1GOCA

Cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQAITQGWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Cooperative stabilization of Escherichia coli ribonuclease HI by insertion of Gly-80b and Gly-77-->Ala substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 48
structure length 156
sequence length 156
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1gocA00
2XRIA 1QHTA 3ISNC 4CE9A 2JGUA 2XY8A 3SPZA 2B6AA 4ICLA 3B6OA 3T1AA 3OJUA 3BDPA 3S3MA 1RNHA 1D9DA 4NYNA 3ZSVA 2IGIA 5I3UA 3VQ7A 4IG3A 2IC3A 5KI6A 3SNNA 4KHWA 1B9FA 4PA1A 4K8XA 3AVGA 4NCAA 1S1WA 2RKIA 2P5GA 2QKBA 1GOBA 4ID1A 4OJRA 1Y97A 3KLIA 1RBSA 4JRQA 1JLGA 1S6PA 2QK9A 4CEEA 1IKVA 3U6FA 1NK9A 3NAEA 2X6NA 4Q5VA 1N5YA 4M3YA 3C94A 1KVCA 3E01A 3TAEA 3RMBA 1WSEA 2GUIA 3M8QA 3RMAA 5DMRA 2QXFA 4W5OA 1B92A 1RT5A 2Z1HA 2R7YA 4KKOA 4CHQA 3I8DA 4HVJA 1NK5A 4CCHA 4DSEA 1RTIA 1WSJA 1D5AA 2KZZA 1C0UA 2YNFA 3NHGA 4F3TA 1RTJA 4H4OA 4CIEA 4ELUA 1HPZA 1ASUA 3KLFA 1R0AA 1D9FA 1CZ9A 2D0BA 4CGFA 4HUEA 4EP5A 4W5NA 1S1UA 1RILA 3ZSQA 2PY5A 1LWEA 4BE2A 1XHXA 1S5JA 2E6MA 3DM2A 2GV9A 3DRSA 4I2QA 3OYJA 4FW1A 5J2PA 2ZQBA 1QQCA 4J2EA 4LSNA 4CIFA 4KRFA 4GMJB 1KLNA 1RBVA 3NGYA 3O3FA 2YKMA 3S9HA 2YNGA 3P83D 4OGCA 3VA0A 4DS4A 2KFZA 3HL8A 4KFBA 3L3UA 5FDLA 3DRPA 1C1BA 5K14A 4E19A 3ZCMA 4CEQA 1JL2A 3LPUA 4N56A 3PX6A 1J5OA 3M8SA 2VWKA 2D5RA 4CK3A 1TGOA 1Q9YA 1TL3A 4JS5A 1QSLA 5I42A 4DLGA 1S1VA 1RT3A 3ZSZA 1KVAA 1WSIA 3RTVA 4B08A 1T8EA 1JLBA 1DTQA 3K57A 4OPJA 4DTUA 3AVMA 3SCXA 5DK5A 4C8NA 3LWLA 2IDOA 4IFVA 3VQPA 1NK7A 2DTUA 4LSLA 3VQ8A 1DLOA 3KLEA 3CFRA 3SUQA 4E1MA 3EZ5A 1G15A 4CECA 4E1NA 3SI6A 1SL2A 4NYFA 3TAQA 3BGRA 3NFAA 5KRTA 4E7KA 3HPOA 4DQPA 3MEGA 3ZT3A 1RT2A 3KD5E 3M8RA 1TKXA 4ZTJA 2DFHA 4CJEA 3K59A 3ALYA 2X6SA 3TR8A 4UQGA 4KHQA 1X9WA 1RT1A 3ZSYA 1BIUA 3RRGA 3DOLA 4E7IA 2YNHA 4CF9A 3KK3A 3OYHA 2IS3A 3SQ0A 3DLBA 2OZMA 2FC0A 1ZYQA 4KI4A 2RN2A 4FLXA 2BANA 4FZZA 3TARA 4DMNA 1QS4A 1VSFA 1YT3A 3HSTB 1X9MA 3OY9A 1BI4B 4DU1A 1BQNA 3QEVA 3KD1E 1QSYA 4DSJA 3UIQA 1LV5A 3VQBA 1YTAA 3NH0A 3K5LA 2JLEA 2G8IA 3H08A 4OVLA 2HHTA 2HVIA 1HYVA 2ITGA 2HHQA 1ZBUA 3VQQA 3TAPA 3QLHA 1CXUA 1S9GA 3QIPA 1CZBA 1L3TA 3PO5A 4BE1A 3NH1A 3QEWA 3DRRA 1I39A 3SPYA 4CJRA 1ITGA 3ZSXA 2D0AA 3AVCA 4HUFA 3SQ4A 4Z0UA 1NOZA 3SQ1A 3KJVA 3AVJA 1ZBIA 3G10A 3OJSA 1I3AA 2XY7A 4Z4CA 4KHNA 5KTQA 2BDPA 1KLMA 1S6QA 2IAJA 3HPHA 3RWUA 4N41A 1X1PA 3OVNA 3PX4A 4F3OA 3P1GA 3ZT2A 4CJKA 3T3FA 3LDSA 4OLAA 2B5JA 3PX0A 1IKWA 3AO5A 3DI6A 4CHZA 1CLQA 3NDKA 1W0HA 3HO1A 1VRUA 1RT4A 3HPGA 3DLGA 4DSIA 1JLFA 3HJFA 4CFCA 3OYIA 3MEEA 3VQ6A 3I0SA 5CYMA 3O4NA 3AO4A 1NKEA 4CF0A 4DFKA 4I2PA 4KTWA 4N76A 4DQRA 2EHGA 1L5UA 3S3NA 1B9DA 3V81A 1UA0A 5CY4A 3F9KA 4DU4A 1QSSA 1KCFA 1RDBA 3NGIA 5C42A 4E3SA 2HNDA 1RTDA 4DWIA 4FZXC 1HYZA 4I9LA 4FJ8A 1VRTA 4FJGA 3HM9A 3TAMA 4E0DA 4HCCA 2F96A 3TI0A 4CJTA 3ZSWA 3OYFA 1EETA 1BQMA 4KPYA 2YNIA 1LW0A 4FJNA 4KTQA 2HVHA 4NCBA 3V1RA 1VSLA 3V1QA 4Z4GA 4KB0A 1C1AA 2FBTA 3A2FA 1RT6A 1VSIA 3ULDA 4CERA 4GVMA 4EP4A 2VG6A 4HTUA 4K8ZA 4GW6A 4OKJA 5C24A 4CGIA 2HHSA 5HP1A 4CFDA 1ZBFA 4CJLA 4O0JA 4CF2A 4DTRA 4DF4A 2A1RA 4EZ6A 4HCBA 4M3TA 2OPSA 3AVLA 3OS1A 4DSFA 3MECA 1KFSA 4BDZA 1BGXT 3IAYA 3V9XA 5KRSA 2ZD1A 4B9TA 1TL1A 3VQAA 3V9WA 1NJYA 4FJ9A 1C6VA 4CIGA 3K58A 4CK1A 1RCHA 3L2RA 1IG9A 4CHYA 1RDAA 1HYSA 4B8AB 4DLEA 3SYZA 4KHSA 3CQ8A 5FRMA 3MXMA 3C6TA 4NCGA 4DQQA 4H8KA 2I5JA 1TKZA 3VQ4A 2DY4A 4F2SA 4DFPA 4AHUA 2OPQA 5CZ1A 5CZ2A 4CEFA 5T7BA 4CHNA 2XHBA 3CG7A 2RPIA 5HRPA 3ASMA 4Z4HA 1YVUA 1REVA 2VG7A 1U49A 3VQDA 2FBVA 4AILC 1L3VA 4O5BA 3B6PA 3D45A 1FXXA 4CK2A 1O1WA 3SUNA 3VQEA 3WNFA 4F2RA 1VSJA 3QIOA 3KK1A 4DQSA 4DTSA 1RBRA 3QEXA 1BIZA 1RBTA 4Y1CA 4ZHRA 3V6DA 1X9SA 2G8WA 4RW6A 4ELTA 3LANA 3LP0A 4FLWA 2QKKA 4FVMA 4FJLA 5EU7A 3KKSA 3AVBA 1KVBA 3VQCA 5HLFA 2WONA 3L3VA 1U45A 3ZT0A 3QNNA 3NCIA 1T7PA 4B9NA 1LW2A 1VSEA 4CJ4A 2O4IA 4CJ5A 4CGJA 4CESA 3JYTA 4BACA 4FLVA 3KKRA 3RMDA 4OKEA 1SKRA 1VSHA 1KRPA 2OA8A 4BDPA 4M3ZA 3LPTA 4LH4A 4CGDA 1IH7A 2Q3SA 4TSXA 3T19A 3SV3A 3OYMA 3AO1A 4FW2A 3QERA 4FK0A 4FLYA 2ATQA 4FJ5A 3V1OA 3HP9A 4IG0A 3CM6A 4B3OA 1VK0A 2HNZA 1MU2A 3VQ5A 3RRHA 3AA2A 1JLAA 1J54A 2D0CA 3LWMA 4Z4IA 3IS9A 2HHVA 4FLUA 1SL0A 4YFUA 4FJ7A 4RG8A 4O55A 1C0TA 1WNSA 4E89A 4DTMA 3AO3A 1Q8IA 3KLGA 4PY5A 5FRNA 5HBMA 1NKBA 2HMIA 4FZYA 1TAUA 3L2UA 4CHPA 2Z1GA 4CHOA 4J2DA 1A5VA 4CEZA 4Q0BA 4CJUA 1KTQA 2RF2A 4C8MA 1F21A 4KAZA 3THVA 4E7JA 2HNYA 1FK9A 2IOCA 3L2QA 3VA3A 1JL1A 3OYBA 4FM0A 3QEPA 3LZJA 3AA3A 2YHAA 4DU3A 3MXJA 5CYQA 3AA4A 4N47A 3VN5A 4FJHA 2E6LA 2WOMA 4R5PA 4O0IA 4EZ9A 1T05A 1WLJA 3U3GA 1ZBLA 1IKXA 4B9UA 1N6QA 2BGGA 4WE1A 4F8RA 4B9SA 2HW3A 4CEBA 1FKOA 2PZSA 1VSDA 3ZT1A 3K5NA 1LWFA 3LP1A 4O4GA 3NF6A 2NUBA 3V9ZA 1K6YA 3V9SA 4M3RA 4FXDA 1J9AA 1BCOA 1SUQA 1HRHA 4CJVA 5KGWA 3L8BA 4E7LA 1A5XA 3O3HA 1NK4A 4J2AA 4W5RA 4Z4EA 4DG1A 4OPKA 4DSLA 3AVFA 2B4JA 4HUGA 1RBUA 4FLZA 3DMJA 2XO7A 1U04A 3D0PA 2Y1IA 3TAGA 2G8FA 4KTZA 4CF1A 4CJSA 3HXMA 4FM1A 4AH9A 4DTOA 4FYDA 3QNOA 4BE0A 2OPPA 4CJ3A 4CFBA 1WSHA 3HK2A 4KREA 1W9HA 3QEIA 3M8PA 1UWBA 3SQ2A 4ID5A 3QO9A 4CJPA 3LZIA 4FJMA 1EP4A 1BCMA 4BWJA 1XWLA 4M41A 1GOCA 5HRNA 3OYDA 3QESA 2VWJA 4DTNA 3NF7A 1TVRA 4B9MA 4RW4A 1TK5A 3EYZA 3O3GA 5HROA 1JLCA 1D8YA 3LP2A 2P5OA 3TWHA 3SV4A 4C8OA 4RW9A 3OYAA 3OS0A 1S1XA 1NOYA 4ZTFA 1C1CA 3CFOA 3PY8A 1ASWA 5SWMA 1Z26A 4DS5A 3QETA 1U4BA 4M42A 1U48A 1T03A 1UOCA 2ZE2A 4OLBA 2E4LA 2EX3A 3AO2A 2OYQA 1SV5A 1HQEA 3OYNA 4DFMA 1ASVA 4FLTA 1KFDA 1SKSA 4DSKA 3OYKA 4AHCA 2HHXA 2PYLA 2OPRA 4CGHA 4KV8A 3L2VA 2GBZA 3NBPA 3HVRA 3AVAA 3DLRA 4CGGA 3K5MA 4LY7A 3L2WA 4CEAA 3SJJA 2G8KA 4B9LA 1LWCA 3RR8A 4JS4A 3RR7A 3KTQA 3PO4A 2F8TA 3C95A 2A1SA 1VSKA 3WNGA 1QE1A 3SUOA 4FJIA 1WN7A 3K5OA 3MEDA 3DYAA 4OKKA 3TANA 1Z25A 3AVKA 4IDKA 3NF8A 4DF8A 3LALA 2KW4A 4QOZB 2FBXA 1HJRA 4AHTA 4CJWA 4BDYA 4DFJA 2PYJA 3CFPA 2G8UA 4M3XA 3PV8A 1NK0A 2LSNA 4FJXA 3DOKA 1NJWA 4B9VA 1BISA 1NK6A 3MXIA 4MQ3A 1JKHA 1XC9A 1UA1A 2F8SA 3DLKA 3KK2A 4O44A 2G8HA 1NK8A 3OYCA 3ZT4A 4E7HA 1BHLA 3G0ZA 1UAXA 1VSMA 4C8KA 2KZMA 1TAQA 3OYEA 3U3YA 3HP6A 4DQIA 3OYLA 3C6UA 1TKDA 2VG5A 3V4IA 3LAKA 4LH5A 4BWMA 4DTPA 1IO2A 3NE6A 3OS2A 3SUPA 1TK8A 1GOAA 2BE2A 4FJKA 4PWDA 4N5SA 3NGZA 4M45A 3K2PA 3LP3A 3ZSRA 2KFNA 2O4GA 3NH2A 4AHRA 1L3UA 2P51A 3SZ2A 3CYMA 3TAFA 3S3OA 2DFFA 4I9QA 4XIUA 4QAGA 2KQ2A 1TKTA 2YKNA 3RMCA 4PUOA 1XI1A 5J1EA 3JSMA 1TK0A 1WSFA 1SKWA 3HVTA 3P5JA 2XY6A 4IBNA 4MFBA 4CF8A 4FK2A 2FBYA 1XHZA 1QTMA 4RW8A 3DLHA 3LAMA 4CJFA 3PUFA 1SL1A 1EKEA 1RT7A 1HMVA 3KLHA 3F73A 1WSGA 1EXQA 3DLEA 1ZBHA 1BI4A 4YNQA 1JLEA 1FKPA 4M3UA 4CEOA 2X74A 1U47A 4IFYA 4PQUA 4B8CA 2Z1IA 5J2NA 2OZSA 4C8LA 1S1TA 4CJQA 4G1QA 2HB5A 5HRRA 4CEDA 1HQUA 4W5QA 2YV0X 3MAQA 3O4QA 3AV9A 4DTJA 1EX4A 4IKFA 5J2QA 4DTXA 1TV6A 3ITHA 4FJJA 3AVIA 2DFEA 1RDDA 3IG1A 1L3SA 1A5WA 5JS1A 2HHWA 3I0RA 1S9EA 1RDCA 3EY1A 5E41A 1IKYA 4RW7A 3V9UA 1LAWA 1JXEA 1DTTA 1WAJA 5J2MA 3AA5X 1CXQA 2X78A 1NJXA 3HYFA 4KB1A 4JLHA 3HT3A 3WNEA 4M3WA 1HNIA 2HHUA 1KSPA 3QINA 4Y1DA 2XY5A 1NJZA 4JRPA 3NF9A 5SZTA 5D3GA 4AHSA 4OGEA 4FM2A 3CM5A 1HNVA 2KTQA 3FFIA 2Y1JA 4J2BA 3AVHA 3IRXA 4F4KA 4KI6A 4FCYA 4QCLA 2ETJA 2AJQA 4W5TA 1LAVA 3KIOA 4KHYA 4HHTA 1JXBA 4LD0A 1BL3A 3VQ9A 3WNHA 4ELVA 4CFAA 4AHVA 1YTUA 4Z4FA 1JLQA 2P1JA 2Z1JA 4H4MA 1WAFA 3ZSOA 1RTHA 1J53A 5KGXA 4KO0A 5JS2A 3TABA 3OYGA 2W42A 2G8VA 4FK4A 4I7FA 1NKCA 2YHBA 4L8RB 4KHUA 1Q9XA 5C25A 5HRSA 3AVNA 1C0MA 5FROA
chains in the Genus database with same CATH superfamily
5HL7L 1QHTA 2JGUA 2XY8A 2KKZA 4JD2B 1RNHA 1TYQA 4NYNA 3D7EO 4LF5K 1B9FA 4M7YA 3ID6A 4PA1A 3AVGA 3CMAN 2P5GA 2A6AA 2QKBA 1GLDG 1GOBA 3S41A 2P9PA 3KLIA 4EAHD 1NK9A 1XNRK 5E26A 3G71N 4IZ9A 2X6NA 1KVCA 4NLBA 4A62A 5AQKA 3AAPA 3RMAA 3WQUA 1JJ2M 5AQYA 1B92A 4WQ4C 1WSJA 4X66K 2VQFK 3CCQN 2KZZA 1RTJA 4JKBA 3KLFA 1ASUA 2D0BA 2Q0RA 1S1UA 3VF2A 4M63C 1S5JA 4I2QA 3OYJA 2ZQBA 1QQCA 4LSNA 5BRFA 4CIFA 5FLXO 2D0PA 4B1VA 4OGCA 5LMUK 5AZIA 3PIPL 4Z94A 2GWJA 4CK3A 1TGOA 3VF4A 1QSLA 4A5BA 1WUAA 2ZGYA 1Q81O 1JLBA 1BU6O 3K57A 3AVMA 3CI5A 3EO3A 4C8NA 4FSVA 4FWRA 2IDOA 4YORA 3MDQA 2Q97A 3O9UA 3CFRA 3F2KA 3SI6A 1G15A 4E1NA 4H0VB 3J7AP 2CH6A 3BGRA 3HPOA 3ZT3A 5FPEA 3KD5E 3SLCA 4ZTJA 2E20A 4FWLA 2X6SA 1X9WA 3ZSYA 1NJIO 4H5VA 4I6MB 4E7IA 1WOQA 3SQ0A 3O9SA 4MO4A 2BANA 4FZZA 4DMNA 1QS4A 1VSFA 4DU1A 3QEVA 3CJ7A 3UIQA 3MCPA 1YTAA 3NH0A 2G8IA 3W0LA 1NGIA 4IWVA 3R9PA 4YOWA 2IVOA 1K8AO 4NXMK 3IFRA 3QLHA 1XMQK 5GAHP 1ESVA 3QEWA 1EQYA 4X65K 3SPYA 4CJRA 3VEYA 5AQNA 5BREA 3SQ1A 5AQTA 3CCSN 2ZJQL 1LOTB 1X1PA 3LDSA 2W41A 2QWQA 4JI7K 1CLQA 1RT4A 3HPGA 3NVMA 4CFCA 5AJ3K 5AQSA 4CF0A 2E8AA 1B9DA 3V81A 1UA0A 3F9KA 4DU4A 1RTDA 4FJ8A 1HYZA 4I9LA 4FJGA 3HM9A 5ELZA 4E0DA 4HCCA 3TI0A 4CJTA 2AP1A 2YNIA 3DAWA 4OO1J 3QBWA 1H1VA 4DR3K 4NXNK 2FBTA 4K43A 1VSIA 1SZ2A 4DR5K 4CZMA 4EP4A 2VG6A 4OKJA 2HHSA 2V7ZA 4DUYK 3THXB 2HBJA 1ZBFA 4FWPA 1VQ6N 2OPSA 3AVLA 4DB3A 2UUBK 1KFSA 3V9XA 1TL1A 3VQAA 4CIGA 4CBUA 4XH5A 4FOEA 3CCMN 4CHYA 1IG9A 1RDAA 2P9LA 4B8AB 3MXMA 3C6TA 4H8KA 1X3MA 3AAQA 4DFPA 5CZ2A 1Z6RA 5HRPA 3ATVA 3ZEUA 1XNQK 1YVUA 3VQDA 4AILC 4K0KK 3D45A 3HSCA 3R6MA 5AQJA 2OANA 4F2RA 4DQSA 4DTSA 3DXKB 4ZHRA 4ELTA 4H5TA 4FJLA 3KKSA 2BDPA 2P5OA 4DV4K 4CESA 1YIJN 4JI5K 3ZETB 1VQPN 5BPMA 2OA8A 1KRPA 1BUPA 4O5FA 4V19S 4CGDA 4FK0A 1WBDA 3SV3A 3OYMA 2BUPA 3TSUA 3RSEA 3VGMA 1MU2A 3VQ5A 3RRHA 3AA2A 1JLAA 3CJCA 4O55A 1C0TA 3KLGA 5FRNA 5HBMA 2HMIA 3L2UA 4CHPA 2Z1GA 4CHOA 4BC3A 3GBTA 2OTJN 3GDQA 3PSIA 4KAZA 2HNYA 4AF1A 3L2QA 3AY9A 3AA3A 2YHAA 3CC4N 4DU3A 5CYQA 2DPNA 1Y64A 3IUCA 3G25A 1ZBLA 1IKXA 1N6QA 2HF3A 4CEBA 1FKOA 1SL0A 3LP1A 2NUBA 5AQOA 1M1KO 4M3RA 5KGWA 3A5NC 4A61A 2NRVA 3QBXA 1VQKN 2B4JA 3VESA 1EWQA 3C7NB 4KTZA 4AH9A 3QNOA 2OPPA 3HK2A 1HKGA 1NGCA 1UWBA 3LZIA 4M41A 4AQYK 1NMDA 4JD2A 5EXWA 2VWJA 3NF7A 1TVRA 2E1YA 3QDKA 4BG9A 4B9MA 1YHQN 4FOIA 3CCUN 4B3MK 2O8EB 3O1BA 4C8OA 3OYAA 1C1CA 3CFOA 3PY8A 4BR9A 4J8FA 4JI6K 1UOCA 1VQ7N 4OLBA 2P9IB 2OYQA 1HQEA 2IIRA 4FLTA 4FWMA 3C6HA 5CR4A 3DLRA 3L2WA 1YVNA 4B9LA 3RR8A 4E1JA 3RR7A 3AGKA 3K5OA 4OKKA 4IDKA 3NF8A 2KW4A 4QOZB 1WB9A 4M3XA 4BRHA 2QWPA 2QWMA 1IJJA 3PV8A 1NK0A 3HRGA 2LSNA 3UE5A 4LFBK 4B9VA 1BISA 1XMOK 3SJHA 2G8HA 4GKKK 4O44A 3T7ZA 4E7HA 1UAXA 3ZX3A 3ATUA 4IJNA 4BRDA 4DQIA 3VENA 3OYLA 1TKDA 2VG5A 3V4IA 4QS8A 4IOCL 1TK8A 5M1OA 1IO2A 3NE6A 1E4FT 4FJKA 5B8HA 4ISEA 3NGZA 3LP3A 3SAFA 2O4GA 4IEEA 3NH2A 4K41A 3S3OA 3PIOL 2DFFA 2QW9A 4I9QA 3D2FB 3MN7A 4XIUA 1HJOA 1TKTA 4PUOA 1TK0A 1SKWA 3P5JA 3L6QA 1XQSC 4I6MA 2FBYA 1QTMA 3DLHA 5KPRA 1ATSA 1E3MA 4JI0K 2PFUA 3KLHA 1EXQA 3TU5A 3R1XA 3VMFB 4BRAA 2HSTA 4B8CA 2Z1IA 5J2NA 5AFUH 2HB5A 5HRRA 4CEDA 5JICA 4W5QA 1QZ6A 3B8AX 3CQXA 2A5XA 4OPAA 4DTJA 1EX4A 4IKFA 4FJJA 1RDDA 1L3SA 1T3VA 2H3GX 3UKUA 3EY1A 1OKJA 1JXEA 3HZ6A 5AQGA 4F9OA 4BR7A 1CXQA 3C6AA 1QVGM 4JLHA 3BF1A 3WNEA 2HHUA 3QINA 3U8XA 3IKMA 3I56N 4JRPA 1NJZA 4AHSA 4FM2A 4X64K 2Y1JA 4KBOA 1NGHA 1YITN 4F4KA 4FCYA 2ETJA 1LAVA 1JXBA 4ELVA 2NZTA 1J6ZA 4EFHA 5DM7L 2YX6A 2QEXN 4KO0A 3TABA 2W42A 4KHUA 5C25A 3KWGA 4MLHA 3T1AA 3B6OA 3OJUA 4H5RA 3ZSVA 3C0BA 4JHDB 1MWMA 4IG3A 2IC3A 4RCHA 5AQWA 5DM6L 2J4RA 4NCAA 2RKIA 1Y97A 1S6PA 2JWLA 2YHXA 3NAEA 5AQFA 3C94A 2AA4A 3THYA 2GUIA 2VGNA 2QXFA 2NRRA 1IV0A 3VTIA 4W5OA 1RT5A 2Z1HA 2R7YA 1NK5A 3EE8A 1RTIA 1C0UA 1QVFM 3NHGA 2WFBA 4CIEA 4ELUA 3CETA 5M1QA 4A2BA 1CZ9A 4HUEA 1R0AA 1D9FA 4ILHA 3ZSQA 3Q7CA 4AM7A 1LWEA 4BE2A 5J2PA 4J2EA 3DJCA 1KQSM 3EZWA 4GMJB 3VPZA 3O3FA 3VA0A 4DS4A 3HL8A 3L3UA 3ZCMA 3DXKA 4H03B 2FSKA 2UUAK 2FXUA 5C2DA 1GLAG 2OTLN 4LC9B 2O8DB 2O8BB 4DKWA 3LWLA 2ZM6K 1NK7A 4LSLA 3SUQA 3EZ5A 3GE1A 3NFAA 3MEGA 1HX1A 2E5LK 3J7ZO 4X62K 1BO5O 4UQGA 3CCLN 1BIUA 3KK3A 2E2OA 2FC0A 3SBTA 5C15A 1ZYQA 4KI4A 4B1UB 4FWQA 3Q7BA 2QI2A 4BY9C 1YT3A 3HSTB 3R8EA 4MDBA 3OY9A 1BI4B 1NGDA 4H0TB 1IBLK 1QSYA 4DSJA 1LV5A 4WCEL 4B9QA 3H08A 3N4QA 2HHTA 2UU9K 3VQQA 1C0FA 2QA4N 5M1KA 1S9GA 5KQDA 1NBWA 1L3TA 3VEWA 4HUFA 4Z0UA 3KJVA 3AVJA 4LF6K 1ZBIA 1JCEA 3C7NA 4C23A 1ATRA 4Z4CA 2XY7A 3CIPA 4KHNA 1KLMA 3HPHA 3RWUA 4NLCA 3WUHA 3WEEB 3JS6A 4FVUA 3VEXA 3PX0A 4CHZA 3NDKA 1SAZA 1W0HA 1VRUA 3HJFA 2FSJA 3OYIA 3K9JA 3MEEA 3I0SA 5AQHA 3AO4A 2O8EA 4I2PA 4N76A 3O8MA 3S3NA 3BP8A 3D2EB 1QSSA 5KQ8A 1RDBA 4DWIA 3OA9A 1VRTA 4JKAA 3TAMA 4BC4A 2P9IA 2W6KA 3ZSWA 1Q18A 4RTFD 2HBLA 4BRMA 3V1RA 4NCBA 3DXMA 4Z4GA 4FL9A 1RT6A 4IEIA 4CERA 1ATNA 3O9QA 5C12A 3GG4A 4K8ZA 3ZX2A 4CFDA 4M3TA 4KH6A 4DSFA 5KRSA 3A0IX 5AZJB 4FJ9A 3O08A 4U67L 3ENOA 4DLEA 3SYZA 4CI6A 4DQQA 3VQ4A 4F2SA 1YJ9N 4CZEA 5CZ1A 4CEFA 4QS9A 4BRFA 4QS7A 4CHNA 3ASMA 4Z4HA 2VG7A 1REVA 1U49A 5AQQA 4BR4A 3QIOA 3VEVA 3MWPA 3QEXA 4KH5A 1X3NA 3LDQA 4FVMA 5EU7A 1U45A 3VQCA 2WONA 3ZT0A 3NCIA 1LW2A 3K0SA 3D2FA 3KKRA 3RMDA 3OBWA 4BDPA 3LPTA 4LH4A 1HUXA 1IH7A 2Q3SA 3T19A 3QERA 2HHXA 3AO1A 4BRQA 4FLYA 4IG0A 5F1XA 3L4QA 4B3OA 5AQIA 2D0CA 4Z4IA 5AFUA 1YI2N 3ENHA 3FFKB 1WNSA 4E89A 4DTMA 1Q8IA 4PY5A 4YHHK 4K25A 1NKBA 4J2DA 5AQVA 3A5MC 4Q0BA 1KTQA 2RF2A 3LDLA 1P90A 3VA3A 2IOCA 3CMEN 1JL1A 5AQXA 3K9KA 2UXCK 3KHYA 3AA4A 4N47A 4FJHA 2E6LA 4PKGA 4R5PA 3CJBA 4B9UA 4CBXA 4B9SA 1S22A 1VSDA 3K5NA 1U2VB 4GNIA 1SUQA 1HRHA 5AQLA 4J2AA 5JVHL 3ENBA 4DG1A 1YXQA 3AVFA 4U7BA 3AGRA 3D0PA 4KHPK 4CF1A 3HXMA 4OPHA 1W2BM 2ZJPL 4BE0A 3EKUA 1XUPO 3QEIA 4C1NK 3QO9A 4BGAA 4FJMA 2Q2RA 4BWJA 1BCMA 4JI1K 5HRNA 4ISFA 3QMLA 3N4PA 1YUWA 3EYZA 1JLCA 1D8YA 1BG3A 1KXPA 2P9UB 1VQON 1QZ5A 4RW9A 1S1XA 1NOYA 4YDUA 4M42A 1Z26A 3NVKA 1SQKA 5AQMA 3ULEB 2P9KB 2ZE2A 4B1YB 5BPLA 2ZF5O 3OYNA 1SKSA 1KAYA 3IDHA 3AVAA 2NRWA 4JK7A 1E4GT 3BEXA 1VQLN 2HF4A 3C95A 4BRNA 3WNGA 3PLAA 4FJIA 1WN7A 4PL8A 4CJ7A 3MEDA 2O8FB 3VERA 4FPBA 4FPAA 1FJGK 3SMSA 4DR6K 4DFJA 3CFPA 4MDAA 4EHTA 1JKHA 1XC9A 1UA1A 2F8SA 2PAVA 1HKCA 3DLKA 4JKDA 3ZT4A 1BHLA 3G0ZA 5CHIA 3OYEA 3BZKA 3JAMO 2WBNA 4JI8K 1NGEA 3UKRB 4LF4K 4DTPA 3SUPA 4PWDA 1VHXA 1GOAA 4GV6A 4N5SA 2WUSA 3ZSRA 2KFNA 3SZ2A 3CYMA 1J5EK 1N36K 2YKNA 5J1EA 3JSMA 1WSFA 2XY6A 4IBNA 4FK2A 1XHZA 3VGKA 3VEZA 5IT9O 3HBTA 2F9TA 3PUFA 1NNEA 3DLEA 4BVOA 1BI4A 5LJVA 4YNQA 1IBMK 4CEOA 1U47A 4L3QA 5GIPA 3H45C 3CD6N 3MAQA 3O4QA 4H0YB 3AV9A 1OH7A 2FSNA 3THWA 4DTXA 1TV6A 3ITHA 3AVIA 2HHWA 3I0RA 5E41A 1K9MO 1IKYA 1IG8A 1LAWA 2HOEA 5F0XA 5HOOA 5J2MA 3GOIA 3AA5X 3HYFA 4CZKA 1HNIA 1NM1A 3CPEA 4Y1DA 3WEEA 2XY5A 5D3GA 4OGEA 2KTQA 3FFIA 3AVHA 5GAEP 3CCRN 4KI6A 4W5TA 4JI2K 4BVPA 4LD0A 1BL3A 5AQUA 4CFAA 3KK7A 1YTUA 1JLQA 2P1JA 2Z1JA 4WYBA 1WAFA 5AQZA 3H1QA 5KGXA 2VYPA 2YHBA 5HRSA 5FROA 4ZTFA 5GADP 4YOTA 2XRIA 4CE9A 3ISNC 3SPZA 2B6AA 1D9DA 1BOTO 5ADXH 1OH8A 3VQ7A 5KI6A 1RFQA 4GVEA 2YJEA 4H5NA 3MWTA 4K8XA 1JLGA 2RE2A 3H3OB 4CEEA 3VGLA 1K73O 1TYQB 4M3YA 2F7TA 4DCHA 3E01A 3RMBA 1DT9A 1WSEA 5AZJA 3H6EA 3M8QA 5DMRA 3MN9A 4CHQA 4CCHA 4DSEA 4YOVA 2YNFA 4H4OA 4BG8A 2QWRA 3LM2A 1GLJO 5H1SQ 1N34K 1YAGA 4JK9A 4CGFA 3LL3A 4JKHA 4DR1K 1S72N 2BH1A 2ASPA 3DM2A 2GV9A 3DRSA 4KRFA 3CC2N 3NGYA 2YKMA 2E2QA 1GLLO 2I7NA 4B3TK 4KFBA 4DV0K 3DRPA 1C1BA 2GEMA 5K14A 3LPUA 4N56A 3PX6A 1J5OA 5M1NA 2VWKA 4A2AA 2D5RA 3CJAA 4JS5A 1HKBA 2A3ZA 4DLGA 5AZIB 1RT3A 2D4WA 4A57A 4B08A 1T8EA 4OPJA 3SCXA 4IFVA 3KLEA 1DLOA 1OH6A 1SL2A 1U6ZA 5KRTA 4E7KA 1S3XA 3MX2A 4DQPA 1HNWK 4FWKA 2Q31A 1RT2A 3M8RA 1TKXA 3K59A 2GELA 3ALYA 4MLEA 3TR8A 2UYTA 2YJFA 3P38A 2F9WA 4YOXA 2IS3A 3DLBA 4ILJA 2OZMA 2RN2A 4CZJA 5EY4A 4JEPA 3O5BA 5JLHA 4DR2K 1BQNA 3LDPA 3KD1E 4CD3A 1GLCG 3K5LA 2JLEA 4OVLA 4BRIA 1YJNN 2HHQA 1ZBUA 3TAPA 5AQPA 5EX5A 1CXUA 3QIPA 3NH1A 3DRRA 4DV6K 2D0AA 1NOZA 3OJSA 5KTQA 5IWAK 3G4SN 2IAJA 1S6QA 3M1FA 4F3OA 3CCEN 3ZT2A 1K8KB 4OLAA 2B5JA 3DI6A 3AO5A 4XH1A 3ZYYX 1HNZK 3HO1A 3AARA 4JI4K 3VQ6A 3O4NA 2P9UA 4B1XB 4KTWA 1VQ4N 4IOAL 2EHGA 1Q82O 5CY4A 2ZWHA 1NGGA 3NGIA 2DY4A 3ULEA 5C42A 4FZXC 2P9KA 4K42A 3THXA 3OYFA 1EETA 1BQMA 4YOYA 1LW0A 4FJNA 2HVHA 4PKIA 1BA1A 3V1QA 2VWBA 4KB0A 1C1AA 4GVMA 4HTUA 5C24A 5HP1A 4DTRA 4O0JA 4EZ6A 3OS1A 4BDZA 3IAYA 2ZD1A 1NJYA 3OHRA 4ILGB 4CK1A 2YI1A 4IDHA 3L2RA 3VTHA 3CQ8A 4HWIA 1N8RO 4NCGA 2I5JA 1TKZA 1NGBA 2OPQA 4AHUA 5T7BA 3CG7A 3TTFA 2RPIA 3A5OC 3SAHA 2FBVA 4DQ8A 4MO5A 4FO0A 3FR0A 4O5BA 3T69A 4DV3K 1L3VA 4WQ5C 1FXXA 2GWKA 4CK2A 1O1WA 3SUNA 3BZCA 3VQEA 3WNFA 3ZETA 4JKFA 3UKRA 1RBRA 1BIZA 1RBTA 4Y1CA 2ITMA 4RW6A 3J81O 3O9TA 4FLWA 2QKKA 3AVBA 3P4IA 3ZEUB 4B9NA 1VSEA 4CJ5A 4CGJA 3MMVA 3JYTA 4BACA 4WF9L 4FLVA 2QXLA 4OKEA 3QB0A 2QWOA 3TTDA 3WXMB 4DV5K 4TSXA 2ATQA 4FJ5A 3V1OA 3HP9A 2QWNA 4BRCA 3CM6A 1X9JA 4IXCA 1J54A 3TPQA 3IS9A 4B1WB 2HHVA 3M3ZA 4FLUA 4YFUA 1OH5A 4BC5A 4HTLA 3AO3A 1TAUA 3RSEB 4FZYA 1NWKA 1HLUA 3VETA 3I33A 4CEZA 2VCPA 3BY5A 4C8MA 4GY2B 2E2PA 3OYBA 4FM0A 3WXLA 2P9NB 3VN5A 2WOMA 3HI0A 4O0IA 4EZ9A 2BGGA 2PZSA 3ZT1A 3V9ZA 4O4GA 1K6YA 1BCOA 4B1ZA 4CJVA 3J7YP 4GKJK 1ZBSA 4E7LA 3CJ1A 4Z4EA 4GV9A 3ZX0A 4OPKA 4DSLA 5JVGL 1VQNN 1RBUA 4LF7K 2XO7A 3TAGA 4BREA 4BC2A 3FZHA 4DTOA 4FYDA 4CJ3A 4KREA 3F9MA 3BUZB 3OTOK 1KC8O 3M8PA 3SQ2A 3VEOA 5ADXA 4CJPA 1EP4A 1XWLA 1GOCA 5BN9A 2E2NA 3TWHA 3SV4A 1GLFO 3UB5A 5JLFA 1ASWA 5SWMA 4DS5A 1U48A 1T03A 4JK8A 1GLBG 3KVGA 1RGIA 4OX9K 3WXJA 2ASOA 1BWFO 2E4LA 2EX3A 3EN9A 3AO2A 4LFCK 1SV5A 1ASVA 4DSKA 3OYKA 5F2RA 3GL1A 4CGHA 3L2VA 3NBPA 3QFPA 3HVRA 3CQYA 4LY7A 3LDNA 5I9EB 3MCAB 4DHYA 2A1SA 1QE1A 4WQ4A 3SUOA 2WC9A 3O6WA 2PBDA 4DF8A 3R3LA 2FBXA 1HJRA 2KLAA 4CJWA 4BDYA 2G8UA 3CHWA 3E1YA 1HNXK 4FJXA 3DOKA 1NJWA 1NK6A 4KH4A 2UXBK 4EIAA 1NK8A 1QQOA 2KZMA 1TAQA 4BROA 1NGJA 4H5WA 3HP6A 4FWOA 1V4TA 3C6UA 3J8AA 3LAKA 3CPWM 3M6GA 4BWMA 2A41A 1HR0K 4M45A 3K2PA 1NG9A 1L3UA 2P51A 3TAFA 1NMNA 3O4WA 3L0QA 4QAGA 2KQ2A 3RMCA 1VAZA 1MA9B 4CZHA 4MFBA 4BQZA 3LAMA 1RDWX 4JKGB 4BRKA 3CF5L 4BRLA 1RT7A 4JI3K 4BR5A 4JAXA 3F73A 1ZBHA 3EEQA 4M3UA 1FKPA 3I8BA 4IFYA 3O80A 1S1TA 2CGLA 1C0GA 1HQUA 3E9OA 4YY3K 2BTFA 3I55N 2NRHA 5J2QA 1IBKK 2DFEA 2FF3B 5JS1A 3CXCM 1S9EA 1RDCA 4BRGA 4DUZK 1NJXA 2X78A 4KB1A 3C65A 1MWKA 4M3WA 1K8KA 3NF9A 1NGAA 3CM5A 3UKUB 5BR9A 1V4SA 2A40A 4CD1A 2AJQA 5BRDA 3KIOA 4KHYA 3QFUA 4HHTA 3VQ9A 5GIOA 3D6RA 1N33K 4FWSA 4H4MA 3WXIA 4JHDA 2P9SB 2G8VA 3OYGA 4FK4A 2JWKA 4L8RB 3J80O 5LY3A 3IRXA 1KD1O 4M7XA 4YDUC 4C1NI 5LJWA 3OBYA 4ICLA 1XC3A 3BDPA 3S3MA 2D0OA 2IGIA 1YJWN 5I3UA 3SNNA 4KHWA 2V7YA 3F5TA 3W3DA 4CW7B 1S1WA 1QQNA 3FZFA 4ID1A 4OJRA 1RBSA 4JRQA 2QK9A 3U6FA 1IKVA 4B3SK 3U9DA 1ZXOA 4Q5VA 1N5YA 2NRTA 4DV7K 2FF6A 3TAEA 4FWNA 1HPMA 4KKOA 3I8DA 4HVJA 3H3NO 1D5AA 4RWTA 4YOUA 4G9ZA 4F3TA 4BGBA 3FGUA 4R79A 1HPZA 3H46O 4EP5A 5KPZA 2NRZA 4W5NA 3THYB 1RILA 1DKGD 2PY5A 3CC7N 1XHXA 2E6MA 4FW1A 1KLNA 5KPTA 1RBVA 3S9HA 2O8DA 2YNGA 3P83D 1R59O 3E9LA 2UXDK 2KFZA 4LFAK 5FDLA 5LMNK 4E19A 4CEQA 1JL2A 2O8CB 5C0YA 2O8BA 3M8SA 1Q7YO 1EO1A 3TSQA 4PKHA 1T6CA 1Q9YA 1TL3A 4O8UA 5I42A 1S1VA 3ZSZA 1KVAA 1WSIA 3RTVA 4H0OA 4A5AA 1DTQA 4DTUA 5DK5A 2IVNA 3VQPA 2DTUA 3VQ8A 2VGMA 4E1MA 3G6EN 4CECA 2KHOA 4NYFA 4IO9L 1DGKN 3TAQA 2GX9A 2DFHA 4CJEA 4KHQA 1RT1A 5BN8A 3RRGA 3DOLA 3CCJN 2YNHA 4CF9A 3OYHA 4BRPA 4FLXA 3TARA 1I94K 4DR7K 1X9MA 3EL2A 2P9NA 4IO8A 3VOVA 4H0PA 3VQBA 2NNWA 3A8YA 2HVIA 1YF5L 4XH4A 1HYVA 2ITGA 2ZJRL 5BPNA 1VQ5N 2HHHK 1N32K 2Q0UA 4GV3A 1CZBA 3PO5A 4BE1A 4NB4A 1I39A 3M5RA 2YCHA 4IJAA 1ITGA 3ZSXA 3SQ4A 3AVCA 4LF8K 3CCVN 3G10A 1I3AA 5C2FA 1Q86O 4N41A 3OVNA 3PX4A 3P1GA 4CJKA 2YHYA 2HBMA 4WFAL 3T3FA 1IKWA 3D2EA 4DSIA 3DLGA 5GAGP 1JLFA 1DEJA 1KAZA 1VQ8N 5CYMA 1NKEA 4DFKA 4DQRA 1L5UA 1ILYA 1QHAA 1KCFA 1T6DA 4DV2K 4E3SA 1BA0A 2HNDA 1O13A 4ISGA 1G99A 1EWRA 5M1PA 3SAGA 2F96A 4JKEA 2YHWA 5MLCQ 2ZGZA 4KPYA 3TTCA 2GTDA 4KTQA 3AVNA 1ZC6A 2HBKA 1VSLA 3A2FA 3ULDA 1FW6A 2P9PB 4GW6A 4CGIA 3T1HK 4CJLA 4CF2A 4DF4A 2A1RA 3PSFA 4HCBA 3MECA 2EWSA 1BGXT 3DXMB 1GLEG 3TSPA 4B9TA 3V9WA 1C6VA 3K58A 1RCHA 1BDGA 1HYSA 4Y0WA 4KHSA 5FRMA 4BQLA 5A2QO 3E9PA 3H1VX 2XHBA 3EKSA 5JMVA 4O8KA 1W97L 3B6PA 1NU0A 4DV1K 3CJ9A 2E88A 4JKCA 1VSJA 3KK1A 4CZGA 3V6DA 3MK6A 1X9SA 2G8WA 3SK3A 3LANA 3LP0A 1VQ9N 5AQRA 3ID8A 1KVBA 5HLFA 3L3VA 1T7PA 3QNNA 2CGJA 5EOYA 4CJ4A 2O4IA 4JNEA 1NLVA 3JXUA 1WBBA 1SKRA 1VSHA 3VF6A 4M3ZA 2WTUA 1NGFA 3A5LC 4FW2A 4JKGA 1VK0A 2HNZA 2QTDA 2V52B 3LWMA 4FJ7A 3FLCO 4JV5K 4RG8A 4WFBL 4BR0A 1TUUA 2A42A 3WQTA 4CZIA 1A5VA 2W40A 4CJUA 5AR0A 1F21A 3THVA 1U2VA 4E7JA 1FK9A 1JCFA 3QEPA 3LZJA 1OVQA 3MXJA 1KAXA 3LDOA 1SS6A 1T05A 1WLJA 3U3GA 4WE1A 4F8RA 2HW3A 4PHTX 2QM1A 3U9ZA 3HM8A 3TANA 1LWFA 4FXDA 3NF6A 3V9SA 1M90O 4LF9K 1J9AA 3L8BA 1A5XA 4NO7A 3O3HA 1NK4A 4W5RA 1TUYA 4HUGA 4JYAK 4FLZA 1CZAN 1T44A 3DMJA 1U04A 2VQEK 2Y1IA 3T1YK 2G8FA 2P9SA 3P31A 5BR8K 4CJSA 4FM1A 1QQMA 4CFBA 1WSHA 3EE9A 1W9HA 3NMUA 4ID5A 1OVYA 2RHKA 4CBWA 3OYDA 3QESA 4DTNA 4RW4A 1TK5A 3O3GA 4IOXA 5HROA 3LP2A 3KZBA 2D1KA 2FLOA 5C10A 3OS0A 2F4VK 3SBGA 4AM6A 3E66A 1U4BA 3QETA 3WXKA 1JCGA 4DFMA 1KFDA 4CZLA 3WT0A 4AHCA 2O8FA 4XEIA 2PYLA 2OPRA 4KV8A 2GBZA 3LM9A 4CGGA 3K5MA 3SJJA 2G8KA 4CEAA 1LWCA 4JS4A 3L4IA 3KTQA 3OW2M 3PO4A 2F8TA 3P39A 1VSKA 3O9RA 3DYAA 2Q1NA 1Z25A 3AVKA 2CH5A 5FPMA 3LALA 2P9LB 2V51B 4AHTA 2NRXA 2O8CA 2PYJA 3SMPA 3O1WA 2CGKA 5FPNA 3U4LA 4A59A 3CERA 3ZLJA 3MXIA 4MQ3A 4WFNL 2GUPA 3KK2A 4BR2A 3OYCA 1VSMA 4C8KA 3FE1A 3U3YA 3HOTA 4CZFA 4CVNE 4LH5A 4DR4K 3IMXA 3QICA 3OS2A 2BE2A 4WQ5A 4AHRA 2OCEA 3MN5A 3MN6A 3DLLL 4UY8O 5GINA 1MDUB 1XI1A 3HVTA 5EVZA 4CF8A 2Q36A 4RW8A 5FPDA 4CJFA 1SL1A 1EKEA 1HMVA 1LCUA 1W7AA 4B3RK 1WSGA 2I7PA 1JLEA 2X74A 5E84A 4PQUA 3FZKA 5TKYA 2W6LA 2OZSA 4C8LA 4CJQA 4G1QA 4EHUA 3DWLA 2YV0X 5BRHA 3KWIA 3HTVA 5CE3A 3BF3A 3IG1A 1A5WA 3HOSA 3FZMA 4RW7A 3V9UA 1DTTA 2NLXA 1Z05A 1WAJA 2IVPA 4JN4A 5LL6Z 1D4XA 1P8ZA 3HT3A 3THWB 1KSPA 2HMPA 2QWLA 5SZTA 1HNVA 4J2BA 1RDUA 4QCLA 3RVCA 4PL7A 4IFEA 3MX5A 2ASMA 3WNHA 4AHVA 2UUCK 4Z4FA 2E1ZA 4H0XB 5TKWA 3ZSOA 1RTHA 1J53A 5M1FA 5JS2A 4I7FA 1NKCA 1VQMN 1Q9XA 3FZLA 1C0MA
chains in the Genus database with same CATH topology
2XRIA 1QHTA 3ISNC 4CE9A 2JGUA 2XY8A 3SPZA 2B6AA 4ICLA 3B6OA 3T1AA 3OJUA 3BDPA 3S3MA 1RNHA 1D9DA 4NYNA 3ZSVA 2IGIA 5I3UA 3VQ7A 4IG3A 2IC3A 5KI6A 3SNNA 4KHWA 1B9FA 4PA1A 4K8XA 3AVGA 4NCAA 1S1WA 2RKIA 2P5GA 2QKBA 1GOBA 4ID1A 4OJRA 1Y97A 3KLIA 1RBSA 4JRQA 1JLGA 1S6PA 2QK9A 4CEEA 1IKVA 3U6FA 1NK9A 3NAEA 2X6NA 4Q5VA 1N5YA 4M3YA 3C94A 1KVCA 3E01A 3TAEA 3RMBA 1WSEA 2GUIA 3M8QA 3RMAA 5DMRA 2QXFA 4W5OA 1B92A 1RT5A 2Z1HA 2R7YA 4KKOA 4CHQA 3I8DA 4HVJA 1NK5A 4CCHA 4DSEA 1RTIA 1WSJA 1D5AA 2KZZA 1C0UA 2YNFA 3NHGA 4F3TA 1RTJA 4H4OA 4CIEA 4ELUA 1HPZA 1ASUA 3KLFA 1R0AA 1D9FA 1CZ9A 2D0BA 4CGFA 4HUEA 4EP5A 4W5NA 1S1UA 1RILA 3ZSQA 2PY5A 1LWEA 4BE2A 1XHXA 1S5JA 2E6MA 3DM2A 2GV9A 3DRSA 4I2QA 3OYJA 4FW1A 5J2PA 2ZQBA 1QQCA 4J2EA 4LSNA 4CIFA 4KRFA 4GMJB 1KLNA 1RBVA 3NGYA 3O3FA 2YKMA 3S9HA 2YNGA 3P83D 4OGCA 3VA0A 4DS4A 2KFZA 3HL8A 4KFBA 3L3UA 5FDLA 3DRPA 1C1BA 5K14A 4E19A 3ZCMA 4CEQA 1JL2A 3LPUA 4N56A 3PX6A 1J5OA 3M8SA 2VWKA 2D5RA 4CK3A 1TGOA 1Q9YA 1TL3A 4JS5A 1QSLA 5I42A 4DLGA 1S1VA 1RT3A 3ZSZA 1KVAA 1WSIA 3RTVA 4B08A 1T8EA 1JLBA 1DTQA 3K57A 4OPJA 4DTUA 3AVMA 3SCXA 5DK5A 4C8NA 3LWLA 2IDOA 4IFVA 3VQPA 1NK7A 2DTUA 4LSLA 3VQ8A 1DLOA 3KLEA 3CFRA 3SUQA 4E1MA 3EZ5A 1G15A 4CECA 4E1NA 3SI6A 1SL2A 4NYFA 3TAQA 3BGRA 3NFAA 5KRTA 4E7KA 3HPOA 4DQPA 3MEGA 3ZT3A 1RT2A 3KD5E 3M8RA 1TKXA 4ZTJA 2DFHA 4CJEA 3K59A 3ALYA 2X6SA 3TR8A 4UQGA 4KHQA 1X9WA 1RT1A 3ZSYA 1BIUA 3RRGA 3DOLA 4E7IA 2YNHA 4CF9A 3KK3A 3OYHA 2IS3A 3SQ0A 3DLBA 2OZMA 2FC0A 1ZYQA 4KI4A 2RN2A 4FLXA 2BANA 4FZZA 3TARA 4DMNA 1QS4A 1VSFA 1YT3A 3HSTB 1X9MA 3OY9A 1BI4B 4DU1A 1BQNA 3QEVA 3KD1E 1QSYA 4DSJA 3UIQA 1LV5A 3VQBA 1YTAA 3NH0A 3K5LA 2JLEA 2G8IA 3H08A 4OVLA 2HHTA 2HVIA 1HYVA 2ITGA 2HHQA 1ZBUA 3VQQA 3TAPA 3QLHA 1CXUA 1S9GA 3QIPA 1CZBA 1L3TA 3PO5A 4BE1A 3NH1A 3QEWA 3DRRA 1I39A 3SPYA 4CJRA 1ITGA 3ZSXA 2D0AA 3AVCA 4HUFA 3SQ4A 4Z0UA 1NOZA 3SQ1A 3KJVA 3AVJA 1ZBIA 3G10A 3OJSA 1I3AA 2XY7A 4Z4CA 4KHNA 5KTQA 2BDPA 1KLMA 1S6QA 2IAJA 3HPHA 3RWUA 4N41A 1X1PA 3OVNA 3PX4A 4F3OA 3P1GA 3ZT2A 4CJKA 3T3FA 3LDSA 4OLAA 2B5JA 3PX0A 1IKWA 3AO5A 3DI6A 4CHZA 1CLQA 3NDKA 1W0HA 3HO1A 1VRUA 1RT4A 3HPGA 3DLGA 4DSIA 1JLFA 3HJFA 4CFCA 3OYIA 3MEEA 3VQ6A 3I0SA 5CYMA 3O4NA 3AO4A 1NKEA 4CF0A 4DFKA 4I2PA 4KTWA 4N76A 4DQRA 2EHGA 1L5UA 3S3NA 1B9DA 3V81A 1UA0A 5CY4A 3F9KA 4DU4A 1QSSA 1KCFA 1RDBA 3NGIA 5C42A 4E3SA 2HNDA 1RTDA 4DWIA 4FZXC 1HYZA 4I9LA 4FJ8A 1VRTA 4FJGA 3HM9A 3TAMA 4E0DA 4HCCA 2F96A 3TI0A 4CJTA 3ZSWA 3OYFA 1EETA 1BQMA 4KPYA 2YNIA 1LW0A 4FJNA 4KTQA 2HVHA 4NCBA 3V1RA 1VSLA 3V1QA 4Z4GA 4KB0A 1C1AA 2FBTA 3A2FA 1RT6A 1VSIA 3ULDA 4CERA 4GVMA 4EP4A 2VG6A 4HTUA 4K8ZA 4GW6A 4OKJA 5C24A 4CGIA 2HHSA 5HP1A 4CFDA 1ZBFA 4CJLA 4O0JA 4CF2A 4DTRA 4DF4A 2A1RA 4EZ6A 4HCBA 4M3TA 2OPSA 3AVLA 3OS1A 4DSFA 3MECA 1KFSA 4BDZA 1BGXT 3IAYA 3V9XA 5KRSA 2ZD1A 4B9TA 1TL1A 3VQAA 3V9WA 1NJYA 4FJ9A 1C6VA 4CIGA 3K58A 4CK1A 1RCHA 3L2RA 1IG9A 4CHYA 1RDAA 1HYSA 4B8AB 4DLEA 3SYZA 4KHSA 3CQ8A 5FRMA 3MXMA 3C6TA 4NCGA 4DQQA 4H8KA 2I5JA 1TKZA 3VQ4A 2DY4A 4F2SA 4DFPA 4AHUA 2OPQA 5CZ1A 5CZ2A 4CEFA 5T7BA 4CHNA 2XHBA 3CG7A 2RPIA 5HRPA 3ASMA 4Z4HA 1YVUA 1REVA 2VG7A 1U49A 3VQDA 2FBVA 4AILC 1L3VA 4O5BA 3B6PA 3D45A 1FXXA 4CK2A 1O1WA 3SUNA 3VQEA 3WNFA 4F2RA 1VSJA 3QIOA 3KK1A 4DQSA 4DTSA 1RBRA 3QEXA 1BIZA 1RBTA 4Y1CA 4ZHRA 3V6DA 1X9SA 2G8WA 4RW6A 4ELTA 3LANA 3LP0A 4FLWA 2QKKA 4FVMA 4FJLA 5EU7A 3KKSA 3AVBA 1KVBA 3VQCA 5HLFA 2WONA 3L3VA 1U45A 3ZT0A 3QNNA 3NCIA 1T7PA 4B9NA 1LW2A 1VSEA 4CJ4A 2O4IA 4CJ5A 4CGJA 4CESA 3JYTA 4BACA 4FLVA 3KKRA 3RMDA 4OKEA 1SKRA 1VSHA 1KRPA 2OA8A 4BDPA 4M3ZA 3LPTA 4LH4A 4CGDA 1IH7A 2Q3SA 4TSXA 3T19A 3SV3A 3OYMA 3AO1A 4FW2A 3QERA 4FK0A 4FLYA 2ATQA 4FJ5A 3V1OA 3HP9A 4IG0A 3CM6A 4B3OA 1VK0A 2HNZA 1MU2A 3VQ5A 3RRHA 3AA2A 1JLAA 1J54A 2D0CA 3LWMA 4Z4IA 3IS9A 2HHVA 4FLUA 1SL0A 4YFUA 4FJ7A 4RG8A 4O55A 1C0TA 1WNSA 4E89A 4DTMA 3AO3A 1Q8IA 3KLGA 4PY5A 5FRNA 5HBMA 1NKBA 2HMIA 4FZYA 1TAUA 3L2UA 4CHPA 2Z1GA 4CHOA 4J2DA 1A5VA 4CEZA 4Q0BA 4CJUA 1KTQA 2RF2A 4C8MA 1F21A 4KAZA 3THVA 4E7JA 2HNYA 1FK9A 2IOCA 3L2QA 3VA3A 1JL1A 3OYBA 4FM0A 3QEPA 3LZJA 3AA3A 2YHAA 4DU3A 3MXJA 5CYQA 3AA4A 4N47A 3VN5A 4FJHA 2E6LA 2WOMA 4R5PA 4O0IA 4EZ9A 1T05A 1WLJA 3U3GA 1ZBLA 1IKXA 4B9UA 1N6QA 2BGGA 4WE1A 4F8RA 4B9SA 2HW3A 4CEBA 1FKOA 2PZSA 1VSDA 3ZT1A 3K5NA 1LWFA 3LP1A 4O4GA 3NF6A 2NUBA 3V9ZA 1K6YA 3V9SA 4M3RA 4FXDA 1J9AA 1BCOA 1SUQA 1HRHA 4CJVA 5KGWA 3L8BA 4E7LA 1A5XA 3O3HA 1NK4A 4J2AA 4W5RA 4Z4EA 4DG1A 4OPKA 4DSLA 3AVFA 2B4JA 4HUGA 1RBUA 4FLZA 3DMJA 2XO7A 1U04A 3D0PA 2Y1IA 3TAGA 2G8FA 4KTZA 4CF1A 4CJSA 3HXMA 4FM1A 4AH9A 4DTOA 4FYDA 3QNOA 4BE0A 2OPPA 4CJ3A 4CFBA 1WSHA 3HK2A 4KREA 1W9HA 3QEIA 3M8PA 1UWBA 3SQ2A 4ID5A 3QO9A 4CJPA 3LZIA 4FJMA 1EP4A 1BCMA 4BWJA 1XWLA 4M41A 1GOCA 5HRNA 3OYDA 3QESA 2VWJA 4DTNA 3NF7A 1TVRA 4B9MA 4RW4A 1TK5A 3EYZA 3O3GA 5HROA 1JLCA 1D8YA 3LP2A 2P5OA 3TWHA 3SV4A 4C8OA 4RW9A 3OYAA 3OS0A 1S1XA 1NOYA 4ZTFA 1C1CA 3CFOA 3PY8A 1ASWA 5SWMA 1Z26A 4DS5A 3QETA 1U4BA 4M42A 1U48A 1T03A 1UOCA 2ZE2A 4OLBA 2E4LA 2EX3A 3AO2A 2OYQA 1SV5A 1HQEA 3OYNA 4DFMA 1ASVA 4FLTA 1KFDA 1SKSA 4DSKA 3OYKA 4AHCA 2HHXA 2PYLA 2OPRA 4CGHA 4KV8A 3L2VA 2GBZA 3NBPA 3HVRA 3AVAA 3DLRA 4CGGA 3K5MA 4LY7A 3L2WA 4CEAA 3SJJA 2G8KA 4B9LA 1LWCA 3RR8A 4JS4A 3RR7A 3KTQA 3PO4A 2F8TA 3C95A 2A1SA 1VSKA 3WNGA 1QE1A 3SUOA 4FJIA 1WN7A 3K5OA 3MEDA 3DYAA 4OKKA 3TANA 1Z25A 3AVKA 4IDKA 3NF8A 4DF8A 3LALA 2KW4A 4QOZB 2FBXA 1HJRA 4AHTA 4CJWA 4BDYA 4DFJA 2PYJA 3CFPA 2G8UA 4M3XA 3PV8A 1NK0A 2LSNA 4FJXA 3DOKA 1NJWA 4B9VA 1BISA 1NK6A 3MXIA 4MQ3A 1JKHA 1XC9A 1UA1A 2F8SA 3DLKA 3KK2A 4O44A 2G8HA 1NK8A 3OYCA 3ZT4A 4E7HA 1BHLA 3G0ZA 1UAXA 1VSMA 4C8KA 2KZMA 1TAQA 3OYEA 3U3YA 3HP6A 4DQIA 3OYLA 3C6UA 1TKDA 2VG5A 3V4IA 3LAKA 4LH5A 4BWMA 4DTPA 1IO2A 3NE6A 3OS2A 3SUPA 1TK8A 1GOAA 2BE2A 4FJKA 4PWDA 4N5SA 3NGZA 4M45A 3K2PA 3LP3A 3ZSRA 2KFNA 2O4GA 3NH2A 4AHRA 1L3UA 2P51A 3SZ2A 3CYMA 3TAFA 3S3OA 2DFFA 4I9QA 4XIUA 4QAGA 2KQ2A 1TKTA 2YKNA 3RMCA 4PUOA 1XI1A 5J1EA 3JSMA 1TK0A 1WSFA 1SKWA 3HVTA 3P5JA 2XY6A 4IBNA 4MFBA 4CF8A 4FK2A 2FBYA 1XHZA 1QTMA 4RW8A 3DLHA 3LAMA 4CJFA 3PUFA 1SL1A 1EKEA 1RT7A 1HMVA 3KLHA 3F73A 1WSGA 1EXQA 3DLEA 1ZBHA 1BI4A 4YNQA 1JLEA 1FKPA 4M3UA 4CEOA 2X74A 1U47A 4IFYA 4PQUA 4B8CA 2Z1IA 5J2NA 2OZSA 4C8LA 1S1TA 4CJQA 4G1QA 2HB5A 5HRRA 4CEDA 1HQUA 4W5QA 2YV0X 3MAQA 3O4QA 3AV9A 4DTJA 1EX4A 4IKFA 5J2QA 4DTXA 1TV6A 3ITHA 4FJJA 3AVIA 2DFEA 1RDDA 3IG1A 1L3SA 1A5WA 5JS1A 2HHWA 3I0RA 1S9EA 1RDCA 3EY1A 5E41A 1IKYA 4RW7A 3V9UA 1LAWA 1JXEA 1DTTA 1WAJA 5J2MA 3AA5X 1CXQA 2X78A 1NJXA 3HYFA 4KB1A 4JLHA 3HT3A 3WNEA 4M3WA 1HNIA 2HHUA 1KSPA 3QINA 4Y1DA 2XY5A 1NJZA 4JRPA 3NF9A 5SZTA 5D3GA 4AHSA 4OGEA 4FM2A 3CM5A 1HNVA 2KTQA 3FFIA 2Y1JA 4J2BA 3AVHA 3IRXA 4F4KA 4KI6A 4FCYA 4QCLA 2ETJA 2AJQA 4W5TA 1LAVA 3KIOA 4KHYA 4HHTA 1JXBA 4LD0A 1BL3A 3VQ9A 3WNHA 4ELVA 4CFAA 4AHVA 1YTUA 4Z4FA 1JLQA 2P1JA 2Z1JA 4H4MA 1WAFA 3ZSOA 1RTHA 1J53A 5KGXA 4KO0A 5JS2A 3TABA 3OYGA 2W42A 2G8VA 4FK4A 4I7FA 1NKCA 2YHBA 4L8RB 4KHUA 1Q9XA 5C25A 5HRSA 3AVNA 1C0MA 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRI A;  1QHT A;  3ISN C;  4CE9 A;  2JGU A;  2XY8 A;  3SPZ A;  2B6A A;  4ICL A;  3B6O A;  3T1A A;  3OJU A;  3BDP A;  3S3M A;  1RNH A;  1D9D A;  4NYN A;  3ZSV A;  2IGI A;  5I3U A;  3VQ7 A;  4IG3 A;  2IC3 A;  5KI6 A;  3SNN A;  4KHW A;  1B9F A;  4PA1 A;  4K8X A;  3AVG A;  4NCA A;  1S1W A;  2RKI A;  2P5G A;  2QKB A;  1GOB A;  4ID1 A;  4OJR A;  1Y97 A;  3KLI A;  1RBS A;  4JRQ A;  1JLG A;  1S6P A;  2QK9 A;  4CEE A;  1IKV A;  3U6F A;  1NK9 A;  3NAE A;  2X6N A;  4Q5V A;  1N5Y A;  4M3Y A;  3C94 A;  1KVC A;  3E01 A;  3TAE A;  3RMB A;  1WSE A;  2GUI A;  3M8Q A;  3RMA A;  5DMR A;  2QXF A;  4W5O A;  1B92 A;  1RT5 A;  2Z1H A;  2R7Y A;  4KKO A;  4CHQ A;  3I8D A;  4HVJ A;  1NK5 A;  4CCH A;  4DSE A;  1RTI A;  1WSJ A;  1D5A A;  2KZZ A;  1C0U A;  2YNF A;  3NHG A;  4F3T A;  1RTJ A;  4H4O A;  4CIE A;  4ELU A;  1HPZ A;  1ASU A;  3KLF A;  1R0A A;  1D9F A;  1CZ9 A;  2D0B A;  4CGF A;  4HUE A;  4EP5 A;  4W5N A;  1S1U A;  1RIL A;  3ZSQ A;  2PY5 A;  1LWE A;  4BE2 A;  1XHX A;  1S5J A;  2E6M A;  3DM2 A;  2GV9 A;  3DRS A;  4I2Q A;  3OYJ A;  4FW1 A;  5J2P A;  2ZQB A;  1QQC A;  4J2E A;  4LSN A;  4CIF A;  4KRF A;  4GMJ B;  1KLN A;  1RBV A;  3NGY A;  3O3F A;  2YKM A;  3S9H A;  2YNG A;  3P83 D;  4OGC A;  3VA0 A;  4DS4 A;  2KFZ A;  3HL8 A;  4KFB A;  3L3U A;  5FDL A;  3DRP A;  1C1B A;  5K14 A;  4E19 A;  3ZCM A;  4CEQ A;  1JL2 A;  3LPU A;  4N56 A;  3PX6 A;  1J5O A;  3M8S A;  2VWK A;  2D5R A;  4CK3 A;  1TGO A;  1Q9Y A;  1TL3 A;  4JS5 A;  1QSL A;  5I42 A;  4DLG A;  1S1V A;  1RT3 A;  3ZSZ A;  1KVA A;  1WSI A;  3RTV A;  4B08 A;  1T8E A;  1JLB A;  1DTQ A;  3K57 A;  4OPJ A;  4DTU A;  3AVM A;  3SCX A;  5DK5 A;  4C8N A;  3LWL A;  2IDO A;  4IFV A;  3VQP A;  1NK7 A;  2DTU A;  4LSL A;  3VQ8 A;  1DLO A;  3KLE A;  3CFR A;  3SUQ A;  4E1M A;  3EZ5 A;  1G15 A;  4CEC A;  4E1N A;  3SI6 A;  1SL2 A;  4NYF A;  3TAQ A;  3BGR A;  3NFA A;  5KRT A;  4E7K A;  3HPO A;  4DQP A;  3MEG A;  3ZT3 A;  1RT2 A;  3KD5 E;  3M8R A;  1TKX A;  4ZTJ A;  2DFH A;  4CJE A;  3K59 A;  3ALY A;  2X6S A;  3TR8 A;  4UQG A;  4KHQ A;  1X9W A;  1RT1 A;  3ZSY A;  1BIU A;  3RRG A;  3DOL A;  4E7I A;  2YNH A;  4CF9 A;  3KK3 A;  3OYH A;  2IS3 A;  3SQ0 A;  3DLB A;  2OZM A;  2FC0 A;  1ZYQ A;  4KI4 A;  2RN2 A;  4FLX A;  2BAN A;  4FZZ A;  3TAR A;  4DMN A;  1QS4 A;  1VSF A;  1YT3 A;  3HST B;  1X9M A;  3OY9 A;  1BI4 B;  4DU1 A;  1BQN A;  3QEV A;  3KD1 E;  1QSY A;  4DSJ A;  3UIQ A;  1LV5 A;  3VQB A;  1YTA A;  3NH0 A;  3K5L A;  2JLE A;  2G8I A;  3H08 A;  4OVL A;  2HHT A;  2HVI A;  1HYV A;  2ITG A;  2HHQ A;  1ZBU A;  3VQQ A;  3TAP A;  3QLH A;  1CXU A;  1S9G A;  3QIP A;  1CZB A;  1L3T A;  3PO5 A;  4BE1 A;  3NH1 A;  3QEW A;  3DRR A;  1I39 A;  3SPY A;  4CJR A;  1ITG A;  3ZSX A;  2D0A A;  3AVC A;  4HUF A;  3SQ4 A;  4Z0U A;  1NOZ A;  3SQ1 A;  3KJV A;  3AVJ A;  1ZBI A;  3G10 A;  3OJS A;  1I3A A;  2XY7 A;  4Z4C A;  4KHN A;  5KTQ A;  2BDP A;  1KLM A;  1S6Q A;  2IAJ A;  3HPH A;  3RWU A;  4N41 A;  1X1P A;  3OVN A;  3PX4 A;  4F3O A;  3P1G A;  3ZT2 A;  4CJK A;  3T3F A;  3LDS A;  4OLA A;  2B5J A;  3PX0 A;  1IKW A;  3AO5 A;  3DI6 A;  4CHZ A;  1CLQ A;  3NDK A;  1W0H A;  3HO1 A;  1VRU A;  1RT4 A;  3HPG A;  3DLG A;  4DSI A;  1JLF A;  3HJF A;  4CFC A;  3OYI A;  3MEE A;  3VQ6 A;  3I0S A;  5CYM A;  3O4N A;  3AO4 A;  1NKE A;  4CF0 A;  4DFK A;  4I2P A;  4KTW A;  4N76 A;  4DQR A;  2EHG A;  1L5U A;  3S3N A;  1B9D A;  3V81 A;  1UA0 A;  5CY4 A;  3F9K A;  4DU4 A;  1QSS A;  1KCF A;  1RDB A;  3NGI A;  5C42 A;  4E3S A;  2HND A;  1RTD A;  4DWI A;  4FZX C;  1HYZ A;  4I9L A;  4FJ8 A;  1VRT A;  4FJG A;  3HM9 A;  3TAM A;  4E0D A;  4HCC A;  2F96 A;  3TI0 A;  4CJT A;  3ZSW A;  3OYF A;  1EET A;  1BQM A;  4KPY A;  2YNI A;  1LW0 A;  4FJN A;  4KTQ A;  2HVH A;  4NCB A;  3V1R A;  1VSL A;  3V1Q A;  4Z4G A;  4KB0 A;  1C1A A;  2FBT A;  3A2F A;  1RT6 A;  1VSI A;  3ULD A;  4CER A;  4GVM A;  4EP4 A;  2VG6 A;  4HTU A;  4K8Z A;  4GW6 A;  4OKJ A;  5C24 A;  4CGI A;  2HHS A;  5HP1 A;  4CFD A;  1ZBF A;  4CJL A;  4O0J A;  4CF2 A;  4DTR A;  4DF4 A;  2A1R A;  4EZ6 A;  4HCB A;  4M3T A;  2OPS A;  3AVL A;  3OS1 A;  4DSF A;  3MEC A;  1KFS A;  4BDZ A;  1BGX T;  3IAY A;  3V9X A;  5KRS A;  2ZD1 A;  4B9T A;  1TL1 A;  3VQA A;  3V9W A;  1NJY A;  4FJ9 A;  1C6V A;  4CIG A;  3K58 A;  4CK1 A;  1RCH A;  3L2R A;  1IG9 A;  4CHY A;  1RDA A;  1HYS A;  4B8A B;  4DLE A;  3SYZ A;  4KHS A;  3CQ8 A;  5FRM A;  3MXM A;  3C6T A;  4NCG A;  4DQQ A;  4H8K A;  2I5J A;  1TKZ A;  3VQ4 A;  2DY4 A;  4F2S A;  4DFP A;  4AHU A;  2OPQ A;  5CZ1 A;  5CZ2 A;  4CEF A;  5T7B A;  4CHN A;  2XHB A;  3CG7 A;  2RPI A;  5HRP A;  3ASM A;  4Z4H A;  1YVU A;  1REV A;  2VG7 A;  1U49 A;  3VQD A;  2FBV A;  4AIL C;  1L3V A;  4O5B A;  3B6P A;  3D45 A;  1FXX A;  4CK2 A;  1O1W A;  3SUN A;  3VQE A;  3WNF A;  4F2R A;  1VSJ A;  3QIO A;  3KK1 A;  4DQS A;  4DTS A;  1RBR A;  3QEX A;  1BIZ A;  1RBT A;  4Y1C A;  4ZHR A;  3V6D A;  1X9S A;  2G8W A;  4RW6 A;  4ELT A;  3LAN A;  3LP0 A;  4FLW A;  2QKK A;  4FVM A;  4FJL A;  5EU7 A;  3KKS A;  3AVB A;  1KVB A;  3VQC A;  5HLF A;  2WON A;  3L3V A;  1U45 A;  3ZT0 A;  3QNN A;  3NCI A;  1T7P A;  4B9N A;  1LW2 A;  1VSE A;  4CJ4 A;  2O4I A;  4CJ5 A;  4CGJ A;  4CES A;  3JYT A;  4BAC A;  4FLV A;  3KKR A;  3RMD A;  4OKE A;  1SKR A;  1VSH A;  1KRP A;  2OA8 A;  4BDP A;  4M3Z A;  3LPT A;  4LH4 A;  4CGD A;  1IH7 A;  2Q3S A;  4TSX A;  3T19 A;  3SV3 A;  3OYM A;  3AO1 A;  4FW2 A;  3QER A;  4FK0 A;  4FLY A;  2ATQ A;  4FJ5 A;  3V1O A;  3HP9 A;  4IG0 A;  3CM6 A;  4B3O A;  1VK0 A;  2HNZ A;  1MU2 A;  3VQ5 A;  3RRH A;  3AA2 A;  1JLA A;  1J54 A;  2D0C A;  3LWM A;  4Z4I A;  3IS9 A;  2HHV A;  4FLU A;  1SL0 A;  4YFU A;  4FJ7 A;  4RG8 A;  4O55 A;  1C0T A;  1WNS A;  4E89 A;  4DTM A;  3AO3 A;  1Q8I A;  3KLG A;  4PY5 A;  5FRN A;  5HBM A;  1NKB A;  2HMI A;  4FZY A;  1TAU A;  3L2U A;  4CHP A;  2Z1G A;  4CHO A;  4J2D A;  1A5V A;  4CEZ A;  4Q0B A;  4CJU A;  1KTQ A;  2RF2 A;  4C8M A;  1F21 A;  4KAZ A;  3THV A;  4E7J A;  2HNY A;  1FK9 A;  2IOC A;  3L2Q A;  3VA3 A;  1JL1 A;  3OYB A;  4FM0 A;  3QEP A;  3LZJ A;  3AA3 A;  2YHA A;  4DU3 A;  3MXJ A;  5CYQ A;  3AA4 A;  4N47 A;  3VN5 A;  4FJH A;  2E6L A;  2WOM A;  4R5P A;  4O0I A;  4EZ9 A;  1T05 A;  1WLJ A;  3U3G A;  1ZBL A;  1IKX A;  4B9U A;  1N6Q A;  2BGG A;  4WE1 A;  4F8R A;  4B9S A;  2HW3 A;  4CEB A;  1FKO A;  2PZS A;  1VSD A;  3ZT1 A;  3K5N A;  1LWF A;  3LP1 A;  4O4G A;  3NF6 A;  2NUB A;  3V9Z A;  1K6Y A;  3V9S A;  4M3R A;  4FXD A;  1J9A A;  1BCO A;  1SUQ A;  1HRH A;  4CJV A;  5KGW A;  3L8B A;  4E7L A;  1A5X A;  3O3H A;  1NK4 A;  4J2A A;  4W5R A;  4Z4E A;  4DG1 A;  4OPK A;  4DSL A;  3AVF A;  2B4J A;  4HUG A;  1RBU A;  4FLZ A;  3DMJ A;  2XO7 A;  1U04 A;  3D0P A;  2Y1I A;  3TAG A;  2G8F A;  4KTZ A;  4CF1 A;  4CJS A;  3HXM A;  4FM1 A;  4AH9 A;  4DTO A;  4FYD A;  3QNO A;  4BE0 A;  2OPP A;  4CJ3 A;  4CFB A;  1WSH A;  3HK2 A;  4KRE A;  1W9H A;  3QEI A;  3M8P A;  1UWB A;  3SQ2 A;  4ID5 A;  3QO9 A;  4CJP A;  3LZI A;  4FJM A;  1EP4 A;  1BCM A;  4BWJ A;  1XWL A;  4M41 A;  1GOC A;  5HRN A;  3OYD A;  3QES A;  2VWJ A;  4DTN A;  3NF7 A;  1TVR A;  4B9M A;  4RW4 A;  1TK5 A;  3EYZ A;  3O3G A;  5HRO A;  1JLC A;  1D8Y A;  3LP2 A;  2P5O A;  3TWH A;  3SV4 A;  4C8O A;  4RW9 A;  3OYA A;  3OS0 A;  1S1X A;  1NOY A;  4ZTF A;  1C1C A;  3CFO A;  3PY8 A;  1ASW A;  5SWM A;  1Z26 A;  4DS5 A;  3QET A;  1U4B A;  4M42 A;  1U48 A;  1T03 A;  1UOC A;  2ZE2 A;  4OLB A;  2E4L A;  2EX3 A;  3AO2 A;  2OYQ A;  1SV5 A;  1HQE A;  3OYN A;  4DFM A;  1ASV A;  4FLT A;  1KFD A;  1SKS A;  4DSK A;  3OYK A;  4AHC A;  2HHX A;  2PYL A;  2OPR A;  4CGH A;  4KV8 A;  3L2V A;  2GBZ A;  3NBP A;  3HVR A;  3AVA A;  3DLR A;  4CGG A;  3K5M A;  4LY7 A;  3L2W A;  4CEA A;  3SJJ A;  2G8K A;  4B9L A;  1LWC A;  3RR8 A;  4JS4 A;  3RR7 A;  3KTQ A;  3PO4 A;  2F8T A;  3C95 A;  2A1S A;  1VSK A;  3WNG A;  1QE1 A;  3SUO A;  4FJI A;  1WN7 A;  3K5O A;  3MED A;  3DYA A;  4OKK A;  3TAN A;  1Z25 A;  3AVK A;  4IDK A;  3NF8 A;  4DF8 A;  3LAL A;  2KW4 A;  4QOZ B;  2FBX A;  1HJR A;  4AHT A;  4CJW A;  4BDY A;  4DFJ A;  2PYJ A;  3CFP A;  2G8U A;  4M3X A;  3PV8 A;  1NK0 A;  2LSN A;  4FJX A;  3DOK A;  1NJW A;  4B9V A;  1BIS A;  1NK6 A;  3MXI A;  4MQ3 A;  1JKH A;  1XC9 A;  1UA1 A;  2F8S A;  3DLK A;  3KK2 A;  4O44 A;  2G8H A;  1NK8 A;  3OYC A;  3ZT4 A;  4E7H A;  1BHL A;  3G0Z A;  1UAX A;  1VSM A;  4C8K A;  2KZM A;  1TAQ A;  3OYE A;  3U3Y A;  3HP6 A;  4DQI A;  3OYL A;  3C6U A;  1TKD A;  2VG5 A;  3V4I A;  3LAK A;  4LH5 A;  4BWM A;  4DTP A;  1IO2 A;  3NE6 A;  3OS2 A;  3SUP A;  1TK8 A;  1GOA A;  2BE2 A;  4FJK A;  4PWD A;  4N5S A;  3NGZ A;  4M45 A;  3K2P A;  3LP3 A;  3ZSR A;  2KFN A;  2O4G A;  3NH2 A;  4AHR A;  1L3U A;  2P51 A;  3SZ2 A;  3CYM A;  3TAF A;  3S3O A;  2DFF A;  4I9Q A;  4XIU A;  4QAG A;  2KQ2 A;  1TKT A;  2YKN A;  3RMC A;  4PUO A;  1XI1 A;  5J1E A;  3JSM A;  1TK0 A;  1WSF A;  1SKW A;  3HVT A;  3P5J A;  2XY6 A;  4IBN A;  4MFB A;  4CF8 A;  4FK2 A;  2FBY A;  1XHZ A;  1QTM A;  4RW8 A;  3DLH A;  3LAM A;  4CJF A;  3PUF A;  1SL1 A;  1EKE A;  1RT7 A;  1HMV A;  3KLH A;  3F73 A;  1WSG A;  1EXQ A;  3DLE A;  1ZBH A;  1BI4 A;  4YNQ A;  1JLE A;  1FKP A;  4M3U A;  4CEO A;  2X74 A;  1U47 A;  4IFY A;  4PQU A;  4B8C A;  2Z1I A;  5J2N A;  2OZS A;  4C8L A;  1S1T A;  4CJQ A;  4G1Q A;  2HB5 A;  5HRR A;  4CED A;  1HQU A;  4W5Q A;  2YV0 X;  3MAQ A;  3O4Q A;  3AV9 A;  4DTJ A;  1EX4 A;  4IKF A;  5J2Q A;  4DTX A;  1TV6 A;  3ITH A;  4FJJ A;  3AVI A;  2DFE A;  1RDD A;  3IG1 A;  1L3S A;  1A5W A;  5JS1 A;  2HHW A;  3I0R A;  1S9E A;  1RDC A;  3EY1 A;  5E41 A;  1IKY A;  4RW7 A;  3V9U A;  1LAW A;  1JXE A;  1DTT A;  1WAJ A;  5J2M A;  3AA5 X;  1CXQ A;  2X78 A;  1NJX A;  3HYF A;  4KB1 A;  4JLH A;  3HT3 A;  3WNE A;  4M3W A;  1HNI A;  2HHU A;  1KSP A;  3QIN A;  4Y1D A;  2XY5 A;  1NJZ A;  4JRP A;  3NF9 A;  5SZT A;  5D3G A;  4AHS A;  4OGE A;  4FM2 A;  3CM5 A;  1HNV A;  2KTQ A;  3FFI A;  2Y1J A;  4J2B A;  3AVH A;  3IRX A;  4F4K A;  4KI6 A;  4FCY A;  4QCL A;  2ETJ A;  2AJQ A;  4W5T A;  1LAV A;  3KIO A;  4KHY A;  4HHT A;  1JXB A;  4LD0 A;  1BL3 A;  3VQ9 A;  3WNH A;  4ELV A;  4CFA A;  4AHV A;  1YTU A;  4Z4F A;  1JLQ A;  2P1J A;  2Z1J A;  4H4M A;  1WAF A;  3ZSO A;  1RTH A;  1J53 A;  5KGX A;  4KO0 A;  5JS2 A;  3TAB A;  3OYG A;  2W42 A;  2G8V A;  4FK4 A;  4I7F A;  1NKC A;  2YHB A;  4L8R B;  4KHU A;  1Q9X A;  5C25 A;  5HRS A;  3AVN A;  1C0M A;  5FRO A; 
#chains in the Genus database with same CATH topology
 5HL7 L;  1QHT A;  2JGU A;  2XY8 A;  2KKZ A;  4JD2 B;  1RNH A;  1TYQ A;  4NYN A;  3D7E O;  4LF5 K;  1B9F A;  4M7Y A;  3ID6 A;  4PA1 A;  3AVG A;  3CMA N;  2P5G A;  2A6A A;  2QKB A;  1GLD G;  1GOB A;  3S41 A;  2P9P A;  3KLI A;  4EAH D;  1NK9 A;  1XNR K;  5E26 A;  3G71 N;  4IZ9 A;  2X6N A;  1KVC A;  4NLB A;  4A62 A;  5AQK A;  3AAP A;  3RMA A;  3WQU A;  1JJ2 M;  5AQY A;  1B92 A;  4WQ4 C;  1WSJ A;  4X66 K;  2VQF K;  3CCQ N;  2KZZ A;  1RTJ A;  4JKB A;  3KLF A;  1ASU A;  2D0B A;  2Q0R A;  1S1U A;  3VF2 A;  4M63 C;  1S5J A;  4I2Q A;  3OYJ A;  2ZQB A;  1QQC A;  4LSN A;  5BRF A;  4CIF A;  5FLX O;  2D0P A;  4B1V A;  4OGC A;  5LMU K;  5AZI A;  3PIP L;  4Z94 A;  2GWJ A;  4CK3 A;  1TGO A;  3VF4 A;  1QSL A;  4A5B A;  1WUA A;  2ZGY A;  1Q81 O;  1JLB A;  1BU6 O;  3K57 A;  3AVM A;  3CI5 A;  3EO3 A;  4C8N A;  4FSV A;  4FWR A;  2IDO A;  4YOR A;  3MDQ A;  2Q97 A;  3O9U A;  3CFR A;  3F2K A;  3SI6 A;  1G15 A;  4E1N A;  4H0V B;  3J7A P;  2CH6 A;  3BGR A;  3HPO A;  3ZT3 A;  5FPE A;  3KD5 E;  3SLC A;  4ZTJ A;  2E20 A;  4FWL A;  2X6S A;  1X9W A;  3ZSY A;  1NJI O;  4H5V A;  4I6M B;  4E7I A;  1WOQ A;  3SQ0 A;  3O9S A;  4MO4 A;  2BAN A;  4FZZ A;  4DMN A;  1QS4 A;  1VSF A;  4DU1 A;  3QEV A;  3CJ7 A;  3UIQ A;  3MCP A;  1YTA A;  3NH0 A;  2G8I A;  3W0L A;  1NGI A;  4IWV A;  3R9P A;  4YOW A;  2IVO A;  1K8A O;  4NXM K;  3IFR A;  3QLH A;  1XMQ K;  5GAH P;  1ESV A;  3QEW A;  1EQY A;  4X65 K;  3SPY A;  4CJR A;  3VEY A;  5AQN A;  5BRE A;  3SQ1 A;  5AQT A;  3CCS N;  2ZJQ L;  1LOT B;  1X1P A;  3LDS A;  2W41 A;  2QWQ A;  4JI7 K;  1CLQ A;  1RT4 A;  3HPG A;  3NVM A;  4CFC A;  5AJ3 K;  5AQS A;  4CF0 A;  2E8A A;  1B9D A;  3V81 A;  1UA0 A;  3F9K A;  4DU4 A;  1RTD A;  4FJ8 A;  1HYZ A;  4I9L A;  4FJG A;  3HM9 A;  5ELZ A;  4E0D A;  4HCC A;  3TI0 A;  4CJT A;  2AP1 A;  2YNI A;  3DAW A;  4OO1 J;  3QBW A;  1H1V A;  4DR3 K;  4NXN K;  2FBT A;  4K43 A;  1VSI A;  1SZ2 A;  4DR5 K;  4CZM A;  4EP4 A;  2VG6 A;  4OKJ A;  2HHS A;  2V7Z A;  4DUY K;  3THX B;  2HBJ A;  1ZBF A;  4FWP A;  1VQ6 N;  2OPS A;  3AVL A;  4DB3 A;  2UUB K;  1KFS A;  3V9X A;  1TL1 A;  3VQA A;  4CIG A;  4CBU A;  4XH5 A;  4FOE A;  3CCM N;  4CHY A;  1IG9 A;  1RDA A;  2P9L A;  4B8A B;  3MXM A;  3C6T A;  4H8K A;  1X3M A;  3AAQ A;  4DFP A;  5CZ2 A;  1Z6R A;  5HRP A;  3ATV A;  3ZEU A;  1XNQ K;  1YVU A;  3VQD A;  4AIL C;  4K0K K;  3D45 A;  3HSC A;  3R6M A;  5AQJ A;  2OAN A;  4F2R A;  4DQS A;  4DTS A;  3DXK B;  4ZHR A;  4ELT A;  4H5T A;  4FJL A;  3KKS A;  2BDP A;  2P5O A;  4DV4 K;  4CES A;  1YIJ N;  4JI5 K;  3ZET B;  1VQP N;  5BPM A;  2OA8 A;  1KRP A;  1BUP A;  4O5F A;  4V19 S;  4CGD A;  4FK0 A;  1WBD A;  3SV3 A;  3OYM A;  2BUP A;  3TSU A;  3RSE A;  3VGM A;  1MU2 A;  3VQ5 A;  3RRH A;  3AA2 A;  1JLA A;  3CJC A;  4O55 A;  1C0T A;  3KLG A;  5FRN A;  5HBM A;  2HMI A;  3L2U A;  4CHP A;  2Z1G A;  4CHO A;  4BC3 A;  3GBT A;  2OTJ N;  3GDQ A;  3PSI A;  4KAZ A;  2HNY A;  4AF1 A;  3L2Q A;  3AY9 A;  3AA3 A;  2YHA A;  3CC4 N;  4DU3 A;  5CYQ A;  2DPN A;  1Y64 A;  3IUC A;  3G25 A;  1ZBL A;  1IKX A;  1N6Q A;  2HF3 A;  4CEB A;  1FKO A;  1SL0 A;  3LP1 A;  2NUB A;  5AQO A;  1M1K O;  4M3R A;  5KGW A;  3A5N C;  4A61 A;  2NRV A;  3QBX A;  1VQK N;  2B4J A;  3VES A;  1EWQ A;  3C7N B;  4KTZ A;  4AH9 A;  3QNO A;  2OPP A;  3HK2 A;  1HKG A;  1NGC A;  1UWB A;  3LZI A;  4M41 A;  4AQY K;  1NMD A;  4JD2 A;  5EXW A;  2VWJ A;  3NF7 A;  1TVR A;  2E1Y A;  3QDK A;  4BG9 A;  4B9M A;  1YHQ N;  4FOI A;  3CCU N;  4B3M K;  2O8E B;  3O1B A;  4C8O A;  3OYA A;  1C1C A;  3CFO A;  3PY8 A;  4BR9 A;  4J8F A;  4JI6 K;  1UOC A;  1VQ7 N;  4OLB A;  2P9I B;  2OYQ A;  1HQE A;  2IIR A;  4FLT A;  4FWM A;  3C6H A;  5CR4 A;  3DLR A;  3L2W A;  1YVN A;  4B9L A;  3RR8 A;  4E1J A;  3RR7 A;  3AGK A;  3K5O A;  4OKK A;  4IDK A;  3NF8 A;  2KW4 A;  4QOZ B;  1WB9 A;  4M3X A;  4BRH A;  2QWP A;  2QWM A;  1IJJ A;  3PV8 A;  1NK0 A;  3HRG A;  2LSN A;  3UE5 A;  4LFB K;  4B9V A;  1BIS A;  1XMO K;  3SJH A;  2G8H A;  4GKK K;  4O44 A;  3T7Z A;  4E7H A;  1UAX A;  3ZX3 A;  3ATU A;  4IJN A;  4BRD A;  4DQI A;  3VEN A;  3OYL A;  1TKD A;  2VG5 A;  3V4I A;  4QS8 A;  4IOC L;  1TK8 A;  5M1O A;  1IO2 A;  3NE6 A;  1E4F T;  4FJK A;  5B8H A;  4ISE A;  3NGZ A;  3LP3 A;  3SAF A;  2O4G A;  4IEE A;  3NH2 A;  4K41 A;  3S3O A;  3PIO L;  2DFF A;  2QW9 A;  4I9Q A;  3D2F B;  3MN7 A;  4XIU A;  1HJO A;  1TKT A;  4PUO A;  1TK0 A;  1SKW A;  3P5J A;  3L6Q A;  1XQS C;  4I6M A;  2FBY A;  1QTM A;  3DLH A;  5KPR A;  1ATS A;  1E3M A;  4JI0 K;  2PFU A;  3KLH A;  1EXQ A;  3TU5 A;  3R1X A;  3VMF B;  4BRA A;  2HST A;  4B8C A;  2Z1I A;  5J2N A;  5AFU H;  2HB5 A;  5HRR A;  4CED A;  5JIC A;  4W5Q A;  1QZ6 A;  3B8A X;  3CQX A;  2A5X A;  4OPA A;  4DTJ A;  1EX4 A;  4IKF A;  4FJJ A;  1RDD A;  1L3S A;  1T3V A;  2H3G X;  3UKU A;  3EY1 A;  1OKJ A;  1JXE A;  3HZ6 A;  5AQG A;  4F9O A;  4BR7 A;  1CXQ A;  3C6A A;  1QVG M;  4JLH A;  3BF1 A;  3WNE A;  2HHU A;  3QIN A;  3U8X A;  3IKM A;  3I56 N;  4JRP A;  1NJZ A;  4AHS A;  4FM2 A;  4X64 K;  2Y1J A;  4KBO A;  1NGH A;  1YIT N;  4F4K A;  4FCY A;  2ETJ A;  1LAV A;  1JXB A;  4ELV A;  2NZT A;  1J6Z A;  4EFH A;  5DM7 L;  2YX6 A;  2QEX N;  4KO0 A;  3TAB A;  2W42 A;  4KHU A;  5C25 A;  3KWG A;  4MLH A;  3T1A A;  3B6O A;  3OJU A;  4H5R A;  3ZSV A;  3C0B A;  4JHD B;  1MWM A;  4IG3 A;  2IC3 A;  4RCH A;  5AQW A;  5DM6 L;  2J4R A;  4NCA A;  2RKI A;  1Y97 A;  1S6P A;  2JWL A;  2YHX A;  3NAE A;  5AQF A;  3C94 A;  2AA4 A;  3THY A;  2GUI A;  2VGN A;  2QXF A;  2NRR A;  1IV0 A;  3VTI A;  4W5O A;  1RT5 A;  2Z1H A;  2R7Y A;  1NK5 A;  3EE8 A;  1RTI A;  1C0U A;  1QVF M;  3NHG A;  2WFB A;  4CIE A;  4ELU A;  3CET A;  5M1Q A;  4A2B A;  1CZ9 A;  4HUE A;  1R0A A;  1D9F A;  4ILH A;  3ZSQ A;  3Q7C A;  4AM7 A;  1LWE A;  4BE2 A;  5J2P A;  4J2E A;  3DJC A;  1KQS M;  3EZW A;  4GMJ B;  3VPZ A;  3O3F A;  3VA0 A;  4DS4 A;  3HL8 A;  3L3U A;  3ZCM A;  3DXK A;  4H03 B;  2FSK A;  2UUA K;  2FXU A;  5C2D A;  1GLA G;  2OTL N;  4LC9 B;  2O8D B;  2O8B B;  4DKW A;  3LWL A;  2ZM6 K;  1NK7 A;  4LSL A;  3SUQ A;  3EZ5 A;  3GE1 A;  3NFA A;  3MEG A;  1HX1 A;  2E5L K;  3J7Z O;  4X62 K;  1BO5 O;  4UQG A;  3CCL N;  1BIU A;  3KK3 A;  2E2O A;  2FC0 A;  3SBT A;  5C15 A;  1ZYQ A;  4KI4 A;  4B1U B;  4FWQ A;  3Q7B A;  2QI2 A;  4BY9 C;  1YT3 A;  3HST B;  3R8E A;  4MDB A;  3OY9 A;  1BI4 B;  1NGD A;  4H0T B;  1IBL K;  1QSY A;  4DSJ A;  1LV5 A;  4WCE L;  4B9Q A;  3H08 A;  3N4Q A;  2HHT A;  2UU9 K;  3VQQ A;  1C0F A;  2QA4 N;  5M1K A;  1S9G A;  5KQD A;  1NBW A;  1L3T A;  3VEW A;  4HUF A;  4Z0U A;  3KJV A;  3AVJ A;  4LF6 K;  1ZBI A;  1JCE A;  3C7N A;  4C23 A;  1ATR A;  4Z4C A;  2XY7 A;  3CIP A;  4KHN A;  1KLM A;  3HPH A;  3RWU A;  4NLC A;  3WUH A;  3WEE B;  3JS6 A;  4FVU A;  3VEX A;  3PX0 A;  4CHZ A;  3NDK A;  1SAZ A;  1W0H A;  1VRU A;  3HJF A;  2FSJ A;  3OYI A;  3K9J A;  3MEE A;  3I0S A;  5AQH A;  3AO4 A;  2O8E A;  4I2P A;  4N76 A;  3O8M A;  3S3N A;  3BP8 A;  3D2E B;  1QSS A;  5KQ8 A;  1RDB A;  4DWI A;  3OA9 A;  1VRT A;  4JKA A;  3TAM A;  4BC4 A;  2P9I A;  2W6K A;  3ZSW A;  1Q18 A;  4RTF D;  2HBL A;  4BRM A;  3V1R A;  4NCB A;  3DXM A;  4Z4G A;  4FL9 A;  1RT6 A;  4IEI A;  4CER A;  1ATN A;  3O9Q A;  5C12 A;  3GG4 A;  4K8Z A;  3ZX2 A;  4CFD A;  4M3T A;  4KH6 A;  4DSF A;  5KRS A;  3A0I X;  5AZJ B;  4FJ9 A;  3O08 A;  4U67 L;  3ENO A;  4DLE A;  3SYZ A;  4CI6 A;  4DQQ A;  3VQ4 A;  4F2S A;  1YJ9 N;  4CZE A;  5CZ1 A;  4CEF A;  4QS9 A;  4BRF A;  4QS7 A;  4CHN A;  3ASM A;  4Z4H A;  2VG7 A;  1REV A;  1U49 A;  5AQQ A;  4BR4 A;  3QIO A;  3VEV A;  3MWP A;  3QEX A;  4KH5 A;  1X3N A;  3LDQ A;  4FVM A;  5EU7 A;  1U45 A;  3VQC A;  2WON A;  3ZT0 A;  3NCI A;  1LW2 A;  3K0S A;  3D2F A;  3KKR A;  3RMD A;  3OBW A;  4BDP A;  3LPT A;  4LH4 A;  1HUX A;  1IH7 A;  2Q3S A;  3T19 A;  3QER A;  2HHX A;  3AO1 A;  4BRQ A;  4FLY A;  4IG0 A;  5F1X A;  3L4Q A;  4B3O A;  5AQI A;  2D0C A;  4Z4I A;  5AFU A;  1YI2 N;  3ENH A;  3FFK B;  1WNS A;  4E89 A;  4DTM A;  1Q8I A;  4PY5 A;  4YHH K;  4K25 A;  1NKB A;  4J2D A;  5AQV A;  3A5M C;  4Q0B A;  1KTQ A;  2RF2 A;  3LDL A;  1P90 A;  3VA3 A;  2IOC A;  3CME N;  1JL1 A;  5AQX A;  3K9K A;  2UXC K;  3KHY A;  3AA4 A;  4N47 A;  4FJH A;  2E6L A;  4PKG A;  4R5P A;  3CJB A;  4B9U A;  4CBX A;  4B9S A;  1S22 A;  1VSD A;  3K5N A;  1U2V B;  4GNI A;  1SUQ A;  1HRH A;  5AQL A;  4J2A A;  5JVH L;  3ENB A;  4DG1 A;  1YXQ A;  3AVF A;  4U7B A;  3AGR A;  3D0P A;  4KHP K;  4CF1 A;  3HXM A;  4OPH A;  1W2B M;  2ZJP L;  4BE0 A;  3EKU A;  1XUP O;  3QEI A;  4C1N K;  3QO9 A;  4BGA A;  4FJM A;  2Q2R A;  4BWJ A;  1BCM A;  4JI1 K;  5HRN A;  4ISF A;  3QML A;  3N4P A;  1YUW A;  3EYZ A;  1JLC A;  1D8Y A;  1BG3 A;  1KXP A;  2P9U B;  1VQO N;  1QZ5 A;  4RW9 A;  1S1X A;  1NOY A;  4YDU A;  4M42 A;  1Z26 A;  3NVK A;  1SQK A;  5AQM A;  3ULE B;  2P9K B;  2ZE2 A;  4B1Y B;  5BPL A;  2ZF5 O;  3OYN A;  1SKS A;  1KAY A;  3IDH A;  3AVA A;  2NRW A;  4JK7 A;  1E4G T;  3BEX A;  1VQL N;  2HF4 A;  3C95 A;  4BRN A;  3WNG A;  3PLA A;  4FJI A;  1WN7 A;  4PL8 A;  4CJ7 A;  3MED A;  2O8F B;  3VER A;  4FPB A;  4FPA A;  1FJG K;  3SMS A;  4DR6 K;  4DFJ A;  3CFP A;  4MDA A;  4EHT A;  1JKH A;  1XC9 A;  1UA1 A;  2F8S A;  2PAV A;  1HKC A;  3DLK A;  4JKD A;  3ZT4 A;  1BHL A;  3G0Z A;  5CHI A;  3OYE A;  3BZK A;  3JAM O;  2WBN A;  4JI8 K;  1NGE A;  3UKR B;  4LF4 K;  4DTP A;  3SUP A;  4PWD A;  1VHX A;  1GOA A;  4GV6 A;  4N5S A;  2WUS A;  3ZSR A;  2KFN A;  3SZ2 A;  3CYM A;  1J5E K;  1N36 K;  2YKN A;  5J1E A;  3JSM A;  1WSF A;  2XY6 A;  4IBN A;  4FK2 A;  1XHZ A;  3VGK A;  3VEZ A;  5IT9 O;  3HBT A;  2F9T A;  3PUF A;  1NNE A;  3DLE A;  4BVO A;  1BI4 A;  5LJV A;  4YNQ A;  1IBM K;  4CEO A;  1U47 A;  4L3Q A;  5GIP A;  3H45 C;  3CD6 N;  3MAQ A;  3O4Q A;  4H0Y B;  3AV9 A;  1OH7 A;  2FSN A;  3THW A;  4DTX A;  1TV6 A;  3ITH A;  3AVI A;  2HHW A;  3I0R A;  5E41 A;  1K9M O;  1IKY A;  1IG8 A;  1LAW A;  2HOE A;  5F0X A;  5HOO A;  5J2M A;  3GOI A;  3AA5 X;  3HYF A;  4CZK A;  1HNI A;  1NM1 A;  3CPE A;  4Y1D A;  3WEE A;  2XY5 A;  5D3G A;  4OGE A;  2KTQ A;  3FFI A;  3AVH A;  5GAE P;  3CCR N;  4KI6 A;  4W5T A;  4JI2 K;  4BVP A;  4LD0 A;  1BL3 A;  5AQU A;  4CFA A;  3KK7 A;  1YTU A;  1JLQ A;  2P1J A;  2Z1J A;  4WYB A;  1WAF A;  5AQZ A;  3H1Q A;  5KGX A;  2VYP A;  2YHB A;  5HRS A;  5FRO A;  4ZTF A;  5GAD P;  4YOT A;  2XRI A;  4CE9 A;  3ISN C;  3SPZ A;  2B6A A;  1D9D A;  1BOT O;  5ADX H;  1OH8 A;  3VQ7 A;  5KI6 A;  1RFQ A;  4GVE A;  2YJE A;  4H5N A;  3MWT A;  4K8X A;  1JLG A;  2RE2 A;  3H3O B;  4CEE A;  3VGL A;  1K73 O;  1TYQ B;  4M3Y A;  2F7T A;  4DCH A;  3E01 A;  3RMB A;  1DT9 A;  1WSE A;  5AZJ A;  3H6E A;  3M8Q A;  5DMR A;  3MN9 A;  4CHQ A;  4CCH A;  4DSE A;  4YOV A;  2YNF A;  4H4O A;  4BG8 A;  2QWR A;  3LM2 A;  1GLJ O;  5H1S Q;  1N34 K;  1YAG A;  4JK9 A;  4CGF A;  3LL3 A;  4JKH A;  4DR1 K;  1S72 N;  2BH1 A;  2ASP A;  3DM2 A;  2GV9 A;  3DRS A;  4KRF A;  3CC2 N;  3NGY A;  2YKM A;  2E2Q A;  1GLL O;  2I7N A;  4B3T K;  4KFB A;  4DV0 K;  3DRP A;  1C1B A;  2GEM A;  5K14 A;  3LPU A;  4N56 A;  3PX6 A;  1J5O A;  5M1N A;  2VWK A;  4A2A A;  2D5R A;  3CJA A;  4JS5 A;  1HKB A;  2A3Z A;  4DLG A;  5AZI B;  1RT3 A;  2D4W A;  4A57 A;  4B08 A;  1T8E A;  4OPJ A;  3SCX A;  4IFV A;  3KLE A;  1DLO A;  1OH6 A;  1SL2 A;  1U6Z A;  5KRT A;  4E7K A;  1S3X A;  3MX2 A;  4DQP A;  1HNW K;  4FWK A;  2Q31 A;  1RT2 A;  3M8R A;  1TKX A;  3K59 A;  2GEL A;  3ALY A;  4MLE A;  3TR8 A;  2UYT A;  2YJF A;  3P38 A;  2F9W A;  4YOX A;  2IS3 A;  3DLB A;  4ILJ A;  2OZM A;  2RN2 A;  4CZJ A;  5EY4 A;  4JEP A;  3O5B A;  5JLH A;  4DR2 K;  1BQN A;  3LDP A;  3KD1 E;  4CD3 A;  1GLC G;  3K5L A;  2JLE A;  4OVL A;  4BRI A;  1YJN N;  2HHQ A;  1ZBU A;  3TAP A;  5AQP A;  5EX5 A;  1CXU A;  3QIP A;  3NH1 A;  3DRR A;  4DV6 K;  2D0A A;  1NOZ A;  3OJS A;  5KTQ A;  5IWA K;  3G4S N;  2IAJ A;  1S6Q A;  3M1F A;  4F3O A;  3CCE N;  3ZT2 A;  1K8K B;  4OLA A;  2B5J A;  3DI6 A;  3AO5 A;  4XH1 A;  3ZYY X;  1HNZ K;  3HO1 A;  3AAR A;  4JI4 K;  3VQ6 A;  3O4N A;  2P9U A;  4B1X B;  4KTW A;  1VQ4 N;  4IOA L;  2EHG A;  1Q82 O;  5CY4 A;  2ZWH A;  1NGG A;  3NGI A;  2DY4 A;  3ULE A;  5C42 A;  4FZX C;  2P9K A;  4K42 A;  3THX A;  3OYF A;  1EET A;  1BQM A;  4YOY A;  1LW0 A;  4FJN A;  2HVH A;  4PKI A;  1BA1 A;  3V1Q A;  2VWB A;  4KB0 A;  1C1A A;  4GVM A;  4HTU A;  5C24 A;  5HP1 A;  4DTR A;  4O0J A;  4EZ6 A;  3OS1 A;  4BDZ A;  3IAY A;  2ZD1 A;  1NJY A;  3OHR A;  4ILG B;  4CK1 A;  2YI1 A;  4IDH A;  3L2R A;  3VTH A;  3CQ8 A;  4HWI A;  1N8R O;  4NCG A;  2I5J A;  1TKZ A;  1NGB A;  2OPQ A;  4AHU A;  5T7B A;  3CG7 A;  3TTF A;  2RPI A;  3A5O C;  3SAH A;  2FBV A;  4DQ8 A;  4MO5 A;  4FO0 A;  3FR0 A;  4O5B A;  3T69 A;  4DV3 K;  1L3V A;  4WQ5 C;  1FXX A;  2GWK A;  4CK2 A;  1O1W A;  3SUN A;  3BZC A;  3VQE A;  3WNF A;  3ZET A;  4JKF A;  3UKR A;  1RBR A;  1BIZ A;  1RBT A;  4Y1C A;  2ITM A;  4RW6 A;  3J81 O;  3O9T A;  4FLW A;  2QKK A;  3AVB A;  3P4I A;  3ZEU B;  4B9N A;  1VSE A;  4CJ5 A;  4CGJ A;  3MMV A;  3JYT A;  4BAC A;  4WF9 L;  4FLV A;  2QXL A;  4OKE A;  3QB0 A;  2QWO A;  3TTD A;  3WXM B;  4DV5 K;  4TSX A;  2ATQ A;  4FJ5 A;  3V1O A;  3HP9 A;  2QWN A;  4BRC A;  3CM6 A;  1X9J A;  4IXC A;  1J54 A;  3TPQ A;  3IS9 A;  4B1W B;  2HHV A;  3M3Z A;  4FLU A;  4YFU A;  1OH5 A;  4BC5 A;  4HTL A;  3AO3 A;  1TAU A;  3RSE B;  4FZY A;  1NWK A;  1HLU A;  3VET A;  3I33 A;  4CEZ A;  2VCP A;  3BY5 A;  4C8M A;  4GY2 B;  2E2P A;  3OYB A;  4FM0 A;  3WXL A;  2P9N B;  3VN5 A;  2WOM A;  3HI0 A;  4O0I A;  4EZ9 A;  2BGG A;  2PZS A;  3ZT1 A;  3V9Z A;  4O4G A;  1K6Y A;  1BCO A;  4B1Z A;  4CJV A;  3J7Y P;  4GKJ K;  1ZBS A;  4E7L A;  3CJ1 A;  4Z4E A;  4GV9 A;  3ZX0 A;  4OPK A;  4DSL A;  5JVG L;  1VQN N;  1RBU A;  4LF7 K;  2XO7 A;  3TAG A;  4BRE A;  4BC2 A;  3FZH A;  4DTO A;  4FYD A;  4CJ3 A;  4KRE A;  3F9M A;  3BUZ B;  3OTO K;  1KC8 O;  3M8P A;  3SQ2 A;  3VEO A;  5ADX A;  4CJP A;  1EP4 A;  1XWL A;  1GOC A;  5BN9 A;  2E2N A;  3TWH A;  3SV4 A;  1GLF O;  3UB5 A;  5JLF A;  1ASW A;  5SWM A;  4DS5 A;  1U48 A;  1T03 A;  4JK8 A;  1GLB G;  3KVG A;  1RGI A;  4OX9 K;  3WXJ A;  2ASO A;  1BWF O;  2E4L A;  2EX3 A;  3EN9 A;  3AO2 A;  4LFC K;  1SV5 A;  1ASV A;  4DSK A;  3OYK A;  5F2R A;  3GL1 A;  4CGH A;  3L2V A;  3NBP A;  3QFP A;  3HVR A;  3CQY A;  4LY7 A;  3LDN A;  5I9E B;  3MCA B;  4DHY A;  2A1S A;  1QE1 A;  4WQ4 A;  3SUO A;  2WC9 A;  3O6W A;  2PBD A;  4DF8 A;  3R3L A;  2FBX A;  1HJR A;  2KLA A;  4CJW A;  4BDY A;  2G8U A;  3CHW A;  3E1Y A;  1HNX K;  4FJX A;  3DOK A;  1NJW A;  1NK6 A;  4KH4 A;  2UXB K;  4EIA A;  1NK8 A;  1QQO A;  2KZM A;  1TAQ A;  4BRO A;  1NGJ A;  4H5W A;  3HP6 A;  4FWO A;  1V4T A;  3C6U A;  3J8A A;  3LAK A;  3CPW M;  3M6G A;  4BWM A;  2A41 A;  1HR0 K;  4M45 A;  3K2P A;  1NG9 A;  1L3U A;  2P51 A;  3TAF A;  1NMN A;  3O4W A;  3L0Q A;  4QAG A;  2KQ2 A;  3RMC A;  1VAZ A;  1MA9 B;  4CZH A;  4MFB A;  4BQZ A;  3LAM A;  1RDW X;  4JKG B;  4BRK A;  3CF5 L;  4BRL A;  1RT7 A;  4JI3 K;  4BR5 A;  4JAX A;  3F73 A;  1ZBH A;  3EEQ A;  4M3U A;  1FKP A;  3I8B A;  4IFY A;  3O80 A;  1S1T A;  2CGL A;  1C0G A;  1HQU A;  3E9O A;  4YY3 K;  2BTF A;  3I55 N;  2NRH A;  5J2Q A;  1IBK K;  2DFE A;  2FF3 B;  5JS1 A;  3CXC M;  1S9E A;  1RDC A;  4BRG A;  4DUZ K;  1NJX A;  2X78 A;  4KB1 A;  3C65 A;  1MWK A;  4M3W A;  1K8K A;  3NF9 A;  1NGA A;  3CM5 A;  3UKU B;  5BR9 A;  1V4S A;  2A40 A;  4CD1 A;  2AJQ A;  5BRD A;  3KIO A;  4KHY A;  3QFU A;  4HHT A;  3VQ9 A;  5GIO A;  3D6R A;  1N33 K;  4FWS A;  4H4M A;  3WXI A;  4JHD A;  2P9S B;  2G8V A;  3OYG A;  4FK4 A;  2JWK A;  4L8R B;  3J80 O;  5LY3 A;  3IRX A;  1KD1 O;  4M7X A;  4YDU C;  4C1N I;  5LJW A;  3OBY A;  4ICL A;  1XC3 A;  3BDP A;  3S3M A;  2D0O A;  2IGI A;  1YJW N;  5I3U A;  3SNN A;  4KHW A;  2V7Y A;  3F5T A;  3W3D A;  4CW7 B;  1S1W A;  1QQN A;  3FZF A;  4ID1 A;  4OJR A;  1RBS A;  4JRQ A;  2QK9 A;  3U6F A;  1IKV A;  4B3S K;  3U9D A;  1ZXO A;  4Q5V A;  1N5Y A;  2NRT A;  4DV7 K;  2FF6 A;  3TAE A;  4FWN A;  1HPM A;  4KKO A;  3I8D A;  4HVJ A;  3H3N O;  1D5A A;  4RWT A;  4YOU A;  4G9Z A;  4F3T A;  4BGB A;  3FGU A;  4R79 A;  1HPZ A;  3H46 O;  4EP5 A;  5KPZ A;  2NRZ A;  4W5N A;  3THY B;  1RIL A;  1DKG D;  2PY5 A;  3CC7 N;  1XHX A;  2E6M A;  4FW1 A;  1KLN A;  5KPT A;  1RBV A;  3S9H A;  2O8D A;  2YNG A;  3P83 D;  1R59 O;  3E9L A;  2UXD K;  2KFZ A;  4LFA K;  5FDL A;  5LMN K;  4E19 A;  4CEQ A;  1JL2 A;  2O8C B;  5C0Y A;  2O8B A;  3M8S A;  1Q7Y O;  1EO1 A;  3TSQ A;  4PKH A;  1T6C A;  1Q9Y A;  1TL3 A;  4O8U A;  5I42 A;  1S1V A;  3ZSZ A;  1KVA A;  1WSI A;  3RTV A;  4H0O A;  4A5A A;  1DTQ A;  4DTU A;  5DK5 A;  2IVN A;  3VQP A;  2DTU A;  3VQ8 A;  2VGM A;  4E1M A;  3G6E N;  4CEC A;  2KHO A;  4NYF A;  4IO9 L;  1DGK N;  3TAQ A;  2GX9 A;  2DFH A;  4CJE A;  4KHQ A;  1RT1 A;  5BN8 A;  3RRG A;  3DOL A;  3CCJ N;  2YNH A;  4CF9 A;  3OYH A;  4BRP A;  4FLX A;  3TAR A;  1I94 K;  4DR7 K;  1X9M A;  3EL2 A;  2P9N A;  4IO8 A;  3VOV A;  4H0P A;  3VQB A;  2NNW A;  3A8Y A;  2HVI A;  1YF5 L;  4XH4 A;  1HYV A;  2ITG A;  2ZJR L;  5BPN A;  1VQ5 N;  2HHH K;  1N32 K;  2Q0U A;  4GV3 A;  1CZB A;  3PO5 A;  4BE1 A;  4NB4 A;  1I39 A;  3M5R A;  2YCH A;  4IJA A;  1ITG A;  3ZSX A;  3SQ4 A;  3AVC A;  4LF8 K;  3CCV N;  3G10 A;  1I3A A;  5C2F A;  1Q86 O;  4N41 A;  3OVN A;  3PX4 A;  3P1G A;  4CJK A;  2YHY A;  2HBM A;  4WFA L;  3T3F A;  1IKW A;  3D2E A;  4DSI A;  3DLG A;  5GAG P;  1JLF A;  1DEJ A;  1KAZ A;  1VQ8 N;  5CYM A;  1NKE A;  4DFK A;  4DQR A;  1L5U A;  1ILY A;  1QHA A;  1KCF A;  1T6D A;  4DV2 K;  4E3S A;  1BA0 A;  2HND A;  1O13 A;  4ISG A;  1G99 A;  1EWR A;  5M1P A;  3SAG A;  2F96 A;  4JKE A;  2YHW A;  5MLC Q;  2ZGZ A;  4KPY A;  3TTC A;  2GTD A;  4KTQ A;  3AVN A;  1ZC6 A;  2HBK A;  1VSL A;  3A2F A;  3ULD A;  1FW6 A;  2P9P B;  4GW6 A;  4CGI A;  3T1H K;  4CJL A;  4CF2 A;  4DF4 A;  2A1R A;  3PSF A;  4HCB A;  3MEC A;  2EWS A;  1BGX T;  3DXM B;  1GLE G;  3TSP A;  4B9T A;  3V9W A;  1C6V A;  3K58 A;  1RCH A;  1BDG A;  1HYS A;  4Y0W A;  4KHS A;  5FRM A;  4BQL A;  5A2Q O;  3E9P A;  3H1V X;  2XHB A;  3EKS A;  5JMV A;  4O8K A;  1W97 L;  3B6P A;  1NU0 A;  4DV1 K;  3CJ9 A;  2E88 A;  4JKC A;  1VSJ A;  3KK1 A;  4CZG A;  3V6D A;  3MK6 A;  1X9S A;  2G8W A;  3SK3 A;  3LAN A;  3LP0 A;  1VQ9 N;  5AQR A;  3ID8 A;  1KVB A;  5HLF A;  3L3V A;  1T7P A;  3QNN A;  2CGJ A;  5EOY A;  4CJ4 A;  2O4I A;  4JNE A;  1NLV A;  3JXU A;  1WBB A;  1SKR A;  1VSH A;  3VF6 A;  4M3Z A;  2WTU A;  1NGF A;  3A5L C;  4FW2 A;  4JKG A;  1VK0 A;  2HNZ A;  2QTD A;  2V52 B;  3LWM A;  4FJ7 A;  3FLC O;  4JV5 K;  4RG8 A;  4WFB L;  4BR0 A;  1TUU A;  2A42 A;  3WQT A;  4CZI A;  1A5V A;  2W40 A;  4CJU A;  5AR0 A;  1F21 A;  3THV A;  1U2V A;  4E7J A;  1FK9 A;  1JCF A;  3QEP A;  3LZJ A;  1OVQ A;  3MXJ A;  1KAX A;  3LDO A;  1SS6 A;  1T05 A;  1WLJ A;  3U3G A;  4WE1 A;  4F8R A;  2HW3 A;  4PHT X;  2QM1 A;  3U9Z A;  3HM8 A;  3TAN A;  1LWF A;  4FXD A;  3NF6 A;  3V9S A;  1M90 O;  4LF9 K;  1J9A A;  3L8B A;  1A5X A;  4NO7 A;  3O3H A;  1NK4 A;  4W5R A;  1TUY A;  4HUG A;  4JYA K;  4FLZ A;  1CZA N;  1T44 A;  3DMJ A;  1U04 A;  2VQE K;  2Y1I A;  3T1Y K;  2G8F A;  2P9S A;  3P31 A;  5BR8 K;  4CJS A;  4FM1 A;  1QQM A;  4CFB A;  1WSH A;  3EE9 A;  1W9H A;  3NMU A;  4ID5 A;  1OVY A;  2RHK A;  4CBW A;  3OYD A;  3QES A;  4DTN A;  4RW4 A;  1TK5 A;  3O3G A;  4IOX A;  5HRO A;  3LP2 A;  3KZB A;  2D1K A;  2FLO A;  5C10 A;  3OS0 A;  2F4V K;  3SBG A;  4AM6 A;  3E66 A;  1U4B A;  3QET A;  3WXK A;  1JCG A;  4DFM A;  1KFD A;  4CZL A;  3WT0 A;  4AHC A;  2O8F A;  4XEI A;  2PYL A;  2OPR A;  4KV8 A;  2GBZ A;  3LM9 A;  4CGG A;  3K5M A;  3SJJ A;  2G8K A;  4CEA A;  1LWC A;  4JS4 A;  3L4I A;  3KTQ A;  3OW2 M;  3PO4 A;  2F8T A;  3P39 A;  1VSK A;  3O9R A;  3DYA A;  2Q1N A;  1Z25 A;  3AVK A;  2CH5 A;  5FPM A;  3LAL A;  2P9L B;  2V51 B;  4AHT A;  2NRX A;  2O8C A;  2PYJ A;  3SMP A;  3O1W A;  2CGK A;  5FPN A;  3U4L A;  4A59 A;  3CER A;  3ZLJ A;  3MXI A;  4MQ3 A;  4WFN L;  2GUP A;  3KK2 A;  4BR2 A;  3OYC A;  1VSM A;  4C8K A;  3FE1 A;  3U3Y A;  3HOT A;  4CZF A;  4CVN E;  4LH5 A;  4DR4 K;  3IMX A;  3QIC A;  3OS2 A;  2BE2 A;  4WQ5 A;  4AHR A;  2OCE A;  3MN5 A;  3MN6 A;  3DLL L;  4UY8 O;  5GIN A;  1MDU B;  1XI1 A;  3HVT A;  5EVZ A;  4CF8 A;  2Q36 A;  4RW8 A;  5FPD A;  4CJF A;  1SL1 A;  1EKE A;  1HMV A;  1LCU A;  1W7A A;  4B3R K;  1WSG A;  2I7P A;  1JLE A;  2X74 A;  5E84 A;  4PQU A;  3FZK A;  5TKY A;  2W6L A;  2OZS A;  4C8L A;  4CJQ A;  4G1Q A;  4EHU A;  3DWL A;  2YV0 X;  5BRH A;  3KWI A;  3HTV A;  5CE3 A;  3BF3 A;  3IG1 A;  1A5W A;  3HOS A;  3FZM A;  4RW7 A;  3V9U A;  1DTT A;  2NLX A;  1Z05 A;  1WAJ A;  2IVP A;  4JN4 A;  5LL6 Z;  1D4X A;  1P8Z A;  3HT3 A;  3THW B;  1KSP A;  2HMP A;  2QWL A;  5SZT A;  1HNV A;  4J2B A;  1RDU A;  4QCL A;  3RVC A;  4PL7 A;  4IFE A;  3MX5 A;  2ASM A;  3WNH A;  4AHV A;  2UUC K;  4Z4F A;  2E1Z A;  4H0X B;  5TKW A;  3ZSO A;  1RTH A;  1J53 A;  5M1F A;  5JS2 A;  4I7F A;  1NKC A;  1VQM N;  1Q9X A;  3FZL A;  1C0M A; 
#chains in the Genus database with same CATH homology
 2XRI A;  1QHT A;  3ISN C;  4CE9 A;  2JGU A;  2XY8 A;  3SPZ A;  2B6A A;  4ICL A;  3B6O A;  3T1A A;  3OJU A;  3BDP A;  3S3M A;  1RNH A;  1D9D A;  4NYN A;  3ZSV A;  2IGI A;  5I3U A;  3VQ7 A;  4IG3 A;  2IC3 A;  5KI6 A;  3SNN A;  4KHW A;  1B9F A;  4PA1 A;  4K8X A;  3AVG A;  4NCA A;  1S1W A;  2RKI A;  2P5G A;  2QKB A;  1GOB A;  4ID1 A;  4OJR A;  1Y97 A;  3KLI A;  1RBS A;  4JRQ A;  1JLG A;  1S6P A;  2QK9 A;  4CEE A;  1IKV A;  3U6F A;  1NK9 A;  3NAE A;  2X6N A;  4Q5V A;  1N5Y A;  4M3Y A;  3C94 A;  1KVC A;  3E01 A;  3TAE A;  3RMB A;  1WSE A;  2GUI A;  3M8Q A;  3RMA A;  5DMR A;  2QXF A;  4W5O A;  1B92 A;  1RT5 A;  2Z1H A;  2R7Y A;  4KKO A;  4CHQ A;  3I8D A;  4HVJ A;  1NK5 A;  4CCH A;  4DSE A;  1RTI A;  1WSJ A;  1D5A A;  2KZZ A;  1C0U A;  2YNF A;  3NHG A;  4F3T A;  1RTJ A;  4H4O A;  4CIE A;  4ELU A;  1HPZ A;  1ASU A;  3KLF A;  1R0A A;  1D9F A;  1CZ9 A;  2D0B A;  4CGF A;  4HUE A;  4EP5 A;  4W5N A;  1S1U A;  1RIL A;  3ZSQ A;  2PY5 A;  1LWE A;  4BE2 A;  1XHX A;  1S5J A;  2E6M A;  3DM2 A;  2GV9 A;  3DRS A;  4I2Q A;  3OYJ A;  4FW1 A;  5J2P A;  2ZQB A;  1QQC A;  4J2E A;  4LSN A;  4CIF A;  4KRF A;  4GMJ B;  1KLN A;  1RBV A;  3NGY A;  3O3F A;  2YKM A;  3S9H A;  2YNG A;  3P83 D;  4OGC A;  3VA0 A;  4DS4 A;  2KFZ A;  3HL8 A;  4KFB A;  3L3U A;  5FDL A;  3DRP A;  1C1B A;  5K14 A;  4E19 A;  3ZCM A;  4CEQ A;  1JL2 A;  3LPU A;  4N56 A;  3PX6 A;  1J5O A;  3M8S A;  2VWK A;  2D5R A;  4CK3 A;  1TGO A;  1Q9Y A;  1TL3 A;  4JS5 A;  1QSL A;  5I42 A;  4DLG A;  1S1V A;  1RT3 A;  3ZSZ A;  1KVA A;  1WSI A;  3RTV A;  4B08 A;  1T8E A;  1JLB A;  1DTQ A;  3K57 A;  4OPJ A;  4DTU A;  3AVM A;  3SCX A;  5DK5 A;  4C8N A;  3LWL A;  2IDO A;  4IFV A;  3VQP A;  1NK7 A;  2DTU A;  4LSL A;  3VQ8 A;  1DLO A;  3KLE A;  3CFR A;  3SUQ A;  4E1M A;  3EZ5 A;  1G15 A;  4CEC A;  4E1N A;  3SI6 A;  1SL2 A;  4NYF A;  3TAQ A;  3BGR A;  3NFA A;  5KRT A;  4E7K A;  3HPO A;  4DQP A;  3MEG A;  3ZT3 A;  1RT2 A;  3KD5 E;  3M8R A;  1TKX A;  4ZTJ A;  2DFH A;  4CJE A;  3K59 A;  3ALY A;  2X6S A;  3TR8 A;  4UQG A;  4KHQ A;  1X9W A;  1RT1 A;  3ZSY A;  1BIU A;  3RRG A;  3DOL A;  4E7I A;  2YNH A;  4CF9 A;  3KK3 A;  3OYH A;  2IS3 A;  3SQ0 A;  3DLB A;  2OZM A;  2FC0 A;  1ZYQ A;  4KI4 A;  2RN2 A;  4FLX A;  2BAN A;  4FZZ A;  3TAR A;  4DMN A;  1QS4 A;  1VSF A;  1YT3 A;  3HST B;  1X9M A;  3OY9 A;  1BI4 B;  4DU1 A;  1BQN A;  3QEV A;  3KD1 E;  1QSY A;  4DSJ A;  3UIQ A;  1LV5 A;  3VQB A;  1YTA A;  3NH0 A;  3K5L A;  2JLE A;  2G8I A;  3H08 A;  4OVL A;  2HHT A;  2HVI A;  1HYV A;  2ITG A;  2HHQ A;  1ZBU A;  3VQQ A;  3TAP A;  3QLH A;  1CXU A;  1S9G A;  3QIP A;  1CZB A;  1L3T A;  3PO5 A;  4BE1 A;  3NH1 A;  3QEW A;  3DRR A;  1I39 A;  3SPY A;  4CJR A;  1ITG A;  3ZSX A;  2D0A A;  3AVC A;  4HUF A;  3SQ4 A;  4Z0U A;  1NOZ A;  3SQ1 A;  3KJV A;  3AVJ A;  1ZBI A;  3G10 A;  3OJS A;  1I3A A;  2XY7 A;  4Z4C A;  4KHN A;  5KTQ A;  2BDP A;  1KLM A;  1S6Q A;  2IAJ A;  3HPH A;  3RWU A;  4N41 A;  1X1P A;  3OVN A;  3PX4 A;  4F3O A;  3P1G A;  3ZT2 A;  4CJK A;  3T3F A;  3LDS A;  4OLA A;  2B5J A;  3PX0 A;  1IKW A;  3AO5 A;  3DI6 A;  4CHZ A;  1CLQ A;  3NDK A;  1W0H A;  3HO1 A;  1VRU A;  1RT4 A;  3HPG A;  3DLG A;  4DSI A;  1JLF A;  3HJF A;  4CFC A;  3OYI A;  3MEE A;  3VQ6 A;  3I0S A;  5CYM A;  3O4N A;  3AO4 A;  1NKE A;  4CF0 A;  4DFK A;  4I2P A;  4KTW A;  4N76 A;  4DQR A;  2EHG A;  1L5U A;  3S3N A;  1B9D A;  3V81 A;  1UA0 A;  5CY4 A;  3F9K A;  4DU4 A;  1QSS A;  1KCF A;  1RDB A;  3NGI A;  5C42 A;  4E3S A;  2HND A;  1RTD A;  4DWI A;  4FZX C;  1HYZ A;  4I9L A;  4FJ8 A;  1VRT A;  4FJG A;  3HM9 A;  3TAM A;  4E0D A;  4HCC A;  2F96 A;  3TI0 A;  4CJT A;  3ZSW A;  3OYF A;  1EET A;  1BQM A;  4KPY A;  2YNI A;  1LW0 A;  4FJN A;  4KTQ A;  2HVH A;  4NCB A;  3V1R A;  1VSL A;  3V1Q A;  4Z4G A;  4KB0 A;  1C1A A;  2FBT A;  3A2F A;  1RT6 A;  1VSI A;  3ULD A;  4CER A;  4GVM A;  4EP4 A;  2VG6 A;  4HTU A;  4K8Z A;  4GW6 A;  4OKJ A;  5C24 A;  4CGI A;  2HHS A;  5HP1 A;  4CFD A;  1ZBF A;  4CJL A;  4O0J A;  4CF2 A;  4DTR A;  4DF4 A;  2A1R A;  4EZ6 A;  4HCB A;  4M3T A;  2OPS A;  3AVL A;  3OS1 A;  4DSF A;  3MEC A;  1KFS A;  4BDZ A;  1BGX T;  3IAY A;  3V9X A;  5KRS A;  2ZD1 A;  4B9T A;  1TL1 A;  3VQA A;  3V9W A;  1NJY A;  4FJ9 A;  1C6V A;  4CIG A;  3K58 A;  4CK1 A;  1RCH A;  3L2R A;  1IG9 A;  4CHY A;  1RDA A;  1HYS A;  4B8A B;  4DLE A;  3SYZ A;  4KHS A;  3CQ8 A;  5FRM A;  3MXM A;  3C6T A;  4NCG A;  4DQQ A;  4H8K A;  2I5J A;  1TKZ A;  3VQ4 A;  2DY4 A;  4F2S A;  4DFP A;  4AHU A;  2OPQ A;  5CZ1 A;  5CZ2 A;  4CEF A;  5T7B A;  4CHN A;  2XHB A;  3CG7 A;  2RPI A;  5HRP A;  3ASM A;  4Z4H A;  1YVU A;  1REV A;  2VG7 A;  1U49 A;  3VQD A;  2FBV A;  4AIL C;  1L3V A;  4O5B A;  3B6P A;  3D45 A;  1FXX A;  4CK2 A;  1O1W A;  3SUN A;  3VQE A;  3WNF A;  4F2R A;  1VSJ A;  3QIO A;  3KK1 A;  4DQS A;  4DTS A;  1RBR A;  3QEX A;  1BIZ A;  1RBT A;  4Y1C A;  4ZHR A;  3V6D A;  1X9S A;  2G8W A;  4RW6 A;  4ELT A;  3LAN A;  3LP0 A;  4FLW A;  2QKK A;  4FVM A;  4FJL A;  5EU7 A;  3KKS A;  3AVB A;  1KVB A;  3VQC A;  5HLF A;  2WON A;  3L3V A;  1U45 A;  3ZT0 A;  3QNN A;  3NCI A;  1T7P A;  4B9N A;  1LW2 A;  1VSE A;  4CJ4 A;  2O4I A;  4CJ5 A;  4CGJ A;  4CES A;  3JYT A;  4BAC A;  4FLV A;  3KKR A;  3RMD A;  4OKE A;  1SKR A;  1VSH A;  1KRP A;  2OA8 A;  4BDP A;  4M3Z A;  3LPT A;  4LH4 A;  4CGD A;  1IH7 A;  2Q3S A;  4TSX A;  3T19 A;  3SV3 A;  3OYM A;  3AO1 A;  4FW2 A;  3QER A;  4FK0 A;  4FLY A;  2ATQ A;  4FJ5 A;  3V1O A;  3HP9 A;  4IG0 A;  3CM6 A;  4B3O A;  1VK0 A;  2HNZ A;  1MU2 A;  3VQ5 A;  3RRH A;  3AA2 A;  1JLA A;  1J54 A;  2D0C A;  3LWM A;  4Z4I A;  3IS9 A;  2HHV A;  4FLU A;  1SL0 A;  4YFU A;  4FJ7 A;  4RG8 A;  4O55 A;  1C0T A;  1WNS A;  4E89 A;  4DTM A;  3AO3 A;  1Q8I A;  3KLG A;  4PY5 A;  5FRN A;  5HBM A;  1NKB A;  2HMI A;  4FZY A;  1TAU A;  3L2U A;  4CHP A;  2Z1G A;  4CHO A;  4J2D A;  1A5V A;  4CEZ A;  4Q0B A;  4CJU A;  1KTQ A;  2RF2 A;  4C8M A;  1F21 A;  4KAZ A;  3THV A;  4E7J A;  2HNY A;  1FK9 A;  2IOC A;  3L2Q A;  3VA3 A;  1JL1 A;  3OYB A;  4FM0 A;  3QEP A;  3LZJ A;  3AA3 A;  2YHA A;  4DU3 A;  3MXJ A;  5CYQ A;  3AA4 A;  4N47 A;  3VN5 A;  4FJH A;  2E6L A;  2WOM A;  4R5P A;  4O0I A;  4EZ9 A;  1T05 A;  1WLJ A;  3U3G A;  1ZBL A;  1IKX A;  4B9U A;  1N6Q A;  2BGG A;  4WE1 A;  4F8R A;  4B9S A;  2HW3 A;  4CEB A;  1FKO A;  2PZS A;  1VSD A;  3ZT1 A;  3K5N A;  1LWF A;  3LP1 A;  4O4G A;  3NF6 A;  2NUB A;  3V9Z A;  1K6Y A;  3V9S A;  4M3R A;  4FXD A;  1J9A A;  1BCO A;  1SUQ A;  1HRH A;  4CJV A;  5KGW A;  3L8B A;  4E7L A;  1A5X A;  3O3H A;  1NK4 A;  4J2A A;  4W5R A;  4Z4E A;  4DG1 A;  4OPK A;  4DSL A;  3AVF A;  2B4J A;  4HUG A;  1RBU A;  4FLZ A;  3DMJ A;  2XO7 A;  1U04 A;  3D0P A;  2Y1I A;  3TAG A;  2G8F A;  4KTZ A;  4CF1 A;  4CJS A;  3HXM A;  4FM1 A;  4AH9 A;  4DTO A;  4FYD A;  3QNO A;  4BE0 A;  2OPP A;  4CJ3 A;  4CFB A;  1WSH A;  3HK2 A;  4KRE A;  1W9H A;  3QEI A;  3M8P A;  1UWB A;  3SQ2 A;  4ID5 A;  3QO9 A;  4CJP A;  3LZI A;  4FJM A;  1EP4 A;  1BCM A;  4BWJ A;  1XWL A;  4M41 A;  1GOC A;  5HRN A;  3OYD A;  3QES A;  2VWJ A;  4DTN A;  3NF7 A;  1TVR A;  4B9M A;  4RW4 A;  1TK5 A;  3EYZ A;  3O3G A;  5HRO A;  1JLC A;  1D8Y A;  3LP2 A;  2P5O A;  3TWH A;  3SV4 A;  4C8O A;  4RW9 A;  3OYA A;  3OS0 A;  1S1X A;  1NOY A;  4ZTF A;  1C1C A;  3CFO A;  3PY8 A;  1ASW A;  5SWM A;  1Z26 A;  4DS5 A;  3QET A;  1U4B A;  4M42 A;  1U48 A;  1T03 A;  1UOC A;  2ZE2 A;  4OLB A;  2E4L A;  2EX3 A;  3AO2 A;  2OYQ A;  1SV5 A;  1HQE A;  3OYN A;  4DFM A;  1ASV A;  4FLT A;  1KFD A;  1SKS A;  4DSK A;  3OYK A;  4AHC A;  2HHX A;  2PYL A;  2OPR A;  4CGH A;  4KV8 A;  3L2V A;  2GBZ A;  3NBP A;  3HVR A;  3AVA A;  3DLR A;  4CGG A;  3K5M A;  4LY7 A;  3L2W A;  4CEA A;  3SJJ A;  2G8K A;  4B9L A;  1LWC A;  3RR8 A;  4JS4 A;  3RR7 A;  3KTQ A;  3PO4 A;  2F8T A;  3C95 A;  2A1S A;  1VSK A;  3WNG A;  1QE1 A;  3SUO A;  4FJI A;  1WN7 A;  3K5O A;  3MED A;  3DYA A;  4OKK A;  3TAN A;  1Z25 A;  3AVK A;  4IDK A;  3NF8 A;  4DF8 A;  3LAL A;  2KW4 A;  4QOZ B;  2FBX A;  1HJR A;  4AHT A;  4CJW A;  4BDY A;  4DFJ A;  2PYJ A;  3CFP A;  2G8U A;  4M3X A;  3PV8 A;  1NK0 A;  2LSN A;  4FJX A;  3DOK A;  1NJW A;  4B9V A;  1BIS A;  1NK6 A;  3MXI A;  4MQ3 A;  1JKH A;  1XC9 A;  1UA1 A;  2F8S A;  3DLK A;  3KK2 A;  4O44 A;  2G8H A;  1NK8 A;  3OYC A;  3ZT4 A;  4E7H A;  1BHL A;  3G0Z A;  1UAX A;  1VSM A;  4C8K A;  2KZM A;  1TAQ A;  3OYE A;  3U3Y A;  3HP6 A;  4DQI A;  3OYL A;  3C6U A;  1TKD A;  2VG5 A;  3V4I A;  3LAK A;  4LH5 A;  4BWM A;  4DTP A;  1IO2 A;  3NE6 A;  3OS2 A;  3SUP A;  1TK8 A;  1GOA A;  2BE2 A;  4FJK A;  4PWD A;  4N5S A;  3NGZ A;  4M45 A;  3K2P A;  3LP3 A;  3ZSR A;  2KFN A;  2O4G A;  3NH2 A;  4AHR A;  1L3U A;  2P51 A;  3SZ2 A;  3CYM A;  3TAF A;  3S3O A;  2DFF A;  4I9Q A;  4XIU A;  4QAG A;  2KQ2 A;  1TKT A;  2YKN A;  3RMC A;  4PUO A;  1XI1 A;  5J1E A;  3JSM A;  1TK0 A;  1WSF A;  1SKW A;  3HVT A;  3P5J A;  2XY6 A;  4IBN A;  4MFB A;  4CF8 A;  4FK2 A;  2FBY A;  1XHZ A;  1QTM A;  4RW8 A;  3DLH A;  3LAM A;  4CJF A;  3PUF A;  1SL1 A;  1EKE A;  1RT7 A;  1HMV A;  3KLH A;  3F73 A;  1WSG A;  1EXQ A;  3DLE A;  1ZBH A;  1BI4 A;  4YNQ A;  1JLE A;  1FKP A;  4M3U A;  4CEO A;  2X74 A;  1U47 A;  4IFY A;  4PQU A;  4B8C A;  2Z1I A;  5J2N A;  2OZS A;  4C8L A;  1S1T A;  4CJQ A;  4G1Q A;  2HB5 A;  5HRR A;  4CED A;  1HQU A;  4W5Q A;  2YV0 X;  3MAQ A;  3O4Q A;  3AV9 A;  4DTJ A;  1EX4 A;  4IKF A;  5J2Q A;  4DTX A;  1TV6 A;  3ITH A;  4FJJ A;  3AVI A;  2DFE A;  1RDD A;  3IG1 A;  1L3S A;  1A5W A;  5JS1 A;  2HHW A;  3I0R A;  1S9E A;  1RDC A;  3EY1 A;  5E41 A;  1IKY A;  4RW7 A;  3V9U A;  1LAW A;  1JXE A;  1DTT A;  1WAJ A;  5J2M A;  3AA5 X;  1CXQ A;  2X78 A;  1NJX A;  3HYF A;  4KB1 A;  4JLH A;  3HT3 A;  3WNE A;  4M3W A;  1HNI A;  2HHU A;  1KSP A;  3QIN A;  4Y1D A;  2XY5 A;  1NJZ A;  4JRP A;  3NF9 A;  5SZT A;  5D3G A;  4AHS A;  4OGE A;  4FM2 A;  3CM5 A;  1HNV A;  2KTQ A;  3FFI A;  2Y1J A;  4J2B A;  3AVH A;  3IRX A;  4F4K A;  4KI6 A;  4FCY A;  4QCL A;  2ETJ A;  2AJQ A;  4W5T A;  1LAV A;  3KIO A;  4KHY A;  4HHT A;  1JXB A;  4LD0 A;  1BL3 A;  3VQ9 A;  3WNH A;  4ELV A;  4CFA A;  4AHV A;  1YTU A;  4Z4F A;  1JLQ A;  2P1J A;  2Z1J A;  4H4M A;  1WAF A;  3ZSO A;  1RTH A;  1J53 A;  5KGX A;  4KO0 A;  5JS2 A;  3TAB A;  3OYG A;  2W42 A;  2G8V A;  4FK4 A;  4I7F A;  1NKC A;  2YHB A;  4L8R B;  4KHU A;  1Q9X A;  5C25 A;  5HRS A;  3AVN A;  1C0M A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...