1GNWA

Structure of glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
210
Chain Sequence
b'GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of glutathione S-transferase from Arabidopsis thaliana at 2.2 A resolution: structural characterization of herbicide-conjugating plant glutathione S-transferases and a novel active site architecture.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 78
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gnwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gnwA01
1OYJA 1SJIA 1TRUA 1QFNA 3C8EA 3DD3A 1XW5A 4ECJA 2ON5A 3TKPA 4DSQA 2GZPA 1O81A 3VI5A 2VL3A 1TJDA 1AC1A 4OFMA 3QCPA 5DJLA 4PTSA 5AISA 2FHEA 1GULA 2H1DA 3LWAA 3I69A 4GQCA 5COHA 4TW5A 5ECIB 2VD0A 4L5LA 3HJPA 4MA9A 3PGTA 2AYTA 2H30A 5LCZA 4ZL7A 1KTEA 4D73B 4O7HA 3MWHA 2R5GA 6GSXA 2F8FA 1Z6MA 4V1Ag 5KEJA 5L71A 2FD3A 4HQSA 2VLTA 1A8LA 1O7UA 3IR4A 1CQGA 3C1SA 4BL7A 1V2AA 4RI6A 1XIYA 4WBRD 1SKSB 4ZBDA 3ISOA 3RHCA 5A4UA 2IN3A 4J56E 4L0UA 1ERTA 3L9SA 4XRAA 5B6MA 1KBNA 1AUCA 4LL1B 4G0KA 4WR5A 2E2GA 5G30A 2MMOA 2A2RA 1GSDA 3FR6A 3P2AA 2KHPA 1PD21 1WRYA 3H93A 3D5JA 1M9BA 5EL8A 5AN1A 2OE0A 5G5EA 3ZFBA 4ZL9A 5F0GA 3I9V2 3H79A 4MH2A 2H73A 1EEJA 4WBJA 4O92A 5G31A 4OD7A 2WZ9A 1M2DA 3LEFA 2AB6A 3VK9A 1TKDB 2YZUA 5B8BA 2GGTA 5C00A 1TDIA 4QL9A 1YJ6A 2DC5A 1A0FA 1G0TA 5E59A 2DMLA 3NOFA 2F8AA 3KH7A 3TCOA 2OE3A 3O6TA 1GRXA 3VWXA 3UVTA 4Q5NA 3F63A 3A2XA 4XS4B 3TKRA 3QD9A 1OC3A 4TXOB 3D21A 5G2ZA 1N2AA 2CVDA 3GH6A 2YPMA 5ECLB 2JZRA 5EPFA 1W4VA 4GWRA 2I4AA 3P7XA 4Q5QA 1Z5YE 5ECPB 4Q5FA 4MJAA 2RUEA 1WPIA 3CSJA 5DQSA 2GQKA 1QGVA 2KOKA 1HNAA 3E0UA 5FT3A 1PKWA 1Y6EA 2QGVA 1XCCA 4O32A 3RAZA 1JHBA 2C3TA 3VPTA 4TVEA 2B1LA 2EIOA 4IKHA 3WYWA 1A23A 2PVOC 2BTOT 1B4PA 1J08A 4IP6A 4IQAA 5G1KA 3UJ1A 4F2IA 6GSVA 5DAKA 2H6XA 1XWGA 4E8EA 5IPHA 2VL9A 3TRXA 2ALBA 4ML6A 4I2TA 2HSYA 4V2LA 3UAPA 1W89A 2PN8A 2K8SA 2C3NA 3M8NA 2LQQA 1V9WA 1ERUA 2IFQB 4JU5A 2VL2A 2ON7A 4KA0A 3LORA 3KTBA 1OAZA 2MBSA 4EXJA 4KF9A 3ZL5A 2OJLA 3UBLA 4HDEA 1A8YA 2IMFA 1F2EA 3IRAA 2RM6A 2R2JA 1AAZA 3ERFA 1AQWA 3QFBC 3LFLA 4AJ6A 3ZMKA 1J9BA 1HD2A 3CTGA 3KP9A 2OADA 1Z7PA 1SJ6A 2PERA 3V1WA 1F9MA 1BQ7A 1WIKA 3KIJA 4I2UA 5B7CA 3GSSA 4MZWA 4RI7A 2CVBA 3W6GA 1GLPA 3GUSA 4FIWA 3ZLPA 3IE3A 2IL3A 5LNKe 1EV4A 2LKUA 2CT6A 6GSWA 4HUAA 2YJHA 2DJKA 3NZNA 3DGQA 1K3YA 2H6YA 4F0CA 2QSIA 1QMVA 2N5AA 1F6MC 1LBKA 3LG6A 1GSUA 3QDNA 2M72A 1FG4A 4J2FA 5G5FA 5H5RA 2O7KA 4V2NA 2YJ7A 1X9MB 3SWLA 2X8GA 2IPAA 5KN0A 3LJRA 3LSZA 5D96A 2H66A 4V1Ap 2CA8A 3F6DA 4HOJA 1VGLA 5GAND 2WDUA 4KDYA 1KEBA 5A5KA 3EINA 6GSSA 1R4WA 2HNLA 2O85A 1SL0B 1ZL9A 2YANA 3KH9A 4HJ2A 4BL7B 2TIRA 2HQTA 2C4JA 4ECBA 4G2EA 2R37A 5D93A 3Q74A 1GSYA 1QXHA 3CSIA 1ABAA 2MMNA 3IDVA 1OVNA 2VCTA 3HA9A 4XS4A 3DWVA 1KNGA 1S3AA 4MZBA 2LRCA 1V40A 4TXOA 1O8XA 4EF0A 4PURA 1T4ZA 3FRCA 5J9CA 2E0QA 3R3EA 1Z3EA 5AIXA 3VWWA 4XRDA 3QAVA 4GF0A 4FYCA 3GKKA 1CQHA 3GNJA 5ENUA 2GTUA 22GSA 4XHMA 2VCVA 2OACA 4PXOA 1GSSA 4FO5A 2HT9A 2IWTA 3A3TA 1DUGA 2Z9SA 2GVPA 1ZOFA 3TOTA 4FH8A 3KEBA 2RM5A 2B6MA 4JR6A 4JZQA 2H1BA 2FWFA 1V58A 4NWYA 1M7TA 1K3OA 4OO5A 4ML1A 3EVIA 2HRNA 1TRWA 3MAKA 4L5OA 4MF5A 4I5QA 3ZIJA 3O3TA 4E8HA 1YEXA 1YF0A 2V32A 1S3DA 1SL1B 5ABRA 10GSA 4OFTA 4G0LA 4QL7A 1PL2A 4G19A 5F07A 3D22A 2FA8A 4KB3A 1U87A 1TU8A 4IBPA 2VCQA 3DMLA 3HHVA 1BG5A 2M46A 3IV4A 4K7NA 3CYNA 3D0ZA 3IK7A 4ZBAA 3TUEA 3IA1A 2HLSA 4HJMA 1LU4A 4EO3A 2P31A 3N5OA 4RUVA 3F8UA 1C72A 4XIHA 5B8AA 3VURA 3M0FA 2OE1A 1VF4A 3FHKA 2RIIA 1UVZA 4DEJA 4X1UA 4FQUA 1I5GA 14GSA 5GZZB 3R2QA 2LUSA 2V6OA 2HSHA 2YOIA 3KJYA 4V2MA 1T3BA 1V57A 2GSQA 2WULA 5DAKB 4OWYA 2L4QA 4EL1A 3HVVA 2VCZA 5CRGA 17GSA 4OMVA 4PUFC 4TN8A 4NHWA 2XBIA 4X43A 2B5XA 1SJZA 1Q98A 4KSOA 5C04A 3EYTA 1RQMA 3DVWA 2LTKA 3HD5A 3ZZXA 2PMTA 4NV5A 6GSUA 1OC9A 2JACA 2OKAA 2LNSA 4F03A 2QKEA 3TJBA 5DBQA 4KUNA 3ME8A 1M99A 3EWLA 4EDYA 1OKDA 1JZOA 3GKXA 4K1FA 3DEXA 1MDJA 1GL8A 1DBYA 2CAIA 4MJEA 6GSTA 1T8EB 1A2MA 1SK2A 3LXZA 3GIXA 4MK3A 2K8VA 2NTOA 5JWQB 3C7MA 3F4TA 4WEYA 4WF5A 2DIZA 1B48A 2H8LA 3IOSA 3RBTA 2L5LA 4YH2A 4DSSB 3FKFA 4LMWA 4QQ7A 4POLA 1EP8A 1GSEA 4JEDA 1TXXA 1ZCPA 2AJQB 4BA7A 2KUCA 3CRTA 2H72A 3BOAA 4MZCA 4ECCA 4TOPA 2IIYA 1FAAA 4FYUA 4K2DA 4GTUA 5ECHB 1U3AA 5CNWA 5IOWA 2GS3A 2HRAA 4USSA 1XWKA 1PL1A 4EE0A 3BJ5A 1EOGA 2H6ZA 2MMAA 5J41A 2R3XA 2H75A 1SK0A 2OA7A 5IMCA 5DQYA 3F4SA 3MDKA 4MMMA 3KCMA 1K0CA 2HSNB 2L5OA 2VL2C 5IMDA 3UVHA 1G6YA 3TOUA 4G9HA 2V1MA 4G10A 2BJXA 3HJOA 2H19A 4YAVA 2F9SA 2GT5A 3ZFLA 1ILOA 2YNXA 3P8WA 5GAPD 4ZB6A 4MJCA 1JZRA 2GSTA 5D8IA 3NIVA 3GRXA 4ULXA 1YEPA 2DJ1A 1TK0B 1PMTA 2FWGA 2G2QA 3IAS2 1BAYA 1R7HA 1B9YC 4WR4A 4KDUA 2FY6A 4XTSA 4PNFA 4WXTA 2CV4A 1FW1A 5A4WA 1N8JA 2PWJA 4PNGA 1ST9A 2HSMA 3W8SA 1MEKA 2FA4A 2YWIA 3ZIVA 4MABA 2HZEA 3CMIA 3HYPA 4ZIJA 1MTCA 3TDGA 4ACSA 2PVQA 1K0DA 2H0GA 2PU9C 3LGCA 1G7EA 2GQMA 3GL5A 1USBA 4XS6A 2VLUA 1MD3A 1MDIA 1SL2B 1GLQA 2IMIA 2I1UA 1JZWA 1B8XA 2HXKA 1PX6A 1HYUA 1B4QA 3EC3A 2C3QA 2DJ3A 3RPNA 2MMZA 1MDKA 1XOAA 3DIEA 1E2YA 1GH2A 2O87A 5GSTA 1TI3A 5D9XA 3WGEA 3L9UA 3SBCA 5E4WA 4ZB8A 1GTAA 1EEMA 2YWNA 3GFKA 1ML6A 13GSA 3ZYWA 3ED3A 2ES7A 1IYIA 1NHOA 16GSA 2JZSA 2R6KA 4BVXB 4NAXA 3JCML 3H8QA 3UOMA 4CDOA 1ZYEA 3F3QA 1ERVA 4PX1A 4CHSA 2JZTA 1HQOA 5HR1A 1VRSD 4MDCA 2HE3A 3ZVJA 2PGTA 4HQZA 1UC7A 2L6CA 1FB6A 2H0HA 3U6VA 1T7PB 3AY8A 5H5SA 1EZKA 3Q19A 2VO4A 1SD9A 2LJKA 1GSFA 2PBJA 3LYPA 4DSSA 1YY7A 3F6FA 4ZXGA 1ZMAA 5CYYA 1XWCA 3TB2A 5HR0A 4IHUA 1GUMA 4J57E 3KZQA 2KP1A 1H75A 9GSSA 2A4VA 1OC9B 3UARA 1FHEA 4TKYA 1BEDA 2YP6A 2E7PA 2J9HA 1A2JA 2LV3A 5IOXA 2NDOA 2CZ2A 1X0RA 3FYGA 4NPBA 4CW9A 1XOBA 2DJ0A 2IMDA 3VLNA 4ZILA 3D4TA 4OCFA 3CXGA 3G7JA 2H0IA 3TKSC 1PN9A 3Q18A 5AIVA 2AUVA 1RW1A 4I97A 1JLWA 3LXTA 2P0GA 1X9SB 4N11A 2HZFA 3D6IA 4EUYA 1A2LA 2KLXA 5HFGA 2H71A 1X5DA 2FCHA 5ECQB 2H01A 3KGKA 3GMFA 1AQXA 1EV9A 2VM1A 4TR3A 1QQ2A 5CAXA 2X8HA 1R26A 1DE1A 2GQLA 3M3MA 2WRTA 3FZ4A 3N9JA 2DMMA 2XPDA 1U3IA 4HS1A 3H4KA 4IJIA 1V98A 2YWMA 2LRTA 3F9UA 1ON4A 1O85A 3BD2A 3WT1A 1WP0A 3ZREA 5G1LA 3O76A 3ERGA 3DRNA 5JWRB 1SKWB 1PKZA 1WWJA 2WS2A 2JU5A 4KCEA 1DSBA 4HU9A 3RDWA 1HNBA 5ELGA 2JSZA 1O73A 5J4UA 2LEGA 4IW9A 2AHEA 2FWHA 1G6WA 1ZGNA 4JRRA 3P90A 4PGTA 1BJXA 5J3RA 1URMA 2D2ZA 3TJJA 2TRXA 2FLSA 1E6BA 1Z9HA 4I8BA 5IM9A 3QR6A 5CRWA 2H70A 3PR8A 1EWXA 4TR4A 3APOA 4LA1A 5DDLA 5ECOB 4N10A 2K6VA 1AW9A 2NPBA 1AQVA 2HFDA 1ZYQB 4GLTA 4KH7A 4NHZA 8GSSA 3LYKA 3VWUA 2RUFA 1R5AA 3FR9A 4MP4A 2JL4A 1TOFA 4BWQA 3TKSA 5HFIA 2X64A 4BWSA 4NMUA 3KD0A 2JSYA 4TXVA 3DKSA 2P5QA 1ERWA 3VWVA 4MPGA 3L0HA 11GSA 4ZB9A 4KW6A 3EMPA 1TTZA 2GT6A 2YZHA 3ME7A 2HSMB 1XBSA 1NSWA 4IELA 2CQ9A 4TR1A 5ECSA 1TK5B 4IS0A 1YDKA 2G0FA 2HZEB 1TI1A 3IPZA 4KE3A 4MCUA 7GSSA 4MF7A 4BVXA 1OE7A 4BPYA 2N5BA 3KM6A 5KN2A 2VAFA 3FZ9A 5FWGA 2GZZA 4IN0A 3IBHA 2C80A 1XW9A 3ZRDA 1XFLA 1BX9A 3TJKA 2L57A 3UBKA 1O6JA 1OKTA 4GQFA 4N0VA 19GSA 1MD4A 2FUG2 2X8CA 4POKA 1XW6A 3A5WA 4MJBA 4HZ2A 2WJUA 2LSTA 3PINA 5IO0A 3Q6OA 3HJMA 3IHQA 2B7KA 4RQRA 3TJGA 1QUWA 4K8MA 2JADA 2CZ3A 1VF3A 2WFCA 5B6NA 4YQVA 4F0BA 3FR3A 1GUKA 3FEUA 4H86A 1PRXA 2YV7A 3K8NA 1WJKA 2UZ8A 3J7Yb 2FWEA 5D73A 3KTLA 5LD0A 4EC0A 1NW2A 3CTFA 1BYEA 3L9VA 5DALB 4X0XA 1DE2A 2KP2A 1X5CA 4RQXA 2O8VB 4TRXA 3QAGA 1EP7A 2H74A 4N30A 2WGRA 1WMJA 2ZCTA 2B5YA 3IAM2 5JCWA 2YN1A 3ZMLA 1TRSA 4G0IA 2MYGA 1THXA 1GNWA 2GSRA 1A24A 1FB0A 4GSSA 3PH9A 2EC4A 5ECKB 1M9AA 4PUAA 1PX7A 1FO5A 1T4YA 5CRDA 3S9FA 3A2VA 3WT2A 4NV2A 4AF2A 5KN1A 1RK4A 1JLVA 3MNGA 3BCIA 20GSA 2N5FA 3TRPA 3PPUA 3GV1A 3KP8A 4LL4B 2HRKA 4IJ3A 2H1AA 2VOCA 4JR4A 4Q5RA 1GNEA 3GA4A 2GDRA 4NXIA 4K7OA 2VCWA 1PSQA 5D9TA 4KGIA 3L78A 2LJRA 2K18A 4K7IA 2LJAA 2LS5A 5ELAA 5CP1A 5F05A 3GKMA 3FZ5A 2LRNA 4JE1A 2VM2A 2NVLA 5HQPA 2HYXA 2B5EA 4GSTA 2MZCA 4KCAA 2B3SA 3IK9A 3BCKA 3E3EA 4OFNA 2F51A 2EIQA 1IYHA 2CX3A 1M2AA 3C1RA 1NHYA 3TGZA 3RPPA 1S3CA 5ECMB 4TR0A 1EGRA 4PQHA 1F3AA 3CBUA 2HRFA 3VFIA 5HR3A 1M2BA 3MSZA 3FW2A 1F37A 4POMA 2DSAA 2CX4A 2V2GA 1ACVA 5FHIA 3APSA 1AIUA 1FVJA 2F3MA 3IC8A 3UMAA 5INYA 3F0IA 3UIWA 12GSA 3CRUA 5F8BA 4AGSA 2B7JA 4F9ZA 2AV4A 2V6KA 1WOUA 3C73A 2XPEA 2O89A 5DCGA 1K0BA 5ECRB 2VCXA 4GSNA 1T1VA 2EIRA 3ZVJD 3US3A 1PA3A 2IJYA 4LLRA 3G7YA 4PQ1A 2OBKA 4IVFA 5JCUA 1OC8A 2I9HA 3APQA 3TKQA 4L8EA 5D9WA 4K9ZA 1TU7A 4ZL8A 4K0NA 5CREA 1VF1A 5IIZA 5EVOA 1YQ1A 1SU9A 3EMXA 2B1KA 4XS1A 4JBBA 3F3RA 2C0EA 3E9JB 4HZ4A 2A2SA 1QK8A 5H5QA 1X5EA 2DIYA 2YWOA 5IMFA 2GZYA 5A4VA 3KMNA 3HCZA 3HVXA 1JFUA 2IMEA 3GTUA 4XCSA 4WF4A 2DLXA 1LJRA 1XPVA 2C0GA 1Y25A 2GLRA 1T00A 4GRFA 4TR1B 1XWBA 2C8UA 2HI7A 4BVYA 4N0ZA 1XWAA 4KSMA 2H76A 3HVSA 2ZNMA 2C0DA 2TRCP 3KXOA 4ILFA 1B9XC 3GH9A 5IPGA 3TJFA 3QPMA 2XBQA 2PUKC 3EU4A 5DALA 2FGXA 1SYXA 1YKAA 1HNCA 2VIMA 1YF1A 1SYRA 4KX4A 1GTBA 2REMA 5CO3A 1WE0A 1XVQA 2GSSA 3GX0A 1YZXA 4I6XA 2X99A 1XVWA 1F3BA 2YCDA 4IGJA 4DSRA 2C1YA 5F06A 3WD6A 2L6DA 4OCEA 2OBIA 5GSSA 3HZ4A 2VLVA 3G7IA 4YQMA 4D73A 5JWOB 2LNTA 2XC2A 3M9KA 1EOHA 5ID2B 3ZITA 3FZAA 1Q4JA 5IMAA 3DXBA 1NM3A 2R4VA 2IMKA 3IXRA 4KAEA 3QFAC 3WGXA 5HR2A 3UL3A 2M80A 4GXZA 2VD1A 4ISDA 5J5NA 3HY2A 1TRVA 1EGOA 1U6TA 3KMOA 3EURA 4AJ7A 4MLYA 2CVKA 1K0OA 1O8WA 1OE8A 3DVXA 4HI7A 2P5RA 1K3LA 2H1GA 2I81A 2DJ2A 4ID0A 4K6XA 3F4RA 4MH3A 2WCIA 1XXUA 2WB9A 3QOUA 5IMVA 4MF6A 5DJMA 2XHFA 4EVMA 1SD8A 3HDCA 1I9DA 1JZDA 3TRQA 3OR5A 4F82A 3M9JA 4YAPA 1Z7RA 3GSTA 1U88A 1FOVA 3GN3A 4HEA2 3G9BA 5ECNB 3FY7A 3RHBA 4MPFA 3DYRA 4FYBA 4EKZA 2HRKB 1FVKA 3I43A 4P3YB 1GWCA 5IMZA 1K0AA 1PQNA 1UA5A 4PQIA 2DBCA 5AGYA 2CAQA 3GHAA 2J23A 2V41A 1GP1A 3LQ7A 5BMUA 4O5RA 3TKSE 1YKCA 3M1GA 1VF2A 3GL3A 3ERWA 3I6AA 5IO2A 1A0RP 1GTUA 5JCGA 4WKWA 1SKRB 1TP9A 2QC7A 3IC4A 18GSA 3GURA 5IQYA 1M0UA 4L0WA 1K0MA 3VPQA 2ZUPA 1GSQA 3H1NA 3CSHA 5CRHA 2K9FA 1X9WB 1AXDA 3QMXA 4IP1A 4WETA 3A2WA 2VUPA 1ZZYA 2E2MA 1R5PA 5DCHA 4Z7XA 3VI7A 1GUHA 5D9VA 1TK8B 4GCIA 5KN3A 4KDXA 1G7OA 4ZBBA 1TW9A 4DVCA 1GTIA 1Z6NA 4YQUA 3L4NA 4IQ1A 2BMXA 3ZTLA 3GX8A 2NBSA 2IFQA 3FK8A 1SK1A 1H4OA 3EU3A 3U5RE 1J0FA 4POBA 2DJJA 2YV9A 4K0GA 1XZOA 2C0FA 4HU7A 4KNDA 2AAWA 1PGTA 5EY6A 3GYKA 2LQOA 4LMVA 1UN2A 3C71A 3D4MA 2L59A 1THOA 4OO4A 2FNOA 5J9BA 3BBYA 4ECIA 3HKRA 1SENA 6GSYA 3WGDA 4AJ8A 2MBTA 3GTUB 3W8JA 3UEMA 2I3YA 3GKNA 5HFKA 3QAWA 5DVBA 2L4CA 5ID2A 3J7Yk 2RLIA 2PPTA 3HZ8A 4BVYB 3HXSA 1K0NA 3EE2A 4EDZA
chains in the Genus database with same CATH superfamily
1OYJA 1SJIA 1TRUA 1QFNA 3C8EA 3DD3A 1XW5A 4ECJA 2ON5A 3TKPA 4DSQA 2GZPA 1O81A 3VI5A 2VL3A 1TJDA 1AC1A 4OFMA 4GDFA 3QCPA 5DJLA 4PTSA 5AISA 2FHEA 5A1NB 1GULA 2H1DA 3LWAA 3I69A 4GQCA 1BG1A 5COHA 4TW5A 5ECIB 2VD0A 4L5LA 2WW3A 3HJPA 4MA9A 3PGTA 2AYTA 2H30A 5LCZA 5A5HA 4ZL7A 3RFRC 1KTEA 4D73B 4O7HA 3CWGA 3MWHA 2R5GA 6GSXA 1ZYPA 2F8FA 1Z6MA 4V1Ag 5KEJA 5L71A 2FD3A 4HQSA 2VLTA 1A8LA 1O7UA 3HVNA 3IR4A 1CQGA 3C1SA 4BL7A 1V2AA 4RI6A 1XIYA 4WBRD 1SKSB 4ZBDA 3ISOA 3RHCA 5A4UA 2IN3A 4J56E 4L0UA 4N3ZA 1ERTA 3L9SA 4XRAA 5B6MA 1KBNA 1AUCA 4LL1B 4G0KA 4WR5A 2E2GA 5G30A 4K5SA 1TXUA 2MMOA 5A34A 2A2RA 1GSDA 3FR6A 3P2AA 2KHPA 4QMKA 1PD21 1WRYA 3H93A 3D5JA 1M9BA 5EL8A 5AN1A 2OE0A 5G5EA 3ZFBA 4ZL9A 5F0GA 3I9V2 2WW2A 3H79A 4MH2A 2H73A 1EEJA 4WBJA 4O92A 5G31A 4OD7A 2WZ9A 1M2DA 3LEFA 2AB6A 3VK9A 1TKDB 2YZUA 5B8BA 2GGTA 5C00A 1TDIA 1XG8A 4QL9A 1YJ6A 2DC5A 1A0FA 1G0TA 5E59A 2DMLA 3NOFA 2F8AA 3KH7A 3TCOA 2OE3A 3O6TA 4YKFA 1GRXA 3VWXA 4EIPA 3UVTA 4Q5NA 3F63A 3A2XA 4XS4B 3TKRA 3QD9A 1OC3A 5BMUB 2WW0A 4TXOB 3D21A 5G2ZA 1N2AA 2CVDA 1M3JA 3GH6A 2YPMA 5ECLB 2JZRA 5EPFA 1W4VA 2A2PA 4GWRA 2I4AA 3P7XA 4Q5QA 1Z5YE 5ECPB 4Q5FA 4MJAA 2RUEA 1WPIA 3CSJA 5DQSA 2GQKA 4CY8A 1QGVA 2KOKA 1HNAA 3E0UA 5KOWA 5FT3A 1PKWA 1Y6EA 2QGVA 1XCCA 4O32A 3RAZA 1JHBA 2OT3A 2C3TA 3VPTA 4TVEA 2B1LA 2EIOA 4IKHA 3WYWA 1A23A 4G01A 2PVOC 2BTOT 1B4PA 1J08A 1ZYNA 4IP6A 4IQAA 5G1KA 3UJ1A 4F2IA 6GSVA 5DAKA 2H6XA 1XWGA 4E8EA 5IPHA 2VL9A 3TRXA 2ALBA 4ML6A 4I2TA 2HSYA 4V2LA 4PI2C 3UAPA 1W89A 2PN8A 2K8SA 2C3NA 3M8NA 2LQQA 1V9WA 1ERUA 2IFQB 4JU5A 2VL2A 2ON7A 4KA0A 3LORA 3KTBA 1OAZA 2MBSA 4EXJA 4KF9A 3ZL5A 2OJLA 3UBLA 4BIKA 5A1NA 4HDEA 1A8YA 2IMFA 1F2EA 3IRAA 4K5RA 2RM6A 2R2JA 1AAZA 3ERFA 1AQWA 3QFBC 3LFLA 4AJ6A 3ZMKA 1J9BA 1HD2A 3CTGA 3KP9A 2OADA 1Z7PA 1SJ6A 2PERA 5J4YA 3V1WA 1F9MA 1BQ7A 1WIKA 3KIJA 4A5PA 4I2UA 5B7CA 3GSSA 4MZWA 4RI7A 2CVBA 3W6GA 1GLPA 3GUSA 4FIWA 3ZLPA 3IE3A 2IL3A 5LNKe 1EV4A 2LKUA 2CT6A 6GSWA 4HUAA 2YJHA 2WVZA 2DJKA 3NZNA 3DGQA 1K3YA 2H6YA 4F0CA 2QSIA 1QMVA 2N5AA 1F6MC 1LBKA 3LG6A 1GSUA 3QDNA 2M72A 1FG4A 4J2FA 5G5FA 5H5RA 2O7KA 4V2NA 2YJ7A 1X9MB 5A5HB 3SWLA 2X8GA 2IPAA 5KN0A 1YVLA 3LJRA 3LSZA 5D96A 2H66A 4V1Ap 2CA8A 3F6DA 4HOJA 1VGLA 2HSNA 5GAND 2WDUA 1SVOA 4KDYA 1KEBA 5A5KA 4PI0C 3EINA 6GSSA 1R4WA 2HNLA 2O85A 4HSCX 1SL0B 1ZL9A 2YANA 4HJ2A 3KH9A 4BL7B 2TIRA 2HQTA 2C4JA 4ECBA 4G2EA 2R37A 5D93A 3Q74A 5KOXA 1GSYA 1QXHA 3CSIA 1ABAA 2MMNA 3IDVA 3TU3B 1OVNA 2VCTA 3HA9A 4XS4A 3DWVA 1KNGA 1S3AA 4MZBA 2LRCA 5A34B 1V40A 4TXOA 1O8XA 4EF0A 4PURA 1T4ZA 3FRCA 5J9CA 2E0QA 3R3EA 1Z3EA 5AIXA 3VWWA 4XRDA 3QAVA 4GF0A 4FYCA 3GKKA 1CQHA 3GNJA 5ENUA 2GTUA 22GSA 4XHMA 2VCVA 2OACA 4PXOA 1GSSA 4FO5A 2HT9A 2IWTA 3A3TA 1DUGA 2Z9SA 2GVPA 1ZOFA 3TOTA 4FH8A 3KEBA 4ICYA 2RM5A 2B6MA 4JR6A 4JZQA 2H1BA 2FWFA 1V58A 4NWYA 1M7TA 1K3OA 4OO5A 4ML1A 3EVIA 2HRNA 1TRWA 3MAKA 4L5OA 4MF5A 4I5QA 3ZIJA 3O3TA 4E8HA 1YEXA 1YF0A 2V32A 1S3DA 1SL1B 5ABRA 10GSA 4OFTA 4G0LA 4QL7A 1PL2A 4G19A 5F07A 3D22A 2FA8A 4KB3A 1U87A 1TU8A 4IBPA 1Y1UA 2VCQA 3DMLA 3HHVA 1BG5A 2M46A 3IV4A 4K7NA 3CYNA 3D0ZA 3IK7A 4ZBAA 3TUEA 3IA1A 2HLSA 4HJMA 1LU4A 4EO3A 2P31A 3N5OA 4RUVA 3F8UA 1C72A 4XIHA 5B8AA 3VURA 3M0FA 2OE1A 1VF4A 1PFOA 3FHKA 2RIIA 1UVZA 4DEJA 4X1UA 4FQUA 1I5GA 14GSA 5GZZB 3R2QA 2LUSA 2V6OA 2HSHA 2YOIA 3KJYA 4Z2RA 4V2MA 1T3BA 1V57A 2GSQA 2WULA 5DAKB 4OWYA 2L4QA 2WVYA 4EL1A 2UV8G 3HVVA 2VCZA 5CRGA 17GSA 4OMVA 4PUFC 4TN8A 4NHWA 2H1LA 2XBIA 4X43A 2B5XA 1SJZA 4FXYP 1Q98A 4KSOA 5C04A 3EYTA 1RQMA 3DVWA 2LTKA 3HD5A 3ZZXA 2PMTA 4NV5A 6GSUA 1OC9A 2JACA 2OKAA 2LNSA 1M3IA 4F03A 2QKEA 3TJBA 5DBQA 3FMWA 4KUNA 3ME8A 1M99A 4AKIA 3EWLA 4EDYA 1OKDA 3LW9A 1JZOA 3GKXA 4K1FA 3DEXA 1MDJA 1GL8A 1DBYA 2CAIA 4MJEA 6GSTA 1T8EB 1A2MA 1SK2A 3LXZA 3GIXA 4MK3A 2K8VA 2NTOA 5JWQB 3C7MA 3F4TA 4WEYA 4WF5A 2DIZA 3RGBC 1B48A 2H8LA 3IOSA 3RBTA 2L5LA 4YH2A 4DSSB 3FKFA 4LMWA 4QQ7A 4POLA 1EP8A 1GSEA 4JEDA 1TXXA 1ZCPA 2AJQB 4BA7A 2KUCA 3CRTA 2H72A 3BOAA 4MZCA 4EIQA 4ECCA 4TOPA 2DKHA 2IIYA 1FAAA 4FYUA 4K2DA 4GTUA 5ECHB 1U3AA 5CNWA 5IOWA 2GS3A 2HRAA 4USSA 1XWKA 1PL1A 4EE0A 3BJ5A 1EOGA 2H6ZA 2MMAA 5J41A 2R3XA 2H75A 1SK0A 2OA7A 5IMCA 5DQYA 3F4SA 3MDKA 4MMMA 3KCMA 1K0CA 2HSNB 2L5OA 2VL2C 5IMDA 3UVHA 1G6YA 3TOUA 4G9HA 2V1MA 4G10A 2BJXA 3HJOA 2H19A 4YAVA 2F9SA 2GT5A 3ZFLA 1ILOA 2YNXA 1YEWC 3P8WA 5GAPD 4ZB6A 4MJCA 1JZRA 2GSTA 5D8IA 3NIVA 3GRXA 4ULXA 2O3EA 1YEPA 2DJ1A 1TK0B 1PMTA 2FWGA 2G2QA 3IAS2 1BAYA 4ZB7A 1R7HA 1B9YC 4WR4A 4KDUA 2FY6A 4XTSA 4PNFA 2R0CA 4WXTA 2CV4A 1FW1A 5A4WA 1N8JA 2PWJA 4PNGA 1ST9A 2HSMA 3W8SA 1MEKA 2FA4A 2YWIA 3ZIVA 4MABA 2HZEA 3CMIA 2R0GA 5J4VA 3HYPA 4ZIJA 1MTCA 3TDGA 4ACSA 2PVQA 1K0DA 2H0GA 2PU9C 3LGCA 1G7EA 2GQMA 3GL5A 1USBA 4XS6A 2VLUA 1MD3A 1MDIA 1SL2B 1GLQA 2IMIA 2I1UA 1JZWA 1B8XA 2HXKA 1PX6A 1HYUA 1B4QA 3EC3A 2C3QA 2DJ3A 3RPNA 2MMZA 1MDKA 1XOAA 3DIEA 1E2YA 1GH2A 2O87A 5GSTA 1TI3A 5D9XA 3WGEA 3L9UA 3SBCA 5E4WA 4ZB8A 3CHXC 1GTAA 1EEMA 5J47A 2YWNA 3GFKA 1ML6A 13GSA 3ZYWA 3ED3A 2ES7A 1IYIA 1NHOA 16GSA 2JZSA 2R6KA 4BVXB 4NAXA 3JCML 3H8QA 3UOMA 4CDOA 1ZYEA 3F3QA 1ERVA 4PX1A 4CHSA 2JZTA 1HQOA 5HR1A 1VRSD 4MDCA 2HE3A 3ZVJA 2PGTA 4HQZA 1UC7A 1SVMA 1FB6A 2L6CA 2H0HA 3U6VA 1T7PB 3AY8A 5H5SA 1EZKA 3Q19A 2VO4A 3HMJG 1SD9A 2LJKA 1GSFA 2PBJA 3LYPA 4DSSA 1YY7A 3F6FA 4ZXGA 1ZMAA 5CYYA 1XWCA 3TB2A 5HR0A 4IHUA 1GUMA 4J57E 3KZQA 2KP1A 1H75A 9GSSA 2A4VA 4AKHA 1OC9B 3UARA 1FHEA 4TKYA 1BEDA 2YP6A 2E7PA 2WVXB 2J9HA 1A2JA 2LV3A 5IOXA 2NDOA 2CZ2A 1X0RA 3FYGA 4NPBA 4CW9A 1XOBA 2DJ0A 2IMDA 3VLNA 4ZILA 3D4TA 4OCFA 3CXGA 3G7JA 2H0IA 3TKSC 1PN9A 3Q18A 5AIVA 2AUVA 1RW1A 4I97A 1JLWA 3LXTA 2P0GA 1X9SB 4Z2UA 4N11A 2HZFA 3D6IA 4EUYA 1A2LA 2KLXA 5HFGA 2H71A 1X5DA 2FCHA 5ECQB 2H01A 3KGKA 3GMFA 1AQXA 1EV9A 2VM1A 4TR3A 1QQ2A 4O5QA 5CAXA 2X8HA 1R26A 1DE1A 2GQLA 3M3MA 2WRTA 3FZ4A 3N9JA 2DMMA 2XPDA 1U3IA 4HS1A 1PN0A 3H4KA 4IJIA 1V98A 2YWMA 2LRTA 2EFHA 3F9UA 1ON4A 1O85A 3BD2A 3WT1A 1WP0A 3ZREA 5G1LA 3O76A 3ERGA 3DRNA 5JWRB 1SKWB 1PKZA 1WWJA 2WS2A 2JU5A 4KCEA 1DSBA 2O36A 4HU9A 3RDWA 1HNBA 5ELGA 2JSZA 1O73A 5J4UA 2LEGA 4IW9A 2AHEA 2FWHA 1G6WA 1ZGNA 4JRRA 3P90A 4PGTA 1BJXA 5J3RA 1URMA 2D2ZA 3TJJA 2TRXA 2FLSA 1E6BA 1Z9HA 4I8BA 5IM9A 3QR6A 5CRWA 2H70A 3PR8A 1EWXA 4TR4A 3APOA 4LA1A 5DDLA 5ECOB 4N10A 2K6VA 1AW9A 2NPBA 1AQVA 2HFDA 1ZYQB 4GLTA 4KH7A 4NHZA 8GSSA 3LYKA 3VWUA 2RUFA 1R5AA 3FR9A 4MP4A 2JL4A 1TOFA 4BWQA 3TKSA 5HFIA 2X64A 4BWSA 4NMUA 3KD0A 2JSYA 4TXVA 3DKSA 2P5QA 1ERWA 3VWVA 4MPGA 3L0HA 11GSA 4ZB9A 4KW6A 3EMPA 1TTZA 2GT6A 2YZHA 3ME7A 3EPTA 2HSMB 1XBSA 1NSWA 4IELA 2CQ9A 4TR1A 5ECSA 1TK5B 4IS0A 1YDKA 2G0FA 2HZEB 1TI1A 2X4AA 3IPZA 4KE3A 4MCUA 7GSSA 4MF7A 4BVXA 1OE7A 4BPYA 2N5BA 3KM6A 5KN2A 2VAFA 3FZ9A 5FWGA 2A4HA 2GZZA 4IN0A 3IBHA 2C80A 1XW9A 3ZRDA 1XFLA 1BX9A 3TJKA 2L57A 3UBKA 1O6JA 1OKTA 4GQFA 2VKZG 4N0VA 19GSA 1MD4A 2FUG2 2X8CA 4POKA 1XW6A 3A5WA 4MJBA 4HZ2A 2WJUA 2LSTA 3PINA 5IO0A 3Q6OA 3HJMA 3IHQA 2B7KA 4RQRA 3TJGA 1QUWA 4K8MA 2JADA 2CZ3A 1VF3A 2WFCA 5B6NA 4YQVA 4F0BA 3FR3A 1GUKA 2WVXA 3FEUA 4H86A 1PRXA 2YV7A 3K8NA 1WJKA 2UZ8A 3J7Yb 2FWEA 5D73A 3KTLA 5LD0A 4EC0A 1NW2A 3CTFA 1BYEA 3L9VA 1SVLA 5DALB 4X0XA 1DE2A 2KP2A 1X5CA 4RQXA 2O8VB 4TRXA 3QAGA 1EP7A 2QA2A 2H74A 4N30A 2WGRA 1WMJA 2ZCTA 2B5YA 3IAM2 5JCWA 2O5VA 1N25A 2YN1A 4K2XA 3ZMLA 1TRSA 4G0IA 2MYGA 1THXA 1GNWA 2GSRA 1A24A 4O5UA 1FB0A 4GSSA 3PH9A 2EC4A 5ECKB 1M9AA 4PUAA 1PX7A 1FO5A 2X49A 1T4YA 5CRDA 4MNNA 3S9FA 3A2VA 3WT2A 4NV2A 4AF2A 5KN1A 1RK4A 1JLVA 3MNGA 3BCIA 20GSA 2N5FA 3TRPA 4W66A 3PPUA 3GV1A 3KP8A 4LL4B 2HRKA 4IJ3A 2H1AA 2VOCA 4JR4A 4Q5RA 1GNEA 3GA4A 2GDRA 4NXIA 4K7OA 2VCWA 1PSQA 5D9TA 2EFEA 4KGIA 3L78A 2LJRA 2K18A 4K7IA 2LJAA 2LS5A 5ELAA 5CP1A 5F05A 3GKMA 3FZ5A 2LRNA 4JE1A 2VM2A 2NVLA 5HQPA 2HYXA 2B5EA 4GSTA 2MZCA 4KCAA 2B3SA 3IK9A 3BCKA 3E3EA 4OFNA 2F51A 2EIQA 1IYHA 2EFDA 2CX3A 1M2AA 1S4BP 3C1RA 1NHYA 3TGZA 3RPPA 1S3CA 1I1IP 5ECMB 4TR0A 2R0PA 2QA1A 1EGRA 4PQHA 1F3AA 3CBUA 2HRFA 3VFIA 5HR3A 1M2BA 3MSZA 3FW2A 1F37A 4POMA 2DSAA 2CX4A 2V2GA 1ACVA 5FHIA 3APSA 1AIUA 1FVJA 2F3MA 3IC8A 3UMAA 4Z2TA 5INYA 3F0IA 3UIWA 12GSA 3CRUA 5F8BA 4AGSA 2B7JA 4F9ZA 2AV4A 2V6KA 1WOUA 3C73A 3MYDA 2XPEA 2O89A 5J40A 5DCGA 1K0BA 4E68A 5ECRB 2VCXA 4GSNA 1T1VA 2EIRA 3ZVJD 3US3A 1PA3A 2IJYA 4LLRA 3G7YA 4PQ1A 2OBKA 4IVFA 5JCUA 1OC8A 2I9HA 3APQA 3TKQA 4L8EA 5D9WA 4K9ZA 1TU7A 4ZL8A 4K0NA 5CREA 1VF1A 5IIZA 5EVOA 1YQ1A 1SU9A 3EMXA 2B1KA 4XS1A 4JBBA 3F3RA 2C0EA 3E9JB 4HZ4A 2A2SA 1QK8A 5H5QA 1X5EA 2DIYA 2YWOA 5IMFA 2GZYA 1FOHA 4X4JA 2EFCA 5A4VA 3KMNA 3HCZA 3HVXA 1JFUA 2IMEA 3GTUA 4XCSA 3A5IA 4AKXB 5BRTA 4WF4A 2DLXA 1LJRA 1XPVA 2C0GA 1Y25A 2GLRA 1T00A 4GRFA 4TR1B 1XWBA 2C8UA 2HI7A 4BVYA 4N0ZA 1XWAA 4KSMA 2H76A 3HVSA 2ZNMA 2C0DA 2TRCP 3KXOA 4ILFA 1B9XC 3GH9A 5IPGA 3TJFA 3QPMA 2XBQA 2PUKC 3EU4A 5DALA 2FGXA 1SYXA 1YKAA 1HNCA 2VIMA 1YF1A 4PHZC 1SYRA 4KX4A 1GTBA 2REMA 5CO3A 1WE0A 1XVQA 2GSSA 3GX0A 1YZXA 4I6XA 2X99A 3CQFA 1XVWA 1S3RA 1F3BA 2YCDA 4IGJA 4DSRA 2C1YA 5F06A 3WD6A 2L6DA 4OCEA 2OBIA 5GSSA 3HZ4A 2VLVA 3G7IA 4YQMA 4D73A 5JWOB 2LNTA 2XC2A 3M9KA 1EOHA 5ID2B 3ZITA 3FZAA 1Q4JA 5IMAA 3DXBA 1NM3A 2R4VA 2IMKA 3IXRA 4KAEA 3QFAC 3WGXA 5HR2A 3UL3A 2M80A 4GXZA 2VD1A 4ISDA 5J5NA 3HY2A 1TRVA 1EGOA 1U6TA 3KMOA 3EURA 4AJ7A 4MLYA 2CVKA 1K0OA 1O8WA 1OE8A 3DVXA 4HI7A 2P5RA 1K3LA 2H1GA 2I81A 2DJ2A 4ID0A 4K6XA 3F4RA 4MH3A 2WCIA 3IHGA 2DKIA 1XXUA 2WB9A 3QOUA 5IMVA 4MF6A 5DJMA 2XHFA 4EVMA 1SD8A 4CY6A 3HDCA 1I9DA 1JZDA 3TRQA 3OR5A 4F82A 3M9JA 4YAPA 1Z7RA 3GSTA 1U88A 1FOVA 3GN3A 4HEA2 3G9BA 5ECNB 3FY7A 3RHBA 4MPFA 3DYRA 4FYBA 4EKZA 2HRKB 1FVKA 3I43A 4P3YB 1GWCA 5IMZA 1K0AA 1PQNA 1UA5A 4PQIA 2DBCA 5AGYA 2CAQA 3GHAA 2J23A 2V41A 1GP1A 3LQ7A 2WW1A 5BMUA 4O5RA 3TKSE 1YKCA 3M1GA 1VF2A 3GL3A 3ERWA 3I6AA 5IO2A 1A0RP 1GTUA 5JCGA 4WKWA 1SKRB 1TP9A 2QC7A 3IC4A 18GSA 3GURA 5IQYA 1M0UA 4L0WA 1K0MA 3VPQA 2ZUPA 1GSQA 3H1NA 3CSHA 5CRHA 2K9FA 1X9WB 1AXDA 3QMXA 4IP1A 4WETA 3A2WA 2VUPA 1ZZYA 2E2MA 2WZSA 1R5PA 5DCHA 4Z7XA 3VI7A 1GUHA 5D9VA 1TK8B 4GCIA 5KN3A 4KDXA 1G7OA 4ZBBA 1TW9A 4DVCA 1GTIA 1Z6NA 4YQUA 3L4NA 4IQ1A 2BMXA 3ZTLA 3GX8A 4AKGA 2NBSA 2IFQA 3FK8A 1SK1A 1H4OA 3EU3A 3U5RE 1J0FA 4POBA 2DJJA 3MIXA 2YV9A 4K0GA 1BF5A 1XZOA 2C0FA 4HU7A 4KNDA 2AAWA 1PGTA 5EY6A 3GYKA 2LQOA 4LMVA 1UN2A 3C71A 3D4MA 2L59A 1THOA 4YKGA 4OO4A 2FNOA 5J9BA 3BBYA 4ECIA 4AI6A 3HKRA 1SENA 6GSYA 3WGDA 4AJ8A 2MBTA 3GTUB 3W8JA 3UEMA 2I3YA 3GKNA 5HFKA 3QAWA 5DVBA 2L4CA 5ID2A 3J7Yk 2RLIA 2PPTA 3HZ8A 4BVYB 3HXSA 1K0NA 3EE2A 4EDZA
chains in the Genus database with same CATH topology
1OYJA 1SJIA 1TRUA 1QFNA 3C8EA 3DD3A 1XW5A 4ECJA 2ON5A 3TKPA 4DSQA 2GZPA 1O81A 3VI5A 2VL3A 1TJDA 1AC1A 4OFMA 4GDFA 3QCPA 5DJLA 4PTSA 5AISA 2FHEA 5A1NB 1GULA 2H1DA 3LWAA 3I69A 4GQCA 1BG1A 5COHA 4TW5A 5ECIB 2VD0A 4L5LA 3HJPA 4MA9A 3PGTA 2AYTA 2H30A 5LCZA 5A5HA 4ZL7A 1KTEA 4D73B 4O7HA 3CWGA 3MWHA 2R5GA 6GSXA 1ZYPA 2F8FA 1Z6MA 4V1Ag 5KEJA 5L71A 2FD3A 4HQSA 2VLTA 1A8LA 1O7UA 3IR4A 1CQGA 3C1SA 4BL7A 1V2AA 4RI6A 1XIYA 4WBRD 1SKSB 4ZBDA 3ISOA 3RHCA 5A4UA 2IN3A 4J56E 4L0UA 4N3ZA 1ERTA 3L9SA 4XRAA 5B6MA 1KBNA 1AUCA 4LL1B 4G0KA 4WR5A 2E2GA 5G30A 4K5SA 1TXUA 2MMOA 5A34A 2A2RA 1GSDA 3FR6A 3P2AA 2KHPA 4QMKA 1PD21 1WRYA 3H93A 3D5JA 1M9BA 5EL8A 5AN1A 2OE0A 5G5EA 3ZFBA 4ZL9A 5F0GA 3I9V2 3H79A 4MH2A 2H73A 1EEJA 4WBJA 4O92A 5G31A 4OD7A 2WZ9A 1M2DA 3LEFA 2AB6A 3VK9A 1TKDB 2YZUA 5B8BA 2GGTA 5C00A 1TDIA 4QL9A 1YJ6A 2DC5A 1A0FA 1G0TA 5E59A 2DMLA 3NOFA 2F8AA 3KH7A 3TCOA 2OE3A 3O6TA 4YKFA 1GRXA 3VWXA 4EIPA 3UVTA 4Q5NA 3F63A 3A2XA 4XS4B 3TKRA 3QD9A 1OC3A 5BMUB 4TXOB 3D21A 5G2ZA 1N2AA 2CVDA 3GH6A 2YPMA 5ECLB 2JZRA 5EPFA 1W4VA 2A2PA 4GWRA 2I4AA 3P7XA 4Q5QA 1Z5YE 5ECPB 4Q5FA 4MJAA 2RUEA 1WPIA 3CSJA 5DQSA 2GQKA 4CY8A 1QGVA 2KOKA 1HNAA 3E0UA 5KOWA 5FT3A 1PKWA 1Y6EA 2QGVA 1XCCA 4O32A 3RAZA 1JHBA 2OT3A 2C3TA 3VPTA 4TVEA 2B1LA 2EIOA 4IKHA 3WYWA 1A23A 4G01A 2PVOC 2BTOT 1B4PA 1J08A 1ZYNA 4IP6A 4IQAA 5G1KA 3UJ1A 4F2IA 6GSVA 5DAKA 2H6XA 1XWGA 4E8EA 5IPHA 2VL9A 3TRXA 2ALBA 4ML6A 4I2TA 2HSYA 4V2LA 3UAPA 1W89A 2PN8A 2K8SA 2C3NA 3M8NA 2LQQA 1V9WA 1ERUA 2IFQB 4JU5A 2VL2A 2ON7A 4KA0A 3LORA 3KTBA 1OAZA 2MBSA 4EXJA 4KF9A 3ZL5A 2OJLA 3UBLA 5A1NA 4HDEA 1A8YA 2IMFA 1F2EA 3IRAA 4K5RA 2RM6A 2R2JA 1AAZA 3ERFA 1AQWA 3QFBC 3LFLA 4AJ6A 3ZMKA 1J9BA 1HD2A 3CTGA 3KP9A 2OADA 1Z7PA 1SJ6A 2PERA 5J4YA 3V1WA 1F9MA 1BQ7A 1WIKA 3KIJA 4A5PA 4I2UA 5B7CA 3GSSA 4MZWA 4RI7A 2CVBA 3W6GA 1GLPA 3GUSA 4FIWA 3ZLPA 3IE3A 2IL3A 5LNKe 1EV4A 2LKUA 2CT6A 6GSWA 4HUAA 2YJHA 2DJKA 3NZNA 3DGQA 1K3YA 2H6YA 4F0CA 2QSIA 1QMVA 2N5AA 1F6MC 1LBKA 3LG6A 1GSUA 3QDNA 2M72A 1FG4A 4J2FA 5G5FA 5H5RA 2O7KA 4V2NA 2YJ7A 1X9MB 5A5HB 3SWLA 2X8GA 2IPAA 5KN0A 1YVLA 3LJRA 3LSZA 5D96A 2H66A 4V1Ap 2CA8A 3F6DA 4HOJA 1VGLA 2HSNA 5GAND 2WDUA 1SVOA 4KDYA 1KEBA 5A5KA 3EINA 6GSSA 1R4WA 2HNLA 2O85A 1SL0B 1ZL9A 2YANA 3KH9A 4HJ2A 4BL7B 2TIRA 2HQTA 2C4JA 4ECBA 4G2EA 2R37A 5D93A 3Q74A 5KOXA 1GSYA 1QXHA 3CSIA 1ABAA 2MMNA 3IDVA 3TU3B 1OVNA 2VCTA 3HA9A 4XS4A 3DWVA 1KNGA 1S3AA 4MZBA 2LRCA 5A34B 1V40A 4TXOA 1O8XA 4EF0A 4PURA 1T4ZA 3FRCA 5J9CA 2E0QA 3R3EA 1Z3EA 5AIXA 3VWWA 4XRDA 3QAVA 4GF0A 4FYCA 3GKKA 1CQHA 3GNJA 5ENUA 2GTUA 22GSA 4XHMA 2VCVA 2OACA 4PXOA 1GSSA 4FO5A 2HT9A 2IWTA 3A3TA 1DUGA 2Z9SA 2GVPA 1ZOFA 3TOTA 4FH8A 3KEBA 4ICYA 2RM5A 2B6MA 4JR6A 4JZQA 2H1BA 2FWFA 1V58A 4NWYA 1M7TA 1K3OA 4OO5A 4ML1A 3EVIA 2HRNA 1TRWA 3MAKA 4L5OA 4MF5A 4I5QA 3ZIJA 3O3TA 4E8HA 1YEXA 1YF0A 2V32A 1S3DA 1SL1B 5ABRA 10GSA 4OFTA 4G0LA 4QL7A 1PL2A 4G19A 5F07A 3D22A 2FA8A 4KB3A 1U87A 1TU8A 4IBPA 1Y1UA 2VCQA 3DMLA 3HHVA 1BG5A 2M46A 3IV4A 4K7NA 3CYNA 3D0ZA 3IK7A 4ZBAA 3TUEA 3IA1A 2HLSA 4HJMA 1LU4A 4EO3A 2P31A 3N5OA 4RUVA 3F8UA 1C72A 4XIHA 5B8AA 3VURA 3M0FA 2OE1A 1VF4A 3FHKA 2RIIA 1UVZA 4DEJA 4X1UA 4FQUA 1I5GA 14GSA 5GZZB 3R2QA 2LUSA 2V6OA 2HSHA 2YOIA 3KJYA 4Z2RA 4V2MA 1T3BA 1V57A 2GSQA 2WULA 5DAKB 4OWYA 2L4QA 4EL1A 2UV8G 3HVVA 2VCZA 5CRGA 17GSA 4OMVA 4PUFC 4TN8A 4NHWA 2H1LA 2XBIA 4X43A 2B5XA 1SJZA 1Q98A 4KSOA 5C04A 3EYTA 1RQMA 3DVWA 2LTKA 3HD5A 3ZZXA 2PMTA 4NV5A 6GSUA 1OC9A 2JACA 2OKAA 2LNSA 4F03A 2QKEA 3TJBA 5DBQA 3FMWA 4KUNA 3ME8A 1M99A 4AKIA 3EWLA 4EDYA 1OKDA 3LW9A 1JZOA 3GKXA 4K1FA 3DEXA 1MDJA 1GL8A 1DBYA 2CAIA 4MJEA 6GSTA 1T8EB 1A2MA 1SK2A 3LXZA 3GIXA 4MK3A 2K8VA 2NTOA 5JWQB 3C7MA 3F4TA 4WEYA 4WF5A 2DIZA 1B48A 2H8LA 3IOSA 3RBTA 2L5LA 4YH2A 4DSSB 3FKFA 4LMWA 4QQ7A 4POLA 1EP8A 1GSEA 4JEDA 1TXXA 1ZCPA 2AJQB 4BA7A 2KUCA 3CRTA 2H72A 3BOAA 4MZCA 4EIQA 4ECCA 4TOPA 2DKHA 2IIYA 1FAAA 4FYUA 4K2DA 4GTUA 5ECHB 1U3AA 5CNWA 5IOWA 2GS3A 2HRAA 4USSA 1XWKA 1PL1A 4EE0A 3BJ5A 1EOGA 2H6ZA 2MMAA 5J41A 2R3XA 2H75A 1SK0A 2OA7A 5IMCA 5DQYA 3F4SA 3MDKA 4MMMA 3KCMA 1K0CA 2HSNB 2L5OA 2VL2C 5IMDA 3UVHA 1G6YA 3TOUA 4G9HA 2V1MA 4G10A 2BJXA 3HJOA 2H19A 4YAVA 2F9SA 2GT5A 3ZFLA 1ILOA 2YNXA 3P8WA 5GAPD 4ZB6A 4MJCA 1JZRA 2GSTA 5D8IA 3NIVA 3GRXA 4ULXA 1YEPA 2DJ1A 1TK0B 1PMTA 2FWGA 2G2QA 3IAS2 1BAYA 4ZB7A 1R7HA 1B9YC 4WR4A 4KDUA 2FY6A 4XTSA 4PNFA 2R0CA 4WXTA 2CV4A 1FW1A 5A4WA 1N8JA 2PWJA 4PNGA 1ST9A 2HSMA 3W8SA 1MEKA 2FA4A 2YWIA 3ZIVA 4MABA 2HZEA 3CMIA 2R0GA 5J4VA 3HYPA 4ZIJA 1MTCA 3TDGA 4ACSA 2PVQA 1K0DA 2H0GA 2PU9C 3LGCA 1G7EA 2GQMA 3GL5A 1USBA 4XS6A 2VLUA 1MD3A 1MDIA 1SL2B 1GLQA 2IMIA 2I1UA 1JZWA 1B8XA 2HXKA 1PX6A 1HYUA 1B4QA 3EC3A 2C3QA 2DJ3A 3RPNA 2MMZA 1MDKA 1XOAA 3DIEA 1E2YA 1GH2A 2O87A 5GSTA 1TI3A 5D9XA 3WGEA 3L9UA 3SBCA 5E4WA 4ZB8A 1GTAA 1EEMA 5J47A 2YWNA 3GFKA 1ML6A 13GSA 3ZYWA 3ED3A 2ES7A 1IYIA 1NHOA 16GSA 2JZSA 2R6KA 4BVXB 4NAXA 3JCML 3H8QA 3UOMA 4CDOA 1ZYEA 3F3QA 1ERVA 4PX1A 4CHSA 2JZTA 1HQOA 5HR1A 1VRSD 4MDCA 2HE3A 3ZVJA 2PGTA 4HQZA 1UC7A 1SVMA 1FB6A 2L6CA 2H0HA 3U6VA 1T7PB 3AY8A 5H5SA 1EZKA 3Q19A 2VO4A 3HMJG 1SD9A 2LJKA 1GSFA 2PBJA 3LYPA 4DSSA 1YY7A 3F6FA 4ZXGA 1ZMAA 5CYYA 1XWCA 3TB2A 5HR0A 4IHUA 1GUMA 4J57E 3KZQA 2KP1A 1H75A 9GSSA 2A4VA 4AKHA 1OC9B 3UARA 1FHEA 4TKYA 1BEDA 2YP6A 2E7PA 2J9HA 1A2JA 2LV3A 5IOXA 2NDOA 2CZ2A 1X0RA 3FYGA 4NPBA 4CW9A 1XOBA 2DJ0A 2IMDA 3VLNA 4ZILA 3D4TA 4OCFA 3CXGA 3G7JA 2H0IA 3TKSC 1PN9A 3Q18A 5AIVA 2AUVA 1RW1A 4I97A 1JLWA 3LXTA 2P0GA 1X9SB 4Z2UA 4N11A 2HZFA 3D6IA 4EUYA 1A2LA 2KLXA 5HFGA 2H71A 1X5DA 2FCHA 5ECQB 2H01A 3KGKA 3GMFA 1AQXA 1EV9A 2VM1A 4TR3A 1QQ2A 4O5QA 5CAXA 2X8HA 1R26A 1DE1A 2GQLA 3M3MA 2WRTA 3FZ4A 3N9JA 2DMMA 2XPDA 1U3IA 4HS1A 1PN0A 3H4KA 4IJIA 1V98A 2YWMA 2LRTA 2EFHA 3F9UA 1ON4A 1O85A 3BD2A 3WT1A 1WP0A 3ZREA 5G1LA 3O76A 3ERGA 3DRNA 5JWRB 1SKWB 1PKZA 1WWJA 2WS2A 2JU5A 4KCEA 1DSBA 4HU9A 3RDWA 1HNBA 5ELGA 2JSZA 1O73A 5J4UA 2LEGA 4IW9A 2AHEA 2FWHA 1G6WA 1ZGNA 4JRRA 3P90A 4PGTA 1BJXA 5J3RA 1URMA 2D2ZA 3TJJA 2TRXA 2FLSA 1E6BA 1Z9HA 4I8BA 5IM9A 3QR6A 5CRWA 2H70A 3PR8A 1EWXA 4TR4A 3APOA 4LA1A 5DDLA 5ECOB 4N10A 2K6VA 1AW9A 2NPBA 1AQVA 2HFDA 1ZYQB 4GLTA 4KH7A 4NHZA 8GSSA 3LYKA 3VWUA 2RUFA 1R5AA 3FR9A 4MP4A 2JL4A 1TOFA 4BWQA 3TKSA 5HFIA 2X64A 4BWSA 4NMUA 3KD0A 2JSYA 4TXVA 3DKSA 2P5QA 1ERWA 3VWVA 4MPGA 3L0HA 11GSA 4ZB9A 4KW6A 3EMPA 1TTZA 2GT6A 2YZHA 3ME7A 3EPTA 2HSMB 1XBSA 1NSWA 4IELA 2CQ9A 4TR1A 5ECSA 1TK5B 4IS0A 1YDKA 2G0FA 2HZEB 1TI1A 2X4AA 3IPZA 4KE3A 4MCUA 7GSSA 4MF7A 4BVXA 1OE7A 4BPYA 2N5BA 3KM6A 5KN2A 2VAFA 3FZ9A 5FWGA 2A4HA 2GZZA 4IN0A 3IBHA 2C80A 1XW9A 3ZRDA 1XFLA 1BX9A 3TJKA 2L57A 3UBKA 1O6JA 1OKTA 4GQFA 2VKZG 4N0VA 19GSA 1MD4A 2FUG2 2X8CA 4POKA 1XW6A 3A5WA 4MJBA 4HZ2A 2WJUA 2LSTA 3PINA 5IO0A 3Q6OA 3HJMA 3IHQA 2B7KA 4RQRA 3TJGA 1QUWA 4K8MA 2JADA 2CZ3A 1VF3A 2WFCA 5B6NA 4YQVA 4F0BA 3FR3A 1GUKA 3FEUA 4H86A 1PRXA 2YV7A 3K8NA 1WJKA 2UZ8A 3J7Yb 2FWEA 5D73A 3KTLA 5LD0A 4EC0A 1NW2A 3CTFA 1BYEA 3L9VA 1SVLA 5DALB 4X0XA 1DE2A 2KP2A 1X5CA 4RQXA 2O8VB 4TRXA 3QAGA 1EP7A 2QA2A 2H74A 4N30A 2WGRA 1WMJA 2ZCTA 2B5YA 3IAM2 5JCWA 2O5VA 1N25A 2YN1A 4K2XA 3ZMLA 1TRSA 4G0IA 2MYGA 1THXA 1GNWA 2GSRA 1A24A 4O5UA 1FB0A 4GSSA 3PH9A 2EC4A 5ECKB 1M9AA 4PUAA 1PX7A 1FO5A 2X49A 1T4YA 5CRDA 4MNNA 3S9FA 3A2VA 3WT2A 4NV2A 4AF2A 5KN1A 1RK4A 1JLVA 3MNGA 3BCIA 20GSA 2N5FA 3TRPA 4W66A 3PPUA 3GV1A 3KP8A 4LL4B 2HRKA 4IJ3A 2H1AA 2VOCA 4JR4A 4Q5RA 1GNEA 3GA4A 2GDRA 4NXIA 4K7OA 2VCWA 1PSQA 5D9TA 2EFEA 4KGIA 3L78A 2LJRA 2K18A 4K7IA 2LJAA 2LS5A 5ELAA 5CP1A 5F05A 3GKMA 3FZ5A 2LRNA 4JE1A 2VM2A 2NVLA 5HQPA 2HYXA 2B5EA 4GSTA 2MZCA 4KCAA 2B3SA 3IK9A 3BCKA 3E3EA 4OFNA 2F51A 2EIQA 1IYHA 2EFDA 2CX3A 1M2AA 3C1RA 1NHYA 3TGZA 3RPPA 1S3CA 5ECMB 4TR0A 2R0PA 2QA1A 1EGRA 4PQHA 1F3AA 3CBUA 2HRFA 3VFIA 5HR3A 1M2BA 3MSZA 3FW2A 1F37A 4POMA 2DSAA 2CX4A 2V2GA 1ACVA 5FHIA 3APSA 1AIUA 1FVJA 2F3MA 3IC8A 3UMAA 4Z2TA 5INYA 3F0IA 3UIWA 12GSA 3CRUA 5F8BA 4AGSA 2B7JA 4F9ZA 2AV4A 2V6KA 1WOUA 3C73A 3MYDA 2XPEA 2O89A 5J40A 5DCGA 1K0BA 4E68A 5ECRB 2VCXA 4GSNA 1T1VA 2EIRA 3ZVJD 3US3A 1PA3A 2IJYA 4LLRA 3G7YA 4PQ1A 2OBKA 4IVFA 5JCUA 1OC8A 2I9HA 3APQA 3TKQA 4L8EA 5D9WA 4K9ZA 1TU7A 4ZL8A 4K0NA 5CREA 1VF1A 5IIZA 5EVOA 1YQ1A 1SU9A 3EMXA 2B1KA 4XS1A 4JBBA 3F3RA 2C0EA 3E9JB 4HZ4A 2A2SA 1QK8A 5H5QA 1X5EA 2DIYA 2YWOA 5IMFA 2GZYA 1FOHA 4X4JA 2EFCA 5A4VA 3KMNA 3HCZA 3HVXA 1JFUA 2IMEA 3GTUA 4XCSA 3A5IA 4AKXB 5BRTA 4WF4A 2DLXA 1LJRA 1XPVA 2C0GA 1Y25A 2GLRA 1T00A 4GRFA 4TR1B 1XWBA 2C8UA 2HI7A 4BVYA 4N0ZA 1XWAA 4KSMA 2H76A 3HVSA 2ZNMA 2C0DA 2TRCP 3KXOA 4ILFA 1B9XC 3GH9A 5IPGA 3TJFA 3QPMA 2XBQA 2PUKC 3EU4A 5DALA 2FGXA 1SYXA 1YKAA 1HNCA 2VIMA 1YF1A 1SYRA 4KX4A 1GTBA 2REMA 5CO3A 1WE0A 1XVQA 2GSSA 3GX0A 1YZXA 4I6XA 2X99A 1XVWA 1F3BA 2YCDA 4IGJA 4DSRA 2C1YA 5F06A 3WD6A 2L6DA 4OCEA 2OBIA 5GSSA 3HZ4A 2VLVA 3G7IA 4YQMA 4D73A 5JWOB 2LNTA 2XC2A 3M9KA 1EOHA 5ID2B 3ZITA 3FZAA 1Q4JA 5IMAA 3DXBA 1NM3A 2R4VA 2IMKA 3IXRA 4KAEA 3QFAC 3WGXA 5HR2A 3UL3A 2M80A 4GXZA 2VD1A 4ISDA 5J5NA 3HY2A 1TRVA 1EGOA 1U6TA 3KMOA 3EURA 4AJ7A 4MLYA 2CVKA 1K0OA 1O8WA 1OE8A 3DVXA 4HI7A 2P5RA 1K3LA 2H1GA 2I81A 2DJ2A 4ID0A 4K6XA 3F4RA 4MH3A 2WCIA 3IHGA 2DKIA 1XXUA 2WB9A 3QOUA 5IMVA 4MF6A 5DJMA 2XHFA 4EVMA 1SD8A 4CY6A 3HDCA 1I9DA 1JZDA 3TRQA 3OR5A 4F82A 3M9JA 4YAPA 1Z7RA 3GSTA 1U88A 1FOVA 3GN3A 4HEA2 3G9BA 5ECNB 3FY7A 3RHBA 4MPFA 3DYRA 4FYBA 4EKZA 2HRKB 1FVKA 3I43A 4P3YB 1GWCA 5IMZA 1K0AA 1PQNA 1UA5A 4PQIA 2DBCA 5AGYA 2CAQA 3GHAA 2J23A 2V41A 1GP1A 3LQ7A 5BMUA 4O5RA 3TKSE 1YKCA 3M1GA 1VF2A 3GL3A 3ERWA 3I6AA 5IO2A 1A0RP 1GTUA 5JCGA 4WKWA 1SKRB 1TP9A 2QC7A 3IC4A 18GSA 3GURA 5IQYA 1M0UA 4L0WA 1K0MA 3VPQA 2ZUPA 1GSQA 3H1NA 3CSHA 5CRHA 2K9FA 1X9WB 1AXDA 3QMXA 4IP1A 4WETA 3A2WA 2VUPA 1ZZYA 2E2MA 1R5PA 5DCHA 4Z7XA 3VI7A 1GUHA 5D9VA 1TK8B 4GCIA 5KN3A 4KDXA 1G7OA 4ZBBA 1TW9A 4DVCA 1GTIA 1Z6NA 4YQUA 3L4NA 4IQ1A 2BMXA 3ZTLA 3GX8A 4AKGA 2NBSA 2IFQA 3FK8A 1SK1A 1H4OA 3EU3A 3U5RE 1J0FA 4POBA 2DJJA 3MIXA 2YV9A 4K0GA 1BF5A 1XZOA 2C0FA 4HU7A 4KNDA 2AAWA 1PGTA 5EY6A 3GYKA 2LQOA 4LMVA 1UN2A 3C71A 3D4MA 2L59A 1THOA 4YKGA 4OO4A 2FNOA 5J9BA 3BBYA 4ECIA 4AI6A 3HKRA 1SENA 6GSYA 3WGDA 4AJ8A 2MBTA 3GTUB 3W8JA 3UEMA 2I3YA 3GKNA 5HFKA 3QAWA 5DVBA 2L4CA 5ID2A 3J7Yk 2RLIA 2PPTA 3HZ8A 4BVYB 3HXSA 1K0NA 3EE2A 4EDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYJ A;  1SJI A;  1TRU A;  1QFN A;  3C8E A;  3DD3 A;  1XW5 A;  4ECJ A;  2ON5 A;  3TKP A;  4DSQ A;  2GZP A;  1O81 A;  3VI5 A;  2VL3 A;  1TJD A;  1AC1 A;  4OFM A;  3QCP A;  5DJL A;  4PTS A;  5AIS A;  2FHE A;  1GUL A;  2H1D A;  3LWA A;  3I69 A;  4GQC A;  5COH A;  4TW5 A;  5ECI B;  2VD0 A;  4L5L A;  3HJP A;  4MA9 A;  3PGT A;  2AYT A;  2H30 A;  5LCZ A;  4ZL7 A;  1KTE A;  4D73 B;  4O7H A;  3MWH A;  2R5G A;  6GSX A;  2F8F A;  1Z6M A;  4V1A g;  5KEJ A;  5L71 A;  2FD3 A;  4HQS A;  2VLT A;  1A8L A;  1O7U A;  3IR4 A;  1CQG A;  3C1S A;  4BL7 A;  1V2A A;  4RI6 A;  1XIY A;  4WBR D;  1SKS B;  4ZBD A;  3ISO A;  3RHC A;  5A4U A;  2IN3 A;  4J56 E;  4L0U A;  1ERT A;  3L9S A;  4XRA A;  5B6M A;  1KBN A;  1AUC A;  4LL1 B;  4G0K A;  4WR5 A;  2E2G A;  5G30 A;  2MMO A;  2A2R A;  1GSD A;  3FR6 A;  3P2A A;  2KHP A;  1PD2 1;  1WRY A;  3H93 A;  3D5J A;  1M9B A;  5EL8 A;  5AN1 A;  2OE0 A;  5G5E A;  3ZFB A;  4ZL9 A;  5F0G A;  3I9V 2;  3H79 A;  4MH2 A;  2H73 A;  1EEJ A;  4WBJ A;  4O92 A;  5G31 A;  4OD7 A;  2WZ9 A;  1M2D A;  3LEF A;  2AB6 A;  3VK9 A;  1TKD B;  2YZU A;  5B8B A;  2GGT A;  5C00 A;  1TDI A;  4QL9 A;  1YJ6 A;  2DC5 A;  1A0F A;  1G0T A;  5E59 A;  2DML A;  3NOF A;  2F8A A;  3KH7 A;  3TCO A;  2OE3 A;  3O6T A;  1GRX A;  3VWX A;  3UVT A;  4Q5N A;  3F63 A;  3A2X A;  4XS4 B;  3TKR A;  3QD9 A;  1OC3 A;  4TXO B;  3D21 A;  5G2Z A;  1N2A A;  2CVD A;  3GH6 A;  2YPM A;  5ECL B;  2JZR A;  5EPF A;  1W4V A;  4GWR A;  2I4A A;  3P7X A;  4Q5Q A;  1Z5Y E;  5ECP B;  4Q5F A;  4MJA A;  2RUE A;  1WPI A;  3CSJ A;  5DQS A;  2GQK A;  1QGV A;  2KOK A;  1HNA A;  3E0U A;  5FT3 A;  1PKW A;  1Y6E A;  2QGV A;  1XCC A;  4O32 A;  3RAZ A;  1JHB A;  2C3T A;  3VPT A;  4TVE A;  2B1L A;  2EIO A;  4IKH A;  3WYW A;  1A23 A;  2PVO C;  2BTO T;  1B4P A;  1J08 A;  4IP6 A;  4IQA A;  5G1K A;  3UJ1 A;  4F2I A;  6GSV A;  5DAK A;  2H6X A;  1XWG A;  4E8E A;  5IPH A;  2VL9 A;  3TRX A;  2ALB A;  4ML6 A;  4I2T A;  2HSY A;  4V2L A;  3UAP A;  1W89 A;  2PN8 A;  2K8S A;  2C3N A;  3M8N A;  2LQQ A;  1V9W A;  1ERU A;  2IFQ B;  4JU5 A;  2VL2 A;  2ON7 A;  4KA0 A;  3LOR A;  3KTB A;  1OAZ A;  2MBS A;  4EXJ A;  4KF9 A;  3ZL5 A;  2OJL A;  3UBL A;  4HDE A;  1A8Y A;  2IMF A;  1F2E A;  3IRA A;  2RM6 A;  2R2J A;  1AAZ A;  3ERF A;  1AQW A;  3QFB C;  3LFL A;  4AJ6 A;  3ZMK A;  1J9B A;  1HD2 A;  3CTG A;  3KP9 A;  2OAD A;  1Z7P A;  1SJ6 A;  2PER A;  3V1W A;  1F9M A;  1BQ7 A;  1WIK A;  3KIJ A;  4I2U A;  5B7C A;  3GSS A;  4MZW A;  4RI7 A;  2CVB A;  3W6G A;  1GLP A;  3GUS A;  4FIW A;  3ZLP A;  3IE3 A;  2IL3 A;  5LNK e;  1EV4 A;  2LKU A;  2CT6 A;  6GSW A;  4HUA A;  2YJH A;  2DJK A;  3NZN A;  3DGQ A;  1K3Y A;  2H6Y A;  4F0C A;  2QSI A;  1QMV A;  2N5A A;  1F6M C;  1LBK A;  3LG6 A;  1GSU A;  3QDN A;  2M72 A;  1FG4 A;  4J2F A;  5G5F A;  5H5R A;  2O7K A;  4V2N A;  2YJ7 A;  1X9M B;  3SWL A;  2X8G A;  2IPA A;  5KN0 A;  3LJR A;  3LSZ A;  5D96 A;  2H66 A;  4V1A p;  2CA8 A;  3F6D A;  4HOJ A;  1VGL A;  5GAN D;  2WDU A;  4KDY A;  1KEB A;  5A5K A;  3EIN A;  6GSS A;  1R4W A;  2HNL A;  2O85 A;  1SL0 B;  1ZL9 A;  2YAN A;  3KH9 A;  4HJ2 A;  4BL7 B;  2TIR A;  2HQT A;  2C4J A;  4ECB A;  4G2E A;  2R37 A;  5D93 A;  3Q74 A;  1GSY A;  1QXH A;  3CSI A;  1ABA A;  2MMN A;  3IDV A;  1OVN A;  2VCT A;  3HA9 A;  4XS4 A;  3DWV A;  1KNG A;  1S3A A;  4MZB A;  2LRC A;  1V40 A;  4TXO A;  1O8X A;  4EF0 A;  4PUR A;  1T4Z A;  3FRC A;  5J9C A;  2E0Q A;  3R3E A;  1Z3E A;  5AIX A;  3VWW A;  4XRD A;  3QAV A;  4GF0 A;  4FYC A;  3GKK A;  1CQH A;  3GNJ A;  5ENU A;  2GTU A;  22GS A;  4XHM A;  2VCV A;  2OAC A;  4PXO A;  1GSS A;  4FO5 A;  2HT9 A;  2IWT A;  3A3T A;  1DUG A;  2Z9S A;  2GVP A;  1ZOF A;  3TOT A;  4FH8 A;  3KEB A;  2RM5 A;  2B6M A;  4JR6 A;  4JZQ A;  2H1B A;  2FWF A;  1V58 A;  4NWY A;  1M7T A;  1K3O A;  4OO5 A;  4ML1 A;  3EVI A;  2HRN A;  1TRW A;  3MAK A;  4L5O A;  4MF5 A;  4I5Q A;  3ZIJ A;  3O3T A;  4E8H A;  1YEX A;  1YF0 A;  2V32 A;  1S3D A;  1SL1 B;  5ABR A;  10GS A;  4OFT A;  4G0L A;  4QL7 A;  1PL2 A;  4G19 A;  5F07 A;  3D22 A;  2FA8 A;  4KB3 A;  1U87 A;  1TU8 A;  4IBP A;  2VCQ A;  3DML A;  3HHV A;  1BG5 A;  2M46 A;  3IV4 A;  4K7N A;  3CYN A;  3D0Z A;  3IK7 A;  4ZBA A;  3TUE A;  3IA1 A;  2HLS A;  4HJM A;  1LU4 A;  4EO3 A;  2P31 A;  3N5O A;  4RUV A;  3F8U A;  1C72 A;  4XIH A;  5B8A A;  3VUR A;  3M0F A;  2OE1 A;  1VF4 A;  3FHK A;  2RII A;  1UVZ A;  4DEJ A;  4X1U A;  4FQU A;  1I5G A;  14GS A;  5GZZ B;  3R2Q A;  2LUS A;  2V6O A;  2HSH A;  2YOI A;  3KJY A;  4V2M A;  1T3B A;  1V57 A;  2GSQ A;  2WUL A;  5DAK B;  4OWY A;  2L4Q A;  4EL1 A;  3HVV A;  2VCZ A;  5CRG A;  17GS A;  4OMV A;  4PUF C;  4TN8 A;  4NHW A;  2XBI A;  4X43 A;  2B5X A;  1SJZ A;  1Q98 A;  4KSO A;  5C04 A;  3EYT A;  1RQM A;  3DVW A;  2LTK A;  3HD5 A;  3ZZX A;  2PMT A;  4NV5 A;  6GSU A;  1OC9 A;  2JAC A;  2OKA A;  2LNS A;  4F03 A;  2QKE A;  3TJB A;  5DBQ A;  4KUN A;  3ME8 A;  1M99 A;  3EWL A;  4EDY A;  1OKD A;  1JZO A;  3GKX A;  4K1F A;  3DEX A;  1MDJ A;  1GL8 A;  1DBY A;  2CAI A;  4MJE A;  6GST A;  1T8E B;  1A2M A;  1SK2 A;  3LXZ A;  3GIX A;  4MK3 A;  2K8V A;  2NTO A;  5JWQ B;  3C7M A;  3F4T A;  4WEY A;  4WF5 A;  2DIZ A;  1B48 A;  2H8L A;  3IOS A;  3RBT A;  2L5L A;  4YH2 A;  4DSS B;  3FKF A;  4LMW A;  4QQ7 A;  4POL A;  1EP8 A;  1GSE A;  4JED A;  1TXX A;  1ZCP A;  2AJQ B;  4BA7 A;  2KUC A;  3CRT A;  2H72 A;  3BOA A;  4MZC A;  4ECC A;  4TOP A;  2IIY A;  1FAA A;  4FYU A;  4K2D A;  4GTU A;  5ECH B;  1U3A A;  5CNW A;  5IOW A;  2GS3 A;  2HRA A;  4USS A;  1XWK A;  1PL1 A;  4EE0 A;  3BJ5 A;  1EOG A;  2H6Z A;  2MMA A;  5J41 A;  2R3X A;  2H75 A;  1SK0 A;  2OA7 A;  5IMC A;  5DQY A;  3F4S A;  3MDK A;  4MMM A;  3KCM A;  1K0C A;  2HSN B;  2L5O A;  2VL2 C;  5IMD A;  3UVH A;  1G6Y A;  3TOU A;  4G9H A;  2V1M A;  4G10 A;  2BJX A;  3HJO A;  2H19 A;  4YAV A;  2F9S A;  2GT5 A;  3ZFL A;  1ILO A;  2YNX A;  3P8W A;  5GAP D;  4ZB6 A;  4MJC A;  1JZR A;  2GST A;  5D8I A;  3NIV A;  3GRX A;  4ULX A;  1YEP A;  2DJ1 A;  1TK0 B;  1PMT A;  2FWG A;  2G2Q A;  3IAS 2;  1BAY A;  1R7H A;  1B9Y C;  4WR4 A;  4KDU A;  2FY6 A;  4XTS A;  4PNF A;  4WXT A;  2CV4 A;  1FW1 A;  5A4W A;  1N8J A;  2PWJ A;  4PNG A;  1ST9 A;  2HSM A;  3W8S A;  1MEK A;  2FA4 A;  2YWI A;  3ZIV A;  4MAB A;  2HZE A;  3CMI A;  3HYP A;  4ZIJ A;  1MTC A;  3TDG A;  4ACS A;  2PVQ A;  1K0D A;  2H0G A;  2PU9 C;  3LGC A;  1G7E A;  2GQM A;  3GL5 A;  1USB A;  4XS6 A;  2VLU A;  1MD3 A;  1MDI A;  1SL2 B;  1GLQ A;  2IMI A;  2I1U A;  1JZW A;  1B8X A;  2HXK A;  1PX6 A;  1HYU A;  1B4Q A;  3EC3 A;  2C3Q A;  2DJ3 A;  3RPN A;  2MMZ A;  1MDK A;  1XOA A;  3DIE A;  1E2Y A;  1GH2 A;  2O87 A;  5GST A;  1TI3 A;  5D9X A;  3WGE A;  3L9U A;  3SBC A;  5E4W A;  4ZB8 A;  1GTA A;  1EEM A;  2YWN A;  3GFK A;  1ML6 A;  13GS A;  3ZYW A;  3ED3 A;  2ES7 A;  1IYI A;  1NHO A;  16GS A;  2JZS A;  2R6K A;  4BVX B;  4NAX A;  3JCM L;  3H8Q A;  3UOM A;  4CDO A;  1ZYE A;  3F3Q A;  1ERV A;  4PX1 A;  4CHS A;  2JZT A;  1HQO A;  5HR1 A;  1VRS D;  4MDC A;  2HE3 A;  3ZVJ A;  2PGT A;  4HQZ A;  1UC7 A;  2L6C A;  1FB6 A;  2H0H A;  3U6V A;  1T7P B;  3AY8 A;  5H5S A;  1EZK A;  3Q19 A;  2VO4 A;  1SD9 A;  2LJK A;  1GSF A;  2PBJ A;  3LYP A;  4DSS A;  1YY7 A;  3F6F A;  4ZXG A;  1ZMA A;  5CYY A;  1XWC A;  3TB2 A;  5HR0 A;  4IHU A;  1GUM A;  4J57 E;  3KZQ A;  2KP1 A;  1H75 A;  9GSS A;  2A4V A;  1OC9 B;  3UAR A;  1FHE A;  4TKY A;  1BED A;  2YP6 A;  2E7P A;  2J9H A;  1A2J A;  2LV3 A;  5IOX A;  2NDO A;  2CZ2 A;  1X0R A;  3FYG A;  4NPB A;  4CW9 A;  1XOB A;  2DJ0 A;  2IMD A;  3VLN A;  4ZIL A;  3D4T A;  4OCF A;  3CXG A;  3G7J A;  2H0I A;  3TKS C;  1PN9 A;  3Q18 A;  5AIV A;  2AUV A;  1RW1 A;  4I97 A;  1JLW A;  3LXT A;  2P0G A;  1X9S B;  4N11 A;  2HZF A;  3D6I A;  4EUY A;  1A2L A;  2KLX A;  5HFG A;  2H71 A;  1X5D A;  2FCH A;  5ECQ B;  2H01 A;  3KGK A;  3GMF A;  1AQX A;  1EV9 A;  2VM1 A;  4TR3 A;  1QQ2 A;  5CAX A;  2X8H A;  1R26 A;  1DE1 A;  2GQL A;  3M3M A;  2WRT A;  3FZ4 A;  3N9J A;  2DMM A;  2XPD A;  1U3I A;  4HS1 A;  3H4K A;  4IJI A;  1V98 A;  2YWM A;  2LRT A;  3F9U A;  1ON4 A;  1O85 A;  3BD2 A;  3WT1 A;  1WP0 A;  3ZRE A;  5G1L A;  3O76 A;  3ERG A;  3DRN A;  5JWR B;  1SKW B;  1PKZ A;  1WWJ A;  2WS2 A;  2JU5 A;  4KCE A;  1DSB A;  4HU9 A;  3RDW A;  1HNB A;  5ELG A;  2JSZ A;  1O73 A;  5J4U A;  2LEG A;  4IW9 A;  2AHE A;  2FWH A;  1G6W A;  1ZGN A;  4JRR A;  3P90 A;  4PGT A;  1BJX A;  5J3R A;  1URM A;  2D2Z A;  3TJJ A;  2TRX A;  2FLS A;  1E6B A;  1Z9H A;  4I8B A;  5IM9 A;  3QR6 A;  5CRW A;  2H70 A;  3PR8 A;  1EWX A;  4TR4 A;  3APO A;  4LA1 A;  5DDL A;  5ECO B;  4N10 A;  2K6V A;  1AW9 A;  2NPB A;  1AQV A;  2HFD A;  1ZYQ B;  4GLT A;  4KH7 A;  4NHZ A;  8GSS A;  3LYK A;  3VWU A;  2RUF A;  1R5A A;  3FR9 A;  4MP4 A;  2JL4 A;  1TOF A;  4BWQ A;  3TKS A;  5HFI A;  2X64 A;  4BWS A;  4NMU A;  3KD0 A;  2JSY A;  4TXV A;  3DKS A;  2P5Q A;  1ERW A;  3VWV A;  4MPG A;  3L0H A;  11GS A;  4ZB9 A;  4KW6 A;  3EMP A;  1TTZ A;  2GT6 A;  2YZH A;  3ME7 A;  2HSM B;  1XBS A;  1NSW A;  4IEL A;  2CQ9 A;  4TR1 A;  5ECS A;  1TK5 B;  4IS0 A;  1YDK A;  2G0F A;  2HZE B;  1TI1 A;  3IPZ A;  4KE3 A;  4MCU A;  7GSS A;  4MF7 A;  4BVX A;  1OE7 A;  4BPY A;  2N5B A;  3KM6 A;  5KN2 A;  2VAF A;  3FZ9 A;  5FWG A;  2GZZ A;  4IN0 A;  3IBH A;  2C80 A;  1XW9 A;  3ZRD A;  1XFL A;  1BX9 A;  3TJK A;  2L57 A;  3UBK A;  1O6J A;  1OKT A;  4GQF A;  4N0V A;  19GS A;  1MD4 A;  2FUG 2;  2X8C A;  4POK A;  1XW6 A;  3A5W A;  4MJB A;  4HZ2 A;  2WJU A;  2LST A;  3PIN A;  5IO0 A;  3Q6O A;  3HJM A;  3IHQ A;  2B7K A;  4RQR A;  3TJG A;  1QUW A;  4K8M A;  2JAD A;  2CZ3 A;  1VF3 A;  2WFC A;  5B6N A;  4YQV A;  4F0B A;  3FR3 A;  1GUK A;  3FEU A;  4H86 A;  1PRX A;  2YV7 A;  3K8N A;  1WJK A;  2UZ8 A;  3J7Y b;  2FWE A;  5D73 A;  3KTL A;  5LD0 A;  4EC0 A;  1NW2 A;  3CTF A;  1BYE A;  3L9V A;  5DAL B;  4X0X A;  1DE2 A;  2KP2 A;  1X5C A;  4RQX A;  2O8V B;  4TRX A;  3QAG A;  1EP7 A;  2H74 A;  4N30 A;  2WGR A;  1WMJ A;  2ZCT A;  2B5Y A;  3IAM 2;  5JCW A;  2YN1 A;  3ZML A;  1TRS A;  4G0I A;  2MYG A;  1THX A;  1GNW A;  2GSR A;  1A24 A;  1FB0 A;  4GSS A;  3PH9 A;  2EC4 A;  5ECK B;  1M9A A;  4PUA A;  1PX7 A;  1FO5 A;  1T4Y A;  5CRD A;  3S9F A;  3A2V A;  3WT2 A;  4NV2 A;  4AF2 A;  5KN1 A;  1RK4 A;  1JLV A;  3MNG A;  3BCI A;  20GS A;  2N5F A;  3TRP A;  3PPU A;  3GV1 A;  3KP8 A;  4LL4 B;  2HRK A;  4IJ3 A;  2H1A A;  2VOC A;  4JR4 A;  4Q5R A;  1GNE A;  3GA4 A;  2GDR A;  4NXI A;  4K7O A;  2VCW A;  1PSQ A;  5D9T A;  4KGI A;  3L78 A;  2LJR A;  2K18 A;  4K7I A;  2LJA A;  2LS5 A;  5ELA A;  5CP1 A;  5F05 A;  3GKM A;  3FZ5 A;  2LRN A;  4JE1 A;  2VM2 A;  2NVL A;  5HQP A;  2HYX A;  2B5E A;  4GST A;  2MZC A;  4KCA A;  2B3S A;  3IK9 A;  3BCK A;  3E3E A;  4OFN A;  2F51 A;  2EIQ A;  1IYH A;  2CX3 A;  1M2A A;  3C1R A;  1NHY A;  3TGZ A;  3RPP A;  1S3C A;  5ECM B;  4TR0 A;  1EGR A;  4PQH A;  1F3A A;  3CBU A;  2HRF A;  3VFI A;  5HR3 A;  1M2B A;  3MSZ A;  3FW2 A;  1F37 A;  4POM A;  2DSA A;  2CX4 A;  2V2G A;  1ACV A;  5FHI A;  3APS A;  1AIU A;  1FVJ A;  2F3M A;  3IC8 A;  3UMA A;  5INY A;  3F0I A;  3UIW A;  12GS A;  3CRU A;  5F8B A;  4AGS A;  2B7J A;  4F9Z A;  2AV4 A;  2V6K A;  1WOU A;  3C73 A;  2XPE A;  2O89 A;  5DCG A;  1K0B A;  5ECR B;  2VCX A;  4GSN A;  1T1V A;  2EIR A;  3ZVJ D;  3US3 A;  1PA3 A;  2IJY A;  4LLR A;  3G7Y A;  4PQ1 A;  2OBK A;  4IVF A;  5JCU A;  1OC8 A;  2I9H A;  3APQ A;  3TKQ A;  4L8E A;  5D9W A;  4K9Z A;  1TU7 A;  4ZL8 A;  4K0N A;  5CRE A;  1VF1 A;  5IIZ A;  5EVO A;  1YQ1 A;  1SU9 A;  3EMX A;  2B1K A;  4XS1 A;  4JBB A;  3F3R A;  2C0E A;  3E9J B;  4HZ4 A;  2A2S A;  1QK8 A;  5H5Q A;  1X5E A;  2DIY A;  2YWO A;  5IMF A;  2GZY A;  5A4V A;  3KMN A;  3HCZ A;  3HVX A;  1JFU A;  2IME A;  3GTU A;  4XCS A;  4WF4 A;  2DLX A;  1LJR A;  1XPV A;  2C0G A;  1Y25 A;  2GLR A;  1T00 A;  4GRF A;  4TR1 B;  1XWB A;  2C8U A;  2HI7 A;  4BVY A;  4N0Z A;  1XWA A;  4KSM A;  2H76 A;  3HVS A;  2ZNM A;  2C0D A;  2TRC P;  3KXO A;  4ILF A;  1B9X C;  3GH9 A;  5IPG A;  3TJF A;  3QPM A;  2XBQ A;  2PUK C;  3EU4 A;  5DAL A;  2FGX A;  1SYX A;  1YKA A;  1HNC A;  2VIM A;  1YF1 A;  1SYR A;  4KX4 A;  1GTB A;  2REM A;  5CO3 A;  1WE0 A;  1XVQ A;  2GSS A;  3GX0 A;  1YZX A;  4I6X A;  2X99 A;  1XVW A;  1F3B A;  2YCD A;  4IGJ A;  4DSR A;  2C1Y A;  5F06 A;  3WD6 A;  2L6D A;  4OCE A;  2OBI A;  5GSS A;  3HZ4 A;  2VLV A;  3G7I A;  4YQM A;  4D73 A;  5JWO B;  2LNT A;  2XC2 A;  3M9K A;  1EOH A;  5ID2 B;  3ZIT A;  3FZA A;  1Q4J A;  5IMA A;  3DXB A;  1NM3 A;  2R4V A;  2IMK A;  3IXR A;  4KAE A;  3QFA C;  3WGX A;  5HR2 A;  3UL3 A;  2M80 A;  4GXZ A;  2VD1 A;  4ISD A;  5J5N A;  3HY2 A;  1TRV A;  1EGO A;  1U6T A;  3KMO A;  3EUR A;  4AJ7 A;  4MLY A;  2CVK A;  1K0O A;  1O8W A;  1OE8 A;  3DVX A;  4HI7 A;  2P5R A;  1K3L A;  2H1G A;  2I81 A;  2DJ2 A;  4ID0 A;  4K6X A;  3F4R A;  4MH3 A;  2WCI A;  1XXU A;  2WB9 A;  3QOU A;  5IMV A;  4MF6 A;  5DJM A;  2XHF A;  4EVM A;  1SD8 A;  3HDC A;  1I9D A;  1JZD A;  3TRQ A;  3OR5 A;  4F82 A;  3M9J A;  4YAP A;  1Z7R A;  3GST A;  1U88 A;  1FOV A;  3GN3 A;  4HEA 2;  3G9B A;  5ECN B;  3FY7 A;  3RHB A;  4MPF A;  3DYR A;  4FYB A;  4EKZ A;  2HRK B;  1FVK A;  3I43 A;  4P3Y B;  1GWC A;  5IMZ A;  1K0A A;  1PQN A;  1UA5 A;  4PQI A;  2DBC A;  5AGY A;  2CAQ A;  3GHA A;  2J23 A;  2V41 A;  1GP1 A;  3LQ7 A;  5BMU A;  4O5R A;  3TKS E;  1YKC A;  3M1G A;  1VF2 A;  3GL3 A;  3ERW A;  3I6A A;  5IO2 A;  1A0R P;  1GTU A;  5JCG A;  4WKW A;  1SKR B;  1TP9 A;  2QC7 A;  3IC4 A;  18GS A;  3GUR A;  5IQY A;  1M0U A;  4L0W A;  1K0M A;  3VPQ A;  2ZUP A;  1GSQ A;  3H1N A;  3CSH A;  5CRH A;  2K9F A;  1X9W B;  1AXD A;  3QMX A;  4IP1 A;  4WET A;  3A2W A;  2VUP A;  1ZZY A;  2E2M A;  1R5P A;  5DCH A;  4Z7X A;  3VI7 A;  1GUH A;  5D9V A;  1TK8 B;  4GCI A;  5KN3 A;  4KDX A;  1G7O A;  4ZBB A;  1TW9 A;  4DVC A;  1GTI A;  1Z6N A;  4YQU A;  3L4N A;  4IQ1 A;  2BMX A;  3ZTL A;  3GX8 A;  2NBS A;  2IFQ A;  3FK8 A;  1SK1 A;  1H4O A;  3EU3 A;  3U5R E;  1J0F A;  4POB A;  2DJJ A;  2YV9 A;  4K0G A;  1XZO A;  2C0F A;  4HU7 A;  4KND A;  2AAW A;  1PGT A;  5EY6 A;  3GYK A;  2LQO A;  4LMV A;  1UN2 A;  3C71 A;  3D4M A;  2L59 A;  1THO A;  4OO4 A;  2FNO A;  5J9B A;  3BBY A;  4ECI A;  3HKR A;  1SEN A;  6GSY A;  3WGD A;  4AJ8 A;  2MBT A;  3GTU B;  3W8J A;  3UEM A;  2I3Y A;  3GKN A;  5HFK A;  3QAW A;  5DVB A;  2L4C A;  5ID2 A;  3J7Y k;  2RLI A;  2PPT A;  3HZ8 A;  4BVY B;  3HXS A;  1K0N A;  3EE2 A;  4EDZ A; 
#chains in the Genus database with same CATH topology
 1OYJ A;  1SJI A;  1TRU A;  1QFN A;  3C8E A;  3DD3 A;  1XW5 A;  4ECJ A;  2ON5 A;  3TKP A;  4DSQ A;  2GZP A;  1O81 A;  3VI5 A;  2VL3 A;  1TJD A;  1AC1 A;  4OFM A;  4GDF A;  3QCP A;  5DJL A;  4PTS A;  5AIS A;  2FHE A;  5A1N B;  1GUL A;  2H1D A;  3LWA A;  3I69 A;  4GQC A;  1BG1 A;  5COH A;  4TW5 A;  5ECI B;  2VD0 A;  4L5L A;  2WW3 A;  3HJP A;  4MA9 A;  3PGT A;  2AYT A;  2H30 A;  5LCZ A;  5A5H A;  4ZL7 A;  3RFR C;  1KTE A;  4D73 B;  4O7H A;  3CWG A;  3MWH A;  2R5G A;  6GSX A;  1ZYP A;  2F8F A;  1Z6M A;  4V1A g;  5KEJ A;  5L71 A;  2FD3 A;  4HQS A;  2VLT A;  1A8L A;  1O7U A;  3HVN A;  3IR4 A;  1CQG A;  3C1S A;  4BL7 A;  1V2A A;  4RI6 A;  1XIY A;  4WBR D;  1SKS B;  4ZBD A;  3ISO A;  3RHC A;  5A4U A;  2IN3 A;  4J56 E;  4L0U A;  4N3Z A;  1ERT A;  3L9S A;  4XRA A;  5B6M A;  1KBN A;  1AUC A;  4LL1 B;  4G0K A;  4WR5 A;  2E2G A;  5G30 A;  4K5S A;  1TXU A;  2MMO A;  5A34 A;  2A2R A;  1GSD A;  3FR6 A;  3P2A A;  2KHP A;  4QMK A;  1PD2 1;  1WRY A;  3H93 A;  3D5J A;  1M9B A;  5EL8 A;  5AN1 A;  2OE0 A;  5G5E A;  3ZFB A;  4ZL9 A;  5F0G A;  3I9V 2;  2WW2 A;  3H79 A;  4MH2 A;  2H73 A;  1EEJ A;  4WBJ A;  4O92 A;  5G31 A;  4OD7 A;  2WZ9 A;  1M2D A;  3LEF A;  2AB6 A;  3VK9 A;  1TKD B;  2YZU A;  5B8B A;  2GGT A;  5C00 A;  1TDI A;  1XG8 A;  4QL9 A;  1YJ6 A;  2DC5 A;  1A0F A;  1G0T A;  5E59 A;  2DML A;  3NOF A;  2F8A A;  3KH7 A;  3TCO A;  2OE3 A;  3O6T A;  4YKF A;  1GRX A;  3VWX A;  4EIP A;  3UVT A;  4Q5N A;  3F63 A;  3A2X A;  4XS4 B;  3TKR A;  3QD9 A;  1OC3 A;  5BMU B;  2WW0 A;  4TXO B;  3D21 A;  5G2Z A;  1N2A A;  2CVD A;  1M3J A;  3GH6 A;  2YPM A;  5ECL B;  2JZR A;  5EPF A;  1W4V A;  2A2P A;  4GWR A;  2I4A A;  3P7X A;  4Q5Q A;  1Z5Y E;  5ECP B;  4Q5F A;  4MJA A;  2RUE A;  1WPI A;  3CSJ A;  5DQS A;  2GQK A;  4CY8 A;  1QGV A;  2KOK A;  1HNA A;  3E0U A;  5KOW A;  5FT3 A;  1PKW A;  1Y6E A;  2QGV A;  1XCC A;  4O32 A;  3RAZ A;  1JHB A;  2OT3 A;  2C3T A;  3VPT A;  4TVE A;  2B1L A;  2EIO A;  4IKH A;  3WYW A;  1A23 A;  4G01 A;  2PVO C;  2BTO T;  1B4P A;  1J08 A;  1ZYN A;  4IP6 A;  4IQA A;  5G1K A;  3UJ1 A;  4F2I A;  6GSV A;  5DAK A;  2H6X A;  1XWG A;  4E8E A;  5IPH A;  2VL9 A;  3TRX A;  2ALB A;  4ML6 A;  4I2T A;  2HSY A;  4V2L A;  4PI2 C;  3UAP A;  1W89 A;  2PN8 A;  2K8S A;  2C3N A;  3M8N A;  2LQQ A;  1V9W A;  1ERU A;  2IFQ B;  4JU5 A;  2VL2 A;  2ON7 A;  4KA0 A;  3LOR A;  3KTB A;  1OAZ A;  2MBS A;  4EXJ A;  4KF9 A;  3ZL5 A;  2OJL A;  3UBL A;  4BIK A;  5A1N A;  4HDE A;  1A8Y A;  2IMF A;  1F2E A;  3IRA A;  4K5R A;  2RM6 A;  2R2J A;  1AAZ A;  3ERF A;  1AQW A;  3QFB C;  3LFL A;  4AJ6 A;  3ZMK A;  1J9B A;  1HD2 A;  3CTG A;  3KP9 A;  2OAD A;  1Z7P A;  1SJ6 A;  2PER A;  5J4Y A;  3V1W A;  1F9M A;  1BQ7 A;  1WIK A;  3KIJ A;  4A5P A;  4I2U A;  5B7C A;  3GSS A;  4MZW A;  4RI7 A;  2CVB A;  3W6G A;  1GLP A;  3GUS A;  4FIW A;  3ZLP A;  3IE3 A;  2IL3 A;  5LNK e;  1EV4 A;  2LKU A;  2CT6 A;  6GSW A;  4HUA A;  2YJH A;  2WVZ A;  2DJK A;  3NZN A;  3DGQ A;  1K3Y A;  2H6Y A;  4F0C A;  2QSI A;  1QMV A;  2N5A A;  1F6M C;  1LBK A;  3LG6 A;  1GSU A;  3QDN A;  2M72 A;  1FG4 A;  4J2F A;  5G5F A;  5H5R A;  2O7K A;  4V2N A;  2YJ7 A;  1X9M B;  5A5H B;  3SWL A;  2X8G A;  2IPA A;  5KN0 A;  1YVL A;  3LJR A;  3LSZ A;  5D96 A;  2H66 A;  4V1A p;  2CA8 A;  3F6D A;  4HOJ A;  1VGL A;  2HSN A;  5GAN D;  2WDU A;  1SVO A;  4KDY A;  1KEB A;  5A5K A;  4PI0 C;  3EIN A;  6GSS A;  1R4W A;  2HNL A;  2O85 A;  4HSC X;  1SL0 B;  1ZL9 A;  2YAN A;  4HJ2 A;  3KH9 A;  4BL7 B;  2TIR A;  2HQT A;  2C4J A;  4ECB A;  4G2E A;  2R37 A;  5D93 A;  3Q74 A;  5KOX A;  1GSY A;  1QXH A;  3CSI A;  1ABA A;  2MMN A;  3IDV A;  3TU3 B;  1OVN A;  2VCT A;  3HA9 A;  4XS4 A;  3DWV A;  1KNG A;  1S3A A;  4MZB A;  2LRC A;  5A34 B;  1V40 A;  4TXO A;  1O8X A;  4EF0 A;  4PUR A;  1T4Z A;  3FRC A;  5J9C A;  2E0Q A;  3R3E A;  1Z3E A;  5AIX A;  3VWW A;  4XRD A;  3QAV A;  4GF0 A;  4FYC A;  3GKK A;  1CQH A;  3GNJ A;  5ENU A;  2GTU A;  22GS A;  4XHM A;  2VCV A;  2OAC A;  4PXO A;  1GSS A;  4FO5 A;  2HT9 A;  2IWT A;  3A3T A;  1DUG A;  2Z9S A;  2GVP A;  1ZOF A;  3TOT A;  4FH8 A;  3KEB A;  4ICY A;  2RM5 A;  2B6M A;  4JR6 A;  4JZQ A;  2H1B A;  2FWF A;  1V58 A;  4NWY A;  1M7T A;  1K3O A;  4OO5 A;  4ML1 A;  3EVI A;  2HRN A;  1TRW A;  3MAK A;  4L5O A;  4MF5 A;  4I5Q A;  3ZIJ A;  3O3T A;  4E8H A;  1YEX A;  1YF0 A;  2V32 A;  1S3D A;  1SL1 B;  5ABR A;  10GS A;  4OFT A;  4G0L A;  4QL7 A;  1PL2 A;  4G19 A;  5F07 A;  3D22 A;  2FA8 A;  4KB3 A;  1U87 A;  1TU8 A;  4IBP A;  1Y1U A;  2VCQ A;  3DML A;  3HHV A;  1BG5 A;  2M46 A;  3IV4 A;  4K7N A;  3CYN A;  3D0Z A;  3IK7 A;  4ZBA A;  3TUE A;  3IA1 A;  2HLS A;  4HJM A;  1LU4 A;  4EO3 A;  2P31 A;  3N5O A;  4RUV A;  3F8U A;  1C72 A;  4XIH A;  5B8A A;  3VUR A;  3M0F A;  2OE1 A;  1VF4 A;  1PFO A;  3FHK A;  2RII A;  1UVZ A;  4DEJ A;  4X1U A;  4FQU A;  1I5G A;  14GS A;  5GZZ B;  3R2Q A;  2LUS A;  2V6O A;  2HSH A;  2YOI A;  3KJY A;  4Z2R A;  4V2M A;  1T3B A;  1V57 A;  2GSQ A;  2WUL A;  5DAK B;  4OWY A;  2L4Q A;  2WVY A;  4EL1 A;  2UV8 G;  3HVV A;  2VCZ A;  5CRG A;  17GS A;  4OMV A;  4PUF C;  4TN8 A;  4NHW A;  2H1L A;  2XBI A;  4X43 A;  2B5X A;  1SJZ A;  4FXY P;  1Q98 A;  4KSO A;  5C04 A;  3EYT A;  1RQM A;  3DVW A;  2LTK A;  3HD5 A;  3ZZX A;  2PMT A;  4NV5 A;  6GSU A;  1OC9 A;  2JAC A;  2OKA A;  2LNS A;  1M3I A;  4F03 A;  2QKE A;  3TJB A;  5DBQ A;  3FMW A;  4KUN A;  3ME8 A;  1M99 A;  4AKI A;  3EWL A;  4EDY A;  1OKD A;  3LW9 A;  1JZO A;  3GKX A;  4K1F A;  3DEX A;  1MDJ A;  1GL8 A;  1DBY A;  2CAI A;  4MJE A;  6GST A;  1T8E B;  1A2M A;  1SK2 A;  3LXZ A;  3GIX A;  4MK3 A;  2K8V A;  2NTO A;  5JWQ B;  3C7M A;  3F4T A;  4WEY A;  4WF5 A;  2DIZ A;  3RGB C;  1B48 A;  2H8L A;  3IOS A;  3RBT A;  2L5L A;  4YH2 A;  4DSS B;  3FKF A;  4LMW A;  4QQ7 A;  4POL A;  1EP8 A;  1GSE A;  4JED A;  1TXX A;  1ZCP A;  2AJQ B;  4BA7 A;  2KUC A;  3CRT A;  2H72 A;  3BOA A;  4MZC A;  4EIQ A;  4ECC A;  4TOP A;  2DKH A;  2IIY A;  1FAA A;  4FYU A;  4K2D A;  4GTU A;  5ECH B;  1U3A A;  5CNW A;  5IOW A;  2GS3 A;  2HRA A;  4USS A;  1XWK A;  1PL1 A;  4EE0 A;  3BJ5 A;  1EOG A;  2H6Z A;  2MMA A;  5J41 A;  2R3X A;  2H75 A;  1SK0 A;  2OA7 A;  5IMC A;  5DQY A;  3F4S A;  3MDK A;  4MMM A;  3KCM A;  1K0C A;  2HSN B;  2L5O A;  2VL2 C;  5IMD A;  3UVH A;  1G6Y A;  3TOU A;  4G9H A;  2V1M A;  4G10 A;  2BJX A;  3HJO A;  2H19 A;  4YAV A;  2F9S A;  2GT5 A;  3ZFL A;  1ILO A;  2YNX A;  1YEW C;  3P8W A;  5GAP D;  4ZB6 A;  4MJC A;  1JZR A;  2GST A;  5D8I A;  3NIV A;  3GRX A;  4ULX A;  2O3E A;  1YEP A;  2DJ1 A;  1TK0 B;  1PMT A;  2FWG A;  2G2Q A;  3IAS 2;  1BAY A;  4ZB7 A;  1R7H A;  1B9Y C;  4WR4 A;  4KDU A;  2FY6 A;  4XTS A;  4PNF A;  2R0C A;  4WXT A;  2CV4 A;  1FW1 A;  5A4W A;  1N8J A;  2PWJ A;  4PNG A;  1ST9 A;  2HSM A;  3W8S A;  1MEK A;  2FA4 A;  2YWI A;  3ZIV A;  4MAB A;  2HZE A;  3CMI A;  2R0G A;  5J4V A;  3HYP A;  4ZIJ A;  1MTC A;  3TDG A;  4ACS A;  2PVQ A;  1K0D A;  2H0G A;  2PU9 C;  3LGC A;  1G7E A;  2GQM A;  3GL5 A;  1USB A;  4XS6 A;  2VLU A;  1MD3 A;  1MDI A;  1SL2 B;  1GLQ A;  2IMI A;  2I1U A;  1JZW A;  1B8X A;  2HXK A;  1PX6 A;  1HYU A;  1B4Q A;  3EC3 A;  2C3Q A;  2DJ3 A;  3RPN A;  2MMZ A;  1MDK A;  1XOA A;  3DIE A;  1E2Y A;  1GH2 A;  2O87 A;  5GST A;  1TI3 A;  5D9X A;  3WGE A;  3L9U A;  3SBC A;  5E4W A;  4ZB8 A;  3CHX C;  1GTA A;  1EEM A;  5J47 A;  2YWN A;  3GFK A;  1ML6 A;  13GS A;  3ZYW A;  3ED3 A;  2ES7 A;  1IYI A;  1NHO A;  16GS A;  2JZS A;  2R6K A;  4BVX B;  4NAX A;  3JCM L;  3H8Q A;  3UOM A;  4CDO A;  1ZYE A;  3F3Q A;  1ERV A;  4PX1 A;  4CHS A;  2JZT A;  1HQO A;  5HR1 A;  1VRS D;  4MDC A;  2HE3 A;  3ZVJ A;  2PGT A;  4HQZ A;  1UC7 A;  1SVM A;  1FB6 A;  2L6C A;  2H0H A;  3U6V A;  1T7P B;  3AY8 A;  5H5S A;  1EZK A;  3Q19 A;  2VO4 A;  3HMJ G;  1SD9 A;  2LJK A;  1GSF A;  2PBJ A;  3LYP A;  4DSS A;  1YY7 A;  3F6F A;  4ZXG A;  1ZMA A;  5CYY A;  1XWC A;  3TB2 A;  5HR0 A;  4IHU A;  1GUM A;  4J57 E;  3KZQ A;  2KP1 A;  1H75 A;  9GSS A;  2A4V A;  4AKH A;  1OC9 B;  3UAR A;  1FHE A;  4TKY A;  1BED A;  2YP6 A;  2E7P A;  2WVX B;  2J9H A;  1A2J A;  2LV3 A;  5IOX A;  2NDO A;  2CZ2 A;  1X0R A;  3FYG A;  4NPB A;  4CW9 A;  1XOB A;  2DJ0 A;  2IMD A;  3VLN A;  4ZIL A;  3D4T A;  4OCF A;  3CXG A;  3G7J A;  2H0I A;  3TKS C;  1PN9 A;  3Q18 A;  5AIV A;  2AUV A;  1RW1 A;  4I97 A;  1JLW A;  3LXT A;  2P0G A;  1X9S B;  4Z2U A;  4N11 A;  2HZF A;  3D6I A;  4EUY A;  1A2L A;  2KLX A;  5HFG A;  2H71 A;  1X5D A;  2FCH A;  5ECQ B;  2H01 A;  3KGK A;  3GMF A;  1AQX A;  1EV9 A;  2VM1 A;  4TR3 A;  1QQ2 A;  4O5Q A;  5CAX A;  2X8H A;  1R26 A;  1DE1 A;  2GQL A;  3M3M A;  2WRT A;  3FZ4 A;  3N9J A;  2DMM A;  2XPD A;  1U3I A;  4HS1 A;  1PN0 A;  3H4K A;  4IJI A;  1V98 A;  2YWM A;  2LRT A;  2EFH A;  3F9U A;  1ON4 A;  1O85 A;  3BD2 A;  3WT1 A;  1WP0 A;  3ZRE A;  5G1L A;  3O76 A;  3ERG A;  3DRN A;  5JWR B;  1SKW B;  1PKZ A;  1WWJ A;  2WS2 A;  2JU5 A;  4KCE A;  1DSB A;  2O36 A;  4HU9 A;  3RDW A;  1HNB A;  5ELG A;  2JSZ A;  1O73 A;  5J4U A;  2LEG A;  4IW9 A;  2AHE A;  2FWH A;  1G6W A;  1ZGN A;  4JRR A;  3P90 A;  4PGT A;  1BJX A;  5J3R A;  1URM A;  2D2Z A;  3TJJ A;  2TRX A;  2FLS A;  1E6B A;  1Z9H A;  4I8B A;  5IM9 A;  3QR6 A;  5CRW A;  2H70 A;  3PR8 A;  1EWX A;  4TR4 A;  3APO A;  4LA1 A;  5DDL A;  5ECO B;  4N10 A;  2K6V A;  1AW9 A;  2NPB A;  1AQV A;  2HFD A;  1ZYQ B;  4GLT A;  4KH7 A;  4NHZ A;  8GSS A;  3LYK A;  3VWU A;  2RUF A;  1R5A A;  3FR9 A;  4MP4 A;  2JL4 A;  1TOF A;  4BWQ A;  3TKS A;  5HFI A;  2X64 A;  4BWS A;  4NMU A;  3KD0 A;  2JSY A;  4TXV A;  3DKS A;  2P5Q A;  1ERW A;  3VWV A;  4MPG A;  3L0H A;  11GS A;  4ZB9 A;  4KW6 A;  3EMP A;  1TTZ A;  2GT6 A;  2YZH A;  3ME7 A;  3EPT A;  2HSM B;  1XBS A;  1NSW A;  4IEL A;  2CQ9 A;  4TR1 A;  5ECS A;  1TK5 B;  4IS0 A;  1YDK A;  2G0F A;  2HZE B;  1TI1 A;  2X4A A;  3IPZ A;  4KE3 A;  4MCU A;  7GSS A;  4MF7 A;  4BVX A;  1OE7 A;  4BPY A;  2N5B A;  3KM6 A;  5KN2 A;  2VAF A;  3FZ9 A;  5FWG A;  2A4H A;  2GZZ A;  4IN0 A;  3IBH A;  2C80 A;  1XW9 A;  3ZRD A;  1XFL A;  1BX9 A;  3TJK A;  2L57 A;  3UBK A;  1O6J A;  1OKT A;  4GQF A;  2VKZ G;  4N0V A;  19GS A;  1MD4 A;  2FUG 2;  2X8C A;  4POK A;  1XW6 A;  3A5W A;  4MJB A;  4HZ2 A;  2WJU A;  2LST A;  3PIN A;  5IO0 A;  3Q6O A;  3HJM A;  3IHQ A;  2B7K A;  4RQR A;  3TJG A;  1QUW A;  4K8M A;  2JAD A;  2CZ3 A;  1VF3 A;  2WFC A;  5B6N A;  4YQV A;  4F0B A;  3FR3 A;  1GUK A;  2WVX A;  3FEU A;  4H86 A;  1PRX A;  2YV7 A;  3K8N A;  1WJK A;  2UZ8 A;  3J7Y b;  2FWE A;  5D73 A;  3KTL A;  5LD0 A;  4EC0 A;  1NW2 A;  3CTF A;  1BYE A;  3L9V A;  1SVL A;  5DAL B;  4X0X A;  1DE2 A;  2KP2 A;  1X5C A;  4RQX A;  2O8V B;  4TRX A;  3QAG A;  1EP7 A;  2QA2 A;  2H74 A;  4N30 A;  2WGR A;  1WMJ A;  2ZCT A;  2B5Y A;  3IAM 2;  5JCW A;  2O5V A;  1N25 A;  2YN1 A;  4K2X A;  3ZML A;  1TRS A;  4G0I A;  2MYG A;  1THX A;  1GNW A;  2GSR A;  1A24 A;  4O5U A;  1FB0 A;  4GSS A;  3PH9 A;  2EC4 A;  5ECK B;  1M9A A;  4PUA A;  1PX7 A;  1FO5 A;  2X49 A;  1T4Y A;  5CRD A;  4MNN A;  3S9F A;  3A2V A;  3WT2 A;  4NV2 A;  4AF2 A;  5KN1 A;  1RK4 A;  1JLV A;  3MNG A;  3BCI A;  20GS A;  2N5F A;  3TRP A;  4W66 A;  3PPU A;  3GV1 A;  3KP8 A;  4LL4 B;  2HRK A;  4IJ3 A;  2H1A A;  2VOC A;  4JR4 A;  4Q5R A;  1GNE A;  3GA4 A;  2GDR A;  4NXI A;  4K7O A;  2VCW A;  1PSQ A;  5D9T A;  2EFE A;  4KGI A;  3L78 A;  2LJR A;  2K18 A;  4K7I A;  2LJA A;  2LS5 A;  5ELA A;  5CP1 A;  5F05 A;  3GKM A;  3FZ5 A;  2LRN A;  4JE1 A;  2VM2 A;  2NVL A;  5HQP A;  2HYX A;  2B5E A;  4GST A;  2MZC A;  4KCA A;  2B3S A;  3IK9 A;  3BCK A;  3E3E A;  4OFN A;  2F51 A;  2EIQ A;  1IYH A;  2EFD A;  2CX3 A;  1M2A A;  1S4B P;  3C1R A;  1NHY A;  3TGZ A;  3RPP A;  1S3C A;  1I1I P;  5ECM B;  4TR0 A;  2R0P A;  2QA1 A;  1EGR A;  4PQH A;  1F3A A;  3CBU A;  2HRF A;  3VFI A;  5HR3 A;  1M2B A;  3MSZ A;  3FW2 A;  1F37 A;  4POM A;  2DSA A;  2CX4 A;  2V2G A;  1ACV A;  5FHI A;  3APS A;  1AIU A;  1FVJ A;  2F3M A;  3IC8 A;  3UMA A;  4Z2T A;  5INY A;  3F0I A;  3UIW A;  12GS A;  3CRU A;  5F8B A;  4AGS A;  2B7J A;  4F9Z A;  2AV4 A;  2V6K A;  1WOU A;  3C73 A;  3MYD A;  2XPE A;  2O89 A;  5J40 A;  5DCG A;  1K0B A;  4E68 A;  5ECR B;  2VCX A;  4GSN A;  1T1V A;  2EIR A;  3ZVJ D;  3US3 A;  1PA3 A;  2IJY A;  4LLR A;  3G7Y A;  4PQ1 A;  2OBK A;  4IVF A;  5JCU A;  1OC8 A;  2I9H A;  3APQ A;  3TKQ A;  4L8E A;  5D9W A;  4K9Z A;  1TU7 A;  4ZL8 A;  4K0N A;  5CRE A;  1VF1 A;  5IIZ A;  5EVO A;  1YQ1 A;  1SU9 A;  3EMX A;  2B1K A;  4XS1 A;  4JBB A;  3F3R A;  2C0E A;  3E9J B;  4HZ4 A;  2A2S A;  1QK8 A;  5H5Q A;  1X5E A;  2DIY A;  2YWO A;  5IMF A;  2GZY A;  1FOH A;  4X4J A;  2EFC A;  5A4V A;  3KMN A;  3HCZ A;  3HVX A;  1JFU A;  2IME A;  3GTU A;  4XCS A;  3A5I A;  4AKX B;  5BRT A;  4WF4 A;  2DLX A;  1LJR A;  1XPV A;  2C0G A;  1Y25 A;  2GLR A;  1T00 A;  4GRF A;  4TR1 B;  1XWB A;  2C8U A;  2HI7 A;  4BVY A;  4N0Z A;  1XWA A;  4KSM A;  2H76 A;  3HVS A;  2ZNM A;  2C0D A;  2TRC P;  3KXO A;  4ILF A;  1B9X C;  3GH9 A;  5IPG A;  3TJF A;  3QPM A;  2XBQ A;  2PUK C;  3EU4 A;  5DAL A;  2FGX A;  1SYX A;  1YKA A;  1HNC A;  2VIM A;  1YF1 A;  4PHZ C;  1SYR A;  4KX4 A;  1GTB A;  2REM A;  5CO3 A;  1WE0 A;  1XVQ A;  2GSS A;  3GX0 A;  1YZX A;  4I6X A;  2X99 A;  3CQF A;  1XVW A;  1S3R A;  1F3B A;  2YCD A;  4IGJ A;  4DSR A;  2C1Y A;  5F06 A;  3WD6 A;  2L6D A;  4OCE A;  2OBI A;  5GSS A;  3HZ4 A;  2VLV A;  3G7I A;  4YQM A;  4D73 A;  5JWO B;  2LNT A;  2XC2 A;  3M9K A;  1EOH A;  5ID2 B;  3ZIT A;  3FZA A;  1Q4J A;  5IMA A;  3DXB A;  1NM3 A;  2R4V A;  2IMK A;  3IXR A;  4KAE A;  3QFA C;  3WGX A;  5HR2 A;  3UL3 A;  2M80 A;  4GXZ A;  2VD1 A;  4ISD A;  5J5N A;  3HY2 A;  1TRV A;  1EGO A;  1U6T A;  3KMO A;  3EUR A;  4AJ7 A;  4MLY A;  2CVK A;  1K0O A;  1O8W A;  1OE8 A;  3DVX A;  4HI7 A;  2P5R A;  1K3L A;  2H1G A;  2I81 A;  2DJ2 A;  4ID0 A;  4K6X A;  3F4R A;  4MH3 A;  2WCI A;  3IHG A;  2DKI A;  1XXU A;  2WB9 A;  3QOU A;  5IMV A;  4MF6 A;  5DJM A;  2XHF A;  4EVM A;  1SD8 A;  4CY6 A;  3HDC A;  1I9D A;  1JZD A;  3TRQ A;  3OR5 A;  4F82 A;  3M9J A;  4YAP A;  1Z7R A;  3GST A;  1U88 A;  1FOV A;  3GN3 A;  4HEA 2;  3G9B A;  5ECN B;  3FY7 A;  3RHB A;  4MPF A;  3DYR A;  4FYB A;  4EKZ A;  2HRK B;  1FVK A;  3I43 A;  4P3Y B;  1GWC A;  5IMZ A;  1K0A A;  1PQN A;  1UA5 A;  4PQI A;  2DBC A;  5AGY A;  2CAQ A;  3GHA A;  2J23 A;  2V41 A;  1GP1 A;  3LQ7 A;  2WW1 A;  5BMU A;  4O5R A;  3TKS E;  1YKC A;  3M1G A;  1VF2 A;  3GL3 A;  3ERW A;  3I6A A;  5IO2 A;  1A0R P;  1GTU A;  5JCG A;  4WKW A;  1SKR B;  1TP9 A;  2QC7 A;  3IC4 A;  18GS A;  3GUR A;  5IQY A;  1M0U A;  4L0W A;  1K0M A;  3VPQ A;  2ZUP A;  1GSQ A;  3H1N A;  3CSH A;  5CRH A;  2K9F A;  1X9W B;  1AXD A;  3QMX A;  4IP1 A;  4WET A;  3A2W A;  2VUP A;  1ZZY A;  2E2M A;  2WZS A;  1R5P A;  5DCH A;  4Z7X A;  3VI7 A;  1GUH A;  5D9V A;  1TK8 B;  4GCI A;  5KN3 A;  4KDX A;  1G7O A;  4ZBB A;  1TW9 A;  4DVC A;  1GTI A;  1Z6N A;  4YQU A;  3L4N A;  4IQ1 A;  2BMX A;  3ZTL A;  3GX8 A;  4AKG A;  2NBS A;  2IFQ A;  3FK8 A;  1SK1 A;  1H4O A;  3EU3 A;  3U5R E;  1J0F A;  4POB A;  2DJJ A;  3MIX A;  2YV9 A;  4K0G A;  1BF5 A;  1XZO A;  2C0F A;  4HU7 A;  4KND A;  2AAW A;  1PGT A;  5EY6 A;  3GYK A;  2LQO A;  4LMV A;  1UN2 A;  3C71 A;  3D4M A;  2L59 A;  1THO A;  4YKG A;  4OO4 A;  2FNO A;  5J9B A;  3BBY A;  4ECI A;  4AI6 A;  3HKR A;  1SEN A;  6GSY A;  3WGD A;  4AJ8 A;  2MBT A;  3GTU B;  3W8J A;  3UEM A;  2I3Y A;  3GKN A;  5HFK A;  3QAW A;  5DVB A;  2L4C A;  5ID2 A;  3J7Y k;  2RLI A;  2PPT A;  3HZ8 A;  4BVY B;  3HXS A;  1K0N A;  3EE2 A;  4EDZ A; 
#chains in the Genus database with same CATH homology
 1OYJ A;  1SJI A;  1TRU A;  1QFN A;  3C8E A;  3DD3 A;  1XW5 A;  4ECJ A;  2ON5 A;  3TKP A;  4DSQ A;  2GZP A;  1O81 A;  3VI5 A;  2VL3 A;  1TJD A;  1AC1 A;  4OFM A;  4GDF A;  3QCP A;  5DJL A;  4PTS A;  5AIS A;  2FHE A;  5A1N B;  1GUL A;  2H1D A;  3LWA A;  3I69 A;  4GQC A;  1BG1 A;  5COH A;  4TW5 A;  5ECI B;  2VD0 A;  4L5L A;  3HJP A;  4MA9 A;  3PGT A;  2AYT A;  2H30 A;  5LCZ A;  5A5H A;  4ZL7 A;  1KTE A;  4D73 B;  4O7H A;  3CWG A;  3MWH A;  2R5G A;  6GSX A;  1ZYP A;  2F8F A;  1Z6M A;  4V1A g;  5KEJ A;  5L71 A;  2FD3 A;  4HQS A;  2VLT A;  1A8L A;  1O7U A;  3IR4 A;  1CQG A;  3C1S A;  4BL7 A;  1V2A A;  4RI6 A;  1XIY A;  4WBR D;  1SKS B;  4ZBD A;  3ISO A;  3RHC A;  5A4U A;  2IN3 A;  4J56 E;  4L0U A;  4N3Z A;  1ERT A;  3L9S A;  4XRA A;  5B6M A;  1KBN A;  1AUC A;  4LL1 B;  4G0K A;  4WR5 A;  2E2G A;  5G30 A;  4K5S A;  1TXU A;  2MMO A;  5A34 A;  2A2R A;  1GSD A;  3FR6 A;  3P2A A;  2KHP A;  4QMK A;  1PD2 1;  1WRY A;  3H93 A;  3D5J A;  1M9B A;  5EL8 A;  5AN1 A;  2OE0 A;  5G5E A;  3ZFB A;  4ZL9 A;  5F0G A;  3I9V 2;  3H79 A;  4MH2 A;  2H73 A;  1EEJ A;  4WBJ A;  4O92 A;  5G31 A;  4OD7 A;  2WZ9 A;  1M2D A;  3LEF A;  2AB6 A;  3VK9 A;  1TKD B;  2YZU A;  5B8B A;  2GGT A;  5C00 A;  1TDI A;  4QL9 A;  1YJ6 A;  2DC5 A;  1A0F A;  1G0T A;  5E59 A;  2DML A;  3NOF A;  2F8A A;  3KH7 A;  3TCO A;  2OE3 A;  3O6T A;  4YKF A;  1GRX A;  3VWX A;  4EIP A;  3UVT A;  4Q5N A;  3F63 A;  3A2X A;  4XS4 B;  3TKR A;  3QD9 A;  1OC3 A;  5BMU B;  4TXO B;  3D21 A;  5G2Z A;  1N2A A;  2CVD A;  3GH6 A;  2YPM A;  5ECL B;  2JZR A;  5EPF A;  1W4V A;  2A2P A;  4GWR A;  2I4A A;  3P7X A;  4Q5Q A;  1Z5Y E;  5ECP B;  4Q5F A;  4MJA A;  2RUE A;  1WPI A;  3CSJ A;  5DQS A;  2GQK A;  4CY8 A;  1QGV A;  2KOK A;  1HNA A;  3E0U A;  5KOW A;  5FT3 A;  1PKW A;  1Y6E A;  2QGV A;  1XCC A;  4O32 A;  3RAZ A;  1JHB A;  2OT3 A;  2C3T A;  3VPT A;  4TVE A;  2B1L A;  2EIO A;  4IKH A;  3WYW A;  1A23 A;  4G01 A;  2PVO C;  2BTO T;  1B4P A;  1J08 A;  1ZYN A;  4IP6 A;  4IQA A;  5G1K A;  3UJ1 A;  4F2I A;  6GSV A;  5DAK A;  2H6X A;  1XWG A;  4E8E A;  5IPH A;  2VL9 A;  3TRX A;  2ALB A;  4ML6 A;  4I2T A;  2HSY A;  4V2L A;  3UAP A;  1W89 A;  2PN8 A;  2K8S A;  2C3N A;  3M8N A;  2LQQ A;  1V9W A;  1ERU A;  2IFQ B;  4JU5 A;  2VL2 A;  2ON7 A;  4KA0 A;  3LOR A;  3KTB A;  1OAZ A;  2MBS A;  4EXJ A;  4KF9 A;  3ZL5 A;  2OJL A;  3UBL A;  5A1N A;  4HDE A;  1A8Y A;  2IMF A;  1F2E A;  3IRA A;  4K5R A;  2RM6 A;  2R2J A;  1AAZ A;  3ERF A;  1AQW A;  3QFB C;  3LFL A;  4AJ6 A;  3ZMK A;  1J9B A;  1HD2 A;  3CTG A;  3KP9 A;  2OAD A;  1Z7P A;  1SJ6 A;  2PER A;  5J4Y A;  3V1W A;  1F9M A;  1BQ7 A;  1WIK A;  3KIJ A;  4A5P A;  4I2U A;  5B7C A;  3GSS A;  4MZW A;  4RI7 A;  2CVB A;  3W6G A;  1GLP A;  3GUS A;  4FIW A;  3ZLP A;  3IE3 A;  2IL3 A;  5LNK e;  1EV4 A;  2LKU A;  2CT6 A;  6GSW A;  4HUA A;  2YJH A;  2DJK A;  3NZN A;  3DGQ A;  1K3Y A;  2H6Y A;  4F0C A;  2QSI A;  1QMV A;  2N5A A;  1F6M C;  1LBK A;  3LG6 A;  1GSU A;  3QDN A;  2M72 A;  1FG4 A;  4J2F A;  5G5F A;  5H5R A;  2O7K A;  4V2N A;  2YJ7 A;  1X9M B;  5A5H B;  3SWL A;  2X8G A;  2IPA A;  5KN0 A;  1YVL A;  3LJR A;  3LSZ A;  5D96 A;  2H66 A;  4V1A p;  2CA8 A;  3F6D A;  4HOJ A;  1VGL A;  2HSN A;  5GAN D;  2WDU A;  1SVO A;  4KDY A;  1KEB A;  5A5K A;  3EIN A;  6GSS A;  1R4W A;  2HNL A;  2O85 A;  1SL0 B;  1ZL9 A;  2YAN A;  3KH9 A;  4HJ2 A;  4BL7 B;  2TIR A;  2HQT A;  2C4J A;  4ECB A;  4G2E A;  2R37 A;  5D93 A;  3Q74 A;  5KOX A;  1GSY A;  1QXH A;  3CSI A;  1ABA A;  2MMN A;  3IDV A;  3TU3 B;  1OVN A;  2VCT A;  3HA9 A;  4XS4 A;  3DWV A;  1KNG A;  1S3A A;  4MZB A;  2LRC A;  5A34 B;  1V40 A;  4TXO A;  1O8X A;  4EF0 A;  4PUR A;  1T4Z A;  3FRC A;  5J9C A;  2E0Q A;  3R3E A;  1Z3E A;  5AIX A;  3VWW A;  4XRD A;  3QAV A;  4GF0 A;  4FYC A;  3GKK A;  1CQH A;  3GNJ A;  5ENU A;  2GTU A;  22GS A;  4XHM A;  2VCV A;  2OAC A;  4PXO A;  1GSS A;  4FO5 A;  2HT9 A;  2IWT A;  3A3T A;  1DUG A;  2Z9S A;  2GVP A;  1ZOF A;  3TOT A;  4FH8 A;  3KEB A;  4ICY A;  2RM5 A;  2B6M A;  4JR6 A;  4JZQ A;  2H1B A;  2FWF A;  1V58 A;  4NWY A;  1M7T A;  1K3O A;  4OO5 A;  4ML1 A;  3EVI A;  2HRN A;  1TRW A;  3MAK A;  4L5O A;  4MF5 A;  4I5Q A;  3ZIJ A;  3O3T A;  4E8H A;  1YEX A;  1YF0 A;  2V32 A;  1S3D A;  1SL1 B;  5ABR A;  10GS A;  4OFT A;  4G0L A;  4QL7 A;  1PL2 A;  4G19 A;  5F07 A;  3D22 A;  2FA8 A;  4KB3 A;  1U87 A;  1TU8 A;  4IBP A;  1Y1U A;  2VCQ A;  3DML A;  3HHV A;  1BG5 A;  2M46 A;  3IV4 A;  4K7N A;  3CYN A;  3D0Z A;  3IK7 A;  4ZBA A;  3TUE A;  3IA1 A;  2HLS A;  4HJM A;  1LU4 A;  4EO3 A;  2P31 A;  3N5O A;  4RUV A;  3F8U A;  1C72 A;  4XIH A;  5B8A A;  3VUR A;  3M0F A;  2OE1 A;  1VF4 A;  3FHK A;  2RII A;  1UVZ A;  4DEJ A;  4X1U A;  4FQU A;  1I5G A;  14GS A;  5GZZ B;  3R2Q A;  2LUS A;  2V6O A;  2HSH A;  2YOI A;  3KJY A;  4Z2R A;  4V2M A;  1T3B A;  1V57 A;  2GSQ A;  2WUL A;  5DAK B;  4OWY A;  2L4Q A;  4EL1 A;  2UV8 G;  3HVV A;  2VCZ A;  5CRG A;  17GS A;  4OMV A;  4PUF C;  4TN8 A;  4NHW A;  2H1L A;  2XBI A;  4X43 A;  2B5X A;  1SJZ A;  1Q98 A;  4KSO A;  5C04 A;  3EYT A;  1RQM A;  3DVW A;  2LTK A;  3HD5 A;  3ZZX A;  2PMT A;  4NV5 A;  6GSU A;  1OC9 A;  2JAC A;  2OKA A;  2LNS A;  4F03 A;  2QKE A;  3TJB A;  5DBQ A;  3FMW A;  4KUN A;  3ME8 A;  1M99 A;  4AKI A;  3EWL A;  4EDY A;  1OKD A;  3LW9 A;  1JZO A;  3GKX A;  4K1F A;  3DEX A;  1MDJ A;  1GL8 A;  1DBY A;  2CAI A;  4MJE A;  6GST A;  1T8E B;  1A2M A;  1SK2 A;  3LXZ A;  3GIX A;  4MK3 A;  2K8V A;  2NTO A;  5JWQ B;  3C7M A;  3F4T A;  4WEY A;  4WF5 A;  2DIZ A;  1B48 A;  2H8L A;  3IOS A;  3RBT A;  2L5L A;  4YH2 A;  4DSS B;  3FKF A;  4LMW A;  4QQ7 A;  4POL A;  1EP8 A;  1GSE A;  4JED A;  1TXX A;  1ZCP A;  2AJQ B;  4BA7 A;  2KUC A;  3CRT A;  2H72 A;  3BOA A;  4MZC A;  4EIQ A;  4ECC A;  4TOP A;  2DKH A;  2IIY A;  1FAA A;  4FYU A;  4K2D A;  4GTU A;  5ECH B;  1U3A A;  5CNW A;  5IOW A;  2GS3 A;  2HRA A;  4USS A;  1XWK A;  1PL1 A;  4EE0 A;  3BJ5 A;  1EOG A;  2H6Z A;  2MMA A;  5J41 A;  2R3X A;  2H75 A;  1SK0 A;  2OA7 A;  5IMC A;  5DQY A;  3F4S A;  3MDK A;  4MMM A;  3KCM A;  1K0C A;  2HSN B;  2L5O A;  2VL2 C;  5IMD A;  3UVH A;  1G6Y A;  3TOU A;  4G9H A;  2V1M A;  4G10 A;  2BJX A;  3HJO A;  2H19 A;  4YAV A;  2F9S A;  2GT5 A;  3ZFL A;  1ILO A;  2YNX A;  3P8W A;  5GAP D;  4ZB6 A;  4MJC A;  1JZR A;  2GST A;  5D8I A;  3NIV A;  3GRX A;  4ULX A;  1YEP A;  2DJ1 A;  1TK0 B;  1PMT A;  2FWG A;  2G2Q A;  3IAS 2;  1BAY A;  4ZB7 A;  1R7H A;  1B9Y C;  4WR4 A;  4KDU A;  2FY6 A;  4XTS A;  4PNF A;  2R0C A;  4WXT A;  2CV4 A;  1FW1 A;  5A4W A;  1N8J A;  2PWJ A;  4PNG A;  1ST9 A;  2HSM A;  3W8S A;  1MEK A;  2FA4 A;  2YWI A;  3ZIV A;  4MAB A;  2HZE A;  3CMI A;  2R0G A;  5J4V A;  3HYP A;  4ZIJ A;  1MTC A;  3TDG A;  4ACS A;  2PVQ A;  1K0D A;  2H0G A;  2PU9 C;  3LGC A;  1G7E A;  2GQM A;  3GL5 A;  1USB A;  4XS6 A;  2VLU A;  1MD3 A;  1MDI A;  1SL2 B;  1GLQ A;  2IMI A;  2I1U A;  1JZW A;  1B8X A;  2HXK A;  1PX6 A;  1HYU A;  1B4Q A;  3EC3 A;  2C3Q A;  2DJ3 A;  3RPN A;  2MMZ A;  1MDK A;  1XOA A;  3DIE A;  1E2Y A;  1GH2 A;  2O87 A;  5GST A;  1TI3 A;  5D9X A;  3WGE A;  3L9U A;  3SBC A;  5E4W A;  4ZB8 A;  1GTA A;  1EEM A;  5J47 A;  2YWN A;  3GFK A;  1ML6 A;  13GS A;  3ZYW A;  3ED3 A;  2ES7 A;  1IYI A;  1NHO A;  16GS A;  2JZS A;  2R6K A;  4BVX B;  4NAX A;  3JCM L;  3H8Q A;  3UOM A;  4CDO A;  1ZYE A;  3F3Q A;  1ERV A;  4PX1 A;  4CHS A;  2JZT A;  1HQO A;  5HR1 A;  1VRS D;  4MDC A;  2HE3 A;  3ZVJ A;  2PGT A;  4HQZ A;  1UC7 A;  1SVM A;  1FB6 A;  2L6C A;  2H0H A;  3U6V A;  1T7P B;  3AY8 A;  5H5S A;  1EZK A;  3Q19 A;  2VO4 A;  3HMJ G;  1SD9 A;  2LJK A;  1GSF A;  2PBJ A;  3LYP A;  4DSS A;  1YY7 A;  3F6F A;  4ZXG A;  1ZMA A;  5CYY A;  1XWC A;  3TB2 A;  5HR0 A;  4IHU A;  1GUM A;  4J57 E;  3KZQ A;  2KP1 A;  1H75 A;  9GSS A;  2A4V A;  4AKH A;  1OC9 B;  3UAR A;  1FHE A;  4TKY A;  1BED A;  2YP6 A;  2E7P A;  2J9H A;  1A2J A;  2LV3 A;  5IOX A;  2NDO A;  2CZ2 A;  1X0R A;  3FYG A;  4NPB A;  4CW9 A;  1XOB A;  2DJ0 A;  2IMD A;  3VLN A;  4ZIL A;  3D4T A;  4OCF A;  3CXG A;  3G7J A;  2H0I A;  3TKS C;  1PN9 A;  3Q18 A;  5AIV A;  2AUV A;  1RW1 A;  4I97 A;  1JLW A;  3LXT A;  2P0G A;  1X9S B;  4Z2U A;  4N11 A;  2HZF A;  3D6I A;  4EUY A;  1A2L A;  2KLX A;  5HFG A;  2H71 A;  1X5D A;  2FCH A;  5ECQ B;  2H01 A;  3KGK A;  3GMF A;  1AQX A;  1EV9 A;  2VM1 A;  4TR3 A;  1QQ2 A;  4O5Q A;  5CAX A;  2X8H A;  1R26 A;  1DE1 A;  2GQL A;  3M3M A;  2WRT A;  3FZ4 A;  3N9J A;  2DMM A;  2XPD A;  1U3I A;  4HS1 A;  1PN0 A;  3H4K A;  4IJI A;  1V98 A;  2YWM A;  2LRT A;  2EFH A;  3F9U A;  1ON4 A;  1O85 A;  3BD2 A;  3WT1 A;  1WP0 A;  3ZRE A;  5G1L A;  3O76 A;  3ERG A;  3DRN A;  5JWR B;  1SKW B;  1PKZ A;  1WWJ A;  2WS2 A;  2JU5 A;  4KCE A;  1DSB A;  4HU9 A;  3RDW A;  1HNB A;  5ELG A;  2JSZ A;  1O73 A;  5J4U A;  2LEG A;  4IW9 A;  2AHE A;  2FWH A;  1G6W A;  1ZGN A;  4JRR A;  3P90 A;  4PGT A;  1BJX A;  5J3R A;  1URM A;  2D2Z A;  3TJJ A;  2TRX A;  2FLS A;  1E6B A;  1Z9H A;  4I8B A;  5IM9 A;  3QR6 A;  5CRW A;  2H70 A;  3PR8 A;  1EWX A;  4TR4 A;  3APO A;  4LA1 A;  5DDL A;  5ECO B;  4N10 A;  2K6V A;  1AW9 A;  2NPB A;  1AQV A;  2HFD A;  1ZYQ B;  4GLT A;  4KH7 A;  4NHZ A;  8GSS A;  3LYK A;  3VWU A;  2RUF A;  1R5A A;  3FR9 A;  4MP4 A;  2JL4 A;  1TOF A;  4BWQ A;  3TKS A;  5HFI A;  2X64 A;  4BWS A;  4NMU A;  3KD0 A;  2JSY A;  4TXV A;  3DKS A;  2P5Q A;  1ERW A;  3VWV A;  4MPG A;  3L0H A;  11GS A;  4ZB9 A;  4KW6 A;  3EMP A;  1TTZ A;  2GT6 A;  2YZH A;  3ME7 A;  3EPT A;  2HSM B;  1XBS A;  1NSW A;  4IEL A;  2CQ9 A;  4TR1 A;  5ECS A;  1TK5 B;  4IS0 A;  1YDK A;  2G0F A;  2HZE B;  1TI1 A;  2X4A A;  3IPZ A;  4KE3 A;  4MCU A;  7GSS A;  4MF7 A;  4BVX A;  1OE7 A;  4BPY A;  2N5B A;  3KM6 A;  5KN2 A;  2VAF A;  3FZ9 A;  5FWG A;  2A4H A;  2GZZ A;  4IN0 A;  3IBH A;  2C80 A;  1XW9 A;  3ZRD A;  1XFL A;  1BX9 A;  3TJK A;  2L57 A;  3UBK A;  1O6J A;  1OKT A;  4GQF A;  2VKZ G;  4N0V A;  19GS A;  1MD4 A;  2FUG 2;  2X8C A;  4POK A;  1XW6 A;  3A5W A;  4MJB A;  4HZ2 A;  2WJU A;  2LST A;  3PIN A;  5IO0 A;  3Q6O A;  3HJM A;  3IHQ A;  2B7K A;  4RQR A;  3TJG A;  1QUW A;  4K8M A;  2JAD A;  2CZ3 A;  1VF3 A;  2WFC A;  5B6N A;  4YQV A;  4F0B A;  3FR3 A;  1GUK A;  3FEU A;  4H86 A;  1PRX A;  2YV7 A;  3K8N A;  1WJK A;  2UZ8 A;  3J7Y b;  2FWE A;  5D73 A;  3KTL A;  5LD0 A;  4EC0 A;  1NW2 A;  3CTF A;  1BYE A;  3L9V A;  1SVL A;  5DAL B;  4X0X A;  1DE2 A;  2KP2 A;  1X5C A;  4RQX A;  2O8V B;  4TRX A;  3QAG A;  1EP7 A;  2QA2 A;  2H74 A;  4N30 A;  2WGR A;  1WMJ A;  2ZCT A;  2B5Y A;  3IAM 2;  5JCW A;  2O5V A;  1N25 A;  2YN1 A;  4K2X A;  3ZML A;  1TRS A;  4G0I A;  2MYG A;  1THX A;  1GNW A;  2GSR A;  1A24 A;  4O5U A;  1FB0 A;  4GSS A;  3PH9 A;  2EC4 A;  5ECK B;  1M9A A;  4PUA A;  1PX7 A;  1FO5 A;  2X49 A;  1T4Y A;  5CRD A;  4MNN A;  3S9F A;  3A2V A;  3WT2 A;  4NV2 A;  4AF2 A;  5KN1 A;  1RK4 A;  1JLV A;  3MNG A;  3BCI A;  20GS A;  2N5F A;  3TRP A;  4W66 A;  3PPU A;  3GV1 A;  3KP8 A;  4LL4 B;  2HRK A;  4IJ3 A;  2H1A A;  2VOC A;  4JR4 A;  4Q5R A;  1GNE A;  3GA4 A;  2GDR A;  4NXI A;  4K7O A;  2VCW A;  1PSQ A;  5D9T A;  2EFE A;  4KGI A;  3L78 A;  2LJR A;  2K18 A;  4K7I A;  2LJA A;  2LS5 A;  5ELA A;  5CP1 A;  5F05 A;  3GKM A;  3FZ5 A;  2LRN A;  4JE1 A;  2VM2 A;  2NVL A;  5HQP A;  2HYX A;  2B5E A;  4GST A;  2MZC A;  4KCA A;  2B3S A;  3IK9 A;  3BCK A;  3E3E A;  4OFN A;  2F51 A;  2EIQ A;  1IYH A;  2EFD A;  2CX3 A;  1M2A A;  3C1R A;  1NHY A;  3TGZ A;  3RPP A;  1S3C A;  5ECM B;  4TR0 A;  2R0P A;  2QA1 A;  1EGR A;  4PQH A;  1F3A A;  3CBU A;  2HRF A;  3VFI A;  5HR3 A;  1M2B A;  3MSZ A;  3FW2 A;  1F37 A;  4POM A;  2DSA A;  2CX4 A;  2V2G A;  1ACV A;  5FHI A;  3APS A;  1AIU A;  1FVJ A;  2F3M A;  3IC8 A;  3UMA A;  4Z2T A;  5INY A;  3F0I A;  3UIW A;  12GS A;  3CRU A;  5F8B A;  4AGS A;  2B7J A;  4F9Z A;  2AV4 A;  2V6K A;  1WOU A;  3C73 A;  3MYD A;  2XPE A;  2O89 A;  5J40 A;  5DCG A;  1K0B A;  4E68 A;  5ECR B;  2VCX A;  4GSN A;  1T1V A;  2EIR A;  3ZVJ D;  3US3 A;  1PA3 A;  2IJY A;  4LLR A;  3G7Y A;  4PQ1 A;  2OBK A;  4IVF A;  5JCU A;  1OC8 A;  2I9H A;  3APQ A;  3TKQ A;  4L8E A;  5D9W A;  4K9Z A;  1TU7 A;  4ZL8 A;  4K0N A;  5CRE A;  1VF1 A;  5IIZ A;  5EVO A;  1YQ1 A;  1SU9 A;  3EMX A;  2B1K A;  4XS1 A;  4JBB A;  3F3R A;  2C0E A;  3E9J B;  4HZ4 A;  2A2S A;  1QK8 A;  5H5Q A;  1X5E A;  2DIY A;  2YWO A;  5IMF A;  2GZY A;  1FOH A;  4X4J A;  2EFC A;  5A4V A;  3KMN A;  3HCZ A;  3HVX A;  1JFU A;  2IME A;  3GTU A;  4XCS A;  3A5I A;  4AKX B;  5BRT A;  4WF4 A;  2DLX A;  1LJR A;  1XPV A;  2C0G A;  1Y25 A;  2GLR A;  1T00 A;  4GRF A;  4TR1 B;  1XWB A;  2C8U A;  2HI7 A;  4BVY A;  4N0Z A;  1XWA A;  4KSM A;  2H76 A;  3HVS A;  2ZNM A;  2C0D A;  2TRC P;  3KXO A;  4ILF A;  1B9X C;  3GH9 A;  5IPG A;  3TJF A;  3QPM A;  2XBQ A;  2PUK C;  3EU4 A;  5DAL A;  2FGX A;  1SYX A;  1YKA A;  1HNC A;  2VIM A;  1YF1 A;  1SYR A;  4KX4 A;  1GTB A;  2REM A;  5CO3 A;  1WE0 A;  1XVQ A;  2GSS A;  3GX0 A;  1YZX A;  4I6X A;  2X99 A;  1XVW A;  1F3B A;  2YCD A;  4IGJ A;  4DSR A;  2C1Y A;  5F06 A;  3WD6 A;  2L6D A;  4OCE A;  2OBI A;  5GSS A;  3HZ4 A;  2VLV A;  3G7I A;  4YQM A;  4D73 A;  5JWO B;  2LNT A;  2XC2 A;  3M9K A;  1EOH A;  5ID2 B;  3ZIT A;  3FZA A;  1Q4J A;  5IMA A;  3DXB A;  1NM3 A;  2R4V A;  2IMK A;  3IXR A;  4KAE A;  3QFA C;  3WGX A;  5HR2 A;  3UL3 A;  2M80 A;  4GXZ A;  2VD1 A;  4ISD A;  5J5N A;  3HY2 A;  1TRV A;  1EGO A;  1U6T A;  3KMO A;  3EUR A;  4AJ7 A;  4MLY A;  2CVK A;  1K0O A;  1O8W A;  1OE8 A;  3DVX A;  4HI7 A;  2P5R A;  1K3L A;  2H1G A;  2I81 A;  2DJ2 A;  4ID0 A;  4K6X A;  3F4R A;  4MH3 A;  2WCI A;  3IHG A;  2DKI A;  1XXU A;  2WB9 A;  3QOU A;  5IMV A;  4MF6 A;  5DJM A;  2XHF A;  4EVM A;  1SD8 A;  4CY6 A;  3HDC A;  1I9D A;  1JZD A;  3TRQ A;  3OR5 A;  4F82 A;  3M9J A;  4YAP A;  1Z7R A;  3GST A;  1U88 A;  1FOV A;  3GN3 A;  4HEA 2;  3G9B A;  5ECN B;  3FY7 A;  3RHB A;  4MPF A;  3DYR A;  4FYB A;  4EKZ A;  2HRK B;  1FVK A;  3I43 A;  4P3Y B;  1GWC A;  5IMZ A;  1K0A A;  1PQN A;  1UA5 A;  4PQI A;  2DBC A;  5AGY A;  2CAQ A;  3GHA A;  2J23 A;  2V41 A;  1GP1 A;  3LQ7 A;  5BMU A;  4O5R A;  3TKS E;  1YKC A;  3M1G A;  1VF2 A;  3GL3 A;  3ERW A;  3I6A A;  5IO2 A;  1A0R P;  1GTU A;  5JCG A;  4WKW A;  1SKR B;  1TP9 A;  2QC7 A;  3IC4 A;  18GS A;  3GUR A;  5IQY A;  1M0U A;  4L0W A;  1K0M A;  3VPQ A;  2ZUP A;  1GSQ A;  3H1N A;  3CSH A;  5CRH A;  2K9F A;  1X9W B;  1AXD A;  3QMX A;  4IP1 A;  4WET A;  3A2W A;  2VUP A;  1ZZY A;  2E2M A;  1R5P A;  5DCH A;  4Z7X A;  3VI7 A;  1GUH A;  5D9V A;  1TK8 B;  4GCI A;  5KN3 A;  4KDX A;  1G7O A;  4ZBB A;  1TW9 A;  4DVC A;  1GTI A;  1Z6N A;  4YQU A;  3L4N A;  4IQ1 A;  2BMX A;  3ZTL A;  3GX8 A;  4AKG A;  2NBS A;  2IFQ A;  3FK8 A;  1SK1 A;  1H4O A;  3EU3 A;  3U5R E;  1J0F A;  4POB A;  2DJJ A;  3MIX A;  2YV9 A;  4K0G A;  1BF5 A;  1XZO A;  2C0F A;  4HU7 A;  4KND A;  2AAW A;  1PGT A;  5EY6 A;  3GYK A;  2LQO A;  4LMV A;  1UN2 A;  3C71 A;  3D4M A;  2L59 A;  1THO A;  4YKG A;  4OO4 A;  2FNO A;  5J9B A;  3BBY A;  4ECI A;  4AI6 A;  3HKR A;  1SEN A;  6GSY A;  3WGD A;  4AJ8 A;  2MBT A;  3GTU B;  3W8J A;  3UEM A;  2I3Y A;  3GKN A;  5HFK A;  3QAW A;  5DVB A;  2L4C A;  5ID2 A;  3J7Y k;  2RLI A;  2PPT A;  3HZ8 A;  4BVY B;  3HXS A;  1K0N A;  3EE2 A;  4EDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...