1GOCA

Cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQAITQGWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Cooperative stabilization of Escherichia coli ribonuclease HI by insertion of Gly-80b and Gly-77-->Ala substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 48
structure length 156
sequence length 156
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1gocA00
2ATQA 2IDOA 1TK5A 3RMCA 4FJ5A 3LWMA 4FCYA 2EX3A 1NK9A 1U45A 4FM2A 4F2SA 1C0MA 1KFSA 4FXDA 2IAJA 4CIGA 2RKIA 3VN5A 3K57A 3LP0A 2FBXA 3P83D 3V9XA 1LWEA 1RILA 2HVIA 3NFAA 2G8KA 4H4OA 1LW2A 1TL1A 1NOYA 2YNGA 4JRPA 2P5GA 4CGJA 3V6DA 4KFBA 1IKVA 1S1VA 3M8SA 2XHBA 3M8RA 1LWCA 4DSEA 3THVA 1L3SA 1ZBHA 4Z0UA 2P51A 3KLEA 4J2BA 1VSLA 4G1QA 1CZ9A 4WE1A 4W5OA 3QEXA 4O0IA 3TABA 1GOAA 3ALYA 5KGXA 4DSFA 1UA1A 3NCIA 5HRRA 1WLJA 1HQEA 3VA0A 4OVLA 4CK2A 3I0SA 5KI6A 1YT3A 4N5SA 5JS1A 3EYZA 4LD0A 2Y1JA 1UOCA 4LH4A 2RF2A 3CM6A 1S6PA 1C1CA 2HB5A 3EY1A 2XRIA 4IG3A 3NF6A 3QEPA 1F21A 4FW2A 3VQ8A 4DFJA 3TAEA 4B9LA 3U3YA 1SUQA 2YHBA 3I8DA 1YTUA 1XI1A 3SQ2A 2E6LA 2X78A 5C24A 4PQUA 5KRSA 3NH1A 3TAMA 3QO9A 4OPKA 3QEVA 1VK0A 4FM1A 1HYZA 4CJRA 1CXQA 4BACA 5J2NA 1RT7A 3AA4A 5D3GA 3O3HA 3DLBA 1BL3A 4LY7A 3SCXA 4C8NA 3A2FA 4AH9A 4FK2A 3KIOA 3AO4A 3DM2A 2D0AA 2A1SA 3C6TA 1NKCA 1NK6A 2QKBA 4DLEA 1EETA 1U48A 3V1RA 3G10A 3QEIA 4Z4IA 1W0HA 2BE2A 2QXFA 3HVRA 3B6OA 3HSTB 4Y1DA 4CEFA 1SL0A 4KI6A 1Y97A 3AO1A 4IFYA 1Q9XA 3NH0A 1C1AA 3CFPA 3OS1A 1LAWA 1VSHA 4CF2A 1NK4A 4JS5A 2XY5A 5C25A 4DWIA 3LP3A 4DU3A 4CJKA 4CJEA 1A5WA 4FJXA 3AA3A 2KTQA 2OZSA 3OS2A 4FYDA 3SPZA 1RNHA 3MECA 4KV8A 1IKYA 4BWMA 3OYAA 3LWLA 4DS4A 1B9FA 3CFOA 3RWUA 4KPYA 4OLBA 3QLHA 3FFIA 2DY4A 1BQMA 4CIEA 1TK0A 4M3UA 3QESA 1JL1A 3MAQA 4DFKA 2IS3A 4DSJA 5HBMA 2OZMA 1TAUA 4I2PA 1RTJA 2KZZA 3AA2A 3VQPA 3OYNA 4FZXC 1S9EA 2P5OA 1XWLA 3AVFA 4CEQA 4AHSA 3KJVA 1T05A 3NF9A 3OY9A 4OGEA 2EHGA 4E7LA 1T7PA 1WNSA 1A5VA 2BGGA 4DTSA 2X74A 3L8BA 1TKTA 1TGOA 2OPPA 3ZT0A 3KK2A 1VSDA 4HHTA 4B3OA 1J53A 2ZD1A 3SUPA 1ZBIA 3AVBA 5FROA 4DFPA 2PZSA 1QSSA 4I2QA 1QSLA 4B9UA 1QS4A 4RW8A 3VA3A 4N76A 4MQ3A 1RBVA 1ASWA 1T03A 4F3OA 1HNVA 2DFFA 3ITHA 4DLGA 2OYQA 4BE1A 3CM5A 2HHTA 2F8SA 4K8ZA 3MEEA 3NF8A 4H4MA 3OYEA 3WNEA 3M8QA 3AVHA 3TAPA 2PYJA 4CF8A 4C8OA 3IAYA 3CFRA 4FJ7A 4ELUA 1X9SA 3DOKA 1KVCA 3JYTA 1IKXA 4I7FA 4LSLA 4KKOA 3JSMA 1DTQA 1NK5A 1NK7A 4IDKA 1KLNA 2Z1HA 3ZSQA 4NYNA 4AILC 5I3UA 4CIFA 3DOLA 4R5PA 4FJHA 4DQRA 4Y1CA 4AHTA 4FK4A 3NGYA 1C6VA 1WSJA 4E7JA 3VQ9A 1RT5A 4DSLA 3M8PA 4RW7A 4ELVA 3ZSVA 4EZ9A 3WNFA 2HHWA 1NK0A 4E1NA 1KVBA 1VSKA 1RBRA 4HTUA 4CJVA 5HP1A 2YKNA 4AHUA 3WNGA 4CHNA 5J2QA 1BHLA 1C0UA 3SV3A 4DSIA 4FJIA 2XO7A 3ULDA 4O0JA 2Z1IA 3OYCA 3NE6A 1BCMA 4DF8A 3ZSWA 1ASVA 4CERA 3KK1A 1WAFA 4KI4A 1S1XA 5KGWA 4CE9A 3VQQA 3V9SA 1LW0A 4FJGA 4KB1A 1NKEA 2E4LA 4CGHA 3OVNA 4M3TA 4KO0A 3D0PA 4CF0A 1JLGA 3KK3A 4FJLA 1L3TA 4IFVA 2X6NA 4E7IA 4DQQA 3QERA 4RW6A 3QIOA 2FBVA 3VQ5A 4E0DA 3KLHA 4GVMA 4DU4A 1L3VA 1RDBA 1L5UA 2VWKA 1RT1A 3NAEA 1HYSA 3IG1A 4BE0A 4Z4EA 1NJYA 4CEZA 3LPUA 4DQSA 4Q0BA 1D5AA 2GBZA 3V4IA 2Q3SA 3PV8A 2B5JA 1WSGA 4B08A 3DRRA 3PX0A 1I3AA 1IO2A 5J2PA 3PY8A 4DTJA 4HVJA 2FBYA 3U6FA 1U47A 1KVAA 3NBPA 4GW6A 4HUEA 1VRUA 4B9TA 4B9VA 1FKPA 2GUIA 2YNIA 4QOZB 1HQUA 1C1BA 4EP5A 1EP4A 3AVNA 4KTWA 4RW4A 3HM9A 3IRXA 2A1RA 4CGGA 3ZT3A 1WSHA 2HMIA 2R7YA 4J2DA 1RCHA 3AVKA 4CGIA 4CJPA 1KFDA 2P1JA 1T8EA 4O4GA 3EZ5A 2OPRA 5J2MA 1RTIA 3DLEA 3OYMA 2OA8A 3HO1A 3HK2A 4C8LA 3TI0A 3OYJA 3AO5A 1NJWA 2QKKA 1NK8A 3CYMA 2VG7A 3QIPA 4CJSA 3PO5A 4DQIA 4L8RB 1WN7A 1JLAA 2F96A 4CJTA 4CGDA 4DTRA 2E6MA 3C95A 1CXUA 5CY4A 1XC9A 4FLXA 3ZT1A 2ZE2A 2GV9A 3O4NA 3V9WA 4KRFA 3HVTA 2KZMA 1I39A 3L2VA 1SL1A 3VQAA 3CQ8A 3VQ4A 1QSYA 3AVAA 4N47A 4Z4CA 3HL8A 5E41A 3NGIA 4CJ5A 3P5JA 1XHXA 2YKMA 3OYLA 2G8WA 5HRNA 4CJ4A 3LDSA 3CG7A 3AV9A 3O3FA 1QQCA 3TAGA 4DMNA 4K8XA 4FJNA 1VSIA 2B4JA 2IOCA 5CYMA 4FLYA 4ZTJA 4GMJB 4KAZA 4KHUA 3HP6A 4CHYA 4ELTA 4OLAA 1L3UA 2BDPA 1W9HA 4CCHA 4CJQA 4CF9A 4DTMA 3DMJA 2VWJA 5HLFA 1K6YA 1CLQA 1VSEA 4E3SA 3ZT2A 4DTNA 3AVGA 4CEEA 4OGCA 3O3GA 3LPTA 3MEGA 1SKSA 1B92A 3ISNC 4H8KA 5CZ1A 3DLKA 3ZSYA 1WSEA 4O5BA 4OPJA 4XIUA 3KLGA 3RTVA 4PWDA 5EU7A 3H08A 1REVA 2JLEA 4BDZA 1JKHA 3DLGA 3RR7A 4ZHRA 1DLOA 2FBTA 3OJUA 3K5MA 4FLWA 3LP2A 4AHRA 1BI4B 2HNZA 2Z1JA 4JRQA 3DRSA 3TAFA 3HJFA 1QHTA 3L2QA 2O4IA 4KREA 3PX4A 3HYFA 2I5JA 2XY6A 1WAJA 3SNNA 1LWFA 4CFBA 3AVMA 3LANA 1FK9A 3RMDA 1ITGA 4QCLA 1BIUA 4BWJA 1JLEA 3LP1A 1WSIA 4F3TA 1LV5A 1S1UA 5KRTA 4E7KA 2HW3A 1VRTA 1MU2A 4Z4GA 3WNHA 1CZBA 1HJRA 1YTAA 3O4QA 5DK5A 3PX6A 3DI6A 2Z1GA 5CYQA 4F8RA 3PO4A 5T7BA 1TVRA 1TKXA 4NCBA 4MFBA 1XHZA 1S9GA 4B9MA 1QE1A 1U04A 4B8AB 2DTUA 3V9ZA 4UQGA 3L3UA 4DTPA 2FC0A 3KD1E 4O55A 2VG5A 4ZTFA 1UAXA 3T19A 1SL2A 1HMVA 1N6QA 2YNFA 5HRSA 3KTQA 4KHWA 1RDDA 4M3XA 3DLRA 3SUNA 4LSNA 3RRGA 4EZ6A 4W5RA 1UA0A 1X9WA 4I9LA 3QINA 4CHQA 4FJ8A 1HNIA 3T1AA 4FM0A 3SUQA 4FLVA 1UWBA 2KQ2A 3VQCA 1J5OA 3OYDA 4C8MA 4FZZA 2G8VA 2WOMA 2VG6A 1RT3A 2G8HA 3K5OA 3NF7A 1GOBA 3ASMA 3HPHA 4KHQA 1G15A 1O1WA 2D0CA 3G0ZA 3ZT4A 2G8IA 3L2RA 1KTQA 1JLFA 1Q8IA 1S1WA 3HXMA 1NOZA 4F2RA 1ZBUA 4J2EA 5FDLA 3OYIA 4LH5A 3D45A 3ZSZA 3HT3A 1JLBA 3TANA 2HHSA 4B9NA 2DFHA 1BISA 2F8TA 4CHZA 3TAQA 1TAQA 1JLCA 2KW4A 4OKJA 3ZCMA 3K2PA 1Q9YA 4DS5A 4FJJA 5I42A 1SV5A 4E89A 4O44A 3OYBA 4M42A 3T3FA 3RRHA 4DG1A 1LAVA 3VQBA 4DF4A 1TKDA 1KSPA 4JS4A 4NYFA 2ETJA 1IKWA 3AO3A 4CECA 4CJWA 1VSMA 3SUOA 1TL3A 1BQNA 2OPSA 3MXJA 4HUGA 3KD5E 1Z25A 3F9KA 4CK1A 3C6UA 3OYGA 1D9FA 4FLTA 2AJQA 2X6SA 4FZYA 3HPOA 1HYVA 4PA1A 4M3RA 4HUFA 4QAGA 4DTUA 4J2AA 4DTOA 2DFEA 3HP9A 1U4BA 5HROA 3DYAA 4RW9A 3QNOA 1SKWA 4CFCA 3K58A 3TWHA 2G8FA 5FRMA 4Z4FA 3SJJA 4OKEA 2XY8A 4IKFA 1NJZA 1RDCA 2YHAA 3KKRA 3VQ7A 4HCCA 2HHXA 3K5NA 4AHCA 4KHNA 4CGFA 3VQEA 1IH7A 1FKOA 3OS0A 4ID5A 4FLZA 2XY7A 4CJLA 4DFMA 1RT2A 1BI4A 3NGZA 2HHVA 1X1PA 3NH2A 2Y1IA 4CEAA 3SQ4A 4KHSA 4RG8A 3V81A 4KTZA 4BDPA 1ASUA 2HHUA 3TARA 4CEBA 2NUBA 3V1OA 3UIQA 1EX4A 4M3ZA 3SQ1A 3RR8A 2KFNA 4N56A 4OKKA 1BIZA 3AVIA 2O4GA 4KHYA 1ZBFA 4PUOA 2JGUA 1RBTA 4JLHA 3BDPA 3AVJA 1NKBA 3SQ0A 4CFDA 4FK0A 1JLQA 1TKZA 3VQ6A 5FRNA 1RTHA 3HPGA 1NJXA 3ZSXA 5KTQA 5J1EA 3V9UA 2RPIA 2PYLA 1J9AA 1EXQA 5HRPA 4E1MA 4HCBA 1GOCA 3I0RA 3TR8A 4CESA 5C42A 1SKRA 3RMAA 1U49A 3AVCA 3VQDA 4E19A 3QNNA 5CZ2A 4F4KA 4W5NA 3S3NA 3OYFA 3SYZA 4CF1A 2YV0X 3MXMA 1N5YA 2HNYA 3K59A 4E7HA 5SWMA 4NCAA 3AVLA 1B9DA 5JS2A 1J54A 2W42A 3MEDA 3E01A 1D9DA 1WSFA 1IG9A 2ITGA 3KKSA 3LZIA 4ICLA 1HPZA 4M45A 4W5QA 3QEWA 1EKEA 1VSFA 4DU1A 2B6AA 3AO2A 4TSXA 2ZQBA 2WONA 4M41A 3C94A 1Z26A 3OYKA 2QK9A 4B9SA 4KB0A 4CJ3A 4Q5VA 3SI6A 1HRHA 1VSJA 3NHGA 3AA5X 3MXIA 4FW1A 4CJUA 4CHOA 4I9QA 3F73A 3U3GA 4DQPA 1JL2A 3IS9A 1RBSA 3L2WA 1BCOA 4FVMA 1JXEA 4B8CA 3K5LA 1A5XA 1ZYQA 3L3VA 1RDAA 4FJKA 4FJ9A 4CHPA 3ZSOA 4BDYA 4AHVA 4DSKA 2YNHA 3L2UA 4C8KA 4FLUA 1S1TA 4ID1A 1TV6A 5K14A 3KLFA 1RBUA 4CFAA 4CEOA 1R0AA 4FJMA 4PY5A 2HNDA 3OYHA 2KFZA 4IG0A 2D0BA 1TK8A 3V1QA 1DTTA 3S3OA 3DLHA 3OJSA 4BE2A 3P1GA 2RN2A 1QTMA 4N41A 2D5RA 4NCGA 5DMRA 3SPYA 4CJFA 4YNQA 2IGIA 3NDKA 1BGXT 2LSNA 2OPQA 4Z4HA 1C0TA 1KCFA 4YFUA 1D8YA 4M3WA 4M3YA 1RT6A 3LAKA 2HHQA 4KTQA 2IC3A 4EP4A 3S9HA 1X9MA 2BANA 4CEDA 3LALA 3SV4A 4OJRA 1S5JA 1YVUA 3KLIA 4CK3A 4IBNA 1KRPA 5SZTA 3S3MA 1RT4A 1KLMA 4W5TA 3SZ2A 3RMBA 3PUFA 2HVHA 1JXBA 3LZJA 1FXXA 3DRPA 3LAMA 1ZBLA 3ZSRA 3BGRA 2PY5A 4DTXA 1RTDA 1S6QA 3B6PA 2G8UA 3QETA
chains in the Genus database with same CATH superfamily
1TK5A 4JYAK 4DUZK 3RMCA 1SS6A 4B1WB 1WBDA 4YOXA 5LY3A 3R9PA 3SLCA 2IAJA 2RKIA 3VN5A 3LP0A 2QWQA 3HOSA 3OBWA 3P83D 4HTLA 2OTLN 1NGIA 4EAHD 3ENHA 2HVIA 3ENOA 4JRPA 4CGJA 3CCRN 4Y0WA 3M8RA 3HBTA 1ZBHA 3ZX2A 4WE1A 3QEXA 1CZ9A 3TABA 5KGXA 5EY4A 1UA1A 2A6AA 1HQEA 3I0SA 5KI6A 1YT3A 3F2KA 1M90O 5JS1A 4LH4A 3VEXA 3OBYA 3NF6A 1NNEA 2NRXA 3U3YA 1IG8A 2YHBA 4PQUA 5KRSA 3NH1A 3TAMA 3TTCA 4B1UB 2JWLA 4YOYA 3A2FA 1NKCA 3G10A 3HVRA 3VF6A 3AO1A 3MDQA 1C1AA 3OS1A 4CF2A 3CHWA 5FPMA 5C25A 4DWIA 4LF7K 4DU3A 2QXLA 1QQOA 4F9OA 4BRHA 5I9EB 1A5WA 2GEMA 4JI2K 3MECA 4KV8A 4BWMA 5BRDA 4BR5A 2ZM6K 4KPYA 3WXIA 1BQMA 4CIEA 5AFUA 3QESA 4GKJK 4DFKA 4H5WA 5HL7L 4LF6K 4I2PA 1QZ5A 3OYNA 1XWLA 3AVFA 3LDLA 4CEQA 1T05A 3OY9A 4IZ9A 4E7LA 1A5VA 4DTSA 2X74A 4HHTA 3RVCA 5LMUK 1J53A 2O8DA 2V52B 2ZD1A 3SUPA 1ZBIA 3AVBA 4KH5A 4N76A 4B9UA 4MQ3A 3C0BA 4F3OA 4BE1A 4CJ7A 4WF9L 4H4MA 4X66K 3TAPA 1SAZA 1S3XA 4CF8A 4C8OA 4YDUA 1GLAG 3UKRB 3VPZA 3JSMA 1NK7A 2CH6A 3FZHA 4R5PA 5EXWA 4PHTX 4FK4A 3A5OC 4JKAA 2HHHK 4DR2K 3DLLL 4ELVA 4BGAA 3JXUA 1VSKA 1RBRA 3B8AX 4CJVA 5J2QA 2IVNA 2E1YA 4DSIA 4O0JA 3NE6A 3CC7N 3WT0A 3ZSWA 3AY9A 5AQOA 3PSFA 1Q82O 5ADXA 2Q0UA 4FPAA 5KGWA 1HPMA 3V9SA 4FJGA 4CGHA 4M3TA 5BPMA 4A2AA 2X6NA 4IJAA 2I7NA 4GY2B 1RDBA 2VWKA 4BE0A 1NJYA 3LPUA 4DQSA 1D5AA 5H1SQ 1ATNA 4B08A 3T1HK 4DTJA 3U6FA 3MN6A 1KVAA 3SAFA 4B9VA 2GUIA 2UU9K 4QOZB 5DM7L 4EP5A 3E9PA 4KTWA 1DT9A 5AQMA 3IRXA 3KWIA 3ZT3A 3ATUA 3H3OB 3AVKA 4O4GA 3OYMA 3HO1A 3ULEA 2E8AA 3OYJA 3AO5A 3O5BA 2QKKA 5JVGL 4IDHA 4CJSA 3PO5A 4DQIA 4L8RB 2P9PA 1JLAA 2D1KA 4M7YA 3C95A 5CY4A 3ZT1A 2GV9A 2KZMA 3VQAA 4B1ZA 3WXMB 2NRVA 4CJ5A 3P5JA 5CE3A 2YKMA 3I55N 3LDSA 3AV9A 3ENBA 4K8XA 1BU6O 3TPQA 2O8CA 5BPNA 4BVPA 2BDPA 4DUYK 1W9HA 4CCHA 4DTMA 1VQ6N 2VWJA 1VSEA 4E3SA 3MCAB 3C7NA 4CEEA 4H8KA 3ISNC 1BA0A 4OPJA 1G99A 5E26A 3H08A 1REVA 5EU7A 4BDZA 3LDPA 3K5MA 3TAFA 3VF4A 4AHRA 2Z1JA 1YITN 4BC4A 2GELA 3J8AA 4NO7A 1KXPA 1QVFM 3VGLA 3A5LC 4RCHA 1WSIA 5GADP 2P9NA 2KHOA 1CZBA 1YTAA 1GLBG 3DI6A 2O8EA 3T69A 3WQTA 1TKXA 2BH1A 4FSVA 1YJNN 4B9MA 3FZFA 3AARA 3J80O 3OHRA 3T19A 4JI5K 1N34K 3I33A 1N6QA 2YNFA 2UUAK 4KHWA 3ID8A 3DLRA 3RRGA 3PLAA 4EZ6A 2P9KA 4W5RA 4FJ8A 2E2QA 4FO0A 1HNIA 3UKUB 2GTDA 1DGKN 5AQPA 4FLVA 1UWBA 2I7PA 1J5OA 1WOQA 2G8VA 4C1NI 3CJ1A 2G8HA 3ZT4A 3P4IA 1JLFA 1NGDA 1Q8IA 3HTVA 1NOZA 1ZBUA 5FDLA 1HX1A 3HT3A 2ZWHA 3TANA 4MO5A 2HHSA 3TAQA 1D4XA 1JLCA 4OKJA 5I42A 4JKFA 3A8YA 4E89A 2DPNA 1K9MO 4M42A 4DR7K 3KVGA 4JKDA 2W6KA 3SAGA 2V51B 2F4VK 2V7ZA 3AO3A 4DHYA 3SUOA 3W0LA 1TL3A 4HUGA 4PKGA 2AJQA 4DTUA 4JKCA 5HROA 3DYAA 4IJNA 4RW9A 3K58A 2G8FA 3DWLA 4Z4FA 3SJJA 4M7XA 3E9LA 5F1XA 4KHNA 3OS0A 2XY7A 4DFMA 2HHVA 4KTZA 3TARA 3L6QA 4M3ZA 4C23A 3CJAA 3EKSA 1EWQA 4YDUC 1HLUA 4FWSA 2JGUA 4FWPA 4BRIA 3BDPA 1NKBA 1KC8O 1IV0A 1NLVA 2VYPA 4ISEA 2WTUA 1VQ7N 4G9ZA 1NBWA 1OVQA 1RTHA 2FXUA 4PL7A 1NJXA 2RPIA 2PYLA 1J9AA 5HRPA 2BTFA 1SKRA 4BRAA 2OANA 4GKKK 5CZ2A 4F4KA 4W5NA 4CZKA 3S3NA 2D0PA 3K59A 4E7HA 1B9DA 4DV1K 4J8FA 1N33K 2FSKA 4KH6A 5JMVA 3KKSA 3PIPL 3H1VX 3LZIA 4A61A 4ICLA 1HPZA 4U67L 4W5QA 5AQTA 3QEWA 4CZEA 3AO2A 3VTHA 1Z26A 1Y64A 3MK6A 4B9SA 3SI6A 3MXIA 3AA5X 3O1BA 4I9QA 3MN7A 4DV6K 5AQWA 3IS9A 1BCOA 5TKWA 2UXDK 1ZYQA 5BRHA 4H0PA 1RDAA 4FOIA 4FJ9A 3ZETB 4DSKA 5AJ3K 2YNHA 3L2UA 1S1TA 4YOUA 1GLLO 4CFAA 3OYHA 4IG0A 4GNIA 3K0SA 4BE2A 4N41A 2FF6A 1HR0K 3SPYA 1R59O 3SJHA 3M3ZA 3NDKA 2LSNA 1C0TA 4YFUA 2HHQA 4KTQA 3CIPA 4DV4K 4EP4A 4JI4K 3VERA 4JNEA 3LALA 3WXLA 4EFHA 4JKEA 1KRPA 3S3MA 1KLMA 3DXKA 1YHQN 3ZSRA 1MA9B 4BRNA 1X9WA 1RDWX 2ATQA 4I6MA 3NVKA 4FJ5A 3CCLN 1U45A 1KFSA 2H3GX 1BDGA 4C1NK 3K57A 1N32K 2IIRA 2ZJQL 3O08A 5BR9A 1RILA 4AQYK 3NFAA 1LW2A 1NOYA 4EHTA 2P5GA 1HJOA 1IKVA 4KFBA 1LWCA 3RSEA 3THVA 3K9KA 3T1YK 4K42A 2P51A 3MN5A 3QFUA 4G1QA 3CJ7A 1GOAA 4H5RA 1WLJA 1VHXA 1BUPA 1NJIO 3EYZA 4LD0A 3CM6A 2ASPA 3EY1A 2YHXA 4NXNK 3TAEA 3FLCO 1ESVA 1SUQA 1YTUA 1XI1A 2E6LA 2X78A 1VQMN 3QO9A 4QS7A 1HYZA 4CJRA 4JHDB 4BACA 5J2NA 3AA4A 4LF8K 3O3HA 4LY7A 2BUPA 4C8NA 3KIOA 2E20A 3AO4A 3HOTA 1EETA 3U9DA 4JV5K 1W0HA 1VQ9N 3HSTB 4Y1DA 3MX5A 4KI6A 1Y97A 4IFYA 4DR1K 2NLXA 2P9SB 4JS5A 4BC2A 4CJKA 4CJEA 1YJ9N 5JLFA 3G6EN 3AA3A 4FWOA 2OZSA 4JK9A 3SPZA 5LJWA 1RNHA 3EE8A 4NXMK 1IKYA 3OYAA 4DS4A 3BP8A 1B9FA 1U2VB 3OTOK 1JJ2M 1IBLK 2IS3A 3AA2A 3VQPA 2NZTA 2P5OA 1Q86O 1GLFO 4DR3K 3O9TA 4AHSA 3G4SN 1WNSA 3L8BA 1TKTA 2OPPA 4XH5A 3CPWM 4DV2K 4WFAL 2HBMA 5AQRA 4DFPA 2PZSA 3Q7BA 4I2QA 4JKGB 3GL1A 4RW8A 1T03A 3CM5A 3CFRA 1X9SA 2GX9A 3JYTA 1IKXA 1NG9A 3VEYA 4IDKA 2Z1HA 1E3MA 4AILC 1KD1O 3FE1A 4Y1CA 4AHTA 3EZWA 4QS9A 5AQUA 3R8EA 1RT5A 4DSLA 3M8PA 3A0IX 4MO4A 5AZIB 3ZSVA 3WNFA 1NK0A 1BHLA 1C0UA 3SV3A 2XO7A 4L3QA 4DF8A 2Q0RA 2ZF5O 1ASVA 3KK1A 1IJJA 4V19S 1S1XA 4CE9A 1LW0A 5FPDA 1NKEA 2E4LA 3OVNA 4JI0K 3DXMB 4H5TA 4CF0A 5C2DA 2P9IB 3KK3A 4FJLA 3VOVA 1L3TA 4DQQA 4RW6A 3QIOA 3VQ5A 3VTIA 4GVMA 5BREA 4DU4A 1GLEG 2D4WA 1L5UA 3DAWA 3NAEA 3O4WA 3FZLA 5M1KA 1WSGA 3DRRA 1I3AA 5J2PA 4LF4K 2O8FA 2ZGZA 1DEJA 3NBPA 1YAGA 1E4FT 4GW6A 1VRUA 1HQUA 1C1BA 1CZAN 4RW4A 3HM9A 5IWAK 5HOOA 3R1XA 2R7YA 4J2DA 1RCHA 4CGIA 4CJPA 2P1JA 3D7EO 4C8LA 5JICA 3E66A 3A5MC 3CYMA 2P9LA 3QDKA 2F96A 1P8ZA 4CJTA 2E6MA 1CXUA 3QBXA 1VQ5N 3ZLJA 3O4NA 4H5NA 3HVTA 3VEVA 3O1WA 1I39A 1SL1A 3CQ8A 4N47A 2VGNA 3HL8A 5E41A 3NGIA 3UKRA 1WUAA 3N4PA 2IOCA 4ZTJA 4KAZA 5M1NA 2O8FB 3H6EA 1K8KA 2HF4A 3OA9A 4CZMA 1NGBA 5BR8K 4YOVA 1CLQA 4BG9A 4DTNA 5JLHA 4K43A 4OGCA 3MEGA 3DLKA 1ATRA 3ZSYA 3KLGA 2GWKA 1JKHA 3DLGA 3CCVN 2P9LB 2FBTA 1BI4B 2HNZA 5FPEA 2O4IA 3DRSA 1QHTA 2YI1A 4CFBA 5AQZA 4LFCK 3RMDA 4QCLA 1QVGM 1JLEA 3W3DA 1S1UA 1MU2A 4JEPA 4Z4GA 1HJRA 2Z1GA 4H5VA 5CYQA 5T7BA 4NCBA 1YUWA 4MFBA 1S9GA 5AQFA 1QE1A 4OPAA 3V9ZA 1K8KB 2VG5A 1SL2A 3FGUA 3KTQA 3SUNA 4LSNA 4BQLA 5BPLA 4A5AA 1UA0A 2VQFK 4I9LA 4CI6A 4CHQA 1S22A 3SUQA 3LDNA 3CERA 3MCPA 1W2BM 3CETA 2VG6A 4DV0K 4Z94A 3NF7A 1GOBA 4K0KK 3HPHA 2ASOA 4KHQA 1O1WA 3P38A 2G8IA 1KTQA 1HNZK 3M5RA 3TU5A 1X9JA 2UXBK 3OYIA 4ISGA 1NMNA 1VQON 3I56N 1NGCA 2CGJA 2F8TA 3ZCMA 2KW4A 4JK8A 3K2PA 4DS5A 3BZKA 2KKZA 4FJJA 3A5NC 1FW6A 1SV5A 3R3LA 4B3MK 3T3FA 3RRHA 5ELZA 4DG1A 1GLDG 3VQBA 1TKDA 3UB5A 2ETJA 1IKWA 5BN9A 3D6RA 4CECA 1VSMA 4JKHA 3IFRA 3KD5E 1HYVA 4PA1A 4M3RA 4DTOA 2HMPA 4CZFA 1SKWA 3QNOA 3VEOA 4IO8A 4FWQA 1NJZA 2Q1NA 3KKRA 4A5BA 2HHXA 4EHUA 3VQEA 4CJLA 1T44A 1X1PA 4RG8A 4BDPA 2A41A 4H0YB 4CEBA 5AZJB 3SQ1A 1SZ2A 4OKKA 3T7ZA 3M6GA 2HBJA 5M1OA 4DR4K 4YY3K 3P31A 4KHYA 4JI6K 1RBTA 3ZEUB 1Q18A 4FK0A 3HPGA 5KTQA 1EXQA 4E1MA 4CBWA 1KAZA 3RMAA 3VQDA 3O9SA 3OYFA 4HWIA 2YV0X 2E88A 3MWTA 2QWMA 5SWMA 4BVOA 3UKUA 2FSNA 5JS2A 2W42A 3LDQA 3O8MA 4IOAL 4M45A 3ATVA 3QNNA 4DU1A 4M41A 2B6AA 1GLCG 2ZQBA 2ASMA 4IFEA 3OYKA 4KB0A 2QI2A 3NHGA 4CHOA 4DQPA 1TYQA 1JL2A 1JCFA 3CJBA 3D2FB 1RBSA 4FWMA 3BF1A 4FVMA 3O6WA 4FJKA 4ISFA 3ZSOA 5K14A 3KLFA 2D0BA 1TK8A 5C2FA 5AQIA 1Z6RA 2RN2A 2VGMA 5DMRA 4CJFA 3BY5A 4Z4HA 4M3YA 1C0GA 1RT6A 3LAKA 4BRFA 1NGAA 1XQSC 3WEEA 1W97L 4CVNE 4OJRA 3KLIA 4IBNA 4AF1A 3RMBA 1I94K 3LZJA 1TYQB 1VQNN 2IDOA 4A62A 5AQVA 3LWMA 2YJEA 4BG8A 3BF3A 2EX3A 3CC4N 4FM2A 1C0MA 4CIGA 4YHHK 4JI8K 2FBXA 3V9XA 3GE1A 4MDBA 2G8KA 1TL1A 4K25A 2PFUA 2YNGA 2O8BB 1KAXA 3V6DA 1S1VA 2XHBA 1T3VA 1L3SA 5BN8A 4Z0UA 4DB3A 5MLCQ 3KLEA 3WEEB 1VSLA 3J81O 4O0IA 5IT9O 3NCIA 1EWRA 3VA0A 4OVLA 1IBMK 3O80A 1QQNA 2Y1JA 1MDUB 1S6PA 2HB5A 2J4RA 4IG3A 1ZC6A 3G71N 3VQ8A 4DFJA 4B9LA 3SQ2A 2FF3B 3LDOA 4A57A 5GAGP 3QEVA 2E2NA 4FM1A 2HSTA 4IXCA 3OW2M 1CXQA 3QBWA 1RT7A 3QFPA 2HF3A 3SCXA 1YF5L 1ZBSA 3DM2A 2D0AA 3C6TA 3ZETA 3O9RA 2UUBK 4Z4IA 3IMXA 3S41A 2BE2A 4LF5K 1Q9XA 2QM1A 3P39A 1LAWA 1VSHA 4PKIA 3LP3A 3TTFA 2QWRA 4FJXA 3CXCM 3OS2A 4O8KA 3SAHA 3QICA 3QLHA 2DY4A 4M3UA 1JL1A 3MAQA 4DSJA 2AA4A 5HBMA 4QS8A 2UYTA 4R79A 1TAUA 2KZZA 1RTJA 5GAEP 2WUSA 3M1FA 4FZXC 1S9EA 3KJVA 3Q7CA 1T7PA 3ZT0A 3KK2A 4X65K 3LL3A 3SBTA 1OH7A 5FROA 4K41A 2PAVA 1QSSA 3PSIA 1QSLA 3VA3A 1RBVA 1HNVA 1VQ8N 4DLGA 5AQJA 5AQYA 4WQ4A 2HHTA 5LL6Z 3FFKB 3MX2A 3N4QA 4K8ZA 3MEEA 3OYEA 3WNEA 3M8QA 3AVHA 2PYJA 1RFQA 3IAYA 4FJ7A 4UY8O 3DOKA 2WBNA 4I7FA 4CZHA 1DTQA 1NK5A 4FWRA 1KLNA 5F2RA 5AFUH 4FJHA 4DR5K 3THYB 2WFBA 3CQYA 1C6VA 4B1XB 3VQ9A 4U7BA 1NGFA 1XMOK 2HHWA 3J7ZO 4E1NA 1KVBA 4WQ5C 5HP1A 4XEIA 4FJIA 3ULDA 3OYCA 4CZGA 3WXJA 2VQEK 4CERA 4JHDA 4E1JA 2Q97A 4KB1A 2NRTA 2ZJRL 2P9UA 1HUXA 1OH8A 2FBVA 3AAPA 3KLHA 1HKCA 4X64K 2P9SA 1VQLN 3E9OA 1RT1A 5AR0A 3PV8A 5GIPA 2B5JA 1IO2A 3PY8A 1U2VA 2FBYA 4HVJA 1U47A 4DQ8A 4B9TA 1EO1A 1FKPA 2YNIA 5CHIA 1EP4A 3AVNA 4FPBA 3NMUA 4CGGA 1KAYA 4JD2B 2OPRA 3DLEA 3HK2A 3TI0A 4AM7A 1NK8A 2VG7A 3QIPA 1J5EK 1WN7A 2P9UB 3AGKA 4JKGA 4BREA 2WC9A 2ZE2A 3CF5L 3L2VA 3VQ4A 4EIAA 4Z4CA 4PL8A 5C15A 1K73O 1XHXA 2G8WA 3CCSN 5HRNA 3TAGA 1QQCA 2E2OA 4FLYA 4GMJB 3GDQA 3HP6A 4CHYA 4ELTA 5AQLA 1VQ4N 4CF9A 4DR6K 1K6YA 3ZT2A 3AVGA 2CGLA 3O3GA 3LPTA 2A5XA 5AZIA 1B92A 4KHPK 5CZ1A 1WSEA 4O5BA 4XIUA 3RR7A 1DLOA 3IDHA 3OJUA 4FLWA 3HJFA 4JRQA 3FR0A 3DJCA 2I5JA 2XY6A 1WAJA 3SNNA 1LWFA 3AVMA 1FK9A 4YOTA 3CJ9A 4BRDA 1BIUA 4BWJA 3DXMA 3LP1A 2P9IA 3BZCA 1LV5A 1YVNA 5KRTA 3WNHA 3PX6A 4F8RA 5DK5A 3PO4A 1BA1A 3EKUA 1XHZA 1U04A 3ID6A 4LFAK 4UQGA 3L4IA 1UAXA 2ZJPL 3CC2N 1HMVA 4ILGB 5HRSA 4JI1K 3BUZB 4FM0A 3ZX0A 3VQCA 3OYDA 4C8MA 3SBGA 4FZZA 2WOMA 5KPTA 1RT3A 4BGBA 3HRGA 3ASMA 1G15A 2D0CA 3L2RA 4BQZA 4YOWA 4F2RA 5AQGA 3D45A 3ZSZA 1JLBA 2DFHA 1BISA 3THWA 1Q9YA 4B3RK 2NRHA 3OYBA 1JCGA 1LAVA 4DF4A 2ZGYA 4JS4A 4NYFA 3VEWA 4BRCA 1BQNA 2UXCK 1Q7YO 3MXJA 3AGRA 5FLXO 3F9KA 4CK1A 4FLTA 4FZYA 3CJCA 4HUFA 3FZMA 3JAMO 1MWKA 2IVPA 5EVZA 1T6DA 4CFCA 3TWHA 3K9JA 3D2EB 4ILHA 1RDCA 2YHAA 4HCCA 3K5NA 4CGFA 1BI4A 1VAZA 4B3TK 4KHSA 3V81A 2HHUA 1ASUA 3THWB 3UE5A 4WQ4C 3V1OA 1P90A 1EX4A 2KFNA 3RR8A 3L0QA 5FPNA 5KQDA 1E4GT 3H45C 5KQ8A 4H0XB 4AM6A 3SQ0A 4CFDA 5C10A 3SMPA 1JLQA 3VQ6A 5FRNA 3ZSXA 3V9UA 5J1EA 1NGGA 5TKYA 4HCBA 1GOCA 3I0RA 3TR8A 1U49A 4NLCA 4E19A 2RE2A 3SYZA 3MXMA 4KBOA 4NCAA 2AP1A 1J54A 3L4QA 3MEDA 2ITGA 4FWLA 4DV3K 2A42A 5M1PA 4FL9A 1EKEA 1VSFA 3H46O 4TSXA 3KWGA 2QKBA 2QK9A 2OCEA 1VSJA 1TUUA 3NVMA 2E2PA 3KK7A 2GUPA 3K5LA 3L3VA 4CHPA 4BDYA 3F5TA 4C8KA 1R0AA 1RBUA 4PY5A 4CEOA 4FJMA 2HNDA 3CCEN 3V1QA 1DTTA 3DLHA 1NGEA 2D5RA 4NCGA 4OPHA 4YNQA 3C6AA 2IGIA 2OPQA 1KCFA 2QEXN 2KLAA 1RDUA 2IC3A 4A2BA 1X9MA 1ILYA 2BANA 4CEDA 3SV4A 1YVUA 4CK3A 4BRGA 3SZ2A 1MWMA 1JXBA 1NGJA 4B1YB 1FXXA 3DRPA 4M63C 1S6QA 3B6PA 3GG4A 3QETA 1LOTB 3VENA 3AAQA 1LCUA 4JK7A 4LC9B 3O9UA 4FCYA 2F9TA 1NK9A 4F2SA 4ILJA 2O8DB 4BC3A 4FXDA 3JS6A 5AZJA 4MLEA 2FLOA 5A2QO 1LWEA 3CD6N 3ZEUA 4H4OA 4B3SK 2V7YA 2QWOA 3M8SA 4DSEA 4IOXA 3HI0A 3J7YP 2W41A 4J2BA 3BEXA 4W5OA 3H3NO 2VWBA 3ALYA 4DSFA 1YJWN 2CGKA 5HRRA 5DM6L 3IKMA 4CK2A 4MDAA 4BC5A 4N5SA 1UOCA 2RF2A 1C1CA 1ATSA 3EL2A 2XRIA 1XNQK 2VCPA 4JKBA 4WQ5A 1F21A 3QEPA 4FW2A 4CBUA 3I8DA 4IO9L 5C24A 4OPKA 1VK0A 1XC3A 3D2FA 1VQPN 4H0OA 4OX9K 5D3GA 4H03B 1BL3A 5CR4A 3DLBA 4AH9A 4FK2A 5M1QA 3E1YA 1NK6A 2A1SA 4DLEA 1U48A 2HBLA 3V1RA 1HKGA 2EWSA 3CPEA 3VETA 3QEIA 2JWKA 2QXFA 3VESA 3EE9A 5F0XA 3B6OA 4CEFA 1SL0A 3NH0A 3CFPA 1QQMA 1NK4A 2XY5A 1NU0A 3I8BA 5AQHA 4BRPA 2KTQA 4FYDA 4CD3A 3LWLA 3RWUA 3CFOA 4OLBA 1T6CA 1HNXK 4CW7B 2CH5A 3FFIA 1S72N 1TK0A 2OZMA 4CD1A 2QWNA 1XNRK 3GBTA 5BRFA 3CMAN 3NF9A 4PKHA 3WXKA 4OGEA 2EHGA 2BGGA 1N8RO 3ULEB 4CBXA 4GV3A 1TGOA 1GLJO 1VSDA 2NRWA 4B3OA 1HKBA 2P9PB 3VGMA 1QS4A 4DV5K 4NLBA 1JCEA 1ASWA 1BO5O 1SQKA 2DFFA 3ITHA 2OYQA 2FSJA 2F8SA 5C12A 3NF8A 1EQYA 2O8BA 2Q2RA 3CCUN 3EO3A 1X3MA 4ELUA 1X3NA 1KVCA 4LSLA 4KKOA 4CZJA 3ZSQA 4NYNA 5I3UA 3J7AP 4CIFA 2O8CB 3DOLA 3C6HA 3U9ZA 4DQRA 5M1FA 3G25A 5LMNK 1N36K 4H0TB 3NGYA 1WSJA 4E7JA 2Q36A 3C7NB 1M1KO 3TTDA 4RW7A 5GINA 4EZ9A 4HTUA 3VGKA 3U8XA 2YKNA 1V4SA 3WNGA 4AHUA 4CHNA 2Z1IA 3R6MA 1BCMA 4XH1A 5AQXA 1WAFA 4KI4A 3MMVA 3VQQA 5LJVA 4KO0A 3D0PA 1JLGA 3TSPA 3LM2A 4IFVA 1YXQA 2P9NB 4E7IA 3QERA 1KQSM 5B8HA 4E0DA 2O8EB 4FWNA 1L3VA 5AQNA 3THXA 3QB0A 5C0YA 1HYSA 3IG1A 4Z4EA 4Q0BA 4CEZA 4RWTA 2GBZA 3V4IA 2Q3SA 3PX0A 4JI7K 1OVYA 4JAXA 2QA4N 5EOYA 3VEZA 2GWJA 1HNWK 2P9KB 4HUEA 1W7AA 4JN4A 3EEQA 3H1QA 5KPZA 3PIOL 4BRKA 4B1VA 2A1RA 4LF9K 1WSHA 2HMIA 5AQQA 4FWKA 1T8EA 2QTDA 1KFDA 2F9WA 5J2MA 3EZ5A 1RTIA 2OA8A 3CCJN 1NJWA 4BR9A 2YHYA 3CCMN 1OH6A 4CGDA 4DTRA 1BG3A 1XC9A 3HM8A 4H0VB 4WFNL 4FLXA 1IBKK 3V9WA 4KRFA 1RGIA 4FVUA 3CQXA 4DCHA 1QSYA 3AVAA 3ZX3A 3MN9A 3THXB 4GV6A 1FJGK 5E84A 2UUCK 3OYLA 2W40A 4XH4A 4CJ4A 2QWPA 3CG7A 3O3FA 4FJNA 4DMNA 3GOIA 2RHKA 5KPRA 1VSIA 4BR2A 2B4JA 5CYMA 4KHUA 4OLAA 1L3UA 4OO1J 3THYA 4CJQA 3DMJA 5GIOA 5HLFA 1H1VA 4O5FA 1QZ6A 1SKSA 4LFBK 3TSUA 4CZLA 4PWDA 3RTVA 2JLEA 5JVHL 1U6ZA 4ZHRA 3F9MA 3O9QA 1ZXOA 4BY9C 3LP2A 5AQSA 3L2QA 4KREA 3PX4A 3HYFA 2YX6A 3LANA 4JI3K 1ITGA 1Z05A 3CMEN 4F3TA 4O8UA 3WQUA 1NGHA 4E7KA 2HW3A 1VRTA 3O4QA 2E5LK 4BRMA 1TVRA 3LM9A 4B8AB 2DTUA 2HOEA 3L3UA 4IEEA 4DV7K 4DTPA 2FC0A 3KD1E 4O55A 4ZTFA 1K8AO 5AQKA 2PBDA 1RDDA 1BWFO 4M3XA 3MWPA 4BR4A 4WCEL 3QINA 4DKWA 3T1AA 2A3ZA 3HSCA 1QHAA 2IVOA 2KQ2A 3CCQN 1VQKN 4JD2A 3K5OA 1YI2N 3G0ZA 1WB9A 2YHWA 1S1WA 3HXMA 4J2EA 3SMSA 4LH5A 1WBBA 3EN9A 4B9NA 4CHZA 1TAQA 2D0OA 2YCHA 3SK3A 3QMLA 1TUYA 4O44A 4GV9A 4RTFD 1KSPA 5GAHP 4CJWA 3U4LA 2OPSA 1Z25A 4X62K 3C6UA 3OYGA 1D9FA 2QW9A 2X6SA 4WFBL 3HPOA 1OKJA 4QAGA 4J2AA 2ITMA 2DFEA 3HP9A 1U4BA 1C0FA 5FRMA 4MLHA 4OKEA 1OH5A 2XY8A 4B9QA 4IKFA 4GVEA 3DXKB 5ADXH 3VQ7A 4AHCA 4IEIA 1IH7A 1FKOA 3VMFB 4ID5A 4FLZA 3KZBA 1RT2A 4I6MB 3NGZA 2Y1IA 3NH2A 4CEAA 3SQ4A 4BRQA 2NUBA 3UIQA 4N56A 4NB4A 3CI5A 4FOEA 1BIZA 3AVIA 3TSQA 2O4GA 1J6ZA 2A40A 1ZBFA 4PUOA 2OTJN 4JLHA 3AVJA 3IUCA 1TKZA 1XUPO 3RSEB 5C42A 4CESA 3AVCA 2Q31A 4WYBA 4CF1A 1V4TA 1NWKA 1N5YA 2HNYA 3AVLA 3C65A 3VF2A 1D9DA 3E01A 3KHYA 1WSFA 1IG9A 1NMDA 2NNWA 4IWVA 2NRRA 1DKGD 2WONA 3C94A 4CJ3A 4Q5VA 1HRHA 4YORA 4FW1A 2YJFA 4CJUA 3F73A 3U3GA 2W6LA 4A59A 2F7TA 2HBKA 3HZ6A 3WUHA 2QWLA 3L2WA 4B8CA 1JXEA 4BRLA 1A5XA 4KH4A 4AHVA 4BR7A 4FLUA 4ID1A 1TV6A 2KFZA 4CZIA 3S3OA 1XMQK 3OJSA 1QTMA 3P1GA 1YIJN 1NM1A 1BGXT 1D8YA 5EX5A 3FZKA 4BR0A 4M3WA 2NRZA 1BOTO 3S9HA 4BROA 1S5JA 4IOCL 3D2EA 1Q81O 5SZTA 1RT4A 4W5TA 3ZYYX 3PUFA 2HVHA 3LAMA 1ZBLA 2PY5A 3BGRA 4DTXA 1RTDA 2E1ZA 1O13A 2G8UA
chains in the Genus database with same CATH topology
2ATQA 2IDOA 1TK5A 3RMCA 4FJ5A 3LWMA 4FCYA 2EX3A 1NK9A 1U45A 4FM2A 4F2SA 1C0MA 1KFSA 4FXDA 2IAJA 4CIGA 2RKIA 3VN5A 3K57A 3LP0A 2FBXA 3P83D 3V9XA 1LWEA 1RILA 2HVIA 3NFAA 2G8KA 4H4OA 1LW2A 1TL1A 1NOYA 2YNGA 4JRPA 2P5GA 4CGJA 3V6DA 4KFBA 1IKVA 1S1VA 3M8SA 2XHBA 3M8RA 1LWCA 4DSEA 3THVA 1L3SA 1ZBHA 4Z0UA 2P51A 3KLEA 4J2BA 1VSLA 4G1QA 1CZ9A 4WE1A 4W5OA 3QEXA 4O0IA 3TABA 1GOAA 3ALYA 5KGXA 4DSFA 1UA1A 3NCIA 5HRRA 1WLJA 1HQEA 3VA0A 4OVLA 4CK2A 3I0SA 5KI6A 1YT3A 4N5SA 5JS1A 3EYZA 4LD0A 2Y1JA 1UOCA 4LH4A 2RF2A 3CM6A 1S6PA 1C1CA 2HB5A 3EY1A 2XRIA 4IG3A 3NF6A 3QEPA 1F21A 4FW2A 3VQ8A 4DFJA 3TAEA 4B9LA 3U3YA 1SUQA 2YHBA 3I8DA 1YTUA 1XI1A 3SQ2A 2E6LA 2X78A 5C24A 4PQUA 5KRSA 3NH1A 3TAMA 3QO9A 4OPKA 3QEVA 1VK0A 4FM1A 1HYZA 4CJRA 1CXQA 4BACA 5J2NA 1RT7A 3AA4A 5D3GA 3O3HA 3DLBA 1BL3A 4LY7A 3SCXA 4C8NA 3A2FA 4AH9A 4FK2A 3KIOA 3AO4A 3DM2A 2D0AA 2A1SA 3C6TA 1NKCA 1NK6A 2QKBA 4DLEA 1EETA 1U48A 3V1RA 3G10A 3QEIA 4Z4IA 1W0HA 2BE2A 2QXFA 3HVRA 3B6OA 3HSTB 4Y1DA 4CEFA 1SL0A 4KI6A 1Y97A 3AO1A 4IFYA 1Q9XA 3NH0A 1C1AA 3CFPA 3OS1A 1LAWA 1VSHA 4CF2A 1NK4A 4JS5A 2XY5A 5C25A 4DWIA 3LP3A 4DU3A 4CJKA 4CJEA 1A5WA 4FJXA 3AA3A 2KTQA 2OZSA 3OS2A 4FYDA 3SPZA 1RNHA 3MECA 4KV8A 1IKYA 4BWMA 3OYAA 3LWLA 4DS4A 1B9FA 3CFOA 3RWUA 4KPYA 4OLBA 3QLHA 3FFIA 2DY4A 1BQMA 4CIEA 1TK0A 4M3UA 3QESA 1JL1A 3MAQA 4DFKA 2IS3A 4DSJA 5HBMA 2OZMA 1TAUA 4I2PA 1RTJA 2KZZA 3AA2A 3VQPA 3OYNA 4FZXC 1S9EA 2P5OA 1XWLA 3AVFA 4CEQA 4AHSA 3KJVA 1T05A 3NF9A 3OY9A 4OGEA 2EHGA 4E7LA 1T7PA 1WNSA 1A5VA 2BGGA 4DTSA 2X74A 3L8BA 1TKTA 1TGOA 2OPPA 3ZT0A 3KK2A 1VSDA 4HHTA 4B3OA 1J53A 2ZD1A 3SUPA 1ZBIA 3AVBA 5FROA 4DFPA 2PZSA 1QSSA 4I2QA 1QSLA 4B9UA 1QS4A 4RW8A 3VA3A 4N76A 4MQ3A 1RBVA 1ASWA 1T03A 4F3OA 1HNVA 2DFFA 3ITHA 4DLGA 2OYQA 4BE1A 3CM5A 2HHTA 2F8SA 4K8ZA 3MEEA 3NF8A 4H4MA 3OYEA 3WNEA 3M8QA 3AVHA 3TAPA 2PYJA 4CF8A 4C8OA 3IAYA 3CFRA 4FJ7A 4ELUA 1X9SA 3DOKA 1KVCA 3JYTA 1IKXA 4I7FA 4LSLA 4KKOA 3JSMA 1DTQA 1NK5A 1NK7A 4IDKA 1KLNA 2Z1HA 3ZSQA 4NYNA 4AILC 5I3UA 4CIFA 3DOLA 4R5PA 4FJHA 4DQRA 4Y1CA 4AHTA 4FK4A 3NGYA 1C6VA 1WSJA 4E7JA 3VQ9A 1RT5A 4DSLA 3M8PA 4RW7A 4ELVA 3ZSVA 4EZ9A 3WNFA 2HHWA 1NK0A 4E1NA 1KVBA 1VSKA 1RBRA 4HTUA 4CJVA 5HP1A 2YKNA 4AHUA 3WNGA 4CHNA 5J2QA 1BHLA 1C0UA 3SV3A 4DSIA 4FJIA 2XO7A 3ULDA 4O0JA 2Z1IA 3OYCA 3NE6A 1BCMA 4DF8A 3ZSWA 1ASVA 4CERA 3KK1A 1WAFA 4KI4A 1S1XA 5KGWA 4CE9A 3VQQA 3V9SA 1LW0A 4FJGA 4KB1A 1NKEA 2E4LA 4CGHA 3OVNA 4M3TA 4KO0A 3D0PA 4CF0A 1JLGA 3KK3A 4FJLA 1L3TA 4IFVA 2X6NA 4E7IA 4DQQA 3QERA 4RW6A 3QIOA 2FBVA 3VQ5A 4E0DA 3KLHA 4GVMA 4DU4A 1L3VA 1RDBA 1L5UA 2VWKA 1RT1A 3NAEA 1HYSA 3IG1A 4BE0A 4Z4EA 1NJYA 4CEZA 3LPUA 4DQSA 4Q0BA 1D5AA 2GBZA 3V4IA 2Q3SA 3PV8A 2B5JA 1WSGA 4B08A 3DRRA 3PX0A 1I3AA 1IO2A 5J2PA 3PY8A 4DTJA 4HVJA 2FBYA 3U6FA 1U47A 1KVAA 3NBPA 4GW6A 4HUEA 1VRUA 4B9TA 4B9VA 1FKPA 2GUIA 2YNIA 4QOZB 1HQUA 1C1BA 4EP5A 1EP4A 3AVNA 4KTWA 4RW4A 3HM9A 3IRXA 2A1RA 4CGGA 3ZT3A 1WSHA 2HMIA 2R7YA 4J2DA 1RCHA 3AVKA 4CGIA 4CJPA 1KFDA 2P1JA 1T8EA 4O4GA 3EZ5A 2OPRA 5J2MA 1RTIA 3DLEA 3OYMA 2OA8A 3HO1A 3HK2A 4C8LA 3TI0A 3OYJA 3AO5A 1NJWA 2QKKA 1NK8A 3CYMA 2VG7A 3QIPA 4CJSA 3PO5A 4DQIA 4L8RB 1WN7A 1JLAA 2F96A 4CJTA 4CGDA 4DTRA 2E6MA 3C95A 1CXUA 5CY4A 1XC9A 4FLXA 3ZT1A 2ZE2A 2GV9A 3O4NA 3V9WA 4KRFA 3HVTA 2KZMA 1I39A 3L2VA 1SL1A 3VQAA 3CQ8A 3VQ4A 1QSYA 3AVAA 4N47A 4Z4CA 3HL8A 5E41A 3NGIA 4CJ5A 3P5JA 1XHXA 2YKMA 3OYLA 2G8WA 5HRNA 4CJ4A 3LDSA 3CG7A 3AV9A 3O3FA 1QQCA 3TAGA 4DMNA 4K8XA 4FJNA 1VSIA 2B4JA 2IOCA 5CYMA 4FLYA 4ZTJA 4GMJB 4KAZA 4KHUA 3HP6A 4CHYA 4ELTA 4OLAA 1L3UA 2BDPA 1W9HA 4CCHA 4CJQA 4CF9A 4DTMA 3DMJA 2VWJA 5HLFA 1K6YA 1CLQA 1VSEA 4E3SA 3ZT2A 4DTNA 3AVGA 4CEEA 4OGCA 3O3GA 3LPTA 3MEGA 1SKSA 1B92A 3ISNC 4H8KA 5CZ1A 3DLKA 3ZSYA 1WSEA 4O5BA 4OPJA 4XIUA 3KLGA 3RTVA 4PWDA 5EU7A 3H08A 1REVA 2JLEA 4BDZA 1JKHA 3DLGA 3RR7A 4ZHRA 1DLOA 2FBTA 3OJUA 3K5MA 4FLWA 3LP2A 4AHRA 1BI4B 2HNZA 2Z1JA 4JRQA 3DRSA 3TAFA 3HJFA 1QHTA 3L2QA 2O4IA 4KREA 3PX4A 3HYFA 2I5JA 2XY6A 1WAJA 3SNNA 1LWFA 4CFBA 3AVMA 3LANA 1FK9A 3RMDA 1ITGA 4QCLA 1BIUA 4BWJA 1JLEA 3LP1A 1WSIA 4F3TA 1LV5A 1S1UA 5KRTA 4E7KA 2HW3A 1VRTA 1MU2A 4Z4GA 3WNHA 1CZBA 1HJRA 1YTAA 3O4QA 5DK5A 3PX6A 3DI6A 2Z1GA 5CYQA 4F8RA 3PO4A 5T7BA 1TVRA 1TKXA 4NCBA 4MFBA 1XHZA 1S9GA 4B9MA 1QE1A 1U04A 4B8AB 2DTUA 3V9ZA 4UQGA 3L3UA 4DTPA 2FC0A 3KD1E 4O55A 2VG5A 4ZTFA 1UAXA 3T19A 1SL2A 1HMVA 1N6QA 2YNFA 5HRSA 3KTQA 4KHWA 1RDDA 4M3XA 3DLRA 3SUNA 4LSNA 3RRGA 4EZ6A 4W5RA 1UA0A 1X9WA 4I9LA 3QINA 4CHQA 4FJ8A 1HNIA 3T1AA 4FM0A 3SUQA 4FLVA 1UWBA 2KQ2A 3VQCA 1J5OA 3OYDA 4C8MA 4FZZA 2G8VA 2WOMA 2VG6A 1RT3A 2G8HA 3K5OA 3NF7A 1GOBA 3ASMA 3HPHA 4KHQA 1G15A 1O1WA 2D0CA 3G0ZA 3ZT4A 2G8IA 3L2RA 1KTQA 1JLFA 1Q8IA 1S1WA 3HXMA 1NOZA 4F2RA 1ZBUA 4J2EA 5FDLA 3OYIA 4LH5A 3D45A 3ZSZA 3HT3A 1JLBA 3TANA 2HHSA 4B9NA 2DFHA 1BISA 2F8TA 4CHZA 3TAQA 1TAQA 1JLCA 2KW4A 4OKJA 3ZCMA 3K2PA 1Q9YA 4DS5A 4FJJA 5I42A 1SV5A 4E89A 4O44A 3OYBA 4M42A 3T3FA 3RRHA 4DG1A 1LAVA 3VQBA 4DF4A 1TKDA 1KSPA 4JS4A 4NYFA 2ETJA 1IKWA 3AO3A 4CECA 4CJWA 1VSMA 3SUOA 1TL3A 1BQNA 2OPSA 3MXJA 4HUGA 3KD5E 1Z25A 3F9KA 4CK1A 3C6UA 3OYGA 1D9FA 4FLTA 2AJQA 2X6SA 4FZYA 3HPOA 1HYVA 4PA1A 4M3RA 4HUFA 4QAGA 4DTUA 4J2AA 4DTOA 2DFEA 3HP9A 1U4BA 5HROA 3DYAA 4RW9A 3QNOA 1SKWA 4CFCA 3K58A 3TWHA 2G8FA 5FRMA 4Z4FA 3SJJA 4OKEA 2XY8A 4IKFA 1NJZA 1RDCA 2YHAA 3KKRA 3VQ7A 4HCCA 2HHXA 3K5NA 4AHCA 4KHNA 4CGFA 3VQEA 1IH7A 1FKOA 3OS0A 4ID5A 4FLZA 2XY7A 4CJLA 4DFMA 1RT2A 1BI4A 3NGZA 2HHVA 1X1PA 3NH2A 2Y1IA 4CEAA 3SQ4A 4KHSA 4RG8A 3V81A 4KTZA 4BDPA 1ASUA 2HHUA 3TARA 4CEBA 2NUBA 3V1OA 3UIQA 1EX4A 4M3ZA 3SQ1A 3RR8A 2KFNA 4N56A 4OKKA 1BIZA 3AVIA 2O4GA 4KHYA 1ZBFA 4PUOA 2JGUA 1RBTA 4JLHA 3BDPA 3AVJA 1NKBA 3SQ0A 4CFDA 4FK0A 1JLQA 1TKZA 3VQ6A 5FRNA 1RTHA 3HPGA 1NJXA 3ZSXA 5KTQA 5J1EA 3V9UA 2RPIA 2PYLA 1J9AA 1EXQA 5HRPA 4E1MA 4HCBA 1GOCA 3I0RA 3TR8A 4CESA 5C42A 1SKRA 3RMAA 1U49A 3AVCA 3VQDA 4E19A 3QNNA 5CZ2A 4F4KA 4W5NA 3S3NA 3OYFA 3SYZA 4CF1A 2YV0X 3MXMA 1N5YA 2HNYA 3K59A 4E7HA 5SWMA 4NCAA 3AVLA 1B9DA 5JS2A 1J54A 2W42A 3MEDA 3E01A 1D9DA 1WSFA 1IG9A 2ITGA 3KKSA 3LZIA 4ICLA 1HPZA 4M45A 4W5QA 3QEWA 1EKEA 1VSFA 4DU1A 2B6AA 3AO2A 4TSXA 2ZQBA 2WONA 4M41A 3C94A 1Z26A 3OYKA 2QK9A 4B9SA 4KB0A 4CJ3A 4Q5VA 3SI6A 1HRHA 1VSJA 3NHGA 3AA5X 3MXIA 4FW1A 4CJUA 4CHOA 4I9QA 3F73A 3U3GA 4DQPA 1JL2A 3IS9A 1RBSA 3L2WA 1BCOA 4FVMA 1JXEA 4B8CA 3K5LA 1A5XA 1ZYQA 3L3VA 1RDAA 4FJKA 4FJ9A 4CHPA 3ZSOA 4BDYA 4AHVA 4DSKA 2YNHA 3L2UA 4C8KA 4FLUA 1S1TA 4ID1A 1TV6A 5K14A 3KLFA 1RBUA 4CFAA 4CEOA 1R0AA 4FJMA 4PY5A 2HNDA 3OYHA 2KFZA 4IG0A 2D0BA 1TK8A 3V1QA 1DTTA 3S3OA 3DLHA 3OJSA 4BE2A 3P1GA 2RN2A 1QTMA 4N41A 2D5RA 4NCGA 5DMRA 3SPYA 4CJFA 4YNQA 2IGIA 3NDKA 1BGXT 2LSNA 2OPQA 4Z4HA 1C0TA 1KCFA 4YFUA 1D8YA 4M3WA 4M3YA 1RT6A 3LAKA 2HHQA 4KTQA 2IC3A 4EP4A 3S9HA 1X9MA 2BANA 4CEDA 3LALA 3SV4A 4OJRA 1S5JA 1YVUA 3KLIA 4CK3A 4IBNA 1KRPA 5SZTA 3S3MA 1RT4A 1KLMA 4W5TA 3SZ2A 3RMBA 3PUFA 2HVHA 1JXBA 3LZJA 1FXXA 3DRPA 3LAMA 1ZBLA 3ZSRA 3BGRA 2PY5A 4DTXA 1RTDA 1S6QA 3B6PA 2G8UA 3QETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATQ A;  2IDO A;  1TK5 A;  3RMC A;  4FJ5 A;  3LWM A;  4FCY A;  2EX3 A;  1NK9 A;  1U45 A;  4FM2 A;  4F2S A;  1C0M A;  1KFS A;  4FXD A;  2IAJ A;  4CIG A;  2RKI A;  3VN5 A;  3K57 A;  3LP0 A;  2FBX A;  3P83 D;  3V9X A;  1LWE A;  1RIL A;  2HVI A;  3NFA A;  2G8K A;  4H4O A;  1LW2 A;  1TL1 A;  1NOY A;  2YNG A;  4JRP A;  2P5G A;  4CGJ A;  3V6D A;  4KFB A;  1IKV A;  1S1V A;  3M8S A;  2XHB A;  3M8R A;  1LWC A;  4DSE A;  3THV A;  1L3S A;  1ZBH A;  4Z0U A;  2P51 A;  3KLE A;  4J2B A;  1VSL A;  4G1Q A;  1CZ9 A;  4WE1 A;  4W5O A;  3QEX A;  4O0I A;  3TAB A;  1GOA A;  3ALY A;  5KGX A;  4DSF A;  1UA1 A;  3NCI A;  5HRR A;  1WLJ A;  1HQE A;  3VA0 A;  4OVL A;  4CK2 A;  3I0S A;  5KI6 A;  1YT3 A;  4N5S A;  5JS1 A;  3EYZ A;  4LD0 A;  2Y1J A;  1UOC A;  4LH4 A;  2RF2 A;  3CM6 A;  1S6P A;  1C1C A;  2HB5 A;  3EY1 A;  2XRI A;  4IG3 A;  3NF6 A;  3QEP A;  1F21 A;  4FW2 A;  3VQ8 A;  4DFJ A;  3TAE A;  4B9L A;  3U3Y A;  1SUQ A;  2YHB A;  3I8D A;  1YTU A;  1XI1 A;  3SQ2 A;  2E6L A;  2X78 A;  5C24 A;  4PQU A;  5KRS A;  3NH1 A;  3TAM A;  3QO9 A;  4OPK A;  3QEV A;  1VK0 A;  4FM1 A;  1HYZ A;  4CJR A;  1CXQ A;  4BAC A;  5J2N A;  1RT7 A;  3AA4 A;  5D3G A;  3O3H A;  3DLB A;  1BL3 A;  4LY7 A;  3SCX A;  4C8N A;  3A2F A;  4AH9 A;  4FK2 A;  3KIO A;  3AO4 A;  3DM2 A;  2D0A A;  2A1S A;  3C6T A;  1NKC A;  1NK6 A;  2QKB A;  4DLE A;  1EET A;  1U48 A;  3V1R A;  3G10 A;  3QEI A;  4Z4I A;  1W0H A;  2BE2 A;  2QXF A;  3HVR A;  3B6O A;  3HST B;  4Y1D A;  4CEF A;  1SL0 A;  4KI6 A;  1Y97 A;  3AO1 A;  4IFY A;  1Q9X A;  3NH0 A;  1C1A A;  3CFP A;  3OS1 A;  1LAW A;  1VSH A;  4CF2 A;  1NK4 A;  4JS5 A;  2XY5 A;  5C25 A;  4DWI A;  3LP3 A;  4DU3 A;  4CJK A;  4CJE A;  1A5W A;  4FJX A;  3AA3 A;  2KTQ A;  2OZS A;  3OS2 A;  4FYD A;  3SPZ A;  1RNH A;  3MEC A;  4KV8 A;  1IKY A;  4BWM A;  3OYA A;  3LWL A;  4DS4 A;  1B9F A;  3CFO A;  3RWU A;  4KPY A;  4OLB A;  3QLH A;  3FFI A;  2DY4 A;  1BQM A;  4CIE A;  1TK0 A;  4M3U A;  3QES A;  1JL1 A;  3MAQ A;  4DFK A;  2IS3 A;  4DSJ A;  5HBM A;  2OZM A;  1TAU A;  4I2P A;  1RTJ A;  2KZZ A;  3AA2 A;  3VQP A;  3OYN A;  4FZX C;  1S9E A;  2P5O A;  1XWL A;  3AVF A;  4CEQ A;  4AHS A;  3KJV A;  1T05 A;  3NF9 A;  3OY9 A;  4OGE A;  2EHG A;  4E7L A;  1T7P A;  1WNS A;  1A5V A;  2BGG A;  4DTS A;  2X74 A;  3L8B A;  1TKT A;  1TGO A;  2OPP A;  3ZT0 A;  3KK2 A;  1VSD A;  4HHT A;  4B3O A;  1J53 A;  2ZD1 A;  3SUP A;  1ZBI A;  3AVB A;  5FRO A;  4DFP A;  2PZS A;  1QSS A;  4I2Q A;  1QSL A;  4B9U A;  1QS4 A;  4RW8 A;  3VA3 A;  4N76 A;  4MQ3 A;  1RBV A;  1ASW A;  1T03 A;  4F3O A;  1HNV A;  2DFF A;  3ITH A;  4DLG A;  2OYQ A;  4BE1 A;  3CM5 A;  2HHT A;  2F8S A;  4K8Z A;  3MEE A;  3NF8 A;  4H4M A;  3OYE A;  3WNE A;  3M8Q A;  3AVH A;  3TAP A;  2PYJ A;  4CF8 A;  4C8O A;  3IAY A;  3CFR A;  4FJ7 A;  4ELU A;  1X9S A;  3DOK A;  1KVC A;  3JYT A;  1IKX A;  4I7F A;  4LSL A;  4KKO A;  3JSM A;  1DTQ A;  1NK5 A;  1NK7 A;  4IDK A;  1KLN A;  2Z1H A;  3ZSQ A;  4NYN A;  4AIL C;  5I3U A;  4CIF A;  3DOL A;  4R5P A;  4FJH A;  4DQR A;  4Y1C A;  4AHT A;  4FK4 A;  3NGY A;  1C6V A;  1WSJ A;  4E7J A;  3VQ9 A;  1RT5 A;  4DSL A;  3M8P A;  4RW7 A;  4ELV A;  3ZSV A;  4EZ9 A;  3WNF A;  2HHW A;  1NK0 A;  4E1N A;  1KVB A;  1VSK A;  1RBR A;  4HTU A;  4CJV A;  5HP1 A;  2YKN A;  4AHU A;  3WNG A;  4CHN A;  5J2Q A;  1BHL A;  1C0U A;  3SV3 A;  4DSI A;  4FJI A;  2XO7 A;  3ULD A;  4O0J A;  2Z1I A;  3OYC A;  3NE6 A;  1BCM A;  4DF8 A;  3ZSW A;  1ASV A;  4CER A;  3KK1 A;  1WAF A;  4KI4 A;  1S1X A;  5KGW A;  4CE9 A;  3VQQ A;  3V9S A;  1LW0 A;  4FJG A;  4KB1 A;  1NKE A;  2E4L A;  4CGH A;  3OVN A;  4M3T A;  4KO0 A;  3D0P A;  4CF0 A;  1JLG A;  3KK3 A;  4FJL A;  1L3T A;  4IFV A;  2X6N A;  4E7I A;  4DQQ A;  3QER A;  4RW6 A;  3QIO A;  2FBV A;  3VQ5 A;  4E0D A;  3KLH A;  4GVM A;  4DU4 A;  1L3V A;  1RDB A;  1L5U A;  2VWK A;  1RT1 A;  3NAE A;  1HYS A;  3IG1 A;  4BE0 A;  4Z4E A;  1NJY A;  4CEZ A;  3LPU A;  4DQS A;  4Q0B A;  1D5A A;  2GBZ A;  3V4I A;  2Q3S A;  3PV8 A;  2B5J A;  1WSG A;  4B08 A;  3DRR A;  3PX0 A;  1I3A A;  1IO2 A;  5J2P A;  3PY8 A;  4DTJ A;  4HVJ A;  2FBY A;  3U6F A;  1U47 A;  1KVA A;  3NBP A;  4GW6 A;  4HUE A;  1VRU A;  4B9T A;  4B9V A;  1FKP A;  2GUI A;  2YNI A;  4QOZ B;  1HQU A;  1C1B A;  4EP5 A;  1EP4 A;  3AVN A;  4KTW A;  4RW4 A;  3HM9 A;  3IRX A;  2A1R A;  4CGG A;  3ZT3 A;  1WSH A;  2HMI A;  2R7Y A;  4J2D A;  1RCH A;  3AVK A;  4CGI A;  4CJP A;  1KFD A;  2P1J A;  1T8E A;  4O4G A;  3EZ5 A;  2OPR A;  5J2M A;  1RTI A;  3DLE A;  3OYM A;  2OA8 A;  3HO1 A;  3HK2 A;  4C8L A;  3TI0 A;  3OYJ A;  3AO5 A;  1NJW A;  2QKK A;  1NK8 A;  3CYM A;  2VG7 A;  3QIP A;  4CJS A;  3PO5 A;  4DQI A;  4L8R B;  1WN7 A;  1JLA A;  2F96 A;  4CJT A;  4CGD A;  4DTR A;  2E6M A;  3C95 A;  1CXU A;  5CY4 A;  1XC9 A;  4FLX A;  3ZT1 A;  2ZE2 A;  2GV9 A;  3O4N A;  3V9W A;  4KRF A;  3HVT A;  2KZM A;  1I39 A;  3L2V A;  1SL1 A;  3VQA A;  3CQ8 A;  3VQ4 A;  1QSY A;  3AVA A;  4N47 A;  4Z4C A;  3HL8 A;  5E41 A;  3NGI A;  4CJ5 A;  3P5J A;  1XHX A;  2YKM A;  3OYL A;  2G8W A;  5HRN A;  4CJ4 A;  3LDS A;  3CG7 A;  3AV9 A;  3O3F A;  1QQC A;  3TAG A;  4DMN A;  4K8X A;  4FJN A;  1VSI A;  2B4J A;  2IOC A;  5CYM A;  4FLY A;  4ZTJ A;  4GMJ B;  4KAZ A;  4KHU A;  3HP6 A;  4CHY A;  4ELT A;  4OLA A;  1L3U A;  2BDP A;  1W9H A;  4CCH A;  4CJQ A;  4CF9 A;  4DTM A;  3DMJ A;  2VWJ A;  5HLF A;  1K6Y A;  1CLQ A;  1VSE A;  4E3S A;  3ZT2 A;  4DTN A;  3AVG A;  4CEE A;  4OGC A;  3O3G A;  3LPT A;  3MEG A;  1SKS A;  1B92 A;  3ISN C;  4H8K A;  5CZ1 A;  3DLK A;  3ZSY A;  1WSE A;  4O5B A;  4OPJ A;  4XIU A;  3KLG A;  3RTV A;  4PWD A;  5EU7 A;  3H08 A;  1REV A;  2JLE A;  4BDZ A;  1JKH A;  3DLG A;  3RR7 A;  4ZHR A;  1DLO A;  2FBT A;  3OJU A;  3K5M A;  4FLW A;  3LP2 A;  4AHR A;  1BI4 B;  2HNZ A;  2Z1J A;  4JRQ A;  3DRS A;  3TAF A;  3HJF A;  1QHT A;  3L2Q A;  2O4I A;  4KRE A;  3PX4 A;  3HYF A;  2I5J A;  2XY6 A;  1WAJ A;  3SNN A;  1LWF A;  4CFB A;  3AVM A;  3LAN A;  1FK9 A;  3RMD A;  1ITG A;  4QCL A;  1BIU A;  4BWJ A;  1JLE A;  3LP1 A;  1WSI A;  4F3T A;  1LV5 A;  1S1U A;  5KRT A;  4E7K A;  2HW3 A;  1VRT A;  1MU2 A;  4Z4G A;  3WNH A;  1CZB A;  1HJR A;  1YTA A;  3O4Q A;  5DK5 A;  3PX6 A;  3DI6 A;  2Z1G A;  5CYQ A;  4F8R A;  3PO4 A;  5T7B A;  1TVR A;  1TKX A;  4NCB A;  4MFB A;  1XHZ A;  1S9G A;  4B9M A;  1QE1 A;  1U04 A;  4B8A B;  2DTU A;  3V9Z A;  4UQG A;  3L3U A;  4DTP A;  2FC0 A;  3KD1 E;  4O55 A;  2VG5 A;  4ZTF A;  1UAX A;  3T19 A;  1SL2 A;  1HMV A;  1N6Q A;  2YNF A;  5HRS A;  3KTQ A;  4KHW A;  1RDD A;  4M3X A;  3DLR A;  3SUN A;  4LSN A;  3RRG A;  4EZ6 A;  4W5R A;  1UA0 A;  1X9W A;  4I9L A;  3QIN A;  4CHQ A;  4FJ8 A;  1HNI A;  3T1A A;  4FM0 A;  3SUQ A;  4FLV A;  1UWB A;  2KQ2 A;  3VQC A;  1J5O A;  3OYD A;  4C8M A;  4FZZ A;  2G8V A;  2WOM A;  2VG6 A;  1RT3 A;  2G8H A;  3K5O A;  3NF7 A;  1GOB A;  3ASM A;  3HPH A;  4KHQ A;  1G15 A;  1O1W A;  2D0C A;  3G0Z A;  3ZT4 A;  2G8I A;  3L2R A;  1KTQ A;  1JLF A;  1Q8I A;  1S1W A;  3HXM A;  1NOZ A;  4F2R A;  1ZBU A;  4J2E A;  5FDL A;  3OYI A;  4LH5 A;  3D45 A;  3ZSZ A;  3HT3 A;  1JLB A;  3TAN A;  2HHS A;  4B9N A;  2DFH A;  1BIS A;  2F8T A;  4CHZ A;  3TAQ A;  1TAQ A;  1JLC A;  2KW4 A;  4OKJ A;  3ZCM A;  3K2P A;  1Q9Y A;  4DS5 A;  4FJJ A;  5I42 A;  1SV5 A;  4E89 A;  4O44 A;  3OYB A;  4M42 A;  3T3F A;  3RRH A;  4DG1 A;  1LAV A;  3VQB A;  4DF4 A;  1TKD A;  1KSP A;  4JS4 A;  4NYF A;  2ETJ A;  1IKW A;  3AO3 A;  4CEC A;  4CJW A;  1VSM A;  3SUO A;  1TL3 A;  1BQN A;  2OPS A;  3MXJ A;  4HUG A;  3KD5 E;  1Z25 A;  3F9K A;  4CK1 A;  3C6U A;  3OYG A;  1D9F A;  4FLT A;  2AJQ A;  2X6S A;  4FZY A;  3HPO A;  1HYV A;  4PA1 A;  4M3R A;  4HUF A;  4QAG A;  4DTU A;  4J2A A;  4DTO A;  2DFE A;  3HP9 A;  1U4B A;  5HRO A;  3DYA A;  4RW9 A;  3QNO A;  1SKW A;  4CFC A;  3K58 A;  3TWH A;  2G8F A;  5FRM A;  4Z4F A;  3SJJ A;  4OKE A;  2XY8 A;  4IKF A;  1NJZ A;  1RDC A;  2YHA A;  3KKR A;  3VQ7 A;  4HCC A;  2HHX A;  3K5N A;  4AHC A;  4KHN A;  4CGF A;  3VQE A;  1IH7 A;  1FKO A;  3OS0 A;  4ID5 A;  4FLZ A;  2XY7 A;  4CJL A;  4DFM A;  1RT2 A;  1BI4 A;  3NGZ A;  2HHV A;  1X1P A;  3NH2 A;  2Y1I A;  4CEA A;  3SQ4 A;  4KHS A;  4RG8 A;  3V81 A;  4KTZ A;  4BDP A;  1ASU A;  2HHU A;  3TAR A;  4CEB A;  2NUB A;  3V1O A;  3UIQ A;  1EX4 A;  4M3Z A;  3SQ1 A;  3RR8 A;  2KFN A;  4N56 A;  4OKK A;  1BIZ A;  3AVI A;  2O4G A;  4KHY A;  1ZBF A;  4PUO A;  2JGU A;  1RBT A;  4JLH A;  3BDP A;  3AVJ A;  1NKB A;  3SQ0 A;  4CFD A;  4FK0 A;  1JLQ A;  1TKZ A;  3VQ6 A;  5FRN A;  1RTH A;  3HPG A;  1NJX A;  3ZSX A;  5KTQ A;  5J1E A;  3V9U A;  2RPI A;  2PYL A;  1J9A A;  1EXQ A;  5HRP A;  4E1M A;  4HCB A;  1GOC A;  3I0R A;  3TR8 A;  4CES A;  5C42 A;  1SKR A;  3RMA A;  1U49 A;  3AVC A;  3VQD A;  4E19 A;  3QNN A;  5CZ2 A;  4F4K A;  4W5N A;  3S3N A;  3OYF A;  3SYZ A;  4CF1 A;  2YV0 X;  3MXM A;  1N5Y A;  2HNY A;  3K59 A;  4E7H A;  5SWM A;  4NCA A;  3AVL A;  1B9D A;  5JS2 A;  1J54 A;  2W42 A;  3MED A;  3E01 A;  1D9D A;  1WSF A;  1IG9 A;  2ITG A;  3KKS A;  3LZI A;  4ICL A;  1HPZ A;  4M45 A;  4W5Q A;  3QEW A;  1EKE A;  1VSF A;  4DU1 A;  2B6A A;  3AO2 A;  4TSX A;  2ZQB A;  2WON A;  4M41 A;  3C94 A;  1Z26 A;  3OYK A;  2QK9 A;  4B9S A;  4KB0 A;  4CJ3 A;  4Q5V A;  3SI6 A;  1HRH A;  1VSJ A;  3NHG A;  3AA5 X;  3MXI A;  4FW1 A;  4CJU A;  4CHO A;  4I9Q A;  3F73 A;  3U3G A;  4DQP A;  1JL2 A;  3IS9 A;  1RBS A;  3L2W A;  1BCO A;  4FVM A;  1JXE A;  4B8C A;  3K5L A;  1A5X A;  1ZYQ A;  3L3V A;  1RDA A;  4FJK A;  4FJ9 A;  4CHP A;  3ZSO A;  4BDY A;  4AHV A;  4DSK A;  2YNH A;  3L2U A;  4C8K A;  4FLU A;  1S1T A;  4ID1 A;  1TV6 A;  5K14 A;  3KLF A;  1RBU A;  4CFA A;  4CEO A;  1R0A A;  4FJM A;  4PY5 A;  2HND A;  3OYH A;  2KFZ A;  4IG0 A;  2D0B A;  1TK8 A;  3V1Q A;  1DTT A;  3S3O A;  3DLH A;  3OJS A;  4BE2 A;  3P1G A;  2RN2 A;  1QTM A;  4N41 A;  2D5R A;  4NCG A;  5DMR A;  3SPY A;  4CJF A;  4YNQ A;  2IGI A;  3NDK A;  1BGX T;  2LSN A;  2OPQ A;  4Z4H A;  1C0T A;  1KCF A;  4YFU A;  1D8Y A;  4M3W A;  4M3Y A;  1RT6 A;  3LAK A;  2HHQ A;  4KTQ A;  2IC3 A;  4EP4 A;  3S9H A;  1X9M A;  2BAN A;  4CED A;  3LAL A;  3SV4 A;  4OJR A;  1S5J A;  1YVU A;  3KLI A;  4CK3 A;  4IBN A;  1KRP A;  5SZT A;  3S3M A;  1RT4 A;  1KLM A;  4W5T A;  3SZ2 A;  3RMB A;  3PUF A;  2HVH A;  1JXB A;  3LZJ A;  1FXX A;  3DRP A;  3LAM A;  1ZBL A;  3ZSR A;  3BGR A;  2PY5 A;  4DTX A;  1RTD A;  1S6Q A;  3B6P A;  2G8U A;  3QET A; 
#chains in the Genus database with same CATH topology
 1TK5 A;  4JYA K;  4DUZ K;  3RMC A;  1SS6 A;  4B1W B;  1WBD A;  4YOX A;  5LY3 A;  3R9P A;  3SLC A;  2IAJ A;  2RKI A;  3VN5 A;  3LP0 A;  2QWQ A;  3HOS A;  3OBW A;  3P83 D;  4HTL A;  2OTL N;  1NGI A;  4EAH D;  3ENH A;  2HVI A;  3ENO A;  4JRP A;  4CGJ A;  3CCR N;  4Y0W A;  3M8R A;  3HBT A;  1ZBH A;  3ZX2 A;  4WE1 A;  3QEX A;  1CZ9 A;  3TAB A;  5KGX A;  5EY4 A;  1UA1 A;  2A6A A;  1HQE A;  3I0S A;  5KI6 A;  1YT3 A;  3F2K A;  1M90 O;  5JS1 A;  4LH4 A;  3VEX A;  3OBY A;  3NF6 A;  1NNE A;  2NRX A;  3U3Y A;  1IG8 A;  2YHB A;  4PQU A;  5KRS A;  3NH1 A;  3TAM A;  3TTC A;  4B1U B;  2JWL A;  4YOY A;  3A2F A;  1NKC A;  3G10 A;  3HVR A;  3VF6 A;  3AO1 A;  3MDQ A;  1C1A A;  3OS1 A;  4CF2 A;  3CHW A;  5FPM A;  5C25 A;  4DWI A;  4LF7 K;  4DU3 A;  2QXL A;  1QQO A;  4F9O A;  4BRH A;  5I9E B;  1A5W A;  2GEM A;  4JI2 K;  3MEC A;  4KV8 A;  4BWM A;  5BRD A;  4BR5 A;  2ZM6 K;  4KPY A;  3WXI A;  1BQM A;  4CIE A;  5AFU A;  3QES A;  4GKJ K;  4DFK A;  4H5W A;  5HL7 L;  4LF6 K;  4I2P A;  1QZ5 A;  3OYN A;  1XWL A;  3AVF A;  3LDL A;  4CEQ A;  1T05 A;  3OY9 A;  4IZ9 A;  4E7L A;  1A5V A;  4DTS A;  2X74 A;  4HHT A;  3RVC A;  5LMU K;  1J53 A;  2O8D A;  2V52 B;  2ZD1 A;  3SUP A;  1ZBI A;  3AVB A;  4KH5 A;  4N76 A;  4B9U A;  4MQ3 A;  3C0B A;  4F3O A;  4BE1 A;  4CJ7 A;  4WF9 L;  4H4M A;  4X66 K;  3TAP A;  1SAZ A;  1S3X A;  4CF8 A;  4C8O A;  4YDU A;  1GLA G;  3UKR B;  3VPZ A;  3JSM A;  1NK7 A;  2CH6 A;  3FZH A;  4R5P A;  5EXW A;  4PHT X;  4FK4 A;  3A5O C;  4JKA A;  2HHH K;  4DR2 K;  3DLL L;  4ELV A;  4BGA A;  3JXU A;  1VSK A;  1RBR A;  3B8A X;  4CJV A;  5J2Q A;  2IVN A;  2E1Y A;  4DSI A;  4O0J A;  3NE6 A;  3CC7 N;  3WT0 A;  3ZSW A;  3AY9 A;  5AQO A;  3PSF A;  1Q82 O;  5ADX A;  2Q0U A;  4FPA A;  5KGW A;  1HPM A;  3V9S A;  4FJG A;  4CGH A;  4M3T A;  5BPM A;  4A2A A;  2X6N A;  4IJA A;  2I7N A;  4GY2 B;  1RDB A;  2VWK A;  4BE0 A;  1NJY A;  3LPU A;  4DQS A;  1D5A A;  5H1S Q;  1ATN A;  4B08 A;  3T1H K;  4DTJ A;  3U6F A;  3MN6 A;  1KVA A;  3SAF A;  4B9V A;  2GUI A;  2UU9 K;  4QOZ B;  5DM7 L;  4EP5 A;  3E9P A;  4KTW A;  1DT9 A;  5AQM A;  3IRX A;  3KWI A;  3ZT3 A;  3ATU A;  3H3O B;  3AVK A;  4O4G A;  3OYM A;  3HO1 A;  3ULE A;  2E8A A;  3OYJ A;  3AO5 A;  3O5B A;  2QKK A;  5JVG L;  4IDH A;  4CJS A;  3PO5 A;  4DQI A;  4L8R B;  2P9P A;  1JLA A;  2D1K A;  4M7Y A;  3C95 A;  5CY4 A;  3ZT1 A;  2GV9 A;  2KZM A;  3VQA A;  4B1Z A;  3WXM B;  2NRV A;  4CJ5 A;  3P5J A;  5CE3 A;  2YKM A;  3I55 N;  3LDS A;  3AV9 A;  3ENB A;  4K8X A;  1BU6 O;  3TPQ A;  2O8C A;  5BPN A;  4BVP A;  2BDP A;  4DUY K;  1W9H A;  4CCH A;  4DTM A;  1VQ6 N;  2VWJ A;  1VSE A;  4E3S A;  3MCA B;  3C7N A;  4CEE A;  4H8K A;  3ISN C;  1BA0 A;  4OPJ A;  1G99 A;  5E26 A;  3H08 A;  1REV A;  5EU7 A;  4BDZ A;  3LDP A;  3K5M A;  3TAF A;  3VF4 A;  4AHR A;  2Z1J A;  1YIT N;  4BC4 A;  2GEL A;  3J8A A;  4NO7 A;  1KXP A;  1QVF M;  3VGL A;  3A5L C;  4RCH A;  1WSI A;  5GAD P;  2P9N A;  2KHO A;  1CZB A;  1YTA A;  1GLB G;  3DI6 A;  2O8E A;  3T69 A;  3WQT A;  1TKX A;  2BH1 A;  4FSV A;  1YJN N;  4B9M A;  3FZF A;  3AAR A;  3J80 O;  3OHR A;  3T19 A;  4JI5 K;  1N34 K;  3I33 A;  1N6Q A;  2YNF A;  2UUA K;  4KHW A;  3ID8 A;  3DLR A;  3RRG A;  3PLA A;  4EZ6 A;  2P9K A;  4W5R A;  4FJ8 A;  2E2Q A;  4FO0 A;  1HNI A;  3UKU B;  2GTD A;  1DGK N;  5AQP A;  4FLV A;  1UWB A;  2I7P A;  1J5O A;  1WOQ A;  2G8V A;  4C1N I;  3CJ1 A;  2G8H A;  3ZT4 A;  3P4I A;  1JLF A;  1NGD A;  1Q8I A;  3HTV A;  1NOZ A;  1ZBU A;  5FDL A;  1HX1 A;  3HT3 A;  2ZWH A;  3TAN A;  4MO5 A;  2HHS A;  3TAQ A;  1D4X A;  1JLC A;  4OKJ A;  5I42 A;  4JKF A;  3A8Y A;  4E89 A;  2DPN A;  1K9M O;  4M42 A;  4DR7 K;  3KVG A;  4JKD A;  2W6K A;  3SAG A;  2V51 B;  2F4V K;  2V7Z A;  3AO3 A;  4DHY A;  3SUO A;  3W0L A;  1TL3 A;  4HUG A;  4PKG A;  2AJQ A;  4DTU A;  4JKC A;  5HRO A;  3DYA A;  4IJN A;  4RW9 A;  3K58 A;  2G8F A;  3DWL A;  4Z4F A;  3SJJ A;  4M7X A;  3E9L A;  5F1X A;  4KHN A;  3OS0 A;  2XY7 A;  4DFM A;  2HHV A;  4KTZ A;  3TAR A;  3L6Q A;  4M3Z A;  4C23 A;  3CJA A;  3EKS A;  1EWQ A;  4YDU C;  1HLU A;  4FWS A;  2JGU A;  4FWP A;  4BRI A;  3BDP A;  1NKB A;  1KC8 O;  1IV0 A;  1NLV A;  2VYP A;  4ISE A;  2WTU A;  1VQ7 N;  4G9Z A;  1NBW A;  1OVQ A;  1RTH A;  2FXU A;  4PL7 A;  1NJX A;  2RPI A;  2PYL A;  1J9A A;  5HRP A;  2BTF A;  1SKR A;  4BRA A;  2OAN A;  4GKK K;  5CZ2 A;  4F4K A;  4W5N A;  4CZK A;  3S3N A;  2D0P A;  3K59 A;  4E7H A;  1B9D A;  4DV1 K;  4J8F A;  1N33 K;  2FSK A;  4KH6 A;  5JMV A;  3KKS A;  3PIP L;  3H1V X;  3LZI A;  4A61 A;  4ICL A;  1HPZ A;  4U67 L;  4W5Q A;  5AQT A;  3QEW A;  4CZE A;  3AO2 A;  3VTH A;  1Z26 A;  1Y64 A;  3MK6 A;  4B9S A;  3SI6 A;  3MXI A;  3AA5 X;  3O1B A;  4I9Q A;  3MN7 A;  4DV6 K;  5AQW A;  3IS9 A;  1BCO A;  5TKW A;  2UXD K;  1ZYQ A;  5BRH A;  4H0P A;  1RDA A;  4FOI A;  4FJ9 A;  3ZET B;  4DSK A;  5AJ3 K;  2YNH A;  3L2U A;  1S1T A;  4YOU A;  1GLL O;  4CFA A;  3OYH A;  4IG0 A;  4GNI A;  3K0S A;  4BE2 A;  4N41 A;  2FF6 A;  1HR0 K;  3SPY A;  1R59 O;  3SJH A;  3M3Z A;  3NDK A;  2LSN A;  1C0T A;  4YFU A;  2HHQ A;  4KTQ A;  3CIP A;  4DV4 K;  4EP4 A;  4JI4 K;  3VER A;  4JNE A;  3LAL A;  3WXL A;  4EFH A;  4JKE A;  1KRP A;  3S3M A;  1KLM A;  3DXK A;  1YHQ N;  3ZSR A;  1MA9 B;  4BRN A;  1X9W A;  1RDW X;  2ATQ A;  4I6M A;  3NVK A;  4FJ5 A;  3CCL N;  1U45 A;  1KFS A;  2H3G X;  1BDG A;  4C1N K;  3K57 A;  1N32 K;  2IIR A;  2ZJQ L;  3O08 A;  5BR9 A;  1RIL A;  4AQY K;  3NFA A;  1LW2 A;  1NOY A;  4EHT A;  2P5G A;  1HJO A;  1IKV A;  4KFB A;  1LWC A;  3RSE A;  3THV A;  3K9K A;  3T1Y K;  4K42 A;  2P51 A;  3MN5 A;  3QFU A;  4G1Q A;  3CJ7 A;  1GOA A;  4H5R A;  1WLJ A;  1VHX A;  1BUP A;  1NJI O;  3EYZ A;  4LD0 A;  3CM6 A;  2ASP A;  3EY1 A;  2YHX A;  4NXN K;  3TAE A;  3FLC O;  1ESV A;  1SUQ A;  1YTU A;  1XI1 A;  2E6L A;  2X78 A;  1VQM N;  3QO9 A;  4QS7 A;  1HYZ A;  4CJR A;  4JHD B;  4BAC A;  5J2N A;  3AA4 A;  4LF8 K;  3O3H A;  4LY7 A;  2BUP A;  4C8N A;  3KIO A;  2E20 A;  3AO4 A;  3HOT A;  1EET A;  3U9D A;  4JV5 K;  1W0H A;  1VQ9 N;  3HST B;  4Y1D A;  3MX5 A;  4KI6 A;  1Y97 A;  4IFY A;  4DR1 K;  2NLX A;  2P9S B;  4JS5 A;  4BC2 A;  4CJK A;  4CJE A;  1YJ9 N;  5JLF A;  3G6E N;  3AA3 A;  4FWO A;  2OZS A;  4JK9 A;  3SPZ A;  5LJW A;  1RNH A;  3EE8 A;  4NXM K;  1IKY A;  3OYA A;  4DS4 A;  3BP8 A;  1B9F A;  1U2V B;  3OTO K;  1JJ2 M;  1IBL K;  2IS3 A;  3AA2 A;  3VQP A;  2NZT A;  2P5O A;  1Q86 O;  1GLF O;  4DR3 K;  3O9T A;  4AHS A;  3G4S N;  1WNS A;  3L8B A;  1TKT A;  2OPP A;  4XH5 A;  3CPW M;  4DV2 K;  4WFA L;  2HBM A;  5AQR A;  4DFP A;  2PZS A;  3Q7B A;  4I2Q A;  4JKG B;  3GL1 A;  4RW8 A;  1T03 A;  3CM5 A;  3CFR A;  1X9S A;  2GX9 A;  3JYT A;  1IKX A;  1NG9 A;  3VEY A;  4IDK A;  2Z1H A;  1E3M A;  4AIL C;  1KD1 O;  3FE1 A;  4Y1C A;  4AHT A;  3EZW A;  4QS9 A;  5AQU A;  3R8E A;  1RT5 A;  4DSL A;  3M8P A;  3A0I X;  4MO4 A;  5AZI B;  3ZSV A;  3WNF A;  1NK0 A;  1BHL A;  1C0U A;  3SV3 A;  2XO7 A;  4L3Q A;  4DF8 A;  2Q0R A;  2ZF5 O;  1ASV A;  3KK1 A;  1IJJ A;  4V19 S;  1S1X A;  4CE9 A;  1LW0 A;  5FPD A;  1NKE A;  2E4L A;  3OVN A;  4JI0 K;  3DXM B;  4H5T A;  4CF0 A;  5C2D A;  2P9I B;  3KK3 A;  4FJL A;  3VOV A;  1L3T A;  4DQQ A;  4RW6 A;  3QIO A;  3VQ5 A;  3VTI A;  4GVM A;  5BRE A;  4DU4 A;  1GLE G;  2D4W A;  1L5U A;  3DAW A;  3NAE A;  3O4W A;  3FZL A;  5M1K A;  1WSG A;  3DRR A;  1I3A A;  5J2P A;  4LF4 K;  2O8F A;  2ZGZ A;  1DEJ A;  3NBP A;  1YAG A;  1E4F T;  4GW6 A;  1VRU A;  1HQU A;  1C1B A;  1CZA N;  4RW4 A;  3HM9 A;  5IWA K;  5HOO A;  3R1X A;  2R7Y A;  4J2D A;  1RCH A;  4CGI A;  4CJP A;  2P1J A;  3D7E O;  4C8L A;  5JIC A;  3E66 A;  3A5M C;  3CYM A;  2P9L A;  3QDK A;  2F96 A;  1P8Z A;  4CJT A;  2E6M A;  1CXU A;  3QBX A;  1VQ5 N;  3ZLJ A;  3O4N A;  4H5N A;  3HVT A;  3VEV A;  3O1W A;  1I39 A;  1SL1 A;  3CQ8 A;  4N47 A;  2VGN A;  3HL8 A;  5E41 A;  3NGI A;  3UKR A;  1WUA A;  3N4P A;  2IOC A;  4ZTJ A;  4KAZ A;  5M1N A;  2O8F B;  3H6E A;  1K8K A;  2HF4 A;  3OA9 A;  4CZM A;  1NGB A;  5BR8 K;  4YOV A;  1CLQ A;  4BG9 A;  4DTN A;  5JLH A;  4K43 A;  4OGC A;  3MEG A;  3DLK A;  1ATR A;  3ZSY A;  3KLG A;  2GWK A;  1JKH A;  3DLG A;  3CCV N;  2P9L B;  2FBT A;  1BI4 B;  2HNZ A;  5FPE A;  2O4I A;  3DRS A;  1QHT A;  2YI1 A;  4CFB A;  5AQZ A;  4LFC K;  3RMD A;  4QCL A;  1QVG M;  1JLE A;  3W3D A;  1S1U A;  1MU2 A;  4JEP A;  4Z4G A;  1HJR A;  2Z1G A;  4H5V A;  5CYQ A;  5T7B A;  4NCB A;  1YUW A;  4MFB A;  1S9G A;  5AQF A;  1QE1 A;  4OPA A;  3V9Z A;  1K8K B;  2VG5 A;  1SL2 A;  3FGU A;  3KTQ A;  3SUN A;  4LSN A;  4BQL A;  5BPL A;  4A5A A;  1UA0 A;  2VQF K;  4I9L A;  4CI6 A;  4CHQ A;  1S22 A;  3SUQ A;  3LDN A;  3CER A;  3MCP A;  1W2B M;  3CET A;  2VG6 A;  4DV0 K;  4Z94 A;  3NF7 A;  1GOB A;  4K0K K;  3HPH A;  2ASO A;  4KHQ A;  1O1W A;  3P38 A;  2G8I A;  1KTQ A;  1HNZ K;  3M5R A;  3TU5 A;  1X9J A;  2UXB K;  3OYI A;  4ISG A;  1NMN A;  1VQO N;  3I56 N;  1NGC A;  2CGJ A;  2F8T A;  3ZCM A;  2KW4 A;  4JK8 A;  3K2P A;  4DS5 A;  3BZK A;  2KKZ A;  4FJJ A;  3A5N C;  1FW6 A;  1SV5 A;  3R3L A;  4B3M K;  3T3F A;  3RRH A;  5ELZ A;  4DG1 A;  1GLD G;  3VQB A;  1TKD A;  3UB5 A;  2ETJ A;  1IKW A;  5BN9 A;  3D6R A;  4CEC A;  1VSM A;  4JKH A;  3IFR A;  3KD5 E;  1HYV A;  4PA1 A;  4M3R A;  4DTO A;  2HMP A;  4CZF A;  1SKW A;  3QNO A;  3VEO A;  4IO8 A;  4FWQ A;  1NJZ A;  2Q1N A;  3KKR A;  4A5B A;  2HHX A;  4EHU A;  3VQE A;  4CJL A;  1T44 A;  1X1P A;  4RG8 A;  4BDP A;  2A41 A;  4H0Y B;  4CEB A;  5AZJ B;  3SQ1 A;  1SZ2 A;  4OKK A;  3T7Z A;  3M6G A;  2HBJ A;  5M1O A;  4DR4 K;  4YY3 K;  3P31 A;  4KHY A;  4JI6 K;  1RBT A;  3ZEU B;  1Q18 A;  4FK0 A;  3HPG A;  5KTQ A;  1EXQ A;  4E1M A;  4CBW A;  1KAZ A;  3RMA A;  3VQD A;  3O9S A;  3OYF A;  4HWI A;  2YV0 X;  2E88 A;  3MWT A;  2QWM A;  5SWM A;  4BVO A;  3UKU A;  2FSN A;  5JS2 A;  2W42 A;  3LDQ A;  3O8M A;  4IOA L;  4M45 A;  3ATV A;  3QNN A;  4DU1 A;  4M41 A;  2B6A A;  1GLC G;  2ZQB A;  2ASM A;  4IFE A;  3OYK A;  4KB0 A;  2QI2 A;  3NHG A;  4CHO A;  4DQP A;  1TYQ A;  1JL2 A;  1JCF A;  3CJB A;  3D2F B;  1RBS A;  4FWM A;  3BF1 A;  4FVM A;  3O6W A;  4FJK A;  4ISF A;  3ZSO A;  5K14 A;  3KLF A;  2D0B A;  1TK8 A;  5C2F A;  5AQI A;  1Z6R A;  2RN2 A;  2VGM A;  5DMR A;  4CJF A;  3BY5 A;  4Z4H A;  4M3Y A;  1C0G A;  1RT6 A;  3LAK A;  4BRF A;  1NGA A;  1XQS C;  3WEE A;  1W97 L;  4CVN E;  4OJR A;  3KLI A;  4IBN A;  4AF1 A;  3RMB A;  1I94 K;  3LZJ A;  1TYQ B;  1VQN N;  2IDO A;  4A62 A;  5AQV A;  3LWM A;  2YJE A;  4BG8 A;  3BF3 A;  2EX3 A;  3CC4 N;  4FM2 A;  1C0M A;  4CIG A;  4YHH K;  4JI8 K;  2FBX A;  3V9X A;  3GE1 A;  4MDB A;  2G8K A;  1TL1 A;  4K25 A;  2PFU A;  2YNG A;  2O8B B;  1KAX A;  3V6D A;  1S1V A;  2XHB A;  1T3V A;  1L3S A;  5BN8 A;  4Z0U A;  4DB3 A;  5MLC Q;  3KLE A;  3WEE B;  1VSL A;  3J81 O;  4O0I A;  5IT9 O;  3NCI A;  1EWR A;  3VA0 A;  4OVL A;  1IBM K;  3O80 A;  1QQN A;  2Y1J A;  1MDU B;  1S6P A;  2HB5 A;  2J4R A;  4IG3 A;  1ZC6 A;  3G71 N;  3VQ8 A;  4DFJ A;  4B9L A;  3SQ2 A;  2FF3 B;  3LDO A;  4A57 A;  5GAG P;  3QEV A;  2E2N A;  4FM1 A;  2HST A;  4IXC A;  3OW2 M;  1CXQ A;  3QBW A;  1RT7 A;  3QFP A;  2HF3 A;  3SCX A;  1YF5 L;  1ZBS A;  3DM2 A;  2D0A A;  3C6T A;  3ZET A;  3O9R A;  2UUB K;  4Z4I A;  3IMX A;  3S41 A;  2BE2 A;  4LF5 K;  1Q9X A;  2QM1 A;  3P39 A;  1LAW A;  1VSH A;  4PKI A;  3LP3 A;  3TTF A;  2QWR A;  4FJX A;  3CXC M;  3OS2 A;  4O8K A;  3SAH A;  3QIC A;  3QLH A;  2DY4 A;  4M3U A;  1JL1 A;  3MAQ A;  4DSJ A;  2AA4 A;  5HBM A;  4QS8 A;  2UYT A;  4R79 A;  1TAU A;  2KZZ A;  1RTJ A;  5GAE P;  2WUS A;  3M1F A;  4FZX C;  1S9E A;  3KJV A;  3Q7C A;  1T7P A;  3ZT0 A;  3KK2 A;  4X65 K;  3LL3 A;  3SBT A;  1OH7 A;  5FRO A;  4K41 A;  2PAV A;  1QSS A;  3PSI A;  1QSL A;  3VA3 A;  1RBV A;  1HNV A;  1VQ8 N;  4DLG A;  5AQJ A;  5AQY A;  4WQ4 A;  2HHT A;  5LL6 Z;  3FFK B;  3MX2 A;  3N4Q A;  4K8Z A;  3MEE A;  3OYE A;  3WNE A;  3M8Q A;  3AVH A;  2PYJ A;  1RFQ A;  3IAY A;  4FJ7 A;  4UY8 O;  3DOK A;  2WBN A;  4I7F A;  4CZH A;  1DTQ A;  1NK5 A;  4FWR A;  1KLN A;  5F2R A;  5AFU H;  4FJH A;  4DR5 K;  3THY B;  2WFB A;  3CQY A;  1C6V A;  4B1X B;  3VQ9 A;  4U7B A;  1NGF A;  1XMO K;  2HHW A;  3J7Z O;  4E1N A;  1KVB A;  4WQ5 C;  5HP1 A;  4XEI A;  4FJI A;  3ULD A;  3OYC A;  4CZG A;  3WXJ A;  2VQE K;  4CER A;  4JHD A;  4E1J A;  2Q97 A;  4KB1 A;  2NRT A;  2ZJR L;  2P9U A;  1HUX A;  1OH8 A;  2FBV A;  3AAP A;  3KLH A;  1HKC A;  4X64 K;  2P9S A;  1VQL N;  3E9O A;  1RT1 A;  5AR0 A;  3PV8 A;  5GIP A;  2B5J A;  1IO2 A;  3PY8 A;  1U2V A;  2FBY A;  4HVJ A;  1U47 A;  4DQ8 A;  4B9T A;  1EO1 A;  1FKP A;  2YNI A;  5CHI A;  1EP4 A;  3AVN A;  4FPB A;  3NMU A;  4CGG A;  1KAY A;  4JD2 B;  2OPR A;  3DLE A;  3HK2 A;  3TI0 A;  4AM7 A;  1NK8 A;  2VG7 A;  3QIP A;  1J5E K;  1WN7 A;  2P9U B;  3AGK A;  4JKG A;  4BRE A;  2WC9 A;  2ZE2 A;  3CF5 L;  3L2V A;  3VQ4 A;  4EIA A;  4Z4C A;  4PL8 A;  5C15 A;  1K73 O;  1XHX A;  2G8W A;  3CCS N;  5HRN A;  3TAG A;  1QQC A;  2E2O A;  4FLY A;  4GMJ B;  3GDQ A;  3HP6 A;  4CHY A;  4ELT A;  5AQL A;  1VQ4 N;  4CF9 A;  4DR6 K;  1K6Y A;  3ZT2 A;  3AVG A;  2CGL A;  3O3G A;  3LPT A;  2A5X A;  5AZI A;  1B92 A;  4KHP K;  5CZ1 A;  1WSE A;  4O5B A;  4XIU A;  3RR7 A;  1DLO A;  3IDH A;  3OJU A;  4FLW A;  3HJF A;  4JRQ A;  3FR0 A;  3DJC A;  2I5J A;  2XY6 A;  1WAJ A;  3SNN A;  1LWF A;  3AVM A;  1FK9 A;  4YOT A;  3CJ9 A;  4BRD A;  1BIU A;  4BWJ A;  3DXM A;  3LP1 A;  2P9I A;  3BZC A;  1LV5 A;  1YVN A;  5KRT A;  3WNH A;  3PX6 A;  4F8R A;  5DK5 A;  3PO4 A;  1BA1 A;  3EKU A;  1XHZ A;  1U04 A;  3ID6 A;  4LFA K;  4UQG A;  3L4I A;  1UAX A;  2ZJP L;  3CC2 N;  1HMV A;  4ILG B;  5HRS A;  4JI1 K;  3BUZ B;  4FM0 A;  3ZX0 A;  3VQC A;  3OYD A;  4C8M A;  3SBG A;  4FZZ A;  2WOM A;  5KPT A;  1RT3 A;  4BGB A;  3HRG A;  3ASM A;  1G15 A;  2D0C A;  3L2R A;  4BQZ A;  4YOW A;  4F2R A;  5AQG A;  3D45 A;  3ZSZ A;  1JLB A;  2DFH A;  1BIS A;  3THW A;  1Q9Y A;  4B3R K;  2NRH A;  3OYB A;  1JCG A;  1LAV A;  4DF4 A;  2ZGY A;  4JS4 A;  4NYF A;  3VEW A;  4BRC A;  1BQN A;  2UXC K;  1Q7Y O;  3MXJ A;  3AGR A;  5FLX O;  3F9K A;  4CK1 A;  4FLT A;  4FZY A;  3CJC A;  4HUF A;  3FZM A;  3JAM O;  1MWK A;  2IVP A;  5EVZ A;  1T6D A;  4CFC A;  3TWH A;  3K9J A;  3D2E B;  4ILH A;  1RDC A;  2YHA A;  4HCC A;  3K5N A;  4CGF A;  1BI4 A;  1VAZ A;  4B3T K;  4KHS A;  3V81 A;  2HHU A;  1ASU A;  3THW B;  3UE5 A;  4WQ4 C;  3V1O A;  1P90 A;  1EX4 A;  2KFN A;  3RR8 A;  3L0Q A;  5FPN A;  5KQD A;  1E4G T;  3H45 C;  5KQ8 A;  4H0X B;  4AM6 A;  3SQ0 A;  4CFD A;  5C10 A;  3SMP A;  1JLQ A;  3VQ6 A;  5FRN A;  3ZSX A;  3V9U A;  5J1E A;  1NGG A;  5TKY A;  4HCB A;  1GOC A;  3I0R A;  3TR8 A;  1U49 A;  4NLC A;  4E19 A;  2RE2 A;  3SYZ A;  3MXM A;  4KBO A;  4NCA A;  2AP1 A;  1J54 A;  3L4Q A;  3MED A;  2ITG A;  4FWL A;  4DV3 K;  2A42 A;  5M1P A;  4FL9 A;  1EKE A;  1VSF A;  3H46 O;  4TSX A;  3KWG A;  2QKB A;  2QK9 A;  2OCE A;  1VSJ A;  1TUU A;  3NVM A;  2E2P A;  3KK7 A;  2GUP A;  3K5L A;  3L3V A;  4CHP A;  4BDY A;  3F5T A;  4C8K A;  1R0A A;  1RBU A;  4PY5 A;  4CEO A;  4FJM A;  2HND A;  3CCE N;  3V1Q A;  1DTT A;  3DLH A;  1NGE A;  2D5R A;  4NCG A;  4OPH A;  4YNQ A;  3C6A A;  2IGI A;  2OPQ A;  1KCF A;  2QEX N;  2KLA A;  1RDU A;  2IC3 A;  4A2B A;  1X9M A;  1ILY A;  2BAN A;  4CED A;  3SV4 A;  1YVU A;  4CK3 A;  4BRG A;  3SZ2 A;  1MWM A;  1JXB A;  1NGJ A;  4B1Y B;  1FXX A;  3DRP A;  4M63 C;  1S6Q A;  3B6P A;  3GG4 A;  3QET A;  1LOT B;  3VEN A;  3AAQ A;  1LCU A;  4JK7 A;  4LC9 B;  3O9U A;  4FCY A;  2F9T A;  1NK9 A;  4F2S A;  4ILJ A;  2O8D B;  4BC3 A;  4FXD A;  3JS6 A;  5AZJ A;  4MLE A;  2FLO A;  5A2Q O;  1LWE A;  3CD6 N;  3ZEU A;  4H4O A;  4B3S K;  2V7Y A;  2QWO A;  3M8S A;  4DSE A;  4IOX A;  3HI0 A;  3J7Y P;  2W41 A;  4J2B A;  3BEX A;  4W5O A;  3H3N O;  2VWB A;  3ALY A;  4DSF A;  1YJW N;  2CGK A;  5HRR A;  5DM6 L;  3IKM A;  4CK2 A;  4MDA A;  4BC5 A;  4N5S A;  1UOC A;  2RF2 A;  1C1C A;  1ATS A;  3EL2 A;  2XRI A;  1XNQ K;  2VCP A;  4JKB A;  4WQ5 A;  1F21 A;  3QEP A;  4FW2 A;  4CBU A;  3I8D A;  4IO9 L;  5C24 A;  4OPK A;  1VK0 A;  1XC3 A;  3D2F A;  1VQP N;  4H0O A;  4OX9 K;  5D3G A;  4H03 B;  1BL3 A;  5CR4 A;  3DLB A;  4AH9 A;  4FK2 A;  5M1Q A;  3E1Y A;  1NK6 A;  2A1S A;  4DLE A;  1U48 A;  2HBL A;  3V1R A;  1HKG A;  2EWS A;  3CPE A;  3VET A;  3QEI A;  2JWK A;  2QXF A;  3VES A;  3EE9 A;  5F0X A;  3B6O A;  4CEF A;  1SL0 A;  3NH0 A;  3CFP A;  1QQM A;  1NK4 A;  2XY5 A;  1NU0 A;  3I8B A;  5AQH A;  4BRP A;  2KTQ A;  4FYD A;  4CD3 A;  3LWL A;  3RWU A;  3CFO A;  4OLB A;  1T6C A;  1HNX K;  4CW7 B;  2CH5 A;  3FFI A;  1S72 N;  1TK0 A;  2OZM A;  4CD1 A;  2QWN A;  1XNR K;  3GBT A;  5BRF A;  3CMA N;  3NF9 A;  4PKH A;  3WXK A;  4OGE A;  2EHG A;  2BGG A;  1N8R O;  3ULE B;  4CBX A;  4GV3 A;  1TGO A;  1GLJ O;  1VSD A;  2NRW A;  4B3O A;  1HKB A;  2P9P B;  3VGM A;  1QS4 A;  4DV5 K;  4NLB A;  1JCE A;  1ASW A;  1BO5 O;  1SQK A;  2DFF A;  3ITH A;  2OYQ A;  2FSJ A;  2F8S A;  5C12 A;  3NF8 A;  1EQY A;  2O8B A;  2Q2R A;  3CCU N;  3EO3 A;  1X3M A;  4ELU A;  1X3N A;  1KVC A;  4LSL A;  4KKO A;  4CZJ A;  3ZSQ A;  4NYN A;  5I3U A;  3J7A P;  4CIF A;  2O8C B;  3DOL A;  3C6H A;  3U9Z A;  4DQR A;  5M1F A;  3G25 A;  5LMN K;  1N36 K;  4H0T B;  3NGY A;  1WSJ A;  4E7J A;  2Q36 A;  3C7N B;  1M1K O;  3TTD A;  4RW7 A;  5GIN A;  4EZ9 A;  4HTU A;  3VGK A;  3U8X A;  2YKN A;  1V4S A;  3WNG A;  4AHU A;  4CHN A;  2Z1I A;  3R6M A;  1BCM A;  4XH1 A;  5AQX A;  1WAF A;  4KI4 A;  3MMV A;  3VQQ A;  5LJV A;  4KO0 A;  3D0P A;  1JLG A;  3TSP A;  3LM2 A;  4IFV A;  1YXQ A;  2P9N B;  4E7I A;  3QER A;  1KQS M;  5B8H A;  4E0D A;  2O8E B;  4FWN A;  1L3V A;  5AQN A;  3THX A;  3QB0 A;  5C0Y A;  1HYS A;  3IG1 A;  4Z4E A;  4Q0B A;  4CEZ A;  4RWT A;  2GBZ A;  3V4I A;  2Q3S A;  3PX0 A;  4JI7 K;  1OVY A;  4JAX A;  2QA4 N;  5EOY A;  3VEZ A;  2GWJ A;  1HNW K;  2P9K B;  4HUE A;  1W7A A;  4JN4 A;  3EEQ A;  3H1Q A;  5KPZ A;  3PIO L;  4BRK A;  4B1V A;  2A1R A;  4LF9 K;  1WSH A;  2HMI A;  5AQQ A;  4FWK A;  1T8E A;  2QTD A;  1KFD A;  2F9W A;  5J2M A;  3EZ5 A;  1RTI A;  2OA8 A;  3CCJ N;  1NJW A;  4BR9 A;  2YHY A;  3CCM N;  1OH6 A;  4CGD A;  4DTR A;  1BG3 A;  1XC9 A;  3HM8 A;  4H0V B;  4WFN L;  4FLX A;  1IBK K;  3V9W A;  4KRF A;  1RGI A;  4FVU A;  3CQX A;  4DCH A;  1QSY A;  3AVA A;  3ZX3 A;  3MN9 A;  3THX B;  4GV6 A;  1FJG K;  5E84 A;  2UUC K;  3OYL A;  2W40 A;  4XH4 A;  4CJ4 A;  2QWP A;  3CG7 A;  3O3F A;  4FJN A;  4DMN A;  3GOI A;  2RHK A;  5KPR A;  1VSI A;  4BR2 A;  2B4J A;  5CYM A;  4KHU A;  4OLA A;  1L3U A;  4OO1 J;  3THY A;  4CJQ A;  3DMJ A;  5GIO A;  5HLF A;  1H1V A;  4O5F A;  1QZ6 A;  1SKS A;  4LFB K;  3TSU A;  4CZL A;  4PWD A;  3RTV A;  2JLE A;  5JVH L;  1U6Z A;  4ZHR A;  3F9M A;  3O9Q A;  1ZXO A;  4BY9 C;  3LP2 A;  5AQS A;  3L2Q A;  4KRE A;  3PX4 A;  3HYF A;  2YX6 A;  3LAN A;  4JI3 K;  1ITG A;  1Z05 A;  3CME N;  4F3T A;  4O8U A;  3WQU A;  1NGH A;  4E7K A;  2HW3 A;  1VRT A;  3O4Q A;  2E5L K;  4BRM A;  1TVR A;  3LM9 A;  4B8A B;  2DTU A;  2HOE A;  3L3U A;  4IEE A;  4DV7 K;  4DTP A;  2FC0 A;  3KD1 E;  4O55 A;  4ZTF A;  1K8A O;  5AQK A;  2PBD A;  1RDD A;  1BWF O;  4M3X A;  3MWP A;  4BR4 A;  4WCE L;  3QIN A;  4DKW A;  3T1A A;  2A3Z A;  3HSC A;  1QHA A;  2IVO A;  2KQ2 A;  3CCQ N;  1VQK N;  4JD2 A;  3K5O A;  1YI2 N;  3G0Z A;  1WB9 A;  2YHW A;  1S1W A;  3HXM A;  4J2E A;  3SMS A;  4LH5 A;  1WBB A;  3EN9 A;  4B9N A;  4CHZ A;  1TAQ A;  2D0O A;  2YCH A;  3SK3 A;  3QML A;  1TUY A;  4O44 A;  4GV9 A;  4RTF D;  1KSP A;  5GAH P;  4CJW A;  3U4L A;  2OPS A;  1Z25 A;  4X62 K;  3C6U A;  3OYG A;  1D9F A;  2QW9 A;  2X6S A;  4WFB L;  3HPO A;  1OKJ A;  4QAG A;  4J2A A;  2ITM A;  2DFE A;  3HP9 A;  1U4B A;  1C0F A;  5FRM A;  4MLH A;  4OKE A;  1OH5 A;  2XY8 A;  4B9Q A;  4IKF A;  4GVE A;  3DXK B;  5ADX H;  3VQ7 A;  4AHC A;  4IEI A;  1IH7 A;  1FKO A;  3VMF B;  4ID5 A;  4FLZ A;  3KZB A;  1RT2 A;  4I6M B;  3NGZ A;  2Y1I A;  3NH2 A;  4CEA A;  3SQ4 A;  4BRQ A;  2NUB A;  3UIQ A;  4N56 A;  4NB4 A;  3CI5 A;  4FOE A;  1BIZ A;  3AVI A;  3TSQ A;  2O4G A;  1J6Z A;  2A40 A;  1ZBF A;  4PUO A;  2OTJ N;  4JLH A;  3AVJ A;  3IUC A;  1TKZ A;  1XUP O;  3RSE B;  5C42 A;  4CES A;  3AVC A;  2Q31 A;  4WYB A;  4CF1 A;  1V4T A;  1NWK A;  1N5Y A;  2HNY A;  3AVL A;  3C65 A;  3VF2 A;  1D9D A;  3E01 A;  3KHY A;  1WSF A;  1IG9 A;  1NMD A;  2NNW A;  4IWV A;  2NRR A;  1DKG D;  2WON A;  3C94 A;  4CJ3 A;  4Q5V A;  1HRH A;  4YOR A;  4FW1 A;  2YJF A;  4CJU A;  3F73 A;  3U3G A;  2W6L A;  4A59 A;  2F7T A;  2HBK A;  3HZ6 A;  3WUH A;  2QWL A;  3L2W A;  4B8C A;  1JXE A;  4BRL A;  1A5X A;  4KH4 A;  4AHV A;  4BR7 A;  4FLU A;  4ID1 A;  1TV6 A;  2KFZ A;  4CZI A;  3S3O A;  1XMQ K;  3OJS A;  1QTM A;  3P1G A;  1YIJ N;  1NM1 A;  1BGX T;  1D8Y A;  5EX5 A;  3FZK A;  4BR0 A;  4M3W A;  2NRZ A;  1BOT O;  3S9H A;  4BRO A;  1S5J A;  4IOC L;  3D2E A;  1Q81 O;  5SZT A;  1RT4 A;  4W5T A;  3ZYY X;  3PUF A;  2HVH A;  3LAM A;  1ZBL A;  2PY5 A;  3BGR A;  4DTX A;  1RTD A;  2E1Z A;  1O13 A;  2G8U A; 
#chains in the Genus database with same CATH homology
 2ATQ A;  2IDO A;  1TK5 A;  3RMC A;  4FJ5 A;  3LWM A;  4FCY A;  2EX3 A;  1NK9 A;  1U45 A;  4FM2 A;  4F2S A;  1C0M A;  1KFS A;  4FXD A;  2IAJ A;  4CIG A;  2RKI A;  3VN5 A;  3K57 A;  3LP0 A;  2FBX A;  3P83 D;  3V9X A;  1LWE A;  1RIL A;  2HVI A;  3NFA A;  2G8K A;  4H4O A;  1LW2 A;  1TL1 A;  1NOY A;  2YNG A;  4JRP A;  2P5G A;  4CGJ A;  3V6D A;  4KFB A;  1IKV A;  1S1V A;  3M8S A;  2XHB A;  3M8R A;  1LWC A;  4DSE A;  3THV A;  1L3S A;  1ZBH A;  4Z0U A;  2P51 A;  3KLE A;  4J2B A;  1VSL A;  4G1Q A;  1CZ9 A;  4WE1 A;  4W5O A;  3QEX A;  4O0I A;  3TAB A;  1GOA A;  3ALY A;  5KGX A;  4DSF A;  1UA1 A;  3NCI A;  5HRR A;  1WLJ A;  1HQE A;  3VA0 A;  4OVL A;  4CK2 A;  3I0S A;  5KI6 A;  1YT3 A;  4N5S A;  5JS1 A;  3EYZ A;  4LD0 A;  2Y1J A;  1UOC A;  4LH4 A;  2RF2 A;  3CM6 A;  1S6P A;  1C1C A;  2HB5 A;  3EY1 A;  2XRI A;  4IG3 A;  3NF6 A;  3QEP A;  1F21 A;  4FW2 A;  3VQ8 A;  4DFJ A;  3TAE A;  4B9L A;  3U3Y A;  1SUQ A;  2YHB A;  3I8D A;  1YTU A;  1XI1 A;  3SQ2 A;  2E6L A;  2X78 A;  5C24 A;  4PQU A;  5KRS A;  3NH1 A;  3TAM A;  3QO9 A;  4OPK A;  3QEV A;  1VK0 A;  4FM1 A;  1HYZ A;  4CJR A;  1CXQ A;  4BAC A;  5J2N A;  1RT7 A;  3AA4 A;  5D3G A;  3O3H A;  3DLB A;  1BL3 A;  4LY7 A;  3SCX A;  4C8N A;  3A2F A;  4AH9 A;  4FK2 A;  3KIO A;  3AO4 A;  3DM2 A;  2D0A A;  2A1S A;  3C6T A;  1NKC A;  1NK6 A;  2QKB A;  4DLE A;  1EET A;  1U48 A;  3V1R A;  3G10 A;  3QEI A;  4Z4I A;  1W0H A;  2BE2 A;  2QXF A;  3HVR A;  3B6O A;  3HST B;  4Y1D A;  4CEF A;  1SL0 A;  4KI6 A;  1Y97 A;  3AO1 A;  4IFY A;  1Q9X A;  3NH0 A;  1C1A A;  3CFP A;  3OS1 A;  1LAW A;  1VSH A;  4CF2 A;  1NK4 A;  4JS5 A;  2XY5 A;  5C25 A;  4DWI A;  3LP3 A;  4DU3 A;  4CJK A;  4CJE A;  1A5W A;  4FJX A;  3AA3 A;  2KTQ A;  2OZS A;  3OS2 A;  4FYD A;  3SPZ A;  1RNH A;  3MEC A;  4KV8 A;  1IKY A;  4BWM A;  3OYA A;  3LWL A;  4DS4 A;  1B9F A;  3CFO A;  3RWU A;  4KPY A;  4OLB A;  3QLH A;  3FFI A;  2DY4 A;  1BQM A;  4CIE A;  1TK0 A;  4M3U A;  3QES A;  1JL1 A;  3MAQ A;  4DFK A;  2IS3 A;  4DSJ A;  5HBM A;  2OZM A;  1TAU A;  4I2P A;  1RTJ A;  2KZZ A;  3AA2 A;  3VQP A;  3OYN A;  4FZX C;  1S9E A;  2P5O A;  1XWL A;  3AVF A;  4CEQ A;  4AHS A;  3KJV A;  1T05 A;  3NF9 A;  3OY9 A;  4OGE A;  2EHG A;  4E7L A;  1T7P A;  1WNS A;  1A5V A;  2BGG A;  4DTS A;  2X74 A;  3L8B A;  1TKT A;  1TGO A;  2OPP A;  3ZT0 A;  3KK2 A;  1VSD A;  4HHT A;  4B3O A;  1J53 A;  2ZD1 A;  3SUP A;  1ZBI A;  3AVB A;  5FRO A;  4DFP A;  2PZS A;  1QSS A;  4I2Q A;  1QSL A;  4B9U A;  1QS4 A;  4RW8 A;  3VA3 A;  4N76 A;  4MQ3 A;  1RBV A;  1ASW A;  1T03 A;  4F3O A;  1HNV A;  2DFF A;  3ITH A;  4DLG A;  2OYQ A;  4BE1 A;  3CM5 A;  2HHT A;  2F8S A;  4K8Z A;  3MEE A;  3NF8 A;  4H4M A;  3OYE A;  3WNE A;  3M8Q A;  3AVH A;  3TAP A;  2PYJ A;  4CF8 A;  4C8O A;  3IAY A;  3CFR A;  4FJ7 A;  4ELU A;  1X9S A;  3DOK A;  1KVC A;  3JYT A;  1IKX A;  4I7F A;  4LSL A;  4KKO A;  3JSM A;  1DTQ A;  1NK5 A;  1NK7 A;  4IDK A;  1KLN A;  2Z1H A;  3ZSQ A;  4NYN A;  4AIL C;  5I3U A;  4CIF A;  3DOL A;  4R5P A;  4FJH A;  4DQR A;  4Y1C A;  4AHT A;  4FK4 A;  3NGY A;  1C6V A;  1WSJ A;  4E7J A;  3VQ9 A;  1RT5 A;  4DSL A;  3M8P A;  4RW7 A;  4ELV A;  3ZSV A;  4EZ9 A;  3WNF A;  2HHW A;  1NK0 A;  4E1N A;  1KVB A;  1VSK A;  1RBR A;  4HTU A;  4CJV A;  5HP1 A;  2YKN A;  4AHU A;  3WNG A;  4CHN A;  5J2Q A;  1BHL A;  1C0U A;  3SV3 A;  4DSI A;  4FJI A;  2XO7 A;  3ULD A;  4O0J A;  2Z1I A;  3OYC A;  3NE6 A;  1BCM A;  4DF8 A;  3ZSW A;  1ASV A;  4CER A;  3KK1 A;  1WAF A;  4KI4 A;  1S1X A;  5KGW A;  4CE9 A;  3VQQ A;  3V9S A;  1LW0 A;  4FJG A;  4KB1 A;  1NKE A;  2E4L A;  4CGH A;  3OVN A;  4M3T A;  4KO0 A;  3D0P A;  4CF0 A;  1JLG A;  3KK3 A;  4FJL A;  1L3T A;  4IFV A;  2X6N A;  4E7I A;  4DQQ A;  3QER A;  4RW6 A;  3QIO A;  2FBV A;  3VQ5 A;  4E0D A;  3KLH A;  4GVM A;  4DU4 A;  1L3V A;  1RDB A;  1L5U A;  2VWK A;  1RT1 A;  3NAE A;  1HYS A;  3IG1 A;  4BE0 A;  4Z4E A;  1NJY A;  4CEZ A;  3LPU A;  4DQS A;  4Q0B A;  1D5A A;  2GBZ A;  3V4I A;  2Q3S A;  3PV8 A;  2B5J A;  1WSG A;  4B08 A;  3DRR A;  3PX0 A;  1I3A A;  1IO2 A;  5J2P A;  3PY8 A;  4DTJ A;  4HVJ A;  2FBY A;  3U6F A;  1U47 A;  1KVA A;  3NBP A;  4GW6 A;  4HUE A;  1VRU A;  4B9T A;  4B9V A;  1FKP A;  2GUI A;  2YNI A;  4QOZ B;  1HQU A;  1C1B A;  4EP5 A;  1EP4 A;  3AVN A;  4KTW A;  4RW4 A;  3HM9 A;  3IRX A;  2A1R A;  4CGG A;  3ZT3 A;  1WSH A;  2HMI A;  2R7Y A;  4J2D A;  1RCH A;  3AVK A;  4CGI A;  4CJP A;  1KFD A;  2P1J A;  1T8E A;  4O4G A;  3EZ5 A;  2OPR A;  5J2M A;  1RTI A;  3DLE A;  3OYM A;  2OA8 A;  3HO1 A;  3HK2 A;  4C8L A;  3TI0 A;  3OYJ A;  3AO5 A;  1NJW A;  2QKK A;  1NK8 A;  3CYM A;  2VG7 A;  3QIP A;  4CJS A;  3PO5 A;  4DQI A;  4L8R B;  1WN7 A;  1JLA A;  2F96 A;  4CJT A;  4CGD A;  4DTR A;  2E6M A;  3C95 A;  1CXU A;  5CY4 A;  1XC9 A;  4FLX A;  3ZT1 A;  2ZE2 A;  2GV9 A;  3O4N A;  3V9W A;  4KRF A;  3HVT A;  2KZM A;  1I39 A;  3L2V A;  1SL1 A;  3VQA A;  3CQ8 A;  3VQ4 A;  1QSY A;  3AVA A;  4N47 A;  4Z4C A;  3HL8 A;  5E41 A;  3NGI A;  4CJ5 A;  3P5J A;  1XHX A;  2YKM A;  3OYL A;  2G8W A;  5HRN A;  4CJ4 A;  3LDS A;  3CG7 A;  3AV9 A;  3O3F A;  1QQC A;  3TAG A;  4DMN A;  4K8X A;  4FJN A;  1VSI A;  2B4J A;  2IOC A;  5CYM A;  4FLY A;  4ZTJ A;  4GMJ B;  4KAZ A;  4KHU A;  3HP6 A;  4CHY A;  4ELT A;  4OLA A;  1L3U A;  2BDP A;  1W9H A;  4CCH A;  4CJQ A;  4CF9 A;  4DTM A;  3DMJ A;  2VWJ A;  5HLF A;  1K6Y A;  1CLQ A;  1VSE A;  4E3S A;  3ZT2 A;  4DTN A;  3AVG A;  4CEE A;  4OGC A;  3O3G A;  3LPT A;  3MEG A;  1SKS A;  1B92 A;  3ISN C;  4H8K A;  5CZ1 A;  3DLK A;  3ZSY A;  1WSE A;  4O5B A;  4OPJ A;  4XIU A;  3KLG A;  3RTV A;  4PWD A;  5EU7 A;  3H08 A;  1REV A;  2JLE A;  4BDZ A;  1JKH A;  3DLG A;  3RR7 A;  4ZHR A;  1DLO A;  2FBT A;  3OJU A;  3K5M A;  4FLW A;  3LP2 A;  4AHR A;  1BI4 B;  2HNZ A;  2Z1J A;  4JRQ A;  3DRS A;  3TAF A;  3HJF A;  1QHT A;  3L2Q A;  2O4I A;  4KRE A;  3PX4 A;  3HYF A;  2I5J A;  2XY6 A;  1WAJ A;  3SNN A;  1LWF A;  4CFB A;  3AVM A;  3LAN A;  1FK9 A;  3RMD A;  1ITG A;  4QCL A;  1BIU A;  4BWJ A;  1JLE A;  3LP1 A;  1WSI A;  4F3T A;  1LV5 A;  1S1U A;  5KRT A;  4E7K A;  2HW3 A;  1VRT A;  1MU2 A;  4Z4G A;  3WNH A;  1CZB A;  1HJR A;  1YTA A;  3O4Q A;  5DK5 A;  3PX6 A;  3DI6 A;  2Z1G A;  5CYQ A;  4F8R A;  3PO4 A;  5T7B A;  1TVR A;  1TKX A;  4NCB A;  4MFB A;  1XHZ A;  1S9G A;  4B9M A;  1QE1 A;  1U04 A;  4B8A B;  2DTU A;  3V9Z A;  4UQG A;  3L3U A;  4DTP A;  2FC0 A;  3KD1 E;  4O55 A;  2VG5 A;  4ZTF A;  1UAX A;  3T19 A;  1SL2 A;  1HMV A;  1N6Q A;  2YNF A;  5HRS A;  3KTQ A;  4KHW A;  1RDD A;  4M3X A;  3DLR A;  3SUN A;  4LSN A;  3RRG A;  4EZ6 A;  4W5R A;  1UA0 A;  1X9W A;  4I9L A;  3QIN A;  4CHQ A;  4FJ8 A;  1HNI A;  3T1A A;  4FM0 A;  3SUQ A;  4FLV A;  1UWB A;  2KQ2 A;  3VQC A;  1J5O A;  3OYD A;  4C8M A;  4FZZ A;  2G8V A;  2WOM A;  2VG6 A;  1RT3 A;  2G8H A;  3K5O A;  3NF7 A;  1GOB A;  3ASM A;  3HPH A;  4KHQ A;  1G15 A;  1O1W A;  2D0C A;  3G0Z A;  3ZT4 A;  2G8I A;  3L2R A;  1KTQ A;  1JLF A;  1Q8I A;  1S1W A;  3HXM A;  1NOZ A;  4F2R A;  1ZBU A;  4J2E A;  5FDL A;  3OYI A;  4LH5 A;  3D45 A;  3ZSZ A;  3HT3 A;  1JLB A;  3TAN A;  2HHS A;  4B9N A;  2DFH A;  1BIS A;  2F8T A;  4CHZ A;  3TAQ A;  1TAQ A;  1JLC A;  2KW4 A;  4OKJ A;  3ZCM A;  3K2P A;  1Q9Y A;  4DS5 A;  4FJJ A;  5I42 A;  1SV5 A;  4E89 A;  4O44 A;  3OYB A;  4M42 A;  3T3F A;  3RRH A;  4DG1 A;  1LAV A;  3VQB A;  4DF4 A;  1TKD A;  1KSP A;  4JS4 A;  4NYF A;  2ETJ A;  1IKW A;  3AO3 A;  4CEC A;  4CJW A;  1VSM A;  3SUO A;  1TL3 A;  1BQN A;  2OPS A;  3MXJ A;  4HUG A;  3KD5 E;  1Z25 A;  3F9K A;  4CK1 A;  3C6U A;  3OYG A;  1D9F A;  4FLT A;  2AJQ A;  2X6S A;  4FZY A;  3HPO A;  1HYV A;  4PA1 A;  4M3R A;  4HUF A;  4QAG A;  4DTU A;  4J2A A;  4DTO A;  2DFE A;  3HP9 A;  1U4B A;  5HRO A;  3DYA A;  4RW9 A;  3QNO A;  1SKW A;  4CFC A;  3K58 A;  3TWH A;  2G8F A;  5FRM A;  4Z4F A;  3SJJ A;  4OKE A;  2XY8 A;  4IKF A;  1NJZ A;  1RDC A;  2YHA A;  3KKR A;  3VQ7 A;  4HCC A;  2HHX A;  3K5N A;  4AHC A;  4KHN A;  4CGF A;  3VQE A;  1IH7 A;  1FKO A;  3OS0 A;  4ID5 A;  4FLZ A;  2XY7 A;  4CJL A;  4DFM A;  1RT2 A;  1BI4 A;  3NGZ A;  2HHV A;  1X1P A;  3NH2 A;  2Y1I A;  4CEA A;  3SQ4 A;  4KHS A;  4RG8 A;  3V81 A;  4KTZ A;  4BDP A;  1ASU A;  2HHU A;  3TAR A;  4CEB A;  2NUB A;  3V1O A;  3UIQ A;  1EX4 A;  4M3Z A;  3SQ1 A;  3RR8 A;  2KFN A;  4N56 A;  4OKK A;  1BIZ A;  3AVI A;  2O4G A;  4KHY A;  1ZBF A;  4PUO A;  2JGU A;  1RBT A;  4JLH A;  3BDP A;  3AVJ A;  1NKB A;  3SQ0 A;  4CFD A;  4FK0 A;  1JLQ A;  1TKZ A;  3VQ6 A;  5FRN A;  1RTH A;  3HPG A;  1NJX A;  3ZSX A;  5KTQ A;  5J1E A;  3V9U A;  2RPI A;  2PYL A;  1J9A A;  1EXQ A;  5HRP A;  4E1M A;  4HCB A;  1GOC A;  3I0R A;  3TR8 A;  4CES A;  5C42 A;  1SKR A;  3RMA A;  1U49 A;  3AVC A;  3VQD A;  4E19 A;  3QNN A;  5CZ2 A;  4F4K A;  4W5N A;  3S3N A;  3OYF A;  3SYZ A;  4CF1 A;  2YV0 X;  3MXM A;  1N5Y A;  2HNY A;  3K59 A;  4E7H A;  5SWM A;  4NCA A;  3AVL A;  1B9D A;  5JS2 A;  1J54 A;  2W42 A;  3MED A;  3E01 A;  1D9D A;  1WSF A;  1IG9 A;  2ITG A;  3KKS A;  3LZI A;  4ICL A;  1HPZ A;  4M45 A;  4W5Q A;  3QEW A;  1EKE A;  1VSF A;  4DU1 A;  2B6A A;  3AO2 A;  4TSX A;  2ZQB A;  2WON A;  4M41 A;  3C94 A;  1Z26 A;  3OYK A;  2QK9 A;  4B9S A;  4KB0 A;  4CJ3 A;  4Q5V A;  3SI6 A;  1HRH A;  1VSJ A;  3NHG A;  3AA5 X;  3MXI A;  4FW1 A;  4CJU A;  4CHO A;  4I9Q A;  3F73 A;  3U3G A;  4DQP A;  1JL2 A;  3IS9 A;  1RBS A;  3L2W A;  1BCO A;  4FVM A;  1JXE A;  4B8C A;  3K5L A;  1A5X A;  1ZYQ A;  3L3V A;  1RDA A;  4FJK A;  4FJ9 A;  4CHP A;  3ZSO A;  4BDY A;  4AHV A;  4DSK A;  2YNH A;  3L2U A;  4C8K A;  4FLU A;  1S1T A;  4ID1 A;  1TV6 A;  5K14 A;  3KLF A;  1RBU A;  4CFA A;  4CEO A;  1R0A A;  4FJM A;  4PY5 A;  2HND A;  3OYH A;  2KFZ A;  4IG0 A;  2D0B A;  1TK8 A;  3V1Q A;  1DTT A;  3S3O A;  3DLH A;  3OJS A;  4BE2 A;  3P1G A;  2RN2 A;  1QTM A;  4N41 A;  2D5R A;  4NCG A;  5DMR A;  3SPY A;  4CJF A;  4YNQ A;  2IGI A;  3NDK A;  1BGX T;  2LSN A;  2OPQ A;  4Z4H A;  1C0T A;  1KCF A;  4YFU A;  1D8Y A;  4M3W A;  4M3Y A;  1RT6 A;  3LAK A;  2HHQ A;  4KTQ A;  2IC3 A;  4EP4 A;  3S9H A;  1X9M A;  2BAN A;  4CED A;  3LAL A;  3SV4 A;  4OJR A;  1S5J A;  1YVU A;  3KLI A;  4CK3 A;  4IBN A;  1KRP A;  5SZT A;  3S3M A;  1RT4 A;  1KLM A;  4W5T A;  3SZ2 A;  3RMB A;  3PUF A;  2HVH A;  1JXB A;  3LZJ A;  1FXX A;  3DRP A;  3LAM A;  1ZBL A;  3ZSR A;  3BGR A;  2PY5 A;  4DTX A;  1RTD A;  1S6Q A;  3B6P A;  2G8U A;  3QET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...