1GOTA

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
338
structure length
338
Chain Sequence
SAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
total genus 117
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1gotA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gotA01
1Q20A 1ZP6A 1LTQA 3DEFA 3GJ8A 4UNSA 2A30A 2QUZA 2J7PA 4Q9IA 4QGGA 3GCGA 5JWHA 3R9IA 4B3XA 4AY2A 2PX0A 3WYFA 1A7JA 1SULA 4H1UA 4B33A 1DG3A 1EFUA 2PMDA 2ZI5A 4JZKA 4QBFA 2HDNB 4Q9LA 3T35A 5IDVA 3OFNA 2VP0A 4TQUS 1OXXK 1UFQA 3C16C 5FTKA 5L3RA 4DDVA 1SXJD 2YWEA 5IK2A 3C4JA 3MG9A 5L8VA 4E09A 5TVKA 5HE8A 1US8A 1L4YA 1GNPA 4PQFA 2JLQA 1UJ2A 1I2MA 1H8HA 3MD0A 3A1WA 1AJEA 1OYYA 3EPJA 3TUZC 1ZJ6A 3W5JA 1SHKA 3NTUA 4DZZA 2B21A 5DNYB 3MWYW 3NDPA 4Q48A 4JYBA 2F3TA 1ZUHA 5D3MA 4KBFA 2AXNA 2HJGA 1SVWA 3P1JA 1IOZA 1YZNA 4YQFA 1R0XA 1C9KA 2EFCB 3AKCA 3VTKA 3Q9LA 3Q3JB 3K09A 4A2PA 3GJXC 2XEXA 1MV5A 1P2TA 4KFSA 4BFXA 1YHNA 4B75A 1N5JA 4DCTA 2CHQA 1Z0JA 2ZRIA 1KZGB 5TY0A 3TH5A 1KDPA 1TUEA 2LCFA 4GFDA 3NKVA 1E0KA 5E3HA 3U6KA 2QBYB 4LHYA 1P2VA 1P3JA 1SVKA 2XJ4A 2YC2C 3ZDQA 1GFIA 2EVWX 4EQ6B 1E9DA 1E69A 2Q9BA 5KNCA 5JEEA 1QHYA 4DSOA 4QGAA 3X2SA 1G8HA 1LV7A 3KQLA 2OXCA 2BC9A 1AK2A 1T5IA 2IT1A 3U6BA 4BGDA 1W0KD 4BASA 4BEBA 1G5RA 1CJUC 4NDZA 3AM1A 4DIDA 3GLFB 2ZJ2A 1HQYE 1U0LA 3ADBA 3KDSE 1F60A 2O52A 3FGNA 1OV4A 4LV5B 4QHTA 5FTNA 3UXMA 1G8PA 2JLRA 1FMLA 2H5EA 1OIWA 3SBDA 2ZE5A 1W7AA 2GTPA 2R62A 3AF1A 1F5NA 3QQ5A 5EE3A 3SNHA 1WF3A 2G1JA 3SHFA 1DAMA 1UEJA 5JCPA 2IXGA 3GLIE 1RRFA 4D6PA 1YR9A 2YOHA 2VSXA 4RVCA 3C41J 5E7JA 3DVLA 3CWQA 3I73A 1T3HA 2F1IA 1VDZA 5JECA 1S0UA 2RKOA 1LFDB 1NBME 3AF0A 5TV2A 1NMZA 1W5SA 3DKVA 5C4MA 2ZRBA 2TMKA 4OHXA 2O8EA 4D2IA 5FL3A 4ZCLA 4L5BA 1W47A 2BMEA 3R9XA 3HPRA 3H4MA 2ZIAA 1AQYA 2A7QA 3PEUA 4MGYR 3U3KA 1C4OA 4ZKDA 2XGJA 1JALA 4R2IA 3X1DA 1PVOA 3LD9A 2AWOA 2NQ2C 1VPLA 2ZYTX 2JJ8A 4IOKA 1IAQA 1P60A 1JR3A 2CLCX 3OF5A 3A36A 2D7CA 1Q3HA 4OI1A 3EA5A 4Q1CA 2WZQA 4E03A 1LF0A 3C5CA 5HE9A 3LH5A 2QP9X 1X1RA 2IYSA 3WHLA 2GEDA 4RD0A 5F98A 1JPNA 4A9AA 1KMQA 4RD4A 1TU4A 1ODFA 3UPUA 2JAQA 2HJVA 3SI7A 1NVVR 1QHIA 1Z63A 1Z06A 1S3SA 2V9PA 1FQKA 2FEMA 2IYYA 3S1AA 2GESA 2ZVPX 1KI7A 4FCWA 3BS4A 1KKLA 1R6BX 3CNOA 5CB8A 4HYYA 2ZITA 2CE7A 5DHFA 2ZUCA 3WP1B 2OAQ1 5FI1B 2KBFA 3HJNA 3THXA 4LWZA 4DVGA 2R6FA 2WWXA 3CX8A 1U0HC 1SXJE 1W4CA 5JSZB 3AEZA 5KSOA 1G3IA 1XTSA 3BBPA 2JJ1A 2PZEA 5G53C 2FH5B 5KOYA 1R0WA 1GTVA 1ZM4A 2LKDA 4P31A 3L43A 4GMDA 2FOLA 1IN6A 4ZCMA 1XBTA 1YZQA 3W90A 3OEED 3AF2A 3AF3A 4Y0VA 1AN0A 4W9MC 1XCPA 1R8SA 1EX7A 1S1CA 4EKDA 1O3YA 1VIAA 2JLSA 2P6NA 1T8UA 4NYIQ 5DE3A 2KJQA 4Q4AA 3QY0A 4E07A 1LS6A 3CIOA 3ZVNA 1CBUA 3AVTA 2C9YA 4RCZA 4IDQA 5FOWA 4JBXA 3K09C 1F48A 3E70C 4IDPA 4TMVA 2OBMA 4EUNA 1O87A 4B3BA 2DY1A 5AWFC 3TW8B 2J41A 4M21A 3CRW1 2JEOA 1AKEA 2H18A 2QU8A 5H1YA 1G3RA 4KYUA 3T1TA 4HI0E 3HDTA 1FZQA 3MCAA 3PV0A 1XXHA 4QNRA 1VHLA 5DHAA 3EZ6A 3VMFA 1SXJB 5BYKA 2BWJA 3RRMA 4TTQA 3IIJA 3NEJA 5FBLB 2RGGA 4MYHA 1TX4B 1YE8A 4LYAA 1Z2AA 4Q1DA 2GDJA 2XZOA 1SQ5A 3KFVA 3SC3A 2VO1A 1G7TA 1TUIA 4L15A 2MMCA 2WJIA 3IQXA 3MFYA 1IM2A 3REFA 3EX7C 2ASEA 3LNCA 2UVQA 4KJZA 5SZJA 3KJGA 4TL8A 4D4JA 1GL9B 1ZNXA 4NCNA 1ZBDA 3AVWA 2QM7A 2HLDA 3TQFA 4B74A 5BW8A 1WB9A 3CR7A 1K5DA 4IEEA 1FX0A 1HH4A 4TLBA 2QRZA 3QEOA 2WV9A 3SJZA 4OQFA 2NGRA 3CF6R 4V03A 3ZZTA 4GNKA 4FMCF 1I4LD 1NSFA 3K9GA 3LQQA 1UM8A 4QHSA 1F2TB 4DCVA 3P4XA 3TIFA 1A2BA 3QVVA 4PO1A 1IN8A 1DAGA 1DAKA 1YRBA 1VYUA 2ZI6A 4D82A 2W2TA 3NEYA 3KJIA 3QF4A 1E2KA 1ZVQA 4DIEA 4M1KA 3IBYA 2IWHA 5B57C 3QENA 2PL3A 2FG5A 3ICQB 1XMIA 4B6EA 2P5TB 1OIXA 4R9UC 3HU3A 3QPVA 4IXNA 1W46A 3KJHA 5E7IA 1W5TA 5B64A 5JS7A 3KJEA 2QMEA 2FSGA 2ODNA 4BZQA 1E2MA 2YYZA 3B1ZA 2ONJA 2GK7A 4BQSA 3N2IA 4URUR 2A5JA 3DPUA 1EFCA 4OI4A 2N46A 2J0VA 3FKSA 1KYIA 2ZSDA 2VF8A 4JMPA 4NU0A 1H65A 4HZIA 3I3SR 4DLRA 1NN3A 4AIIA 1AS3A 2VHTA 4YLGA 4OHWA 3MLEA 5HZKA 4L4UA 1CR0A 5JJKA 4BUJA 4LC1A 4BFSA 1NVVQ 4URZR 4PPQA 2KB0A 3K9LA 1ZM7A 3ECCA 3V4FA 4TTPA 3CNLA 1G7RA 1TU3A 2PLFA 2ZI4A 4ZDJA 2R44A 4FIDA 2ZPTX 5TARA 2Z5FA 4PC6A 1KK3A 3GJ7A 1Y63A 3THYA 1DE0A 2JGNA 4HAWA 1AZTA 2GJSA 2J87A 2H7VA 4FD2A 3P26A 2Q21A 2ZSEA 3B85A 3K0AA 5FFMA 1S9HA 2OCBA 2RGNA 1D5CA 2HV8A 4RFVA 5CK4A 4LI0A 2CBZA 3IHLA 1YR6A 1OYWA 2H8KA 3T61A 2X2FA 2LWIA 1JBKA 2QN6A 2F43A 1P61B 3LXRA 3MSXA 4AYWA 1DADA 1ZUIA 2YZ2A 2OFXA 4HAXA 2GXQA 2W0SA 2ZU6A 2QQ0A 2X77A 4OI0A 1OW3B 1P4SA 4B3FX 1EFRD 1W4AA 2B7CA 2I1VB 2ZR9A 3ZJYA 1N25A 4RFSA 2DBYA 4J0QA 1DG1G 5JEDA 2ATVA 2CNWA 1Q1BA 1HE8B 2BOVA 4TN1A 2IHBA 4WZ6A 3VKGA 4X8OA 3KQNA 1GRRA 3UG6A 3VX3A 1ZYUA 4O2RA 4LHVA 1J8MF 4TZ0A 1Z8FA 4FMBB 3VFDA 3IEVA 1Z5ZA 3LBHA 3QG5A 4HDQB 4PHFA 3KUDA 5CYPA 3GFOA 3TAHA 2ZE6A 3QKUA 3EWAA 2EU8A 2ZS7A 1W0JA 3CPHA 1CULC 4M1OA 5FBRB 3UATA 2QROA 1XPUA 3DMDA 1G3QA 4Q4JA 1UPTA 2BM1A 4MH0R 5HKKA 3SQWA 4AKGA 5TMPA 1AGRA 1W36C 2VEDA 1QHNA 1CEEA 2ZI9A 2QL6A 4PZLA 3FFAA 2FA9A 2NZ8A 4B34A 3L0OA 2EWWA 1DAIA 2HXSA 5F2EA 4F7WA 2BCGY 3HP1A 4OI2A 1K5GA 5CM9C 1N3BA 1II8B 4DSNA 2JATA 4JT4A 4ZDKA 3QKRA 4LJ5A 4N1AA 4MGIR 1NLZA 2WM9B 1G16A 1VCMA 4LV8B 1FTSA 1LB1B 1UAAA 2W83A 2Z0MA 1IY1A 4JVSB 3OE7A 2OILA 5DGXA 4P33A 1Q57A 1XJCA 2OG2A 1U81A 2QGZA 5ANRB 3SN6A 3LO5A 2VA8A 2W2VA 3X1WA 2QG6A 3LY5A 1AS2A 2BDTA 4S2EA 4N3NA 4NPHA 1Q1ZA 4A0GA 4TMWA 3PVSA 4KI0A 2JLVA 1Q1EA 1TQDA 2I4IA 1DARA 1F6BA 3FFBA 2PH1A 4YMWA 3CF0A 3AUYA 1RRCA 2AX4A 5FUXA 3KL4A 2MMGA 1CXZA 3NHAA 4R2HA 2QGNA 1R7RA 4CEHA 1WP9A 3A1VA 3LV8A 3FOZA 1SVMA 421PA 3FHOA 1G64A 5KDOA 2DHRA 2F1JA 3GD7A 3DZDA 3GJ5A 4UXJA 1TMKA 4JL5A 1SVOA 1KI8A 2YOGA 5EP1A 1NKSA 3AVQA 1NLYA 1Z6GA 1P2SA 2BEKA 2E87A 1DAHA 4JIMA 4Q19A 1B0UA 2FGJA 1OH7A 2GILA 4B3CA 4RY2A 2RGNC 3B82A 4TZ6A 2PLRA 3GJ0A 4NE2A 2F55A 3E5HA 5KUTA 1QG4A 1FOEB 4ERNA 5F3WB 4HDCA 3QSYA 2GWHA 2QRNA 3S1AB 4DEXA 1YVDA 1OLOA 3AKEA 4YMUA 4LCBA 5AUNB 1PLKA 5C18A 2GVDC 2W2XA 2NO0A 2OZEA 3PUZA 4Y0AA 4TLCA 5LB2A 3U7HB 1E9CA 4IDNA 5FL7D 4OQXA 1SKYB 1KJZA 2X8AA 2O0KA 2P5SA 2YHSA 4MKHA 1N6OA 3EC1A 3IO3A 3K9HA 2ODBA 3OAAA 3AP1A 4HAZA 1HA3A 3Q5DA 4QJ3A 2FX3A 3VAAA 1G7CA 2OFWA 2QTHA 3I62A 1P6XA 3TR5A 1CTQA 5KO2A 3CPJB 1VG8A 5CITA 4RZXA 2XOKA 2OAP1 2BBSA 4G1UC 2GCOA 1JR3E 3RS2A 4Z54A 5G41A 2F1RA 2FPLA 2QAGA 3CX6A 1GL7A 2XTNA 2O8BA 1X8JA 3OE7D 5JRZA 4MYUA 1N0UA 1XDBA 1DO2A 4TL6A 1E6CA 4GPTA 2R6GA 3ZZ0A 3QPWA 2G1KA 3ZQJA 3DZ8A 2J3EA 2G3YA 1CKEA 2IA5A 2VF7A 5KSZA 4ON9A 2RGEA 3DO6A 5D3QA 1V43A 4AC9A 1H8HD 2R8RA 1BMFD 1DEKA 1KI6B 1QHSA 1Z07A 2X2EA 3ASYA 1M1YE 4QBHA 1FNMA 3GEIA 5J40A 4K46A 4CVNA 5EP2A 4GOKA 2OBNA 3I92A 4LDJA 1ESMA 1Z0FA 2R9VA 4TT3D 3KUCA 4MRNA 2CVFA 1EESA 2IXFA 1HQCA 3SJBA 1U8ZA 3PCRB 5DI3A 4EIWA 2O5VA 4DB4A 1ZC3A 2AN9A 2WWFA 4P3YA 1VG0B 3FMIA 5G3ZA 4C7OA 2GEVA 3ND8A 3K53A 3BH0A 2CEAA 3UKDA 2UZ3A 4D0GA 1MR3F 2VH5R 1T4GA 4XH9B 1R5OA 2QI9C 2IYWA 1TEXA 3MRSA 3AF4A 5JCZA 1FL9A 5CK5A 1U0JA 3KXKA 1WE2A 2RGBA 2C9OA 4LHXA 2FZ4A 1WDTA 2ZJYA 3WYGA 4TYYA 2VRWA 1GNRA 3DOEA 5AUPB 1TQ2A 2HCBA 3LFUA 4AURA 4ESHA 1XTIA 2V7QA 2WMNB 1R5NA 2Q9AA 5FI0B 3D6TB 3PG5A 1DOAA 4RCYA 3EW9A 3QNUA 2GXAA 4IVQA 2XNDA 1CRPA 2FV8A 1SHZA 2QMUA 1E2PA 1U2RA 3ZS8A 1XTKA 3DOFA 1YU9A 1XNJA 4KLNA 2WPDA 1XPRA 3SFZA 2FEOA 3WBJA 3QF4B 1KK1A 1F2UA 1G18A 1GKIA 3WRXC 4URXR 5JI2E 4AWXA 2D2EA 3T1QA 4XVUA 1TQ6A 3CM0A 4EFMA 3EASA 1W36B 1N5KA 1X8KA 4EFLA 2GJAA 2O8CA 1NMYA 3QI2A 2ZSBA 2IWRA 2GKSA 4P4SA 4RZUA 2ECKA 3L82B 1KSHA 4V0ME 1FNNA 3JZAA 1BYUA 1G8YA 2A9KA 4X8HA 3W6OA 1CR2A 4B3DA 4OKSA 3P27A 4V0KA 2ZM5A 4EPRA 1CJKC 3NXSA 4G5QA 2AWNA 4H9GA 4TT3A 4Q7MB 4DLUA 3WMFA 3SJCA 4DLSA 5JJLA 2YWHA 2OE2A 1AQUA 3RSOA 2B92A 1HE1C 1NJFA 2ERXA 5DYGA 3JZMA 1G3MA 4PZZA 4EPWA 4D80A 2AD5A 3Q7QA 5FTJA 3MGCA 3PUWA 3THOA 5FOXA 1OHHA 3OIVA 1ZC4A 2GF9A 3BH6A 4TYPA 1W44A 2ZVQX 1FTNA 5G3YA 1VECA 2FGKA 3THWA 1VG1A 2QAGC 4JSYA 4KSCA 2IUSA 4KFRA 1Z29A 3BE4A 3EG5A 4Z1MA 1KHTA 3GLIA 2ZJBA 3OEEA 4PX9A 2AR7A 1TL7C 4GZLA 2OO7A 1T8TA 4UXHA 3OEHD 1Z47A 5TDHA 4DCNA 1ZNYA 2DPXA 5IT5A 4HAUA 3LA6A 4CEJB 1RZ3A 2WSSD 4Z8YA 5IHPA 4MRRA 4C0HA 1E9AA 1E1RD 1KDRA 2OHFA 1LNZA 3IEUA 1I4TD 3ZGXA 1E94E 3W3AA 4Z51A 4LBVA 3X1ZA 2I3BA 3ZVLA 2YJTD 1SXJC 4BPBA 1QHHB 3GLHE 1JEDA 3SQXA 2O0HA 3QBTA 3LVRE 3NC0C 3L0IB 1GVNB 4PTLA 2V7QD 1R4AA 1GSIA 3BORA 2IS4A 2BBTA 1Z6YA 2D74A 1JAHA 5KNBA 3VKHA 3CRVA 3LDAA 4LX0A 1LW7A 2WAYA 1G4UR 4MUAA 2XNDD 5E4FA 3RC8A 3SYLA 3BJIC 4WZAE 3B1XA 1KO8A 1FUKA 3WRYC 4O3MA 2YKGA 1YRAA 1KTVA 4HSEA 1W49A 4B32A 1US8B 2ZRPA 3NIBA 1E2DA 4G5RA 3O47A 1RVDA 2K5UA 1M7BA 1P9RA 4P0TA 5FH9A 3QE0A 1G21E 2NTYC 4PC7A 3IBGA 3GLGE 1II0A 3Q8XB 5LB4A 4PQRA 4AI6A 4A6XA 4CT4B 1J7KA 2CE2X 2JIZD 4L9SA 4CZ2A 3C8UA 2A5FA 5EE9A 3TGPA 5JHGB 5D3MB 2J0UA 4HLQB 2EFGA 3R20A 1RKBA 4V0NA 1IQPA 2DR3A 1BH2A 3CX7A 2CK3D 4HB2A 1GIAA 3QEJA 5DISB 1M74A 4V0OA 3ZVRA 1SGWA 5M04A 2EYQA 1PUIA 2WWYA 4HLUA 3TSWA 5JJIA 1RJ9A 2IYVA 3GLHB 1XZPA 5FOSA 4DBLC 4IHQA 4LJ8A 2J7PD 2C2HA 3J81k 2JLXA 2BBOA 1WMSA 4ABYA 4L8GA 1D6JA 1VYTA 3AGQA 3OFND 4KLZA 4DB2A 3NBYC 3U5ZB 3HR7A 1Q22A 4A8JA 2REBA 3WBKA 1YR7A 4OQMA 2ZRCA 5JI3E 3VR1A 1ZAKA 3EIEA 3D3QA 4MGZR 2HYIC 3D31A 4AD8A 2C78A 1UBFA 4A36A 3U44B 1XU4A 2VBCA 4CEIB 3A58B 5SZKB 3F3YA 3GLFA 3W34A 2P6RA 1BOFA 2W6ID 2YINC 4BFWA 1Z6AA 3HPQA 2HT6A 1G20E 3FB4A 3B6EA 3A4MA 2AK3A 4GRAA 1UKEA 1UBEA 2FFBA 4U00A 4V02A 5EUQB 2WPDD 2YWFA 1KY3A 4M1SA 4U5XA 1SZPA 1UF9A 2GXUA 2QPAA 1NN0A 2OCPA 3CO5A 3QOFA 2IYXA 4A4DA 2QE7D 3LVQE 1P9WA 2R2AA 4LJAA 1AGPA 2C95A 4L16A 5HKKD 5B30A 4C0SA 1Z6TA 4JKYA 1G6OA 1J2JA 2P2LA 4FWIB 3EZ9A 1CP2A 1DAFA 1XTQA 1YJ5A 2C8VA 3W8NA 1JR6A 2H57A 4FMDF 4XWKA 2OXRA 1E9SA 1IN7A 2AXPA 1CU1A 4EPXA 3X1YA 1D9XA 4JVNA 4NCJA 3LQRA 1OSNA 4ZIRB 1XMSA 1KSGA 4DRZA 2O8FB 2H16A 4C3ZA 1MO4A 4Q7KA 5AJYA 2QBYA 1M2OB 3KTAB 3IPYA 4DEYA 1M6NA 1EWQA 1RRGA 3BXZA 1W4RA 1YKSA 4WXRA 2ATXA 4BZPA 1U94A 1XTRA 2NO7A 4PQYA 1P9NA 3DM5A 1ZNWA 4KHZA 2Q9CA 3A1SA 3BWDD 3NBXX 2EYUA 3OZXA 3Q85A 4XSGA 1E32A 1G17A 3EAQA 1JXOA 1GUAA 1ZCAA 3GEHA 4KXFB 3AVUA 221PA 5DIFA 3TR0A 3VNVA 1P62B 4IW3B 2DWQA 4XTCS 2E1RA 1KOFA 4KITB 2Q0HA 1ZINA 3I8SA 2GETA 1KMHA 2IK8A 1Q3TA 3SEAA 4F4JA 5K8UA 1SKQA 1LY1A 2NPIA 1EGAA 1S4QA 2REOA 4EAQA 3AB3A 1RYHA 3QKTA 1D2MA 3C15C 4YC7A 1GOTA 4TLEA 4PAOA 4MRVA 5FBVB 2G77B 4B35A 5L3QB 4R98A 4AYXA 3K0EA 4JLPA 3TUJC 2ZJAA 4F92B 2WHXA 3B1WA 1LVGA 3A37A 1SVSA 1W48A 4LHWA 4GT1A 4NL4H 4DLXA 2GJ8A 5HR5A 1Z22A 3EPLA 1WQ1R 2UKDA 4EQ6A 2XXAB 3QPUA 1WBBA 3H2YA 2FJUA 5FTLA 1T3SA 2B8TA 3CLVA 4HLUC 1CR1A 1OXUA 3PEYA 4Q47A 3NBZC 4HEJA 4B71A 1NP6A 4DLVA 2O8EB 4I1OA 1XP8A 4B73A 3NH9A 4ZKEA 1OFUX 2QPOA 2W58A 6Q21A 1KZ7B 1DO0A 3RANA 4X8LA 1KDOA 4LJ6A 4EJSB 4E5UA 1NJGA 3B7GA 5CLQA 4M53A 1E2HA 1NN5A 2CXXA 3UWKA 2CL6X 3FHCB 4G3XA 4TYWA 3OIWA 1JI0A 4Q4LA 4HUQB 4H1VA 4XOIA 4Q9HA 2JJ2A 4ZV4A 1PV4A 4TQ9A 2V4ZA 3IPXA 3I61A 3P32A 3DMNA 4NYMQ 2ZQ5A 4JLDA 1ELOA 4S35A 1VCOA 5FR2A 3VQTA 3RAPR 2XZLA 3B1VA 4ZDWA 1JEEA 1KI9A 1E2GA 4QFMA 4DXAA 4A92A 2REXB 3F0TA 3RS5A 3M6AA 1DTSA 4OHYA 4EPTA 1T0JB 5J4VA 3THXB 2WAXA 3AVVA 1II9A 2GEUA 2J7KA 2IYRA 2WBLC 5GVRA 2C04A 4LJYA 4B2PA 3V4RA 1H8ED 1T91A 5J5CA 4C2TA 1K6MA 2YNMA 4M1MA 3CR8A 2WJJA 1WA5A 2HUPA 2FE4A 1FX0B 4HZUA 4IXMA 2DWPA 2G0NA 2G9NA 1XEXB 1OFIA 1G4AE 2X1VA 2O8DB 2PJZA 1RYFA 3ZS9A 2IS2A 2XX3A 3RS7A 1NSTA 2ZYVX 2ZSAA 3FE2A 3SYNA 4B3GA 1N6PA 4GP7A 1S3GA 4OBEA 4OHZA 2V1UA 2C98A 4CW7A 1XEWY 2LKCA 1J99A 3R8FA 1LS1A 4HLDA 3U7FB 4TWZA 4CYMA 4Q4AB 3WNBA 5BN3A 2CHGA 3I4LA 3GEEA 4GSYA 2C9CA 1JB1A 4I99A 4NTZA 4ARZA 4TL9A 3A1TA 3FWYA 1ESNA 4DJTA 1KI3A 4FXPA 2ZRFA 4I1SA 1RPZA 5CDFA 1D9ZA 2FF7A 2NPFA 2JLWA 1NLFA 3QKSB 3P20A 3ZIAD 4CDGA 2ZRHA 2QT1A 2AKYA 3JVUA 3RS0A 2VPPA 4OK5A 4RD2A 5K8TA 1SXJA 2PEZA 3JVVA 2Q3HA 4NZYA 3L8ZA 4EPVA 4DC9A 2JDIA 5EXTA 1F3OA 2KI5A 4A82A 3IHWA 1S2MA 1OXTA 3IDQA 3RVBA 1XD2B 4ZO4A 4MUBA 5JWRA 1E2EA 1QRAA 2BMDA 3W6PA 4XJXA 4C4PA 4DT1B 2PT5A 3I8XA 4RKEA 5FOVA 4FCTA 1KI4A 5LDDC 4W5JA 4Q1EA 4CRWB 1NG9A 3WMGA 5FOUA 1QF9A 2IX3A 1XD9A 2GA8A 3K0SA 1AM4D 4LUCA 2VYFA 3BFVA 2FZLA 2ZS9A 2HXYA 3QIAA 1E9EA 5GJWC 3U3MA 4DCSA 2QAJA 5J4YA 4MITA 2Q6TA 1VKJA 4DLTA 3VU9A 2VQSA 1MH1A 2MSCB 2BEJA 1E3MA 4PAQA 2ZRDA 4D4LA 4O25A 2DCUA 4R71A 2GVZC 2A5DA 4Q4HA 5K8LA 3C5HA 1X86B 4PPFA 4ESVA 1W4BA 1XD8A 4NYMR 4TLAA 3U4QB 2IYLD 3B2EA 4Q00A 2IL1A 4N0EA 3CKLA 1E1RA 3KXLA 1MO3A 4FMCB 4OYHA 4KVGA 1TF5A 3B60A 1GITA 2WSSA 1E96A 5LD2B 4MQBA 2UZIR 4WAUA 3BB1A 5J4KA 1QVRA 4PSAA 1A4RA 3F8TA 3T1OA 3SHWA 1N5IA 1VCNA 5KSYA 2GF0A 1RE0A 3QXJA 5DSZA 4C0KA 4CF7A 1KAOA 2PBRA 2R65A 3GLHA 2JLYA 5B58C 2JDID 2FPKA 2VHQA 1E9FA 3RRZA 1HYQA 3KQUA 3ASZA 4OJKA 1F2TA 1VMAA 3ZLJA 5AK0A 2CL0X 4PXAA 3TSZA 1JPJA 4AKEA 4CIDA 4YONB 4JBYA 3A4NA 5F9HA 4A8JB 2WOJA 3I1FA 5CLLA 3RSLA 3AGPA 3KFXA 4BFTA 3KQHA 4JJZA 4BFUA 2ORVA 1QG2A 3FMFA 2ZTSA 1U8AA 4P4TA 3MJRA 2QMHA 5C2JB 2ZAMA 2VP5A 2AL7A 4YMSA 2JJ2D 1UDWA 1TF7A 3H86A 5JRJA 1E0AA 4HATA 1BO6A 2P6UA 2WICA 3CBQA 5KPJA 3EPHA 1KO7A 3HU2A 4PO8A 2HT1A 3HYTA 3QF7A 1E9BA 5FPHA 3E1SA 4P4UA 3T06B 3GQBA 3PITA 4I81A 2PEYA 3ND9A 4RSGA 3TJZA 3AP3A 1FW6A 4JYCA 1AS0A 2GAAA 3U3OA 2CJWA 1W0KA 3LWNA 2OFOA 2JJ1D 1Z0IA 4II7A 4OQLA 4LBZA 4RFSB 1U8YA 1W2GA 2FPMA 2D3WA 4M4SA 1NNEA 1SVIA 4QXAA 3TSOA 4AG6A 5JZVA 2C03A 4ACBA 4PR0A 4A0HA 1E4YA 1EXMA 5FL7A 5LD2C 2CCGA 1A82A 4PO9A 3AVPA 4MDFA 1RFLA 1E1QA 1W1WA 2RHDA 5GJBA 1XJQA 1JR3D 3MAAC 2P3SA 2A78A 4TSFD 1XFAA 4Q7LA 1KJYA 4NP6A 3CZPA 2Q3FA 5B2ZA 4BEJA 4C0BA 1BS1A 2A5GA 1E4VA 4Q4JB 4WZBE 5K8IA 5BN4A 2JASA 1Z3IX 3B78A 1UKZA 5GJVC 4ASUA 3RDPA 4XWAA 3DM9B 4I1VA 4R7ZA 2F43B 2RCNA 4JLJA 5EZ5A 3HU1A 4YXWD 2J5XA 5P21A 4UNPA 4QM7A 4C0LA 4US2R 1EX6A 4A1FA 3NBFA 2BVNA 2W0MA 3F5FA 4YDHB 2Z6VA 5EUMA 3SR0A 1OH8A 4QKQA 4LBYA 1P73A 2JA1A 3N70A 4BE7B 3CNNA 1PUJA 3LW8A 3AVOA 2ZE7A 4JLMA 2BKUA 3TLXA 3SU8A 1IHUA 4W5HA 1YZUA 2ZRNA 1OKKA 2ZROA 1IXSB 2PCJA 1ZM2A 3QXHA 4LRWA 3T12A 2FU5C 4JLOA 1A5TA 5CM8B 3PEVA 3CONA 3U7EB 3I5YA 3KB2A 1HV8A 5KTYA 4CT5A 3ADDA 5JLJA 2OCAA 2IEZA 2ZXUA 3AP2A 4Q66C 1ZU4A 3EC2A 2ZR7A 3M0EA 3CH4B 2N1BA 3NDBB 4FMDB 2FSIA 4MYCA 1Z2CA 5EE0A 5A4JA 1KI1A 3ADKA 2QE7A 4JLKA 1TTTA 3PUVA 4HB0A 3ICEA 3AQ4A 3CF2A 4HB4A 3TKLA 1U9IA 2QM8A 1E1QD 3H1TA 1S9DA 4I4LA 3QKRB 4Q18A 5BWMA 2XTZA 2XOKD 4A15A 1JQJC 4W7SA 2JCSA 5KNDA 4KCGA 3O8DA 1L8QA 1CJTC 5CJ2A 4B6FA 3BIFA 2HLDD 4BLOA 5A5GA 3UMSA 4QBIA 1Z0DA 4ZI2A 4MRSA 4U02A 3UMFA 1PLLA 2H1LA 3BFXA 4QGFA 5DN6D 2NZJA 2BMJA 1BYIA 1TPZA 2NO6A 2VP9A 2BJWA 3FKSD 2XAUA 2F1HA 2OESA 2DB3A 3PENA 4LJ4A 2ANBA 1N6LA 2RH5A 721PA 4BECA 3R7WB 4B48A 1GNQA 1B23P 4K8OA 2QSYA 2ZAOA 1OB5A 1VHTA 5IRCD 4LPSA 4QRHA 4KYIB 1XPOA 4D0LB 1P7CA 3RNLA 4UKDA 1KSJA 5DI3B 5AUQA 2FFHA 4PPNA 1UKYA 4UJ5A 1X1SA 1HY3A 3C7KA 3RWMB 4W5WA 4FW9A 2XITA 2HYDA 3GJ3A 1Z0AA 4KSBA 5H8WA 4GL2A 2D62A 2P65A 3NWJA 3UK6A 2G83A 2EFEB 2RGDA 1OB2A 3KXIA 3KKMA 5HCIA 2VTKA 4HAYA 2WTUA 4IKEA 3ZZUA 4GDFA 1XZQA 1VYVA 1ZIPA 4BLPA 3LBNA 3B9QA 4XTRA 5L3SB 3CWZA 1MO6A 2VL7A 4PC3A 4Q03A 3BB4A 2DFLA 1P5ZB 1EG7A 4HZUB 3A8TA 2ZI7A 1N0WA 4DHEA 4C2UA 2EFHB 3OIYA 2BM0A 2XNSA 3RS4A 2NMVA 4NCKA 5CYOA 3QG1A 4TTRA 5JS8A 4PZYA 2QZ4A 1MABA 2GBLA 3MJHA 3T5DA 1KGDA 1XF9A 4LOAA 2QAGB 2WJYA 1ZD8A 1OH5A 3OIUA 2GCNA 3KKOA 2FN4A 3GJ4A 4LC0A 4QJ4A 4JLBA 1W36D 2IS6A 5HPYB 1N6RA 2GJ9A 2QTVB 4QG7A 2OBLA 4HAVA 4GOJA 4ARZB 1ZNZA 2NIPA 3TRFA 2BMFA 4QBGB 1R2QA 2WJHA 4MKFA 1D8TA 1NBMD 3A1UA 5JSZA 2J9RA 4C0AC 1IBRA 3FMPB 3TAUA 5CB6A 1YZKA 3CZQA 5KYKA 3AV0B 2FNAA 4YMTA 5AJXA 1ZM3A 1X3SA 2VP6A 3LX5A 521PA 1EK0A 2IC5A 3V00A 1DAEA 2G0TA 4NONA 2F6RA 4QNMA 3ZYCA 3SS8A 3VR5A 4MDEA 1U99A 2L0XA 3K9NA 5EXPA 2CLSA 2PMKA 5SZHB 3MWLA 1ZRHA 1E79A 3BK7A 1IXRC 4M1YA 4G01B 1R10A 2QP3A 3QBVA 4G0NA 4RZ2A 3TQCA 4C7OB 2J0QA 3TK1A 2CCJA 4WW0A 4KODA 2OEPA 1JNYA 4OK6A 4Q1FA 4WBSA 3MUFA 1FQJA 3B1YA 3AUXA 5FPTA 3GJ6A 1OJLA 2EWVA 2CLDX 1ZIOA 3M1IA 3SJAA 5H68A 1NY6A 4UNQA 1HT1E 4LSGA 4JLVA 4DCUA 4QGHA 3HYRA 3W9YA 4OQNA 3WHKA 5FR1A 4QC2A 2VP4A 5CIQA 3VHXA 3VR4A 1KO1A 3NVAA 1QHGA 1NVXQ 1E0SA 1D2NA 2PX3A 1XXHB 2GZHA 2W6JA 4PC1A 4PFSA 2A5YB 5G40A 5A0FA 3QUSA 4G5GA 3R9WA 1KI6A 3K0CA 4KAXA 2AK2A 3RWOA 4EFNA 3U61B 3FKQA 2ZRAA 2OLKA 1WCV1 4HLCA 4Q4HB 3LX8A 1E79D 4WVFA 3CB4A 1Z6XA 1P75A 3BAFA 1C1YA 4M9QA 3W6NA 1VTKA 1F2UB 1BMFA 1S8FA 4PHHA 4HDOB 1U9IC 4M8NE 4WA7A 2ORWA 2IYTA 2WIBA 1QHHA 2O8CB 4XIGS 1HT2E 3PUXA 1L2TA 3EXAA 4D4MA 1E2FA 3IIKA 4F38A 2GAOA 2D2FA 2VHJA 3H0KA 4DDTA 2H17A 1EFRA 4LYJA 2A2ZA 1K8RA 2AD1A 3LLUA 2DFKB 3O8BA 2F7SA 2PT7A 4DDWA 4M9ZA 5GVSA 3BD9A 1UDXA 1ZMXA 2QEQA 4RD6A 2YV5A 2W00A 3TMKA 1CIPA 1J90A 3FMOB 1T6NA 4NBSA 4C9BA 1NIPA 3ONWA 3PIRA 3G82C 5EZ6B 3FVQA 4Z1MD 1DS6A 4JSTA 5BYJA 4DWJA 2IYUA 1OH6A 4U7DA 2C99A 1HUQA 3QXSA 3U3RA 1ZM9A 3IO5A 3CRQA 2F3RA 5FTMA 4TMZA 1YR8A 5KU1A 1RRPA 1W2HA 3EIHA 4KFUA 5KHOC 1N6NA 2IYZA 1FP7A 4Q1AA 4O0MA 4NYJR 3LW7A 2WVJA 2YWGA 3D8BA 2XSZA 2Z4RA 2RGAA 3EARA 1T9HA 2XTMA 2N42A 4B76A 2IUTA 4QM6A 1ZCBA 1FUUA 4IOLA 3VR6A 5JWOA 3TBKA 4B2IA 1OPXA 1QZXA 4KO8A 3LAWA 4Z8XA 2O0JA 4IVRA 3REGA 1VG9B 5HZHA 5KPDA 1JJ7A 2WWIA 1OFHA 4BFZA 3BH7A 4XVRA 1CF4A 4NH0A 1MO5A 3CW2A 1CRQA 621PA 5FBQB 2BV3A 1KK0A 4JLNA 4FN5A 5TB5A 3SBEA 4PSKA 4IRUB 4DSUA 1KNXA 2E9SA 3KKPA 4ACAA 5LPNA 1G41A 2YVUA 4GZMA 4N0DA 2ZR0A 3K0FB 1G1MA 4TLDA 3QJYA 4IFEA 3H84A 2GRJA 3K0AB 3GPLA 3ZIAA 5EXSA 1SVLA 3OHMA 2PZGA 3DL0A 1JQLB 1HURA 2ZETA 3G5UA 2PJRA 1R0YA 2WIAA 2QSZA 3Q72A 5FPSA 3T15A 2WWGA 3TW4A 1D2EA 2B7BA 2RGCA 3LRPA 2IXEA 2ONKA 4GMXA 4IVPA 1U98A 1KK2A 2FFAA 3OAAD 3RRNA 4BFYA 1COWD 1BKDR 5E95A 1G3UA 3AVXA 3AKDA 4YMVA 4Q02A 4TQAA 4MGKR 2WSMA 4EPYA 3I32A 2ZRKA 4GOXA 4LZZA 3ZQ6A 3ZD7A 3OEHA 4OL0A 5H70A 2ZE8A 3L2OB 5C1BA 1NBMA 1AIPA 3K0CC 4LHZA 1T3LA 2EW1A 5UKDA 2J0UB 5TXGA 3L8YA 4LGMA 5DO9A 4FINA 4IDOA 3WNCA 3BC1A 2RAPA 2ERYA 4DLWA 2GZAA 1NVUQ 4M1TA 3C14C 3GP8A 3EPKA 3B8HA 1FMJA 2F9LA 3EZFA 1X6VA 121PA 1G8GA 4ZI3A 1S96A 1P2UA 3TUIC 2G88A 1HEIA 4Q1BA 1RJ9B 1GDDA 1J70A 3NHBA 2V1XA 4LPKA 2O8FA 4F4CA 4M0LA 4A0FA 1TEVA 2CK3A 5J4HA 2WKRA 4Q21A 3GLGB 2P67A 2ZANA 4BLQA 4D81A 2IYQA 4BZXA 1YZGA 4DUGD 3EIQA 3RS3A 3UIEA 2VLIA 3VR2A 5L3VA 4FI3C 1VCIA 5AR1A 3M4YA 1GAJA 3GFPA 1UKVY 2IBMA 2ZRGA 3U44A 4YXWA 4MYTA 4UJ3A 4EDHA 2QT0A 1II8A 2OV2A 3NH6A 1E0JA 1G5TA 3WMEA 2QORA 2NO9A 2IW3A 3VR3A 1ZW6A 4PSVA 2DFNA 2JIZA 4HUTA 1W0JD 2KE5A 1GZSA 4AK9A 1T0HB 4B44A 4DSTA 1OIVA 2OM2A 1GL6A 4TSFA 1OXSC 2ZUBA 3TVTA 3UMRA 4URYR 4ZDIA 2JLZA 1KO4A 3SE0A 1G19A 2BJVA 4M9SA 4WOPA 2KSQA 4IEIA 2CCKA 2CNWD 5FPYA 1EWRA 3FPAA 1KAGA 4ILEA 4QHYA 1RC8A 4V0MA 2GXSA 4G5SA 2H92A 5J47A 1FPMA 4O2LA 1JECA 3OESA 3D7MA 4LJ7A 2CVHA 4BLTA 1XMVA 2AFHE 1Z08A 5HTKA 3VX4A 5KDDA 1E99A 3IGFA 2RHMA 4GI7A 2V8OA 3THYB 1RW4A 4DLYA 5AUOB 1QDEA 1ZD1A 4PHTA 4CEIA 4QOSA 3GFTA 3CRMA 1N6HA 5DI9A 1TNDA 3TNFA 2D06A 2BIFA 4AKHA 4JLAA 1WRBA 3BRWD 4RZ3A 3KTAA 3GLFE 4ITRC 4KV9A 2J0SA 3W8RA 1M7GA 2ZRMA 3KKQA 5C46F 5L3SA 2ODEA 5FOTA 3AVYA 4XVQA 1OKKD 1QVAA 4MRPA 5BN5A 5JBQA 2ZU0C 4HUQA 1UEIA 1IJFA 1DELA 2OT3B 2ZJ5A 4LBWA 2JLUA 4E22A 2J45A 3FDIA 1E2NA 1MABB 3CH5A 3N2EA 4MA4A 2HEIA 5HCNA 1CLUA 4US0R 1NL3A 3RLFA 4QJ5A 2RB4A 2XSZD 4OHVA 2IF0A 1KMHB 3BB3A 4KFTA 1TF2A 1ZUNB 2VHUA 3EZ2A 3L0PA 4RD1A 3UANA 1FFHA 1LF5A 1M8PA 4IOMA 3BFKA 4TYQA 1E2JA 2ZJOA 2FSFA 1JAIA 2BBWA 3PR1A 1N6IA 1MRNA 4NKRA 4P32A 4F4IA 4ZCIA 4ZIRA 4F91B 5JMTA 4ASUD 4B47A 1OFTA 2ZJZA 4UNNA 5DH9A 4Q5IA 1AKYA 4RD3A 1YZLA 2VSOA 3FYHA 3LBIA 4IFBA 2ZUDA 4X8MA 1R8QA 4QL3A 4BLSA 3ZD6A 2XB2A 2NG1A 3T5GA 3AKYA 5JFGA 4FCVA 2WJVA 4UQOA 2ODWA 4Q9JA 4A2WA 4IDHA 3EA0A 2A3RA 5EXXA 4B2LA 2Q3MA 1NRJB 3A4LA 2CL7X 2VSFA 2VIIA 4POAA 3PUYA 1BIFA 1EFTA 4OK3A 4JBWA 3N5CA 3EWSA 2O8BB 1GKUB 4TL7A 2PZFA 2ZRJA 4Q9KA 3TVDA 4XSHA 2QTFA 5AJZA 4NHOA 1UBCA 4EJSA 2ZYUX 1KO5A 2EFDB 4KBGA 2ZI3A 1DBSA 4A8JC 4NCHA 3RYTC 3CRRA 2R6DA 2GZDA 3RRYA 2W6IA 4JL6A 5L3QA 3G0HA 4BLRA 1XEFA 3Q5EA 2ZS8A 4G5OA 1G5PA 1J8YF 1Q12A 1N6KA 1OXVA 4GP6A 821PA 2OCYC 4PANA 1P72A 1AZSC 1G291 1QBKC 2OUKA 5JHHB 2GNOA 1IXZA 2QMOA 1XMJA 1KSFX 2XXAA 2YOFA 4M1WA 1UADA 1IY0A 2G6BA 3A6PC 4DKXA 1OF1A 1PLJA 8OHMA 2Y8EA 1CR4A 3AH8A 3I72A 5IF9A 3I5XA 3VNUA 4LJ9A 2R6AA 2XZPA 2RGXA 4CGZA 4US1R 1OT3A 1ANKA 2NO1A 2IF2A 3LXXA 1XEWX 4CEHB 4BRUA 3ETLA 1TQ4A 5EE1A 4B43A 2ORIA 3MWJA 1NN1A 3R8CA 4XD7A 3NG1A 2QA5A 3SYKA 4M9XA 1XJ0A 1ETUA 3UWOA 1NMXA 1Z28A 2C77A 1R5BA 5CJPA 1MOZA 3P4YA 4XD7D 1ZU5A 1WXQA 4TMXA 1YQTA 2V54A 1NVWQ 1NIJA 4D26A 3QXXA 2IS1A 2Z4SA 1A2KC 2WJGA 2P0EA 4PHGA 2J59A 1JJVA 2QQEA 2IUUA 1WBDA 1OE0A 5LBIA 3QVUA 4NMMA 3IILA 1CJVC 2YC4C 5FUWA 2XJ9A 1TAGA 2ZRLA 1L4UA 4AG5A 3VHLB 5KSPA 3BOSA 5SZIA 3HWSA 1KJWA 4MKGA 3IIMA 2B6HA 4V0LA 4MKIA 2QP4A 1I4DD 2ANCA 1G9XA 2CDNA 3CUEF 1KI2A 1GP2A 2C5LA 1XCMA 1A1VA 4PC2A 4C30A 1Z83A 3WYAA 3K70C 4P4SB 2NOAA 3ZVMA 2AKAB 3LLMA 3CPEA 2V6JA 4WIAA 3W3ZB 1UBGA 1IONA 2F9MA 2BHRA 2MSEB 2B8WA 1G7SA 1XEXA 5BXQC 2D4HA 2O8DA 1CJMA 1N2CE 3PEWA 2EQBA 2I1QA 5C4GB 2SHKA 2HF8A 2RMKA 2GCOB 2WMOB 5KDLA 1Q1QA 3B9PA 1S1MA 3BERA 3PFIA 4M2LA 3RHFA 3SOPA 3V9PA 1IY2A 1GRQA 1MT0A 3SDZA 2FFQA 5EP3A 3U60B 3EZ7A 2ZEJA 4IOJA 4RJLA 4AYTA 3HR8A 4JKIA 2ZYWX 2GHIA 4TYNA 3DKPA 2WWWA 5J4LA 5AJVB 2GJKA 3KKNA 2FWRA 1XXHE 1PJRA 2BKEA 3E2IA 1G8FA 3K0FA 4BWYA 4LV6A 5EQTA 3WP0A 4AKIA 3THWB 3IKJA 1XTJA 1EFHA 4D25A 1RIFA 2IEYA 1GG2A 4C0JA 1G6HA 3KQKA 3L0SA 4PAMA 1E2IA 3GLIB 3QKSA 2D7DA 2CHVA 2Z83A 3K8YA 2ZREA 5CDFE 4JL8A 4FWTA 2OLJA 4A2QA 1MRSA 1Y3AA 5EE5B 4LK2A 1I2DA 1TADA 4TMTA 1E98A 1FP6A 3U7GA 4C0QC 1M34E 2V6IA 5IK2D 3U4QA 4K81B 3SFVA 2GCPA 3KB1A 5DYIA 4A6PA 3WY9A 1KNQA 1Q0UA 2J1LA 1X8LA 1KDTA 2AHOA 1XD2A 2IHYA 2R6CA 2DWOA 4F93B 1CS4C 2DYKA 2V55B 4EJSC 4LY6A 4A0RA 5CIWA 4L9WA 4KVAA 4DT1A 1SKYE 4TMKA 3K70B 3PXGA 1ZD9A 4GBMA 4D0NA 1NG1A 1Z0KA 3K1JA 4LYHA 4HB3A 1GM5A 4NCIA 5GADl 4JVMA 3T34A 1IN4A 2FSHA 3TE6A 1R0ZA 4I1UA 5FUYA 1HTWA 5GJCA 4JT2A 4M22A 2HCJB 2VHCA 3VU9B 1GWNA 4WXPA 2QENA 2WOOA 1H8EA 3GLGA 3K70D 1ONBA 3SZRA 1V5WA 3NC1C 3U2QA 3ZH9B 2FMXA 5EP4A 4D4KA 4CEJA 2XB4A 3PJRA 1E2QA 1COWA 3UG7A 1N0VC 1NKTA 1MKYA 2CMKA 2V3CC 5FBWB 2KWIA 3U3JA 3FHTA 1KY2A 5F9FA 4NYJQ 4YDSA 1AA9A 1N5LA 4PPGA 3BGWA 1VIYA 5AJWA 1Q44A 1DVRA 2OSBA 4Q7JB 5EJEA 5ELXA 3QXCA 1M7HA 1XRJA 1NY5A 2QNRA 2W6JD 5BQ5A 2WKQA 1Q21A 2X19A 2HF9A 1DPFA 3B13B 3RC3A 4UXIA 2QY9A 1L7VC 2GBLC 4JJKA 2Z43A 3DDCA 3DHWC 4IJMA 4OJQA 4DLZA 4BFVA 3W5IA 3WXMA 4XWOA 3ADCA 4JS0A 2DFTA 1OHHD 2KBEA 4URWR 3T1VA 4URVR 5FPKA 2GK6A 3IQWA 1GKYA 1NI3A 5FUVA 3O8CA 2BCJQ 1IJEA 1E2LA 2MSDB 4UNRA 2WKPA 3PQCA 5E7MA 3B5JA 3GMTA 1U90A 3RABA 4DUGA 2J46A 4JVLA 5DN6A 2ZSFA 2QPTA 1GILA 4ZPXA 3VKWA 1XX6A 1YZTA 2ZJ8A 4LYFA 2VP2A 3Q7PA 4NYIR 2WWHA 3FTQA 4KU4A 3O8RA 1T5LA 3WNDA 1E9RA 1IN5A 1XCGB 1KIMA 3X1XA 2PCLA 3MWKA 1NF3A 4Q01A 3KZ1E 1GRNA 1JXMA 2CJWB 1QHXA 3R7WA 4RKFA 4BRWA 3IUYA 3KX2A 2AFIE 1XWIA 3MMPA 4DDUA 2FDCA 2C96A 5DLQC 1KKMA 1PZNA 1XB2A
chains in the Genus database with same CATH superfamily
1ZP6A 3UFXA 1EJ2A 3DDWA 3GJ8A 2DFPA 2EJWA 1Z45A 2JCGA 3HCOA 4YAOA 1BN6A 3KSUA 3GCGA 3H87A 3HXPA 3N8DA 1DTWB 1VJ1A 3HV2A 4Q9IA 3VBCA 4CXMA 4OHFA 3WYFA 2DJIA 2CMDA 1DG3A 2VHEA 3E2MA 3KPYA 4E12A 3SXUB 1WXEA 4QBFA 3RKSA 3SY8A 1EU1A 1NYQA 1XTPA 1UQRA 2BFCA 3JAWA 4FHEA 5L45A 1RLMA 2VP0A 3FSGA 4PV7A 1M2OA 3I52A 1UFQA 5FTKA 4ZVOA 4ZXPA 5L3RA 1X38A 4EY8A 2R48A 1SXJD 3C4JA 1DT3A 1RCTE 1NT2A 1NU8A 3DB2A 3O83A 3TQTA 1GZHB 5JMPA 4JLUA 3RSZA 4E09A 4N49A 4CIAA 1Z5NA 3BICA 1GNPA 1C7IA 1QM5A 3QUTA 3EDRA 3OLZA 4O2BA 3GDOA 1KZ6A 3LBFA 4B4DA 1UJ2A 1L1EA 1KMMA 1Y6ZA 3TPFA 4A23A 4U7JA 1AJEA 1OYYA 1IHOA 1FTYA 3E23A 4NECA 2PXHA 5AJTA 2QIPA 2A9OA 3W5JA 1MJNA 4YN3A 1AKNA 4DZZA 3EGVA 3KC2A 5FTWA 2WUGA 3IKTA 3EXHA 3PA6A 2FX5A 2RHBA 3MWYW 4JA2A 4Q48A 4JYBA 1G55A 1IVYA 1HOXA 2F3TA 3C3BA 3Q0TA 4PYMA 4R1NA 5K0CA 1AO0A 5REQA 3QI7A 2HK9A 4N48A 1PFUA 3THRA 1XMPA 2IZZA 1YZNA 4FHFA 5J9FA 4BB6A 1C9KA 3AKCA 2ZUVA 3OLYA 3Q9LA 4XEUA 3NHYA 3GJXC 4KFSA 1MV5A 1RPJA 3QVWA 4MB2A 4A03A 1C0PA 4BNZA 5IBCA 1YHNA 4KUEA 4LRXA 3V3KA 1FW8A 1PD0A 3TH5A 4BQRA 2LR0A 1E0KA 1K86A 4B09A 3EGEA 5CVUA 2ZYHA 2VDVE 1P3JA 1TJ3A 1SVKA 2JFOA 2YC2C 3IKLA 3ZDQA 5IABA 1KIAA 2VSQA 2EVWX 1PR2A 3OJLA 1E9DA 1BFKA 4EEKA 4RVDA 1JKIA 1DZIA 2WA2A 5AVQA 4D3FA 1LV7A 2BC9A 2JFZA 1RKQA 1T5IA 2IT1A 1J7JA 1VOTA 3T6KA 4XUGB 2PTGA 1QIFA 3H11A 3IRUA 1CJSA 2Y68A 5ALXA 5K45A 1CJUC 1D0IA 2VXBA 4C6TA 2PIDA 2GI4A 3RYHA 1T29A 1USGA 4WKBA 4YALA 5IUKC 1VPEA 4H7PA 1G5IA 1XAJA 2O52A 1OV4A 4LV5B 5FTNA 2Y0BA 1FMLA 3B5EA 3ITDA 5BV7A 2OMKA 5H0IA 3RJMA 4Q1VA 5DI3A 1L5RA 4Y6PA 3VDMA 1N5RA 2GBGA 2ZE5A 1SCKA 3I05A 4H60A 1CNFA 1K6IA 1T2UA 3H2ZA 4QUIA 4NSNA 5E38A 1UBOS 3G9QA 2R62A 2Q7OE 1E61A 4RETA 4X92A 4CT0A 1Y6QA 2WWRA 3OPYI 4UCXA 5CNKA 1V1MB 1WF3A 5DOZA 2IU0A 5ILQA 4MS4A 1RRFA 2OHOA 3LS2A 3HRIA 5DV9A 3EFEA 1FJXA 2VSXA 1QAMA 5HUQA 1EE9A 5E7JA 3DCJA 2F8LA 4WLUA 1QGYA 3COVA 1T3HA 3WJ7A 2EX0A 1S8OA 3MT0A 3L06A 2RKOA 4MR8A 1NA5A 3OU2A 4UM8B 4D45A 4NEHB 4KK4A 1ADYA 2B99A 3RBAA 3UA3A 2W6QA 3MOIA 3SAJA 1W5SA 3QPCA 3DKVA 4QG7A 1XNRB 4G65A 3K20A 2E7ZA 4HVAA 3ZDRA 4D2IA 4L5BA 4P36A 4ZPJA 1EBUA 1L4HA 2QYTA 3HLTA 3NTXA 1ES9A 2A7QA 1R0CA 3G0CA 1WMDA 3F2IA 3B1KA 2P6MA 4ZKDA 1QV6A 4HQLA 2NX2A 4NBKA 3HYLA 5HQJA 2OXIA 5I7AA 3X1DA 4P7BA 2NZWA 3FNFA 2ECPA 2NQ2C 3LD9A 3NIGB 4KPFC 5HXAA 1HFKA 3FSJX 2CFCA 3G8BA 5KX5B 1IAQA 1P60A 1TYAE 2NVBA 2FN8A 1TK3A 3DOIA 3QEMA 2ZJ6A 4BE4A 2D7CA 2EZ8A 4PO3X 5KVQA 4EUFA 4UDOA 1TJ5A 4OAOA 1EDBA 1LF0A 1ZZGA 2R68A 3WHLA 2WYIA 4K6FA 4ARCA 3H4TA 4UBJA 4K6GA 4UBMA 4YNBA 1KMQA 4X6UA 2CKMA 2W6ZA 1SXQA 4JC0A 2R8BA 2X22A 3DEZA 3ESXA 4UEOA 2E6KA 1OAOC 5CDSA 1JHQA 3CCFA 3G2NA 5J5VA 3MAJA 1Z63A 2C83A 1S3SA 2HLPA 3EMVA 4MEJA 2IYYA 3S1AA 4LSMA 2ZVPX 4OAPA 4P7JA 3BS4A 3IUNA 3CNOA 4B3MB 2X15A 4LS3A 5KOJB 2FJPA 2ZITA 1L5HB 3RVNA 4XPZA 1S8AA 2EEZA 5FI1B 5JMOA 4EJ0A 2FVXA 1YBFA 4J6EA 2UYOA 3O6VA 4JX8A 4PZDA 4W82A 2R6FA 3PNYA 1OFUA 1M1NA 1X0XA 3I9MA 4I8IA 2AN4A 3I2JA 4MQEA 5FLXA 2IITA 3KVRA 3R5XA 1N92A 4KX3A 4HWTA 1XTSA 2AQ8A 2LD4A 5EKDA 3L9XA 2PZEA 4Q24A 4RV9A 3ZWOA 1FTGA 2FH5B 3A6DA 5KOYA 4MAFA 3OLWA 1GV1A 1B73A 3P4UA 1YZVA 3EH1A 3L43A 4U3JA 3RHZA 1YZQA 1AQIA 2F1OA 3HB4X 3OEED 5KMGA 3AF3A 4TVKA 4Y0VA 4RW0A 3DWFA 4W9MC 4RLFA 3JASB 2OORA 3CJQA 4R01A 2IXAA 2IOQA 3ITKA 3NETA 4ZU3A 3UQYS 5JH7A 3HTXA 4RWZA 5DE3A 4QELA 1QO7A 3WYNA 5CB4F 5IU6A 3LKBA 2QMYA 2AG6A 3T41A 1LS6A 3CX4A 1MAVA 3TLJA 1CBUA 3ZVNA 4NBUA 1SCJA 4RCZA 3RNOA 3NXKA 4ZT3A 4EI8A 3K09C 1F48A 2YVKA 3EVAA 4XVHA 4IDPA 2EXXA 4RY8A 1T36A 2AI1A 1XNHA 3RARA 1O87A 3RYIB 2DY1A 4FYJA 5AWFC 4G8JA 4ZXFA 5K0LA 5HA5A 5GPBA 1JWBB 1OA1A 3CRW1 1IYZA 3IV7A 1AKEA 4JI0B 4PY2A 3T1TA 4ARUA 1SU8A 3HP7A 4GOMD 1C2TA 3HFJA 4HI0E 2SCUA 5A4IS 3PV0A 4QNRA 1VHLA 1T1EA 5JTUA 1FNDA 5BYKA 4RHXA 4FOLA 3LSTA 4TTQA 3RRMA 3NEJA 4RORA 1TX4B 4I5FA 4WN9B 1VMKA 3UB3A 2ISSD 4Q1DA 1U1IA 1SQ5A 4NU5A 3EC7A 3VO1A 3GDGA 3WB1A 1G7TA 1FVHA 4EHBA 1W85B 3X3HA 5TMEA 4BN0A 3GRUA 3FCUB 4G89A 3REFA 3EX7C 3L5KA 3LNCA 4OA8A 4MUMA 1LI5A 1QAOA 3HCFA 2WUVA 4UCWA 4N6NA 4YJFA 4C87A 4HV4A 4GQIA 5IVIA 3DNPA 4AMGA 2FW0A 1J22A 1DEAA 1GL9B 1MFPA 3D0QA 4BQOA 2VJMA 4D4JA 5LWHA 1O6GA 2OR3A 2QRLA 3AVWA 4DR6B 1M0EA 3EXEA 1I4WA 1O6FA 4CKCA 4B74A 4R84A 2CYCA 3DFUA 3CR7A 3JQFC 1K5DA 5DBIA 3BKXA 1ZCZA 1L8XA 4IH9A 3IP7A 1K27A 1RYDA 4V03A 3VJLA 4BFCA 2B4RO 2CDRA 1NSFA 4HDSB 4QECA 4XUCA 2BGLA 3BMXA 4BAGA 3K9GA 5ADVA 3VYTB 2BHNA 4QHSA 4NFSA 5IUNC 1LGYA 1I7PA 4YRRA 1Q6YA 4NJEB 3VR6H 1A2BA 2AG5A 2W4IA 3QTBA 3FOCA 3TLEA 4XQ0A 3RC7A 4DZRA 3O4IA 2OHHA 2W43A 1DAGA 3WL8A 1YRBA 1Z18A 4UU8A 2QOEA 1PL6A 5B1IA 4MV3A 2W2TA 2UYQA 4QREA 4P3OA 3W7VA 3PDCA 3QF4A 3ZW9A 4EG6A 1O9HA 4FQ5A 1L4GA 1TKAA 4IH1A 1EMDA 3LDHA 5EJ9A 4O2BF 5LQAA 3N6XA 5C52B 2JGFA 3OM1A 5EP4A 2ZPUA 3EQ7A 1P7WA 2Q45A 3IBYA 1SWVA 1XA4A 3JQQA 1ZH0A 1EVQA 2FLVA 5B57C 2DU8A 1YD7A 5BW4A 3W5CA 1BE8A 3INNA 3HU3A 3QPVA 1LW6E 2DTXA 5KNCH 4JIGA 1EA5A 2VHXA 3E4CA 3SQLA 2E4UA 2RKWA 3GDWA 1Q0RA 2N75A 1DTEA 1A7KA 4FLMA 2A9QA 1IQ0A 4L6CA 4XUDA 1WZNA 2ONJA 2GK7A 1X80B 3AEUA 4URUR 1SUEA 4AZ3B 4D9BA 3ZK8A 2N46A 1OYVA 4U7HA 1VFPA 2H59A 4MWZA 3OZ7A 1TUGA 1LEHA 2VF8A 1DCTA 2V5AA 2V6FA 3QBEA 3NB0A 4AIIA 4CM1A 2HPZA 3GRVA 2H29A 4OHWA 2DLNA 1JIIA 2H2GA 3BXHA 3E61A 3JYQA 3MLEA 5HZKA 4BUJA 2YQ5A 3GT0A 4Y1RB 3Q3IA 3ZDCA 4PPQA 3ROZA 1SXHA 1PT9A 3K9LA 5FP0A 2WJPA 2Q1WA 2RD2A 4HX9A 1G7RA 3RHTA 2R44A 4FIDA 2GWRA 4BKPA 5TARA 5DBGA 3RUIA 2HCFA 4BNVA 1J49A 3THYA 5EIBC 4HAWA 2YNMC 3GOHA 4FYKA 3DDSA 3LHSA 4IIEA 1A1SA 4CL8A 5A6VA 3OJEA 2ZSEA 3B85A 5FFMA 4QVIA 2XGMA 1D5CA 4RFVA 1PNRA 4EK9A 2CBZA 3C1UA 3I23A 3GZNB 5BPHA 2AZTA 2H11A 2TSYB 3JD2A 3IHLA 5LDHA 1UMBB 2H8KA 3ETHA 4OXRA 2LWIA 1JBKA 2JH3A 4HOYA 3VVLA 3RAFC 1T2AA 2WG1A 1ZUIA 4M8KA 5DHRA 4HAXA 3MPOA 2GXQA 2W0SA 4CIWA 3CVXA 4P93A 3GAAA 2WW8A 1EFRD 4K9OA 5TQVA 1P33A 2ZR9A 4LFBB 2A84A 5GMOA 3FTNA 2IH2A 2WSYB 5CFOA 1TYEB 3FPGA 4XLLA 5D6OA 2A59A 1WJGA 2DBYA 3CRNA 4Y7CA 1F12A 2BI4A 3D2BA 4YBZA 5A6SB 5JEDA 4ZOBA 3VDQA 1Q1BA 1WDKA 4AUKA 3AR6A 1LUAA 2XH8A 4DMUB 3OKCA 4X8OA 4NQZA 3PTAA 1U5CA 3QEBZ 1SKAA 5B58T 3EEBA 2ZJ1A 3IMKA 3JQ7B 4IV8A 1HDEA 3TRDA 5I7WA 3KQNA 1FVFA 1L3CA 3U56A 4BTLA 5IAOA 2NTEA 4LZLA 4ZP1A 2VAVA 4JU9A 1BMQA 1M10A 2BFDB 3QPDA 4HDQB 4PHFA 2R7AA 1JLKA 4OBXA 3TAHA 5B5SA 3HDJA 3QKUA 3L9WA 2O5RA 3EWAA 1CUFA 2G9ZA 1OPRA 1CULC 4FMPA 5FBRB 2WMDA 3DXZA 4ZI7B 2IOHA 2OK7A 4PLHA 4W8GA 4N5MA 4WKGA 1NW6A 1XHEA 2C8JA 2IRWA 2PFSA 1MD9A 1SEPA 4IQFA 4Q4JA 4RPKA 2IBSA 2G36A 3W04A 1R5JA 3SQWA 4CM8B 4HEA1 1PKXA 3TFOA 2OHGA 4RZHA 4S0XA 5DGIA 5KOIA 1XZLA 1W36C 5P8WA 3D4IA 1ODCA 5DVZA 3AJAA 1CEEA 2EIHA 2ZI9A 4O29A 3U7IA 2WWVD 1WTCA 2NZ8A 1DRVA 3DBLB 4Q3BA 4QULA 4BMDA 4KGXA 1DAIA 4OSEA 3ISVA 4HWSA 5CT4A 5F2EA 5HF6A 3W78A 3PC3A 3ZV7A 1MJGM 2QRVA 3H65A 1Q7RA 1Z5OA 3FZNA 1ORRA 1NUAA 1VL6A 4ZAVA 1CFZA 1JHYA 1TIPA 2CJXA 3RYHB 1YAHA 2PMBA 2VQEB 3MUNA 2BAGA 3LPNA 3I2IA 1BG6A 3QKRA 4GO1A 2NTJA 1L3IA 1QH1B 1MA0A 3IUBA 1G42A 4OXKA 1ISMA 1NUSA 1R27A 4X97A 5CVEA 1FTSA 2FQYA 3P97A 5I5GA 4IWYA 3AL0C 1MC8A 2W83A 3EZLA 1IY1A 1TM2A 2Q4EA 3VSAA 1RWMA 4P33A 2WZBA 2OG2A 1U81A 2QGZA 2Z1DA 2XB8A 4FU0A 2W2VA 4W5NA 4M0EA 2BDTA 3Q15C 3MGAA 4AICA 1XROA 4N3NA 3E22A 3WIDA 4Y9DA 5HKAA 2PV7A 1DARA 4GD3Q 4C5BA 3VSCA 3EIUA 3DL7A 5DEIA 2AB0A 4K2HA 2QZZA 4YWHA 4A8PA 1TJNA 3D2LA 2H1SA 1WOMA 1WXGA 4AJHA 4H0CA 2H1VA 2VUUA 2PH1A 4YMWA 2AJLI 1O0CA 2ADOA 2AE2A 4KK3A 1WXIA 5FUXA 3SKXA 2V3VA 4UFOA 4G8BA 4ZWNA 5TGZA 1CXZA 1TC2A 3L7CA 2PAFA 5BMOA 5C5DA 4IGKA 4PLGA 3VBEA 1THMA 3KVYA 5LZ8A 3TB6A 4CEHA 1TYDE 2B2XA 3GROA 5COBA 5BUCA 3MTGA 3PQ3A 3LJKA 1ODLA 1I94B 3OZVA 4G2TA 4AY4A 5KWEA 5IBRA 4OJYA 2FP3A 2DHRA 4GR4A 1Z4OA 3DZDA 4HT3B 4UXJA 4QZVA 3KAJA 4PXSA 5CBPA 3WNQA 1Z6GA 2ZYRA 4XSVA 1R0BA 2CVZA 3KLOA 3M83A 3CRZA 3LRTA 3UK0A 5D87A 2K87A 4HGPA 2AUMA 2GILA 2YY6A 1DQRA 1W1IA 4Y2RA 4COOA 5L6MB 4ZTZB 2RHJA 3BUSA 5D1NA 4JODA 1OI4A 2PLRA 3HWWA 4HD8A 4NE2A 2F55A 2YXDA 1Q0TA 3MGBA 5KUTA 2RHLA 1T5OA 1FOEB 1GCUA 1E3SA 4ERNA 4HDCA 1IQUA 3ZHQA 3EVNA 3PNQA 3CNEA 3ZHXA 4BWFB 3ENQA 2MSWA 1EGMB 1OLOA 2R8PA 1AUXA 1L6RA 1UAGA 2W2XA 1L5HA 4LYGA 1GQRA 4Y0AA 1AB5A 1DNPA 4TLCA 3L7YA 4BGIA 4MEBA 1RLTA 4LJRA 1F7UA 2O1WA 3JARB 2FEPA 3GLRA 1N8NA 3MXTA 2HF2A 4HWGA 3ULKA 2D6FA 1JKJB 2YHSA 1JJIA 1I3LA 2AR0A 3OQJA 5ESDA 4DADA 1J6UA 4H6XA 1SY7A 5A3SA 1YB6A 2Z3ZA 1XLUA 1ADGA 1J0AA 4RGQA 3GRPA 4KIJA 1PJ4A 4NARA 4E33A 2JIBA 3EMKA 5ADHA 5JALA 1CTQA 1JF8A 5DSXA 5JNUA 1V71A 5T3UA 1WU8A 2V9ZA 3WLPA 1YASA 2XOKA 1XF1A 3ZK7A 4YROA 1OVGA 3DE7X 1JR3E 4HQFA 3SZOA 2F1RA 2FPLA 3AEKB 4BQEA 2O7VA 1NUHA 4H0FA 5HIAA 4KXYA 3BVPA 1GL7A 3ZCQA 2JG3A 2X42A 2ZVJA 5CB4B 4Z7NB 1N2OA 1QGUB 2O2SA 4KQ6A 1TCVA 3MT9A 1FQWA 2OZLB 3GC6A 2Q1YA 3HUUA 2BD0A 3W2GA 5JDIC 1DO2A 3D5QA 4TL6A 4LZPA 3LKDA 4P22A 3HMKA 2G1KA 4R5MA 1YVPA 1RXSA 3HCRA 3WB9A 1PL0A 2JI6A 1RLUA 2IA5A 5IVPA 3OCZA 1XCJA 2GTHA 4ON9A 3BBLA 5KSZA 3I12A 3EZGA 1V43A 3IAS1 2OB1A 1H8HD 4I4NA 5LC1A 2R8RA 2JD0A 1QHSA 2QJTA 3L4EA 1M1YE 4OH7A 3VV3A 5J40A 4K46A 1D3AA 3O4FA 3PIDA 4PIVA 1SK8A 5EP2A 4NAUA 2EATA 1FFWA 3MTEA 2PLNA 2YV4A 4RIGA 3TTVA 1Y6FA 2R9VA 4HYEA 4MVJE 5BY2A 4X6LA 2CVFA 1ZL2A 4WD3A 4ZZ1A 4I9NA 1Z7WA 4DYVA 3LC0A 4EIWA 1BCRA 1FP2A 1JN0A 1PT5A 3HNOA 3FMIA 5G3ZA 2IZOA 4Y2HA 3ND8A 1XJWA 3C3XA 2CEAA 2ZJ7A 3F6RA 3P2KA 1WD5A 1YDMA 2HAEA 1KEZA 3DLAA 2P3QA 4ILKA 4ITVA 4S0ZA 3VNSA 4B83A 4O4IB 1AQ6A 1CNMA 3A3KA 2VH5R 3UN1A 2OC4A 4D0GA 1WUJS 1DJQA 1PJBA 1R5OA 2QI9C 3NRJA 3STWA 1PGQA 3AF4A 2VJMB 3WAJA 2JFGA 4PRKA 3BPSA 2CXNA 2BKXA 4CTNA 3NV7A 4KR0A 2ZB2A 3P2OA 1P3DA 1NBWB 1B6TA 1GNRA 1S6YA 3HR4A 1IBCA 1LBEA 1XTIA 5DEOA 5H81A 3T8YA 1R5NA 1RKVA 3PG5A 4EAAA 1NVMB 2FDRA 4UHBA 1GGEA 1SG6A 1Y7TA 1YCFA 2YJNA 3EY9A 3NT2A 4AP9A 5CLFA 3N3AC 2QMUA 1SHZA 4TWJA 3SYTA 2YNMD 1TD9A 1U2RA 2I2DA 3VVMA 5HZMA 1JWLA 1NFQA 1X7ZB 1DIHA 2ISCA 2ZUWA 2E6UX 4ARVA 3E82A 1HE2A 1YU9A 3LXUX 4YRSA 1PGNA 2JHFA 3M5DA 4WA8A 5HGJA 1C8BA 1DV2A 3QF4B 1S5PA 3JQ9C 4GBED 4HR7A 1D7AA 1GKIA 1LLUA 3OO0A 3SMVA 3TZKA 4BP3A 4URXR 2C7RA 1SB8A 5LVAA 2KYRA 3KEMA 1EG2A 3ZLTA 1URPA 2VAWA 4F5ZA 3GUUA 4LF7B 2BTQA 1D7OA 1N5KA 4N9QA 2RGWA 2NO5A 2DSNA 1TUBA 2XWPA 1Z4KA 2P77A 3QI2A 1M1ZA 2P0AA 2ZSBA 3FLEA 2GKSA 3HBMA 4HL6A 5CPBA 1RHQA 2XOEA 2Y92A 1ZJJA 2IIPA 4A73A 3G88A 3T7TA 5IHXA 3H5IA 3JQGB 1DINA 1G8YA 1YR1A 1JH9A 4X8HA 4AZ3A 4DV6B 4Y6RA 1KR2A 4H7HA 1DIBA 1WMEA 4D9KA 1X7YA 2BFMA 2IPLA 3EZXA 4C7MA 1CJKC 2ZM5A 4H9GA 4K1LA 3SJCA 1RMQA 3WWCA 1OXBB 4OLBA 3NTLA 4MPPA 4A5SA 2B92A 2M6SA 5DM70 1HE1C 1A4UA 1W2WB 2WLTA 4OKIA 4OIFA 2B36A 4D80A 3EFOA 3MNFA 2AD5A 4WN3A 3VYSB 4JFRA 3INYA 3PR2B 2QUIA 5AVOA 2B2NA 3OIVA 1B8OA 5KAMA 3W4JA 1R6VA 1ZC4A 5FKJA 4MICA 4DIFA 3H2SA 1Z9BA 1W44A 1FTNA 1H3NA 1VECA 5AKIA 1QJCA 1CWUA 2FGKA 5E0OA 3ZGNA 2EG9A 1Q0HA 2CV1A 2X3YA 2FX2A 1KR5A 3E7XA 3GCZA 3FDXA 4Z1MA 1NQWA 1HE3A 1K97A 3BHMA 1UMBA 3C98A 4E0BA 5H3CA 1VBMA 1YJAA 1EFPA 2OO7A 1B0PA 4DE5A 4QPJC 2ZDHA 2KQUA 4NV1A 5ALHA 3FOAA 4DCNA 1ZNYA 1Y42X 2DPXA 5IT5A 3LA6A 4BNIA 2OMEA 3G2LA 5GZ1A 1KJJA 5IHPA 4MRRA 1SAYA 2XB9A 1FP4A 4ZYTA 5BV8A 1KDRA 1PZXA 4O4LF 2X5XA 3VU0A 1LNZA 3IEUA 3WE7A 1KOGA 5A6SA 3T0IA 4AS3A 4KE7A 1QCZA 4AWBA 1LPPA 2EZTA 3X1ZA 2I3BA 1NC1A 3O9MA 1Q2UA 1JEDA 5HF5A 4U0JA 3QBTA 3GGCA 1R4AA 1MV8A 1V1JA 3HKCA 5JC1A 2D74A 1ZMOA 2W93A 1YJBA 3OFJA 3ZGZA 5KNBA 3EWNA 2W6PA 1CZHA 4O3FA 1LW7A 3VM6A 4CMJA 5DZSA 5B1YA 5LQNA 4KPEC 1G4UR 3EBPA 4L85A 3WQHA 3UGKA 4W9NC 3B1XA 1KO8A 1FUKA 4O3MA 1JIQA 2P9CA 1UM9A 1YRAA 3NO4A 4JB3A 4P8RA 1H1LB 3USCS 1T5TA 3AMVA 3LCRA 5BWBA 1US8B 4KIFA 5LKAA 1WW3A 4G5RA 3O9VA 4YFYA 4DSZA 4V1CI 4BZWA 3QWIA 2JFHA 2ZB8A 3ROFA 4KDRA 3KZMA 1P9RA 3Q9NA 1V5EA 2ZTMA 1G21E 1RRKA 3RVPA 5CBKA 3DO8A 1ULAA 4HX5A 4P2GA 4RM2A 3GLGE 1QPZA 4YECA 2W70A 3V48A 4IF4A 1JLSA 3Q8XB 4AI6A 4EI7A 4A6XA 4TTIA 5I6DA 2CE2X 2XNKA 3OU6A 1DWUA 4L9SA 5F4BA 3C8UA 3IR7A 3UV6A 1NC3A 5EE9A 5CNMA 5EJ7A 1O89A 4QVGA 3KCQA 4RSMA 2EFGA 4ECEA 4JOSA 1JU4A 4V0NA 3PF8A 1J1UA 3H9CA 1UK7A 2ORYA 3CX7A 4Y6QA 4YQYA 3V7WA 3IQIX 5F12A 4I9HA 4RF4A 5M04A 1SGWA 3NDIA 2V7VA 2WWYA 4TVSA 4HLUA 5JJIA 2IYVA 3BMNB 4K9LA 3B1JA 2CMFA 2PRZA 2PU5A 3N2KB 4IJQA 5CH8A 3SEZA 1L9KA 2BBOA 4NEGA 1TGVA 2PRIA 1D6JA 2DQ4A 2YR0A 3TBFA 4O63O 1Z8DA 4MPDA 4HPWA 4KSYA 1TK9A 5B3JC 4A8JA 3VUEA 4R4JA 3PDWA 2X8LA 3DCYA 4MWCA 2ZRCA 4OQMA 2CHEA 4XGRA 3RU3A 1ZAKA 4P98A 3D3QA 1JR2A 2HYIC 3KSMA 1M0SA 3D31A 2R6JA 3R7FA 3T9DA 1XU4A 4TM8A 4FK8A 4CF3A 4H16A 5SZKB 4OLJA 1E7MA 1WCYA 3F3YA 4BC0A 3GLFA 1XDWA 4EJ2A 4D74A 2YV3A 5IPFA 4ND7A 2HT6A 1NP7A 4REMA 4L5YA 1A9XB 3R3HA 1G20E 1S2GA 3FB4A 5L4SA 4JCOA 1A50B 1OT5A 4IILA 2DE0X 3HXTA 4LYYA 2HQSA 1ZXLA 4GRAA 4MUGA 1UKEA 4KUGA 4YQZA 2YWFA 1V8DA 4OJNA 5I9NA 1JT2A 1E3QA 2B61A 1PW7A 2PZBA 2VYQA 5EHNA 4BOYA 4E4TA 4UBIA 1UF9A 2IFTA 2ONCA 2GXUA 5L51A 3GGJA 4PFQA 1PAUA 1NN0A 2HR1A 4U8HA 2NUTB 1ZVKA 2QRJA 3PLNA 3DVAA 4NVRA 3GAMA 5E4JA 1E3WA 1UDCA 3QHQA 4N6OA 4PZ0A 4EUSA 5KHLB 4IJUA 1P9WA 1W5FA 6REQB 3NQ41 3P0EA 3ZDYB 1YC5A 5B30A 3GEBA 4CQMD 4IIHA 1T6XA 2HBQA 2P2LA 5THXA 2OORC 4HFRA 1CP2A 3RR2A 3UFXB 1SD2A 1XZNA 2E37A 2XUHA 1GEGA 1IN7A 5E8RA 1JFVA 3WLRA 4J0IA 1D9XA 4JVNA 4MW4A 4FC7A 5CEEA 4FM9A 3B3QA 5CCBA 2JGEA 2Q1SA 2YQZA 1KSGA 3PLRA 5G1PA 1QOPB 3RIGA 4BO1A 1FS4A 2QTWB 1WPRA 1NQUA 2QBYA 4Z9YA 1T8PA 3RRJA 1O1YA 1LJ8A 3KQYA 4I08A 2HF7A 1DBPA 4W6ZA 5KVVA 4ZU6X 4KLAA 1YKSA 1VJTA 4RXMA 8LDHA 2NO7A 1BKYA 2BONA 4KHZA 4P84A 2DHQA 4EZEA 3S1SA 3A1SA 1S89A 2B9EA 1XWWA 3CN7A 3H2BA 3KG2A 3OZXA 2XDQA 1SG9A 3H2KA 1EE1A 1E32A 2R84A 3VR5D 1JXOA 2Z2KA 1ZCAA 1U04A 4KXFB 3AVUA 2WHPA 1GGHA 3VNVA 1L8OA 2DWQA 4XTCS 1JVNA 1KOFA 2C1ZA 3O90A 4R2LA 1G8JA 2UYCA 2YXPX 2IK8A 3GNQA 1YQDA 3SEAA 1ZUD1 1FDVA 4F4JA 5REQB 4NBNA 3ER8A 4G0PA 2CN1A 1S4QA 2REOA 1M76A 3AB3A 1MX3A 3F9IA 3FX2A 3IAM6 3IQHX 4PBTA 3BZWA 1GOTA 5AD1A 1M54A 4MVJH 3NTOA 3SJUA 4JELA 2VNAA 2WM2A 1SQSA 4B35A 3OCVA 1HZZA 1I2ZA 1QR6A 1SQGA 2VJCA 1HG0A 3K0EA 2Q2WA 4HF7A 3GG9A 2ZJAA 1QKIA 1N2BA 2E0IA 2SECE 2R4QA 4JN6B 4LYEA 4EP1A 3FDZA 4CR8A 1LVGA 4K26A 5J5AA 1W48A 4DLXA 1LJUA 1CJBA 3FRHA 2C7PA 4EW3A 4DMLA 4ANFA 2PQ6A 3PZBA 4Y2QA 4YP6A 3QPUA 1XYGA 1JJFA 2FJUA 3Q2KA 1T3SA 2B8TA 3TTUA 4CTMA 3CLVA 1AMUA 3PEYA 2CLEB 3NRCA 4I50F 4IUBS 3ER9A 1YK1A 2GUGA 4RTOA 3BQNB 1HKUA 1CLEA 4FBLA 1QGOA 1SD1A 4G0ZA 4ETIA 1KYZA 16PKA 2Z3VA 1LK5A 5DDIP 1V37A 5IARA 4M9UA 4I1OA 4LWQA 1DCKA 5F2NA 1C9NA 3KWFA 3NM6B 5FLYA 4BUCA 1JMKC 2QPOA 2W58A 4IQ0A 3VTFA 1YBVA 4OV6B 4AAYA 2M9MA 4F2GA 1CZRA 4FHCA 1K6EA 1RYMA 3DZHA 4M8LA 3OM9A 4QBKA 3TQQA 2Y2VA 1NN5A 2CXXA 2FFRA 2YCLA 3FHCB 1LQUA 3FMVA 4XE5A 1C8KA 4MCIA 4WZZA 1UOOA 3NKLA 5GOZA 1DAOA 3R7DA 1KPHA 2VCHA 1SHJA 4V2UA 4YJ3A 1JEQA 3PQ4A 5DNUA 2ZPAA 2MINA 1H22A 4N8DA 1C9EA 5JAZA 5F21A 1G0OA 1OD6A 4YRJA 5DB4A 3I61A 1NZFA 1JQ5A 4TUYB 3DMNA 1V9SA 4NYMQ 2OZKA 2WJAA 4JLDA 1VCOA 1YJ8A 2C7VA 5FR2A 4F04A 2P8SA 2A1UB 3OIGA 1X7ZA 1M1YA 3A4VA 3N59A 4M0KA 4QPZA 4A92A 2REXB 3RS5A 3IAUA 3CZ5A 5J4VA 3AVVA 2WAOA 3H17A 3HDVA 2J7KA 2VYVA 1R4NB 4KMMA 3JQ8A 3A28A 1QK3A 4PF1A 3ZNPA 2YNMA 2K4MA 1U1FA 2AVDA 2HQBA 2R11A 3NJ4A 4OREX 4TM7A 3ZE9A 1M2JA 1WA5A 2FE4A 4UMFA 4HZUA 4IXMA 2FTKE 2P11A 4JITA 2WYWA 2HMTA 2RBKA 3ZU5A 4HGYA 1YTLA 1G4AE 3H1EA 3PDUA 2PJZA 3EEYA 2ZSHA 5DTJA 2QLBA 2VDLB 3PTLA 4ZGBA 3O8OA 4XFDA 5AW2A 2FN7A 1N6PA 3CU5A 1A5BB 1S3GA 1WR8A 4FXOA 5DSTA 3A27A 1MOPA 2J4CA 2ZLBA 4CW7A 2I3AA 4DMFA 4ZICA 2AG1A 3V2GA 5JFTA 3GEMA 3R8FA 1U31A 1LS1A 2PUWA 5EL0A 3AKZA 1U8TA 4CYMA 1YDEA 3H16A 1HE4A 4INPA 3E3NA 1ZJWA 3I4LA 4G1MB 1TRHA 4GSYA 1DQZA 4DR1B 4ARZA 2QD3A 1NKVA 3A1TA 4RQBA 4BJ5A 3FWYA 4HN4B 4BLWA 3OI7A 3KUXA 4I1SA 3UKJA 3KZXA 1D9ZA 4BGVA 1UC8A 2BEUB 5AO9A 1SOVA 2GN9A 4KXNA 3P20A 2B5WA 2ZRHA 3W9BA 4F45A 1H0HA 3DULA 3IOMA 4QPNA 1IWOA 4OK5A 4E5SA 1RMTA 2QUJA 1NT4A 3QKWA 1IHDA 2BE9A 4ZEXA 3LHIA 1TE2A 3NCTA 1IOWA 3E9RA 3O8NA 4G1VA 1NASA 5HILA 1BQ4A 3WGHA 4NMLA 5M29A 1NPYA 4NJMA 4PHCA 1Q3KA 4LF6B 4I46A 4MV8A 3IDQA 5A7HA 3V8VA 1RSZA 4R31A 4XIJA 3PDHA 1VJGA 3FYDA 3IAAA 5T57A 3VZDA 3I1IA 1DI0A 2ES4A 4ZZIA 1U3TA 2GYWA 4JI6B 3U80A 5AVYA 1S7CA 5JWRA 4BQPA 1E2EA 4KQKA 3F90A 3HB1A 1LPBB 2BMDA 3D5EA 3WKDA 5AI6A 5EPUA 4BNNA 2CUTA 4DV1B 1KAQA 1NZJA 1REQB 1H2BA 4FFOA 3WMGA 3I04A 5FOUA 2XI4A 3C7AA 1FYFA 1XD9A 2GA8A 4JDPA 5F78A 1AM4D 2IJGX 3HKCB 3AR3A 4LUCA 4WESB 2PS0A 3UMVA 1CDEA 3TB4A 1P1HA 1A9YA 1E9EA 2ZWVA 4MITA 2MTBA 2Q6TA 4DARA 3ZK9A 3MJCA 3VU9A 1HDZA 3ESDA 4XIIA 2MSCB 2BEJA 3L8EA 2CYBA 1XVVA 4D4LA 1UXKA 2Q8PA 2C07A 4ATNA 3WOHA 2DCUA 1Z2NX 3SBXA 3T9AA 3O1JC 1X86B 3W4KA 5LZ9A 1YZHA 2ZUUA 3GARA 4M0PA 5CW2A 1SZDA 2FDXA 2XNCA 1QH8A 3WK9A 4LJKA 4ZOEA 3KLPX 1EP2B 1Y80A 1W85A 4QRDA 1B8PA 2IU4A 2G08A 2IL1A 4I2NA 2PGAA 1XZJA 1UBHS 2D0DA 2IXTA 3QUCA 4MVJF 3LUFA 2C2YA 3QVOA 5JO0A 4DR2B 3AT1A 1E1RA 3JD3A 1MO3A 3A4YA 1V8BA 3A4IA 1UKCA 3BZBA 5INTA 1GITA 2WSSA 2I1WA 1FY2A 5E9AA 2UZIR 4UZEA 5LD2B 4ZO8A 4K9QA 4ZRMA 4F5WA 1V25A 4PSCA 1PZEA 3T1OA 4Z0PA 5ULLA 3QMWA 5KSYA 4ZREA 1RE0A 4IKPA 4NH4A 5A5EA 4XM1A 5CLHA 1AHPA 3JRNA 4C0KA 3H2IA 4J43A 1U7ZA 1XN1A 4LXUA 2GD2A 2WE7A 3WGTA 3WYCA 2VHZA 4OJKA 1FCJA 3DUFA 3QFHA 1PG2A 3L84A 1FC0A 4MTCA 5AK0A 4NBTA 1OX4B 4NJEA 1WKBA 1JPJA 1X7GA 3GFQA 3OP4A 4IMPA 4AKEA 1C80A 1QOZA 4B5KA 1I4EB 4A8JB 4PG8A 5CLLA 4Z0HO 4K6CA 3KFXA 3RSLA 2C4HA 3ZJ4A 4JJZA 5TEWA 3DAHA 2ORVA 3L7JA 4CKZA 1T2FA 1BVHA 3DE4X 1QFMA 1XLWA 1A95A 3KYDB 1PWEA 2AL7A 3IURA 4YMSA 1W8DA 2A0YA 2G28A 4NG5A 3FUWA 2IYOA 2QXYA 1DSSG 3DDHA 5EA2A 3ZEAA 1FSPA 1IL0A 1T9AA 4RC9A 4LOHA 1P45A 2WICA 3CBQA 3R23A 1DFHA 3CYFA 5H82A 1UUFA 1CEXA 2I03A 2APJA 1Y6RA 3DFIA 2RAFA 3MB8A 5FX2A 2GD1O 4GI1A 4ZAZA 1GQSA 4DM7A 5JS6A 5LXTA 2J3KA 2DR2A 2D5CA 2HMYB 3TJZA 3REQA 4UUPA 3IB6A 1K0FA 1ECJA 3GBSA 1LWNA 5JYEA 1BGWA 2CJWA 4HQ0A 1E62A 2OFOA 1LPSA 2LNDA 1RXUA 1D1SA 4IEFB 4II7A 5ENVA 4AKSA 4TTSA 5EIXA 1OU4A 4FE7A 4RFSB 2FPMA 1NR1A 4CM4B 1K5PA 3AU9A 4IFTA 3RU2A 2IPAB 4CN8A 4DRYA 1WCWA 1Q50A 2IYAA 3PZRA