1GO2A

Structure of ferredoxin-nadp+ reductase with lys 72 replaced by glu (k72e)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGEPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP+ REDUCTASE
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2001-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1go2A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1go2A02
4B48A 1GVHA 4ZCLA 2BM0A 2RC6A 4C0SA 4ZCMA 2XNCA 3W5HA 4J0QA 1QUEA 1JJ2B 3VO2A 1TVCA 2C77A 2J7KA 1VQPB 4NBSA 3U2QA 4F7DA 5EMNA 4YALA 4BPRA 1FNMA 2AHOA 1YHQB 3VNUA 1N8RD 3WXMA 4R71A 1QGZA 2C78A 3CW2A 2BM1A 4YAUA 2DY1A 1H42A 1H85A 3JQQA 2E1RA 3G4SB 5THXA 3CPWB 4QHYA 4PC2A 1D2EA 4B44A 3AVXA 2D74A 1KTVA 3W2FA 4ZV4A 1QGYA 4RCZA 4FWTA 3FJOA 1QX4A 1VQ5B 4HE6A 1NJID 1E64A 4QFMA 3B82A 4LBWA 2EIXA 1EFUA 3W2GA 3WNCA 1S72B 3AVVA 2YWEA 1BX1A 4YAOA 3B78A 2QDXA 3LVBA 4AC9A 1K9MD 1KD1D 2VNIA 3I56B 3ZZUA 1KK0A 3G71B 1SKQA 4B3XA 4LC0A 2PMDA 4M2LA 2OTJB 3I55B 4C43A 1GR1A 3ZC3A 2QN6A 3ZZTA 1E62A 3B8HA 1UMKA 1KC8D 2DERA 2BF4A 3AVYA 4ACAA 1DDIA 5TV2A 1R5NA 4P6VF 3MCAA 1YI2B 1OB5A 3WNBA 4G5GA 3CC7B 1ZM3A 3W2EA 1EXMA 2BPOA 4B43A 1M90D 1KK2A 4WQMA 1VQ4B 3LO8A 1QH0A 4RD3A 2XEXA 3FPKA 3CXCB 4G1BA 1KK3A 4AF6A 1KRHA 3A1FA 3AVWA 2BGJA 2B7BA 4LBYA 4UAJA 3W5VA 3VO1A 4ACBA 4B4DA 1YJNB 4AF7A 1TLLA 2OTLB 2CNDA 3I1FA 3SJZA 1E63A 3MMPA 3OZUA 3CCSB 2VNJA 1S0UA 3CCMB 3QE2A 3QFCA 1GJRA 1HA3A 3WNDA 2BMWA 4B47A 3CMAB 1M1KD 2YWGA 1EFTA 2QTZA 1VQNB 1KQSB 1FDRA 1QGAA 3WBKA 3OJWA 2BV3A 1ELOA 2CRVA 1QG0A 3OZVA 2BSAA 4HE5A 1YIJB 3CCVB 3QSYA 3LRXA 5AN9A 1D1NA 4DQKA 3CCJB 1QFYA 3CC4B 2B7CA 1IB0A 1R5OA 4LBZA 2HCJB 1J9ZA 1CNFA 3W5UA 1U2RA 3V76A 1FRNA 2GPJA 4M53A 1VQMB 1D8TA 2QA4B 3ZBTA 1Q86D 2XNJA 2QEXB 2BVNA 3AVUA 2R6HA 1W2BB 2VNHA 5KSWB 1BQEA 4RCYA 2BN4A 3CCUB 4YAWA 4IW3B 1SM4A 2B5OA 1TTTA 3CCEB 3WBJA 1IJFA 1NDHA 5JBQA 3JQRA 4ZGNB 3U6KA 2GQFA 4NCNA 5GV7A 1OGJA 2HDNB 2X3UA 2EFGA 3E20A 4MYTA 4DQLA 1WDTA 1VQKB 3G6EB 1FNDA 3CCQB 3U6BA 3OZWA 4ZGQB 4Y9RA 2YWHA 1XB2A 2RC5A 5HXBA 4PGOA 2ZITA 2VZLA 3OJXA 1ZUNB 1B23P 1FNCA 1TUIA 4EH1A 3CB4A 4M1KA 1DDGA 1JB9A 1KJZA 4ZCIA 3J81k 3CMEB 3MHPA 1F20A 3WYAA 1QFJA 4G1VA 1ZM4A 4PC1A 3VMFA 1BX0A 4M0LA 1G7TA 1JNYA 1KK1A 4RJLA 1XE1A 4N3GA 1Q81D 2OK7A 1Q82D 4N3NA 1AMOA 3CD6B 4P3YA 2VYQA 1JA0A 1I7PA 2HMAA 4YAFA 1K73D 1IJEA 4TMXA 2QTLA 3PENA 1VQ8B 1N0VC 2BGIA 3ZZ0A 4TMVA 1K8AD 1BJKA 2QMUA 1OB2A 1F60A 1CQXA 4YHBA 4U9UA 3CC2B 1FNBA 1EP3B 3ZBUA 1QVFB 1QVGB 1VQ6B 2DETA 1QUFA 1JA1A 5GV8A 3JQPA 4Q7JB 1FRQA 4RD0A 3CCLB 1EP1B 1N0UA 1VQLB 3WY9A 4PC3A 4PC7A 2VNKA 4RD1A 3W2HA 1DARA 4M4SA 4RD2A 3AGQA 1W87A 5TR9A 4TMZA 1CNEA 4K1XA 1W35A 1YITB 5DSZA 4MYUA 3QFRA 4FK8A 1VQ7B 4PC6A 4Y7CA 1Q7YD 2FX3A 1B2RA 3E1YE 1ZM9A 3LYUA 1G7CA 3CRZA 5TY0A 3W2IA 1AIPA 1EP2B 2YWFA 1EFCA 3P26A 1YJ9B 3AGPA 1ZM2A 1GAQA 3CCRB 1G7SA 2NPFA 1A8PA 3ES9A 3VNVA 1YJWB 1R5BA 2PLFA 1G7RA 5H59A 1QFZA 4H9GA 4TN1A 2DEUA 1GO2A 5FA6A 2DCUA 3OW2B 3QFSA 1VQ9B 1OGIA 4TMWA 3QFTA 1VQOB 4FN5A 2PIAA 1EWYA 1GAWA 1W34A 4Y9UA 3AVTA 4RD6A 4LBVA 2OK8A 1DG1G 4TMTA 4RD4A 5H5JA 3P27A
chains in the Genus database with same CATH superfamily
3A4YA 1I9GA 3U9LA 3VR5H 4RBNA 2VHYA 4DJEC 3RC8A 4K1LA 1KEUA 1KS9A 5CBKA 1TEXA 5M2QA 2ZT7A 3D7RA 4O3MA 2GUWA 2V6GA 3M6LA 4CQLA 3EXEA 3IT3A 4BEJA 4P80A 1H0HA 3R3VA 4E88A 3GPIA 2B1GA 3AZPA 3NV7A 3VDQA 1NPTO 1G17A 3OUUA 2JAXA 4M1ZA 4F5DA 1K4KA 1X1QA 2Q4DA 4YCCA 2ZVDA 2RARA 3FOAA 2YQ4A 5JV5A 2QJWA 2FQ1A 2JANA 5CAEA 5I3ZA 5EESA 1IY1A 2GXSA 3TNDA 1H2BA 2H1VA 2O2SA 3EY9A 1RQPA 2GZDA 2WIGA 2PM8A 2NZWA 4EHKA 2HLPA 1QGUA 4PX5A 2OGWA 1C1XA 2QM8A 1TE2A 3HP4A 2ZT6A 2QPOA 4UEQA 1UP6A 1TM5E 2B37A 2I8AA 5AYVA 1T5HX 4KFUA 2H2FA 3RIYA 3ANMA 1SO8A 3RKRA 4R8VA 3GA0A 3IP1A 5HZBA 2I6UA 4GF5A 2W2OA 1VL6A 1CHNA 2N75A 1WHTB 2HWUA 1ORHA 1QOQB 3SHTA 1HNZB 1EFHA 5ETJA 5B1DA 4CQLB 4DC0A 1XRMA 1R6DA 1ZJ5A 2MR6A 2RGAA 3GFSA 1R2QA 2BEWB 3Q10A 1W73A 3AXTA 4KP7A 4W99A 5TT0A 3RSHA 3SE0A 4D8UA 1TCCA 2GK4A 2QTCA 2XGSA 3GRRA 4M6WA 3UJHA 5LVAA 1YBVA 1SHZA 4HTFB 3EIUA 3TXXA 3ETLA 4MRNA 2E1RA 4LXHA 3UPUA 3D6UA 1ZGZA 3ROFA 1L8AA 2PUWA 2EWWA 5ALZA 1EDDA 4MUGA 4EO4A 1E9CA 3IIKA 5L6MB 2EFEB 2JHPA 3E9ZA 1JT9A 3JU3A 4URYR 1V1RA 2WP0A 4LYEA 4OX9Y 5BSTA 2C84A 1NG1A 4P36A 2O7RA 5HJ2A 1Q7EA 2BTQA 3ZWWA 3VX3A 2Z4RA 4FYPA 2QAGB 4DMLA 2F48A 1ZVVA 4C7XA 2AG8A 5FPQA 4JKYA 4QJBA 3UAVA 2I4OA 1FRFS 2Q21A 2XR1A 1HC7A 2XIQA 4RMHA 5C7LO 3K2IA 1C8LA 3G2PA 4YO7A 5KX5A 1F0PA 2Q62A 5IYWA 1U81A 5DBIA 3PUNA 3ENKA 4G97A 3COYA 4GM4A 1QX4A 2ZSIA 1BRMA 5E4FA 2JEZA 3OEED 1VQ5B 4Y2TA 1PNRA 1N3BA 1RLTA 5TB5A 4XWWA 1POXA 2ROQA 2J3JA 3ZE1B 1C3OB 1D09A 2CZQA 5LYJF 2I67A 3IIJA 2BH2A 3EC1A 3ZCPA 1FVFA 2P0EA 5FA8A 4AJPA 3Q72A 4V1CI 5K8UA 2BHTA 2XUKA 5F4JA 1OLSA 3OF3A 4RJKA 3THSA 2KPOA 2A0UA 3TCXB 3VTKA 2IOFK 2X13A 1VI5A 3E58A 3SKBA 4KMOA 1VG0B 2QDXA 4OGWA 1ACJA 3V1KA 4F1JA 1DKRA 1PR0A 5HZGA 5E38A 3MOIA 3A6EA 3ONEA 1KD1D 1E1DA 2J59A 3I56B 3CIOA 2GLUA 1F51E 5FOUA 5I9IA 2FN4A 2VP0A 4R1SA 4RK0A 3IPLA 4MV4A 4BO2A 4Z3KA 4UUPA 3E03A 4R2LA 4TV9B 2K7FA 3ZY3A 4CWAA 2FR8C 3OJFA 3I9LA 3N58A 4YMHA 2X76A 1QHHA 1MW9X 4WUVA 4QBGB 4PN3A 3JZDA 5DM70 4DCGA 1Y9ZA 1RYDA 3VUFA 3MCUA 4YB8A 5CH8A 1AKUA 4H1TA 2B8JA 3QI2A 2V7VA 1E62A 1CDOA 1LZKA 3PC8C 1WG8A 1GYQA 1FA9A 1I2ZA 1FX1A 2YWCA 3A7EA 5SYAA 4HGPA 4GW3A 1EWQA 2AN3A 2G9VA 3W8EA 3FTPA 4FMPA 3TFWA 1RS0A 2WU0A 4PONA 2GREA 3X2SA 4E5UA 3PCXA 1UD8A 2O2ZA 4UFNA 3RAJA 2QJRA 3ZE9A 1JZSA 4G0WA 4PGMA 4MUMA 4BKRA 2VBUA 4ROTA 4DLWA 2A9OA 4AJNA 2H2AA 3HB9A 1UPUA 4LAFA 2I8CA 4DMHA 2JJ2A 3OMXA 1L7AA 3KOYA 2H0QA 3HZHA 4WGGA 2EF1A 3FVVA 3C6BA 4XOIA 4LHSA 4Q4AB 4RLSA 3R74A 4DUYB 1D2GA 4LZNA 4RVHA 1SRRA 4BCDA 3A26A 1Z5PA 3L92A 3VXKA 5TMDA 4K9PA 2HHJA 2C92A 1AGXA 1LXCA 2DC1A 2NGRA 1V96A 1LF0A 1LI7A 3KSZO 3JSXA 3WHPA 1AZTA 4QO8A 1R37A 2JAOA 2VATA 4GMXA 4MQUA 3S1AB 2AEJA 3GZTB 1KU0A 2C58A 1K92A 2Z98A 1PRYA 4MV1A 1CS0A 2VPWA 4CMCA 3ZDFA 2ZJ2A 3A1FA 2V3VA 5JJIA 1YE3A 2QGZA 4MV7A 5BVGA 4RDXA 2AK3A 4LBYA 1KF0A 1UQRA 4IKEA 4KN9S 1WZCA 4OQNA 4EX6A 3WISA 3R3UA 3DMFA 3FTEA 2R6GA 4LCJA 1VKZA 1ZKDA 4MWEA 3I9KA 1J33A 3MJDA 3ZYCA 2BZ1A 4R4JA 2HQRA 4OQZA 1NJFA 1EWRA 2VPYA 2WILA 5A8AA 2VWQA 2ZYAA 3PGKA 1DUSA 4OHPA 3HFGA 2ZJ1A 1E63A 3GCWA 4WGFA 1ZHHA 4JOSA 5A02A 1XTTA 2XRMA 3NOVA 4QDJA 4CMGA 2GO7A 4L08A 1Y6QA 2C0PA 2CLFB 4TLAA 4YT8A 1DCTA 4OD0A 1W5BA 2ET6A 3QQPA 1PDVA 3QX8A 2PHZA 1I4EB 2H4ZA 1OFHA 4W1PA 3RVNA 3WNDA 1UXIA 2GAOA 1ZI9A 2DQSA 3EZ9A 4L8FA 4WEQA 5EHIA 1M8GA 4RGVA 3VPFA 3BBPA 2MTBA 1YOBA 3NRBA 1VQNB 4FQ5A 2HEIA 3F49S 3QEKA 1KBOA 4MVJE 4OOFA 4G8JA 5TJ9A 2A0WA 3GMIA 2HI0A 1FDRA 3DMPA 3K72B 3TPZA 4CCYA 3RRNA 4O4LF 1U31A 2BZGA 3P2OA 5F9FA 2HDOA 3L7KA 3R09A 1TEHA 4PINA 3K0CC 3WQBA 2REQB 2QENA 3OE7D 4NAVA 3ET4A 3LFTA 2QMOA 3P0RA 2OQVA 2BV3A 3R7DA 4P1VA 5IXSA 4G8DA 2PKYX 2B4KA 3K20A 1BOFA 1E8NA 4MVJD 3SMVA 1A9XA 2ODTX 1FDWA 2TYSB 4NECA 4J91A 3IRVA 4JY7A 2TRSB 1ZOOA 3H1TA 1QHSA 3OESA 3DDUA 1E2NA 5B4UA 4S24A 3MAGA 1YK1A 4JBNA 2M1ZA 1UM9A 1Y3HA 3OZGA 2QL5A 3H13A 4J8PA 1E4YA 3ROXA 4CLXA 2FWBA 4EEZA 1YBMA 3OLYA 3SI7A 5DLQC 2I87A 4AG5A 1CUWA 5CJPA 3T1HB 2ECPA 2BBSA 3EDRA 1TCBA 2FPPA 3M1LA 1X8KA 3VNBA 3A4LA 3C3MA 1XIVA 1JEAA 3IMEA 3PGMA 4MCAA 4N0MA 4COKA 4EG8A 1KDRA 2IP2A 1ZH6A 4TMFA 3S29A 3V4ZA 3W5UA 1USUA 3R75A 3RS7A 1GYPA 1LKZA 3V76A 4YCSA 2V9ZA 3EF1A 2NSDA 1FFEA 3N2GB 3QH4A 4FS8A 1V1MB 1KMNA 3NBAA 1RFGE 2V7EA 2NVUB 1ENZA 2VP4A 3NYRA 3QVJA 1I33A 3TI9A 2ZUBA 2OCPA 1F3OA 2HV9A 4UTZA 3WLMA 3KB8A 3P2MA 2XTNA 3ZQ6A 4DLVA 4DSAA 2WKPA 2IYZA 3SJCA 4ARZB 2RAFA 4GPEA 3NHMA 5K20A 4GPD1 4QXQA 2B8NA 4JITA 1N0HA 4NWIA 4YJHA 3TOZA 5IJ9B 2G1UA 1J2JA 4WZBE 2Z9DA 1QHGA 2I5PO 3K9QO 1FU4A 1Q7RA 1SG6A 3K4QA 3WYBA 1LI5A 2H2WA 4XARA 1H5UA 4B3IA 4OQLA 1AV6A 2VNHA 2DRIA 2IEAA 3GUVA 4ZO8A 4C05A 1TRHA 1W4LA 1ZO8A 1OZHA 4NSNA 2V6MA 1XRLA 1PEAA 2J3HA 4L4ZA 4RFLA 2B4YA 3FF1A 1PJCA 2Z95A 3VGPA 3OA0A 4L4RA 1LSOA 3JWGA 4C0XA 1L7XA 1RQNA 1XFAA 2GKGA 4MB2A 1P91A 4XCXA 1E5LA 1NHWA 2WWRA 1WOMA 4QTTB 3S1LA 4ZYWA 5LUBA 4ZGNB 4LV8B 3OPXA 4QPNA 5D6OA 1DTWB 1JBEA 5KTSA 3LC0A 2V1UA 3BAZA 1RWVA 3OIWA 4JI8B 1WAMA 3D3EA 4QEZA 5CVUA 1BDIA 1VKHA 4E1AA 1IL0A 2NYAA 2A5JA 2G3YA 3E1SA 4Q1BA 5M34A 4WXMA 2OCKA 1GCAA 3AI3A 3N6RA 3DEIA 4LHWA 3QVWA 3IDOA 5ESXA 2J48A 1GILA 3E8SA 4J0HA 4M87A 5CEFA 1U9CA 2UVPA 5HA5A 3IHWA 3TEJA 4BQIA 3OQOA 1KZ9A 1AK1A 4Y9RA 1ULBA 2AA3A 3COSA 4HH3C 3WLAA 1DAHA 1RPNA 2GM3A 2OBNA 2IUUA 3W3ZB 1TLFA 4PYLA 5HJEA 4HFMA 4LGCA 1E3WB 4J4HA 2DBQA 3F8SA 3GGSA 3KKEA 2CXHA 3DMDA 3NHSA 5LMUB 3E1GA 4AJOA 1NYRA 3NIBA 4AZ0A 2F8LA 1EVKA 1OOEA 3CZ9A 4X7DA 3AEQA 3HHPA 4JROA 4BWVA 2C97A 1F0YA 1Y3FE 2E89A 2FE1A 3PNSA 4JZYA 1Y4UA 4AD8A 4Z49A 5L51A 5TEVA 4NHEA 2VDWA 3HBFA 3Q87B 4WV3A 1DNPA 1JYFA 3TLAA 1PW7A 3I5XA 1F20A 3T0IA 2V7UA 2JGNA 4EWLA 1RPZA 1OLSB 2PRZA 2PJDA 4ZQGA 1FQWA 1Z4QA 1JIKA 4NMHA 3DR3A 3DQZA 3GWGA 3D6MA 4RNDB 1K98A 2JFXA 2WYUA 4XWKA 4GT1A 3IP8A 2SCUA 3M7IA 4QGGA 4DF3A 2C2WA 4NESA 4FXOA 2WHYA 4W8HA 3MSXA 2OORA 3QGMA 3GJ0A 3W6PA 6REQB 3KJQA 2I6FA 1XN1A 2FPWA 1UBOS 1SKYE 2QGFA 1FVHA 3ENVA 3P20A 3R77A 4MS3A 4X54A 1RBYA 1FSSA 3C87A 5DMHA 3EZYA 3C97A 4IDHA 4N82A 5KX5B 4KZPA 3IAUA 4LK3A 4DDMA 4CZ2A 2AVDA 3M6UA 4EGQA 3WK5A 5FA5A 2V7XA 3BB3A 5B3LA 4LHZA 4LZWA 1OH7A 1UKAA 2YHIA 1IJEA 1MFZA 2BUBA 2OOKA 1ARZA 2BI7A 3PE3A 3B8EA 5DGDA 3DBHB 1ZXBA 5EMLA 3EA5A 5HQTA 1EUDA 1I2BA 1BJKA 3COJA 3NVMB 1VIVA 5CDYA 4FEEA 4DV4B 2YJNA 1W6RA 5LMZA 3IQFA 1IVSA 3TOVA 3FTDA 1EEHA 3GUUA 1P81A 2WMNB 4DBLE 2YFHA 3G68A 4B9AA 3VVCA 4O4HF 4TKVA 3NKVA 5KYXA 3D6AA 1B8NA 3TUZC 4ER0A 2ZL7A 2Q1XA 1NXPA 4Q18A 1RADA 1JYSA 4GXQA 5EJGA 3UB4A 4HDSA 4AZWA 1T2EA 2X8JA 1DX6A 4X8MA 4H17A 1COWA 5G4KA 5JDCC 3GR6A 1Z6TA 4Y2YA 5CA0F 4Z8YA 2MR5A 1YTUA 2FDRA 1UC5B 4BEBA 2C2XA 1X7YA 1G18A 1NVBA 1IQPA 3CF4G 5IANA 5H81A 1MO2A 1XMXA 1U0TA 2ZIFA 1VQLB 4ZT6A 1J56A 3TJZA 3OFSA 1I2MA 1IBSA 3K6RA 5ALTA 5MN6A 3P9ZA 1ZL0A 1QGDA 5HDQA 1TVMA 1IN5A 4EY8A 1PJAA 4MI6A 4W5JA 4L0DA 2Y1FA 3OOWA 3RUHA 2FA9A 3B5IA 3D2BA 3FNIA 1CR2A 4LQDA 4DUGA 1O4VA 1Z5GA 4LNHA 2O8VA 1KOJA 1G1AA 3JYPA 3Q15C 621PA 4IDDA 4C0JA 5JU6A 3P97A 3VMMA 4EKIA 3NHLA 1PR2A 1B42A 2QAGC 3E7PA 4JWTA 3T1NA 4Z4QA 4LFAB 1F4VA 2E82A 3MJFA 4QELA 3O1IC 3SDSA 4KO3S 4ENTA 1EMDA 3L4KA 4XN0A 3MTEA 2TMKA 1MOSA 3RFFA 3MCWA 2FPIA 2REBA 4RM2A 2EATA 1J42A 1L7VC 3AI1A 3RHSA 4CIAA 3RROA 421PA 4U7FA 5DNVA 3SSAA 3V8MA 3N39C 1ESDA 4L8YA 1QS0B 1YMVA 1WKVA 4MWTA 1PO7A 3LF2A 5THQA 4EFNA 1A0OA 1QP0A 1TZKA 2V58A 1OW3B 1YJQA 2PNJA 5JIBA 3NEPX 3S7ZA 1GNRA 3CUSA 2CK3D 3HB0A 4I5EA 1OYYA 4IMIB 5GM1A 4YYZA 2ECFA 4NVRA 4Q0MA 3HCPA 5EKUA 3GLGA 2BHNA 3T7CA 1NURA 2CB0A 4O0MA 1RJ9A 2V59A 4JSTA 4JBWA 2VAXA 3AZQA 2I0FA 4HVTA 3VVMA 1HR0B 3RIHA 2QBYB 1G7RA 3E9YA 3NFYA 4IDAA 4IR7A 4MZDA 3ZWDA 2Z6AA 4BLSA 2ZYIA 3I0MA 4LECA 1YJCA 5AKHA 4QSHA 2FSSA 3TR0A 4DV5B 3OW2B 4QYXA 4LOJA 1BHJA 3N8IA 4X91A 4ZYXA 1DIHA 4RGYA 4TMWA 4NENA 1RKVA 1P1FA 2AOVA 2QUKA 3D64A 2FG5A 4JB3A 1L4EA 4KXNA 4UVHA 4WK4B 4CM5A 821PA 1G2PA 1CEYA 4E07A 4IXTA 4WD3A 1QQ7A 2FJUA 1GAWA 3FPAA 1E2LA 5CB6A 4GOOD 2OY0A 4CW7A 1CUGA 4Y9UA 3FX2A 4DGQA 1PQWA 1XMVA 2NW6A 1LV7A 3QBDA 2VUUA 3G0BA 4TRMA 4EB6A 5LIPA 3U5ZB 3MGGA 4YT5A 1W2GA 4PSDA 2IUTA 5C35A 2PGIA 3O8CA 4U7PB 5KNCD 1GKUB 2QTWB 2RCNA 3DL4A 3G9UA 1Q7GA 4XEUA 3R0ZA 5FTJA 4AQDA 4F2HA 3UCFA 1T0PA 4M99A 4DQXA 2HK9A 1L5OA 3CWZA 1Z36A 3A3OA 3RHFA 1JKMA 5DGIA 4ZCMA 3W5HA 4EEXA 2ID8A 3DPIA 4GP7A 3LW7A 3RVJA 1R0WA 3V8QA 5AFSA 4FOPA 4FM9A 4M9XA 3ZHQA 1JG6A 2Q8PA 1IUPA 1AD2A 3DQPA 3PIRA 3ZHUA 3OKAA 4WLNA 2FMTA 1I51A 1UK6A 2J6IA 2Q4OA 1CW2B 2JD1A 2Q4EA 4CG2A 1YWGO 1GEGA 5EWLA 2IYYA 5I4KA 1CS4C 3CH7A 3L4BA 5F2EA 5EWMA 4CEHA 2XUGA 2ZYUX 3NTOA 4XLFA 4Q15A 2MYUA 4RV9A 4YJHB 2CCJA 3IR5A 4ONEA 3WB9A 4NC9A 4GHWA 1W85A 5A4JA 4CMBA 1KOGA 2BRUC 4PRZA 3PYMA 4P33A 1ZXXA 3KAQA 4QU9A 2FP4A 3T5DA 2ZQ5A 3EGDB 5BSKA 3GCGA 4JL5A 4P4SA 1DQSA 1XEAA 3HG7A 2HGSA 3KR0A 4HQ0A 1JL3A 4OXQA 5AUQA 4A03A 1JIXA 4F92B 4HGRA 4Q1DA 2NUTB 4ZQEA 3TRDA 3D4BA 3EUFA 2ZS8A 4E7OA 3F6YA 4MCJA 4HCJA 1DBIA 4R7ZA 4ALJA 4AP9A 2IW3A 4ZDKA 2BM1A 3RGWS 3IQHX 3I5MA 1GG8A 1XTPA 3BC9A 3L7BA 4P3XA 3JY6A 1V9LA 3V42A 3GLIA 4JMQA 1G60A 2FLVA 1H42A 2ICAA 1TA9A 1W0CA 2OXRA 4CFZA 3E9MA 1SZCA 4JFRA 2VP5A 5EP4A 5AVKA 4KXXA 2GDJA 4ZV7A 3E70C 3TEMA 2AYZA 2ZIWB 3LV8A 4LRXA 4U02A 3WLIA 3TLJA 4PC2A 1ADYA 5FPHA 3E6AA 5JXHA 1DWQA 5TVGA 1B0PA 2YRXA 5IH7A 1SCJA 5DIZA 3U7IA 1R6BX 2GPAA 2JI9A 1PVVA 4NFSA 3PF9A 3F7OA 3RSQA 3ERCA 5IMBA 2MYTA 4JI2B 4XN3A 3GJSA 3L4EA 3W0LB 5CW2A 2Y1LA 4YPVA 1D9ZA 2ODWA 4I19A 1VG8A 1P9RA 3GSIA 2TMGA 5LMCA 5HIJA 1MPXA 3RYCA 2W6OA 3N3BC 1JFTA 4NG4A 1W2WB 4O25A 1T5TA 4HWOA 4EUHA 1II9A 1XNGA 4GR4A 5FORA 4V24A 4JXKA 3K30A 1NJID 4H7HA 3GLHE 3JQAA 2QRLA 1GRCA 1KR2A 4M1MA 5GAJA 2HRDA 3DMHA 2WRZA 3GJ5A 1M10A 3E61A 4QNNA 4ZHQF 2HNBA 3FRHA 1AJEA 4N0PA 2X9NA 2QJFA 4K9OA 2BEVA 2L42A 1IIBA 1MKYA 3N53A 1X9IA 1NBEA 4OHRA 1U5AA 4Z4VA 3ZOZA 1GL9B 3T7RA 1KY4A 5IX8A 4BLUA 3ZE2B 1WSRA 5E1MA 3FY4A 5L3SB 3WWDA 1EIWA 5HW0A 1JXQA 4UATA 3TZBA 3T1VA 1GD1O 1VE3A 3DBVO 1C9NA 3RH0A 4N5LA 2CE2X 5DK6A 5B37A 3DEKA 3EIFA 1CJTC 4AJLA 1CS0B 4RTRA 3TRKA 2D0DA 1QRUA 1S8OA 1UMCB 2PAAA 3SZMA 4OBBA 3TNYA 1CF9A 1L5QA 3VNRA 4AG3A 4FFBB 4CE6A 1JJFA 3DS8A 1SKYB 5T3YA 1Y5MA 3HKEA 5JSYA 3LE8A 4HQRA 2JCGA 2ORVA 4X7FA 1DT3A 2W83A 4HFNA 4PNPA 4JODA 4MIOA 2PIDA 1MC1A 2Z58A 1Q2XA 2ZJZA 3G8CA 4B6PA 3L8DA 2APJA 4DXDA 3A9RA 4UHFA 2FN9A 3H4IA 4NK4A 3B3QA 1DDIA 3W8RA 4MRMB 3IXMA 2CJWB 4C01A 1Z12A 5HIAA 4YJ2B 2ZE6A 1G66A 3H8VA 4CGYA 1KSJA 2PUFA 3RIXA 1UDBA 1SCUA 1XRPA 1Z7EA 2PL9A 1JLSA 3KEQA 3ECCA 1GGMA 2R85A 4KBGA 3QVUA 5CM9C 3KUCA 2A0KA 5FAXA 5FV7A 4IGKA 1L8OA 4OB7A 3K71B 4XA8A 4RPBA 1TAHA 1SVUA 6YASA 4CI0B 4CR7A 3NIGB 4PLTA 4XIJA 5KTPA 4IHJF 3LPNA 5HF8A 4D99A 1VYUA 4AK9A 2Y71A 4KSYA 3WHKA 3T53B 3ZIDA 1ADBA 1QLWA 3STTA 3UPTA 1HURA 3EZNA 3IE2A 4D4MA 1Z26A 3K15A 4HRAA 2MYPA 2ZSJA 4TMKA 4Y2RA 2OBBA 3IQDB 1DVRA 4IOMA 4EO7A 1W5EA 2XYHA 5FI0B 4BLTA 1QQBA 5DX1A 2AJTA 3BKXA 3K0EA 5EHNA 2H57A 2QUZA 3T61A 4LV5B 2MSEB 3EVEA 4IGAA 4R0NA 1K6XA 5REQB 4RKWA 1CUUA 1OYVA 1J25A 3SFZA 4WERA 1N2EA 2HBRA 2BGLA 3DXZA 3F71A 2AXEA 3GFGA 3CP8A 1IOZA 1VL0A 3NPMA 3KK0A 2WF5A 3K8ZA 4GOXA 4L7QA 5AHKA 5AVYA 5L3QA 1WIWA 4LDRA 1W49A 4IHKA 4HLDA 4K9KA 4BVHA 4AMVA 4YUWA 1XZPA 5E8JA 1D6MA 4PW0A 4YRBA 4PZAA 4B33A 1N8TA 4P3PA 1V6AA 2GMWA 4BE9A 3ZI0A 4CCAA 3ZVKA 2G04A 2NU6A 1MBZA 3IXLA 5H3CA 2V7WA 3JQ8A 2IU3A 5DE3A 5K0JA 2HQSA 4RL4A 1L1RA 4WOJA 3WFZA 1U98A 1Y3BE 2V7QD 2XOEA 4NBVA 4UQPA 4LJ8A 5JJBA 4GX1A 1DU4A 4TTIA 4MEJA 1QB8A 3IIIA 4KXFB 3V8BA 5AW8A 5JNTA 1QLHA 2P77A 4CTKA 1XXHB 1S4MA 2FCAA 1KP2A 3KQLA 1JIQA 4L5CA 3OZRA 4DEXA 4PZEA 3I53A 4M76B 4HYYA 4MXDA 3GFRA 1XHFA 1I4DD 2WWVD 3BA6A 1EQAA 2CXUA 1TC1A 1ZIYA 2HLDA 1ADJA 3H2GA 2KI5A 5K2MA 4B32A 3VHXA 3BTUA 3IEKA 1O3YA 1YRYE 2QPAA 1FC0A 2RFLA 1CZHA 1G9TA 2AEMA 4P5EA 5CGZA 5CJ2A 3HI6A 3WB0A 1QE5A 3H5RA 4W7SA 3CF6R 4IYRA 3TLMA 1QAMA 3UPDA 3Q7EA 2BHLA 1VLVA 2Y99A 3QK7A 4TQUS 2EBUA 3F8WA 2OOSA 3T1QA 3SCZA 1B73A 2KB0A 3TXAA 5CDSA 4JV5B 1JLHA 1Q21A 3OZEA 3I8XA 4B3TB 3ACDA 3SSMA 1ZS9A 1ZJYA 1R00A 5HK8A 1RBZA 2YVUA 4B2PA 3D3WA 3PR2B 4KXWA 5LU9A 4MQ6A 1MJ5A 1RWBA 5EEGA 1FFYA 2WKSA 4E5NA 10MHA 4DQKA 2V8OA 4WAUA 1U1DA 2FW9A 4MGEA 4PAQA 5EIWA 3S3TA 2EJWA 3OIUA 4MTLA 5EZQA 3TH5A 4HDRB 3X2EA 4P84A 4EGCB 5D7BA 5IT5A 2DR2A 2VNAA 2ZAOA 3MOGA 1Y7PA 4XQEA 3LDAA 1I1QB 1Z47A 2ZZEA 3E22A 2LUOA 2XXBA 2FEKA 5JTTA 2XCOA 2I7VA 4P7KA 1KJWA 1KZ1A 2NN3C 4AZ3A 1G3QA 2Z09A 3F6RA 3RNLA 1BDJA 3ZBTA 1RI3A 2B1QA 2BI4A 3LECA 3MUEA 3SBOA 5ALFA 2A5GA 4BWGA 1Q86D 2C7PA 4D0LB 4NMLA 4B3MB 3L07A 5DFAA 5CAEB 3UANA 1YI8A 1GPYA 3R9XA 2WA1A 3HVIA 4ND6A 1TO6A 5SV2A 3LUGA 4PFJA 3SZGA 1G20E 3I2YX 1O89A 5E4JA 4XGRA 1XPJA 2Y9PB 2GYUA 4LSGA 4EI8A 4JMLA 4BN5A 2I91A 4NAUA 4DWWA 4JQOA 3SAJA 1WV1A 1VLOA 1L7QA 3EMDA 5A6SA 2CF6A 1ZZEA 3CZ5A 1MNAA 1O6CA 3AYXB 4YUZA 1WD7A 4RIIA 4DCVA 5JFOA 2WTUA 4M86A 4TSFD 1YQQA 4N3BA 3F3KA 3LUAA 1U2ZA 2I3BA 1MJNA 2Z5VA 1K8QA 4HXEB 3I61A 2WTEA 4YAWA 2CNWD 3QUBA 4E5DA 3HP7A 3D0OA 1QJ4A 1ZN7A 3EDQA 3TINA 2PH1A 4IJ5A 1EAMA 1MAHA 4EI7A 1DWUA 1NXOA 3UGJA 2VZEA 1L3IA 4FDUA 4Z4ZA 1NVXQ 1W581 3VA7A 5C7IO 1C3EA 1JR2A 1KDPA 3DLCA 1UFQA 3HZRA 3QVXA 3W77A 3GLGB 1T15A 1NZDA 3FNFA 1SBZA 4NOLA 1N36B 1GUZA 1OGJA 2XBLA 2J67A 1FP6A 2I4RA 3RBAA 4KUGA 3EOAI 2A9JA 4OU5A 4R81A 5K3AA 4DZTA 5BQ3A 2ZQYA 4OK5A 2EFGA 3B1XA 4ASUD 5F76A 3LCVB 4C4RA 1EBUA 4KMMA 4EHDA 1OFTA 2FVXA 2ZU6A 2P4EA 1T4DA 1CIVA 3UGQA 4PAAA 4XVHA 4B79A 4BB9A 1J0DA 1Y34E 2XMSA 1QFXA 4HAXA 1Z62A 3ILSA 1SELA 4PG8A 4QJIA 1Y8RA 3HEAA 4RK4A 1XQXA 4AMGA 5IJWA 3VH1A 1MQSA 2AKAB 5CU7A 3GEBA 4I2NA 5CFNA 2Q6IA 4JJ4A 2E2WA 4YMIA 3ZZMA 4MLZA 1F6WA 1J22A 1X9HA 2IYWA 4GDFA 1T8TA 3DNFA 2GPWA 4JUIA 4NXMB 2XDWA 4EO9A 1E1LA 1XO1A 2BFDB 5C80A 7YASA 3CB4A 1UZAA 3E15A 5TQVA 2PH5A 1ILEA 3GCDA 1VQ1A 5K09A 4FU0A 4FWIB 3CY6A 4D81A 3RYIB 4BAUA 4WFIA 1G1MA 1J07A 3EBLA 3M83A 4BKOA 1LLFA 4TKOB 2F90A 2ZIGA 4AY3A 2Z57A 5JAPA 5K0GA 3VVBA 3ESBA 5BT8A 1OAAA 4UJ5A 5EP1A 3VMFA 4TOIA 2DHEA 3H5VA 3FNHA 3ME5A 3WKEA 2QZ4A 4CKEA 1T6YA 1DIAA 4FUTA 4R7GA 3TAXA 2ZIXA 3VKWA 1NP3A 3OT4A 4C7OB 5D5QA 2Y1OA 1Q0UA 3OCXA 4LG1A 3DONA 3A4VA 5EE1A 2ZUDA 2P4QA 1P29A 3B1ZA 3GVIA 4D92A 4Y9SA 2A9QA 3CD6B 2OPHA 1UD2A 3C6MA 3TM5A 3DCJA 3K1JA 1OQAA 1EVIA 1Y37A 2VJKA 1PR4A 5AOVA 4J03A 1FFBA 4XD2A 3R6DA 2J8ZA 4FCTA 1JDNA 4D3DA 4YQFA 2XT6A 4IQGA 1V5WA 3C3DA 5AOBA 1GAEO 4G1CA 3M6MD 5LOVA 1KH2A 2R1VB 4I9GA 4NRDA 1NW6A 2D3WA 3AESB 1HT1E 4S3MA 5E7QA 5K3DA 4TYWA 4F56A 4RZ2A 5GONA 3ZDBA 2AG6A 1GNTA 5TGTA 2QMUA 3ONYA 1JEJA 1FBNA 5AI0A 4RMIA 4YCAA 2WHRA 2WC1A 1G64A 2DBVO 3ZWKA 4M54A 4WL0A 1A4IA 2MSNA 3RYHB 2B30A 3LX5A 3NC1C 2J6HA 2QRVB 1NRXA 2IV2X 3C85A 1F5NA 1CDZA 4YNBA 3BYZA 3D3QA 3F74A 3R7NA 2B92A 4IF4A 4KAAA 4OYLA 1VQ6B 4WOKA 3ZQUA 1JEYB 2FN8A 2F1IA 2WJWA 3H5IA 4GBMA 2VC2B 4J90A 1QG2A 3L93A 1U4SA 2F1KA 2KMLA 1ZBQA 1RI4A 2AN4A 3DG9A 1YOVB 3G8DA 3PD7A 3P1JA 1XD2A 3K09A 4KXYA 4QGAA 1EP9A 3SZUA 2D4HA 3TS1A 4WKOA 4JB8A 4G5OA 3TGPA 3F73A 1R9JA 4ETNA 1T8YA 2CKDA 3K9CA 2M5SA 3OPOA 5GINE 2G1JA 3N2NA 4B4WA 1I7NA 1ML3A 4B6RA 3U3JA 2IVZA 1U0GA 1X7ZB 1EQUA 3NT2A 3QVGB 4RH3A 4YYEA 3KQKA 4POAA 1KYYA 1ISPA 4QUEA 4S2EA 1KR5A 3SS9X 5CK5A 3PLAE 3L18A 3TGLA 4HIZA 3KJFA 3QYFA 4V0ME 2JJ1D 2VK4A 4HBZA 1X42A 3H2KA 2FX3A 8AT1A 4JOCA 3V7FA 1B2RA 4BNLA 1GPWB 2VBCA 2V3CC 2MSWA 4JDPA 1SXPA 2JL1A 1KQNA 3HJFA 4ENWA 2XOXA 3V7AA 2I29A 4BUZA 5CYPA 1WJGA 1Z0DA 2OSVA 3HGQA 4XYMA 3H9QA 3U7QB 3W2IA 1GAXA 1PR3A 3F4BA 3H1GA 1RAAA 4JGGA 7REQA 2FP3A 4HTAA 2GJSA 4OJMX 1WA5A 3P26A 1YJ9B 3KOXA 2DXIA 2HSGA 4EW3A 1NC3A 3FPGA 5EQTA 1GPKA 2YMPA 2AYYA 3BXOA 1D0SA 4UHKA 3QVOA 4KXQA 4EB0A 2RGNC 3QVMA 2G63A 3O4VA 5LQKA 3SHOA 3DCIA 1R7RA 1TUBB 5KPDA 4XASA 1P4RA 1OBCA 2CLDX 1S2OA 2IYQA 2WT8A 3I2GA 4H0NA 4PTLA 1XRSB 3N8KA 3EHDA 2HSDA 1FRVA 3AESA 2JFVA 1PYGA 1RRCA 1ULHA 3H94A 3A28A 3DBOB 2BMAA 3IMKA 1TZ2A 2CJYA 1Z6AA 1Y9EA 5MGBA 4M7WA 3ZJTA 1O57A 2QMZA 5EYPB 5FF9A 4TS3A 3QHAA 4HDMA 1VQ9B 1T9HA 2KQUA 3N2LA 3LHFA 5DM1A 4DPMA 1U7WA 1H4SA 3UWPA 5IRCD 2QSJA 3QFTA 3MYRA 3M70A 3GQVA 3RCBA 4HLQB 2NTYC 3O1JC 2G25A 1BKDR 2HO4A 2O7NA 1KJYA 2BEUA 3EHEA 3VISA 1L5FA 4A0QA 1ZD5A 1TM2A 2ASEA 4FVTA 4JXJA 4RAOA 1I2AA 5F5XA 2XE7A 2HD4A 2OUIA 1TAQA 3ABQB 5DP1A 2WDPA 3F2IA 2W6PA 1CQJA 2Z1DA 4JX8A 3IQIX 4ZC8A 2O7VA 4TXHA 4JVLA 4IICA 3L4JA 1EJ0A 3HJNA 1EGMB 1UQTA 2QX4A 3AEYA 3FI0A 4I1RA 2XNCA 3G5TA 4K5QA 5LA6A 4Q6BA 2FPOA 5FBVB 1CKEA 4EABA 1QUEA 1M74A 2P78A 3NBMA 5A6VA 1MEEA 2PX5A 5DYGA 5JZSA 3OPQA 5KEIA 1UKVY 3OTGA 3QRWA 2J5XA 4E1VA 3CLUD 3PA8A 5IEJA 1TVCA 1V6SA 2NO9A 1VL8A 2D62A 5EHXA 2GESA 3T1YB 4BQNA 4OLBA 5CJJA 2FLWA 4WMLA 4YP5A 2P9YA 4OLFA 1OXTA 3HL0A 4ESHA 2Y0CA 4YRCA 2NUPB 1K8YB 3C70A 3L1IA 1A9SA 3G5LA 3WDMA 2CLIB 1O87A 4ZHQA 2OQRA 4KIWA 1NJ5A 1FNMA 2AHOA 1M2GA 4O6VA 2ZW9A 4Q4CA 3MQ2A 3NWJA 3V8EA 2GZ1A 1N6HA 1UKZA 3JWIA 1ECPA 4QAJA 1VIMA 3F9IA 4PXSA 2YWDA 4I7EA 4BIMA 3F6SA 7MDHA 2WKWA 5IVKA 1TC2A 4UULA 3GP8A 2IXDA 4NJOA 2C03A 4UJ3A 3EQ9A 2QN7A 3LPMA 5L3VA 4CEJA 1BMFD 1Z0KA 1P4SA 4A36A 1GCGA 5A0FA 4UUOA 3U48A 3EZLA 3EVBA 4EJSC 4HEQA 3A6KA 4MW9A 1JBKA 3BUSA 3GA5A 4FYIA 4L02A 4WNYA 5T64A 4R84A 3X2FA 1FIUA 5DASA 2HYIC 3VV3A 1U7XA 2Z6VA 4AS1A 5EKXA 5FHRA 1DAGA 2I65A 1RYMA 1Y89A 1OCEA 2W22A 1NSTA 2WSYB 4RHEA 3GRFA 4YJDA 2IITA 2NX2A 3LDHA 2WM3A 3ACBA 3H19A 3ZYZA 4TLEA 3BQNB 4YCDA 4K8OA 2Q49A 1CQZA 1E8DA 2CD9A 1FXSA 3GP5A 4GKBA 4GZLA 4OHVA 5H0IA 5IYZF 4BKMA 4I8IA 3AF4A 4K8RB 1WPGA 2ECQA 5FWXB 3WDSA 1XWIA 1PNQA 3DHYA 1TADA 4QQFA 1H93A 4BFXA 5KTRA 3DNPA 4GM1A 2Q2NA 4PEVA 2W6IA 4CLHA 2NXWA 1GKLA 2IBSA 4GEKA 2ZUVA 3I4FA 1AHNA 3O2SB 2J30A 4HRVA 4PO1A 4RCZA 4G6ZA 3I9V1 1YZGA 4BO7A 1PJ2A 1X7XB 1A7UA 3FJOA 3GT3A 3MRVA 5EIBD 3UXHA 1KZ6A 3L7NA 4IIBA 3O3OB 4C4AA 4IDOA 4BQPA 1W4CA 1CNMA 4KJXA 2Z2XA 4Q3NA 3OFJA 1EFKA 3QVGA 2GXQA 1NYQA 2B7LA 5JC8A 1IXZA 3CPXA 4LQCA 1HT0A 3AVVA 3LZ6A 2GCEA 3HC7A 3OHPA 1NN3A 5JZ9A 2ZRIA 4K9MA 3PZBA 2P2CA 3TO5A 1TK2A 3MRTA 1ULSA 3DTVD 3TRJA 4DMMA 3L9WA 5BQOA 1ZCJA 4ARZA 1I7DA 2ZB4A 2OBFA 5FTWA 2VRNA 1K2WA 3G71B 1KXZA 1FDSA 3DE6X 3H5AA 3QEBZ 2QTVB 1D2HA 3DCYA 6ADHA 4KQCA 1ZITA 2X7JA 4CUJA 4EHLA 1Q6ZA 2C5EA 4BQSA 2ZB3A 4J43A 4MA0A 3I55B 1ZLYA 1W5TA 2IEYA 3W5SA 3SYNA 1PJZA 2A1UA 5LIRA 1RWQA 3MTDA 4ZOLA 4LI0A 3VPBA 2WVAA 3ZDQA 1F48A 4Q66C 3ZZTA 4F3KA 1KO4A 3LBAA 2J7PD 3DZKA 4NBNA 1EB8A 3LUHA 2P68A 2I2CA 4DLPA 3LA6A 5DXFA 1TRKA 4KYIB 3U7HB 4TTVA 4NABA 1BAPA 1G8KA 4WZEA 1P4HA 3HJAA 1IY0A 3V4RA 4UPVA 3K1YA 4HFRA 3DW3X 3OAAD 3BCHA 4MR8A 1OREA 1LJLA 2JHFA 4B3DA 3CC7B 1CJKC 2H85A 5B3KA 5C8YB 4W5OA 3WMRA 2AR0A 4TT3D 2YHSA 2ZRDA 2EX1A 1G2QA 3CNQS 3CLHA 1QRDA 4ZK2A 2O2IA 1H2WA 2NO4A 4HS4A 1ZSVA 5BNIA 3UHAA 3X44A 4NCAA 4Q1FA 4RLHA 3RKUA 1XR3A 3W4KA 2A57A 1U8XX 1YZFA 2LKDA 3RRMA 2CMKA 1G291 1UC4B 4L51A 5LQUA 4AECA 3KB2A 2YIJA 3ZCTA 4MB6A 4QOHA 4P2GA 3BEDA 1BQ4A 1KRHA 3C5HA 1GV0A 5JUWA 3E5NA 3M34A 3GCXA 5TPWA 2JJYA 1ZHFA 5JZBA 2VAVA 1UJCA 3QMMA 1IONA 3F3SA 3O03A 3QKRA 4H3SA 4HN4B 2EARA 3A0RB 2DYKA 3L6DA 3P0JA 4H35A 4S0XA 3PWZA 5DYYA 3WIVA 2G1AA 4CM9D 1YH3A 4YRSA 1JG7A 1UBRS 5A4DA 2COKA 1UR5A 2XCLA 3C1OA 3CU5A 1K7SN 2VJPA 3OTOB 2O54A 3N1UA 3T0FA 3EGEA 4D3SA 2VNSA 3QLEA 1CUZA 4MKZA 2CF5A 1H2EA 2CCKA 2OV1A 4UDNA 3VC2A 3BK7A 2AQIA 3G02A 2PRSA 1CY7A 1G59A 5JAUA 4ZAZA 3QFCA 2WSBA 1IQRA 1USIA 2OO5C 3GCZA 3MTBA 4RF5A 5ECWA 4DA7A 4UDXX 1M2VB 1S7CA 1N7GA 3P94A 3Q7IA 2VJJA 1FPQA 2ECKA 4F86A 2QIOA 4KQ6A 1VHOA 3A6DA 1QO9A 1IIRA 1RBMA 3IAM6 1AQ6A 4MNTA 5BNTA 1NVKA 2AC7A 4ZYUA 5K6TA 5KBYA 1YQGA 4Z9XA 1NW3A 3BRSA 2CWDA 2OO3A 4QNMA 5F33A 3X1YA 5AW6A 2A6PA 3IQZA 3Q9LA 3B5JA 1DS6A 4MMZB 1OTXA 1QDUA 3AUKA 4HGQA 1ELOA 3N3AC 1TQ6A 2VYVA 4DA8A 1MTZA 1IU9A 4EOGA 5BR1A 2BEWA 2RE8A 2UKDA 1M2JA 1WUHS 5HWSA 4XOTA 3CCVB 1CY2A 1DMRA 1GNPA 2GWHA 3MQFA 1QRSA 4ECEA 2PBLA 3KLBA 1C29B 4GKJB 1I3OA 2CVFA 3VR6A 1GKIA 1CU1A 4GX5A 2A1IA 2PV7A 1MENA 3CCBA 3STHA 3PE4A 4OI1A 2R8BA 3DD5A 4R1PA 1N78A 1C1XB 2IKSA 4PYRA 1XN4A 2A5DA 3I9MA 4S1NA 2B1RA 5HVNA 5HXAA 3FYCA 3R7BA 3VFDA 5FV4A 1X0VA 2HK8A 3CZPA 1U2RA 2R60A 3L0IB 5K0BA 1UJMA 4M60A 3PRHA 5KDDA 3WYFA 3A9WA 2P9QA 3VAYA 1U8CB 3KPJA 4L50A 4M9RA 4JJEA 3OQJA 4R8RA 1SG0A 5DSTA 1H3EA 3AFOA 4CQJA 3OECA 1NL3A 4I4NA 1TAGA 5H80A 3LZDA 3PI7A 3RT9A 3DB2A 1RZUA 2C9MA 3DTTA 4KOEC 3IAHA 1J99A 3C74A 2DFKB 3FUCA 2PUBA 2B5WA 4BFVA 4HDNB 1I01A 4BQRA 4C7KA 2Z6UA 2RBKA 3GGJA 1OYOA 5E4TA 1NYLA 3QVTA 4P54A 3OT5A 2Q9CA 4D02A 1VKOA 2IE8A 3CJQA 4YIKA 4PHTA 4PZUA 4PO8A 1EWTA 1SBYA 5C3UA 2CLKB 2NZVG 3O3CA 3QF7A 4JLAA 3W2TA 1YMQA 3G13A 4GI5A 4TTPA 2ZCVA 3WLNA 3ZDZB 1U5CA 1XKLA 4HDKB 3DOFA 1ZU5A 1ZJJA 5L3ZA 2PKEA 5JDCA 4JR0A 4GMHA 5EE3A 2DLDA 1OTYA 2CVZA 1UT5A 1B8VA 3CRNA 1H94A 3R9IA 8GPBA 3F78A 2BHRA 2ZIAA 5K8VA 1E89A 1WMAA 4AVZA 2P2ZA 2C54A 3AFMA 5DTQA 1U2TA 3TG2A 2GASA 1RFLA 5GV7A 1P33A 2GGSA 2O20A 4F5ZA 4MVYA 4QM6A 5DWVA 1FS6A 1EHYA 2P9FA 3KKPA 3U0VA 1DWPA 2EEPA 1Q0SA 2X3UA 2ORED 4LYYA 1G16A 4MQEA 4UOQA 3PCRB 3KPYA 3KYJB 2N42A 4M8KA 5DTJA 5T3UA 5J4YA 3C5WP 2I9KA 3QX3A 4DMRA 1GAJA 1VCHA 4P93A 1IK6A 3UJ8A 4V0MA 3D4IA 2KE5A 4FYXA 1X1CA 4NV0A 5EIXA 1Q3KA 1XTRA 3IDFA 2CNOA 2I4MA 3BXZA 1KBQA 1SOMA 3AB7A 4ABYA 1DQYA 1NE7A 3KEMA 2H4FA 3NRCA 4M9SA 3TQIA 1XMOB 1L2TA 2FFJA 2WQZA 3T52A 4Y2QA 4C2TA 1ZIOA 2Z04A 4QDKA 2DB3A 3AETA 2RK6A 3ZHBA 2QXUA 2D1YA 4YEDA 2GEFA 3R23A 2OXEA 2ZI4A 1FNCA 2OHOA 8ABPA 4EH1A 3RKSA 1EJ2A 1RKXA 5KOYA 4O2AA 4XTCS 5EKTA 5AI5A 1YHZA 4RX1A 1JNXX 1DKMA 2GUGA 1QH1A 1BE0A 2F1JA 4KQWA 1YHNA 3LQFA 3UG7A 3AM4A 4F96A 3I9JA 4DT1B 3P9YA 3FKSD 4RO0A 3HU3A 1X77A 4D9GA 3I5YA 1JIIA 3JX9A 1JMKC 1XJWA 4UCXA 5K0ZA 2CKMA 2QX6A 3VC7A 1Z15A 3NT4A 1BX0A 1ORIA 1WOPA 3EPKA 5FI1B 4YROA 1NRIA 3DLBA 2WIFA 1IQ0A 1J4AA 1F3LA 2XMBA 1SAYA 3PFBA 4GEGA 4IVRA 4FOLA 1V26A 2JFGA 1PL8A 4MKRA 3S99A 1WLYA 2RK3A 2Q5IA 3CVOA 5IMSA 1AMOA 1USGA 3TR6A 4XDYA 5CX1B 2XBMA 5JCOA 1J20A 2FOIA 1RQXA 3SNHA 5K3CA 4ND5A 4D43A 1Y9DA 2FZCA 2OBXA 2F8MA 4XAQA 4E2XA 2FW7A 2NXNA 5B4TA 3BBLA 2AUNA 2IYRA 4WRRA 3FSGD 5DNCA 4IOLA 2FKAA 7AT1A 1P0MA 1PFQA 2WE7A 3D5QA 3GJ4A 4QRIA 5HKOA 4XB1A 4CG3A 1K8AD 1GTL1 3SVLA 1ZXLA 4B3CA 4FOSA 2BCJQ 1WP4A 3LNTA 3VSCA 2HMWA 4XR4A 3OCUA 3NPAA 4LOLA 5BN4B 4QAQA 1NW8A 4HTFA 1TVEA 2GQ0A 3SJAA 1EP3B 1T6BY 4HAVA 3WNQA 3OIVA 5IUNC 4L6CA 2CNKA 1IDOA 1NLUA 1R74A 5AVTA 1SEVA 3KEOA 3NGXA 3RSLA 4AKTA 1NSFA 1GPAA 3UW3A 1JFRA 3DAHA 5JNRA 1K0FA 1GTG1 3KJXA 5E2AA 2GYYA 1KHTA 5BNWA 1B00A 2IHBA 2ZOSA 1L1EA 4B4UA 2JLBA 3IOEA 1EGVB 2ZRBA 3IAM1 4J0CA 3UWOA 3P9RA 4RD0A 2H8KA 3ZNPA 3G2MA 4RJJA 5KNLA 3GG9A 4PC3A 1KGSA 2P9CA 2V5VA 1N6LA 2BGUA 1MCZA 2FW0A 1G21E 3MGBA 3DHWC 3R40A 3RJ5A 4R2KA 3RO7A 5JJ5A 2EIHA 4JYCA 1MJFA 3W2HA 3G2KA 5CK4A 2BT4A 4S12A 4TT8A 5ED0A 4FIZA 3AGQA 1W87A 2HRZA 2J6BA 3NXKA 2H00A 1OR8A 4RDIA 5CCXA 4JP5A 3F4KA 1JGTA 3FTCA 2VN8A 5ALVA 3OWHA 5TC4A 4M0FA 2BSQA 2J3KA 3BRWD 1GCIA 4MK4A 3HCCA 2BEVB 4D96A 4WH0A 3B13B 3ZHOA 4BQFA 2GCOA 2IYEA 3FHOA 1BMFA 3FIJA 1WZ2A 1XFDA 2YZMA 1P75A 4BNDB 1ECCA 5KKNB 1JG1A 4Y7CA 1KOFA 3ANNA 1Q7YD 1QX3A 1KP3A 3GRZA 4U4AA 1CZLA 2Q7OE 3EIQA 4P7FA 1J09A 2QORA 3ZLVA 2QSUA 2NO6A 4V0KA 3PC6A 2B35A 3NTQA 1KPHA 2B2NA 3PDUA 2C5LA 1TQHA 1MU0A 2BF7A 2DPLA 1LV8A 2ZYTX 3ESQA 1ZINA 4QOSA 4Q1VA 3W1WA 2OB2A 4WY5A 5KOIA 1UBHS 1XWFA 4H27A 2YYAA 3TQTA 2L2QA 2YC2C 4URZR 1UK9A 1T4GA 3OPVA 4Z4IA 2YV2A 3DP7A 4K03A 2B78A 4CEJB 4BJ5A 4OGGA 5KI6A 5H82A 2WT9A 4KBYA 4FX5A 3DT6A 2IF2A 4FR2A 5HF5A 3TLYA 3X1KA 1IRXA 1N2XA 2JK0A 2PGJA 3KQNA 1II8B 2EW8A 2H07A 1WU8A 2W11A 3DTNA 2OV8A 4GYKA 3ZE7A 3ZLUA 4F97A 3SHWA 4OMDA 3HO6A 3ZWNA 3C1UA 2BCGY 1T3HA 5H59A 1PQPA 3T54A 4BC1A 2IBTA 1DBQA 3BNWA 3WK8A 4PLPA 2D5LA 4GLBA 4WINA 1PL7A 3MT7A 3BSFA 3PLNA 5FWAA 2WFAA 3TD6A 2HR1A 3E05A 2RBGA 5FH9A 3PFFA 3IO5A 3LU1A 4ZYVA 3L0SA 4P4LA 1J9EA 1BGVA 2VPIA 5A3SA 4HSEA 3RUCA 1FYFA 4R41A 1ZNWA 1O94D 2XAAA 3EF3A 3K5HA 1EWYA 1WPCA 1PL0A 1V45E 3CHYA 4PLWA 1PQ4A 3KHKA 1WMSA 4JU9A 5J2TF 1UINA 4NFYA 5U1PA 3U3ZA 2XHZA 2FUCA 3L05A 4HKTA 3O3NB 1A5ZA 1D4FA 4WNIA 2GHTA 4MQLA 3OCCA 4AZVA 1Y3AA 4DT1A 3H7IA 5EMKA 2C99A 3X43A 1PUXA 1NA5A 4KR3A 2R6R1 3MWJA 3KNZA 4GR5A 1KYTA 1Z9BA 1U9IC 1SZPA 1UXJA 1YB4A 1L4YA 2F9FA 3QY9A 3PVZA 2ZG6A 4D9MA 4O02B 2EEZA 5FBQB 4MITA 3THXA 1J9GA 4M1WA 4KH0A 1K8RA 4AS3A 3FROA 1NW7A 4FFWA 4BWYA 2Y6VA 5AHOA 2OXIA 4BY9E 4CF3A 1U0HC 2HIHA 1TGVA 1HDZA 2WD7A 3DOOA 4OPVA 3OURA 3W78A 5F7XA 3L0YA 1V11B 2NO7A 2QTFA 2XDQA 1DUVG 5AJTA 4Y0AA 3IAS1 2ZPUA 3E81A 2OYRA 4YIHA 1RMQA 1WQ4A 1N92A 3ZIAD 4KR7A 1ZIDA 3JASA 2AN1A 3TUJC 3N7AA 1J0XO 4P82A 4DM7A 1YC5A 1CB7A 1LX6A 4HGOA 2H52A 3LIPA 4FFOA 3U81A 3V1NA 5HZKA 1GTSA 4MAMA 4RPHA 2P4HX 2HZBA 4IEEA 4DLZA 5EI5A 4DW8A 1Z5VA 5C52B 3CW8X 3NETA 3U31A 2W98A 3U16A 2VHJA 4HWKA 4US1R 4E5KA 2ILTA 4PX9A 5I9TA 4PGFA 3IKTA 1BXKA 5BYJA 1IM5A 3UY4A 4AW9A 3MAJA 2Z2JA 5F52A 4HXGA 4UFPA 3ZY4A 4B0OA 1AA9A 1W5AA 1NLFA 521PA 5GJWC 4WCFB 4YRZA 2ZXUA 3SY8A 5ALIA 3CO0S 1UMDA 1BXRA 1OXBB 2H5JA 3DR5A 2A86A 1XLTC 1QU2A 4WCFC 4RY2A 3WIOA 3TLCA 1TEVA 5EJFA 2VYFA 1WMEA 3C7TA 1W96A 1I32A 1XLVA 2OCBA 2XLBA 3PRKE 1WDWB 1JHQA 2O5CA 3OCVA 4YCLA 3QX9A 1JKJA 3N2ZB 1W4ZA 1ZD1A 2V4UA 3FJ1A 1E0SA 1H2HA 1ESZA 3GNTA 3BH7A 4BKPA 1Z63A 1YB1A 2QN9A 3VBCA 4D56A 1Z4KA 2KHZA 4X8OA 1MJHA 4NXNB 3I83A 3ZVMA 1QVAA 4BNYA 3ENWA 3F1LA 3I32A 3C7DB 4J9UE 4LBWA 1N3YA 2ZEJA 4BQQA 3A31A 1C3XA 4Y6SA 1UPTA 4W9RA 3AVQA 4ZANA 1VF7A 5HFJA 3WNCA 2VDOB 3HSYA 4QLOA 1CDDA 1HEUA 2M32A 1DC6A 3QW2A 2A58A 1ZD3A 3BMQA 5LCXA 3C8ZA 2C95A 1P5ZB 2B6NA 2XQVA 1EU1A 4MARA 1NNUA 4EVSA 1I5RA 1TCAA 3C16C 1UT6A 2BR4A 3GJ6A 3AUAA 3NHBA 4KRGA 4WSOA 2IOQA 4NPAA 2H6EA 1D1QA 1O6ZA 1K2VN 1UD3A 3PHGA 4KLCA 3PTZA 4O4IB 1FS4A 4U63A 2YDXA 5L7YA 5IBCA 4JI0B 1WTAA 5IXYA 5K3FA 1JHUA 1L5SA 1KS2A 1YDWA 3K05A 1P0QA 2Z8YM 3GIWA 3DLIA 3ADOA 4XM1A 1DKQA 3WNVA 5I8PA 4ZPJA 4I1UA 3FOEC 2OTJB 4D9CA 4Q3KA 2QD5A 2Z2YA 4P7BA 4LISA 5CDFE 4KODA 5J9FA 2FSHA 2TMDA 2JLRA 1EM6A 3TVYA 3B1FA 3B8HA 3K2QA 4BO8A 2C04A 3EQ6A 1Y6ZA 4K6OA 2Q7XA 4ZARA 4CFYA 1N75A 1C14A 3IUQA 3N0TA 1J8QA 1RXWA 2ISCA 4GOND 3IA7A 1YX2A 1F0KA 2A0FA 3DEAA 1U8AA 2JGJA 4KIUA 1KSFX 1B0AA 3CUVA 1YDHA 4B87A 2O8DA 1YUBA 2A59A 3BWYA 1ZMRA 2ZRJA 2C88A 5IARA 3WOVA 3SX4A 1MAWA 1SBTA 1KDTA 2GKSA 2X0NA 3E5MA 2VP2A 4BUJA 5IAGA 3REGA 5CXQA 3WYCA 1VCOA 3BSWA 4MUXA 4M7OA 5MF6A 1CX9B 1CRQA 2CJPA 3PHHA 4CUKA 1I1HA 4KE6A 3C2QA 3TI7A 2JGIA 4WQMA 2I6TA 4E3WA 1JSRA 1RHJA 2RG1A 2WT4A 3WGKA 4KFRA 2ISQA 2JKVA 2X8BA 1IRIA 3KWLA 4HN2A 3B20A 4DCTA 2G1PA 5DLYA 2IODA 4FB5A 5HE8A 3H99A 3UC9A 4AF6A 4AN4A 2Y6UA 2CW5A 1PLKA 2MMCA 2Q6TA 5K2OA 2F1RA 5HM8A 5F1OA 4QA9A 1M8FA 1F8GA 3VO1A 3WGZA 5LJLA 4LHVA 4ANFA 1ZCBA 1VI6A 2ZYHA 4PGAA 1JTEA 3PHCA 4EUFA 5IN4A 3OPYA 1UPFA 4C3ZA 4KAJA 4HXYA 4PAMA 3OZUA 1LLQA 1O5OA 4MJ7A 1S3SA 2QRZA 2W58A 3TYXA 1OTHA 3HBAA 1CB0A 2QHXA 1FMFA 3O75A 2FH5B 1S0UA 4HQFA 4OUDA 1NKTA 3CCMB 1SR8A 2ST1A 2W2TA 3ICCA 3AR2A 2VF5X 5E95A 2AZDA 4I46A 4GAEA 1RM3A 4XYEA 4FTWA 3VYWA 3A27A 4RE5A 4P2NA 3ZBPA 1P7ZA 4YP9A 3UCXA 4DPLA 1ZOSA 3I9NA 1EK5A 1RXUA 3KQQA 2CZCA 2UVQA 4TZTA 4CMJA 5GTDA 1PG5A 3KJNA 5JD6A 5IU6A 2IS6A 4NDNE 2BFEB 2C2MA 2X6XA 3IE0A 4KQXA 1YA4A 4JUDX 5D2CA 1WOSA 4N48A 2JI6A 2R86A 1GG9A 3GFTA 4OHCA 2DIEA 4EF6A 1TX4B 4FNMA 2HFKA 4KW7A 3OSZA 5DYIA 3WMWA 3DVAB 3R7FA 1QOZA 3L8GA 3BY1A 5KQMA 3A2KA 5ER6A 1XZDA 1SUSA 2Z2ZA 3I23A 4LVNA 2ZTLA 3RUIA 4R3WA 3O84A 1HLGA 5CNIA 3RR2A 1WCXA 1BMTA 1NDUA 1Y1TA 2Q0QA 2VUTA 2D13A 4G5FA 2QTVA 5U4QA 1BFDA 2Z5LA 4QPCA 1ISSA 2FWJA 2R751 1P2FA 2IS2A 2RD2A 4O4JA 4UU8A 5ALRA 3KVRA 4RTLA 3QLUC 1NJ2A 1D4OA 4F4FA 5DI3A 5T6BA 3I2KA 1JUDA 3FVRA 5IT9A 3N6VA 1R5OA 3CO5A 4B2LA 1IM2A 4LQLA 1NVTA 1OLXA 3D8TA 4Q7EA 2FSUA 4U7GA 1J9ZA 4RHFA 4UM5A 4F04A 3SC4A 3LFUA 3BFKA 3R7AA 4ER7A 5IKPA 1A77A 1TPZA 2QA4B 1ULZA 2NZXA 2RAVA 5G4LA 5B1SA 2HM7A 5JS8A 2O2GA 4ZAGA 5FWDA 4UREA 4FD3A 5IUKC 2X0KA 4GZMA 2X8LA 4MW7A 4CXMA 5J4VA 1QYRA 2FSIA 4RK6A 4ASUA 2OR3A 1KE2A 3QVVA 2OVFA 4ZO7A 4DNTB 2QD3A 2BM8A 1SA0A 2EKLA 2R6DA 2YV5A 1T3GA 1FFDA 1QG6A 3OQHA 3K2EA 4OJTA 4BTLA 3KCQA 4FFMA 1THMA 3BQJA 1KEEB 1GUDA 1F06A 3FKJA 5EZYB 1UXKA 3NHFA 1ZD2P 4BGIA 5KSWB 4TWZA 5LNK6 4IGFA 2V4MA 2CHFA 2BR5A 2H65A 3AWIA 1YI1A 2C9ZA 4O1MA 3IJRA 4HL6A 4BMZA 2FWRA 1USVA 3AEKA 4D0GA 1S2GA 1V2HE 1ZOLA 2PD4A 3ZN2A 1TTTA 3PNOA 3RVOA 3V8NA 3HUUA 4MWDA 3N76A 3L8FA 1TZBA 3DLPX 3DXXA 3WLJA 1M73E 1FFWA 5AXBA 2VO1A 3AHJA 4Y2GA 5IYZB 1JAIA 2ZE8A 1YC2A 3AU8A 4MQBA 5E9AA 5I7WA 2V7BA 1CEEA 2YZ2A 3LY8A 5JAQA 2PZFA 4AYXA 4M7PA 3EGXB 1AUOA 3IXQA 1H22A 1D4AA 4KMRA 2HAEA 4G63A 1SVMA 1YZKA 4W1SA 3S1SA 2OG1A 4V0SA 3VNAA 5EIBC 3ETHA 1QP7A 2E4UA 1VQKB 3FSEA 1YFLA 3OZWA 3MTQA 4L3VA 3BD8A 1EWKA 4KXVA 4P35A 1I6WA 4MPTA 3S2IA 2GM4A 2A9FA 2BHSA 2IOFA 5FJJA 3ZKWA 3NUGA 4E51A 3ICWA 5A7FA 2PUAA 2A67A 4RABA 2GI4A 4ID9A 3K9HA 1ES9A 3LDUA 4M88A 4KO2S 4R2XA 4Z2YA 2QT1A 1LU9A 1QHEA 3C1AA 4XJSA 5JAIA 2UYCA 1I4WA 5A9SB 4OP2A 3AHDA 3T7DA 2QGNA 1X7GA 1J5PA 2ANCA 1E0KA 3A3YA 3TE6A 1AQNA 3U4MA 2XYRA 1Y1KE 3GLUA 3I3SR 4G8BA 2XDYA 4EJ0A 2R6CA 1E5QA 4PFQA 4ZCIA 4N8SA 1VSBA 1PZMA 3ZPXA 1C4KA 2I8LA 3ITNA 1ZMXA 1HLPA 1MT3A 1UKCA 2BDTA 2QA5A 3KBOA 1OX4B 4L9RA 2DGDA 4EHAA 1E3MA 5HSGA 2H3EA 4HPJB 1FF9A 2Z3WA 2JC3A 4CNBA 2EKQA 4GYJA 1HSOA 4RJLA 2WPDA 2PKWA 1J49A 1G4AE 2WIAA 1OXMA 3QFHA 2BLLA 4MRAA 1BW9A 4RKEA 4AMZA 5AW1A 3M1YA 2C61A 2JI7A 1JDTA 1PIWA 1SB8A 3I2FA 1ONSA 2RHLA 4GQAA 4HP8A 4Z9AA 5GJBA 3NH9A 4MAAA 3DPSA 3HKEB 4WZKA 1RHUA 3UGTA 1G5IA 3AEUB 4QEKA 2CFSA 4IUYA 4TMXA 4OH7A 4Y1RA 4D44A 5FWYB 2FHPA 1O1YA 1QH8A 4FZRA 4BBJA 1VXOA 4H7DA 2JZCA 4AWAA 3DGEC 3VQTA 4JBYA 1T8RA 1HORA 2EJCA 3CWQA 3AY3A 1D1PA 2FUKA 2P5YA 3JAKB 1ND6A 3K70D 1F60A 5AXCA 4ZDWA 4YHBA 2GF0A 2QV0A 1GN9A 3IDAA 3KXDA 1RLOA 4DNPA 4EMTA 1IBMB 1KQ3A 4NENB 4I5FA 1A5TA 2P9EA 3HCFA 1XALA 3L49A 2H0RA 3GUCA 5BSFA 3BT7A 4DA6A 2AQKA 1A8SA 1EX9A 1JZQA 4IOKA 3ROEA 1GZSA 2O2EA 1YBHA 5DHFA 4BLQA 1P45A 4O4LA 1NQ5A 1IC6A 2YZ7A 4J1TA 3G2IA 1M2OA 4PCAA 3HE3A 3ABRB 5JPIA 2EVWX 2F3PA 1NR7A 1T13A 4EYQA 1IUOA 2OD2A 2PUVA 3H87A 3DAGA 4URHA 2XXJA 4XOUA 4C4SA 3JQPA 4YCNA 1YCDA 5BN5B 4N9QA 5T4HA 1Q11A 3H05A 3MWLA 3G6KA 1DC7A 1BROA 3KG2A 4NU0A 3K9GA 2PUGA 1GV1A 3ZS9A 4E33A 4Q4LA 3UCEA 4N6GA 1HTBA 3GGGA 3UUEA 5SZHB 3JQ9A 5JSZA 2EJTA 3F1KA 4WLEA 1U0SY 2DPYA 1C1YA 3F5QA 1K3TA 1PGOA 2ZDGA 4GPZA 4Y6PA 4UTXA 4RTQA 1F8UA 1H6BA 2VT6A 1EFVB 2YJGA 3LT5A 2FMXA 5DHAA 1T5OA 1MVNA 4E6PA 4YFYA 4RY8A 4YHHB 5LR6A 1L4UA 1RE0A 3OZ7A 5HG0A 3ZU4A 1ISGA 1RHKA 3SDBA 5AKZA 4IXNA 5IS2A 4FONA 1SC9A 1O95A 1TO1E 3E9QA 2XUJA 1ZM9A 5JH7F 2OHHA 4IAOA 5BV8A 1MO5A 2IUSA 4UAVA 3S2GA 2FGKA 3PGXA 1G6HA 4INJA 1KPIA 5TT1A 4BTEA 1CCWA 1L0BA 1ODJA 4MHTA 1RXVA 2N1BA 2AF3C 2R44A 2RI6A 4DKXA 5IKMA 2OFXA 1TJ4A 5EERA 4QYIA 2GETA 2G82A 1B6SA 3DBIA 3RRZA 1TQDA 1K86A 2NPFA 1PT5A 3DWGA 4BE7B 3D2LA 1AF4A 4DV1B 1UJNA 4OXYA 1W76A 2PLFA 2Q6KA 4Q9LA 3ODPA 5ERXA 5HIIA 5CCBA 1CSEE 3PC8A 2VCEA 2YZGA 1T9KA 1X2BA 3O9MA 3T0GA 1GNQA 1N1EA 2ACVA 2EC5A 2FUG6 4TN1A 3MS4A 4G3XA 1DG9A 4ZZ2A 5JWRA 3ETJA 1GPNA 1H0KA 3A9CA 1DV1A 1YRLA 5DNDA 2CT8A 1W8DA 2OD9A 4HFJA 2H5IA 1M0SA 2UXBB 1EVQA 4IQ8A 4H08A 6CHYA 3TTTA 1X80A 1R0XA 3D3JA 2V4DA 4D3XA 1EGHA 4LZAA 3DE0X 3NC0C 1V7CA 5AJXA 2I6QA 5KNDA 3MMNA 1BWSA 3SEZA 1QK5A 3PX2A 5C8XA 4YWHA 5HUQA 4UOZA 1PCXA 1V8DA 1G8JA 3KAJA 1T43A 2YXEA 1Z4NA 3IDQA 2IELA 2AJDA 3G0IA 4BNHA 4NE7A 4TQ9A 1SQFA 3HR7A 1SVLA 1VMAA 5LP1A 3MWDA 1M1XB 4S1OA 3SYRA 4D8WA 3FWNA 2G1KA 4L95C 4DN6A 5U9CA 3LO5A 4WN9A 3STWA 3VZCA 5A5EA 1PWXA 2WNIA 3L43A 2BGRA 4CI9A 2CC2A 2QVLA 3NHRA 4UXHA 3BL8A 1N1MA 4MW2A 1PWEA 2IPMA 3O0TA 1B8UA 4MGKR 1SPBS 4MW4A 1VQPB 1D5WA 1MT0A 3T95A 2V6BA 1AA6A 1NF9A 1WDLA 3DO6A 4CDGA 3FE2A 3M1IA 4YALA 1BE8A 5DCLA 4CMIA 13PKA 2AVNA 1YS2X 4NQRA 5EZYF 4OOEA 3I1YA 4NNOA 3HS3A 4RF2A 2VA9A 2YVLA 4ZIRB 3NDBB 5HFAA 1ABEA 1ECJA 4RTOA 4NPCA 2VHWA 2XYVA 3A2MA 4WA7A 3TW8A 3MHTA 4I0WB 2RAPA 4I66A 2A8YA 1QS0A 1YS6A 2W2NA 4GE3A 4GKAA 2JGKA 4LI3X 4MQ4A 3RQIA 3TRFA 3JVVA 1FXWF 1GU0A 4H1UA 3T5BA 2TECE 5KZMB 2VEDA 5CB8A 5LQMA 1MX1A 2GZAA 4PXYA 1STOA 3CSDA 1FMJA 2GN9A 4OQXA 4WKNA 1RQLA 2EP5A 3GY0A 5JVDB 1Z4MA 1HDXA 4QGHA 1H85A 2YZKA 3W5IA 4DBVO 3S5JA 2IYSA 2PK3A 4K6MA 4MO9A 5JCZA 4EFDA 1LQUA 3T12A 3CF4A 1E7RA 2XRFA 4MKGA 3RANA 3AMVA 1XL0A 1NUPA 2CXQA 3FFBA 2H2HA 2Y1CA 4RF3A 1DMSA 2E1BA 4Q24A 4BV3A 1Y1QA 4TS1A 3EEQA 2IYNA 1T24A 3EGDA 3KQVA 1TIPA 2P2LA 5GONB 1TVKB 3NWPA 2HF8A 2NU8B 2XYGA 3FUWA 5DF1A 4EQZA 5HKAA 1E1KA 1M34A 3EBOA 4AX4A 4AY4A 1KYVA 3PUYA 4L6AA 3RV4A 4ZN6A 3K1AA 1OAOA 5M29A 3EOZA 2EJBA 2ZVQX 2CNWA 3ABZA 3WNZA 1VHDA 2HIMA 1T8UA 2FCRA 3I3OA 1YCGA 2WZQA 1BWRA 2RSLA 2EFHB 4FMBB 2GPYA 3P7MA 1M5RA 2JARA 5AMXA 1CUVA 2PLAA 3V1LA 4P0QB 1TKBA 4OSEA 2FAXA 5AI9A 4EYEA 2D2FA 2P75A 5KQRA 2B4AA 2ZKIA 3B2EA 4PE5B 1N7IA 5JHGB 4FQ8A 1QH1B 1PU2A 3HBJA 3L0CA 4J16C 4XCQA 4HGYA 4F6LA 2P5UA 2I66A 3ONNA 1ZGJA 4YAIA 5HTOA 4MV3A 3DL2A 3FWPA 2GZMA 3SQDA 4XQ0A 3HSSA 4G9EA 2WJ4A 3O8OB 1RQRA 2IZ5A 2PGNA 1MOPA 2COEA 2BW0A 2XGMA 3PHJA 3LBHA 2I76A 2VNIA 3KKKA 4UXJA 5ERGB 5INTA 1IWOA 5CB4B 2VKQA 2WFMA 3IA2A 1L7OA 1J21A 3K1AB 3P2EA 5FPSA 2VHVA 3T7EA 4CM6A 2JLZA 2AFIA 5KYUB 4A92A 1NI3A 3U40A 1W0JA 2AMVA 3HRIA 3B5EA 2K2QB 3R7WB 3H0KA 1D2NA 4DDHA 3NDRA 4J7CA 2YWJA 4A8PA 2P90A 4LDQA 5IC5A 3A6ZA 3IDZA 1BLIA 2KVOA 5B2FA 3UXEA 1WZNA 1ZA1A 2HRRA 3FXAA 3USES 5J2UA 1L5WA 3UF0A 4MQEB 5IABA 4KPEC 2JIZD 4EQ6A 4LDZA 2DFVA 4FKMA 3C3AA 2QAGA 3DB1A 1JEOA 3Q0EA 5ISMA 2BF4A 3OZFA 4EY7A 1YQTA 3I9OA 2IWHA 4Q19A 3HCRA 3WLFA 1HFKA 2YW9A 3H75A 3PD1A 4PRKA 2Y0BA 1P19A 2JGFA 3FFTA 1W0KA 4GGPA 2ORIA 1JXAA 3PE6A 2WHPA 4I8DA 4MLCA 2VQDA 4YEJA 1YNSA 3LUPA 2WV7A 5FFFA 1BMDA 1Q1NA 1T9GS 3R20A 2QV7A 2P40A 1MZPA 5EFZA 2QB5A 3W2EA 4OYHA 4MJLA 3RU2A 3CEAA 2HLDD 1P8JA 4E1BA 3AM5A 3DT8A 4HNUA 3KRTA 2XQFA 3HXKA 2BPOA 4X07A 3DPUA 5BMVF 1HFEL 3AINA 4ITRC 2EFJA 4QRDA 4ZT3A 1IZ7A 1CIJA 4AMUA 3T3EA 5KU7A 5HUHA 4Y2HA 1X3SA 4J75A 1VQ4B 2UUBB 2NUAA 3CH4B 1T1SA 2Z5FA 3BN3A 4RADA 4BASA 2GYVA 2F59A 4B73A 2YOFA 3KOMA 3KDSE 2X9QA 4PPGA 1VRWA 5DWDA 1LPAB 2V7QA 2B69A 3PXEA 4Y0NA 4QLBA 2F1OA 4OVKA 3I01A 4ZEOA 4X1KB 2VQ6A 3JQCA 3HN2A 3FCEA 4WCFA 4WOPA 2VA8A 2VEOA 4BX9A 5TXGA 3AIOA 1U3WA 1WUYA 1FFHA 1OASA 3KL4A 4K40A 2R65A 4F8JA 5JLJA 1YASA 4UAJA 2VZ0A 5EMHA 5BN1A 3H2BA 4OGLA 2Y9MB 1SXJB 1GRVA 2YTZA 5J2UB 4IJKA 5D1HA 2VFAA 1KEVA 4DR4B 3CUKA 3W06A 2YJZA 1JR3E 1I0ZA 1HEYA 5FR1A 1G21A 3SDZA 4V2IA 5IKXA 3DBLB 4ZGGA 3N8HA 2CB9A 3L3BA 2WD9A 4U2KA 1G8GA 3D7MA 2XE6A 3ZQJA 4DRXA 4XFDA 2ZULA 1NAHA 2CGEA 2WYOA 1MH1A 2GCNA 1IMJA 1FFXB 2D7JA 2J33A 3UQYS 1X80B 4BNZA 2FSGA 3STXA 4XLHA 4RFVA 4DG8A 4KOAA 4PLCA 1Z4OA 2RH5A 5DNAA 3I09A 2NQTA 2QQGA 3TIVA 1DJOA 4FBGA 2Q3JA 2WJZB 1M6NA 2JIBA 2PJZA 4F9TA 4B47A 3EZGA 4NIMA 2IT1A 1I6MA 3CZRA 1ZG3A 5KIAA 3ZNOA 3R7LA 1JAZA 2CNNA 1SCAA 1UMBA 1N06A 2PS3A 3EBPA 4OSOA 2MSCB 4WACA 3FDFA 1VPWA 1T9GR 2O0KA 1U6IA 3M6IA 1R0RE 1ZH0A 4RPGA 2GO1A 4CM8A 1T3LA 3JD3A 2V97A 4EPTA 4WK2B 1ZZGA 2W2VA 2FR0A 2OV6A 3MFQA 4C21A 1OT5A 4HE5A 3F67A 2GA9A 2ZYDA 1NUSA 3UUWA 5KSYA 4L4SA 5ESDA 3REQB 4QPZA 3PIIA 3GUYA 2FUNB 3FHTA 5DM60 1XEWX 3FNGA 4RIFA 2NO0A 1DRKA 4FEAA 4IMPA 2J6CA 4M0EA 2G70A 2LBPA 1BCRB 2KYRA 1TK3A 3LOUA 4Q34A 4V1CB 4UFOA 3QMWA 2WZBA 2M2IA 2NV4A 4BVGA 1W47A 5CA0A 4WJLA 2F6RA 4RU1A 5LD2B 1ODIA 4BVEA 1UDRA 3RT7A 1CNFA 2IE0A 2JGAA 1V8OA 4AWBA 1RM5A 2B5VA 1NYTA 1M1UA 3JQ8B 1JHAA 3P5BA 3QLJA 4XWTA 4DQDA 2B8EA 4ZVMA 3W7BA 5K0TA 2QVCA 3JZFA 1L3CA 3N05A 4Y2SA 4P31A 3KFVA 2OHJA 3HCBA 3I2JA 5CB4F 1RP7A 4DCMA 4ZOBA 3G59A 1HTWA 4DB4A 5BW8A 1ZR4A 3AW8A 3ZWPA 2GN4A 1PJTA 2QEXB 3E2PA 2OCGA 4POOA 5EHZA 2PT9A 4KGVA 2DP4E 3E0QA 1RCUA 4NU5A 1FTSA 3ND9A 4QREA 1DB3A 1RYHA 1Z18A 1UBJS 3NJ4A 4JLBA 4NJEA 4JYPA 4C29A 1ZUHA 4J7UA 1DBRA 2GXUA 2Q4BA 2MJLA 3P4XA 4C7VA 1W1WA 1YA6A 4IIHA 3ZHRA 2ZR0A 2J3IA 1Q1GA 4BO9A 3W5CA 1MVOA 3GLFE 4UDYX 2OSBA 1JH8A 3PGVA 3QTBA 2BTEA 3D7NA 3DLAA 2FETA 3KWMA 3OOSA 3PJRA 4WXHA 3Q5GA 5C5EA 1WTHD 3PQCA 1WR8A 1L5RA 3GLSA 3IB3A 4JD5A 3B1VA 1Z4LA 2WG1A 4CL0A 5M5BA 5HK9A 4YPOA 4TUYA 4G4IA 1L5HB 2OP0A 1XELA 2Z5GA 3RD5A 1HM5A 2J1LA 4OL9A 3ROZA 4Q7QA 3EEFA 3CCEB 4W63A 4XRRA 3GDOA 2XCRB 2FMHA 4KRXA 5L7TA 1N5LA 4YRNA 3F6CA 3AKEA 2EBWA 2I4TA 3KALA 1K88A 3MB5A 4HNRA 1YIAA 4BMYA 3AUXA 3L7LA 5FPPA 1XK7A 4FEYA 4AG6A 5DK4A 3F6PA 3W3AD 4F5EA 4N3AA 1TXGA 2XNHA 4AJHA 3RVDA 2O0LA 3PITA 2IYXA 3CLSD 3URKA 2A1UB 1W9MA 5CEEA 1V1JA 4BMDA 3IUMA 3LBNA 1ZVMA 4QYSA 4WZZA 4DSZA 1Q0RA 3GVPA 1FNDA 2YL2A 2ZAYA 3VH3A 1T4CA 3L1VA 4IX1A 2YY5A 4QQKA 4UHJA 3MW8A 4MR7B 5DTIA 5CBPA 4X3OA 1FQKA 4RCVA 1GPH1 1DQRA 1T1EA 3B53X 4K9DA 2GILA 2PZAA 1VL1A 3DFFA 4RH1A 1X1RA 2VZLA 4XQ9A 5JISA 1PJBA 5HPYB 2GKOA 1D7OA 2L19A 3QX7A 4FMDF 4QDZA 3GFOA 1V0JA 1CE8B 5ER9A 1ZCAA 1QO7A 4O4JB 3CLTD 4Q21A 2PUJA 1E3LA 4MVJM 2ZTVA 4DIUA 1O58A 2XQJA 3V4PB 1MJGM 4WBXC 3RSCA 1LCIA 2DFNA 1RLMA 2OBLA 2PZEA 3WGOA 2QRQA 3ZDEA 3B38A 1Z5UA 3QTTA 3H9CA 3G0GA 4NMXB 4BVAA 3MHPA 2V8BA 2ZSBA 1SC4A 2X1MA 3DDSA 4CTMA 1TKCA 5HE9A 3V2GA 2QD1A 1P5FA 5KYVA 2YJTD 1DKPA 5IWAB 1ZWLA 2UAGA 3KIPA 1E2HA 5FTMA 1Z37A 1XVIA 2GD1O 4BP8A 1KVRA 1U28A 2V3WA 3EIXA 4QPJC 5EZSA 1LJ8A 3GFBA 4Q5IA 1PFUA 2A0YA 5FLEX 4PXAA 1SNYA 4OFXA 5F3DA 4N9WA 4YMLA 3BXPA 2XKKA 4D3FA 2LIPA 4DCNA 2JIRA 3HJRA 3O1LA 1WTCA 4JT8A 4NOKA 5ECDA 2O57A 2XVZA 5FQOA 1IWBB 3KOOA 2W6ID 1XJ0A 4LY9A 1GLGA 2VDRB 2XCIA 5LWQA 4A16A 2KWIA 2TS1A 1VQ8B 2IZZA 4E22A 3CN7A 1DRWA 1MX5A 2WVJA 5CM8B 2QVYX 3ZTYA 3QXSA 4HNSA 3UBMA 4EZEA 3MN1A 4DCOA 1QPZA 1KZ7B 3QXHA 2VRCA 3RI3A 2OXFA 4B8WA 1OXXK 4OTZA 4RVUA 4G37A 5EJ7A 2HBYA 2ZJYA 3KUKA 1M2VA 1NFRA 3TGWA 3JRWA 1YJ5A 4RF4A 2POCA 1P6UA 5D3MA 2C57A 4PN7A 2WWXA 3LTEA 3HBLA 2IQIA 2DPXA 1IULA 5HHTA 1VLMA 1GIAA 1S2LA 1ZRNA 4U7JA 4F60A 4QPDA 4XGKA 4BFUA 4A8TA 1UJ5A 5KTKA 4CLOB 3BH4A 2DE0X 3QIVA 4HF7A 1JKIA 1D03A 3SJPA 1KYWA 1U3UA </