1GOTA

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
338
structure length
338
Chain Sequence
SAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
total genus 117
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1gotA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gotA01
1W49A 5HKKA 2FV8A 3QG1A 4PC3A 3RHFA 3WY9A 4F4CA 3TUZC 2REBA 4LBWA 3KB2A 4EAQA 1OW3B 1P2VA 4FMCB 4IXMA 3LQRA 4AWXA 3GLIB 1F2UA 5FBVB 2J5XA 2ZVPX 2NZ8A 1S0UA 1NKSA 4OI1A 4MRSA 1N6KA 5DI9A 5JEEA 5TXGA 2CCJA 3E5HA 2OXCA 3GLHB 621PA 1XPRA 2ZRNA 3BH6A 1NP6A 3I3SR 1WRBA 2J7PA 4TT3A 4HB4A 2AFIE 3AM1A 2ZS7A 2Q6TA 2DFTA 1LV7A 4FW9A 4JLDA 1U8YA 1ZBDA 1GAJA 5HKKD 4AYWA 3DMDA 4C0AC 3EZ2A 4G0NA 1DADA 3JVUA 5L3RA 1VCMA 3G5UA 4C0JA 5HR5A 3QE0A 5IDVA 4BZPA 4U7DA 1GDDA 1IN4A 2IF2A 3JZMA 1XJQA 1G6OA 1JR6A 8OHMA 3I61A 1W7AA 2PL3A 1N0UA 1G3QA 2W0SA 4D0LB 2J7PD 4TT3D 5FPHA 2OM2A 4M8NE 1B23P 1XWIA 2ATXA 5JMTA 3X2SA 4XVUA 3THWB 5FR1A 3GLFE 4FXPA 3FVQA 3QKSB 3B2EA 1U9IC 4RKEA 4PO8A 3I5XA 1KMHB 2R2AA 1SKYE 2PCLA 3BWDD 4L16A 5L3VA 4V0KA 4I1OA 1K6MA 5EXTA 2FEOA 3V00A 3KTAA 5E7IA 2J41A 1KSHA 1YKSA 5J4HA 1E2IA 2PX0A 2IS2A 5B2ZA 2BDTA 2CJWA 4HLUC 3ZS8A 1SULA 3KKMA 2A5GA 1X86B 4YMUA 1RJ9B 3ZLJA 3QKUA 2NO9A 2CL7X 2YOGA 2DFNA 1E4YA 2GDJA 1OB2A 2GNOA 3FHOA 5GJCA 2QEQA 2O5VA 2WOOA 1DVRA 3AF0A 2ZYVX 3OFNA 4QHSA 2FFBA 1KSJA 4KFUA 4OHXA 3T12A 5L3SB 4JYCA 1ESMA 1FNMA 3CW2A 2Y8EA 4IVRA 3K09C 1HT2E 1II8A 3GLIA 3MCAA 4HAYA 4A8JB 4RZXA 1DBSA 1NVUQ 3FPAA 2CK3A 3EPKA 4IXNA 2ERXA 2R9VA 1WMSA 3GLHA 3VR6A 4GP7A 5DI3B 4Q1CA 4Z54A 4ZKDA 1M8PA 1Q1EA 2OLKA 2ZRKA 4A4DA 1G5TA 3NEYA 2QBYA 1YZGA 1GWNA 4TQ9A 2GJSA 2QY9A 3B13B 2ZUBA 3K0EA 2KJQA 1L2TA 1CLUA 4JVNA 4DCSA 5G3ZA 5D3MB 4XJXA 3H1TA 1SXJE 3CNNA 3OFND 2CL0X 4V0LA 1O3YA 4NTZA 2EWWA 3TUJC 1OV4A 4H1UA 2IL1A 4Q4HB 3U4QA 4EPTA 1FTSA 1G7RA 4U00A 2ZSBA 5F9HA 1E2MA 4L5BA 5A0FA 5E7JA 3U7HB 2CBZA 4DZZA 1J8YF 1IXZA 4HLUA 4D4LA 2DFKB 4GP6A 3WYAA 1G3IA 4QBIA 2CVHA 4TYPA 3EPHA 1E9CA 3TAUA 3SYLA 2FWRA 1DAGA 4HLDA 1P9RA 2WKQA 2OESA 1KMHA 4HAUA 5HCNA 1HUQA 5B30A 3ZQJA 1E6CA 3K09A 2ZRFA 4M9XA 4TWZA 4RD6A 5CYPA 1DTSA 1S9DA 3Q8XB 3IEVA 2C2HA 2NOAA 1Q12A 2QM8A 4FCWA 3A8TA 3W5IA 3WMFA 2WWYA 2Z5FA 2VP5A 2ZIAA 4C0LA 3SJZA 2YC4C 4RFSA 1LFDB 1XDBA 4QGHA 1W48A 4CIDA 3T5DA 3ZZ0A 1S2MA 2A5DA 2C03A 4JBWA 1KI6B 3VR2A 3UANA 2MMGA 3RRZA 1PJRA 4XH9B 2QAGB 3KKQA 4TN1A 2YOHA 1P62B 2VP9A 4BE7B 4DSOA 1YHNA 2X2FA 2HLDA 1T4GA 1Z08A 2WIAA 4C7OA 2D62A 2J59A 4DDWA 1HE8B 1G64A 2RHDA 4GFDA 4WZ6A 1W4BA 3TSZA 4JT2A 5EXXA 5CIQA 1N0WA 3VR3A 1Z6GA 2YVUA 3BH0A 2J0QA 2BWJA 4O2RA 5E3HA 3ASYA 4JVMA 3CKLA 3LBNA 3CONA 4HZUA 1FX0A 2QAGC 2V8OA 3EASA 3B1XA 3U3RA 2REOA 2QTHA 2WBLC 2ODBA 2BEKA 3CPJB 1CJVC 4L15A 3LXRA 1R8SA 3X1YA 4D0GA 3GLGA 2OSBA 1LF0A 2ZITA 4KLNA 1XF9A 2HLDD 5EE9A 4PTLA 4E5UA 4GZMA 3HYRA 4ZIRA 3TK1A 4JS0A 4CF7A 2P0EA 4C2TA 3TSOA 2DWQA 1E94E 2C9OA 3VHXA 1YRAA 4XWOA 5FH9A 2FN4A 2JATA 4CDGA 4B76A 2YWHA 1TX4B 5FTJA 3CF0A 4B74A 1Z0JA 2IUTA 4PQFA 1Q1BA 2ZI6A 4RD0A 1Z0KA 3I8XA 1BO6A 1NSTA 2GCNA 5FI1B 1QBKC 2BJVA 1K5GA 1KAGA 3CPEA 2CVFA 2ZRGA 5GVRA 5KO2A 5BYJA 5FR2A 2IC5A 4MQBA 1Q44A 5G3YA 1KGDA 2GF0A 1SQ5A 3RVBA 2XZLA 2R6FA 2R6CA 2OBNA 3CM0A 4B2LA 4A9AA 2QAGA 4A1FA 5M04A 4MITA 3LQQA 3TVDA 2JLVA 3MJHA 4MRNA 3GCGA 1E4VA 4UKDA 4BFZA 2TMKA 3D8BA 1JALA 3NKVA 3QKTA 1W2HA 1Z8FA 1SKQA 2VHJA 3ZD7A 1US8A 2MSDB 1E2QA 4B3XA 1UBFA 2VP4A 5BYKA 1KI9A 1HA3A 5KNBA 2ZR9A 4Q1BA 1D2NA 4CW7A 3HR7A 3U3MA 1SGWA 4Q66C 3DZDA 1JXMA 3W9YA 2AK3A 5J47A 5JRZA 3QPVA 3E2IA 4JLBA 1W44A 3EIQA 1GITA 2NGRA 5EP3A 1Z2AA 4R2HA 4IOLA 1MRNA 2WAYA 2IA5A 5KDLA 3RWOA 4P3YA 3SYKA 4RD3A 2JJ1A 4TTRA 2PZFA 5LDDC 2IYQA 1KHTA 1QVRA 3FHTA 5JBQA 2AKAB 1KNQA 1D6JA 2V54A 1GNPA 1HH4A 1TPZA 4FMCF 4MYHA 5DE3A 2LWIA 4Q4AB 3VMFA 1E32A 4BFTA 2XOKA 1F48A 1R0ZA 2AFHE 5GVSA 1TUIA 2RH5A 1ELOA 2R65A 3ONWA 3GD7A 2NPFA 2QAJA 1E99A 1T6NA 1U2RA 3I1FA 2VP2A 4YDHB 3QQ5A 4NYIQ 3KJHA 1G41A 1LW7A 3U3JA 3X1XA 1W36D 3T61A 3O8BA 5J4LA 3VX4A 3UPUA 1KI1A 1W4CA 1J8MF 4LHWA 3P27A 2RMKA 1XMVA 5KTYA 2IK8A 2PT7A 5CLQA 4Q7JB 2ZJBA 4M22A 4JLJA 3EZ7A 2JJ1D 2FSGA 3K0CC 2WAXA 2JLYA 4MGIR 5DHAA 5SZKB 4WBSA 1XPOA 2RHMA 5FFMA 3VHLB 4F92B 2GXQA 1GFIA 2XOKD 1U81A 2V1UA 1Z83A 2GCOB 2WMNB 4V0OA 1OKKA 3KFXA 2PEYA 1N6RA 4KLZA 3A1WA 4NBSA 1M7BA 1DAHA 4PSVA 1Q57A 3ZVLA 1ZIOA 2FE4A 1WP9A 4TMWA 3JVVA 2HT1A 1RRGA 1ZM4A 4A82A 2XEXA 1X8KA 2QP4A 1I2MA 2I3BA 3AVQA 5F98A 5FOXA 3QSYA 3TBKA 4AI6A 2VHTA 1PLLA 3WHLA 4C0SA 3D6TB 3AH8A 3SE0A 4JYBA 2VQSA 1T0JB 1DG1G 5JHGB 2ZSFA 3DEFA 3L8YA 1C9KA 4PHFA 5DH9A 1OKKD 3KJIA 3ZZTA 1OH8A 2F1JA 1P4SA 5AUPB 2H17A 2QMHA 4AKGA 5HZHA 4M1OA 3BBPA 1XB2A 4NKRA 4HAWA 3S1AA 1NMYA 1JR3E 3ZDQA 1JI0A 3K0CA 1P75A 5JSZB 2BBSA 2HF9A 4Q01A 1ANKA 5DN6A 4A0GA 1DARA 1SVLA 2QG6A 4GPTA 4Q4AA 4AK9A 3NVAA 2QPAA 4OI4A 3SBEA 2ZM5A 2BC9A 1S1CA 1GOTA 1TL7C 3D3QA 4EIWA 3AB3A 1GKIA 3MMPA 1W2GA 3TAHA 1NI3A 4LYHA 4QFMA 3IDQA 1WQ1R 2QTFA 2OG2A 4BFSA 1S3GA 2AXPA 4GSYA 2DYKA 2Z0MA 4EPWA 3B9PA 1ZD8A 1OYWA 4PQRA 3BC1A 1CR2A 3P4YA 4I1VA 4UJ5A 1AZSC 4KFTA 3WNDA 4HAXA 3AUXA 5EXSA 3EARA 2MSCB 2ATVA 3Q9LA 1RYFA 4XWAA 5DN6D 4Y0AA 4FWTA 4DLSA 3CF2A 1DEKA 4QBGB 2VPPA 1KNXA 5FBRB 2V1XA 1OE0A 1T5IA 3ECCA 4QM7A 1JQLB 3TE6A 4JSTA 3A4NA 3PR1A 2OFOA 2H57A 5GJWC 221PA 2JLQA 3MJRA 4KVGA 1GL6A 2OAP1 3CF6R 5SZHB 1DG3A 4KVAA 1VCNA 2PEZA 3IBGA 4UNNA 3QKRA 1VKJA 4LOAA 4MH0R 5JRJA 3R8FA 1CRPA 2D06A 4BLPA 5B58C 2C98A 3CIOA 3L0PA 4LDJA 4IOJA 3AKDA 1CEEA 1W5TA 3FB4A 3K8YA 3E1SA 3TGPA 5FL3A 2CLCX 4Q1DA 2X2EA 2CHGA 2QMOA 4OK6A 2J7KA 3WRXC 4Y0VA 1CU1A 3NHBA 2A30A 3FHCB 2XNSA 2GTPA 2ZYTX 3I72A 1YR6A 1LF5A 3T5GA 1JECA 4W5WA 1KY3A 2O8BA 4IFEA 1UEIA 2NO7A 2NTYC 2R6DA 4B71A 5IK2A 1ZVQA 2C8VA 5EP1A 4PAMA 1VPLA 4M1SA 1G20E 3T35A 3SN6A 2GJAA 2IYVA 1HY3A 2JLWA 3HDTA 4DEXA 2WJJA 3P4XA 2GXUA 4AG6A 5DSZA 2O8FB 1X1SA 3KXKA 1E1QD 5AWFC 4DVGA 4W5JA 2AK2A 3NG1A 3FMOB 4M1MA 5BQ5A 3SC3A 3W8RA 1P9WA 1G16A 3KQNA 1R0XA 1KDOA 4GMXA 4C2UA 2ZSAA 3K9GA 4GL2A 4TYQA 3AKCA 4MYUA 2RGNA 4URVR 1NVVQ 1CR4A 1NVWQ 4Q21A 5IK2D 5IT5A 1OH5A 4B35A 1AS3A 1IY2A 3QEOA 2EFEB 4OK5A 3IBYA 521PA 2YZ2A 2QN6A 3BRWD 2A7QA 3DKPA 3UIEA 1ODFA 1G9XA 4P32A 3W3AA 4RZUA 1I4TD 1F6BA 2OUKA 1HQYE 4RD4A 5FOVA 2GA8A 1RE0A 1N2CE 3LX5A 4UNRA 2JLUA 3GJ7A 4GI7A 2ZREA 1CIPA 4ZO4A 1ZINA 4QGGA 3D7MA 1VG1A 2W00A 3C4JA 2BOVA 2XB4A 4TL8A 5JJKA 2EYUA 3CX6A 2BBWA 1N3BA 4IJMA 4PC6A 3X1WA 3LAWA 4DLTA 2C78A 3BE4A 4BZXA 2OLJA 5TARA 4A0FA 2ZRAA 2P6NA 4NCIA 1NIPA 4ZKEA 4IW3B 4V03A 4ARZB 6Q21A 1LTQA 2F7SA 1LNZA 1ZW6A 2G0TA 2ZRDA 4DJTA 1C1YA 4F7WA 1T8TA 3KFVA 1R7RA 2H18A 4MKGA 1NKTA 3WNBA 3N2EA 3LBHA 4BFUA 2WSMA 1RW4A 1NY6A 5J4VA 2IYWA 4I4LA 4RJLA 4OI0A 4E22A 3GLHE 5CLLA 4F93B 3CX7A 1JEEA 2ZSEA 4LY6A 4US1R 4PX9A 1S1MA 2UZIR 2P67A 3AF2A 4NCKA 3TW4A 3VX3A 3WRYC 4YQFA 3RDPA 4P4SA 2VA8A 4TYYA 1MO5A 2O8FA 2P65A 5HZKA 2OT3B 2VHUA 2NG1A 4Q9LA 5B64A 4BWYA 1F2UB 1G7TA 4ZCMA 4RD2A 4TL9A 4BLSA 1DAIA 1YR7A 5KU1A 5CITA 2VYFA 3WP0A 4TTQA 4A6XA 4DCVA 2EFDB 1DELA 4ZCIA 1GP2A 2AKYA 4I1UA 4PPQA 1LB1B 2FNAA 5CB6A 4JLVA 2HEIA 2FFHA 4X8OA 3TJZA 4X8LA 5KSOA 1Z2CA 4Q03A 4FCVA 3U5ZB 2HJGA 3GFOA 3W34A 4YDSA 4F4IA 2WOJA 3H4MA 5CDFE 4LV6A 3M0EA 4QJ5A 4PSKA 1CJTC 1NLYA 1QG2A 4UXJA 3X1ZA 4B75A 1T8UA 3ZVRA 4XSHA 3SHFA 3QXXA 3AF1A 4M4SA 1GKUB 5FUWA 2FZLA 4M9ZA 2J0UA 3I73A 4DCTA 3VNUA 1YRBA 3PQCA 4FINA 4GOXA 4LHZA 3TRFA 4OHZA 3MSXA 4RCYA 5FOTA 4V0MA 3C7KA 1XEWY 2ZJ8A 3TKLA 2V6IA 4IDHA 4ZDKA 5EE5B 1VYTA 4J0QA 3KTAB 3R9WA 4QXAA 2SHKA 4R9UC 2CJWB 2GEVA 4B33A 1OJLA 2FPKA 3W5JA 1P2UA 2HCJB 2ZYWX 4JBYA 4L8GA 3SJAA 5EQTA 1KJZA 2XZOA 4JLKA 4MRVA 1CJKC 4D25A 1XEFA 2WJIA 3KZ1E 1FW6A 1XTKA 2P6UA 2WTUA 3NBZC 3R9IA 3QBTA 4KSBA 3SYNA 1T3SA 3EX7C 1II8B 3H84A 1Z0IA 2D2FA 1MRSA 5CK4A 2YWEA 1VYVA 2W6IA 2CLSA 1N6OA 1YR9A 4DKXA 1KI7A 1JEDA 4HSEA 4TMTA 1FTNA 1WDTA 3BIFA 4Q9JA 2IWHA 1KOFA 1PUIA 2QMUA 4MGKR 2O8DA 2LKDA 4OQNA 1D2EA 1TTTA 1J90A 1P2SA 2J0VA 2NO1A 4LGMA 4TMVA 2HV8A 2EFGA 2Q3MA 1KY2A 2KWIA 2WICA 3CPHA 1YE8A 1EESA 5F3WB 1TEXA 2JA1A 2O0JA 1DE0A 3B82A 4U5XA 3B60A 2C95A 4NYMQ 3U4QB 1OYYA 2VRWA 4URYR 2ZRJA 1U98A 4MGZR 1Z63A 2PMDA 3HU1A 3FMIA 2QNRA 1C4OA 2WKRA 1S9HA 4M1KA 2W6ID 3TR0A 3ND9A 1M2OB 1RPZA 5B57C 2ZE6A 1AKYA 4PC2A 4R71A 1A2BA 1CF4A 1A82A 1P72A 4AYXA 4HB2A 2GXAA 1UKEA 2VIIA 1G3UA 3EG5A 5JJIA 4RVCA 4A2WA 2VF8A 2D7CA 4UXHA 1NBMA 2DWPA 2J3EA 2IYUA 1F2TA 1RVDA 4WW0A 1KDRA 1P61B 3AVXA 1XXHA 3WHKA 2NO6A 3ASZA 4EPRA 4KFSA 1KK0A 2YNMA 3CO5A 4PXAA 4RFSB 4BLTA 4MA4A 3GEIA 1AKEA 5KHOC 3CZQA 5EP2A 2FGKA 4HYYA 4CVNA 3P32A 4TLCA 3RS5A 1YZUA 5SZIA 3RAPR 5E95A 3FDIA 4B6FA 4BGDA 1KMQA 2J1LA 3GFTA 2GESA 4HZIA 4NYIR 4D4MA 1NBMD 1XRJA 4B44A 2YINC 1N6HA 1UM8A 3AP1A 3PXGA 3NEJA 2IHBA 5KNDA 4OJQA 4C7OB 4RD1A 1TEVA 1GTVA 4QBHA 2XGJA 1AS0A 5JS8A 1HQCA 4ACBA 2MMCA 1GNRA 4B2PA 5FTKA 4QJ3A 1RRFA 3EA0A 2IX3A 2ZXUA 1NSFA 1FP7A 1FNNA 3LA6A 3NBFA 1N6PA 4HZUB 1FX0B 2BVNA 3IEUA 5DISB 3QF4A 2OO7A 4LSGA 1GM5A 3GLGB 3AVWA 4U02A 1FFHA 3K0FA 4TMXA 1E9RA 5JECA 4TL6A 1EFRA 3LRPA 5EE3A 4II7A 4L9WA 4GBMA 4XWKA 1IM2A 4PZYA 4ZIRB 1JPNA 2V7QA 5JLJA 2IS6A 1RZ3A 1ZNYA 2ZJ2A 1XMJA 3AGPA 2B6HA 4IEIA 4HLQB 2BM0A 1SVKA 2OEPA 4JKIA 5FUXA 4D4KA 5C46F 3AF4A 5DYGA 1QHXA 4IOMA 1UBCA 3AGQA 4BFYA 4XVQA 5E4FA 4R2IA 3RNLA 4UQOA 2V55B 1G8YA 3PITA 1W5SA 3T34A 2O8EA 1MKYA 3FMPB 4DLVA 4FMDB 3C8UA 3VKHA 2I4IA 3QBVA 3VKWA 1XEWX 4DLYA 3AKEA 5JEDA 1EFRD 4A36A 1KZGB 4DXAA 4NPHA 4KV9A 3VKGA 4CEHA 3SJCA 1PUJA 3IKJA 2V7QD 1RYHA 3O8CA 4GMDA 3V4FA 1SHZA 2ZAOA 2ZS9A 4EJSA 4JJZA 1Y63A 1ZAKA 2OCAA 4BRUA 1J2JA 3B5JA 5ANRB 3TVTA 2ZYUX 4RZ2A 4YMTA 2QUZA 3PUXA 2EQBA 4NMMA 1JAIA 5DIFA 1AGPA 3DL0A 2QRZA 3LO5A 2RB4A 2G1JA 3OIVA 1IN5A 1GRQA 4QBFA 1NN1A 2FH5B 1US8B 4PR0A 1OIWA 2G88A 3RC8A 3PUYA 1OIVA 4UNQA 4K8OA 3GLFB 1ETUA 1TUEA 2QM7A 3N5CA 3RABA 2NO0A 5KYKA 2QBYB 4C3ZA 1OSNA 3AV0B 5FOSA 1E9AA 1U0HC 4XVRA 3T06B 1L4YA 2ZJZA 1NRJB 1XMSA 2IYSA 2QT0A 2XAUA 3ADCA 4MUAA 4XD7A 1W36B 4TLDA 4PO9A 1KDTA 4EFMA 1OH7A 2QL6A 1WBDA 2VL7A 3PVSA 2BKUA 2V4ZA 4A0HA 1CR1A 1X3SA 5KPDA 3T1TA 3NXSA 2C9CA 5H68A 1EG7A 4M1YA 3CWQA 2ZUDA 3TQFA 4BZQA 3A37A 5SZJA 4MDEA 3KXLA 3SI7A 1KO1A 4Q00A 3VR1A 3L2OB 2RGBA 4BPBA 2JLZA 4C0BA 1OB5A 2PZEA 3PV0A 2R62A 4KXFB 1QG4A 3TIFA 2JLXA 3QXJA 2FF7A 4HDQB 1W36C 2HXYA 1XZQA 4NYJQ 2AX4A 3FKSA 4OI2A 2GVDC 4PC1A 4XD7D 1J99A 4JL6A 4RCZA 4BFWA 1E0JA 3CZPA 2RGCA 2GJ8A 4F91B 4IDOA 4NU0A 4WOPA 4AIIA 1P6XA 4KYIB 4DIDA 1LY1A 1KO8A 1XEXA 1DS6A 4TQUS 3IIMA 5KSYA 2FSFA 3ZJYA 4GZLA 2XJ9A 1T0HB 3A4LA 5AK0A 4NCNA 4YMSA 1WA5A 4KHZA 2E87A 4HB3A 3FKSD 2B7BA 1DPFA 3PCRB 1NVVR 4FIDA 1A4RA 2WM9B 3CRRA 3EZ9A 1W4AA 4PPGA 4BLRA 2F1IA 4GT1A 1M6NA 5JWRA 4ZI3A 3GLFA 1XCMA 3C5HA 3EW9A 3KKOA 3CNLA 1F60A 1XD8A 4FCTA 3R7WA 2XTNA 2A9KA 3GJXC 4LJ5A 3RS3A 4B34A 1VCOA 1KJWA 1R4AA 1X8LA 5CM9C 3BS4A 3MWKA 5H70A 2H5EA 2OFWA 3DOEA 3SS8A 1G5RA 2VHQA 1AQYA 4QG7A 3NBXX 1OPXA 2G77B 3DKVA 1YZQA 3GP8A 1YU9A 1VG8A 1S4QA 1V43A 2QTVB 3GJ3A 3OZXA 2P2LA 1XPUA 1NMXA 3OIWA 3P20A 3S1AB 1MO4A 2J0SA 5EP4A 1DO2A 1QZXA 1EFHA 1TU3A 3PUZA 3QY0A 1E96A 5EE1A 1ZM3A 5IHPA 1IN6A 4GOJA 4CEHB 1M34E 1ZC4A 1VG9B 1FQJA 2PX3A 4QNRA 5LD2B 2ANCA 1GSIA 2X8AA 3F8TA 3QIAA 2ORIA 1GUAA 3DM9B 4JLNA 3ADKA 4TLAA 3F3YA 3I32A 4LV5B 4C0HA 2OCYC 2ZEJA 5EE0A 1E2LA 1EFTA 4LUCA 1II9A 3WBJA 1NG1A 4DSUA 2EW1A 1WF3A 3SNHA 1CS4C 3K0AA 1OLOA 1ZM9A 2W2XA 3KQKA 2VLIA 2IWRA 1SXJA 2A78A 2FSHA 3WP1B 4ASUA 2YWFA 2R6GA 4ACAA 2CEAA 1M74A 4JIMA 4NCHA 3U61B 2ZRPA 1W1WA 4G5SA 4EPXA 2XTMA 1Z6AA 5LD2C 4M9SA 2GZDA 3H2YA 3A4MA 3QEJA 2OZEA 4Q9KA 1TQDA 1OT3A 3EWSA 2C04A 3KX2A 1U0JA 2BMFA 3C15C 1Y3AA 1TQ4A 4LJYA 4A6PA 3ZQ6A 3QKRB 1RKBA 2WV9A 3JZAA 4RSGA 1PLKA 4OK3A 1Q1ZA 1SXJD 3AVYA 1PVOA 3QXSA 2CMKA 5EUQB 3Q7PA 5FUVA 4OQLA 4ASUD 2XZPA 2UVQA 2F9LA 1UJ2A 1UFQA 3GJ6A 4QJ4A 1H8HD 1Q21A 4URZR 2FFQA 1G19A 821PA 3B1VA 1EX6A 1OXUA 3TUIC 4TYWA 4D4JA 1EGAA 2REXB 5JCPA 1N6LA 1W46A 1XMIA 4PZZA 3K70D 4IDPA 1UAAA 5JHHB 1SZPA 1E0KA 2Z6VA 3OEEA 4LYJA 5BN3A 2O8BB 1H65A 4LBZA 4BRWA 3SZRA 3NH9A 1JXOA 1UKZA 2IYXA 2ZVQX 4KJZA 2D7DA 3QENA 4HEJA 4DEYA 4AKEA 1XJ0A 2ZJ5A 3LDAA 2BBOA 2MSEB 1IQPA 2GF9A 1UPTA 1RFLA 4JVLA 2ZTSA 3OEHA 2HJVA 1NVXQ 2ZJAA 4LJ8A 4MKHA 1E9SA 4QL3A 1P3JA 1HV8A 3OEED 3W3ZB 1RIFA 4F4JA 1YZTA 1CRQA 4L9SA 4IVQA 2FGJA 2BHRA 4Z51A 1XTRA 2XXAA 3VQTA 3EXAA 4LBYA 3R9XA 4BECA 1OFIA 2CCGA 1G8PA 2RGAA 5LPNA 3G82C 1HYQA 4DT1A 2G83A 3KQUA 3ZZUA 2UKDA 1ZIPA 3DO6A 1LS1A 5C2JB 3U60B 2FG5A 4A0RA 3AEZA 4JLAA 1SHKA 4IRUB 1RRPA 1AZTA 3OEHD 4BLQA 1SVMA 1XD9A 1XTSA 2WMOB 3V9PA 1UKVY 3UG7A 1VCIA 4B73A 3BFVA 3NH6A 2RGNC 4PQYA 3IQWA 4TZ6A 3ZGXA 3P26A 3MG9A 4XTCS 1UKYA 3KL4A 1TQ2A 4FMDF 3Q3JB 4PAOA 3QVVA 2DY1A 4POAA 2IHYA 4HAZA 4NYMR 1EX7A 1E1QA 3WXMA 4ILEA 3P1JA 1NY5A 3Q7QA 2OFXA 2WVJA 2WPDA 3EZ6A 3WMGA 2VF7A 2F6RA 1G8HA 4ZDJA 1E9FA 3EPJA 3L0SA 4MYTA 3DHWC 5FBWB 1A1VA 2O0KA 1QVAA 2P5SA 3GJ5A 2ZE5A 3PEWA 3QPWA 4KYUA 4ZI2A 2ZQ5A 2F9MA 2GETA 2QGZA 3RANA 1LVGA 1KSGA 2W58A 4PFSA 5JWHA 3THXA 3K1JA 4P4SB 4EQ6B 4W7SA 3OAAA 1ZCBA 2EU8A 3A1TA 2FPMA 4TMKA 5DGXA 5KOYA 2OILA 4D80A 4BEBA 1NN0A 2WPDD 4I99A 4LPKA 2DBYA 4AG5A 4EKDA 2P6RA 4PPNA 3WNCA 2AHOA 5FTMA 4P33A 5DLQC 4C4PA 4JT4A 4PHGA 1DAKA 5C4GB 1MH1A 2FJUA 2PZGA 4A2PA 1JQJC 3TR5A 3U6KA 2GK6A 1G18A 4JL8A 5K8IA 4NZYA 3G0HA 1L4UA 2ZAMA 4DDVA 1AK2A 4LHYA 5DO9A 1KO5A 3GQBA 3L43A 4KODA 5BW8A 2BEJA 4TLEA 1P5ZB 3OAAD 2R8RA 5AJZA 1QHSA 3A36A 4IVPA 5AUOB 2GKSA 4QOSA 4US0R 1Z0AA 4DRZA 4JBXA 4DUGA 1QHIA 1ZP6A 3OIUA 4JKYA 4XTRA 2IEYA 1N0VC 2KBFA 2X19A 3L82B 2ZRMA 4PZLA 3QG5A 4B6EA 2J0UB 3SBDA 2HDNB 2PLRA 5KNCA 1YZNA 4C30A 4WAUA 4WA7A 1GILA 1QDEA 1OHHA 1X6VA 3LY5A 3K9HA 1L8QA 2Q3FA 3EA5A 2ZR0A 3O8DA 5AJWA 3SEAA 4MRPA 3UATA 4BEJA 1WB9A 2YOFA 2RGEA 1NN5A 2VSOA 4LC1A 1NF3A 1J7KA 1FL9A 3GLIE 2XNDA 4B3CA 2ZE8A 3VFDA 4PO1A 1D5CA 2ANBA 5EJEA 4CEJA 4DUGD 1QHYA 2Z4SA 2HUPA 2WWXA 4E03A 4M1TA 3HPQA 5BWMA 2FU5C 5BN5A 1FZQA 2ZSDA 4B43A 2D4HA 2BCGY 3THYB 1XD2A 1ZNWA 1E2NA 5G40A 1AGRA 2R6AA 4EQ6A 3O8RA 1OHHD 2G0NA 1OIXA 4NP6A 1S8FA 2IYZA 4Z8YA 2IS4A 2DWOA 4NDZA 4HDOB 2XNDD 1OXTA 1E2DA 3SFZA 1Q1QA 1KIMA 3KXIA 4CYMA 3IGFA 5TB5A 4B47A 3EC1A 4YMVA 2JJ2A 1JNYA 4K46A 3TH5A 2O8DB 2H7VA 4NCJA 3RS0A 5GJBA 1QHHA 4H9GA 1JB1A 2YV5A 1G3MA 3FFAA 3DVLA 1XTIA 2FMXA 4C0QC 3TLXA 2Q9BA 2ZI9A 2ODWA 3MWJA 4Q9HA 3QNUA 2X77A 2AWNA 1MR3F 3SQWA 2C9YA 4DHEA 2GJ9A 1JR3A 1SVOA 1RC8A 1Z29A 5P21A 1T91A 2C5LA 2H92A 3PUVA 3NHAA 5CB8A 2J9RA 1BKDR 3I92A 4LJ4A 3GFPA 2IS1A 3QOFA 3IILA 1AS2A 2BKEA 3BJIC 2JJ2D 5A5GA 4QKQA 4BLOA 2J46A 1XBTA 2IF0A 2GCPA 1U99A 3B8HA 3IIKA 4RY2A 4YXWA 4EPYA 1G7CA 4MKFA 2ZROA 4JLOA 1F2TB 5E7MA 2GXSA 4PANA 3LW8A 1ZMXA 1G8FA 3UXMA 1XXHB 4DBLC 1RRCA 3GPLA 4M21A 1JR3D 2HCBA 1P9NA 1KKMA 4QRHA 4CT4B 4LJ6A 3ETLA 3ADBA 4BFVA 3I5YA 1GL9B 2LKCA 1ZRHA 2WIBA 2OXRA 1S3SA 4LBVA 2D3WA 3TMKA 3THYA 3RS4A 4NONA 2JLSA 2QENA 3GJ0A 1AM4D 4DWJA 2W2VA 3KUDA 2OBMA 4NYJR 4YXWD 1E0AA 3T1VA 1MABA 1Z5ZA 2JDIA 4Q02A 1KK1A 3J81k 3KJGA 1TADA 4Q4JA 4B3GA 3AP2A 3GLGE 2ZPTX 2B8WA 1KZ7B 1IXRC 3REGA 3SFVA 5KSPA 5AR1A 5L3QB 5IRCD 2P3SA 4KBGA 4X8MA 3THOA 1EWQA 1I4DD 1FQKA 4B32A 2ONKA 3VU9A 1AN0A 1XTQA 4KCGA 4A92A 3MD0A 2VBCA 3U44B 2QU8A 2GWHA 721PA 1ZD1A 2CE2X 3QF4B 1N25A 1UF9A 2BBTA 4HAVA 3REFA 2WSSA 1D2MA 1G21E 2JDID 4BUJA 1VDZA 3ZIAA 1NJGA 3K0FB 4DSNA 2QSZA 4XIGS 1DAEA 3VR5A 3LBIA 2X1VA 2QPOA 1KI8A 2PBRA 2AD5A 1NJFA 4Q1EA 2HXSA 1KYIA 2QORA 4EFNA 4KU4A 1KSFX 2JJ8A 2ZI7A 5JWOA 4B3DA 3C5CA 3Q5EA 5DNYB 4GNKA 4B48A 1E2GA 1XFAA 1CJMA 3K9LA 4DLUA 5TVKA 4FD2A 2HT6A 2O8EB 2WSSD 3R20A 2I1QA 1KAOA 1VYUA 2A3RA 1R5BA 2V9PA 3TSWA 3ZIAD 3GJ8A 1IY1A 2Z4RA 3WYFA 2O52A 1IONA 4AD8A 4FI3C 2ZI5A 1U90A 5ELXA 1SVWA 2C77A 1P7CA 1E2PA 4TL7A 1G7SA 5LB2A 1PV4A 3ICQB 3AF3A 3MFYA 2ZS8A 4EJSB 2H16A 4MDFA 1I2DA 2QQEA 1MO6A 1TF2A 5FI0B 1QF9A 2G6BA 3BORA 4ERNA 2B7CA 3MWLA 2OBLA 1UBEA 2XITA 3BXZA 4IDQA 1V5WA 4WIAA 1EWRA 5JFGA 3BFXA 3IHLA 4IOKA 4P0TA 4WXPA 5G53C 4CEIA 1VG0B 2PLFA 4WXRA 2G1KA 5L3QA 5GADl 1P2TA 3UG6A 2NMVA 3EWAA 4MYCA 4ITRC 2BIFA 4WZAE 2E9SA 4Q18A 4JLPA 3BB1A 2KB0A 1ZU5A 2ZUCA 1E9BA 3ZD6A 4EJSC 3EIHA 1P73A 4ZDIA 3U44A 1DOAA 2WJHA 3DMNA 5FOUA 2GEDA 4DCNA 1GVNB 2WWFA 3DPUA 4DLXA 3NBYC 3HU3A 2QQ0A 4TQAA 5H1YA 1JPJA 5IF9A 2N42A 1TF5A 1E69A 1KTVA 1G5PA 1G291 3L0IB 4IFBA 4JL5A 4D6PA 3QJYA 4Q5IA 4AC9A 3VR4A 1FPMA 3AVUA 3KDSE 2KBEA 2ZI4A 1Z22A 5EZ5A 1Z3IX 2K5UA 2HYIC 2W6JA 2ZANA 3DZ8A 1GRNA 2AD1A 3NTUA 4KO8A 2CCKA 4LCBA 4P31A 3U7GA 3IUYA 1BIFA 1E2KA 1KI4A 2XX3A 5HCIA 3KB1A 4LX0A 4US2R 1AJEA 3SHWA 1BYIA 1U9IA 5BXQC 4Z1MA 2EFHB 4A8JC 4Q7KA 3MRSA 4DB4A 3AVPA 2CK3D 2IYYA 2JAQA 2FPLA 1TF7A 1A5TA 2YC2C 2PJRA 1ZM7A 1XCGB 3LV8A 1GZSA 2IYLD 4CGZA 5DHFA 1R0YA 3V4RA 2W6JD 2CNWA 4IKEA 2QPTA 5JS7A 5CDFA 2ORWA 4Q7MB 4D2IA 3THWA 1ZD9A 3FKQA 1XZPA 3QKSA 1XEXB 3X1DA 4NH0A 2RGDA 3RLFA 5C18A 3FYHA 3EAQA 2CXXA 3KUCA 3LWNA 2ZR7A 4M53A 4ZPXA 3LD9A 4DLWA 4JZKA 2XSZA 2IXGA 3PUWA 4Z1MD 2H8KA 4HUQB 4LJ9A 1CP2A 4HI0E 1DAFA 4V02A 3OHMA 2ZU6A 4LHVA 2YHSA 4DDUA 4E07A 3ICEA 2BMEA 4JJKA 3CWZA 4D82A 2R44A 1RJ9A 1W4RA 4DSTA 4TYNA 2AXNA 1VECA 3OF5A 2DHRA 3CR7A 3FE2A 3Q85A 3RSLA 2VO1A 3B1YA 3TQCA 2CNWD 2JASA 2WKPA 4UJ3A 3R7WB 1SKYB 1YJ5A 2ODNA 5L3SA 3C16C 1Q22A 3MWYW 2GAOA 4HDCA 4KBFA 3FOZA 4A15A 4AY2A 2ZJYA 4KFRA 1OXSC 2KSQA 2GZHA 1ZJ6A 1F5NA 4A8JA 1ZCAA 2XB2A 3W90A 3ADDA 2XSZD 2ZRLA 3QUSA 2FX3A 3EZFA 5DI3A 1OFTA 4Q1AA 3WMEA 3AP3A 5K8UA 1FUKA 2QGNA 4WVFA 1WE2A 5HE8A 1KI2A 2ZE7A 1MV5A 2ZRIA 1U94A 2ZRHA 5D3MA 5FTLA 2C96A 3BAFA 3LNCA 5CK5A 3BGWA 2WWIA 1NL3A 4QNMA 4Q4HA 4LK2A 2YKGA 4H1VA 3T1QA 1OH6A 3NC1C 1YZKA 1COWA 3ZS9A 5J4YA 5JI2E 121PA 2O8CB 4B3FX 2B21A 3Q72A 1W47A 2ODEA 2F3RA 2PJZA 3K0AB 1BYUA 4PC7A 4YONB 4HATA 4M0LA 3PG5A 4CRWB 2VP6A 1SXJB 1R8QA 5C4MA 2B92A 3GEEA 3VNVA 1G6HA 1UDXA 5JI3E 4LI0A 3FFBA 4Q4LA 4IHQA 3RS2A 2ZJOA 5FUYA 3W6PA 4G3XA 2QI9C 4PHTA 1E98A 4HB0A 4HUQA 1U0LA 3K70B 1XNJA 2RKOA 2LCFA 3CRW1 3QI2A 1COWD 2EYQA 3BK7A 1QRAA 1KO7A 2W83A 1FOEB 4G5RA 3CBQA 4Q48A 3SOPA 4GDFA 3QXCA 1SXJC 4Q7LA 4TLBA 5EXPA 1KI6A 1X1RA 1Z47A 1JBKA 3RS7A 2IXFA 1LS6A 2GBLC 2GRJA 3K9NA 4G01B 4ZV4A 1QHGA 1TAGA 1K5DA 3QPUA 2RGGA 1S96A 5HPYB 1NG9A 2P5TB 3CLVA 2OE2A 4S2EA 4EUNA 1IAQA 3K70C 4OHVA 3RWMB 4URWR 4PAQA 2A2ZA 4KITB 2IYRA 3BD9A 4TTPA 4MRRA 2AR7A 2UZ3A 1ZNZA 3AQ4A 4XSGA 1F3OA 2W0MA 4UNSA 1JJ7A 3N2IA 4QGFA 2FEMA 3AVOA 3L8ZA 3LH5A 3QF7A 4OBEA 4ESVA 3ZVMA 3D31A 1WBBA 5JZVA 3BOSA 5LB4A 4P4TA 1Q0UA 3CRQA 4S35A 1VIAA 5FL7A 3M4YA 1ZM2A 2WJGA 4EDHA 4Q47A 2G9NA 4ESHA 1BMFA 1U8AA 1A2KC 2IEZA 1JAHA 1Q20A 1XX6A 2WHXA 1G8GA 2OV2A 4XOIA 4ABYA 2WWHA 4B3BA 3BB4A 1G4UR 1W0JA 3DDCA 2O8CA 1WXQA 4GOKA 3FTQA 5KSZA 3I4LA 1IOZA 4UNPA 1UDWA 3GMTA 3IO3A 3SJBA 1T3LA 3Q5DA 4AYTA 2ZETA 3PENA 1VMAA 3RC3A 2IBMA 4QHYA 5DYIA 2XXAB 4LYFA 2DCUA 5KDDA 2IW3A 3DM5A 1OFUX 1ZYUA 5CYOA 3AVVA 1O87A 1YQTA 2F43B 1HTWA 2GBLA 2PT5A 4D81A 4DT1B 2ONJA 3CRVA 5FL7D 3SU8A 4W5HA 3K53A 1H8HA 2G3YA 4ON9A 1E2JA 3AUYA 3FMFA 4QGAA 1BMFD 3HWSA 1AIPA 2NPIA 5JJLA 3T15A 2DR3A 3UWKA 1W0JD 4DB2A 2W2TA 3M1IA 1I4LD 2AWOA 2PH1A 1VHLA 3KJEA 1G17A 1ONBA 3HJNA 4HLCA 1H8EA 1KK2A 5CM8B 1Z0FA 2NZJA 2H1LA 4FN5A 1JJVA 2WWWA 2GJKA 4BQSA 3AVTA 2Z43A 1M7HA 3IIJA 1N5IA 4RZ3A 1X8JA 1XP8A 1AA9A 1ZNXA 3DOFA 3PJRA 1UADA 1XTJA 2ECKA 1AQUA 2YWGA 3EPLA 2JCSA 2F1RA 3PEVA 1D8TA 4OYHA 4OJKA 1E79A 4NE2A 3KKPA 5FPSA 5TMPA 1NIJA 4PPFA 1II0A 4D26A 1IY0A 2BM1A 2QA5A 3LLUA 2A5YB 1B0UA 1MO3A 4OQFA 2AN9A 4KAXA 1NLZA 2IXEA 1N5LA 3FGNA 1H8ED 3NDBB 4MKIA 1IHUA 2AL7A 2PCJA 1GKYA 4I81A 3B6EA 4N0DA 2E1RA 4HUTA 3T1OA 3THXB 1YZLA 2WWGA 4R98A 2CE7A 1D9XA 5EUMA 1KK3A 1ZUNB 2BV3A 2GEUA 1E2FA 1TQ6A 4Q9IA 2Q3HA 4ZCLA 1HEIA 4G5GA 3K0SA 1E79D 3HU2A 2D74A 2ZU0C 4JSYA 3PFIA 4DDTA 4TZ0A 3IHWA 1NN3A 1E2HA 1Z6XA 3M6AA 4G5OA 1U8ZA 2NIPA 4K81B 3A58B 3NDPA 5L8VA 2F43A 4QM6A 3PEYA 3A1UA 2IUUA 1GRRA 3LVQE 3H86A 2VEDA 3EIEA 1M1YE 3RRMA 4DLRA 1EXMA 1TMKA 5KDOA 4JLMA 4V0ME 4F38A 2OCBA 1YVDA 4AURA 3ZVNA 1HURA 3KKNA 4M9QA 4OQXA 1T5LA 3A6PC 1KKLA 1N5JA 4LZZA 2N1BA 3F5FA 3IQXA 4TSFA 3U2QA 2IYTA 5TV2A 2VSXA 1UBGA 3L0OA 3A1VA 1BH2A 3UWOA 2DB3A 1R6BX 4DC9A 1EFCA 4MGYR 3B78A 2GCOA 3VAAA 2WZQA 2YJTD 2CHQA 4EPVA 3HR8A 4I1SA 3RYTC 4LJ7A 5KPJA 4M2LA 1IXSB 4W9MC 1G1MA 3CX8A 3KQLA 3N70A 1Q3HA 4FMBB 3BH7A 4PSAA 5CIWA 5FTNA 5FBQB 1NLFA 2JIZA 4N0EA 2L0XA 1G3RA 2A5FA 2QMEA 4CEJB 5AJVB 5H8WA 5G41A 2Q21A 4BASA 5A4JA 1XCPA 4CT5A 1BOFA 4N1AA 4TSFD 2KI5A 2QROA 3TNFA 2ZRBA 4KSCA 1KO4A 3HYTA 1SVSA 1E9EA 1XD2B 2Q0HA 4O25A 2XJ4A 2FA9A 2DPXA 5J4KA 2VSFA 1ZU4A 1EK0A 4A2QA 4YC7A 1NNEA 2EVWX 2YYZA 5AUNB 3U6BA 2Z83A 3W6NA 3ZYCA 2ERYA 3MGCA 1N5KA 1IN7A 1G4AE 4NHOA 3HPRA 3BFKA 4JMPA 2BCJQ 1IJFA 4C9BA 1KJYA 2V6JA 1XJCA 3BB3A 2JIZD 1E9DA 3VTKA 4AKIA 4G1UC 1WCV1 2B8TA 4IDNA 3IPXA 1TU4A 5CJPA 4NL4H 2OAQ1 5JSZA 4JVSB 4LJAA 3OESA 3PEUA 2Q9AA 1N6IA 2QP3A 2OHFA 1IBRA 4O3MA 3BERA 1T3HA 4URXR 2HF8A 1ZUHA 2GZAA 3NWJA 3WBKA 1QHHB 4M1WA 3E70C 1FP6A 2GILA 4OKSA 5CJ2A 2CL6X 1TNDA 3LVRE 3AKYA 2QRNA 3LFUA 1NBME 2ZRCA 1E2EA 2JEOA 4V0NA 4QC2A 5J40A 4MUBA 1GNQA 2VH5R 3SR0A 4AKHA 1CJUC 4G5QA 4DLZA 2EWVA 1E1RA 5K8TA 1E3MA 2VTKA 3B9QA 3B1WA 1XXHE 3A1SA 1CR0A 1HT1E 4LHXA 4DCUA 2BMJA 5AJYA 1BS1A 1CBUA 3QXHA 3NC0C 2CLDX 4GRAA 3LX8A 1Z0DA 1Z07A 1Z6TA 3H0KA 5FOWA 4WZBE 5HE9A 2C99A 4KI0A 2VP0A 2ASEA 3CNOA 1R10A 4QHTA 3PIRA 4URUR 5TY0A 1Z6YA 1CXZA 1UEJA 4L4UA 4OL0A 3UMFA 1ESNA 2PMKA 1PZNA 5F2EA 3SQXA 2I1VB 1VIYA 1SVIA 2RCNA 3I8SA 3MUFA 2GHIA 2NQ2C 1E1RD 1R5NA 3EC2A 5LBIA 3MAAC 3C41J 1K8RA 1MT0A 1P60A 1VTKA 3OE7A 4LWZA 1Q3TA 1ZUIA 3W8NA 4PHHA 5BN4A 1PLJA 2IUSA 4B2IA 2FDCA 5UKDA 3CB4A 3FWYA 1CULC 4E09A 2KE5A 3ND8A 2D2EA 4C0KA 1MABB 1CKEA 3UMSA 2Q9CA 2RAPA 3MLEA 3GEHA 4LPSA 5FBLB 1OXXK 4Q4JB 3LW7A 3U3KA 4D0NA 4TMZA 3TW8B 4YLGA 1IJEA 5D3QA 3KQHA 3IPYA 2IT1A 4Q1FA 2VHCA 3ZH9B 4N3NA 3VU9B 4ZDWA 1L7VC 1J70A 2OCPA 2QSYA 3OE7D 1KI3A 5F9FA 4P4UA 3U7EB 4O2LA 5EZ6B 1GL7A 1GG2A 5FPKA 3OIYA 1W0KA 2QE7A 1ZC3A 1OXVA 4LYAA 1GIAA 1T9HA 3SDZA 2V3CC 1OF1A 3CH4B 5FPTA 3UKDA 2FZ4A 2F1HA 2FOLA 421PA 4YMWA 5C1BA 1VHTA 1IN8A 2CHVA 2XTZA 2BJWA 4EFLA 3R8CA 3WYGA 5JCZA 1D9ZA 4LRWA 2RGXA 1KDPA 3F0TA 3RRNA 4OHWA 3UMRA 5AJXA 4DIEA 5HTKA 2CDNA 2N46A 1OFHA 4RKFA 2F55A 2JLRA 4R7ZA 2GK7A 4LC0A 1E0SA 3CH5A 4IEEA 2GVZC 3GJ4A 4FWIB 4OQMA 5FPYA 1W0KD 2QE7D 4X8HA 3IO5A 1R0WA 1DO0A 3B7GA 1FMLA 1Z06A 2ZI3A 2QZ4A 1N6NA 5K8LA 1YR8A 2FSIA 2EFCB 3HP1A 1MOZA 4OHYA 1HE1C 3RSOA 3CUEF 2HYDA 3LXXA 3U7FB 2JGNA 3I62A 1R2QA 3U3OA 4CZ2A 3RRYA 5AUQA 1FUUA 2ORVA 3O47A 4RFVA 1M7GA 3CRMA 4Q19A 2WJVA 4ARZA 3C14C 1FMJA 2O0HA 4UXIA 1QHNA 3UK6A 4BFXA 3NIBA 5KUTA 2GAAA 1EFUA 3CR8A 5GJVC 3B85A 4CEIB 1CTQA 3LLMA 2QP9X 2F3TA 2DFLA 3W6OA 3B1ZA 2FFAA 5TDHA 1Z28A 1NMZA 2A5JA 1DAMA 2J45A 2QT1A 3QVUA 4Z8XA 4LV8B 4O0MA 2WJYA 1A7JA 2BMDA 5J5CA 2J87A 1R5OA 1XU4A
chains in the Genus database with same CATH superfamily
1FS6A 4WV3A 2XADA 1CR6A 3G3EA 3GPBA 3KQTA 2HIMA 3IXLA 3WY9A 3TUZC 4B7ZA 5A4AA 3KB2A 3EQ7A 3IP9A 4H1TA 1P2VA 2OV1A 2V5UA 3LSTA 4IXMA 2Q62A 1NR7A 3GOQA 4B4VA 4GAEA 2ZVPX 2ZTLA 3ICPA 3HUFA 1LLQA 3STVA 2OMEA 4LXGA 5JEEA 3NEAA 1BWPA 2WU8A 1BMTA 2OXCA 1ACLA 3AG5A 3BH6A 1GEEA 4OHKA 4C89A 5IARA 3VTAA 1VOTA 2G6TA 4HB4A 1PVVA 4INZA 4AULA 4BO1A 3ZW9A 4JLDA 4MW5A 2PXHA 3K8OE 5IVPA 4C4ZA 1PQYA 3A14A 1U8YA 4BB0A 3G8YA 5TPWB 2FPOA 5HKKD 2ZSKA 5E38A 3DMDA 3TW0A 3PBKA 2B5VA 4DV7B 4C0JA 5HR5A 3GNQA 1OLUB 3I37X 5BVHB 3S5JA 3JZDA 4BKMA 3WNZA 1GDDA 2IF2A 4X7PA 1JR6A 8OHMA 4JUAA 5K0LA 1KZ6A 2IJGX 4F2WA 1U2SA 2W0SA 1NBAA 3X1MA 5JUWA 4TT3D 4L5JA 5FPHA 4EKIA 2OM2A 2EXXA 4DLKA 5HUJA 3IP8A 3THWB 3HXMA 4FXPA 1X19A 3UGQA 2J31A 3H2ZA 1HORA 1U9IC 1VLZA 2HSDA 3EXIA 4R2JA 4RKEA 5E2IA 5FB3A 3RASA 4ENRA 2R2AA 1GQFA 3NETA 5EMKA 1LDYA 2OOSA 4V0KA 4DC0A 1AVTA 3EMKA 1N4DA 3KEMA 2X5OA 2WIGA 3JWPA 1LQUA 3M4NA 4G81A 3V00A 5EXTA 4XAQA 4CR6A 4WBNB 1P2GA 4L4YA 1JT9A 2Z1DA 3F8WA 5I51A 3W7AA 1FDOA 2IS2A 3OLWA 2CJWA 4HLUC 2BR4A 2A5GA 4CKCB 3LU1A 5ERXA 2O07A 3VYRB 3ZLJA 3EGOA 2E4XA 2QX4A 2CL7X 3EF0A 4C0XA 2GDJA 5GJCA 3L6OO 5TGZA 2YHUA 5KTNA 2QEQA 2AN3A 2O5VA 3PGA1 4CMGA 1TKCA 2ZYVX 3OFNA 4QHSA 3KHKA 4KFUA 1KSJA 3RG8A 3W1EA 5L3SB 1G5HA 4H6PA 4DXDA 5KVAA 2DLDA 4JYCA 3L4KA 3CW2A 2Y8EA 4IVRA 4DSAA 3TKYA 1SJ9A 2WC1A 3AW9A 3HBFA 1R9NA 1J49A 3MCAA 1OWOA 3OU7A 4NICA 3TB6A 1NVUQ 1ML4A 4KN8A 4E30A 3LK7A 5EWMB 3IE0A 4YRBA 5ENZA 1EM6A 4IXNA 3S2EA 4AY6A 1AXRA 4GP7A 2GZSA 4JR1A 1BMDA 3H8VA 4Z54A 2ZRKA 4OIFA 3U26A 5KVCA 3PSHA 5BMVB 3AKZA 4TQ9A 4JXZA 3B2QA 2NT3A 5I7UA 2PL9A 3B13B 4DQLA 2ZUBA 1R6AA 1L2TA 4B3MB 3VTZA 1L5GB 1I32A 3T5CA 2FN8A 2LDXA 2EEPA 3H1TA 4XJXA 4QEZA 3CNNA 3D3EA 5G3ZA 3TUJC 1NX9A 3QP9A 3RKUA 2XVYA 1JWBB 2AFVA 2RHBA 4MWBA 4Q4HB 3VR4H 2QV0A 3U4QA 4AJEA 4WPGA 3OCJA 2ZSBA 2UUOA 1BNCA 1JA0A 3IALA 1KETA 3WE7A 2FHSA 5F9HA 2GPJA 4HQLA 3G6KA 3QM1A 4L0CA 3U7HB 3AT1A 2VDWB 1M2OA 4MIOA 5PNTA 1J8YF 3VR6D 5CFRA 3R3XA 4HLUA 2AJCA 4W5OA 4GP9A 2DFKB 4DS3A 1G3IA 4K6FA 5G4LA 2CVHA 4X84A 4NENB 3TAUA 1GXSA 3DG9A 2Z2XA 2FWRA 1Z4IA 1X7HA 4Y1FA 1P9RA 1V4BA 2LBPA 4HAUA 1HUQA 3SQLA 3BXFA 1E6CA 2QTRA 2ZRFA 2YS6A 4RD6A 5CYPA 1I3LA 1N7IA 4E5PA 2C2HA 2NOAA 3OZRA 3TXXA 1CIVA 4BBZA 3WMFA 3PKZA 2YDXA 4ZAYA 3QU7A 4EF6A 2XMSA 2ZIAA 4GX5A 5AQEA 4N8DA 5IEJA 5LXTB 2WF8A 3HI4A 4B6QA 3SJZA 1J0XO 2FVXA 4QGHA 2AW3A 3CTPA 4CIDA 1SUIA 1RHMA 1W85B 2O3QA 2P35A 3EUEA 1OD6A 2FI1A 2I62A 4MVYA 4P36A 3RHTA 1S2MA 1UJ4A 2C03A 4QELA 1V41E 4K3VA 4OV6B 4WCFA 4EOGA 4D44A 1WUKS 1PJRA 4L6AA 4QJIA 4XH9B 4U2GA 3HDVA 4YP5A 2D7JA 3KKQA 5K6TA 1WZEA 1A50B 3TTTA 3L9WA 2OGUA 5HFAA 1QGED 1QH1A 2HLDA 1Z08A 4CCSA 4C7OA 2D62A 2J59A 1LGYA 4GFDA 3EVEA 4V3CA 3INYA 5EXXA 2Z56A 3VGPA 5HRAA 2IHJA 3LSYA 3R3HA 1FSFA 2OVBA 3Q9UA 1JA9A 4J0FA 1G8SA 5E3HA 1U1EA 4GGPA 4R8VA 3VO2A 5JOQA 3COVA 2XUHA 3FCYA 3TR6A 2O3SA 5DEOA 4MIKA 2QAGC 3E27A 3R2JA 3T3HA 2V8OA 3VR2D 3U4GA 5KYWB 2QTHA 2ODBA 2BEKA 3WHPA 1E5VA 2OO5C 3LXRA 4JKOA 3GLGA 3QLUC 5AVYA 1XF9A 1K6EA 2JGMA 2FPUA 3LGSA 3ORRA 4GF5A 1DWPA 3MPUA 4GZMA 3OETA 3PC4A 4ZIRA 1M54A 3BXPA 4OG2A 5B7NA 2F64A 3D8RA 4YUXA 2DR2A 3TK1A 1F9AA 1CS0A 2VK1A 4ZAFA 1PNQA 1QR2A 5BQOA 2C1ZA 3URMA 2DWQA 1GCUA 3OIDA 2G1AA 2HWWA 1GSAA 3JARB 2IVFA 2WE7A 1R00A 2GZ2A 2QT9A 4XWOA 2FN4A 2L17A 2WD7B 3KBBA 4TN5A 3CRNA 2QUKA 2CYAA 3Q3VA 1FP1D 4B45A 3QYJA 1MAVA 3GQVA 3PUKA 1N9ZA 2Q41A 1HYEA 1NVKA 4WFKA 4Z7OB 2DXIA 4CG3A 1FPQA 3UV3A 4LAFA 5IAEA 1U0NA 1BO6A 2AZMA 3VZRA 2X9QA 2GCNA 5K4GA 1I1OA 1LFAA 3UMYA 1KAGA 3O4FA 2UDPA 1JHXA 2VZ0A 5BYJA 4DPKA 2Q4DA 4EJ2A 1J2RA 4K9QA 1ST3A 3JATB 1Q44A 3DL4A 4JY7A 1KGDA 2VZ9A 3DMGA 1OFUA 3RVBA 4QM7A 2XZLA 4FVTA 2R6CA 1QE3A 1HG1A 4B2LA 1FJGB 4DIMA 4M86A 4A9AA 2QAGA 2R8XA 1MNQA 1EJBA 1SC4A 5JVDA 3OI7A 5M04A 5LOVF 2C1XA 5E6SA 1QC5B 5CA0F 2OFFA 2V96A 2BUCA 1VQ1A 4BDTA 2VXBA 3A3OA 2Q3CA 2ZR8A 4RNCA 4LYDA 1O1YA 5FJIA 2PMCA 1RWMA 2EP8A 1U80A 2DUWA 1HDGO 3PR2B 1DEHA 1QZZA 4JR0A 3ETNA 4B3XA 2XMQA 4CQMB 5LA6F 1YS4A 3KVRA 2HADA 3DQQA 1KI9A 1T34A 3DEIA 4PNHA 4UU8A 4WN9A 1FLAA 2C5SA 2ZR9A 4Q1BA 3VH2A 3TQOA 3V7WA 4D9IA 3PHJA 1KDZA 2XKJE 1CFJA 1CCWA 5CPBA 4FSXA 4G4SO 3ZHUA 2Z6AA 1A9QA 3PRHA 4ESOA 1R4NA 3KSDO 2DH6A 2XY4A 3U3MA 3P71T 4MUXA 4QQNA 4HLNA 4RXMA 2A9JA 3D02A 1TDJA 1Z73A 2V7XA 3BWVA 3GGSA 3QELA 5DT9A 4CIWA 5JRZA 1GAWA 2VJNA 3HJGA 1N1GA 3EIQA 3ZJVA 4IH1A 1XZCA 4MJXA 3FRHA 3OT4A 1Q77A 1YUMA 2FPGA 3I01M 4JENA 4FBLA 3ZV6A 1LPSA 5KDLA 2W4IA 3RWOA 1QHFA 4A5OA 4E13A 4RD3A 4RK1A 2FMFA 1HDRA 1MAAA 2PZFA 2IYQA 1DKMA 1Q0QA 4NDAA 5LDDC 2WNIA 2AKAB 2O05A 3B9BA 1TPZA 1JKFA 2JFNA 5DE3A 1V45E 3DSRA 3ZE0B 4BFTA 4BNYA 3LY9A 2Z9DA 5F3RA 1M83A 1JR2A 1ELOA 3V1MA 3ZY3A 1RQLA 4OHBA 3GD7A 2NPFA 3M9LA 1E4EA 4EGQA 3RW9A 2XMCA 4MGHA 4J6EA 3LT4A 1JQBA 2VP2A 4P7GA 3Q3HA 1ILWA 2NPOA 4M9UA 1M8JA 5JDIC 1YF3A 1TT7A 1UPCA 4LHWA 2PH3A 4MCAA 1XMVA 4Z3OA 2AZ4A 1AUOA 1QIMA 4ECEA 2ZJBA 1IQRA 3TLKA 4M1ZA 2H4FA 2JJ1D 1ZAYA 4MVJP 3WWPA 3T7TA 2JLYA 3BIXA 1JFVA 1MRZA 4FM9A 3O1HB 2GO7A 4LSMA 3VHLB 1VRWA 3GGPA 1GFIA 5L95A 3ROPA 4BTEA 1S89A 2VXOA 4CM7A 3UENA 2I6TA 3HBJA 4KLZA 1GPAA 4L73A 1LX7A 5IJ0B 1L4GA 3EFOA 5FUQA 1M7BA 2R5WA 1P1CA 4YAGA 1T9BA 3H5AA 4H0CA 4H1HA 1L7DA 4IMRA 1IBLB 2X4GA 4DA4A 2H52A 1ZM4A 4A82A 1IG3A 1TZKA 5DCUA 3S1LA 4GM1A 4F4FA 2I3BA 4U3JB 5F98A 3I9OA 4H60A 4ZT6A 1IU9A 2W70A 3QSYA 3MINA 1FVOA 4UBIA 5D2CA 3JRXA 3T7JA 1Z2NX 3TBKA 3N75A 4C0SA 3ONFA 4I50B 4JYBA 4MWDA 5PGMA 4UOQA 4WBNF 1XIVA 2VQSA 1M2GA 3G9QA 1AN9A 2FPIA 1DG1G 1PG5A 4LWOA 4Q6BA 5ADHA 5JHGB 1M2VA 3DEFA 3UW3A 2DFVA 2PT9A 2PRIA 4DV1B 4RZIA 3KT8A 4JUDX 3PWZA 5CDSA 1OH8A 4UHEA 2FOIA 4NK5A 1KAHA 2QMHA 5AUPB 5JDIA 1YS9A 1NMEA 3C6BA 1ARZA 3C97A 4CF6A 3CEPB 3OX2A 2CUZA 4M1QA 4BVHA 3S1AA 4LNUA 5DCLA 1N2GA 4OP3A 3JASB 4DMMA 1T8PA 1P7VA 1U65A 4NATA 4EMTA 2VHEA 3RSZA 4UEKA 4KXUA 1GN9A 4A0GA 2TMDA 1DARA 1O96B 2EDCA 2ZKLA 3EXEB 2QTTA 3NVAA 4GPTA 2HRBA 4C7MA 1RRMA 2BC9A 4EECA 1S1CA 2G7ZA 1N3YA 1TL7C 2ZAIA 3D3QA 2YS7A 3FUCA 2PBLA 2GAJA 3OTWA 4QPDA 4BVJA 2UXDB 1SM4A 4C3VA 3MMPA 4QYXA 5BMVF 2PGDA 3TNYA 1CG6A 3NBMA 4RGYA 2QTFA 1BZYA 1S3GA 2CFRA 3KAPA 4Q0MA 4RF2A 4YJDA 3HYCA 4TKUB 2H63A 4XJSA 1CR2A 3P4YA 3O3OB 4E15A 3DZFA 3GO4A 3D2AA 4F11A 5TQJA 3EARA 3C3DA 2UV8A 4JMLA 4UEOA 1RYFA 5F4ZA 3IAHA 4RYDA 5DN6D 5E1BA 3GMSA 3WDKA 4D9FA 2JANA 2VPPA 2FE1A 5FBRB 3BE6A 4G85A 2WB2A 4HRAA 1OE0A 1T5IA 1USGA 2YZGA 4BC0A 4KR3A 4E0BA 2V7BA 4RCVA 4UHJA 3TE6A 4D97A 1I30A 2H57A 3WDLA 4OGKA 3ICVA 2VJCA 4L1KA 4YAWA 1I4WA 1JFSA 2VK4A 3BMQB 5AW4A 2Q3LA 3IAUA 1VZ2A 1TO6A 2PEZA 4EUSA 3IBGA 2NU6A 3JWEA 3R5SA 4M87A 5JRJA 1RI3A 2JGJA 2D06A 3MIZA 4K03A 3UJPA 1SPXA 3UWMA 1EE2A 4TWBA 3L0PA 4LDJA 1KZ1A 4ALLA 3O0DA 3TGPA 3ROFA 5AW5A 3LXUX 5KWVA 1MO2A 2X2EA 4H7FA 4WOKA 2EZTA 4P98A 3QVTA 3ASVA 2J7KA 5LXTF 3VPAA 3ZDAA 1IL0A 4G9BA 4ISBA 3ET5A 1C14A 3BGOS 1DPGA 3EQ6A 4ZJYA 4Z6KA 3MJVA 3AUUA 4CN9A 5CVTA 5LQCA 3I72A 1VXRA 1EAYA 3DO8A 4DUYB 1OJ7A 5AW7A 2NNWB 2O8BA 3KYBA 4IFEA 1NVFA 2I29A 4ND3A 4QUEA 4BEWA 4QA9A 5CHYA 5BOSB 4IPTA 3OURA 2Y2UA 5EP1A 4IGEA 4FZVA 2A1IA 3I0ZA 4LIPD 4LW8A 4Y2QA 4Z9AA 3T35A 5KJCA 3SN6A 1HY3A 1Y4AE 2BISA 2OZLA 4HG2A 5C8ZA 3FTEA 2HH9A 3P4XA 3F6PA 5DP1A 2HTFA 1NQWA 1WWKA 5AHKA 1RQXA 4DJAA 3KXKA 1A5AB 3MTEA 5TSDA 2VAMA 2XHEA 4B80A 2AK2A 1N7GA 3NG1A 4KB5A 1DKQA 4LMRA 4MS1B 3FLMA 3FWHA 1R0XA 5KQRA 4GMXA 3K9GA 4U7PB 2B36A 2IHKA 4TYQA 4E5NA 2H4ZA 1EGQA 5IT5A 5JROA 4KREA 1XSEA 5A03A 3KOWA 2X3FA 1T2FA 2EFEB 1L7OA 4QULA 4ROTA 5AXBA 3IKTA 2VJLA 2QN6A 3DKPA 4LE2A 1KDVA 3TNDA 4NU6A 1BHSA 1IOVA 4GXNA 4RD4A 1HQYE 3ZCTA 1QHEA 2GA8A 3NT4A 2JKYA 1RE0A 2QNIA 4UNRA 5JATA 1D7OA 1C8LA 4C4SA 4P5PA 3VOBA 5CXUA 3GUZA 5DNDA 1HGXA 3REQB 4KXYA 5B7GA 3DEJA 4R2MA 4WERA 4ZO4A 1G5IA 2VPQA 4TRMA 4AMVA 4D57A 1HX7A 1EBBA 3C4JA 1QANA 3RK1A 1NJSA 3BMXA 4P5EA 1H6AA 3GFRA 5FWYB 5DLEA 3RBXA 4AJLA 1NYQA 1SUCA 2FJPA 3O26A 1UJMA 3A32A 4YUZA 3X1WA 3I6YA 3WQSB 1NE7A 1STOA 1LNQA 3MUOA 2BHNA 2AYXA 2OLJA 3CW8X 3IE2A 3GRUA 4FFNA 3HEMA 3W7VA 2FETA 2ZRAA 2HMUA 4NCIA 1NIPA 2R751 4ARZB 1LNZA 3W3AD 2L18A 4DJTA 4X00A 3D1VA 2E82A 4G0YA 4TTVA 5EKUA 4OF4A 3N2EA 3R7DA 1ZOLA 2WSMA 2AEJA 1NY6A 3L0YA 4EKNB 5HX7A 2NAPA 4Y1RA 5ITSA 4RTLA 3TTXA 2MSNA 4E22A 2J3HA 1QIKA 4FNGA 1LBEA 1JEEA 4OSOA 3DE0X 5HIKA 2VUUA 4K86A 4O3FA 2P67A 4G1MB 4MQEA 3TW4A 1LWOA 4YQFA 2G76A 1J0AA 1OAAA 4ZQBA 3UUGA 2ZWAA 3PIIA 2JIMA 3N59A 5A1TA 4P4SA 2OHIA 2O8FA 2BGUA 1XLTC 1V37A 4Q9LA 5LKRA 2NG1A 2WV7A 2AR9A 4H16A 4MP6A 3LOQA 3STYA 5GIOE 4RHEA 4AS1A 2VPZA 2O8VA 4RULA 1F2UB 4QUJA 1X2EA 2WD9A 4LHSA 5FFNA 5T3YA 1EGMB 3RVOA 2XT6A 2DAPA 4BLSA 5M2QA 5CITA 2B0CA 4Y0NA 3ZUPA 4H7KA 4A6XA 2HZBA 2EFDB 3DA8A 3ZDFA 4ZCIA 1V5EA 2DTEA 2O5RA 1E5LA 2FNAA 2PH7A 3A6LA 5AKGA 5CB6A 2Z1NA 1EZZA 1FYVA 1BGXT 5EWJB 2I4LA 3TPFA 3HXPA 3M5WA 1XAGA 4DLPA 3U5ZB 3EW7A 2DM6A 1YASA 4RTQA 4HDNB 5KYXA 4MLCA 3DDUA 4KW7A 5DXJA 5CDFE 2OXIA 3A3NA 1NW4A 5CFOA 4ZVVA 4CR7A 4OLFA 1BE8A 1NLYA 4UXJA 2QUBA 4JP2A 4IIYA 4R9RA 5JAIA 1MHPA 2VQDA 1QS0A 3VSBA 3UMCA 2YYAA 5CP8A 3TN7A 3N8IA 1GKUB 3HN2A 3FYCA 4P3OA 4ZJUA 1T3ZA 2C42A 1ZIXA 4IUDS 4X1YB 4EHHA 1D04A 4WBXC 3HRIA 1BFUA 3X44A 4G41A 4YDRA 3KEGA 1Q7EA 1YRBA 2A57A 3P9ZA 3TRFA 1HR0B 4NRDA 4OHZA 2H2IA 3N74A 3RSFA 4RCYA 4U2EA 5HM8A 1XLTA 5FOTA 3K0BA 4YT2A 4UC0A 2V6IA 4IDHA 4ZDKA 2P9QA 4HFRA 1U9ZA 5EE5B 1G38A 3GN2A 2O20A 1CY1A 1VYTA 4M0EA 1PGPA 1JEYA 2B8EA 3F9CA 3IUQA 5IDYA 4QXAA 2GN1A 4KK4A 1QYVA 2EX0A 1HLFA 4WESB 1ISIA 4MO2A 4B33A 2Y0CA 1OJLA 3EGEA 3O2NA 3W5JA 2HCJB 4D99A 3KJXA 1F6WA 5EQTA 3LQYA 2Q1TA 2R8ZA 3LLSA 3S40A 5TJHA 5KHLB 2IBTA 1DC4A 1TZCA 4H0NA 2JGKA 3MD9A 1YOVA 1LQTA 5EXDA 3RC1A 4WFQA 4B6SA 1UP4A 2EF0A 3I01A 2YJ3A 3RC7A 4TV9B 4EITA 3NW9A 1N92A 3MQFA 3EX7C 1DKLA 2JHFA 1ORRA 4YAOA 5KCMA 4IAOA 4DJEC 3VSEA 2FN3A 3AETA 5LBUA 5CK4A 5H81A 5LN1A 3U1TA 4I50F 1I7QB 1K75A 3HUUA 1SUPA 4N0MA 3AUJB 1KI7A 1N2JA 5LQDA 3D3NA 4HSEA 4HTFB 4B6OA 2JNWA 4WGFA 3CXUA 4TMTA 5F2OA 3LDFA 2PD4A 3BD6A 4ZYWA 4Q9JA 2XKKA 3M70A 2QX7A 1UBKS 3KR0A 3OWOA 4HQFA 4PZEA 5A5FA 4XFJA 4DR3B 1A71A 4J1SA 4YJHA 1J90A 3HH8A 4LOHA 1BGWA 1O5OA 5DFAA 4AP6A 1NZDA 4LGMA 4TMVA 4G0UA 3CPHA 4FKMA 5BR7A 4D9GA 3V6LA 1BVYF 5KSOA 1EESA 3H04A 4U5XA 2C95A 3AR7A 4WN3A 3CLTD 1OYYA 4URYR 1XTBA 2ZRJA 2HFJA 2PMDA 2QYOA 2OD7A 3KKZA 1QB8A 4R1SA 5AKHA 3G89A 1C4OA 5DYWA 1KJ9A 2EJBA 3DLCA 5GONA 5CYGA 4X41A 4WKPA 1QFZA 4M1KA 2W6ID 2ABWA 4XLLA 5CYFA 4CV1A 4U2KA 2EC5A 3ND9A 3TR0A 1RPZA 3TPZA 2DETA 3H13A 1PGNA 1YQEA 3IJ5A 1E1DA 1A2BA 1P72A 2GXAA 1U3WA 1T4BA 3LCRA 1BVUA 1U4SA 2YRFA 1LSJA 4UDXX 2ARKA 4K9MA 3DZIA 2IX9A 1NXPA 2FWPA 2PUVA 3NV9A 3I28A 2WU0A 3L7MA 1TK2A 2VF8A 3MOIA 4RC9A 1A9YA 4TVKA 4X97A 3ROQA 2XLBA 4L7VA 3GC6A 2ID7A 2QN9A 4JJEA 3CLUC 3HR4A 4WW0A 4OAPA 1KF0A 1ULBA 1P61B 1EG2A 4PBRA 3V8NA 3AEKA 2TS1A 3HK2A 1C1HA 2NO6A 2V6FA 3A2LA 2OCXA 2YFHA 4PXAA 4RFSB 4BLTA 2VPTA 3NFYA 4FGJA 3ZBPA 2YASA 1R6TA 4AZ0A 4FFMA 2XGGA 1YQ9A 1XP5A 4KUGA 3GYBA 4WZBA 4KI7A 2FGKA 4IF4A 5BSFA 2D0PB 1H2YA 3U1BA 3P32A 2Z8YA 2VR1A 4TLCA 3G17A 4BKUA 5KYVA 1UQTA 4NYIR 1CY8A 2GESA 3HKDA 3SZGA 1NBMD 3BMCB 3M3HA 5DXAA 2C7OA 1YZ3A 3J7TA 4KNVA 5BV0A 5KNDA 4EUEA 2IHBA 2I71A 1OGJA 2H11A 1F0NA 1GTVA 4QBHA 1ZK3A 1AS0A 5JS8A 4L8YA 1PP4A 2MMCA 3SM3A 3QI7A 1IJBA 3PX2A 4WCVA 2CGEA 3OLQA 2X7JA 5FLKA 3TIIA 3EA0A 3F6RA 2QR5A 1IB6A 1VB3A 1NSFA 1FP7A 4IWYA 2Y05A 1RQ2A 3FWPA 3S81A 3EBLA 1BWRA 3QA9A 1FX0B 2BVNA 3BQ9A 2JD1A 4UHDA 4BPRA 2HRQA 3F5QA 2XYPA 1CUHA 4BV3A 4N3BA 2Z9BA 4Z86A 4L7QA 3IMEA 4BEVA 1M67A 1RYMA 1G2PA 2FAXA 2AOTA 2WDZA 3NHFA 3EIFA 4YROA 3Q6NA 1YGYA 2QRPA 1JSRA 1Z5WA 3E4DA 4MPJA 4PZYA 1JPNA 3LZ6A 5IAOA 5JLJA 4CM4B 3RBZA 1RZ3A 5A4IS 3FZNA 4X3CA 1WOMA 4X1OA 3VHXB 4C88A 3O83A 2VNHA 1SKBA 3E58A 3NHWA 1WB5A 1QHXA 1HFEL 1UBCA 4IOMA 1NW8A 3AGQA 4R2IA 3RNLA 3P0FA 1FQOA 1G8YA 2AMFA 3FKJA 4G0QA 4C20A 1W5SA 1F17A 3MK31 4CR8A 4AJIA 3FMPB 3G59A 1RLMA 4MVJG 5LZ8A 1GUBA 2J3MA 3VKHA 4L74A 3AKEA 1Q1GA 1EFRD 3CN7A 5DPMA 1U0GA 1VMEA 1E3SA 1KZGB 1PD0A 1ULTA 3GJZA 3LQ4A 1H0HA 4FYKA 4G8BA 4J0HA 5AVOA 3WI7A 1HK7A 2V7QD 1VL2A 3JD0A 3UTDA 3ITKA 5KWSA 1SHZA 4BLRA 3S8YA 1HE3A 1RABA 2FP4B 1K27A 4JJZA 1FFEA 2A9RA 1FVHA 2OCAA 4BRUA 1DOZA 3RJ5A 3NHUA 5C8XA 2O2IA 1XL0A 3TVTA 3H6HA 4J43A 3W77A 3FOFC 4HDSB 3M7IA 4YMTA 1XMOB 1JSXA 2AUNA 1Z0SA 3M3PA 2EQBA 4QQFA 1UBSB 1JKIA 1KRHA 2D13A 1DEOA 2OXEA 2QRZA 4L9AA 1NNUA 2HSZA 3QH4A 1ODIA 1T36A 1JW9B 2MYNA 3MVEA 3O8NA 1C3VA 1A9XA 1NN1A 1US8B 2PKQP 2WF6A 3PQEA 4L95C 3ZV7A 1Z0UA 5K7SA 4FZRA 4O6VA 2MHCA 4UNQA 1KGSA 3ZKWB 2G63A 3OEWA 4FS8A 1TUEA 3RABA 2P77A 4I5FA 3ZLUA 4UBKA 4ZCSA 4D74A 3ZJ4A 5KYKA 4K88A 4BB9A 4V3BA 4C3ZA 4C43A 3IMGA 3T94A 3PX3A 2A7XA 3AIMA 4PPYA 2CZGA 5LZ9A 2I3ZA 4XVRA 1RXEA 1RCUA 1L4YA 1RLOA 4P82A 3WWCA 3PLAE 4BZZA 2XAUA 3E1GA 4HMPA 5B4VA 3LCVB 4MUAA 4XD7A 3RVQA 1H2AS 1W36B 3DPIA 4EFMA 1KDTA 3NHJA 1OH7A 3EY9A 3KELA 4PFQA 4C6TA 4CM9D 2C7QA 1WBDA 3I8OA 3GGCA 3PVSA 2JCGA 1ZHHA 2C3YA 3QYAA 1CR1A 1X3SA 4KDRA 2GPYA 3UJDA 3IT1A 5H68A 1EG7A 3RU9A 4M1YA 1M6EX 1BCSB 2W2KB 2ZTHA 2ZUDA 3GFFA 4LRYA 1ZOIA 3TQFA 1IB0A 1I2BA 3KXLA 4KGXA 2WHPA 1VHJA 1Y3FE 3AHFA 3VR1A 4ZMSA 3L2OB 2RGBA 2J9YB 3RF6A 2CMHA 4G0WA 2NUPA 1C50A 1OB5A 3WLNA 5J43A 4BJ1A 2E48A 1MF7A 2OHHA 4YHHB 4QGSA 2D5IA 3HFJA 2K6GA 4HDQB 2HXYA 3V32A 1Y3IA 3G2LA 5KKAA 1D2HA 1B42A 4PC1A 3OQNA 4B7UA 1RWKA 3I5AA 1JQAA 1BW9A 1DC6A 2PXXA 3HY6A 4J9UE 4ZRNA 5IAKA 1FZTA 1B93A 3C6KA 3N2LA 2XODA 4IDOA 5DHSA 4AIIA 3CLRC 4R0VA 2ZZNA 3A9VA 2BHSA 2Z58A 5CBPA 1RR6A 1I6WA 5HNKA 3N0RA 1GRVA 4Q7EA 3QEKA 3UH1A 1A1SA 1XHEA 2QUAA 1YK1A 1KZ4A 1SIOA 3FCAA 5F33A 2HDHA 4FFVA 5I7AA 1H85A 1WJGA 4EEZA 1WA5A 5IFLA 1HEYA 2E87A 3WSTA 4FGKA 1FRNA 1CEYA 4MQLA 1FMTA 3MT9A 3ZHOA 2QVXX 1NVVR 1YRLA 2CN1A 4HOYA 3R7FA 5MHTA 1TVKB 3L4BA 1ZOPA 5KWEA 3JYLA 1KY4A 3K4PA 2PGXA 3OZIA 3KKOA 3V3KA 4XFDA 5HQJA 2W8BA 4OB6A 2A9KA 4LJ5A 1MIOB 1YO6A 4YIKA 4YPFA 1KBZA 1VIMA 5D85A 4ID9A 3ZEIA 3VYWA 4FJ0A 4D3ZA 1N1DA 3TJRA 4EG6A 2REQA 4WMLA 5H70A 2H5EA 3SS8A 1EUCA 1PTKA 1VBNA 4KIWA 4QDJA 1V48A 5BV1A 4BOYA 1AQYA 1CUYA 3OX4A 3NBXX 5F76A 5C7OO 2WSBA 3HCEA 4WZAA 5EPUA 1PT6A 1LPBB 3TW6A 4N4AA 5H82A 4HWTA 3AU9A 4YWHA 2QTVB 1UDBA 1SEVA 4TV9F 5JARA 3HNRA 1DOHA 5TF0A 4JBNA 5JXHA 1X1DA 4JI7B 1DO2A 1QZXA 1U2TA 2FN7A 2Q2QA 1E96A 5IHPA 1IN6A 2AG6A 1R16A 3FNFA 1DL5A 1YK0A 1ZC4A 1ZN2A 2HMYB 3L46A 4NAUA 2UUCB 4KX3A 1YHYA 4RABA 2M6RA 4MYRA 1QFSA 2PSDA 1IQUA 1BXGB 3V8PA 3DM9B 5AESA 3OO1A 3IPRA 5HXAA 3I32A 3N2GB 4WVLA 3VZQA 3UXYA 1EFTA 4RPKA 1II9A 4DSUA 3NLLA 4K87A 4CNBA 4HPJB 2G9RA 1C3XA 3SNHA 3ER8A 4I5DA 2W2XA 1DBPA 1Q19A 1ZM9A 3GGOA 3KQKA 5D87A 1X80A 3JAKA 5FOQA 5JALA 1F12A 1Q7BA 1Z5OA 2EZ9A 1IY9A 2FWIA 2GPBA 3KWMA 4U9UA 2OYCA 4JB2A 2PLNA 1EVYA 2R6GA 3TZHA 1PBTA 4NE7A 2V97A 1P0IA 3RHSA 1XALA 4JQZA 2ZDQA 5LD2C 1XWWA 2GSDA 5ILQA 4L22A 3C8MA 3THSA 2C2YA 2HKIA 2HHCA 2XNJA 3H2YA 4Q9KA 1TQDA 1SN7A 1TCCA 2WQ6A 2CLFB 3KX2A 4GGOA 2I7XA 2XDQB 3WBBA 1U0JA 2BMFA 1EDZA 1JQ3A 3EH2A 3C15C 1MX1A 4XUCA 3JQGB 1D6MA 4ZI7A 5LP6A 1R4MA 5H9VA 4BP1A 3UBMA 4YH1A 5TR9A 2WV9A 3OHSX 3QVWA 1N1EA 4KDEA 2EJVA 1Y8RA 3C6YA 3KYDB 2WT4A 2DHQA 4A27A 1SXJD 1PVOA 2PQ6A 3W2HA 3QXSA 1NPYA 2CMKA 5EUQB 2WMDA 3JW8A 4MB0A 2UVQA 4F8JA 1UJ2A 3QPCA 1YQGA 1XTVA 2XQVA 1H8HD 1Q21A 1AKNA 1RKXA 1Y4UA 2P4HX 3F7MA 1G19A 3GJ6A 4JV5B 1KY5A 2BGTA 2JRCA 2JFYA 3A10A 3JU3A 3OLXA 4Q9DA 1Y8QB 3C3AA 1UAAA 2X3YA 3YASA 4PLWA 5JHHB 3SPXA 2NUBA 2GN2A 4LYJA 5CX1A 2AG0A 5DBIA 3GRZA 2JD2A 1VC2A 2R1UA 4FOSA 3CTMA 2NWQA 4BRWA 1ZQ9A 1PD1A 2WUVA 3NH9A 4L72A 4XLTA 1EZ4A 4KJZA 4CV0A 4ZZ1A 2QDXA 1TYBE 2QQ5A 1ISGA 3KETA 1NVGA 1DAPA 2QXYA 2XVAA 4QUKA 2O23A 1F14A 1L5KA 2RK3A 5JSUA 4FDMA 2Z09A 1H3FA 1GFSA 5I6DA 2MSEB 1IQPA 3SGLA 4IH9A 2FLKA 1Z2PX 3CURA 1J20A 2LVBA 1ZI6A 4G07A 4P4GA 4IMPA 3PVCA 1T10A 1S01A 3LL7A 3NDRA 3WMXA 3WWZA 1KJJA 2ROQA 4F3RA 5BV7A 1F9EA 4U0KA 3RHZA 1WU8A 3OQPA 1V9SA 1ZD2P 1T15A 2XI4A 1L8XA 2HU8A 1RIFA 2R1TB 1KEEA 4F4JA 3R0VA 3W4JA 4EENA 5JPDA 3WSVA 2XXAA 2FGJA 3F4LA 3T7AA 4DWWA 3GN1A 5LIPA 2OCIA 3R9XA 3V46A 1QU2A 4Q3AA 3CCFA 5BOVA 3G82C 4DT1A 1E7MA 4ZEOA 3BRSA 4AZTA 3DO6A 1QLWA 4KJXA 4BV2A 2QLTA 3AM4A 2FG5A 4FSDA 1ZGAA 4A0RA 1EK2A 3AEZA 3O2SB 5ALXA 1AZTA 4BC1A 1SVMA 2DF8A 4KRGA 4BKRA 3A28A 4CJXA 3EOAI 4PLVA 4F3YA 1W2WB 4IYRA 4XYBA 4F2HA 2XCSB 1YFLA 3ZI4A 1J33A 1VCIA 1QMGA 4R83A 3TFQA 5IBQA 3UAYA 3DGFC 3PWSA 4AZ3A 3VNQA 2RH8A 3BWYA 1JFRA 4N40A 3RJ9A 3GP5A 1QTNA 3Q3JB 4PAOA 4W8HA 4XB1A 3QVVA 3QV2A 4MAFA 2ZQZA 1UH5A 1RU3A 4FHCA 1Y8ZA 4E3WA 4ILEA 3MBIA 3Q7QA 2OFXA 2O6LA 4I6GA 4F6RA 2CXHA 2F6RA 3HJFA 4BP3A 5DX8A 1E9FA 1J8VA 1PF7E 3L0SA 1DIHA 3DHWC 5IVHA 4U8HA 4LGYA 4BUZA 3BM5A 3IMFA 5E8JA 3UAXA 2ZE5A 2OBBA 3BE8A 3PEWA 1QQAA 5IH7A 4W5QA 4M60A 3KEQA 1H66A 1JWAB 4TVSA 1M2JA 1PRYA 3USCS 1DEAA 1UBJS 3N8KA 2W58A 3PDIB 4PYMA 3NYIA 2IEAA 3M5PA 3C8HA 1UODA 1WY7A 3DYBA 4M36A 4B4UA 2Z98A 4W7SA 2HK7A 4K40A 3UZUA 3A1TA 2FPMA 2XUIA 5DGXA 1SBNE 5KOYA 1UCFA 3A6EA 3D2LA 1UMKA 4B4DA 4L3OA 1NQXA 3MBKA 2VNAA 5TPZD 4AG5A 1SCNE 5FTMA 4WY8A 1PWYE 3LWBA 2UAGA 4JT4A 1N36B 1CX9B 1NI4B 1JHPA 1O8CA 1IH8A 3ICOA 4UM5A 1VJTA 1JQJC 1SCQA 3U6KA 1PJTA 1W8DA 1XR3A 4REOA 1G18A 4HGRA 5FIUA 4Z3DA 4RTOA 1LBTA 4QATA 2PQMA 5T4BA 3UKJA 3TJMA 5KC8A 4MVWA 1J23A 5LLDA 3U5TA 3GJTA 4JI1B 4HN4B 4NBVA 3KHUA 2C92A 1PX2A 3I2YX 5AW3A 4TLEA 4DR7B 2J9FA 2E4YA 1I1QB 3C7AA 4KXWA 2PVSA 5K0JA 4A7PA 3OPXA 5AJZA 4HX5A 5AOBA 2GKSA 4QOSA 3BD7A 1Z0AA 4DRZA 2OCKA 3PD0A 2II6A 1RXVA 3SSNA 3OIUA 4JKYA 4R3WA 4XTRA 3SIWA 2IEYA 4C3OB 2NXEA 2XUZA 2X19A 3L82B 1QU3A 3HQ4O 4MAAA 4F5WA 1F8GA 1YQQA 4UHCA 2PLRA 1K8QA 1PNOA 4DCGA 1YZNA 3OMXA 2CLLB 4WA7A 1R0SA 1UXGA 1GILA 1X6VA 4HH0A 3G88A 5A3VA 1M1YB 1OZFA 3WGLA 4PGHA 4Y18A 4IWNA 3L1IA 2D2XA 1ZCZA 3VHQA 1TYEB 2Q3FA 4BO2A 1WB9A 2ZR0A 3D59A 3KQWA 5AJWA 2VK8A 3OQHA 4J2TA 3LPDA 1NF3A 4M0DA 4QOEA 1CB7A 2XNDA 1ML3A 1XYGA 2YIDA 2ZE8A 4LK3A 3VFDA 4PO1A 4ZZIA 1XRLA 4DUGD 4E2WA 1QHYA 2E4AA <