  3TDG A;  2YZH A;  2FUG 2;  4ML1 A;  2JZS A;  2FGX A;  3EIN A;  2HFD A;  3PIN A;  3CSJ A;  5JCW A;  1DSB A;  5F07 A;  1K3O A;  1K0A A;  2V6O A;  3H4K A;  4MF7 A;  2R6K A;  3ED3 A;  2MMO A;  4MCU A;  1EEJ A;  3NIV A;  1EOG A;  3R2Q A;  3D4M A;  2GS3 A;  4N0V A;  2OKA A;  5BMU A;  3U5R E;  3KJY A;  1JFU A;  5AGY A;  4EXJ A;  1V58 A;  4F82 A;  2GST A;  1JHB A;  1K0N A;  4XHM A;  4TR0 A;  3HDC A;  2AAW A;  3D22 A;  12GS A;  1FVJ A;  2MMN A;  2ON5 A;  1EEM A;  5GAN D;  3I9V 2;  2WGR A;  4WBR D;  1XZO A;  5G2Z A;  2C1Y A;  2YJH A;  2TIR A;  2DMM A;  5GSS A;  3N9J A;  3HVV A;  5GST A;  1DE2 A;  3L4N A;  2OE1 A;  5HR3 A;  1THX A;  2C0G A;  5DAL A;  2IMF A;  1O7U A;  4LMW A;  3FZ9 A;  4IS0 A;  1EP8 A;  5G30 A;  2VM2 A;  6GSY A;  1K0M A;  3N5O A;  2FD3 A;  4I8B A;  3IOS A;  5DDL A;  2LRT A;  1KNG A;  3UAR A;  4CHS A;  3KP9 A;  2B1K A;  1SYX A;  4EF0 A;  4ZB8 A;  2FA4 A;  1OE8 A;  5HR1 A;  5JCG A;  5J9B A;  3QAW A;  3ZZX A;  2MZC A;  2K8V A;  5J41 A;  2XPD A;  1PGT A;  3RHC A;  1PMT A;  3TJK A;  2I3Y A;  2DSA A;  3HA9 A;  3S9F A;  2HSH A;  4YAP A;  2FNO A;  2F3M A;  1ZL9 A;  18GS A;  1OC9 A;  5ID2 A;  1M9B A;  3KCM A;  3ZTL A;  4HUA A;  5GAP D;  1GSD A;  3IAM 2;  1PSQ A;  1OYJ A;  2VAF A;  1X9M B;  1GNW A;  4F0C A;  3IR4 A;  5H5Q A;  4BVY A;  2LJK A;  1R5P A;  4OFT A;  1MDI A;  2H76 A;  2E0Q A;  3D6I A;  1OC9 B;  4BWQ A;  3BJ5 A;  2VD1 A;  2K18 A;  1B4P A;  1TRV A;  1HNA A;  2ZNM A;  4OO4 A;  1UC7 A;  4YAV A;  4GSS A;  1B48 A;  3D4T A;  3GX8 A;  2LNS A;  4E8E A;  5D9W A;  5IMZ A;  4ECI A;  4CW9 A;  3W8J A;  2IFQ B;  4MA9 A;  2HT9 A;  2L4Q A;  1SK0 A;  1F37 A;  1GRX A;  2PU9 C;  1AQX A;  1SJ6 A;  3US3 A;  4IN0 A;  1Z5Y E;  2CAI A;  1Y25 A;  4EDY A;  3FY7 A;  1GSE A;  1VF3 A;  2GQM A;  1TK5 B;  1BX9 A;  2YV9 A;  2KUC A;  2PVQ A;  5H5S A;  2WZ9 A;  2H72 A;  1URM A;  5EVO A;  4JE1 A;  4KE3 A;  4PQH A;  4HS1 A;  5DQY A;  2G2Q A;  3KH7 A;  3F63 A;  3KIJ A;  4K7I A;  3P2A A;  4POK A;  5L71 A;  2VCZ A;  1U88 A;  1FO5 A;  1GTU A;  2JAC A;  1B9X C;  3MSZ A;  1WOU A;  3K8N A;  4K0G A;  3DEX A;  3WD6 A;  6GSW A;  2VL9 A;  4XTS A;  3TKP A;  2DJ1 A;  3GSS A;  1AQW A;  1YJ6 A;  4IQA A;  5JCU A;  1ILO A;  4KSO A;  2EIQ A;  2PUK C;  4MJE A;  5EY6 A;  5A5K A;  3C73 A;  3TKQ A;  2LST A;  1WPI A;  3L0H A;  4RUV A;  5IM9 A;  5KN2 A;  2GSS A;  3EUR A;  3LGC A;  3EC3 A;  1K3Y A;  1Y6E A;  3HKR A;  5DVB A;  3UAP A;  4GST A;  1GSU A;  2GZP A;  2VO4 A;  1VF4 A;  3GRX A;  4IBP A;  3UBK A;  1F2E A;  1HNC A;  2R37 A;  4TR1 B;  1OKD A;  4RQR A;  3KXO A;  4IGJ A;  14GS A;  1EGO A;  3CTG A;  1MDK A;  3R3E A;  3IBH A;  1XIY A;  2WRT A;  3FHK A;  4WF4 A;  3MDK A;  4MK3 A;  1F3A A;  3J7Y k;  2CA8 A;  3V1W A;  3FR9 A;  4P3Y B;  1B9Y C;  1SD9 A;  1X5E A;  3F8U A;  4HQZ A;  8GSS A;  1XPV A;  2LTK A;  3DYR A;  3EMX A;  3ME8 A;  1K0B A;  1A23 A;  3DVX A;  2YNX A;  4OWY A;  1GLQ A;  3BCI A;  2HQT A;  3QR6 A;  2ZCT A;  4HQS A;  2DML A;  1BG5 A;  3C1S A;  2N5F A;  2LEG A;  3OR5 A;  4EC0 A;  4XS1 A;  1H4O A;  5IPG A;  4ACS A;  2X8H A;  3HCZ A;  4KDX A;  3LEF A;  3MAK A;  4I2U A;  3GIX A;  3Q19 A;  1GTB A;  1YZX A;  4XRA A;  4POB A;  2L57 A;  1CQH A;  3M1G A;  5AIX A;  1R5A A;  4PUF C;  5CP1 A;  3I6A A;  1FG4 A;  3EYT A;  1ZYQ B;  2TRX A;  3P90 A;  5J9C A;  2HSY A;  4XCS A;  3FR6 A;  3LXZ A;  3KTB A;  2VLT A;  5F0G A;  3Q6O A;  1J0F A;  1VRS D;  2VCV A;  4AJ8 A;  2GZY A;  2YP6 A;  5G5F A;  1OC3 A;  4EE0 A;  4F03 A;  3TJG A;  1Z7R A;  5EL8 A;  1LU4 A;  1A24 A;  3GX0 A;  1XW5 A;  4AJ6 A;  4EO3 A;  5ECS A;  4L0U A;  4BWS A;  4MJB A;  1PQN A;  4K7O A;  3M0F A;  1X9W B;  5JWQ B;  3D0Z A;  2HZF A;  2YWM A;  2OAC A;  1X5C A;  1XWB A;  4K6X A;  4HZ4 A;  3DGQ A;  1XFL A;  3IK7 A;  5CYY A;  2XBI A;  1U3I A;  3ZVJ D;  9GSS A;  1G0T A;  2K6V A;  2LS5 A;  5KN3 A;  4TR4 A;  1O73 A;  4BL7 B;  4MF5 A;  5DQS A;  2FA8 A;  4KUN A;  3KMO A;  4ZBA A;  4F9Z A;  1BJX A;  3GTU A;  3F6D A;  4GQF A;  2NDO A;  5CRW A;  5LNK e;  2V6K A;  4J57 E;  5J3R A;  1U6T A;  1TU8 A;  5ECN B;  2RUE A;  4K2D A;  3DD3 A;  4V2M A;  2F8A A;  5F06 A;  2F51 A;  4GLT A;  3GFK A;  3DML A;  2B5E A;  2H0H A;  2PMT A;  4TXV A;  2YJ7 A;  5AIV A;  4ZBD A;  5IMA A;  4D73 B;  4L5O A;  4YQU A;  4G0K A;  5IPH A;  2LRC A;  5B6N A;  5INY A;  3L78 A;  3A2X A;  2X64 A;  1SL0 B;  1ST9 A;  2L4C A;  1VF2 A;  3F4R A;  1BED A;  2GT5 A;  1R26 A;  4G0I A;  2D2Z A;  1T4Z A;  3M9J A;  2A4V A;  2CZ2 A;  4BPY A;  1HD2 A;  4LL4 B;  4TOP A;  3Q74 A;  4FO5 A;  2HRK A;  2KP1 A;  2H73 A;  3GN3 A;  1PL1 A;  2C3T A;  3E0U A;  1ZOF A;  5G31 A;  2IME A;  3HJM A;  2YCD A;  1V2A A;  4HZ2 A;  4PUA A;  2CQ9 A;  2CAQ A;  1NHY A;  3GH6 A;  4MAB A;  2GZZ A;  5CRH A;  1BQ7 A;  3G7J A;  1O8W A;  4WET A;  3HVS A;  1TU7 A;  1O85 A;  3TOU A;  2LQO A;  1SL1 B;  4Q5F A;  5ELG A;  3QPM A;  19GS A;  2OE0 A;  3LYP A;  2VM1 A;  1B8X A;  3HJP A;  2JZT A;  1S3A A;  2HRK B;  1ZGN A;  4LA1 A;  1GSQ A;  1A8Y A;  1UVZ A;  1JZR A;  1M9A A;  1HNB A;  1CQG A;  5KEJ A;  1ERT A;  5IIZ A;  1ML6 A;  5IMV A;  1Q4J A;  1F3B A;  17GS A;  4WR4 A;  1W89 A;  4OFM A;  4ULX A;  1M2B A;  1F9M A;  4MZC A;  2CX4 A;  1ON4 A;  4WXT A;  2I1U A;  2HI7 A;  1R4W A;  6GSV A;  2HZE B;  3TJB A;  5ECP B;  4FQU A;  2CVD A;  4ISD A;  1WIK A;  22GS A;  3HYP A;  3HD5 A;  20GS A;  1M2A A;  2L6D A; 
#chains in the Genus database with same CATH topology
 3KP8 A;  5COH A;  4GTU A;  4NMU A;  1GH2 A;  3BD2 A;  4Z2T A;  2GSR A;  1HQO A;  4JR6 A;  3BOA A;  2HRN A;  3CXG A;  2H66 A;  2KP2 A;  3ZVJ A;  2DJ0 A;  1GSF A;  5A34 A;  2L6C A;  5IMF A;  3PR8 A;  4RI7 A;  4HU9 A;  2CVB A;  3QCP A;  4DSS B;  4JU5 A;  1IYH A;  5G1L A;  4DSQ A;  1AAZ A;  2YAN A;  4WR5 A;  2OE3 A;  4L0W A;  4ZL8 A;  2B6M A;  5B6M A;  2P31 A;  4I2T A;  5IMC A;  4GWR A;  3PGT A;  1V40 A;  6GSX A;  3FEU A;  3ZFB A;  4V2N A;  4GRF A;  2LNT A;  1RK4 A;  1WE0 A;  1YF1 A;  4BIK A;  3TKS E;  5DCG A;  3M3M A;  3IAS 2;  3M9K A;  3GMF A;  5HR2 A;  3FZ5 A;  2R5G A;  4PQ1 A;  2VL2 C;  1JZD A;  4CY8 A;  2PER A;  4JED A;  2KLX A;  4Z2R A;  4KAE A;  4HDE A;  4HOJ A;  3QFB C;  3VI7 A;  2H1D A;  2C4J A;  5E4W A;  6GSU A;  2GT6 A;  1TI1 A;  2XC2 A;  3GL5 A;  1TP9 A;  5KN1 A;  4KA0 A;  2AB6 A;  2IFQ A;  2VCQ A;  1TKD B;  2H1G A;  1SVM A;  2OBI A;  4HJM A;  2GTU A;  1GTA A;  1AIU A;  1TW9 A;  1XOB A;  2B5Y A;  2LJA A;  3UVT A;  1M99 A;  4FIW A;  4WEY A;  3LG6 A;  4OD7 A;  2C80 A;  3KZQ A;  2PVO C;  1JLW A;  5IOW A;  1PN9 A;  2VLU A;  3EMP A;  1NM3 A;  3FZ4 A;  5IMD A;  4KDY A;  1OVN A;  2OAD A;  3KD0 A;  1T1V A;  3F9U A;  1R7H A;  1A2J A;  2CVK A;  1EV9 A;  1TRU A;  1NW2 A;  3FKF A;  2Z9S A;  1SYR A;  1YEW C;  2F9S A;  5D9T A;  1Z6M A;  1OAZ A;  4ML6 A;  5DJM A;  1JZW A;  5KOX A;  2MMZ A;  4KF9 A;  5H5R A;  1VF1 A;  4MPF A;  3C1R A;  1YDK A;  2X8G A;  4LMV A;  4K1F A;  1NSW A;  1GLP A;  2VCT A;  3H93 A;  4HI7 A;  1YF0 A;  2C0D A;  1XW9 A;  1JLV A;  1MDJ A;  1ZYN A;  2OA7 A;  2VL2 A;  4DSR A;  2N5A A;  2PGT A;  1TJD A;  3CMI A;  4JBB A;  2H71 A;  4PNG A;  3VWX A;  3H1N A;  1AUC A;  4MLY A;  4RI6 A;  2CZ3 A;  3DIE A;  4TR1 A;  2L59 A;  3PH9 A;  5J5N A;  4ZIJ A;  1ABA A;  2O89 A;  5CAX A;  3WGE A;  2HXK A;  4YKG A;  4POM A;  2P0G A;  4CDO A;  2A2P A;  1A2L A;  4OCE A;  4MP4 A;  2O87 A;  4A5P A;  3ERW A;  3LFL A;  2L5O A;  2VL3 A;  3VWV A;  5HR0 A;  3CRU A;  1V9W A;  3FYG A;  1ZZY A;  4ZBB A;  4IVF A;  1BF5 A;  1QK8 A;  2DJ2 A;  2PN8 A;  1XWA A;  4Z7X A;  3VFI A;  3HY2 A;  4G01 A;  1J08 A;  1ZCP A;  3L9U A;  4JRR A;  3A5W A;  1JZO A;  3IC8 A;  5BRT A;  4MF6 A;  4V1A p;  2H75 A;  1ZMA A;  13GS A;  2ZUP A;  1FVK A;  2ON7 A;  2M46 A;  1WRY A;  1AW9 A;  2EFE A;  3LOR A;  7GSS A;  2OBK A;  3ZIV A;  1PRX A;  3TJF A;  3C7M A;  4N30 A;  2V41 A;  1E6B A;  4FH8 A;  3FRC A;  4DEJ A;  3ZML A;  2GSQ A;  3F4T A;  4ZB6 A;  2H0G A;  5HFG A;  4LL1 B;  2H74 A;  2ES7 A;  3QMX A;  5CRG A;  5J47 A;  1N8J A;  4PQI A;  1GP1 A;  3GA4 A;  4G0L A;  2H6X A;  2YV7 A;  3ISO A;  3GUR A;  1YKA A;  4IJ3 A;  2NBS A;  1DBY A;  3PPU A;  1M2D A;  3LW9 A;  1T8E B;  5C00 A;  2B3S A;  4OFN A;  1EWX A;  4N11 A;  4HJ2 A;  3CTF A;  3I43 A;  3FK8 A;  4FXY P;  1K0D A;  4IP6 A;  2H19 A;  2E2M A;  4ECJ A;  4TRX A;  1SK2 A;  4H86 A;  3H79 A;  1AC1 A;  5A1N B;  1OC8 A;  4MNN A;  1QQ2 A;  4FYB A;  3QOU A;  4BL7 A;  1X5D A;  1KEB A;  2HLS A;  3EPT A;  16GS A;  1W4V A;  1V98 A;  1TDI A;  3HJO A;  2FHE A;  5B7C A;  2VOC A;  5D93 A;  2GVP A;  3MIX A;  2P5R A;  5ECK B;  5ECI B;  3VI5 A;  4XS4 B;  1J9B A;  3EVI A;  2JZR A;  5CNW A;  1MD3 A;  2IL3 A;  2WB9 A;  3I69 A;  2IMK A;  2O7K A;  4JZQ A;  2DLX A;  5A4W A;  2WVZ A;  3E3E A;  1AXD A;  4E8H A;  2G0F A;  2GDR A;  2HYX A;  2JSY A;  2IWT A;  1ZYP A;  1SJI A;  1KBN A;  4FYU A;  4ZB9 A;  1A0F A;  2IMD A;  3KGK A;  5ECL B;  3QFA C;  3D21 A;  4GCI A;  1S3D A;  4FYC A;  1PKW A;  4D73 A;  4G9H A;  2E7P A;  3AY8 A;  2QC7 A;  4TN8 A;  1U87 A;  3RAZ A;  2WUL A;  4X0X A;  4BA7 A;  1A8L A;  3VWW A;  2BTO T;  3GV1 A;  2QA2 A;  4NHZ A;  2DIZ A;  5A4U A;  1SKS B;  4MDC A;  3LSZ A;  2IIY A;  5B8B A;  2CX3 A;  2E2G A;  2YWI A;  2RUF A;  2B7J A;  4HEA 2;  3GHA A;  3A5I A;  3CQF A;  4J2F A;  1M3J A;  4AI6 A;  1SVL A;  4AGS A;  4AF2 A;  4K8M A;  2WW3 A;  2I9H A;  5JWR B;  1WMJ A;  4PX1 A;  1T4Y A;  3ME7 A;  5ECH B;  1XXU A;  3RDW A;  5D96 A;  1MEK A;  1XG8 A;  1SKR B;  2VUP A;  4PNF A;  1ERV A;  2EIR A;  2H6Y A;  4G19 A;  3FW2 A;  2C3N A;  2UV8 G;  2R4V A;  4WKW A;  3VWU A;  1XBS A;  4KH7 A;  2IPA A;  3VPQ A;  4F2I A;  1GTI A;  1ACV A;  4KW6 A;  2XBQ A;  2YN1 A;  3E9J B;  5CRE A;  2H1A A;  5DAK B;  5F8B A;  4YQV A;  4V2L A;  1FB0 A;  3EWL A;  3LXT A;  4AKI A;  1YQ1 A;  1VGL A;  3A2W A;  4EL1 A;  4KB3 A;  3VUR A;  4USS A;  3CYN A;  1DUG A;  5GZZ B;  3SBC A;  1I9D A;  2RM6 A;  3QDN A;  3LJR A;  4YH2 A;  3JCM L;  3IPZ A;  3G7Y A;  2UZ8 A;  3UL3 A;  2HZE A;  2KHP A;  3RHB A;  1QMV A;  4EUY A;  2C0F A;  5ABR A;  5ECO B;  4AJ7 A;  4PXO A;  1PX7 A;  4MH2 A;  3TOT A;  3IRA A;  1NHO A;  4KSM A;  1XOA A;  4ZB7 A;  2NPB A;  4GQC A;  2WJU A;  4EVM A;  1M0U A;  4X1U A;  4WF5 A;  2GLR A;  1YY7 A;  4BVX B;  1SKW B;  1TXX A;  2AV4 A;  4ILF A;  3UIW A;  2TRC P;  4OO5 A;  10GS A;  4O32 A;  5E59 A;  4ZL9 A;  1BYE A;  2MBT A;  2DC5 A;  2YWO A;  2YWN A;  4HU7 A;  4DSS A;  3GKN A;  3DVW A;  4TVE A;  3RPN A;  5JWO B;  1OE7 A;  2CT6 A;  3UMA A;  2HSM A;  5FHI A;  4YKF A;  1OKT A;  3ERF A;  3WT1 A;  2N5B A;  2DBC A;  1SD8 A;  2O85 A;  4N10 A;  2A2R A;  3IDV A;  1X0R A;  3RPP A;  1GSY A;  2J9H A;  2A2S A;  4Q5N A;  4NHW A;  2RM5 A;  1TRS A;  4OMV A;  3NOF A;  4Q5Q A;  3IHQ A;  5KN0 A;  1T7P B;  1S3R A;  4K0N A;  2P5Q A;  4KGI A;  3O76 A;  3TKR A;  1LJR A;  5C04 A;  2O3E A;  1A0R P;  1A2M A;  5D8I A;  2JL4 A;  4O5R A;  1EP7 A;  1EGR A;  2HRA A;  2HSM B;  2B5X A;  2DKI A;  1S4B P;  2FWH A;  2WCI A;  3KH9 A;  1GUH A;  1Z3E A;  5A4V A;  1PKZ A;  1Q98 A;  3WT2 A;  5IO2 A;  5LCZ A;  2LQQ A;  3A2V A;  3F6F A;  4XRD A;  3O3T A;  3BBY A;  1Z7P A;  3APQ A;  3IXR A;  1GUM A;  2M80 A;  3IC4 A;  2O36 A;  3MNG A;  1GUL A;  3ZL5 A;  5ECR B;  2R3X A;  2AHE A;  5D9V A;  4DVC A;  3GNJ A;  4I97 A;  4I6X A;  1FHE A;  3HZ8 A;  3UJ1 A;  4IEL A;  5DAL B;  1TK8 B;  1MTC A;  2WVY A;  4N0Z A;  3APS A;  5J4U A;  2JU5 A;  1N2A A;  2PBJ A;  1N25 A;  3W8S A;  3VPT A;  2DIY A;  3ZRE A;  3U6V A;  4MZB A;  4X43 A;  2C0E A;  2GQL A;  3ZLP A;  4NXI A;  3ZFL A;  1QXH A;  1GUK A;  1GWC A;  4ZIL A;  4ZL7 A;  2R2J A;  2VLV A;  2H8L A;  2MBS A;  3W6G A;  3Q18 A;  5IOX A;  3GKK A;  1PL2 A;  3DXB A;  3DWV A;  5ELA A;  3WYW A;  3O6T A;  3P8W A;  3TU3 B;  3DRN A;  3QAV A;  2LV3 A;  1M3I A;  1YVL A;  3HVX A;  4GSN A;  4YQM A;  3VLN A;  4GF0 A;  4QQ7 A;  2NVL A;  2LUS A;  1GL8 A;  3ZYW A;  3QD9 A;  5A5H B;  5J4V A;  5ID2 B;  1G6W A;  3KM6 A;  3FMW A;  1PA3 A;  4TXO A;  4GXZ A;  11GS A;  2FWE A;  2EIO A;  1XWC A;  2HRF A;  2OJL A;  4PI2 C;  5D9X A;  3KEB A;  1SL2 B;  3UOM A;  2PPT A;  2GQK A;  1XCC A;  4QL9 A;  5ECQ B;  1FB6 A;  3EU4 A;  4L8E A;  4BVY B;  1YEX A;  4CY6 A;  1WWJ A;  2VCW A;  4JR4 A;  1K0O A;  3ZIT A;  5F05 A;  2H0I A;  5CO3 A;  4TXO B;  5FT3 A;  3L9V A;  1AQV A;  4KND A;  5G5E A;  1T3B A;  2AUV A;  4WBJ A;  4K9Z A;  4ECB A;  6GST A;  2NTO A;  3ZRD A;  4W66 A;  4O7H A;  4K7N A;  3P7X A;  3M8N A;  1FW1 A;  2JSZ A;  5ECM B;  4EKZ A;  5HFI A;  4XIH A;  1XVQ A;  2RLI A;  2L5L A;  3RGB C;  2VIM A;  2YPM A;  1K0C A;  3NZN A;  4MJC A;  4PUR A;  4PHZ C;  1UN2 A;  4MH3 A;  1TTZ A;  3HXS A;  1RW1 A;  2XHF A;  3GKM A;  4IHU A;  2AJQ B;  1QGV A;  1WP0 A;  4ZXG A;  3TB2 A;  4NV2 A;  4IW9 A;  3DKS A;  5IO0 A;  1U3A A;  3KMN A;  2IMI A;  3KTL A;  4J56 E;  1YKC A;  1YEP A;  1TOF A;  1ZYE A;  2AYT A;  2K9F A;  1E2Y A;  4MMM A;  3TUE A;  4NWY A;  5D73 A;  2VCX A;  2LRN A;  6GSS A;  4TKY A;  1QFN A;  5HQP A;  3F0I A;  3LQ7 A;  2O8V B;  2WFC A;  5LD0 A;  2IN3 A;  1S3C A;  2FY6 A;  4I5Q A;  1XVW A;  3A3T A;  4LLR A;  5AN1 A;  5EPF A;  2QGV A;  3RBT A;  1SK1 A;  5A1N A;  4OCF A;  3UEM A;  1USB A;  1H75 A;  3FZA A;  5B8A A;  1K3L A;  2B1L A;  1XWG A;  4MPG A;  3EE2 A;  5AIS A;  3ZIJ A;  1MD4 A;  1V57 A;  4XS4 A;  5HFK A;  3C8E A;  2WDU A;  1M7T A;  4PGT A;  3WGX A;  4NPB A;  3ZMK A;  4IKH A;  3D5J A;  2EFC A;  2X49 A;  3TGZ A;  4V1A g;  4G10 A;  2H01 A;  4KDU A;  2V32 A;  1WJK A;  3G7I A;  2LJR A;  1FAA A;  2R0C A;  5J4Y A;  3C71 A;  3H8Q A;  1SU9 A;  3LWA A;  1SEN A;  5IQY A;  2H70 A;  1THO A;  1FOV A;  2RII A;  4IP1 A;  1TI3 A;  2PWJ A;  2C3Q A;  2KOK A;  2DJJ A;  3TKS C;  2XPE A;  1PN0 A;  4PTS A;  3TRX A;  2QSI A;  5G1K A;  4Q5R A;  2B7K A;  2C8U A;  3IK9 A;  1I5G A;  4KX4 A;  4G2E A;  3TCO A;  3VK9 A;  1EOH A;  2H6Z A;  5DBQ A;  2H1B A;  2FWF A;  4TW5 A;  3G9B A;  5CRD A;  1GSS A;  2FWG A;  4ID0 A;  1O81 A;  2LKU A;  3CSI A;  2BJX A;  2GGT A;  2FLS A;  1X9S B;  1O6J A;  3UVH A;  3L9S A;  4POL A;  1GNE A;  4EIQ A;  4F0B A;  1G7E A;  3APO A;  1ERU A;  3IA1 A;  2J23 A;  1O8X A;  3F4S A;  1LBK A;  2H30 A;  1T00 A;  2IJY A;  3QAG A;  1C72 A;  4QL7 A;  3MWH A;  4L5L A;  3FR3 A;  3LYK A;  5DAK A;  2WW1 A;  3F3R A;  4KCE A;  1PD2 1;  4ECC A;  2YOI A;  3GTU B;  2MMA A;  1TRW A;  2HNL A;  3GKX A;  1Z6N A;  2EFD A;  2VD0 A;  1G7O A;  2JAD A;  4MJA A;  1ERW A;  1EV4 A;  2I81 A;  2V2G A;  3J7Y b;  3TRQ A;  2MYG A;  2EC4 A;  2BMX A;  2X8C A;  5DCH A;  2WZS A;  3F3Q A;  3IV4 A;  3IE3 A;  2ALB A;  1UA5 A;  2V1M A;  3EU3 A;  1IYI A;  2WS2 A;  1RQM A;  2I4A A;  5ENU A;  3TKS A;  4O92 A;  3UBL A;  1PX6 A;  3ERG A;  4NAX A;  2FCH A;  4MZW A;  2DJK A;  3CSH A;  3GUS A;  4N3Z A;  2DJ3 A;  3GYK A;  2QKE A;  2WVX B;  1Z9H A;  2REM A;  4TR3 A;  4XS6 A;  1B4Q A;  2F8F A;  3GST A;  4IJI A;  4BVX A;  1EZK A;  5FWG A;  2M72 A;  1DE1 A;  1TK0 B;  2HE3 A;  3SWL A;  2X99 A;  3BCK A;  3TJJ A;  3TRP A;  1XWK A;  2CV4 A;  4NV5 A;  1G6Y A;  3CBU A;  3HHV A;  1BAY A;  1F6M C;  3CRT A;  3WGD A;  4RQX A;  2YZU A;  4KCA A;  2HSN B;  4EDZ A;  3GL3 A;  3GH9 A;  3HZ4 A;  1KTE A;  1XW6 A;  1HYU A;  1QUW A;  1SJZ A;  2K8S A;  4IQ1 A;  5DJL A;  3TDG A;  2YZH A;  2FUG 2;  4ML1 A;  2JZS A;  2FGX A;  3EIN A;  2HFD A;  3PIN A;  3CSJ A;  5JCW A;  1DSB A;  5F07 A;  1K3O A;  1K0A A;  2V6O A;  3H4K A;  4MF7 A;  2R6K A;  3ED3 A;  2MMO A;  4MCU A;  1EEJ A;  3NIV A;  1EOG A;  3R2Q A;  3D4M A;  2GS3 A;  4N0V A;  2OKA A;  2QA1 A;  1FOH A;  5BMU A;  3U5R E;  3KJY A;  1JFU A;  5AGY A;  4EXJ A;  1V58 A;  4F82 A;  2GST A;  1JHB A;  1K0N A;  4XHM A;  4TR0 A;  3HDC A;  2AAW A;  3D22 A;  12GS A;  1FVJ A;  2MMN A;  2ON5 A;  1EEM A;  5GAN D;  3I9V 2;  2WGR A;  4WBR D;  1XZO A;  5G2Z A;  2C1Y A;  2YJH A;  4O5U A;  2TIR A;  2DMM A;  5GSS A;  3N9J A;  3HVV A;  5GST A;  4AKX B;  1DE2 A;  3L4N A;  2OE1 A;  3HVN A;  5HR3 A;  1THX A;  2C0G A;  5DAL A;  2IMF A;  5BMU B;  1O7U A;  4LMW A;  3FZ9 A;  4IS0 A;  1EP8 A;  5G30 A;  2VM2 A;  2R0G A;  6GSY A;  1K0M A;  3N5O A;  2FD3 A;  4I8B A;  3IOS A;  5DDL A;  2LRT A;  1KNG A;  3UAR A;  4CHS A;  3KP9 A;  4GDF A;  2B1K A;  1SYX A;  2H1L A;  4EF0 A;  1TXU A;  4ZB8 A;  2FA4 A;  1OE8 A;  5HR1 A;  5JCG A;  5J9B A;  3QAW A;  3ZZX A;  2MZC A;  2K8V A;  5J41 A;  5A34 B;  4HSC X;  2XPD A;  1PGT A;  3RHC A;  1PMT A;  3TJK A;  2I3Y A;  2DSA A;  3HA9 A;  5A5H A;  3S9F A;  2HSH A;  4YAP A;  2FNO A;  2F3M A;  1ZL9 A;  18GS A;  1OC9 A;  4AKG A;  3IHG A;  5ID2 A;  1M9B A;  3KCM A;  3ZTL A;  4HUA A;  5GAP D;  1GSD A;  3IAM 2;  2WW0 A;  1PSQ A;  1OYJ A;  2VAF A;  1PFO A;  1GNW A;  1X9M B;  4F0C A;  3IR4 A;  4Z2U A;  5H5Q A;  4BVY A;  2LJK A;  1R5P A;  4OFT A;  1MDI A;  2H76 A;  4ICY A;  2E0Q A;  3D6I A;  1OC9 B;  4BWQ A;  3BJ5 A;  2VD1 A;  2K18 A;  1B4P A;  1TRV A;  1HNA A;  4QMK A;  2ZNM A;  4OO4 A;  1UC7 A;  4YAV A;  4GSS A;  1B48 A;  3D4T A;  3MYD A;  3GX8 A;  2LNS A;  4E8E A;  5D9W A;  3RFR C;  5IMZ A;  4ECI A;  4CW9 A;  3W8J A;  2O5V A;  2IFQ B;  4MA9 A;  2HT9 A;  2L4Q A;  1SK0 A;  1F37 A;  1GRX A;  2PU9 C;  1AQX A;  1SJ6 A;  3US3 A;  4IN0 A;  1Z5Y E;  2CAI A;  1Y25 A;  4EDY A;  4K5R A;  3FY7 A;  1GSE A;  1VF3 A;  5KOW A;  2GQM A;  1TK5 B;  1BX9 A;  2YV9 A;  2KUC A;  2PVQ A;  5H5S A;  2WZ9 A;  2H72 A;  1URM A;  4O5Q A;  5EVO A;  4JE1 A;  4KE3 A;  4PQH A;  4HS1 A;  5DQY A;  2G2Q A;  3KH7 A;  3F63 A;  3KIJ A;  3HMJ G;  4K7I A;  2VKZ G;  3P2A A;  4POK A;  5L71 A;  2X4A A;  2VCZ A;  1U88 A;  1FO5 A;  1GTU A;  2JAC A;  1B9X C;  2A4H A;  3MSZ A;  1WOU A;  3K8N A;  4K0G A;  3DEX A;  3WD6 A;  6GSW A;  2VL9 A;  4XTS A;  4PI0 C;  3TKP A;  2DJ1 A;  3GSS A;  1AQW A;  1YJ6 A;  4IQA A;  5JCU A;  1ILO A;  4KSO A;  2EIQ A;  2PUK C;  4MJE A;  5EY6 A;  5A5K A;  3C73 A;  3TKQ A;  2LST A;  1WPI A;  3L0H A;  4RUV A;  5IM9 A;  5KN2 A;  2GSS A;  3EUR A;  3LGC A;  3EC3 A;  1K3Y A;  1Y6E A;  3HKR A;  5DVB A;  1BG1 A;  3UAP A;  4GST A;  1GSU A;  2GZP A;  2VO4 A;  1VF4 A;  3GRX A;  4IBP A;  3UBK A;  1F2E A;  1HNC A;  2R37 A;  4TR1 B;  1OKD A;  4RQR A;  3KXO A;  4IGJ A;  14GS A;  1EGO A;  3CTG A;  1MDK A;  3R3E A;  3IBH A;  1XIY A;  2WRT A;  3FHK A;  4WF4 A;  3MDK A;  4MK3 A;  4E68 A;  1F3A A;  3J7Y k;  2CA8 A;  3V1W A;  4X4J A;  3FR9 A;  4P3Y B;  1B9Y C;  1SD9 A;  2R0P A;  1X5E A;  3F8U A;  4HQZ A;  8GSS A;  1XPV A;  3EMX A;  2LTK A;  3DYR A;  3ME8 A;  1K0B A;  1A23 A;  3DVX A;  2YNX A;  4OWY A;  1GLQ A;  3BCI A;  2HQT A;  3QR6 A;  2ZCT A;  4HQS A;  2DML A;  1BG5 A;  3C1S A;  2N5F A;  2LEG A;  3OR5 A;  4EC0 A;  2WW2 A;  4XS1 A;  1H4O A;  5IPG A;  4ACS A;  2X8H A;  3HCZ A;  4KDX A;  3LEF A;  3MAK A;  4I2U A;  3GIX A;  3Q19 A;  1GTB A;  1YZX A;  4XRA A;  4POB A;  2L57 A;  1CQH A;  3M1G A;  5AIX A;  1R5A A;  4PUF C;  5CP1 A;  3I6A A;  2EFH A;  1FG4 A;  3EYT A;  1ZYQ B;  2TRX A;  3P90 A;  5J9C A;  2HSY A;  4XCS A;  3FR6 A;  3LXZ A;  3KTB A;  2VLT A;  5F0G A;  3Q6O A;  1J0F A;  1VRS D;  2VCV A;  4AJ8 A;  2GZY A;  2YP6 A;  5G5F A;  1OC3 A;  4EE0 A;  4F03 A;  3TJG A;  1Z7R A;  5EL8 A;  1LU4 A;  1A24 A;  3GX0 A;  1XW5 A;  4AJ6 A;  4EO3 A;  5ECS A;  4L0U A;  4BWS A;  4MJB A;  1PQN A;  4K7O A;  3M0F A;  1X9W B;  5JWQ B;  3D0Z A;  2HZF A;  2YWM A;  2OAC A;  1X5C A;  1XWB A;  4K6X A;  4HZ4 A;  3DGQ A;  1XFL A;  3IK7 A;  5CYY A;  2XBI A;  1U3I A;  3ZVJ D;  9GSS A;  1G0T A;  2K6V A;  2LS5 A;  5KN3 A;  5J40 A;  4TR4 A;  1O73 A;  4BL7 B;  4MF5 A;  5DQS A;  2FA8 A;  4KUN A;  3KMO A;  4ZBA A;  4F9Z A;  1BJX A;  3GTU A;  3F6D A;  4GQF A;  2NDO A;  5CRW A;  5LNK e;  2V6K A;  4J57 E;  5J3R A;  1U6T A;  1TU8 A;  5ECN B;  1Y1U A;  2RUE A;  4K2D A;  3DD3 A;  4V2M A;  2F8A A;  4K2X A;  5F06 A;  2F51 A;  4GLT A;  3GFK A;  3DML A;  2B5E A;  2H0H A;  2PMT A;  4TXV A;  2YJ7 A;  5AIV A;  4ZBD A;  5IMA A;  4D73 B;  4L5O A;  4YQU A;  4G0K A;  2WVX A;  5IPH A;  2LRC A;  5B6N A;  5INY A;  2OT3 A;  3A2X A;  3L78 A;  2X64 A;  1SL0 B;  1ST9 A;  2L4C A;  1VF2 A;  3F4R A;  1BED A;  2GT5 A;  1R26 A;  4G0I A;  2D2Z A;  1T4Z A;  1I1I P;  3M9J A;  2A4V A;  4AKH A;  2CZ2 A;  4BPY A;  1HD2 A;  2HSN A;  4LL4 B;  4TOP A;  3Q74 A;  4FO5 A;  2HRK A;  2KP1 A;  2H73 A;  3GN3 A;  4EIP A;  1PL1 A;  2C3T A;  3E0U A;  1ZOF A;  5G31 A;  2IME A;  3HJM A;  2YCD A;  1V2A A;  4HZ2 A;  4PUA A;  2CQ9 A;  2CAQ A;  1NHY A;  3GH6 A;  4MAB A;  2GZZ A;  5CRH A;  4K5S A;  1BQ7 A;  3CWG A;  3G7J A;  1O8W A;  4WET A;  3HVS A;  1TU7 A;  1O85 A;  3TOU A;  2LQO A;  1SL1 B;  4Q5F A;  5ELG A;  3QPM A;  19GS A;  2OE0 A;  3LYP A;  2VM1 A;  1B8X A;  3HJP A;  2JZT A;  1S3A A;  2HRK B;  1ZGN A;  4LA1 A;  1GSQ A;  1A8Y A;  1UVZ A;  1JZR A;  1M9A A;  1HNB A;  1CQG A;  5KEJ A;  1ERT A;  5IIZ A;  2DKH A;  1ML6 A;  5IMV A;  1Q4J A;  1F3B A;  17GS A;  4WR4 A;  1W89 A;  4OFM A;  3CHX C;  4ULX A;  1M2B A;  1F9M A;  4MZC A;  2CX4 A;  1ON4 A;  4WXT A;  2I1U A;  2HI7 A;  1R4W A;  6GSV A;  2HZE B;  3TJB A;  5ECP B;  1SVO A;  4FQU A;  2CVD A;  4ISD A;  1WIK A;  22GS A;  3HYP A;  3HD5 A;  20GS A;  1M2A A;  2L6D A; 
#chains in the Genus database with same CATH homology
 3KP8 A;  5COH A;  4GTU A;  4NMU A;  1GH2 A;  3BD2 A;  4Z2T A;  2GSR A;  1HQO A;  4JR6 A;  3BOA A;  2HRN A;  3CXG A;  2H66 A;  2KP2 A;  3ZVJ A;  2DJ0 A;  1GSF A;  5A34 A;  2L6C A;  5IMF A;  3PR8 A;  4RI7 A;  4HU9 A;  2CVB A;  3QCP A;  4DSS B;  4JU5 A;  1IYH A;  5G1L A;  4DSQ A;  1AAZ A;  2YAN A;  4WR5 A;  2OE3 A;  4L0W A;  4ZL8 A;  2B6M A;  5B6M A;  2P31 A;  4I2T A;  5IMC A;  4GWR A;  3PGT A;  1V40 A;  6GSX A;  3FEU A;  3ZFB A;  4V2N A;  4GRF A;  2LNT A;  1RK4 A;  1WE0 A;  1YF1 A;  3TKS E;  5DCG A;  3M3M A;  3IAS 2;  3M9K A;  3GMF A;  5HR2 A;  3FZ5 A;  2R5G A;  4PQ1 A;  2VL2 C;  1JZD A;  4CY8 A;  2PER A;  4JED A;  2KLX A;  4Z2R A;  4KAE A;  4HDE A;  4HOJ A;  3QFB C;  3VI7 A;  2H1D A;  2C4J A;  5E4W A;  6GSU A;  2GT6 A;  1TI1 A;  2XC2 A;  3GL5 A;  1TP9 A;  5KN1 A;  4KA0 A;  2AB6 A;  2IFQ A;  2VCQ A;  1TKD B;  2H1G A;  1SVM A;  2OBI A;  4HJM A;  2GTU A;  1GTA A;  1AIU A;  1TW9 A;  1XOB A;  2B5Y A;  2LJA A;  3UVT A;  1M99 A;  4FIW A;  4WEY A;  3LG6 A;  4OD7 A;  2C80 A;  3KZQ A;  2PVO C;  1JLW A;  5IOW A;  1PN9 A;  2VLU A;  3EMP A;  1NM3 A;  3FZ4 A;  5IMD A;  4KDY A;  1OVN A;  2OAD A;  3KD0 A;  1T1V A;  3F9U A;  1R7H A;  1A2J A;  2CVK A;  1EV9 A;  1TRU A;  1NW2 A;  3FKF A;  2Z9S A;  1SYR A;  2F9S A;  5D9T A;  1Z6M A;  1OAZ A;  4ML6 A;  5DJM A;  1JZW A;  5KOX A;  2MMZ A;  4KF9 A;  5H5R A;  1VF1 A;  4MPF A;  3C1R A;  1YDK A;  2X8G A;  4LMV A;  4K1F A;  1NSW A;  1GLP A;  2VCT A;  3H93 A;  4HI7 A;  1YF0 A;  2C0D A;  1XW9 A;  1JLV A;  1MDJ A;  1ZYN A;  2OA7 A;  2VL2 A;  4DSR A;  2N5A A;  2PGT A;  1TJD A;  3CMI A;  4JBB A;  2H71 A;  4PNG A;  3VWX A;  3H1N A;  1AUC A;  4MLY A;  4RI6 A;  2CZ3 A;  3DIE A;  4TR1 A;  2L59 A;  3PH9 A;  5J5N A;  4ZIJ A;  1ABA A;  2O89 A;  5CAX A;  3WGE A;  2HXK A;  4YKG A;  4POM A;  2P0G A;  4CDO A;  2A2P A;  1A2L A;  4OCE A;  4MP4 A;  2O87 A;  4A5P A;  3ERW A;  3LFL A;  2L5O A;  2VL3 A;  3VWV A;  5HR0 A;  3CRU A;  1V9W A;  3FYG A;  1ZZY A;  4ZBB A;  4IVF A;  1BF5 A;  1QK8 A;  2DJ2 A;  2PN8 A;  1XWA A;  4Z7X A;  3VFI A;  3HY2 A;  4G01 A;  1J08 A;  1ZCP A;  3L9U A;  4JRR A;  3A5W A;  1JZO A;  3IC8 A;  5BRT A;  4MF6 A;  4V1A p;  2H75 A;  1ZMA A;  13GS A;  2ZUP A;  1FVK A;  2ON7 A;  2M46 A;  1WRY A;  1AW9 A;  2EFE A;  3LOR A;  7GSS A;  2OBK A;  3ZIV A;  1PRX A;  3TJF A;  3C7M A;  4N30 A;  2V41 A;  1E6B A;  4FH8 A;  3FRC A;  4DEJ A;  3ZML A;  2GSQ A;  3F4T A;  4ZB6 A;  2H0G A;  5HFG A;  4LL1 B;  2H74 A;  2ES7 A;  3QMX A;  5CRG A;  5J47 A;  1N8J A;  4PQI A;  1GP1 A;  3GA4 A;  4G0L A;  2H6X A;  2YV7 A;  3ISO A;  3GUR A;  1YKA A;  4IJ3 A;  2NBS A;  1DBY A;  3PPU A;  1M2D A;  3LW9 A;  1T8E B;  5C00 A;  2B3S A;  4OFN A;  1EWX A;  4N11 A;  4HJ2 A;  3CTF A;  3I43 A;  3FK8 A;  1K0D A;  4IP6 A;  2H19 A;  2E2M A;  4ECJ A;  4TRX A;  1SK2 A;  4H86 A;  3H79 A;  1AC1 A;  5A1N B;  1OC8 A;  4MNN A;  1QQ2 A;  4FYB A;  3QOU A;  4BL7 A;  1X5D A;  1KEB A;  2HLS A;  3EPT A;  16GS A;  1W4V A;  1V98 A;  1TDI A;  3HJO A;  2FHE A;  5B7C A;  2VOC A;  5D93 A;  2GVP A;  3MIX A;  2P5R A;  5ECK B;  5ECI B;  3VI5 A;  4XS4 B;  1J9B A;  3EVI A;  2JZR A;  5CNW A;  1MD3 A;  2IL3 A;  2WB9 A;  3I69 A;  2IMK A;  2O7K A;  4JZQ A;  2DLX A;  5A4W A;  3E3E A;  1AXD A;  4E8H A;  2G0F A;  2GDR A;  2HYX A;  2JSY A;  2IWT A;  1ZYP A;  1SJI A;  1KBN A;  4FYU A;  4ZB9 A;  1A0F A;  2IMD A;  3KGK A;  5ECL B;  3QFA C;  3D21 A;  4GCI A;  1S3D A;  4FYC A;  1PKW A;  4D73 A;  4G9H A;  2E7P A;  3AY8 A;  2QC7 A;  4TN8 A;  1U87 A;  3RAZ A;  2WUL A;  4X0X A;  4BA7 A;  1A8L A;  3VWW A;  2BTO T;  3GV1 A;  2QA2 A;  4NHZ A;  2DIZ A;  5A4U A;  1SKS B;  4MDC A;  3LSZ A;  2IIY A;  5B8B A;  2CX3 A;  2E2G A;  2YWI A;  2RUF A;  2B7J A;  4HEA 2;  3GHA A;  3A5I A;  4J2F A;  4AI6 A;  1SVL A;  4AGS A;  4AF2 A;  4K8M A;  2I9H A;  5JWR B;  1WMJ A;  4PX1 A;  1T4Y A;  3ME7 A;  5ECH B;  1XXU A;  3RDW A;  5D96 A;  1MEK A;  1SKR B;  2VUP A;  4PNF A;  1ERV A;  2EIR A;  2H6Y A;  4G19 A;  3FW2 A;  2C3N A;  2UV8 G;  2R4V A;  4WKW A;  3VWU A;  1XBS A;  4KH7 A;  2IPA A;  3VPQ A;  4F2I A;  1GTI A;  1ACV A;  4KW6 A;  2XBQ A;  2YN1 A;  3E9J B;  5CRE A;  2H1A A;  5DAK B;  5F8B A;  4YQV A;  4V2L A;  1FB0 A;  3EWL A;  3LXT A;  4AKI A;  1YQ1 A;  1VGL A;  3A2W A;  4EL1 A;  4KB3 A;  3VUR A;  4USS A;  3CYN A;  1DUG A;  5GZZ B;  3SBC A;  1I9D A;  2RM6 A;  3QDN A;  3LJR A;  4YH2 A;  3JCM L;  3IPZ A;  3G7Y A;  2UZ8 A;  3UL3 A;  2HZE A;  2KHP A;  3RHB A;  1QMV A;  4EUY A;  2C0F A;  5ABR A;  5ECO B;  4AJ7 A;  4PXO A;  1PX7 A;  4MH2 A;  3TOT A;  3IRA A;  1NHO A;  4KSM A;  1XOA A;  4ZB7 A;  2NPB A;  4GQC A;  2WJU A;  4EVM A;  1M0U A;  4X1U A;  4WF5 A;  2GLR A;  1YY7 A;  4BVX B;  1SKW B;  1TXX A;  2AV4 A;  4ILF A;  3UIW A;  2TRC P;  4OO5 A;  10GS A;  4O32 A;  5E59 A;  4ZL9 A;  1BYE A;  2MBT A;  2DC5 A;  2YWO A;  2YWN A;  4HU7 A;  4DSS A;  3GKN A;  3DVW A;  4TVE A;  3RPN A;  5JWO B;  1OE7 A;  2CT6 A;  3UMA A;  2HSM A;  5FHI A;  4YKF A;  1OKT A;  3ERF A;  3WT1 A;  2N5B A;  2DBC A;  1SD8 A;  2O85 A;  4N10 A;  2A2R A;  3IDV A;  1X0R A;  3RPP A;  1GSY A;  2J9H A;  2A2S A;  4Q5N A;  4NHW A;  2RM5 A;  1TRS A;  4OMV A;  3NOF A;  4Q5Q A;  3IHQ A;  5KN0 A;  1T7P B;  4K0N A;  2P5Q A;  4KGI A;  3O76 A;  3TKR A;  1LJR A;  5C04 A;  1A0R P;  1A2M A;  5D8I A;  2JL4 A;  4O5R A;  1EP7 A;  1EGR A;  2HRA A;  2HSM B;  2B5X A;  2DKI A;  2FWH A;  2WCI A;  3KH9 A;  1GUH A;  1Z3E A;  5A4V A;  1PKZ A;  1Q98 A;  3WT2 A;  5IO2 A;  5LCZ A;  2LQQ A;  3A2V A;  3F6F A;  4XRD A;  3O3T A;  3BBY A;  1Z7P A;  3APQ A;  3IXR A;  1GUM A;  2M80 A;  3IC4 A;  3MNG A;  1GUL A;  3ZL5 A;  5ECR B;  2R3X A;  2AHE A;  5D9V A;  4DVC A;  3GNJ A;  4I97 A;  4I6X A;  1FHE A;  3HZ8 A;  3UJ1 A;  4IEL A;  5DAL B;  1TK8 B;  1MTC A;  4N0Z A;  3APS A;  5J4U A;  2JU5 A;  1N2A A;  2PBJ A;  1N25 A;  3W8S A;  3VPT A;  2DIY A;  3ZRE A;  3U6V A;  4MZB A;  4X43 A;  2C0E A;  2GQL A;  3ZLP A;  4NXI A;  3ZFL A;  1QXH A;  1GUK A;  1GWC A;  4ZIL A;  4ZL7 A;  2R2J A;  2VLV A;  2H8L A;  2MBS A;  3W6G A;  3Q18 A;  5IOX A;  3GKK A;  1PL2 A;  3DXB A;  3DWV A;  5ELA A;  3WYW A;  3O6T A;  3P8W A;  3TU3 B;  3QAV A;  2LV3 A;  3DRN A;  1YVL A;  3HVX A;  4GSN A;  4YQM A;  3VLN A;  4GF0 A;  4QQ7 A;  2NVL A;  2LUS A;  1GL8 A;  3ZYW A;  3QD9 A;  5A5H B;  5J4V A;  5ID2 B;  1G6W A;  3KM6 A;  3FMW A;  1PA3 A;  4TXO A;  4GXZ A;  11GS A;  2FWE A;  2EIO A;  1XWC A;  2HRF A;  2OJL A;  5D9X A;  3KEB A;  1SL2 B;  3UOM A;  2PPT A;  2GQK A;  1XCC A;  4QL9 A;  5ECQ B;  1FB6 A;  3EU4 A;  4L8E A;  4BVY B;  1YEX A;  4CY6 A;  1WWJ A;  2VCW A;  4JR4 A;  1K0O A;  3ZIT A;  5F05 A;  2H0I A;  5CO3 A;  4TXO B;  5FT3 A;  3L9V A;  1AQV A;  4KND A;  5G5E A;  1T3B A;  2AUV A;  4WBJ A;  4K9Z A;  4ECB A;  6GST A;  2NTO A;  3ZRD A;  4W66 A;  4O7H A;  4K7N A;  3P7X A;  3M8N A;  1FW1 A;  2JSZ A;  5ECM B;  4EKZ A;  5HFI A;  4XIH A;  1XVQ A;  2RLI A;  2L5L A;  2VIM A;  2YPM A;  1K0C A;  3NZN A;  4MJC A;  4PUR A;  1UN2 A;  4MH3 A;  1TTZ A;  3HXS A;  1RW1 A;  2XHF A;  3GKM A;  4IHU A;  2AJQ B;  1QGV A;  1WP0 A;  4ZXG A;  3TB2 A;  4NV2 A;  4IW9 A;  3DKS A;  5IO0 A;  1U3A A;  3KMN A;  2IMI A;  3KTL A;  4J56 E;  1YKC A;  1YEP A;  1TOF A;  1ZYE A;  2AYT A;  2K9F A;  1E2Y A;  4MMM A;  3TUE A;  4NWY A;  5D73 A;  2VCX A;  2LRN A;  6GSS A;  4TKY A;  1QFN A;  5HQP A;  3F0I A;  3LQ7 A;  2O8V B;  2WFC A;  5LD0 A;  2IN3 A;  1S3C A;  2FY6 A;  4I5Q A;  1XVW A;  3A3T A;  4LLR A;  5AN1 A;  5EPF A;  2QGV A;  3RBT A;  1SK1 A;  5A1N A;  4OCF A;  3UEM A;  1USB A;  1H75 A;  3FZA A;  5B8A A;  1K3L A;  2B1L A;  1XWG A;  4MPG A;  3EE2 A;  5AIS A;  3ZIJ A;  1MD4 A;  1V57 A;  4XS4 A;  5HFK A;  3C8E A;  2WDU A;  1M7T A;  4PGT A;  3WGX A;  4NPB A;  3ZMK A;  4IKH A;  3D5J A;  2EFC A;  2X49 A;  3TGZ A;  4V1A g;  4G10 A;  2H01 A;  4KDU A;  2V32 A;  1WJK A;  3G7I A;  2LJR A;  1FAA A;  2R0C A;  5J4Y A;  3C71 A;  3H8Q A;  1SU9 A;  3LWA A;  1SEN A;  5IQY A;  2H70 A;  1THO A;  1FOV A;  2RII A;  4IP1 A;  1TI3 A;  2PWJ A;  2C3Q A;  2KOK A;  2DJJ A;  3TKS C;  2XPE A;  1PN0 A;  4PTS A;  3TRX A;  2QSI A;  5G1K A;  4Q5R A;  2B7K A;  2C8U A;  3IK9 A;  1I5G A;  4KX4 A;  4G2E A;  3TCO A;  3VK9 A;  1EOH A;  2H6Z A;  5DBQ A;  2H1B A;  2FWF A;  4TW5 A;  3G9B A;  5CRD A;  1GSS A;  2FWG A;  4ID0 A;  1O81 A;  2LKU A;  3CSI A;  2BJX A;  2GGT A;  2FLS A;  1X9S B;  1O6J A;  3UVH A;  3L9S A;  4POL A;  1GNE A;  4EIQ A;  4F0B A;  1G7E A;  3APO A;  1ERU A;  3IA1 A;  2J23 A;  1O8X A;  3F4S A;  1LBK A;  2H30 A;  1T00 A;  2IJY A;  3QAG A;  1C72 A;  4QL7 A;  3MWH A;  4L5L A;  3FR3 A;  3LYK A;  5DAK A;  3F3R A;  4KCE A;  1PD2 1;  4ECC A;  2YOI A;  3GTU B;  2MMA A;  1TRW A;  2HNL A;  3GKX A;  1Z6N A;  2EFD A;  2VD0 A;  1G7O A;  2JAD A;  4MJA A;  1ERW A;  1EV4 A;  2I81 A;  2V2G A;  3J7Y b;  3TRQ A;  2MYG A;  2EC4 A;  2BMX A;  2X8C A;  5DCH A;  3F3Q A;  3IV4 A;  3IE3 A;  2ALB A;  1UA5 A;  2V1M A;  3EU3 A;  1IYI A;  2WS2 A;  1RQM A;  2I4A A;  5ENU A;  3TKS A;  4O92 A;  3UBL A;  1PX6 A;  3ERG A;  4NAX A;  2FCH A;  4MZW A;  2DJK A;  3CSH A;  3GUS A;  4N3Z A;  2DJ3 A;  3GYK A;  2QKE A;  1Z9H A;  2REM A;  4TR3 A;  4XS6 A;  1B4Q A;  2F8F A;  3GST A;  4IJI A;  4BVX A;  1EZK A;  5FWG A;  2M72 A;  1DE1 A;  1TK0 B;  2HE3 A;  3SWL A;  2X99 A;  3BCK A;  3TJJ A;  3TRP A;  1XWK A;  2CV4 A;  4NV5 A;  1G6Y A;  3CBU A;  3HHV A;  1BAY A;  1F6M C;  3CRT A;  3WGD A;  4RQX A;  2YZU A;  4KCA A;  2HSN B;  4EDZ A;  3GL3 A;  3GH9 A;  3HZ4 A;  1KTE A;  1XW6 A;  1HYU A;  1QUW A;  1SJZ A;  2K8S A;  4IQ1 A;  5DJL A;  3TDG A;  2YZH A;  2FUG 2;  4ML1 A;  2JZS A;  2FGX A;  3EIN A;  2HFD A;  3PIN A;  3CSJ A;  5JCW A;  1DSB A;  5F07 A;  1K3O A;  1K0A A;  2V6O A;  3H4K A;  4MF7 A;  2R6K A;  3ED3 A;  2MMO A;  4MCU A;  1EEJ A;  3NIV A;  1EOG A;  3R2Q A;  3D4M A;  2GS3 A;  4N0V A;  2OKA A;  2QA1 A;  1FOH A;  5BMU A;  3U5R E;  3KJY A;  1JFU A;  5AGY A;  4EXJ A;  1V58 A;  4F82 A;  2GST A;  1JHB A;  1K0N A;  4XHM A;  4TR0 A;  3HDC A;  2AAW A;  3D22 A;  12GS A;  1FVJ A;  2MMN A;  2ON5 A;  1EEM A;  5GAN D;  3I9V 2;  2WGR A;  4WBR D;  1XZO A;  5G2Z A;  2C1Y A;  2YJH A;  4O5U A;  2TIR A;  2DMM A;  5GSS A;  3N9J A;  3HVV A;  5GST A;  4AKX B;  1DE2 A;  3L4N A;  2OE1 A;  5HR3 A;  1THX A;  2C0G A;  5DAL A;  2IMF A;  5BMU B;  1O7U A;  4LMW A;  3FZ9 A;  4IS0 A;  1EP8 A;  5G30 A;  2VM2 A;  2R0G A;  6GSY A;  1K0M A;  3N5O A;  2FD3 A;  4I8B A;  3IOS A;  5DDL A;  2LRT A;  1KNG A;  3UAR A;  4CHS A;  3KP9 A;  4GDF A;  2B1K A;  1SYX A;  2H1L A;  4EF0 A;  1TXU A;  4ZB8 A;  2FA4 A;  1OE8 A;  5HR1 A;  5JCG A;  5J9B A;  3QAW A;  3ZZX A;  2MZC A;  2K8V A;  5J41 A;  5A34 B;  2XPD A;  1PGT A;  3RHC A;  1PMT A;  3TJK A;  2I3Y A;  2DSA A;  3HA9 A;  5A5H A;  3S9F A;  2HSH A;  4YAP A;  2FNO A;  2F3M A;  1ZL9 A;  18GS A;  1OC9 A;  4AKG A;  3IHG A;  5ID2 A;  1M9B A;  3KCM A;  3ZTL A;  4HUA A;  5GAP D;  1GSD A;  3IAM 2;  1PSQ A;  1OYJ A;  2VAF A;  1X9M B;  1GNW A;  4F0C A;  3IR4 A;  4Z2U A;  5H5Q A;  4BVY A;  2LJK A;  1R5P A;  4OFT A;  1MDI A;  2H76 A;  4ICY A;  2E0Q A;  3D6I A;  1OC9 B;  4BWQ A;  3BJ5 A;  2VD1 A;  2K18 A;  1B4P A;  1TRV A;  1HNA A;  4QMK A;  2ZNM A;  4OO4 A;  1UC7 A;  4YAV A;  4GSS A;  1B48 A;  3D4T A;  3MYD A;  3GX8 A;  2LNS A;  4E8E A;  5D9W A;  5IMZ A;  4ECI A;  4CW9 A;  3W8J A;  2O5V A;  2IFQ B;  4MA9 A;  2HT9 A;  2L4Q A;  1SK0 A;  1F37 A;  1GRX A;  2PU9 C;  1AQX A;  1SJ6 A;  3US3 A;  4IN0 A;  1Z5Y E;  2CAI A;  1Y25 A;  4EDY A;  4K5R A;  3FY7 A;  1GSE A;  1VF3 A;  5KOW A;  2GQM A;  1TK5 B;  1BX9 A;  2YV9 A;  2KUC A;  2PVQ A;  5H5S A;  2WZ9 A;  2H72 A;  1URM A;  4O5Q A;  5EVO A;  4JE1 A;  4KE3 A;  4PQH A;  4HS1 A;  5DQY A;  2G2Q A;  3KH7 A;  3F63 A;  3KIJ A;  3HMJ G;  4K7I A;  2VKZ G;  3P2A A;  4POK A;  5L71 A;  2X4A A;  2VCZ A;  1U88 A;  1FO5 A;  1GTU A;  2JAC A;  1B9X C;  2A4H A;  3MSZ A;  1WOU A;  3K8N A;  4K0G A;  3DEX A;  3WD6 A;  6GSW A;  2VL9 A;  4XTS A;  3TKP A;  2DJ1 A;  3GSS A;  1AQW A;  1YJ6 A;  4IQA A;  5JCU A;  1ILO A;  4KSO A;  2EIQ A;  2PUK C;  4MJE A;  5EY6 A;  5A5K A;  3C73 A;  3TKQ A;  2LST A;  1WPI A;  3L0H A;  4RUV A;  5IM9 A;  5KN2 A;  2GSS A;  3EUR A;  3LGC A;  3EC3 A;  1K3Y A;  1Y6E A;  3HKR A;  5DVB A;  1BG1 A;  3UAP A;  4GST A;  1GSU A;  2GZP A;  2VO4 A;  1VF4 A;  3GRX A;  4IBP A;  3UBK A;  1F2E A;  1HNC A;  2R37 A;  4TR1 B;  1OKD A;  4RQR A;  3KXO A;  4IGJ A;  14GS A;  1EGO A;  3CTG A;  1MDK A;  3R3E A;  3IBH A;  1XIY A;  2WRT A;  3FHK A;  4WF4 A;  3MDK A;  4MK3 A;  4E68 A;  1F3A A;  3J7Y k;  2CA8 A;  3V1W A;  4X4J A;  3FR9 A;  4P3Y B;  1B9Y C;  1SD9 A;  2R0P A;  1X5E A;  3F8U A;  4HQZ A;  8GSS A;  1XPV A;  2LTK A;  3DYR A;  3EMX A;  3ME8 A;  1K0B A;  1A23 A;  3DVX A;  2YNX A;  4OWY A;  1GLQ A;  3BCI A;  2HQT A;  3QR6 A;  2ZCT A;  4HQS A;  2DML A;  1BG5 A;  3C1S A;  2N5F A;  2LEG A;  3OR5 A;  4EC0 A;  4XS1 A;  1H4O A;  5IPG A;  4ACS A;  2X8H A;  3HCZ A;  4KDX A;  3LEF A;  3MAK A;  4I2U A;  3GIX A;  3Q19 A;  1GTB A;  1YZX A;  4XRA A;  4POB A;  2L57 A;  1CQH A;  3M1G A;  5AIX A;  1R5A A;  4PUF C;  5CP1 A;  3I6A A;  2EFH A;  1FG4 A;  3EYT A;  1ZYQ B;  2TRX A;  3P90 A;  5J9C A;  2HSY A;  4XCS A;  3FR6 A;  3LXZ A;  3KTB A;  2VLT A;  5F0G A;  3Q6O A;  1J0F A;  1VRS D;  2VCV A;  4AJ8 A;  2GZY A;  2YP6 A;  5G5F A;  1OC3 A;  4EE0 A;  4F03 A;  3TJG A;  1Z7R A;  5EL8 A;  1LU4 A;  1A24 A;  3GX0 A;  1XW5 A;  4AJ6 A;  4EO3 A;  5ECS A;  4L0U A;  4BWS A;  4MJB A;  1PQN A;  4K7O A;  3M0F A;  1X9W B;  5JWQ B;  3D0Z A;  2HZF A;  2YWM A;  2OAC A;  1X5C A;  1XWB A;  4K6X A;  4HZ4 A;  3DGQ A;  1XFL A;  3IK7 A;  5CYY A;  2XBI A;  1U3I A;  3ZVJ D;  9GSS A;  1G0T A;  2K6V A;  2LS5 A;  5KN3 A;  5J40 A;  4TR4 A;  1O73 A;  4BL7 B;  4MF5 A;  5DQS A;  2FA8 A;  4KUN A;  3KMO A;  4ZBA A;  4F9Z A;  1BJX A;  3GTU A;  3F6D A;  4GQF A;  2NDO A;  5CRW A;  5LNK e;  2V6K A;  4J57 E;  5J3R A;  1U6T A;  1TU8 A;  5ECN B;  1Y1U A;  2RUE A;  4K2D A;  3DD3 A;  4V2M A;  2F8A A;  4K2X A;  5F06 A;  2F51 A;  4GLT A;  3GFK A;  3DML A;  2B5E A;  2H0H A;  2PMT A;  4TXV A;  2YJ7 A;  5AIV A;  4ZBD A;  5IMA A;  4D73 B;  4L5O A;  4YQU A;  4G0K A;  5IPH A;  2LRC A;  5B6N A;  5INY A;  2OT3 A;  3A2X A;  3L78 A;  2X64 A;  1SL0 B;  1ST9 A;  2L4C A;  1VF2 A;  3F4R A;  1BED A;  2GT5 A;  1R26 A;  4G0I A;  2D2Z A;  1T4Z A;  3M9J A;  2A4V A;  4AKH A;  2CZ2 A;  4BPY A;  1HD2 A;  2HSN A;  4LL4 B;  4TOP A;  3Q74 A;  4FO5 A;  2HRK A;  2KP1 A;  2H73 A;  3GN3 A;  4EIP A;  1PL1 A;  2C3T A;  3E0U A;  1ZOF A;  5G31 A;  2IME A;  3HJM A;  2YCD A;  1V2A A;  4HZ2 A;  4PUA A;  2CQ9 A;  2CAQ A;  1NHY A;  3GH6 A;  4MAB A;  2GZZ A;  5CRH A;  4K5S A;  1BQ7 A;  3CWG A;  3G7J A;  1O8W A;  4WET A;  3HVS A;  1TU7 A;  1O85 A;  3TOU A;  2LQO A;  1SL1 B;  4Q5F A;  5ELG A;  3QPM A;  19GS A;  2OE0 A;  3LYP A;  2VM1 A;  1B8X A;  3HJP A;  2JZT A;  1S3A A;  2HRK B;  1ZGN A;  4LA1 A;  1GSQ A;  1A8Y A;  1UVZ A;  1JZR A;  1M9A A;  1HNB A;  1CQG A;  5KEJ A;  1ERT A;  5IIZ A;  2DKH A;  1ML6 A;  5IMV A;  1Q4J A;  1F3B A;  17GS A;  4WR4 A;  1W89 A;  4OFM A;  4ULX A;  1M2B A;  1F9M A;  4MZC A;  2CX4 A;  1ON4 A;  4WXT A;  2I1U A;  2HI7 A;  1R4W A;  6GSV A;  2HZE B;  3TJB A;  5ECP B;  1SVO A;  4FQU A;  2CVD A;  4ISD A;  1WIK A;  22GS A;  3HYP A;  3HD5 A;  20GS A;  1M2A A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...