1GO2A

Structure of ferredoxin-nadp+ reductase with lys 72 replaced by glu (k72e)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGEPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1go2A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1go2A02
1G7TA 3LRXA 1VQKB 1EFCA 1KK3A 3VO1A 2VNKA 3OW2B 3WXMA 1QG0A 1YHQB 4AF7A 1D8TA 1VQ4B 2OK7A 1VQ8B 2VNIA 2B7BA 3JQRA 4ZV4A 1VQLB 4YAUA 3CCEB 3CC4B 3WYAA 1S72B 1QFJA 4Y9RA 3VMFA 1FNDA 1EP3B 1N8RD 3CMEB 1WDTA 2YWHA 1B23P 4TMTA 3JQPA 3LO8A 2QTZA 3G6EB 2QTLA 5GV7A 2VNHA 1VQMB 1Q81D 3WNBA 3CC2B 2OTJB 1GR1A 3W5VA 1SM4A 3OZWA 4QHYA 1KRHA 4HE5A 3OJXA 3AVYA 1ZM3A 1QVFB 4RCZA 2BVNA 2AHOA 4DQLA 1XE1A 1Q7YD 1QVGB 3B8HA 4M4SA 2OTLB 1W34A 3CCQB 4ACBA 2XNJA 3CCUB 1BJKA 3I56B 1KTVA 4RD1A 1K73D 1K8AD 4K1XA 2QA4B 2E1RA 2BGIA 2NPFA 3AVWA 1QX4A 2PLFA 3ZC3A 2B5OA 3CCLB 2YWEA 3QFCA 4RD2A 3WNCA 4ZGNB 1DDIA 3ZZ0A 1GAWA 3CXCB 1G7RA 4C43A 1JA0A 3ZZTA 1N0VC 2DETA 1XB2A 2GPJA 1VQ6B 4G1VA 4H9GA 3W2IA 1G7CA 1ELOA 2QN6A 4Y9UA 4TN1A 1EFUA 4PC7A 3MCAA 5H59A 2VNJA 2R6HA 4B3XA 3AVXA 4BPRA 4MYTA 2XEXA 1CNFA 1FDRA 1TLLA 3W2FA 4U9UA 1OGIA 1E63A 2YWGA 1GAQA 4P6VF 1KK0A 1EP2B 3MHPA 3VNVA 1R5NA 1DG1G 5JBQA 1IJEA 3ZZUA 1M90D 2PIAA 4B43A 3P26A 3CRZA 5EMNA 1F20A 4ZGQB 2CRVA 3WY9A 1F60A 2B7CA 4NBSA 4PC1A 2BSAA 3ZBUA 5THXA 4AF6A 1AIPA 4B48A 4P3YA 3U6BA 3CPWB 1I7PA 4TMXA 3I1FA 3ES9A 3CCSB 5GV8A 4FWTA 4M2LA 1H85A 3U6KA 1CNEA 3CB4A 4PC3A 5TY0A 3W2HA 2OK8A 3W5UA 3QE2A 2QDXA 3W5HA 1BQEA 3CCRB 4UAJA 2BV3A 1YI2B 1R5OA 4RD0A 3V76A 1JNYA 2BM0A 2DCUA 2EIXA 4ZCLA 4M0LA 4R71A 1FNCA 5HXBA 4N3NA 1KD1D 5TV2A 1J9ZA 2J7KA 1FRQA 3U2QA 3A1FA 3VO2A 2BMWA 1FNMA 3AGQA 1TUIA 4FN5A 1TVCA 3AGPA 3G4SB 1QUFA 4B44A 1FRNA 1FNBA 4PC6A 4RCYA 1KQSB 1EXMA 4RJLA 5AN9A 1GO2A 4YAOA 2FX3A 1K9MD 4PGOA 2RC6A 4LBYA 1M1KD 2C77A 1SKQA 3E20A 3P27A 2PMDA 4LBVA 2CNDA 1G7SA 4LBWA 3LYUA 4Q7JB 3WBJA 3CMAB 1UMKA 2DEUA 1S0UA 1EP1B 4C0SA 3B78A 4B47A 1TTTA 4ACAA 1NDHA 1Q82D 1EWYA 4YAFA 2X3UA 1GJRA 1D2EA 3QFRA 1N0UA 4MYUA 2GQFA 3AVVA 2RC5A 1KK2A 1D1NA 1KK1A 1QGAA 4WQMA 1BX1A 3CCMB 4M53A 3FJOA 1OGJA 4G1BA 4IW3B 4B4DA 3CCVB 1YJWB 1QFZA 3WNDA 1KJZA 3E1YE 2D74A 5KSWB 4EH1A 4LBZA 1B2RA 4G5GA 2EFGA 3SJZA 5TR9A 3PENA 3G71B 1QUEA 2YWFA 1U2RA 3QSYA 1OB2A 1ZM4A 2BGJA 4YHBA 5FA6A 1JB9A 1VQPB 5H5JA 1YJNB 1JJ2B 1VQ7B 1EFTA 4TMVA 1VQNB 3WBKA 1W2BB 1H42A 2VZLA 2QMUA 1DDGA 2HCJB 4ZCIA 4YALA 4HE6A 1YITB 2BM1A 2DERA 1BX0A 1HA3A 2ZITA 4TMWA 2QEXB 2BPOA 4J0QA 1Q86D 2HMAA 3AVTA 4DQKA 1QH0A 1ZM2A 3CCJB 4M1KA 1OB5A 3AVUA 3I55B 4QFMA 3JQQA 3ZBTA 1VQ9B 3VNUA 4F7DA 1QGYA 4NCNA 1ZUNB 4ZCMA 4PC2A 1VQOB 2BN4A 4TMZA 2BF4A 4RD4A 1IJFA 4LC0A 1DARA 4RD3A 1YJ9B 4Y7CA 1GVHA 3LVBA 1VQ5B 3CW2A 5DSZA 3QFSA 3OZVA 1YIJB 1R5BA 1A8PA 1W87A 3B82A 1QFYA 4FK8A 1E62A 3OJWA 1E64A 3OZUA 1NJID 4YAWA 3CC7B 2VYQA 2HDNB 1QGZA 1KC8D 3QFTA 2C78A 2XNCA 1ZM9A 3J81k 1W35A 1AMOA 4N3GA 3FPKA 3W2GA 3CD6B 3W2EA 3MMPA 1CQXA 1IB0A 4RD6A 1JA1A 2DY1A 4AC9A
chains in the Genus database with same CATH superfamily
1A76A 4B6FA 2HCTA 1L1EA 3LRTA 4ZGBA 4HAOA 4OHMA 3DDYA 3ILHA 3UTCA 3BA6A 1GR0A 4MA0A 4X8HA 1O0SA 3GJTA 3VO1A 1KZ6A 2AKAB 4FZVA 3W8EA 4PNPA 1U8UA 3DYBA 4TWRA 2MYUA 3UWKA 3KXKA 4E5KA 5L40A 1HDZA 1E32A 1DZIA 3FNEA 3DL0A 3ZCVA 5FQNA 3I83A 4HQ6A 1VHQA 5IN5A 3QG1A 4U7PB 4QUJA 3G8CA 1D8TA 5EZYB 5A7FA 1M5UA 4Q4JB 4AECA 2YRFA 5E1MA 3OPVA 3UWMA 1J1ZA 5IYNA 4ZV4A 2G9UA 2BI8A 3CURA 1VHDA 2WSMA 1N6LA 1E8MA 3EASA 3EXEA 5G1PA 2PVSA 4MNTA 4RU1A 3ILSA 2OCAA 2RHCA 7REQB 4JHLA 3GLFE 3HU1A 2ZCJA 1EFRD 3AT1A 3DDNA 4HH1A 4I5FA 1BFKA 1AQUA 2L19A 3RRNA 2ASVA 4EARA 2P79A 2AQIA 4DPMA 3LQ6A 1ZBQA 3FWKA 5DHAA 5GQSA 3S1AB 3D0KA 1O6CA 4I81A 2Q5JA 3JU4A 1M9NA 4L75A 4DV6B 2AHRA 5EQTA 2GN1A 2XEDA 1SZJG 2RBKA 3D3QA 1XK7A 1Y3HA 3S2SA 4URHA 2JHPA 4H4DA 3BQJA 1ENYA 2ZSKA 3DXXA 5IYQA 2JFXA 2RKWA 3IUSA 4R4JA 3DDSA 4MXDA 2P5UA 2ENUA 2R1ZA 1GGMA 3U4CA 3A6GA 4KACA 3GT0A 2VUSA 1Z12A 4DSOA 2EHJA 4BUZA 1ZCAA 4QPPA 5DO9A 2P6NA 1FEZA 3AVYA 2IIPA 4GWLA 4HH3C 1RLIA 4P7BA 2JFVA 2XDWA 2P9HA 4I5DA 2OP1A 3OLWA 5LQSA 3N8HA 2G0TA 2FOIA 3HBJA 2I6QA 1WB6A 3NHUA 1NNI1 5KTTA 6ADHA 4IGKA 3SMVA 2LD4A 1N7JA 2OBSA 4O4LF 5B3LA 1FLDA 3WC4A 2QORA 4LDRA 1TADA 5E7IA 3FR8A 4S12A 2X7JA 4MS1A 2B98A 2UU9B 4PQFA 1W34A 1YSCA 2WJWA 3OM9A 3L8EA 4NQZA 3T7AA 4A2PA 4ACBA 2FSIA 4IH9A 1XRRA 4BMVA 5GJBA 3E3OA 3K6KA 4RJIA 3I9V1 1UC8A 4YS6A 1RIFA 3LY8A 3OFND 4KQHA 3UH1A 1M66A 2XKJE 5ALXA 3EG9B 5SV2A 1HURA 2FUEA 1K8AD 1X7YA 2I22A 1U3VA 1C1DB 2XXJA 2B1RA 1Y3FE 2PWAA 4Q9NA 4ZK2A 1CF4A 2QA4B 3OSZA 2WV7A 4BAUA 4H3KB 4KGVA 4EA6A 4IIJB 4D96A 5I01A 1KYXA 3DF7A 2X3FA 4HDNB 3ASPA 5IU6A 1TJ3A 3COPA 2QXUA 3FPEA 3L0PA 3MM4A 4KXQA 2V59A 4F1KA 1KWGA 1NLMA 2QVYX 2AS0A 5KU7A 4JV5B 2Z1DA 4D0RA 1VL0A 2Z83A 5EQDA 4D3XA 5HS4A 4US2R 1EIZA 1KJYA 2HL6A 4KL8S 3VFDA 1XJWA 2HWKA 1XQBA 1BFDA 4LZWA 2PD3A 1OWPA 1GFWA 1REQB 3KYJB 4RANA 4DRZA 5BQ3A 4JUBA 1P18A 2CGEA 2NTYC 3FPFA 4HCJA 1UQUA 4PSKA 4EKNB 3EBPA 1CPYA 5JQGF 2VS1A 3PTZA 4N54A 4X1OA 3OQMA 2QD2A 3K9HA 3UPTA 3SJ7A 1AM4D 3U17A 4JBXA 2YJ3A 1E6LA 2EL7A 4E5MA 9ABPA 2A0WA 3BC9A 3DXYA 1IEWA 4CR6A 1CT9A 5LNK6 4ZTZB 4H9GA 3FCEA 3KYBA 4MEJA 4Y7DA 2LP4Y 1PDOA 3ABRB 3HDHA 2WM2A 1FDIA 3CWZA 4TT8A 3FYUC 5AKYA 3I2JA 3TSCA 3F6YA 3TQSA 4Q4CA 1XVVA 1Y1KE 121PA 1ZCFA 5EXSA 3WGUA 4Z86A 1Z4LA 4QL3A 4DMRA 4DV1B 2EKDA 1W36D 3KDPA 3FLAA 1HOTA 2QRHA 4MPDA 3EZ7A 3NDPA 1QCZA 2DF8A 3FPSA 3Q87B 3QE4A 1NOIA 1ZU5A 5D00A 3CUKA 3A1SA 4EECA 1MRZA 1JQKA 1HUQA 5IN4A 3FJYA 1UT5A 4HX5A 1ABEA 1QQ6A 3O3OB 2SKEA 1QIJA 3GU3A 1C81A 3IEUA 5JQGB 4TSKA 3FCYA 1L0BA 1Z6ZA 1QC5B 2O2SA 3GFVA 4HS9A 4ZYZA 1ND6A 2P67A 3CN7A 4QYIB 1OGIA 1X7ZB 3DZGA 4Z9XA 2UYOA 4K88A 2XMCA 3A36A 1Y5IA 4BE4A 4B6SA 1MGPA 1NXSA 4D02A 1YOBA 3G6WA 1P7WA 3GEIA 1QU3A 2LWIA 1FFSA 3KZMA 3TQQA 3MGGA 4WOJA 1SOWA 1ZJ6A 3HRIA 5I51A 1QVRA 1NW7A 3RTEA 3C3BA 3IMGA 2A9VA 2J1LA 5BSXA 1H9CA 1IJEA 3GYBA 5TNXA 4EEKA 2IZ7A 3NGMA 4UCXA 1SB8A 2D7JA 1M0WA 4ZK6A 4CEJB 1LCIA 1CY4A 3T6KA 3SYMA 2VJBA 4ZGQB 1KO4A 4BNJA 5HX7A 2TS1A 3GFTA 2DSTA 1B1AA 2HIHA 1E3WA 2SKDA 2ZVDA 3PE4A 5EP4A 3F9CA 4O5AA 3OJLA 4XYGA 1M5RA 1QE5A 1RP7A 2Z8YA 1X1CA 4OQZA 2V7TA 1YF3A 5FL7A 1NF2A 3RSHA 2VSFA 3EXFB 2IC5A 4PVCA 4OQPA 5AVZA 4E5PA 4ZD6A 5FWYB 2BGWA 4XIFA 4ZI5A 3HCCA 4J03A 2IK8A 4ZZ1A 3U6BA 1L4YA 1UEXC 1NJ6A 5SY9A 4IGEA 3EAGA 3F6RA 1K63A 5AH0A 2A6PA 3T51B 5L3SA 2O8BA 1XU4A 4TRNA 1QRUA 3MCVA 5G1OA 3E05A 1X7DA 2FMXA 5AKJA 3GGPA 4RK0A 2CDAA 5BV2P 4NYMR 1W4BA 5D5QA 3V2IA 4BRUA 4MPJA 3VSEA 1JAXA 4LDZA 1XZGA 3VX4A 1XXHB 4HQNA 4FWTA 3MCTA 3UAVA 1EU1A 2I3BA 3A3PA 3NH6A 2D2IA 2BUAA 4Q4HA 5CVEA 1V0EA 1K75A 3CB4A 1GQOA 3V1KA 3ZCTA 5EZQA 4G36A 2Q4RA 1U5BB 2LPMA 2W4IA 4J29A 2ZANA 2Q8NA 4PTYA 4WLVA 5T4EA 5TSDA 4D8XA 4RDJA 5A1JA 1USUA 1XJCA 3SDBA 1FCJA 5JS6A 3E7FA 4MKXA 1T6ZA 4CIVA 4KYVA 3QJGA 1YIOA 1K4YA 1Y1TA 2EWVA 6YASA 2O5EA 1E9BA 1L5NA 1SHUX 2FRVA 4PHCA 4JJIA 4ND3A 2DCUA 1E1NA 1B7GO 2ZBUA 1PDWA 2B1GA 4BCBA 3GFFA 2PX2A 3ZDYB 3HK2A 3CUTA 1OXUA 4A8TA 7YASA 1JR3D 1RJGA 1M72A 1V6SA 5E9AA 1TYDE 4X63A 4I8XA 5LB2A 4UUAA 4CFZA 1KZ4A 1UIRA 4AS3A 5JIBA 3HA5A 2GCIA 4BNIA 3ZLBA 1OY1A 2V3WA 4DJDC 1RXUA 4Q1AA 3ZHVA 3FGPA 4UBJA 4UZSA 1KYYA 1OZ0A 2EQBA 2Q3DA 4GPZA 2OLKA 3DPSA 1T9ZA 1I3MA 2VHCA 2VN8A 2FFBA 2VYND 2SNIE 3D0QA 4AI6A 3GUUA 3IR6A 3ZH2A 5IP5A 3I72A 5BWLA 3BULA 1Y1LA 4YT8A 2XWPA 1EESA 2Z5GA 3Q41A 4P31A 3MUOA 3TGLA 3L0ZA 3EQ9A 4E30A 1IRXA 5LUBA 3K5IA 1EXMA 1RYHA 3T5DA 1NMXA 1CZNA 1TAHA 4Q9DA 1PEAA 1PLJA 1NUPA 3T35A 1PL8A 4YI5A 1K9MD 5ECYA 3GFPA 2Z9DA 2G9ZA 3WA6A 1CUYA 4FGUA 2M6SA 3GVJA 1JSRA 4NNJA 1W88A 1M1KD 1I5EA 2AN3A 2FFRA 2HIMA 3DMGA 3LRPA 5EMLA 2FW6A 3HO8A 4X92A 1CRZA 3PR2B 1IVSA 5E8RA 2JVKA 1FDVA 3A11A 3AERB 2Z2YA 4E08A 3R8CA 3UOAB 3H8JA 4FEGA 4A7PA 3GG2A 4JOSA 5DW0A 1UEIA 1FP1D 2AG0A 1I8DA 3RVNA 1AHNA 3DEAA 2PGNA 3DTVB 1MEJA 2BH2A 1UUFA 5AHOA 5I7UA 2FU5C 5J1SB 3ZDBA 3WNQA 3ACDA 3UJPA 3T41A 4EKIA 3G17A 4NABA 4YUWA 3VKHA 1THMA 4ZANA 2I6SA 3KC2A 7GPBA 5K51A 3BD8A 4FI3F 3OE7D 4YAEA 2JLBA 1T3GA 5CNKA 4KO8A 4KRFA 4HR7A 1OH8A 2DYKA 4KE7A 4OA8A 5BVGA 4A2QA 1VPLA 3B48A 3EDQA 5P21A 1R88A 1QYDA 4EIWA 3RE1A 4L08A 4IIFA 3FVQA 1V0FA 3QBJA 4E0FA 3PDWA 3I01M 1S2MA 5AOAA 5K8JB 3SI7A 1A8IA 3JWIA 2P30A 4P3KA 3M1LA 2VHUA 4YMUA 3OOCA 1TCBA 5JDIA 5KNBD 1VF7A 4Q03A 2VF5X 2DR0A 3ND7A 5TPZD 3B6IA 2B8TA 4Z51A 5J4LA 3BWYA 2QV7A 5I8WA 4OHBA 3E1YE 1UFQA 3GSIA 4AO6A 4WD3A 2D74A 2X5XA 5T6BA 3BQMB 5LSAA 3HDJA 2GJ8A 1NT4A 3OMLA 4W63A 3DM9B 3J7AC 1YBAA 1SIBE 2ZIXB 5CLFA 2IV3A 4M1MA 5JU6A 5GAJA 2DFVA 5T8KC 3U80A 3MJSA 4OXYA 4XRRA 1TIPA 3NIGB 1UADA 4YDSA 3UGQA 1T5LA 3L6DA 1SCQA 1E1DA 1VMIA 4UEKA 3Q3GE 4WK2B 2QMYA 3H1TA 4LNHA 2JEZA 3QW4B 5EIWA 1CJKC 3NT5A 1YI1A 5KJ6A 1WU7A 1VSUA 2PXCA 3EEBA 2Q2OA 4FFDA 4N5MA 4X20A 3TNFA 4XKJA 3GNTA 4YXFA 3HVRA 4H60A 5FR1A 4DL9A 1JHVA 1O95C 2RJOA 2YHIA 2PS1A 4H15A 4I1SA 3X43A 4BQFA 1KDPA 5CB8A 1PYOA 3BWVA 1BS9A 3KT0A 4QVGA 5FNVF 4B7XA 1TO1E 3RTDA 1KH1A 2NVUA 4WUTA 2O6HA 2ODQA 2QV0A 5IC6A 2P5TB 5AWFC 1UBRS 1ESNA 2VDWB 5HVNA 3RYHB 3PVDA 2OCKA 1OXTA 2QK4A 1NM5A 4YVFA 5H7XA 2JIRA 1T1IA 5FI3A 4L50A 4E46A 1OOEA 3H5WA 3KKMA 4OAOA 3ZU5A 5L7TA 3VA7A 1KQOA 2EGHA 1N07A 1MT3A 1XWFA 1W96A 4G1UC 2C9MA 4X00A 4B5LA 2RGDA 1JLMA 4EPVA 4EI9A 1ZD8A 1YRHA 1X38A 2JCBA 4OB8A 4XEHA 5AVOA 3FLEA 3ESDA 3IP9A 5D01A 4OATA 1OAOC 3JQQA 2GPAA 3C5VA 5I5GA 3T1VA 2J7PA 2IY8A 3AEXA 3SHTA 3SGLA 5MN6A 1L9XA 2GPYA 3A9CA 4DCNA 3N6XA 3P2JA 3CNBA 1U3UA 2ZJ8A 2DBZA 5DCYA 4PC2A 1D03A 2ZTVA 2WMDA 3UW3A 3GEPA 2GFHA 2BF4A 5CR9A 1GIAA 5E1DA 5TIIA 4XGNA 1OBHA 4GX0A 2OCPA 1Z5WA 3F8TA 4P58A 3GLIA 4O4JB 4RIHA 3ORRA 3KSBC 1QRAA 2AXNA 4GI1A 4D46A 3K4QA 4KW7A 3D8UA 1RLUA 3CW2A 2Q1TA 3GVCA 2IRWA 4GO1A 4OPVA 2H7CA 1AHHA 3GMIA 5IKEA 2FN8A 4EHBA 3E3AA 5E9JA 5LLTA 3N53A 4R2XA 3IERA 4RZHA 3SOPA 3JXEA 4E5NA 2XWQA 2ZRGA 1E43A 4CTKA 2E4UA 1ZKDA 2VG8A 2YVUA 3PQ3A 4GMDA 2K2QB 4PRKA 3FSEA 3A6PC 2X6YA 3U4DA 3OZUA 1C0EA 3HXQA 3EWIA 1DAPA 3IGFA 3O8CA 3M82A 4P82A 3UAOA 1WMFA 3U3DA 4Y2YA 2Z8ZA 3W3AH 2BKXA 3QX9A 1RMQA 5KTKA 3OM8A 3U7QB 3DZJA 4X93A 1NHGA 1N5MA 2B6NA 2BBOA 3DEIA 3K0FB 3MNFA 4WK6A 1XZBA 3T9CA 4F9FA 5GINE 1OX5A 3WGGA 2FI1A 4FW8A 2X4IA 4BNYA 3PFFA 2VAWA 3EIXA 3WL6A 3WL8A 3ZCRA 4ETIA 1R0RE 4QHSA 1T0UA 1L1FA 4ZHQF 2CJXA 3MXOA 2QZPA 4H7FA 1Q95A 1DTWA 1RC0A 4TV8F 3PFBA 2WTMA 3IIIA 3QXJA 3VU8A 3MN1A 2FW8A 1CUEA 1NULA 2PT7A 4R3NA 4HJXA 2CF4A 5HK9A 5HQTA 2CSUA 3SYRA 4PWYA 1NJ1A 2RHHA 4JHXA 2CCGA 2Q3LA 4DKXA 1GEEA 4EY8A 3NUQA 5JBIA 4HIZA 3V4SA 1ZL0A 3ZHXA 5LOVB 1RZRD 2XGGA 3C3PA 4Y9DA 2VJDA 2ASEA 1S2IA 1U1DA 2I7DA 1IZ8A 1J9EA 5KQRA 5AQ1A 1D1TA 4JMPA 4BKMA 1ULHA 1KK3A 3CM0A 4ZPJA 1W73A 2PGIA 1SBZA 4YO8A 2CB0A 2NQ2C 5HG0A 3K70D 1QZTA 4LFAB 1JJFA 1F06A 1ZY2A 1VRWA 4OJKA 1YDWA 5JARA 3Q6MA 1QYCA 2P3OA 3A37A 4WL0A 4BVFA 2W8BB 3TECE 1AK9A 3CX6A 1OWOA 5DBEX 2QM8A 3AVOA 4BMXA 3RR2A 3GNSA 3R6JA 1G8JA 2Q5LA 4BP9A 2BFPA 4HAUA 2P4HX 4LDJA 4MQLA 4YAUA 2ST1A 2QP4A 3MRXA 3BL6A 3PXAA 4MKFA 3KT3A 1SVMA 3GGGA 1GSOA 2NT3A 1EBBA 4OLHA 2ZIFA 1A5BB 3FOFC 1I4WA 3U31A 1N7GA 1XE3A 4BWVA 5L6LB 5J23A 3V4OA 4P6YA 1E5LA 2W11A 1X39A 1U2QA 2C83A 3FN4A 4C6TB 1WVMA 1VJRA 3ROKA 2QAGB 5JALA 2WPNA 3PNKA 2O57A 5DWQA 4D8YA 3DE5X 1GRQA 1LPNA 3KZVA 1ZGJA 2ODNA 3HPRA 2GR9A 1MX9A 3IB3A 3L5OA 3O73A 4MUJA 2AMLA 1GRVA 1MBZA 2JH9A 2BM8A 2VHXA 3LUFA 1FBTA 3T06B 1Y63A 2AVNA 5K99A 5IJ9B 1ATZA 4FGZA 2W2KA 4N7RA 3T1TA 1QZ3A 2W9XA 2ZYTX 4QNRA 2WJAA 5FADA 4S1WA 3ZV5A 5JNWA 3MBOA 1VC2A 3UK2A 1AZSC 1M34A 1HY3A 2INGX 2OLEA 4EAAA 4YR9A 3DFIA 1E2LA 4IINA 4TKVA 2GRJA 3OJXA 1JT2A 2GEFA 2XCLA 3HG7A 2XB9A 2A1TR 3REQB 4CT5A 1CJCA 2NUTA 1Q6YA 2VL7A 3KEWA 3HB5X 1HE5A 5JAHA 3L7YA 4U63A 3F47A 3GZ4A 5F9MA 1Q91A 3G2LA 1N2CB 5DIZA 4G0UA 1COWA 1CS4C 5FTMA 4LYJA 3VYRB 2QRKA 3AUUA 5EIXA 2XUFA 4OBWA 5BNFA 3WQSB 1Q7YD 3O8QB 2J08A 3AEUA 3JZIA 4F4FA 4RSHA 3L0OA 4G4JA 4Q7KA 3G2HA 1C5KA 3FW1A 3O2JA 2H1RA 5NLLA 3NVKI 3NUGA 2ABWA 1K92A 1GSAA 1O3YA 2UYQA 2JGRA 3GC6A 4Z4YA 4I2NA 1JE1A 2XYRA 4WCDA 3X1YA 1VSTA 2W6JD 3A2MA 1IC6A 2ZWAA 2A1UB 3KQPA 1KTVA 1ZGZA 2I9PA 3BMQB 4CN9A 1GL7A 2LIVA 1OKKA 1P2FA 2Q2NA 1CD5A 4XIIA 2C20A 3VAZA 1XKTA 1JV2B 3TE7A 1N25A 4WESB 3W6UA 2PE3A 3CRQA 4E1AA 4CU2A 4MQFA 5HZKA 2WOOA 4FMDF 1YWGO 4Z7OB 2WFLB 3II6X 1PGPA 2IGTA 2PM8A 4N1AA 2V7BA 1HNNA 1V39A 3JQ9A 2XE6A 1X7HA 1UDBA 1K6MA 2YWEA 1UK7A 1Y8RB 2ATVA 1JW9B 2AVDA 2YFYA 3BRWD 1G60A 3HS3A 4FYJA 1DX4A 2VCYA 1U8CB 3GIDA 4TTQA 1MH1A 2F43A 1BCRA 5F2EA 4C0AC 1AGRA 3CVWA 2IXBA 1ZC3A 1Y6GA 1FP4A 1G5TA 1DDIA 2OV6A 5A9SB 2DYIA 5DOZA 4M0FA 1EI9A 4JSTA 3L01A 1NIJA 1YJBA 4YRLA 2DUNA 4UMEA 3C7DB 1B16A 5I8PA 4M36A 3VPCA 3V8MA 2Y1DA 2YFKA 1XB2A 3OZIA 4B6EA 3NW9A 1Z22A 4LSGA 1FOEB 4G1VA 4X90A 1Z47A 3HNRA 2FPSA 3GH1A 3KU4A 4JC8A 4MV6A 2YZ2A 3WOVA 4R2LA 1RWNA 2VDVE 5IBRA 3WWPA 3EWAA 1B0ZA 1B15A 4GFDA 4O4HB 2CLKB 4UMDA 3SXPA 4UTXA 2JLAA 3C5HA 3AV0B 3KYCA 5BSKA 5FEMA 1DWPA 1GZVA 3AEKB 3JPWA 3L8ZA 2Q2QA 4N5LA 5EZSA 3A26A 4X66B 1CQIA 2AF4C 3PXUA 4WSOA 4HNTA 5CAEB 1P33A 3L0IB 3A9VA 1BGXT 1U0JA 2R87A 4K86A 4MJLA 5E6RA 2Q50A 1C2YA 1PFKA 4MQBA 1U8FO 4MVWA 2XMGA 1JILA 1SIUA 2KBEA 2DUWA 2W6IA 5ESDA 1SHLA 4HYTA 1P9WA 1WNTA 4OK5A 1OQAA 5DX0A 3WIDA 2CNWA 3L7CA 3FIUA 4F4IA 1X77A 2VUHB 3ACBA 4HNVA 1FJXA 3PUHA 4ALLA 1D2MA 1TU0A 1CUCA 2E4XA 1BTOA 4YRBA 4OX9B 1L4NA 1YU6A 2A0YA 3L7IA 4L6AA 5FOXA 2IOHA 2NYAA 2ZWVA 3P5BA 4FE7A 5FFNA 2J32A 2QRVB 4XKVA 2AE2A 1PQPA 3PA8A 5UKDA 3DS8A 2B2XA 4TQAA 3K9BA 3OOYA 4PO8A 3AR4A 2PIAA 1CJUC 4ZVLA 1B14A 5C46F 5FUVA 1TVKB 1FUKA 2K7FA 2NV4A 1FYWA 1KO8A 5EE5B 2F1MA 1FX0B 1LPAB 1WZCA 4BB9A 1U2DA 2XNDD 3VI3B 4EPXA 2PPVA 2AX4A 4CKEB 5BSVA 2ZM6B 1E6UA 1RW4A 3OA2A 3WLHA 4KWHA 4XUGB 1QLHA 3VV2A 1KARA 5COAA 1EGQA 2BEWB 2KMLA 1IHDA 2G83A 3CNOA 3GO4A 3I9KA 1XX6A 4JJ7A 4X1IA 3SYTA 3U16A 1MB3A 1Y89A 3DR3A 5B1IA 2CUNA 1C0KA 4XUEA 5A4AA 4FYXA 2RCYA 3VZDA 3U0BA 3AONB 1JMKC 1QCDA 4X0CA 5TVGA 1BWSA 4X3OA 4C08A 4ZZIA 2NO4A 1P7ZA 2WU3A 4EB6A 3NX4A 3UA4A 2QJWA 3RBAA 4P9SA 3NKVA 4B7ZA 2I29A 5J2TA 2QR3A 1COZA 1IK4A 1E18A 1EUDB 4MLPA 4ER3A 4TMXA 5B2ZA 1E9DA 3EB9A 1KE1A 1OGYA 3DZCA 1W29A 2WJ6A 4NZPA 3L1KA 2NZYA 2TSYB 2YV3A 4TROA 3W3AD 1D2HA 5HKBA 1ZDMA 4PHFA 1Q7GA 2C00A 1H69A 1IZ7A 3BDIA 3VKUA 4QRHA 1P91A 4OP1A 4DUPA 1R0YA 4DPKA 1FSFA 4ZT7A 3N2EA 2J3DA 1BXRB 1KOGA 4KO3S 2AZXA 3P94A 1L5RA 3SZ3A 2O4CA 2YOGA 4FYIA 5EJIA 3MOSA 5CDFE 3IVRA 1NG9A 3EGCA 3WLRA 4G8CA 4X7PA 1HE4A 1Y6ZA 1MVLA 1I01A 1PFWA 2C57A 3SLDA 3EIOA 3NR2A 1ENPA 4L0MA 1GQYA 5I7OA 1V8OA 4DAEA 3UV3A 1R9GA 2VP5A 3O82A 2Q6LA 3CPJB 4J16C 1S9DA 3RQIA 2P65A 5HUJA 1NVFA 4NAHA 1NI4A 5DYWA 2JRCA 4KCGA 4A91A 3ZNQA 1CZLA 2HREA 4HGQA 3K0BA 4GDMA 3OY2A 2FW9A 1Y8RA 4GOMD 1P2TA 2WM3A 3NJ8A 4LPSA 3V7NA 3X0DA 3WAGA 4QOFA 3MYRA 2QIPA 4N3NA 3HUUA 4NCKA 5IBPA 5KDDA 3HYRA 2V6GA 4LIPD 5T64A 4K2HA 4DNPA 5ICGA 3KAQA 4DC1A 4IIDA 4MQFB 3R75A 4BVAA 1G5HA 5M29A 3D54D 4CWAA 3HR8A 3BCUA 3NCHA 4RW0A 1IDOA 2WU0A 4ZIRB 3BE5A 3ROEA 3TZLA 1P45A 2OAP1 2XE4A 1IZZA 1GZ6A 4N0DA 1JBKA 1XXHE 1X13A 2YIVX 3F49S 3F7MA 4YP7A 3ZLUA 4M8KA 1UF9A 3A0UA 2P3QA 2PZKA 2OP0A 3AM4A 4IJ5A 4IIGA 3TZQA 2EDCA 1WSBA 3A6HA 2H92A 4C88A 4MS4B 5A9SA 1Z0AA 4OQNA 1MXHA 1C9MA 4QBKA 3O91A 4X6UA 4F2HA 1BMFD 3V5NA 1GUDA 2P2DA 1LLDA 4G25A 3I2IA 2DMRA 7REQA 1JDZA 4LHSA 4RJLA 1L7QA 3KWMA 1AGXA 1OFVA 2GZHA 3EG5A 5AUQA 4C0XA 3W06A 4IILA 5K0CA 2YMPA 1JJVA 4D99A 1A1VA 1KFBB 4D3YA 1GKKA 4HDOB 1L7NA 2OY0A 1JDNA 3RF6A 1EFHA 1RAIA 3OPNA 1YFLA 1HL3A 1SOMA 1TDJA 4G9GA 3TRDA 1SKQA 1DOZA 1W85B 3B20A 3A4MA 4NMMA 5E7JA 1FYFA 1KVUA 1OJ7A 2EFEB 4A10A 2KS6A 4EKYA 1N2BA 1UKZA 3PUIA 5DN6A 2CNDA 4RHXA 3ZHQA 5D7BA 5K0TA 1WV1A 1XRSB 2ZB4A 2XCRB 1BKDR 2XE7A 5SZKB 3L6UA 4KGZA 3ED5A 3JYHA 4QVKA 1B8PA 2FE1A 4WXEA 3OCCA 3SE0A 2OMEA 2JHGA 3G0GA 2OCDA 3GBVA 2CXOA 2NZXA 1T13A 3QUAA 4LZAA 4O02B 4LCBA 5B7PA 2C5SA 2XUAA 1RYNA 5FNVA 1E2IA 2FY8A 4G9EA 4E94A 4TYWA 2R2GA 1YR2A 4UU0A 1JSCA 2EIHA 1MPTA 1X14A 2QAIA 3WR5A 3EMDA 3ELYA 4WMLA 3W5AA 3HJHA 1XD8A 2W37A 4B6PA 2HHJA 5TGZA 4D9IA 1FC0A 5DJ5A 5FBZA 3S81A 5GM2A 4H6WA 3U1BA 1WULS 3ESBA 4C9BA 5FOQA 4GZ6A 3IEMA 2R7KA 5DBGA 1KSGA 4RTMA 3QEMA 5HOEA 1LNSA 3EQ7A 1WUIS 1WXHA 4B84A 3OZDA 1LPPA 2PX4A 3D6TB 4K0KB 5CT5A 2P8SA 1HE8B 5KKAA 1PO7A 5GOZA 4OTZA 2R96A 1J06A 2ZI3A 3DOIA 3IKTA 4Z53A 5DB4A 5I7HA 3ETLA 3V6LA 3OHMA 1ZQ1A 2I9KA 4ZALA 1VE7A 1H4QA 4JXKA 4BAGA 2FPLA 1CP3A 3BS4A 2ALJA 3EOBI 5DKFA 1NR5A 3AR2A 3I76A 5ESXA 1UBTS 2BEVB 2Z43A 3IUBA 5F3DA 3CUEF 1T0BA 1IHUA 1NVBA 3ND9A 3UKOA 4CF7A 3JQ8B 3M6AA 5J3OA 4N5HX 2IPXA 1X9GA 5IC5A 3VU3A 5LD2B 3WL3A 1LZLA 1M75A 4LXUA 3FB4A 3TPZA 2YCLA 4LOHA 1SXIA 4DUZB 5CGZA 3PENA 3SCZA 1BU5A 1LV8A 1DBQA 4KB5A 4BMZA 1QUEA 2IKQA 2JLRA 1B41A 4EF5A 3ENWA 3QUCA 6NULA 2QWXA 4RM2A 1ZM4A 1CE8A 1JECA 1QOZA 2H54A 3D5EA 5G4KB 5LYJB 2N0SA 2J3EA 2H9IA 1WMBA 4NJMA 2BUBA 1T0HB 2P9YA 4UHBA 4E5VA 4I1UA 2M1XA 1CR2A 3IV6A 3CE6A 3H7IA 1MRNA 4JH0A 4PFSA 3QIAA 4KK4A 3GJRA 3PL1A 1KRWA 1VGRA 1PKVA 3GDOA 1NYLA 3SS7X 2BFDA 2GK4A 5DP1A 2F8MA 4NBLA 4RDHA 5CMLA 4K6MA 4A0SA 4BZWA 2Y1LA 2FH5B 3Q6QA 1RQ7A 3OLCX 2BZGA 4I9GA 4LJ4A 3TIFA 4UPEA 1ZICA 2DERA 4HWPA 3FWZA 5CNIA 2YNMC 4M7RA 4QBGB 2ZITA 1ADCA 3T3EA 3VR2D 3A28A 3T5GA 3AI1A 3WHIA 2YXNA 1GG8A 3AYXB 5GJCA 3FUWA 2HMAA 3AVTA 4L8FA 1OAKA 1M6EX 4LHYA 3CCJB 3R3UA 1E7QA 1E9AA 3DPIA 5FWAA 1H2XA 3AEYA 3DKRA 4F71A 3TG8A 1YR9A 2ZXEA 2A7QA 4HT3B 1U2SA 4CTOA 4NC9A 1Y98A 2C3UA 4PONA 5EKUA 2YQ4A 3MJVA 4F7DA 3C1UA 4TVOA 4AIIA 1BCSB 3OFKA 3A2NA 2PKXA 4BGIA 3MLEA 4PFJA 2CHVA 3OF5A 2FVGA 1KZ7B 1P1KA 3CUYA 4FZ5A 4TWAA 3HB7A 5JE8A 4B6JA 4XYLA 1CUWA 1VQOB 1TFUA 3H2BA 3IXQA 5K0LA 3TGWA 2BMDA 2MYTA 5HIJA 3PDIA 3FZGA 4I5IA 5KX5A 4FUTA 2R9VA 3HACA 2QQGA 4MRSA 5LQKA 3C3CA 3KZOA 3V1TC 2CFIA 2Q1YA 3HHEA 2QF7A 1VQ5B 3LJKA 1FRFS 1QHIA 2I1QA 4K9QA 3VC1A 3OTOB 3SSAA 1F3OA 4FI3C 2EDAA 2NNLD 1W85A 4RKRA 5JW6A 4E32A 5LA6B 1I2DA 1V1RB 3G0DA 4ERNA 4QVAA 1D6SA 1K8ZB 2OBLA 1QE0A 3D1VA 4J2OA 2HBQA 4GXQA 1GA4A 3H4TA 3U3RA 1Z0UA 3EH1A 4YPVA 3C48A 4MO2A 4O1IA 2JJQA 1Q20A 1Z0ZA 3DPUA 4HAWA 4OHKA 5ETJA 4OP2A 5DNYB 2IS4A 2A2ZA 2C95A 2WFLA 5EP2A 5CM2Z 2FQ1A 4FCCA 1KAQA 1Z18A 3CSSA 3M2TA 5TC4A 1JXOA 1UD2A 1ZJ5A 4KQXA 2IA5A 1Q0LA 3QUSA 2QN2A 4NCJA 4O8ZA 1OLUA 2CEAA 3P0RA 4Y2VA 4Y98A 3L40A 5FP0A 1EE2A 4W1QA 1O9HA 3EXHA 4JYPA 4P12A 3GRPA 1BH6A 7MDHA 3IQDB 2XNCA 2JBHA 1D5WA 2R60A 3OBIA 3H65A 1UQRA 4OD0A 1J49A 4WNAA 1W5BA 4Q1EA 4RNDB 3O47A 3SJUA 1YL7A 2VBFA 2EV9A 3VPXA 1TJ5A 2B37A 3T94A 3FI9A 3W2GA 1E3JA 1RCUA 4PHTA 3CD6B 4PZYA 1YR8A 3MHTA 1RWOA 1VE3A 3NPAA 1NSYA 4S1TA 3V1MA 4RD6A 2CHUA 4CHTA 5JADA 1AGYA 2Q3FA 1I7LA 4PIPA 2QAJA 3U4MA 3HO6A 4UVGA 1MB0A 1IM5A 2GETA 2A84A 5TQVA 4F9EA 2VBCA 1KJQA 5FBRB 3ZX4A 2VJOA 1PZNA 4XB2A 3LRXA 2IDJA 1E2HA 4QX6A 5CA1B 1DHTA 2F7SA 1VDMA 1U0LA 1XJQA 2NAFA 3EXAA 4N3CA 2CUZA 1M0SA 4YRTA 2IH4A 2FEPA 2WT9A 4PQYA 4YRKA 3SFVA 2NADA 2XBLA 1MCZA 2HFKA 1Z07A 1TOAA 1ODFA 1AGNA 1BVRA 2PJDA 3MRVA 2XGMA 4KQIA 3VR1A 2BHNA 5ESRA 1W52X 3FD8A 3PG5A 5CCBA 1O0CA 1YZQA 1SHTX 1VQ4B 3GK3A 4HGRA 3R7LA 4B46A 5IWAB 3PFGA 4B3SB 4RF3A 2PWPA 5EZ6B 1GADO 2JI7A 3LCJA 5BN5B 1MC5A 4PIVA 1U0GA 2GAAA 1EM6A 3BXEA 1K6EA 2B99A 1YFKA 2ZWMA 3CC4B 2Q9CA 3HEBA 1T5SA 3P4XA 1GCIA 2ZZKA 1L4KA 4NV3A 3ORHA 4PICA 5IXSA 2H2IA 1IIRA 3FMFA 1N2IA 4LTMA 2Q6KA 3G2QA 5IYZB 3ER6A 2E55A 4TGLA 1SQ0A 1SCUB 1YDGA 4K46A 1SXJC 3CMEB 3FXAA 2HSZA 4ANFA 4CMIA 1RYEA 4TXNA 2X1HA 3MRTA 4U7DA 3C7AA 2DKOA 4C4OA 1BAPA 3L0DA 2HU7A 4MUMA 4WWVA 3WLNA 1E6MA 4OQXA 5JCJA 4V0QA 4OGFA 3ZV7A 4OIMA 2C2KA 3A3YA 2R25B 2Q4OA 2PEYA 4RTKA 1DMRA 2O0KA 1E9EA 3T3MB 5B1EA 4IAOA 3ONUA 3KJEA 3H5TA 3V4FA 3BJMA 1E3IA 3ETEA 4W99A 3L8DA 3SVLA 2VT2A 3GFOA 3WNBA 1YKFA 4KX5A 5AR1A 3SE7A 4BMOB 1J2UA 3KWLA 1EGMB 3DMRA 4TVSA 4OUDB 2AZ4A 1UZUA 1XI2A 2ONYA 4OQYA 4F2GA 4UU7A 3ROFA 4CQMB 1DCMA 3QEAZ 3N8NA 3P4YA 4MRMA 1PKEA 1HQCA 1RAFA 3N0TA 4DYVA 2NXWA 3NAGA 2H1OA 2BVNA 5B3KA 5LQJA 1NQUA 2GRUA 3K09A 5C35A 3VUEA 4ESHA 3LK6A 3K73O 1RC8A 2GYVA 3EDOA 3DW3X 3D59A 1QVGB 1C7EA 1NN0A 5HFNA 4ESVA 4KITB 2O2JA 2X6RA 3UIEA 4AROA 2PS9A 1I30A 4LFCB 4JVNA 5EG5A 1HYBA 1O2DA 4ZKEA 4RDXA 3VSAA 3HXPA 4JJEA 1T25A 2OO3A 3RYFA 2OQIA 3LPLA 4AWAA 1CQJB 2GN0A 1M2WA 2H57A 4ILEA 2G88A 3F67A 3OZEA 3ABQB 1ZZEA 1YS6A 4YCDA 4E4YA 4CEHA 2JFQA 4LDPA 1E0SA 2AB0A 1Y5RA 1V1RA 4MVJA 5F2KA 2NZ2A 4BE9A 4G4IA 1UBMS 2A67A 3QEOA 1F5SA 4HAIA 2NYRA 5DTQA 521PA 1TM5E 2ZRHA 2GHIA 4V39A 1KY2A 4YAJA 3UCFA 3W8DA 2BRUC 2QX9A 1CR1A 2NUBA 3PFWO 3ZK7A 5A02A 5K0FA 5KWIA 4J4HA 2AW3A 1EXVA 4U1RA 1BW9A 2DCMA 4MCHA 4B74A 4PZDA 4P33A 3OJEA 4LVUA 4I3HA 2CLIB 1VMDA 4ZT2A 2J9GA 4QEKA 4UD6A 2QJFA 1XFOA 2OVFA 1IY0A 3AXTA 1QO9A 3RGWS 2JW5A 2IFTA 1YKSA 3WGHA 1P7CA 4US0R 2YIMA 4R7ZA 3NM5A 1A5AB 1C7ZA 1SCIA 4PYQA 3ZZ0A 5TJ9A 2FRDA 5TF0A 1GAWA 2QRJA 2C5EA 4YUYA 2VCEA 3QVJA 1RLOA 5ARDA 1YDEA 1PP4A 2PMCA 5I4CA 1DXYA 1ZONA 3R5JA 1XTRA 4CL3A 2DETA 4P4TA 3AB3A 1YDMA 2VP6A 5BNIA 4AJ4A 5IKMA 2C82A 1CX9B 2IDMA 2B83A 2IP2A 4DB2A 4C0BA 4EGSA 2ECQA 2O5RA 1PWHA 3CXRA 3LGXA 1OILA 4P4SB 4LHWA 4TVKA 5ALZA 5JPIA 4EP1A 4QYSA 1MQAA 4ALJA 4LOLA 4WGGA 2JFBA 4ZN6A 3CX3A 4IDBA 5H81A 4I19A 2KSQA 3KUDA 4F4HA 4JI2B 5AKZA 1NQ5A 3ZWWA 2P62A 3G5AA 4OREX 2HWYA 1W19A 4MR7B 2VJJA 2B78A 3E61A 3K0AB 4TTPA 3WK9A 4HGPA 4HV4A 2F62A 2OHFA 3URMA 3QOYA 6PFKA 1CNFA 1RR6A 2GZRA 2R5FA 4PHGA 3W4KA 2RARA 1UM9B 3KFVA 1K0UA 4CDRA 1WE2A 1K28D 4FWBA 2QVZX 4PG6A 3RTGA 2FPRA 3GAFA 4EW6A 4ZU3A 1V1MA 1YZKA 2Y1KA 1XELA 1XO1A 2G1JA 5IANA 3V4RA 1D2AA 4K03A 3TL6A 1XZDA 4GX1A 4L73A 3SFTA 3U4QA 4GZLA 2W70A 4A8JB 5JAIA 2O1SA 4Q12A 3BCHA 4NL4H 4KDEA 5EWMA 1M5TA 4CMIB 1T2VA 3UEOA 4PNHA 1FXWF 1RWKA 4OGLA 5IWCA 2CNKA 3CVJA 1LX6A 2PXHA 3ONEA 3TD6A 2HRDA 1GDTA 2HMSA 2JIPA 2R84A 3PQFA 2J6CA 1SXJA 3O95A 3C3XA 3NE5B 3AY0A 1NF9A 1XEAA 3G2NA 3ZKWB 3ZPNA 2ZTHA 2QZ4A 4IQ4A 1L5LA 3WHPA 2XTZA 5JD6A 4MRNA 1MLDA 1KU6A 1PJZA 1UOPA 3QEMB 1M83A 1U3DA 3DMPA 3GEMA 4GPBA 4J75A 1PT5A 5BMVA 4LF5B 3BDAA 4DNOA 3AUYA 3H5LA 1U04A 1UPUA 3LI2A 4J3JA 4BVGA 4OY3A 4FXUA 1SHKA 5CB4B 3EMBA 1PVOA 2AZTA 4A1FA 5IF3A 2NO6A 4CQMD 2FZVA 5CGQB 1GZSA 5JR3A 2FETA 2Q41A 3RVSA 3DTYA 1EK6A 1JT9A 2FR8C 1YI0A 3L3BA 1NU6A 3OKFA 4G1MB 4L4UA 4NMXB 3HY3A 3N0WA 3EA5A 4FU0A 3G85A 3DHNA 4DCMA 3W5IA 2IYOA 3LU1A 3DQZA 1JA9A 2BDEA 2PJZA 1CDZA 2Q3EA 4FNOA 1N5LA 2IYYA 2NZJA 5HF6A 1C3JA 4TZKA 2CK3A 3R9KA 3TJMA 4EUKA 5CFOA 5JQWA 5FQOA 4DIFA 5ALYA 2OWEA 2VRBA 2H52A 4PW0A 3GZJA 3RRBA 3W5HA 4PPQA 5K3FA 3FKJA 2XUHA 3CCRB 1EAYA 4MITA 3WWEA 2BCGY 1S3IA 4ZMBA 1HMPA 3HSSA 1O9BA 1ZR2A 5A04A 2C8JA 4XGKA 2EKBA 3E58A 3KVNA 5E4JA 3CNQS 4DDKA 4TWZA 1LS6A 3NU1A 3C4VA 4OFBA 1AC5A 4LXXA 2X0KA 3V32A 1XP8A 3I0NA 3L8MA 2PH1A 5TMDA 5KOJB 4U0JA 4WBSA 1J5XA 4I50B 2AQ8A 1V5VA 4KQFA 4F84A 1GPDG 2QPAA 3FIJA 4UHFA 5TVKA 2O59A 1BRTA 1ZM7A 1CV2A 2R6R1 4AXBA 2JC3A 3TZHA 5KKCA 1N5JA 2H4FA 1FSSA 1WXEA 1N1DA 3CEHA 3KPJA 3X1MA 4BP8A 3VO2A 1MC8A 5CHYA 3ANXA 2EKQA 1MIOB 3PGKA 4KXUA 4ONEA 3OECA 1XJ5A 1PWXA 1WRBA 1XZLA 2HK8A 2I66A 2O0MA 2ZSUA 3IUEA 3K5HA 5BSTA 3TQFA 4KLCA 3UJ8A 4JNCA 4ZEXA 2QMEA 5JZMA 3BKWA 1H05A 3BGSA 3PXGA 4LV6A 5C4MA 5ALHA 5A3VA 3EGOA 4BLPA 3SQNA 1AH2A 4FYHA 4FXPA 4RL4A 2XA9A 1UWVA 4QOJA 3OPYA 5L3ZA 1VHLA 2CJYA 2D0DA 3MB8A 2JI9A 3D6AA 2VDLB 2NPOA 4YCJA 3JQBC 2DKNA 2CVPA 5CDYA 2JLZA 3BMNB 4UDOA 3WTCA 1X1EA 4UJ3A 4O2LA 4IUYA 4M3NA 1G55A 1HO3A 3I4FA 3GN2A 4MGKR 3KE8A 2C77A 1SG0A 2G1UA 4KN5A 4IJMA 5GONF 5IM5A 1NI3A 3R9IA 2DFLA 2BR4A 2LUOA 3KYCB 3FZYA 1T1RA 1C7RA 4R69A 2ZFUA 3EF0A 3CMAB 4XD7D 5HCIA 1V9SA 4B71A 5BORA 2Y4NA 4MR7A 1EAMA 1UZNA 2FN3A 4B3IA 3VTZA 1XLVA 3QWHA 2O8CA 4N7MA 5FDFA 4JUFA 4F46A 4BVLA 3IQWA 1V43A 2Z57A 4MUIA 4UPDA 4G3XA 2LDBA 2Q45A 3KSRA 1ZNQO 1GUZA 1JU3A 1KPGA 3H4IA 2ENWA 2RGYA 2X8BA 4AWXA 4D98A 1F1JA 4B17A 2R1TB 1VE6A 1N0UA 3INNA 3HKEB 4S35A 3WO1A 1V8PA 4F86A 1EZZA 5I7FA 4RGYA 1EK5A 4M7WA 5DF1A 3LL7A 5FWXB 3HJFA 5I3ZA 4TS9A 4U7TB 1E9RA 2RC5A 3WB2A 1KK2A 2AOVA 2YMQA 2UV8A 3V8EA 4UM9B 5E6TA 5DLQC 2R5WA 5REQA 3IPLA 4JJKA 1P31A 3Q8MA 5KAMA 3NOQA 3ML1A 5LMUB 1OFHA 3AY6A 4YIKA 1VOTA 3IQZA 3AUKA 4Z9BA 4HC4A 3H2YA 3N2IA 4INZA 1JFSA 3GDFA 4OI4A 4O63O 3TOZA 4D3FA 1PJCA 2C94A 2I2BA 1SJ9A 3IVGA 2FMUA 4JK3A 1BCRB 2F43B 2RKBA 3HUDA 4M60A 4P36A 3SEFA 3HYNA 5BSEA 5TMPA 5CIYA 1ZAYA 2IEZA 2VH1A 2IV7A 1U1EA 2QRGA 4QBFA 4COKA 1HOXA 1ODJA 4DRXA 1A98A 4ZO6A 2D54A 2YN0A 5HKKA 3IODA 1PJRA 4LRSB 3GH3A 4TUYA 3SEJA 1V7CA 1IN1A 4BKUA 3L6OO 3VR6A 4L4RA 4IDHA 4P34A 3ZU6A 1Z06A 2YFHA 1H1LA 3X1KA 1P5JA 1T8RA 4XYEA 1YQWA 1A8SA 1DJQA 4QRIA 2PGOA 1HFKA 3RIYA 3Q38A 5A6SB 3WKEA 2IZ0A 1Z0SA 2DHEA 3M4JA 3TR5A 1R0XA 3ASTA 4NCBA 1WOMA 4XNFA 3KQQA 2WLTA 4N18A 3B38A 4P0TA 1JAIA 1ADBA 1A9ZA 2F8LA 1Z5ZA 4RHUA 3FPJA 4ODIA 4FYWA 3HFJA 4JB2A 2WYWA 3CUUA 3UOGA 4WZKA 4IDQA 3T3HA 5F4OA 3QSYA 3LLSA 2DT8A 1M2HA 2HO5A 2XX3A 3AI2A 1XZJA 2OAGA 1UOEA 5AVYA 3DUFB 4NOJA 4KJXA 5F21A 2IT1A 3T95A 3TBKA 1PR1A 3QITA 3WB9A 1IG0A 1Y7PA 5ADUS 5H5JA 3GAMA 4DSAA 3VOTA 5GIOE 3VVCA 1GQQA 1WM1A 3K92A 1IOVA 2GH1A 3Q9SA 2IZZA 3AJDA 4G4SO 1TT5A 4LZOA 3WBKA 2O52A 3T9EA 4DYDA 1RBYA 2PRZA 4AJ2A 9LDBA 2QW8A 2LE0A 3SAJA 5EFOA 2ID9A 2YTZA 4FB4A 4NPHA 5FBWB 4FM9A 3LC1O 4B3DA 2J3QA 5C53B 2C54A 4TV9F 1UP4A 3M6FA 2BBWA 4I4TF 3ZU3A 1CDOA 2BEJA 2EW2A 4MYCA 4ON9A 1USKA 3NTLA 1XQWA 2V03A 4W9NC 4D4LA 4EDFA 2C5BA 1RKXA 3VJMA 3HU5A 2J6IA 3EBOA 4NXNB 3Q3HA 4QWWA 1ZOSA 2JGAA 5H4GA 4RVNA 5KYWB 1I2MA 2JIMA 1YDHA 4R3UC 1G2OA 2C3OA 2RI0A 2X0RA 1XMJA 2ZBPA 1PG5A 1DB3A 4LWQA 4ZT4A 4B3FX 1AUQA 2QLJA 1YJCA 5JPCA 3ZDDA 3OI7A 4ZCMA 2DU8A 4X7RA 2FE4A 2PZJA 3LP5A 1HT3A 1ORVA 1RACA 3H5VA 2A58A 3OPMA 2BFCA 2RHRA 4Z6KA 2M9MA 4F6CA 2AKYA 1IN7A 3BG5A 4ZHSA 4Y7CA 3NHBA 1XMVA 3SIWA 3KL4A 1EBUA 3SLGA 1NVVQ 4OXIA 3GCGA 2D0IA 5F52A 1N6NA 3OZVA 1QHYA 5D2CA 5IYZF 4RQUA 4ZYVA 3T34A 4C2BA 5AVWA 5CCXA 3VZSA 3KQSA 4F0JA 4MINA 1CS0B 1IFXA 2I1WA 5FL3A 1VGVA 2ZBFA 3Q98A 1JG3A 4IVPA 4EA8A 1KJJA 2PL5A 3TNJA 4LQ4A 1L5FA 3M3HA 3QYFA 5IVHA 4OHRA 4ZGGA 4F4JA 2XJ9A 1KDRA 4LDNA 2VQDA 2ZT5A 1KXZA 4P22A 4D8WA 3VR5A 3HMKA 5CEJA 4KYIB 4Q19A 3HO1A 4RF4A 5DCWA 2ONCA 4KKVA 1W76A 2PH3A 4D4MA 2CDCA 1NXTA 1U3TA 5GJVC 1MDFA 1P3DA 2B4QA 1H2RS 1ZM9A 2MMCA 4KX3A 3RHZA 2WHYA 4Q93A 1Y6RA 1DBWA 4EDHA 3D2AA 3PLNA 1VFNA 2CMGA 4YV1A 1LVUA 5D3ZA 1QQBA 2IQ5A 3ULKA 2RD2A 1ZD9A 4FTWA 3H4VA 4XIJA 1L5QA 4G5XA 1JA1A 4F6RA 1UODA 4L0DA 3BX1A 3M70A 4K9LA 4UM9D 5TQJA 5C8YB 4WLNA 3OX3A 1KEUA 1CFJA 1N2OA 1XU9A 2H08A 2MSDB 4DLYA 1GEGA 2FZCA 4E03A 2EX1A 3L9XA 1JHPA 2P5YA 2ZOSA 1IAQA 3VSBA 1FTGA 3IVAA 4HRAA 2VNKA 1KQGA 4CL8A 1PR6A 3GEBA 3I42A 2J07A 3DE4X 4H27A 4FFWA 1IOWA 1Z0KA 1RFLA 2V5VA 1A95A 4H31A 3K9FC 5JCZA 2QQFA 2YWRA 1SWVA 1UPBA 1MAAA 3NHFA 3UTDA 2F4NA 4TV9A 1VQ8B 4M9RA 3VPAA 3ZHYA 1TZCA 3G79A 3JQRA 2PO5A 3CFYA 2BFNA 1U2TA 2GCPA 1O9GA 3CJQA 1U28A 3GB9A 2AJCA 3S44A 1HTBA 2N42A 5FUXA 5LLSA 3M4YA 3UANA 4I66A 2DOGA 1A2KC 3PL5A 1Z6YA 3I64A 3GBPA 2P3MA 2BMVA 1JPJA 1N3LA 1QDEA 1U2GA 2BEVA 4F85A 5C1IA 2V65A 5KEIA 4DEVA 3HAGA 4ZAFA 1QU2A 2G1PA 4K3UA 4Z5XA 2R44A 3QLTA 1YCDA 2J41A 2WP0A 3A8JA 2ZI9A 2EJBA 1MOZA 2KBFA 2JAXA 4Z4ZA 3DEZA 3LDUA 4URYR 3NNNA 4WOCA 3TAHA 1QBKC 3V2HA 2EKPA 2YRWA 5B12A 1IG3A 2O0HA 3K0FA 3GFQA 4FFNA 4MQUA 4J9VA 1R6XA 4UQPA 1A72A 1NJ5A 1Y5LA 3L6EA 3C8HA 4URFA 3LBNA 3F46A 3ANYB 4N9WA 1P7PA 1U9IC 1P1CA 4Q7LA 3GJXC 2XZOA 5JWHA 1X74A 5FJIA 4HK4A 1ZYUA 1HDEA 3DAHA 1WAMA 4EX7A 2Q2VA 2BTQA 3ZCSA 1P2GA 4BWGA 4XB1A 3TLMA 5EJ9A 2E85A 1F38A 3SF0A 2QROA 5FI5A 3ESYA 4GGMX 4LYGA 3OFSA 1K5HA 3ZGZA 5JO9A 2YKGA 1TM4E 2BFDB 1P5ZB 3FOCA 3QTLA 4CKWB 1RFGE 1TZ2A 1T3TA 3NTVA 5FWDA 4QTTB 5AHRA 1QDUA 4KPUA 1HZZC 4BEVA 4CQNA 4AJLA 5DBFA 3P0HA 5A5GA 3K15A 2RGAA 5KNCH 1S3GA 1OIWA 2H2FA 4I4IA 1AZLA 1RJWA 1RXIA 1JFTA 1K7CA 1RT9A 1SBYA 1Y1QA 5EHXA 3AEKA 3P9RA 1FTYA 3ZHSA 3S2IA 3CSUA 4MS3B 4GAEA 4AMZA 3OFVA 1Z8FA 4ZQGA 3GJ6A 4F60A 2VWQA 2XVAA 3ZUPA 1BJKA 3ZDEA 4YAIA 2OGSA 3NDJA 3N76A 2J3LA 4GNKA 5I47A 3HCPA 4INAA 1Y8ZA 4FGKA 4KMMA 1Z56C 1ZAKA 5JCOA 3NRJA 3VOBA 2FDRA 1XTKA 4BBJA 1YZHA 5G1NA 5EJAA 1CJVC 1T4GA 3BQ9A 5AIBA 5LZ9A 1NKSA 4MVJD 3J81A 3IH5A 1UJ6A 2B5OA 4AP6A 1GSHA 5F98A 4IUDS 2ZBVA 1CRWG 5HSGA 3TZ6A 1UBFA 3N6VA 4JWTA 5KOJA 1SD2A 1TA4A 3DE2X 3VHXB 1YTUA 3ZOZA 3ETGA 4AUMA 4BO0A 1NYTA 3AJEA 5HP4A 1C3LA 1WOPA 2BEUA 3Q0TA 2EHDA 2G07A 5F1YA 3BMOA 1JJBA 1XZKA 1L8LA 1YL6A 1X1TA 3A06A 3DCYA 2FWNA 2VPYA 4CMJA 3OW7A 2CXPA 2P9EA 1UK6A 3QUTA 3QF4A 2P0EA 2WD7B 4YBRA 1E2EA 3EXHC 4YJFB 1G21E 1VQ6B 1H8ED 2VPQA 3LX6A 2FW0A 3ENZA 2Y2UA 4HF7A 4KVZA 2Y68A 4GM4A 1ELOA 3DEYX 3HP1A 2YV1A 2ILVA 3LA8A 4FR0A 4J43A 1TT7A 2H1IA 2Y93A 1VLOA 1F0NA 4TTAA 4MWBA 1Y4AE 4ZU1X 1O6BA 4RF5A 1MAWA 2DJ5A 1Z6QA 3NWOA 3MWFA 1GHTA 2D06A 3NYRA 3QU4A 1FU8A 2WSSD 2GJPA 4AJJA 2HSJA 2EG9A 421PA 1YX2A 4EABA 1H66A 2PL3A 2YICA 4LMRA 1N4DA 1AUXA 3LE8A 3Q6NA 3U7EB 2AFRA 1B93A 3W5SA 1EDBA 1AXEA 3IOCA 1A9XA 4G8JA 4KPEC 3R0ZA 1JRLA 1H2BA 1NFRA 2G40A 1JDTA 4QJ5A 4Z9FA 4BUCA 4CYMA 1ZESA 2HHHB 2GBGA 4UAUA 5BUZA 3CVVA 4OLBA 3F1KA 1C9JA 1J42A 2IYWA 4Q47A 5KYXB 4P6VF 3G2PA 1NY5A 2QPOA 4FQ8A 5ALLA 3CF6R 1OUMA 1FP6A 5D87A 1DEHA 2ZJ3A 1RABA 3EZYA 3LBIA 3RRYA 4AQDA 4B4VA 5ADWA 5IRCD 1I6WA 1DG1G 1DJLA 2AFHE 1PDVA 2E82A 4AZSA 1VKJA 4IOLA 1EEXB 2PLRA 4OA5A 5J58A 2PZ8A 3PGLA 1OIVA 2BKVA 2J0UB 2XWSA 3A58B 4RQTA 3KUXA 3M5WA 4XUCA 4XQGA 5FTLA 5JPDA 1ZH8A 3TTTA 3EIEA 1ZI9A 5BUQA 1LFDB 2WAMA 2BKUA 3USZA 5CHEA 3WY9A 5FPSA 1EQAA 4RORA 1BDMA 3R40A 4IIYA 4ZEVA 3MAGA 4GOOD 5C1OA 3IJRA 2A86A 2ZSDA 1QNFA 3JYPA 4U2BA 5FYQA 4KR9A 2FW1A 3GYGA 4G26A 2H5LA 3I53A 1XMXA 1L7MA 3AL0C 1KFCB 2OXEA 1QH8B 3NHWA 4AJ9A 2CXNA 4PZEA 4BFTA 2ZT6A 4BQRA 1ECLA 1II8B 2QVLA 4HH0A 1GGJA 4Q66C 3AMVA 3LBHA 4R05A 2HRZA 5DFAA 4DGSA 1Z13A 3NHJA 1P2VA 2PL1A 3C85A 3LDAA 4IRXA 4WFQA 4G0VA 2PSDA 4AMBA 3ZJVA 2QAGC 3H9JA 1E5DA 2HPVA 4ZTUB 4W1SA 3TEMA 4AO7A 3ICEA 1KJNA 1L4EA 2W58A 3QNUA 1E6WA 1JHUA 1QRSA 4LECA 4WA8A 1W8IA 3CTPA 5K3BA 3JVDA 3RFVA 4MKHA 2A5YB 1Y1SA 3HGQA 2OFOA 4IDPA 4GPTA 5FOTA 5AIAA 3RSOA 1VG9B 1XRJA 2AC2A 4CV1A 3BMCB 3U7JA 3H5NA 3H7AA 4QFBA 4OPOA 2B4RO 4DEYA 2D8MA 3QW2A 1YVPA 4WDRA 1LPMA 2C5AA 2GARA 1ZITA 3W5UA 3PNOA 2WJVA 1Z8NA 2YL2A 4J8PA 4OGGA 4RBNA 4UM7A 5FPTA 2HJVA 4WKGA 5I4KA 5EXPA 2PSFA 2WIAA 3EGXA 1ANKA 4XX0B 4GOXA 4WTOA 5FPYA 4HKTA 1C4OA 2CNLA 3NTQA 4D57A 4ND4A 1HLFA 3L6RA 5C5IA 3BL5A 4Z4UA 3OTGA 3VSDA 4OF4A 3RYFB 3OE7A 1PV4A 4G37A 4MMXB 1XYYA 1YIAA 3D3NA 5HPYB 3BT7A 3EHEA 1QS0A 1VHEA 4JL6A 4TYPA 5LP6C 1E3TA 1RIIA 1X7WA 3ZU4A 4DVJA 4HZUB 2ZS8A 1CUDA 4M0LA 3NHKA 4MCAA 3P19A 1P44A 4H16A 2O8DB 4LRUA 3UYLA 1SU4A 1P6UA 1PTKA 2JKZA 3E8MA 1KD1D 5L95A 1U6IA 2I65A 2BEUB 3QBEA 4JFAA 4MLDA 4CBVA 4XWOA 3D3KA 1VJSA 3B3JA 5TF4A 2HRCA 5JJBA 3LKDA 2PYDA 2WQZA 3RVJA 4F4UA 4MA5A 2ZTLA 1U2ZA 2YJNA 1AS3A 3CUSA 5GONA 3VX3A 3PC7A 3K8OE 1AKYA 4DQUA 3F73A 5TPZA 3IPRA 4FMCF 1ECCA 4D45A 4WNIA 2GM4A 5HZMA 3FZQA 4WKOA 4GYYA 3OE4A 5BN5A 4Q3KA 3RLFA 5DRYA 5LPNA 3WGKA 5BOSB 1OTXA 2M32A 3ZDRA 1R8XA 2R6JA 1PCXA 2V9PA 3S6JA 5A4KA 4Y0AA 3E5MA 3ETJA 2ZRKA 4RA6A 1XKXA 4G9BA 3WKCA 2W2PA 3JD2A 3FSGA 1RPTA 1V6CA 2EX4A 2FNAA 2PV0A 3CNEA 3O38A 3W79A 5KPJA 3KQUA 4IS2A 4XR4A 1QLWA 3RS5A 1SKYB 4KWEA 5I8ZA 3DL4A 4EO9A 3C1TA 1ZOPA 2CEKA 4D4IA 3FMPB 1BEEA 4GP6A 4XPIB 3EIQA 3FX2A 1NPDA 1QRTA 3WWOA 1SXJE 1U0EA 2WKQA 1CB7A 3EVEA 3DFMA 4V3CA 2ZRNA 4W1RA 1ZUWA 2CLSA 2GTPA 3CNLA 3E1GA 1B6RA 4MQ6A 1IVYA 1NBIA 5DGHA 2X1MA 2OGUA 1HM5A 3H0EA 4D97A 2BHLA 2H07A 4D82A 2Z09A 2VDMB 2WM9B 3VDQA 5C5EA 1KH2A 1A88A 1QO0D 1J21A 2ANBA 4AKSA 5EHNA 3UC5A 5L8VA 3BL8A 5IVDA 3ZIDA 1J5PA 1OI2A 3JARA 4WT7A 3EEYA 1Q14A 4RPGA 2HF9A 2NVWA 4FS3A 4QXAA 5CVJA 3HNOA 3R3VA 3UUWA 4CM5A 2WIFA 3C6YA 2AMFA 1M2NA 3SJPA 1CUBA 1O4VA 2GM3A 4RIIA 4CG1A 2J5KA 1ZXLA 1SEPA 1ZGGA 4KI7A 3B7GA 3DE1X 3LA6A 3A35A 3NMUF 1LWNA 4CFSA 3EGWA 4DV5B 2ATCA 4PABA 1A5SB 1VL5A 3BH6A 4C4YA 3MSXA 5G3ZA 3E8SA 5CB4F 5IKXA 2J0UA 1MJHA 2PBRA 2XIJA 4JBWA 1PKXA 3W1WA 2IBTA 1I0LA 4JLNA 5ULLA 1EZ1A 3NBFA 2GZ3A 1P61B 4RZIA 3ICQB 5MF6A 2BDUA 1R16A 2ILTA 2OQRA 2MWMA 2FG5A 1M2KA 1SA0A 1WSAA 3HSYA 1OGJA 4L16A 4C5AA 5A4JA 3TWOA 3KFLA 1O6GA 4O1HA 1N33B 3P9QA 3SVZA 2TYSB 4U2GA 4P54A 4YROA 4TYMA 1KHTA 3PDCA 4FGSA 2VBSA 1JVNA 2VP9A 2XDQB 3VZCA 1UMDA 3KEMA 4EH1A 1H22A 4PBSA 4E70A 4QG3A 4CF5A 4GPAA 3SSOA 1FU7A 4Z0NA 2YY6A 4CM1A 1E1MA 2DBRA 3O2QB 3DAFA 3KT6A 3RUHA 3VYSB 2PGAA 5D1HA 1F0KA 2X15A 5F1PA 4J49A 1FBNA 2E5LB 3S1AA 3NASA 4ML3A 4OOFA 2WUDA 1J0CA 2HAEA 2FV8A 2NGRA 1J8YF 2IPLA 821PA 5EJ6A 2WJYA 2G8NA 2FSVA 1Q0RA 2FMTA 2P35A 3B6MA 4IIVA 2D8AA 2ZJOA 3R3XA 2VLIA 1YC2A 1QG2A 2VZ9A 4L5IA 3UWDA 1D7AA 4V1CB 221PA 4R1TA 5AVKA 1Z2AA 2OHVA 2SICE 3FTFA 4JODA 1W6RA 5A0FA 1BQ4A 2QMUA 2A0UA 2YQZA 3FSRA 4K8OA 4LA4A 1NQVA 4PYKA 3LKZA 4R68A 1DAFA 2JCYA 5HFJA 3NETA 4QU0A 4KR7A 1ZCBA 3QPUA 3QTBA 1UPTA 3BHIA 3N28A 3PU6A 2WFZA 4MPTA 3UUEA 5KJ1A 3AW8A 3N9IA 3H87A 3KE9A 2NX2A 2ZVPX 4K81B 2C7BA 3AETA 1TU3A 2VJQA 3O94A 4UW9A 4X54A 2FUKA 2X85A 4L3OA 3ETHA 4HVTA 4XYBA 1ST3A 4EUNA 4YV2A 3PXBA 4QFCA 5JS7A 1FX1A 3EPKA 4XM3A 3ZBTA 1PFUA 3GRRA 5JVDA 3QHPA 4MUHA 2VJIA 3TX2A 4BLUA 5KZMB 1WKBA 4C7OA 3ZWMA 2QE7D 4WH0A 2CL6X 2JDIA 1GGKA 2FPXA 2G1KA 2IYSA 3BTOA 2W48A 3GEEA 3KPUA 3R0IA 2XF8A 3IMCA 4KQGA 4EW3A 5DCLA 2I62A 3PDJA 1V5FA 4MVJG 1KSJA 4AB1A 3H1GA 5L46A 3UV7A 4W82A 2X0FA 2J6HA 3WGJA 1RM4A 2MSCB 4BDSA 5LU8A 3G2IA 1T3LA 5BMVB 2FPWA 4HDNA 4JYZA 4LVOA 4L6IA 1R2QA 1TQ4A 1BMTA 1T15A 5DSZA 2FQYA 1LX7A 1Q44A 1A4IA 1BGWA 1JQBA 1R74A 3PD0A 5AJVB 5GZ6A 1SCAA 5E2IA 3RK0A 2Z08A 1NMYA 3AM5A 4LTDA 5LIRA 4PZLA 1I4EB 4XD7A 1LQUA 2C98A 1PL6A 5EXXA 5A2QA 4G0XA 1FPQA 4PSCA 4ZRDA 5KS2A 2CXQA 3MPUA 4H77A 4PAWA 3R6TA 3T5PA 1JR6A 4NDZA 2DSNA 4RLQA 4U9HS 5FBVB 3EVZA 1HNWB 3BERA 2B0JA 3CMCO 1MA0A 2WWFA 2QTAA 3AIOA 3SM9A 4YAWA 3FFXA 2H7VA 4HYQA 2P91A 2ZL7A 3DTVD 4K9KA 1L5HB 4AQ7A 3NBUA 2C8VA 1AK2A 3ECCA 3ZE1B 4LZJA 3T1NA 5JMWA 1KC8D 4IQFA 2CE2X 2NMVA 4X7EA 2JCGA 3GT7A 4FNGA 4I3FA 4L5BA 3SQLA 3ZHTA 4ER0A 1QH1A 5AO9A 4QEDA 4F5YA 1AMOA 3U56A 2IXEA 3FPKA 3I1JA 3VRHA 4KV7A 2JEYA 4KWCA 4HWKA 2ONKA 3R5HA 1TF7A 2MIIA 1WSDA 1NGSA 1IHOA 3G5UA 1K5GA 3OSUA 1X1AA 5E0KB 4E3WA 2WUEA 4YLYA 4LJYA 1CQZA 5BRNA 1K5PA 2XUZA 3DM5A 4QTXA 2AF3C 1MT0A 1CR4A 3EJWA 5ICCA 4R8RA 3PD1A 1YRBA 4U2EA 3JQ7B 2DTEA 3PP8A 1TYAE 3M2PA 4NZNA 2SECE 3BB1A 1QSGA 1PGJA 3OW2B 1E2PA 3MCWA 2B3DA 1SVKA 2WYOA 4NE7A 5KKNB 1NNSA 4O2AB 1Y42X 5HKKD 1J0BA 2PL9A 5ILGA 5KX5B 1ISIA 1FMTA 1IBSA 2P2LA 3D3EA 3NIBA 1SCJA 3KAKA 4GWGA 1OI7A 5K0ZA 4CEIA 1KRXA 1ECPA 4B81A 1FRZA 1T0JB 4HDRA 1P7VA 1Z88A 4JXJA 1A96A 1RQXA 1YVUA 1HV8A 3N5KA 1UKYA 5HZBA 1CQJA 1NVXQ 2AV6A 3PUVA 1U8EA 2CNWD 2GKGA 4IS3A 1XQXA 4NXMB 3KUCA 2D3WA 4CCSA 3G59A 5ER9A 4OLJA 4QDTA 1A5ZA 1PTJA 1N6RA 4RCVA 1RWMA 2PQ0A 1L8XA 2IOFK 3BORA 3EW9A 3T0GA 3CONA 1CZHA 1N2CE 1RBQA 3KUKA 3TUIC 4QKQA 3AU9A 1TTQB 3L82B 4MB6A 5TB5A 3G7SA 1FQOA 4UE2A 1BROA 3KK0A 4IF6A 5FORA 4C3VA 5DNEA 4QAJA 1UANA 1XQ6A 3E9YA 3IAM1 5FAXA 3P8ZA 2J85A 1KR5A 1S1CA 3M5CA 2B8WA 4FOPA 5EEGA 1FSPA 4Q02A 1CRPA 2JJMA 3BC1A 1FFEA 1SOAA 3AH8A 3RJMA 1M6VA 3OX4A 1NVAA 2IF0A 4ZEOA 3ROPA 2ZPUA 1OW3B 3KYDB 2BD0A 5GV7A 2CXUA 2HSEA 4R5MA 4CI9A 4PYIA 5LWHA 2ZL5A 3WLJA 1GAEO 1M2JA 1XAGA 3OWXA 2R86A 3Q4GA 5B1DA 3GDHA 1CUHA 3GMSA 3IMKA 2OTJB 3RUPA 3QKRA 3SN6A 4X1KA 4BFXA 2GM5A 3OZWA 2WAOA 1KRHA 2XCIA 4XWWA 1H4VB 1QKIA 2C5FA 4N7BA 1ZQ9A 2X7HA 4CMEA 4A23A 5KQGA 4LF9B 2H2DA 3G1UA 4DLUA 1XDGA 1GARA 1XTPA 4GEGA 4KRGA 2AW5A 1T1JA 4R7GA 1QVFB 1CDDA 2OCLA 3LLCA 2VHEA 3ZY4A 4TLBA 4H7DA 4XRGA 4XVCA 2G0NA 2PKEA 1I4TD 2DH6A 4I36A 4JJ8A 3RI3A 2IX3A 1VCIA 4EHKA 4LOJA 4ZVQA 3NOVA 4LYFA 1IULA 3ROGA 1OTYA 1P6XA 1WCYA 3O90A 1Z16A 3OLZA 1Y6JA 4UULA 3WICA 4AP9A 1LTHR 1GZ7A 2AJTA 2HWUA 1PBTA 1X92A 2WJHA 1MHTA 1U11A 5C7OO 4M8NE 4ARZB 3EXIB 1E8NA 5D8DA 1C7FA 3RT1A 3H17A 3VXKA 4EMTA 4DXDA 4URZR 2ZQZA 1W9MA 1TEXA 2C31A 4ENWA 1K73D 3AR3A 5MGBA 1NX6A 3KHUA 5LJLA 1F51E 4Z4GA 1O8BA 2NPFA 3UZUA 4D4GA 1QOQB 2RBGA 4JELA 1GKLA 3ZXSA 5EJ4A 1Z7WA 5EFZA 4C21A 1QHXA 3OCVA 3FA2A 4P4NA 2X9QA 1JHAA 2ZR9A 2ZSHA 1LJ8A 3K05A 1BD4A 4IG4A 1CRLA 1WEKA 2VF7A 2WHPB 1CFZA 2COKA 1NFFA 1E2JA 1YO6A 1DPFA 2AXPA 1GFIA 1R6AA 4UHDA 1SOUA 3S7ZA 3R44A 3HV0A 4WEQA 1GP2A 3CIFA 1LQ2A 2CVOA 1Z4KA 2FPIA 4JLBA 4UNSA 2GTHA 4FJ2A 5IVKA 2QYHA 2XWJI 4G5QA 4Y1RA 5G02A 3SC6A 4N82A 4UUQA 3PHHA 1KO7A 4Q1FA 1EWKA 3EAFA 4R1LA 5C31A 3ADDA 1H1TA 3W78A 5G0VA 1D4FA 2WB4A 4JEUA 4MWZA 3VJKA 4F3KA 2NUAB 1K86A 4IDEA 5J59A 4G85A 3H97A 3BK7A 2FPMA 3NYQA 4ENUA 5JAZA 1YMUA 2C5GA 3WS7A 3PZRA 1SKUA 3O4IA 2V58A 5CFLA 2VTEA 3HM2A 3P2IA 1G7CA 1PFVA 2QN6A 3DT8A 3FFBA 5BSGA 2YJTD 5CDGA 5JSQA 1DKRA 5AVVA 2IXFA 2QPTA 2XMDA 3BVPA 3A25A 1CE8B 4WN9A 3RC2A 4GDFA 1WW8A 3WLFA 4BMPB 3UMFA 1R0ZA 1D6JA 3DZFA 5ER6A 4CDNA 4BNZA 4OO3A 1WEHA 2VXOA 4PM4A 2ZTUA 3C6XA 3MBKA 3UJDA 2PSJA 1N34B 1PR3A 4HDRB 1JIVA 2UDPA 5FTWA 1X7XA 5C7LO 1YMQA 1P7YA 3PNLA 4L5CA 1BHO1 1DUVG 2HR1A 4LQCA 5THQA 1KYVA 3UFXA 1EXNA 4PYNA 1S4QA 3RVLA 2BSXA 1ZLXA 3E03A 3G89A 4M0PA 2QMOA 2H2WA 1C50A 3OZXA 1GFZA 2M5SA 1N9KA 4JLVA 5GPBA 4DV2B 3D2LA 4C3UA 5HQ3A 1X8KA 3AHGA 3VNVA 2H8KA 4ZREA 2H4XA 2NO1A 5F3WB 3AUXA 2FJ0A 3KYIB 4RPLA 1AS2A 3F5QA 3F90A 1ODCA 2ZB2A 5COQA 2ZZQA 4KR0A 3AILA 1AKTA 3KXPA 1WKVA 2E37A 2DLCX 4W5NA 2CD7A 5A71A 2JG3A 1EX6A 4U8GA 4GXNA 2UXDB 4ZV9A 4UBNA 1Z74A 3MTBA 1QFXA 4HQ0A 3G5TA 2BAGA 1Y5NA 2OHJA 3B85A 3LSTA 4IDGA 3CE9A 3EF3A 3KTAB 4JITA 3B1WA 3V8NA 5A2GA 3GZTB 1KWKA 5JJ5A 1KAGA 1POXA 2B1QA 3C15C 3K9WA 4IDFA 2M6RA 1FFXB 1M2OA 2G5CA 5BR1A 5JDIC 3B6JA 3ESCA 4YQZA 1PK8A 3D7KA 4PAGA 1ADGA 3PFKA 5J63A 4E5YA 3DZDA 4PC1A 2XQIA 3DVAB 3TYXA 2I4RA 4BJ3A 2PX3A 3HYCA 2QBYA 1XDDA 5HTOA 1V48A 1T5EA 2ORWA 4GSKA 1EG2A 3JYNA 2CJFA 4ZA2A 1T8PA 3MWEB 4LRTB 4DLKA 2I67A 1AIPA 4XAQA 3WLEA 2HA6A 4P3YA 3PT5A 4K9SA 4ZT6A 3NDBB 3FYTA 4BWYA 1VXRA 1DE0A 4D80A 10MHA 4LXIA 2PFKA 1DXHA 3QVMA 2OQ2A 3WYNA 4ZI7F 3ABOB 1TCVA 2ZULA 3BPSA 2Y0PA 1EWVA 1ULSA 1DCKA 2LRHA 3IX7A 2ZIXA 3EZ9A 2NTVA 3MWKA 2PMEA 1IPHA 1CY8A 4MSUA 1NN5A 4BV2A 5JJCA 3PFCA 2CL7X 4F7WA 2YZ7A 4EJ0A 1P4RA 2XT6A 5J43A 1G41A 3D6JA 1KKLA 4R83A 1JAHA 2QTCA 2ZYWX 1JTFA 1L4BA 1V37A 3ZE9A 2JNWA 3ZGLA 5IG2A 3PEYA 1TAQA 3GLUA 4M54A 4DIBA 3GLHA 1DIBA 1VM6A 1EPUA 1A27A 4O1MA 2OC9A 4OOSA 3MCZA 5JCXA 2PUBA 1LDMA 1ZK0A 2G63A 3HXKA 1YOVA 5JSFA 4TYQA 2BM0A 3IDOA 3CZQA 4DRYA 1KTIA 1DAIA 3ZQJA 3EY4A 1D4AA 2IYVA 3HC7A 3MUEA 2Q1XA 2QZJA 5TS2A 5CA1A 4OP3A 3SKXA 4DR5B 1NUSA 2YXBA 1RM3A 1AKVA 2YWJA 2PBLA 3LXXA 3H2IA 3QPCA 1YULA 3Q3VA 4QQKA 5C18A 3SZRA 2FDXA 1RWQA 1PHRA 3H8VA 1LKZA 4JI4B 4S3MA 2VZ0A 4QJ3A 4HUQB 2V8OA 4J1TA 1EP9A 1GGVA 2FX2A 5DGCA 2DXIA 4RPDA 1X0XA 5HCNA 3LOPA 2XVZA 3I30X 4P0QB 3ONDA 4FFLA 1Z6TA 1E96A 1NR1A 5AK6A 3RU2A 4D4KA 4KG7A 3B1FA 5CBPA 1IBCA 2PXAA 4S04A 2KQUA 3LIPA 4DR1B 2PBFA 4GOJA 4AJNA 2GXQA 3TLGA 4YAKA 3OCYA 5TGTA 1RHUA 3WIEA 4ARCA 4XEUA 3J80A 1H6BA 2AK2A 4PRYA 4OLAA 3EFBA 2G1AA 3KJFA 1DKLA 2EJTA 4YJ2B 1A3CA 4JYBA 3UO8B 1NSTA 2V8BA 5J4YA 4OXXA 3REFA 1FP7A 3ON5A 3OLXA 4E11A 1W4ZA 4NJOA 1NQWA 4OM7A 5JZSA 1OT5A 3SKVA 3EVGA 4IXMA 5LUAA 4RVUA 2VRCA 1SEVA 1XAIA 2FLWA 3K53A 3HBNA 1SVUA 5EY5B 1Z2CA 3O03A 3UOWA 3DZKA 5EGSA 3K1AA 2A59A 2GFQA 2DEUA 4ZT5A 5JYBA 4KMRA 4NEHB 4XM1A 4XZ3A 1ORHA 3FYSA 3GHYA 1XA3A 4A2WA 2XHEA 3EQ6A 1KQPA 2C5HA 1FFWA 4MKIA 3A1WA 1HLDA 4ARUA 2XQJA 3CLUD 5LDGA 4YFVA 5DGXA 1QMGA 1UJNA 2AYYA 2F1RA 2HLHA 3DCIA 3U7QA 2VDQB 3P2YA 1D2RA 4CEHB 2QQEA 1T1EA 3KNZA 3TW8B 3OP1A 4DSTA 2Q1SA 5IVPA 4TRRA 4JT9A 1RLJA 2CZGA 2E6KA 3DLIA 3EVCA 4YTEA 4FMCB 1NZJA 1F2UB 1CDEA 2A0XA 3LY9A 4IDAA 4PYLA 3PC2A 5TPWA 1BJRE 3LBFA 4I55B 1IBMB 1CUSA 2EC5A 2PR2A 1QGAA 2FR0A 3QLJA 3M9WA 1FMCA 2QN9A 1UH5A 5CCEA 2P41A 3ETCA 3DMYA 3OIDA 1RXVA 3HZRA 3B1ZA 3FJOA 2J33A 2P9ZA 3F3KA 2FSSA 3NDRA 3QIVA 4GLFA 1K6JA 4YCBA 5HE8A 1Z2PX 5T4FA 3OFNA 4AMYA 5JCPA 2H6EA 2J3IA 2IYXA 2O8EA 4B4DA 4RTLA 3LKVA 3OEWA 1JQDA 3PDHA 4PBRA 2EWMA 1AB6A 3HKCA 3M8KA 4UVIA 2GLTA 1ZEMA 4W7IA 2XB2A 4JUAA 3MT8A 4C07A 5BT9A 3C5EA 3O4FA 4UBOA 1ZFNA 3CLSD 1ZU4A 3HBLA 4JQCA 3T7KA 1M6NA 4HJRA 2H48A 3ZGYA 4PZZA 3ZDFA 3V00A 3U7RA 4UHJA 1QZUA 2HJSA 2PAAA 3DDZX 1U5BA 5HF8A 1MEOA 2H4YA 3Q2KA 3BF8A 4GGPA 4KAFA 5CEFA 1TJYA 4N0PA 3EIFA 4OK3A 3DOJA 3E82A 6ABPA 3UK1A 4EJSC 2PVPA 2PUTA 1CBUA 2EZTA 4MYHA 4B7UA 1SVWA 2WU4A 4EFNA 1MIHA 2OENG 1Z6AA 2FXIA 1XV5A 4ZO8A 1OT3A 2RGCA 5IEBA 3GLRA 2D5LA 1E94E 1NL3A 2HXSA 5DV9A 1CJSA 4ZRMA 1L5HA 4CIWA 2GD2A 2C2YA 1YZNA 3BGDA 3S2FA 4MVJI 4DCCA 3K9QO 5C0OE 5HOQA 4Z0HO 4GLBA 3HA2A 1UDRA 1N2CA 2VJYA 2R6FA 1PW5A 5DHFA 4WNCA 1LLFA 2WG1A 4G8DA 3OWOA 2P9GA 1MN6A 3EOAI 5CFRA 3ZQKA 4DKJA 1OH6A 3V7YA 2GAJA 1QH0A 5AUOB 1IJKA 1Z8HA 2RGGA 1C41A 3TEJA 1U3CA 3D8SA 3GW8A 3S8YA 4OM8A 1N57A 4QSMA 3UHFA 2YYSA 4B40A 1EX7A 3W5BA 2GVDC 4XORA 2WFAA 4J76A 5LVAA 3CIOA 3RC1A 3FNIA 1EGVB 4K0RA 2Z2XA </