1GO7P

The metzincin's methionine: prtc m226c-e189k double mutant
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHKIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSICSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEASE C
publication title Crystal Structure of a Complex between Pseudomonas Aeruginosa Alkaline Protease and its Cognate Inhibitor: Inhibition by a Zinc-NH2 Coordinative Bond
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 160
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1go7P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1go7P02
2JSDA 2OW2A 2Z2DA 4DV8A 4GUYA 4AIGA 1QICA 2XS3A 3WV3A 3L0VA 3Q2HA 1YQYA 4JPAA 4A3WA 1ND1A 3LUMA 1KUIA 4JIJA 5D2BA 2PJTA 1SMPA 3HY7A 4PKQA 2ZJ7A 1BKCI 3LIRA 1EB6A 1ROSA 1MMRA 4EFSA 1S4BP 3HY9A 1B3DA 3LIKA 5D1TA 3CKIA 3LQ0A 1DMTA 1XFWA 1G12A 3TVCA 2POJA 3L0TA 1CAQA 2DW0A 2JT6A 1AF0A 1GE7A 3ULTA 1MMPA 3B92A 1G49A 3DSLA 2OXUA 4G9LA 1D7XA 1K7IA 5BPAA 3GBOA 3ZXHA 1IAAA 3LGPA 2ZJ6A 1K7QA 4H30A 1CK7A 1O0TA 3HYGA 5B5OA 3WV1A 3TSKA 4I03A 5I2ZA 5BOYA 1ASTA 1MMBA 3KMCA 1UTTA 3OHLA 4PKWA 1OO9A 1IACA 2MZHA 2QUBA 4GWNA 5H8XA 1QJJA 3HDBA 2L0RA 1I1IP 5LABA 4H84A 2J83A 2K9CA 3SHIA 1PWUA 2AIGP 3LAAA 2A8HA 1OS9A 2QPJA 3LA9A 1G05A 2MLSA 3DNGA 1C3IA 1A86A 5CXAA 2FV5A 1K7GA 4H82A 3LEAA 1CGFA 4ILWD 2USNA 3F17A 4HMAA 1XURA 1Y0VA 2K2GA 1IAEA 3F18A 1ZP5A 1YCMA 5D3CA 5D7WA 1DTHA 4XM8A 2ERQA 1B8YA 1SLMA 1GO7P 3LE9A 1D8MA 1SLNA 1Y93A 2O3EA 3BA0A 5CUHA 4DF9A 2OY4A 4HX3A 1YP1A 1UTZA 2X7MA 4PKSA 2W12A 1KUFA 1WNIA 3ZVSA 5BOTA 4JP4A 3EDGA 1BIWA 2I47A 2Y6CA 1GO8P 3N2UA 3AYKA 1JIZA 1KBCA 1R1IA 3DL1A 5D1SA 1R1HA 1D5JA 2J0TA 1JKYA 3EDIA 1C7KA 3Q2GA 1IADA 1KUGA 966CA 2OW1A 1R54A 1OM7A 3NTNA 2EROA 3LK8A 1HTDA 3TS4A 2DDYA 4JA1A 3ZUKA 1CXVA 1ZXVA 3N2VA 830CA 1GE5A 4XCTA 2HU6A 2JT5A 4A7BA 2Z8XA 2OW0A 2OXZA 2MZEA 3B2ZA 3RTSA 1SU3A 3TT4A 2MZIA 3E8RA 5L79A 1XFXA 4GF1A 1PWWA 3K7LA 3G42A 1ZXCA 4XM6A 1BUVM 2D1OA 4GR0A 1I76A 1QUAA 4XBHA 2KRJA 1ZTQA 1H71P 1C8TA 1KAPP 4CTHA 1BKCE 4FXYP 3EWJA 2X3CA 4FU4A 2MLRA 3DPFA 4R3VA 3O64A 3USNA 4GR3A 3EDHA 4H76A 3A6ZA 5CXLA 3VTGA 1R55A 4AXQA 3KMEA 1OMJA 4GQLA 3KEKA 4PKVA 2OI0A 3EHYA 5L7FA 4GR8A 1JAOA 3LILA 1JIWP 2E3XA 4PKTA 1GKDA 1HFSA 3B8ZA 3KECA 5I0LA 5JMYA 2YIGA 2W13A 2Z8ZA 4AYKA 3P1VA 2OZRA 2QUAA 1ZS0A 2W0DA 3KWVC 1JANA 4FVLA 1Y8JA 4I35A 3DPEA 1XFZA 1USNA 1BZSA 4WZVA 2OVXA 3WP8A 1ZVXA 1OS2A 4L6TA 2XQHA 5I43A 1G4KA 4JQGA 1YOUA 3KHIA 1UEAA 1XUCA 2X3AA 2OY2A 3LJZA 2E2DA 3LQBA 4PKRA 3F1AA 1EUBA 2JIHA 3WV2A 1Z3JA 2N8RA 1HV5A 1BSWA 1Q3AA 1FM1A 1L6JA 2OXWA 3LJTA 2JNPA 2RJQA 3EHXA 1CIZA 3UVCA 1XFUA 4DD8A 1HY7A 4GWMA 1XFVA 4IJOA 2DW2A 2YO1A 4IUWA 5I4OA 3I7IA 3HBVP 1G9KA 1IABA 5D1UA 5I12A 3LUNA 1P9HA 2OVZA 1BUDA 1OM6A 1BKCA 4DPEA 3HBUP 4WKIA 2XS4A 2YO0A 3A70A 1RM8A 3G5CA 1OM8A 456CA 3KEJA 2SRTA 1AYKA 2AGMA 2YB9A 1CQRA 2TCLA 1KUKA 1PWVA 3ELMA 2CLTA 1KUHA 2X3BA 2W15A 1HFCA 3O2XA 3F19A 4L19A 2W14A 4QKZA 2O36A 1SATA 3RTTA 1PWQA 1GKCA 2OW9A 5CVWA 2ERPA 1BM6A 1HOVA 1GE6A 3U1RA 2WO8A 1A85A 1IAGA 4AUOA 1FBLA 2AYKA 4H49A 3F16A 3AYUA 1MMQA 1JAPA 2DDFA 1JJ9A 1SRPA 1QJIA 2D1NA 1J7NA 1JAQA 3LKAA 1ATLA 1EAKA 3S6LA 1R1JA 3I7GA 4FXQA 3EDZA 5CZMA 1I73A 1XUDA 1PWPA 2CKIA 4IN9A 3V96B 1D8FA 2WO9A 1BQOA 1UMSA 3LMCA 1XFYA 2DW1A 4ON1A 2Y6DA 5B5PA 2ZVDA 1JH1A 3VI1A 3HB2P 4Q1LA 3NX7A 3F15A 2FV9A 4H3XA 3K7NA 5I3MA 3MA2A 4WKEA 4G0DA 1CGLA 2V4BA 3P24A 1UMTA 4XM7A 1MNCA 3AIGA 3LJGA 4WK7A 4ZR5A 1AKLA 1FLSA 4PKUA 1QIBA 2ML2A 1GXDA 1RMZA 2WOAA 3DWBA 3OHOA 1CGEA 3HDAP 1JK3A 1QIAA 4WF6A 4J4MA 2RJPA 4H2EA 1O0QA 3KRYA 4H1QA 4L63A 1BQQM
chains in the Genus database with same CATH superfamily
2JSDA 2OW2A 2Z2DA 4DV8A 4GUYA 1XAXA 4AIGA 1QICA 2XS3A 3WV3A 3L0VA 3Q2HA 1YQYA 4JPAA 4A3WA 1ND1A 3LUMA 1KUIA 4JIJA 5D2BA 2PJTA 1SMPA 3HY7A 4PKQA 2ZJ7A 1BKCI 3LIRA 1EB6A 1ROSA 1MMRA 4EFSA 1S4BP 3HY9A 1B3DA 3LIKA 5D1TA 3CKIA 3LQ0A 1DMTA 1XFWA 1G12A 3TVCA 2POJA 3L0TA 1CAQA 2DW0A 2JT6A 1AF0A 1GE7A 3ULTA 1MMPA 3B92A 1G49A 3DSLA 2OXUA 4G9LA 1D7XA 1K7IA 5BPAA 3GBOA 3ZXHA 1IAAA 3LGPA 2ZJ6A 1K7QA 4H30A 1CK7A 1O0TA 3HYGA 5B5OA 3WV1A 3TSKA 4I03A 5I2ZA 5BOYA 1ASTA 1MMBA 3KMCA 1UTTA 3OHLA 4PKWA 1OO9A 1IACA 2MZHA 2QUBA 4GWNA 5H8XA 1QJJA 3HDBA 2L0RA 1I1IP 5LABA 4H84A 2J83A 4DT5A 2K9CA 3SHIA 1PWUA 2AIGP 3LAAA 2A8HA 1OS9A 2QPJA 3LA9A 1G05A 2MLSA 3DNGA 1C3IA 1A86A 5CXAA 2FV5A 1K7GA 4H82A 3LEAA 1CGFA 4ILWD 2USNA 3F17A 4HMAA 1XURA 1Y0VA 2K2GA 1IAEA 3F18A 1ZP5A 1YCMA 5D3CA 5D7WA 1DTHA 4XM8A 2ERQA 1B8YA 1SLMA 1GO7P 3LE9A 1D8MA 1SLNA 1Y93A 2O3EA 3BA0A 5CUHA 4DF9A 2OY4A 4HX3A 1YP1A 1UTZA 2X7MA 4PKSA 2W12A 1KUFA 1WNIA 3ZVSA 5BOTA 4JP4A 3EDGA 1BIWA 2I47A 2Y6CA 1GO8P 3N2UA 3AYKA 1JIZA 1KBCA 1R1IA 3DL1A 5D1SA 1OZ9A 1R1HA 1D5JA 2J0TA 1JKYA 3EDIA 1C7KA 3Q2GA 1IADA 1KUGA 3DTEA 966CA 2OW1A 1R54A 1OM7A 3NTNA 2EROA 3LK8A 1HTDA 3TS4A 2DDYA 4JA1A 3ZUKA 1CXVA 1ZXVA 3N2VA 830CA 1GE5A 4XCTA 2HU6A 2JT5A 4A7BA 2Z8XA 2OW0A 2OXZA 2MZEA 3B2ZA 3RTSA 1SU3A 3TT4A 2MZIA 3E8RA 5L79A 1XFXA 4GF1A 1PWWA 3K7LA 3G42A 1ZXCA 4XM6A 1BUVM 2D1OA 4GR0A 1I76A 1QUAA 4XBHA 2KRJA 1ZTQA 1H71P 1C8TA 1KAPP 4CTHA 2YUFA 1BKCE 4FXYP 3EWJA 2X3CA 4FU4A 2MLRA 3DPFA 4R3VA 3O64A 3USNA 4GR3A 3EDHA 4H76A 3A6ZA 5CXLA 3VTGA 1R55A 4AXQA 3KMEA 1OMJA 4GQLA 3KEKA 4PKVA 2OI0A 3EHYA 5L7FA 4GR8A 1JAOA 3LILA 1JIWP 2E3XA 4PKTA 1GKDA 1HFSA 3B8ZA 3KECA 5I0LA 5JMYA 2YIGA 2W13A 2Z8ZA 4AYKA 3P1VA 2OZRA 2QUAA 1ZS0A 2W0DA 3KWVC 1JANA 4FVLA 1Y8JA 4I35A 3DPEA 1XFZA 1USNA 1BZSA 4WZVA 2OVXA 3WP8A 1ZVXA 1OS2A 4L6TA 2XQHA 5I43A 1G4KA 4JQGA 1YOUA 3KHIA 1UEAA 1XUCA 2X3AA 2OY2A 3LJZA 2E2DA 3LQBA 4PKRA 3F1AA 1EUBA 2JIHA 3WV2A 1Z3JA 2N8RA 1HV5A 1BSWA 1Q3AA 1FM1A 1L6JA 2OXWA 3LJTA 2JNPA 2RJQA 3EHXA 1CIZA 3UVCA 1XFUA 4DD8A 1HY7A 4GWMA 1XFVA 4IJOA 2DW2A 2YO1A 4IUWA 5I4OA 3I7IA 3HBVP 1G9KA 1IABA 5D1UA 5I12A 3LUNA 1P9HA 3DTIA 2OVZA 1BUDA 1OM6A 1BKCA 4DPEA 3HBUP 4WKIA 2XS4A 2YO0A 3A70A 1RM8A 3G5CA 4L7AA 1OM8A 456CA 3KEJA 2SRTA 1AYKA 3DTKA 2AGMA 2YB9A 1CQRA 1XM5A 2TCLA 1KUKA 1PWVA 3ELMA 2CLTA 1KUHA 2X3BA 2W15A 1HFCA 3O2XA 3F19A 4L19A 2W14A 4QKZA 2O36A 1SATA 3RTTA 1PWQA 1GKCA 2OW9A 5CVWA 2ERPA 1BM6A 1HOVA 1GE6A 3U1RA 2WO8A 1A85A 1IAGA 4AUOA 1FBLA 2AYKA 4H49A 3F16A 3AYUA 1MMQA 1JAPA 1TVIA 2DDFA 1JJ9A 1SRPA 1QJIA 2D1NA 1J7NA 1JAQA 3LKAA 1ATLA 1EAKA 3S6LA 1R1JA 3I7GA 4FXQA 3EDZA 5CZMA 1I73A 1XUDA 1PWPA 2CKIA 4IN9A 3V96B 1D8FA 2WO9A 1BQOA 1UMSA 3LMCA 1XFYA 2DW1A 4ON1A 2Y6DA 5B5PA 2ZVDA 1JH1A 3VI1A 3HB2P 4Q1LA 3NX7A 3F15A 2FV9A 4H3XA 3K7NA 5I3MA 3MA2A 4WKEA 4G0DA 1CGLA 2V4BA 3P24A 1UMTA 4XM7A 1MNCA 3AIGA 3LJGA 4WK7A 4ZR5A 1AKLA 1FLSA 4PKUA 1QIBA 2ML2A 1GXDA 3DWBA 1RMZA 2WOAA 3OHOA 1CGEA 3HDAP 1JK3A 1QIAA 4WF6A 4J4MA 2RJPA 4H2EA 1O0QA 3KRYA 4H1QA 4L63A 1BQQM
chains in the Genus database with same CATH topology
2JSDA 2OW2A 2Z2DA 4DV8A 4GUYA 4AIGA 1QICA 2XS3A 3WV3A 3L0VA 3Q2HA 1YQYA 4JPAA 4A3WA 1ND1A 3LUMA 1KUIA 4JIJA 5D2BA 2PJTA 1SMPA 3HY7A 4PKQA 2ZJ7A 1BKCI 3LIRA 1EB6A 1ROSA 1MMRA 4EFSA 1S4BP 3HY9A 1B3DA 3LIKA 5D1TA 3CKIA 3LQ0A 1DMTA 1XFWA 1G12A 3TVCA 2POJA 3L0TA 1CAQA 2DW0A 2JT6A 1AF0A 1GE7A 3ULTA 1MMPA 3B92A 1G49A 3DSLA 2OXUA 4G9LA 1D7XA 1K7IA 5BPAA 3GBOA 3ZXHA 1IAAA 3LGPA 2ZJ6A 1K7QA 4H30A 1CK7A 1O0TA 3HYGA 5B5OA 3WV1A 3TSKA 4I03A 5I2ZA 5BOYA 1ASTA 1MMBA 3KMCA 1UTTA 3OHLA 4PKWA 1OO9A 1IACA 2MZHA 2QUBA 4GWNA 5H8XA 1QJJA 3HDBA 2L0RA 1I1IP 5LABA 4H84A 2J83A 2K9CA 3SHIA 1PWUA 2AIGP 3LAAA 2A8HA 1OS9A 2QPJA 3LA9A 1G05A 2MLSA 3DNGA 1C3IA 1A86A 5CXAA 2FV5A 1K7GA 4H82A 3LEAA 1CGFA 4ILWD 2USNA 3F17A 4HMAA 1XURA 1Y0VA 2K2GA 1IAEA 3F18A 1ZP5A 1YCMA 5D3CA 5D7WA 1DTHA 4XM8A 2ERQA 1B8YA 1SLMA 1GO7P 3LE9A 1D8MA 1SLNA 1Y93A 2O3EA 3BA0A 5CUHA 4DF9A 2OY4A 4HX3A 1YP1A 1UTZA 2X7MA 4PKSA 2W12A 1KUFA 1WNIA 3ZVSA 5BOTA 4JP4A 3EDGA 1BIWA 2I47A 2Y6CA 1GO8P 3N2UA 3AYKA 1JIZA 1KBCA 1R1IA 3DL1A 5D1SA 1R1HA 1D5JA 2J0TA 1JKYA 3EDIA 1C7KA 3Q2GA 1IADA 1KUGA 3DTEA 966CA 2OW1A 1R54A 1OM7A 3NTNA 2EROA 3LK8A 1HTDA 3TS4A 2DDYA 4JA1A 3ZUKA 1CXVA 1ZXVA 3N2VA 830CA 1GE5A 4XCTA 2HU6A 2JT5A 4A7BA 2Z8XA 2OW0A 2OXZA 2MZEA 3B2ZA 3RTSA 1SU3A 3TT4A 2MZIA 3E8RA 5L79A 1XFXA 4GF1A 1PWWA 3K7LA 3G42A 1ZXCA 4XM6A 1BUVM 2D1OA 4GR0A 1I76A 1QUAA 4XBHA 2KRJA 1ZTQA 1H71P 1C8TA 1KAPP 4CTHA 2YUFA 1BKCE 4FXYP 3EWJA 2X3CA 4FU4A 2MLRA 3DPFA 4R3VA 3O64A 3USNA 4GR3A 3EDHA 4H76A 3A6ZA 5CXLA 3VTGA 1R55A 4AXQA 3KMEA 1OMJA 4GQLA 3KEKA 4PKVA 2OI0A 3EHYA 5L7FA 4GR8A 1JAOA 3LILA 1JIWP 2E3XA 4PKTA 1GKDA 1HFSA 3B8ZA 3KECA 5I0LA 5JMYA 2YIGA 2W13A 2Z8ZA 4AYKA 3P1VA 2OZRA 2QUAA 1ZS0A 2W0DA 3KWVC 1JANA 4FVLA 1Y8JA 4I35A 3DPEA 1XFZA 1USNA 1BZSA 4WZVA 2OVXA 3WP8A 1ZVXA 1OS2A 4L6TA 2XQHA 5I43A 1G4KA 4JQGA 1YOUA 3KHIA 1UEAA 1XUCA 2X3AA 2OY2A 3LJZA 2E2DA 3LQBA 4PKRA 3F1AA 1EUBA 2JIHA 3WV2A 1Z3JA 2N8RA 1HV5A 1BSWA 1Q3AA 1FM1A 1L6JA 2OXWA 3LJTA 2JNPA 2RJQA 3EHXA 1CIZA 3UVCA 1XFUA 4DD8A 1HY7A 4GWMA 1XFVA 4IJOA 2DW2A 2YO1A 4IUWA 5I4OA 3I7IA 3HBVP 1G9KA 1IABA 5D1UA 5I12A 3LUNA 1P9HA 3DTIA 2OVZA 1BUDA 1OM6A 1BKCA 4DPEA 3HBUP 4WKIA 2XS4A 2YO0A 3A70A 1RM8A 3G5CA 4L7AA 1OM8A 456CA 3KEJA 2SRTA 1AYKA 3DTKA 2AGMA 2YB9A 1CQRA 2TCLA 1KUKA 1PWVA 3ELMA 2CLTA 1KUHA 2X3BA 2W15A 1HFCA 3O2XA 3F19A 4L19A 2W14A 4QKZA 2O36A 1SATA 3RTTA 1PWQA 1GKCA 2OW9A 5CVWA 2ERPA 1BM6A 1HOVA 1GE6A 3U1RA 2WO8A 1A85A 1IAGA 4AUOA 1FBLA 2AYKA 4H49A 3F16A 3AYUA 1MMQA 1JAPA 2DDFA 1JJ9A 1SRPA 1QJIA 2D1NA 1J7NA 1JAQA 3LKAA 1ATLA 1EAKA 3S6LA 1R1JA 3I7GA 4FXQA 3EDZA 5CZMA 1I73A 1XUDA 1PWPA 2CKIA 4IN9A 3V96B 1D8FA 2WO9A 1BQOA 1UMSA 3LMCA 1XFYA 2DW1A 4ON1A 2Y6DA 5B5PA 2ZVDA 1JH1A 3VI1A 3HB2P 4Q1LA 3NX7A 3F15A 2FV9A 4H3XA 3K7NA 5I3MA 3MA2A 4WKEA 4G0DA 1CGLA 2V4BA 3P24A 1UMTA 4XM7A 1MNCA 3AIGA 3LJGA 4WK7A 4ZR5A 1AKLA 1FLSA 4PKUA 1QIBA 2ML2A 1GXDA 3DWBA 1RMZA 2WOAA 3OHOA 1CGEA 3HDAP 1JK3A 1QIAA 4WF6A 4J4MA 2RJPA 4H2EA 1O0QA 3KRYA 4H1QA 4L63A 1BQQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSD A;  2OW2 A;  2Z2D A;  4DV8 A;  4GUY A;  4AIG A;  1QIC A;  2XS3 A;  3WV3 A;  3L0V A;  3Q2H A;  1YQY A;  4JPA A;  4A3W A;  1ND1 A;  3LUM A;  1KUI A;  4JIJ A;  5D2B A;  2PJT A;  1SMP A;  3HY7 A;  4PKQ A;  2ZJ7 A;  1BKC I;  3LIR A;  1EB6 A;  1ROS A;  1MMR A;  4EFS A;  1S4B P;  3HY9 A;  1B3D A;  3LIK A;  5D1T A;  3CKI A;  3LQ0 A;  1DMT A;  1XFW A;  1G12 A;  3TVC A;  2POJ A;  3L0T A;  1CAQ A;  2DW0 A;  2JT6 A;  1AF0 A;  1GE7 A;  3ULT A;  1MMP A;  3B92 A;  1G49 A;  3DSL A;  2OXU A;  4G9L A;  1D7X A;  1K7I A;  5BPA A;  3GBO A;  3ZXH A;  1IAA A;  3LGP A;  2ZJ6 A;  1K7Q A;  4H30 A;  1CK7 A;  1O0T A;  3HYG A;  5B5O A;  3WV1 A;  3TSK A;  4I03 A;  5I2Z A;  5BOY A;  1AST A;  1MMB A;  3KMC A;  1UTT A;  3OHL A;  4PKW A;  1OO9 A;  1IAC A;  2MZH A;  2QUB A;  4GWN A;  5H8X A;  1QJJ A;  3HDB A;  2L0R A;  1I1I P;  5LAB A;  4H84 A;  2J83 A;  2K9C A;  3SHI A;  1PWU A;  2AIG P;  3LAA A;  2A8H A;  1OS9 A;  2QPJ A;  3LA9 A;  1G05 A;  2MLS A;  3DNG A;  1C3I A;  1A86 A;  5CXA A;  2FV5 A;  1K7G A;  4H82 A;  3LEA A;  1CGF A;  4ILW D;  2USN A;  3F17 A;  4HMA A;  1XUR A;  1Y0V A;  2K2G A;  1IAE A;  3F18 A;  1ZP5 A;  1YCM A;  5D3C A;  5D7W A;  1DTH A;  4XM8 A;  2ERQ A;  1B8Y A;  1SLM A;  1GO7 P;  3LE9 A;  1D8M A;  1SLN A;  1Y93 A;  2O3E A;  3BA0 A;  5CUH A;  4DF9 A;  2OY4 A;  4HX3 A;  1YP1 A;  1UTZ A;  2X7M A;  4PKS A;  2W12 A;  1KUF A;  1WNI A;  3ZVS A;  5BOT A;  4JP4 A;  3EDG A;  1BIW A;  2I47 A;  2Y6C A;  1GO8 P;  3N2U A;  3AYK A;  1JIZ A;  1KBC A;  1R1I A;  3DL1 A;  5D1S A;  1R1H A;  1D5J A;  2J0T A;  1JKY A;  3EDI A;  1C7K A;  3Q2G A;  1IAD A;  1KUG A;  966C A;  2OW1 A;  1R54 A;  1OM7 A;  3NTN A;  2ERO A;  3LK8 A;  1HTD A;  3TS4 A;  2DDY A;  4JA1 A;  3ZUK A;  1CXV A;  1ZXV A;  3N2V A;  830C A;  1GE5 A;  4XCT A;  2HU6 A;  2JT5 A;  4A7B A;  2Z8X A;  2OW0 A;  2OXZ A;  2MZE A;  3B2Z A;  3RTS A;  1SU3 A;  3TT4 A;  2MZI A;  3E8R A;  5L79 A;  1XFX A;  4GF1 A;  1PWW A;  3K7L A;  3G42 A;  1ZXC A;  4XM6 A;  1BUV M;  2D1O A;  4GR0 A;  1I76 A;  1QUA A;  4XBH A;  2KRJ A;  1ZTQ A;  1H71 P;  1C8T A;  1KAP P;  4CTH A;  1BKC E;  4FXY P;  3EWJ A;  2X3C A;  4FU4 A;  2MLR A;  3DPF A;  4R3V A;  3O64 A;  3USN A;  4GR3 A;  3EDH A;  4H76 A;  3A6Z A;  5CXL A;  3VTG A;  1R55 A;  4AXQ A;  3KME A;  1OMJ A;  4GQL A;  3KEK A;  4PKV A;  2OI0 A;  3EHY A;  5L7F A;  4GR8 A;  1JAO A;  3LIL A;  1JIW P;  2E3X A;  4PKT A;  1GKD A;  1HFS A;  3B8Z A;  3KEC A;  5I0L A;  5JMY A;  2YIG A;  2W13 A;  2Z8Z A;  4AYK A;  3P1V A;  2OZR A;  2QUA A;  1ZS0 A;  2W0D A;  3KWV C;  1JAN A;  4FVL A;  1Y8J A;  4I35 A;  3DPE A;  1XFZ A;  1USN A;  1BZS A;  4WZV A;  2OVX A;  3WP8 A;  1ZVX A;  1OS2 A;  4L6T A;  2XQH A;  5I43 A;  1G4K A;  4JQG A;  1YOU A;  3KHI A;  1UEA A;  1XUC A;  2X3A A;  2OY2 A;  3LJZ A;  2E2D A;  3LQB A;  4PKR A;  3F1A A;  1EUB A;  2JIH A;  3WV2 A;  1Z3J A;  2N8R A;  1HV5 A;  1BSW A;  1Q3A A;  1FM1 A;  1L6J A;  2OXW A;  3LJT A;  2JNP A;  2RJQ A;  3EHX A;  1CIZ A;  3UVC A;  1XFU A;  4DD8 A;  1HY7 A;  4GWM A;  1XFV A;  4IJO A;  2DW2 A;  2YO1 A;  4IUW A;  5I4O A;  3I7I A;  3HBV P;  1G9K A;  1IAB A;  5D1U A;  5I12 A;  3LUN A;  1P9H A;  2OVZ A;  1BUD A;  1OM6 A;  1BKC A;  4DPE A;  3HBU P;  4WKI A;  2XS4 A;  2YO0 A;  3A70 A;  1RM8 A;  3G5C A;  1OM8 A;  456C A;  3KEJ A;  2SRT A;  1AYK A;  2AGM A;  2YB9 A;  1CQR A;  2TCL A;  1KUK A;  1PWV A;  3ELM A;  2CLT A;  1KUH A;  2X3B A;  2W15 A;  1HFC A;  3O2X A;  3F19 A;  4L19 A;  2W14 A;  4QKZ A;  2O36 A;  1SAT A;  3RTT A;  1PWQ A;  1GKC A;  2OW9 A;  5CVW A;  2ERP A;  1BM6 A;  1HOV A;  1GE6 A;  3U1R A;  2WO8 A;  1A85 A;  1IAG A;  4AUO A;  1FBL A;  2AYK A;  4H49 A;  3F16 A;  3AYU A;  1MMQ A;  1JAP A;  2DDF A;  1JJ9 A;  1SRP A;  1QJI A;  2D1N A;  1J7N A;  1JAQ A;  3LKA A;  1ATL A;  1EAK A;  3S6L A;  1R1J A;  3I7G A;  4FXQ A;  3EDZ A;  5CZM A;  1I73 A;  1XUD A;  1PWP A;  2CKI A;  4IN9 A;  3V96 B;  1D8F A;  2WO9 A;  1BQO A;  1UMS A;  3LMC A;  1XFY A;  2DW1 A;  4ON1 A;  2Y6D A;  5B5P A;  2ZVD A;  1JH1 A;  3VI1 A;  3HB2 P;  4Q1L A;  3NX7 A;  3F15 A;  2FV9 A;  4H3X A;  3K7N A;  5I3M A;  3MA2 A;  4WKE A;  4G0D A;  1CGL A;  2V4B A;  3P24 A;  1UMT A;  4XM7 A;  1MNC A;  3AIG A;  3LJG A;  4WK7 A;  4ZR5 A;  1AKL A;  1FLS A;  4PKU A;  1QIB A;  2ML2 A;  1GXD A;  1RMZ A;  2WOA A;  3DWB A;  3OHO A;  1CGE A;  3HDA P;  1JK3 A;  1QIA A;  4WF6 A;  4J4M A;  2RJP A;  4H2E A;  1O0Q A;  3KRY A;  4H1Q A;  4L63 A;  1BQQ M; 
#chains in the Genus database with same CATH topology
 2JSD A;  2OW2 A;  2Z2D A;  4DV8 A;  4GUY A;  1XAX A;  4AIG A;  1QIC A;  2XS3 A;  3WV3 A;  3L0V A;  3Q2H A;  1YQY A;  4JPA A;  4A3W A;  1ND1 A;  3LUM A;  1KUI A;  4JIJ A;  5D2B A;  2PJT A;  1SMP A;  3HY7 A;  4PKQ A;  2ZJ7 A;  1BKC I;  3LIR A;  1EB6 A;  1ROS A;  1MMR A;  4EFS A;  1S4B P;  3HY9 A;  1B3D A;  3LIK A;  5D1T A;  3CKI A;  3LQ0 A;  1DMT A;  1XFW A;  1G12 A;  3TVC A;  2POJ A;  3L0T A;  1CAQ A;  2DW0 A;  2JT6 A;  1AF0 A;  1GE7 A;  3ULT A;  1MMP A;  3B92 A;  1G49 A;  3DSL A;  2OXU A;  4G9L A;  1D7X A;  1K7I A;  5BPA A;  3GBO A;  3ZXH A;  1IAA A;  3LGP A;  2ZJ6 A;  1K7Q A;  4H30 A;  1CK7 A;  1O0T A;  3HYG A;  5B5O A;  3WV1 A;  3TSK A;  4I03 A;  5I2Z A;  5BOY A;  1AST A;  1MMB A;  3KMC A;  1UTT A;  3OHL A;  4PKW A;  1OO9 A;  1IAC A;  2MZH A;  2QUB A;  4GWN A;  5H8X A;  1QJJ A;  3HDB A;  2L0R A;  1I1I P;  5LAB A;  4H84 A;  2J83 A;  4DT5 A;  2K9C A;  3SHI A;  1PWU A;  2AIG P;  3LAA A;  2A8H A;  1OS9 A;  2QPJ A;  3LA9 A;  1G05 A;  2MLS A;  3DNG A;  1C3I A;  1A86 A;  5CXA A;  2FV5 A;  1K7G A;  4H82 A;  3LEA A;  1CGF A;  4ILW D;  2USN A;  3F17 A;  4HMA A;  1XUR A;  1Y0V A;  2K2G A;  1IAE A;  3F18 A;  1ZP5 A;  1YCM A;  5D3C A;  5D7W A;  1DTH A;  4XM8 A;  2ERQ A;  1B8Y A;  1SLM A;  1GO7 P;  3LE9 A;  1D8M A;  1SLN A;  1Y93 A;  2O3E A;  3BA0 A;  5CUH A;  4DF9 A;  2OY4 A;  4HX3 A;  1YP1 A;  1UTZ A;  2X7M A;  4PKS A;  2W12 A;  1KUF A;  1WNI A;  3ZVS A;  5BOT A;  4JP4 A;  3EDG A;  1BIW A;  2I47 A;  2Y6C A;  1GO8 P;  3N2U A;  3AYK A;  1JIZ A;  1KBC A;  1R1I A;  3DL1 A;  5D1S A;  1OZ9 A;  1R1H A;  1D5J A;  2J0T A;  1JKY A;  3EDI A;  1C7K A;  3Q2G A;  1IAD A;  1KUG A;  3DTE A;  966C A;  2OW1 A;  1R54 A;  1OM7 A;  3NTN A;  2ERO A;  3LK8 A;  1HTD A;  3TS4 A;  2DDY A;  4JA1 A;  3ZUK A;  1CXV A;  1ZXV A;  3N2V A;  830C A;  1GE5 A;  4XCT A;  2HU6 A;  2JT5 A;  4A7B A;  2Z8X A;  2OW0 A;  2OXZ A;  2MZE A;  3B2Z A;  3RTS A;  1SU3 A;  3TT4 A;  2MZI A;  3E8R A;  5L79 A;  1XFX A;  4GF1 A;  1PWW A;  3K7L A;  3G42 A;  1ZXC A;  4XM6 A;  1BUV M;  2D1O A;  4GR0 A;  1I76 A;  1QUA A;  4XBH A;  2KRJ A;  1ZTQ A;  1H71 P;  1C8T A;  1KAP P;  4CTH A;  2YUF A;  1BKC E;  4FXY P;  3EWJ A;  2X3C A;  4FU4 A;  2MLR A;  3DPF A;  4R3V A;  3O64 A;  3USN A;  4GR3 A;  3EDH A;  4H76 A;  3A6Z A;  5CXL A;  3VTG A;  1R55 A;  4AXQ A;  3KME A;  1OMJ A;  4GQL A;  3KEK A;  4PKV A;  2OI0 A;  3EHY A;  5L7F A;  4GR8 A;  1JAO A;  3LIL A;  1JIW P;  2E3X A;  4PKT A;  1GKD A;  1HFS A;  3B8Z A;  3KEC A;  5I0L A;  5JMY A;  2YIG A;  2W13 A;  2Z8Z A;  4AYK A;  3P1V A;  2OZR A;  2QUA A;  1ZS0 A;  2W0D A;  3KWV C;  1JAN A;  4FVL A;  1Y8J A;  4I35 A;  3DPE A;  1XFZ A;  1USN A;  1BZS A;  4WZV A;  2OVX A;  3WP8 A;  1ZVX A;  1OS2 A;  4L6T A;  2XQH A;  5I43 A;  1G4K A;  4JQG A;  1YOU A;  3KHI A;  1UEA A;  1XUC A;  2X3A A;  2OY2 A;  3LJZ A;  2E2D A;  3LQB A;  4PKR A;  3F1A A;  1EUB A;  2JIH A;  3WV2 A;  1Z3J A;  2N8R A;  1HV5 A;  1BSW A;  1Q3A A;  1FM1 A;  1L6J A;  2OXW A;  3LJT A;  2JNP A;  2RJQ A;  3EHX A;  1CIZ A;  3UVC A;  1XFU A;  4DD8 A;  1HY7 A;  4GWM A;  1XFV A;  4IJO A;  2DW2 A;  2YO1 A;  4IUW A;  5I4O A;  3I7I A;  3HBV P;  1G9K A;  1IAB A;  5D1U A;  5I12 A;  3LUN A;  1P9H A;  3DTI A;  2OVZ A;  1BUD A;  1OM6 A;  1BKC A;  4DPE A;  3HBU P;  4WKI A;  2XS4 A;  2YO0 A;  3A70 A;  1RM8 A;  3G5C A;  4L7A A;  1OM8 A;  456C A;  3KEJ A;  2SRT A;  1AYK A;  3DTK A;  2AGM A;  2YB9 A;  1CQR A;  1XM5 A;  2TCL A;  1KUK A;  1PWV A;  3ELM A;  2CLT A;  1KUH A;  2X3B A;  2W15 A;  1HFC A;  3O2X A;  3F19 A;  4L19 A;  2W14 A;  4QKZ A;  2O36 A;  1SAT A;  3RTT A;  1PWQ A;  1GKC A;  2OW9 A;  5CVW A;  2ERP A;  1BM6 A;  1HOV A;  1GE6 A;  3U1R A;  2WO8 A;  1A85 A;  1IAG A;  4AUO A;  1FBL A;  2AYK A;  4H49 A;  3F16 A;  3AYU A;  1MMQ A;  1JAP A;  1TVI A;  2DDF A;  1JJ9 A;  1SRP A;  1QJI A;  2D1N A;  1J7N A;  1JAQ A;  3LKA A;  1ATL A;  1EAK A;  3S6L A;  1R1J A;  3I7G A;  4FXQ A;  3EDZ A;  5CZM A;  1I73 A;  1XUD A;  1PWP A;  2CKI A;  4IN9 A;  3V96 B;  1D8F A;  2WO9 A;  1BQO A;  1UMS A;  3LMC A;  1XFY A;  2DW1 A;  4ON1 A;  2Y6D A;  5B5P A;  2ZVD A;  1JH1 A;  3VI1 A;  3HB2 P;  4Q1L A;  3NX7 A;  3F15 A;  2FV9 A;  4H3X A;  3K7N A;  5I3M A;  3MA2 A;  4WKE A;  4G0D A;  1CGL A;  2V4B A;  3P24 A;  1UMT A;  4XM7 A;  1MNC A;  3AIG A;  3LJG A;  4WK7 A;  4ZR5 A;  1AKL A;  1FLS A;  4PKU A;  1QIB A;  2ML2 A;  1GXD A;  3DWB A;  1RMZ A;  2WOA A;  3OHO A;  1CGE A;  3HDA P;  1JK3 A;  1QIA A;  4WF6 A;  4J4M A;  2RJP A;  4H2E A;  1O0Q A;  3KRY A;  4H1Q A;  4L63 A;  1BQQ M; 
#chains in the Genus database with same CATH homology
 2JSD A;  2OW2 A;  2Z2D A;  4DV8 A;  4GUY A;  4AIG A;  1QIC A;  2XS3 A;  3WV3 A;  3L0V A;  3Q2H A;  1YQY A;  4JPA A;  4A3W A;  1ND1 A;  3LUM A;  1KUI A;  4JIJ A;  5D2B A;  2PJT A;  1SMP A;  3HY7 A;  4PKQ A;  2ZJ7 A;  1BKC I;  3LIR A;  1EB6 A;  1ROS A;  1MMR A;  4EFS A;  1S4B P;  3HY9 A;  1B3D A;  3LIK A;  5D1T A;  3CKI A;  3LQ0 A;  1DMT A;  1XFW A;  1G12 A;  3TVC A;  2POJ A;  3L0T A;  1CAQ A;  2DW0 A;  2JT6 A;  1AF0 A;  1GE7 A;  3ULT A;  1MMP A;  3B92 A;  1G49 A;  3DSL A;  2OXU A;  4G9L A;  1D7X A;  1K7I A;  5BPA A;  3GBO A;  3ZXH A;  1IAA A;  3LGP A;  2ZJ6 A;  1K7Q A;  4H30 A;  1CK7 A;  1O0T A;  3HYG A;  5B5O A;  3WV1 A;  3TSK A;  4I03 A;  5I2Z A;  5BOY A;  1AST A;  1MMB A;  3KMC A;  1UTT A;  3OHL A;  4PKW A;  1OO9 A;  1IAC A;  2MZH A;  2QUB A;  4GWN A;  5H8X A;  1QJJ A;  3HDB A;  2L0R A;  1I1I P;  5LAB A;  4H84 A;  2J83 A;  2K9C A;  3SHI A;  1PWU A;  2AIG P;  3LAA A;  2A8H A;  1OS9 A;  2QPJ A;  3LA9 A;  1G05 A;  2MLS A;  3DNG A;  1C3I A;  1A86 A;  5CXA A;  2FV5 A;  1K7G A;  4H82 A;  3LEA A;  1CGF A;  4ILW D;  2USN A;  3F17 A;  4HMA A;  1XUR A;  1Y0V A;  2K2G A;  1IAE A;  3F18 A;  1ZP5 A;  1YCM A;  5D3C A;  5D7W A;  1DTH A;  4XM8 A;  2ERQ A;  1B8Y A;  1SLM A;  1GO7 P;  3LE9 A;  1D8M A;  1SLN A;  1Y93 A;  2O3E A;  3BA0 A;  5CUH A;  4DF9 A;  2OY4 A;  4HX3 A;  1YP1 A;  1UTZ A;  2X7M A;  4PKS A;  2W12 A;  1KUF A;  1WNI A;  3ZVS A;  5BOT A;  4JP4 A;  3EDG A;  1BIW A;  2I47 A;  2Y6C A;  1GO8 P;  3N2U A;  3AYK A;  1JIZ A;  1KBC A;  1R1I A;  3DL1 A;  5D1S A;  1R1H A;  1D5J A;  2J0T A;  1JKY A;  3EDI A;  1C7K A;  3Q2G A;  1IAD A;  1KUG A;  3DTE A;  966C A;  2OW1 A;  1R54 A;  1OM7 A;  3NTN A;  2ERO A;  3LK8 A;  1HTD A;  3TS4 A;  2DDY A;  4JA1 A;  3ZUK A;  1CXV A;  1ZXV A;  3N2V A;  830C A;  1GE5 A;  4XCT A;  2HU6 A;  2JT5 A;  4A7B A;  2Z8X A;  2OW0 A;  2OXZ A;  2MZE A;  3B2Z A;  3RTS A;  1SU3 A;  3TT4 A;  2MZI A;  3E8R A;  5L79 A;  1XFX A;  4GF1 A;  1PWW A;  3K7L A;  3G42 A;  1ZXC A;  4XM6 A;  1BUV M;  2D1O A;  4GR0 A;  1I76 A;  1QUA A;  4XBH A;  2KRJ A;  1ZTQ A;  1H71 P;  1C8T A;  1KAP P;  4CTH A;  2YUF A;  1BKC E;  4FXY P;  3EWJ A;  2X3C A;  4FU4 A;  2MLR A;  3DPF A;  4R3V A;  3O64 A;  3USN A;  4GR3 A;  3EDH A;  4H76 A;  3A6Z A;  5CXL A;  3VTG A;  1R55 A;  4AXQ A;  3KME A;  1OMJ A;  4GQL A;  3KEK A;  4PKV A;  2OI0 A;  3EHY A;  5L7F A;  4GR8 A;  1JAO A;  3LIL A;  1JIW P;  2E3X A;  4PKT A;  1GKD A;  1HFS A;  3B8Z A;  3KEC A;  5I0L A;  5JMY A;  2YIG A;  2W13 A;  2Z8Z A;  4AYK A;  3P1V A;  2OZR A;  2QUA A;  1ZS0 A;  2W0D A;  3KWV C;  1JAN A;  4FVL A;  1Y8J A;  4I35 A;  3DPE A;  1XFZ A;  1USN A;  1BZS A;  4WZV A;  2OVX A;  3WP8 A;  1ZVX A;  1OS2 A;  4L6T A;  2XQH A;  5I43 A;  1G4K A;  4JQG A;  1YOU A;  3KHI A;  1UEA A;  1XUC A;  2X3A A;  2OY2 A;  3LJZ A;  2E2D A;  3LQB A;  4PKR A;  3F1A A;  1EUB A;  2JIH A;  3WV2 A;  1Z3J A;  2N8R A;  1HV5 A;  1BSW A;  1Q3A A;  1FM1 A;  1L6J A;  2OXW A;  3LJT A;  2JNP A;  2RJQ A;  3EHX A;  1CIZ A;  3UVC A;  1XFU A;  4DD8 A;  1HY7 A;  4GWM A;  1XFV A;  4IJO A;  2DW2 A;  2YO1 A;  4IUW A;  5I4O A;  3I7I A;  3HBV P;  1G9K A;  1IAB A;  5D1U A;  5I12 A;  3LUN A;  1P9H A;  3DTI A;  2OVZ A;  1BUD A;  1OM6 A;  1BKC A;  4DPE A;  3HBU P;  4WKI A;  2XS4 A;  2YO0 A;  3A70 A;  1RM8 A;  3G5C A;  4L7A A;  1OM8 A;  456C A;  3KEJ A;  2SRT A;  1AYK A;  3DTK A;  2AGM A;  2YB9 A;  1CQR A;  2TCL A;  1KUK A;  1PWV A;  3ELM A;  2CLT A;  1KUH A;  2X3B A;  2W15 A;  1HFC A;  3O2X A;  3F19 A;  4L19 A;  2W14 A;  4QKZ A;  2O36 A;  1SAT A;  3RTT A;  1PWQ A;  1GKC A;  2OW9 A;  5CVW A;  2ERP A;  1BM6 A;  1HOV A;  1GE6 A;  3U1R A;  2WO8 A;  1A85 A;  1IAG A;  4AUO A;  1FBL A;  2AYK A;  4H49 A;  3F16 A;  3AYU A;  1MMQ A;  1JAP A;  2DDF A;  1JJ9 A;  1SRP A;  1QJI A;  2D1N A;  1J7N A;  1JAQ A;  3LKA A;  1ATL A;  1EAK A;  3S6L A;  1R1J A;  3I7G A;  4FXQ A;  3EDZ A;  5CZM A;  1I73 A;  1XUD A;  1PWP A;  2CKI A;  4IN9 A;  3V96 B;  1D8F A;  2WO9 A;  1BQO A;  1UMS A;  3LMC A;  1XFY A;  2DW1 A;  4ON1 A;  2Y6D A;  5B5P A;  2ZVD A;  1JH1 A;  3VI1 A;  3HB2 P;  4Q1L A;  3NX7 A;  3F15 A;  2FV9 A;  4H3X A;  3K7N A;  5I3M A;  3MA2 A;  4WKE A;  4G0D A;  1CGL A;  2V4B A;  3P24 A;  1UMT A;  4XM7 A;  1MNC A;  3AIG A;  3LJG A;  4WK7 A;  4ZR5 A;  1AKL A;  1FLS A;  4PKU A;  1QIB A;  2ML2 A;  1GXD A;  3DWB A;  1RMZ A;  2WOA A;  3OHO A;  1CGE A;  3HDA P;  1JK3 A;  1QIA A;  4WF6 A;  4J4M A;  2RJP A;  4H2E A;  1O0Q A;  3KRY A;  4H1Q A;  4L63 A;  1BQQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...