1GOTA

Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
338
structure length
338
Chain Sequence
SAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A crystal structure of a heterotrimeric G protein.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (gtp-binding/transducer)
molecule keywords GT-ALPHA/GI-ALPHA CHIMERA
total genus 117
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1996-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1gotA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gotA01
2IHYA 3DPUA 5DHAA 3EIQA 3LAWA 2I1VB 1E2LA 2AK3A 2MMGA 521PA 1GVNB 2NIPA 5FUWA 1DTSA 4LJ6A 2VP2A 2DWQA 4HAUA 2QQEA 3KFVA 1QHSA 2BMJA 1KJZA 1ZIOA 3LX5A 2DFKB 4BFYA 2VA8A 4PO1A 1N0VC 1KI1A 2NOAA 3W34A 3U2QA 4IOMA 1ESNA 3VTKA 5L3QA 1JXMA 4DXAA 1BIFA 1BO6A 3AV0B 1P62B 2FV8A 2NO7A 5EE3A 4XWKA 3GJ3A 3AVTA 1QHHB 1II8B 1P75A 5CM9C 1J7KA 1NLFA 1XJQA 2JDID 2JIZD 3C7KA 3A4LA 1Z06A 4XOIA 5KSYA 3FOZA 3WYFA 1KO5A 1EFRD 3M4YA 3I5XA 1BH2A 4LBWA 2WVJA 3A1UA 2VP9A 1Z6AA 4WZBE 1KZGB 2QGZA 3ZH9B 4EPYA 4KO8A 4HLQB 2OXCA 2B21A 3HYRA 4IDHA 4DLSA 3AB3A 3CZPA 4FI3C 1HT1E 2UVQA 3ADCA 4HI0E 1E1QA 1SXJB 3WRYC 2WOJA 5K8LA 2EFCB 3MD0A 4D82A 2QI9C 3IHLA 1Z63A 1XTKA 2IYVA 3B2EA 1KSHA 3PJRA 5CB8A 4TZ0A 3T1QA 1XB2A 2DHRA 3P4YA 3QXXA 4QGGA 1P61B 3T06B 3G0HA 1OFTA 1C1YA 4E03A 2QG6A 1M74A 2VSXA 2P65A 2ZITA 2O8BA 3SJBA 3W5IA 2ZRAA 3DKVA 1NBMA 1IJEA 3PUWA 1E9CA 3Q8XB 4IOLA 1KKMA 4HZIA 4TYPA 3K0FB 5DN6A 1VKJA 2ODBA 2X2FA 5KSZA 1ZW6A 1NN1A 5FL3A 4WBSA 1XP8A 3BORA 3IPXA 1EXMA 4KI0A 3D7MA 4M9XA 1H65A 4Q19A 1YZGA 3CB4A 1UM8A 1XF9A 1WBDA 2RGNC 4LWZA 2PX3A 3KUDA 4RKEA 4QNRA 3J81k 5DNYB 1TU3A 2V7QD 4V0NA 2FEOA 1E96A 5DI9A 5A4JA 3VR5A 1LS1A 3KX2A 4KODA 1XPUA 2CK3D 1GITA 4CEIA 2WJHA 2ANCA 3WNBA 3K70C 4KXFB 3LW8A 3KJEA 1AS2A 2J41A 4M53A 3FWYA 4M1YA 3V00A 4GOJA 3DM5A 3SS8A 2RAPA 4A92A 4ARZA 3I61A 5DSZA 2W2TA 1N6RA 2XJ9A 2YINC 4QKQA 4TMTA 1G5TA 2ZREA 2JLYA 3AEZA 3SEAA 4JLBA 4Q4JA 1OE0A 4TQAA 1OW3B 2WICA 2J87A 3L43A 3CX8A 1S3SA 2Q6TA 4IEIA 4A9AA 1RYHA 2H1LA 4ZDIA 1CEEA 2OAQ1 1SULA 4LY6A 4RVCA 2V9PA 4HZUB 5J4HA 2JLUA 1ZUNB 1ONBA 3GMTA 5E7MA 2ZUCA 1HURA 3FVQA 3CF2A 4C0QC 3NDBB 2D4HA 2FF7A 1R5BA 4NCKA 4NCNA 2G0TA 2CNWD 5FPSA 4HAXA 4ZDKA 3SYKA 3Q3JB 1XMIA 2GZAA 2VF8A 1IM2A 3A4NA 3KXKA 2O5VA 3IIKA 2W83A 3OFND 4IOJA 1P2VA 3AF1A 5JHGB 3GFOA 3AKEA 1NL3A 3KB2A 2IYXA 3UWOA 3QVVA 1ZCAA 2A3RA 2C9YA 4JVSB 1R5NA 4C7OA 2PT5A 4CGZA 1OIXA 1M6NA 2BCJQ 2V4ZA 1OKKA 1NVVQ 2ZEJA 3W6NA 1J2JA 1FTNA 2XOKD 3BJIC 2XB2A 5EJEA 2NO0A 2A78A 4LHXA 4C0HA 4M4SA 3CPHA 4XWAA 5EXPA 3FMPB 1N5IA 2BDTA 2RKOA 2OE2A 2J7PA 2MSDB 2ZRBA 1X1RA 4JYCA 3Q72A 2OZEA 4CDGA 1WB9A 3OHMA 4KYUA 4B6FA 1ZP6A 3W6OA 1KYIA 4GT1A 1KOFA 3N70A 4OI4A 2VF7A 4BFXA 3KJIA 1K5DA 4XD7D 1E0JA 1R8QA 1U90A 4R2IA 1NI3A 5FPHA 4O0MA 2C8VA 4JL6A 4B73A 5A5GA 2Z5FA 3REFA 4JVMA 3RSOA 2EFEB 2XXAA 3KL4A 2BBTA 2P5TB 2QAJA 3AUYA 1CF4A 1GL9B 1DEKA 2IYTA 5AJVB 4M21A 5LBIA 3IUYA 4OHYA 3ND8A 1OXXK 4Q21A 3HDTA 2X1VA 3MSXA 5ANRB 1HY3A 1X1SA 5FBWB 5E7IA 3TVDA 3DMNA 3QNUA 1EWRA 2D7DA 3EAQA 1ZM4A 1PV4A 2HDNB 4TL9A 1KI2A 1Z6TA 4XSGA 3SBDA 2MMCA 1S96A 4KLNA 5D3MB 1XZPA 4JL5A 2VHTA 1H8EA 3MG9A 2EFDB 1CJKC 3NH6A 2QAGC 2W6JD 3LD9A 3FGNA 4TSFD 2VP0A 1IJFA 1CR2A 4KVAA 3TQFA 3SNHA 1AZSC 3AVVA 4QJ4A 4MGIR 1U0HC 1GG2A 4AKIA 4JLKA 2K5UA 1HYQA 3PUVA 4TLBA 2AXNA 4IXNA 4LPKA 2IYRA 2YNMA 4L16A 1G4AE 3RC8A 3P27A 1Z0AA 3MLEA 3W9YA 1TQDA 4RD0A 4UQOA 2QN6A 1A2BA 4Q9JA 2PJRA 3QEJA 1G3IA 2CJWB 4PHGA 4Q48A 5FTKA 4LV6A 1GNRA 3EPHA 3OEEA 1XZQA 2JLVA 4KITB 1QHIA 2VIIA 4ZKEA 1F6BA 4PX9A 1E94E 4Q5IA 1JEDA 2WV9A 3T5DA 3TE6A 1DO2A 3PEUA 4MRSA 1Z6GA 2P0EA 2NTYC 3FMOB 3K0CA 3ASYA 3RS3A 3DHWC 2FU5C 3DEFA 2E1RA 1W0JA 1KY3A 1W7AA 4MRNA 1IOZA 3MFYA 3IPYA 4WZ6A 1N6NA 2E9SA 1RKBA 4B6EA 4PTLA 1E69A 3DM9B 3EPLA 1OFIA 3LRPA 2ZRFA 1CLUA 1Z28A 2ONKA 3UK6A 1PLKA 3AVQA 3OIVA 2DCUA 3AP3A 3S1AB 4KFTA 2PEYA 1XD9A 2Q9AA 2Q3FA 5FPTA 2X19A 2FDCA 2A9KA 3QXCA 4OK5A 3GLFE 1FX0B 4DBLC 3GQBA 4QHYA 4LSGA 2REXB 2ZJ2A 1A2KC 4IXMA 4PXAA 2OT3B 4GMDA 3GD7A 4HLDA 1MO4A 5K8IA 4ASUA 2CDNA 3LA6A 3T1VA 4BFUA 5TV2A 1VECA 1NVWQ 3RLFA 3QKTA 3IEUA 4AI6A 4LZZA 4TL8A 1F2UB 5EQTA 4M9SA 2H8KA 2OCPA 2IYUA 4AC9A 1KSFX 3BWDD 5IHPA 1RJ9A 3EC1A 2CNWA 2VHUA 3LFUA 821PA 1VYTA 1Q3HA 2W0MA 1GIAA 3QOFA 4DZZA 1BS1A 3BIFA 1KK0A 4B3CA 1Z0KA 1R0XA 3OIUA 4JLDA 3H2YA 1DAKA 2LWIA 5EXXA 2WAYA 3FTQA 1IY0A 2C77A 3CH5A 1OIVA 1OKKD 3L0SA 4KU4A 3V9PA 4GZLA 2O8EB 5CLQA 4B3DA 3MAAC 3SDZA 4BLSA 3ZVRA 4QRHA 3GP8A 1W5TA 1ZCBA 1JR3D 1GKUB 1ZIPA 1GRQA 1OH7A 1CRPA 2JASA 5CM8B 4EJSC 2GK6A 4JLAA 4DUGA 4JKIA 1FQJA 3QJYA 5SZIA 3TVTA 2QBYB 1E2GA 4W5HA 3BRWD 3N5CA 4FWTA 3CO5A 3K0CC 2JEOA 4Q18A 2LKCA 1KHTA 4V0MA 5GVRA 3T35A 4ZDJA 2GJSA 2V7QA 2AXPA 4ACBA 3R8FA 4BLOA 4C2UA 2O0KA 5EE9A 4LBVA 2WJGA 4B48A 1AN0A 3CLVA 5GJBA 2WBLC 1MOZA 4M1KA 1N5JA 1FMLA 1KMHA 4D4KA 1P72A 2A30A 2GVZC 3CRRA 4AKGA 4B34A 2IC5A 2BV3A 5B30A 2ZJYA 2HJVA 2RGAA 3U3JA 5JCZA 3R7WA 4P33A 2QTFA 1Q12A 3H1TA 3W90A 4AK9A 4G01B 2PZFA 2RMKA 3EA0A 3CUEF 5AUQA 2WKRA 4X8OA 4GI7A 4C2TA 2OILA 3ICQB 2WWFA 2AN9A 4FCTA 1Z6YA 3OEHA 3FFBA 3OIWA 1QG2A 1SVKA 2DFNA 3LNCA 5FBLB 5G3ZA 2ORVA 4HAZA 4HDCA 5JS8A 2B8WA 3K0SA 4GBMA 2RHMA 4JLPA 5H68A 2R9VA 2DPXA 3AF4A 5BXQC 1N5LA 4Q7JB 3QEOA 1RIFA 4ITRC 4X8HA 1BOFA 2FFQA 5JMTA 4TTRA 1MO6A 1X8JA 1TU4A 3QBVA 5FBRB 4C0SA 4DLXA 1QG4A 5JWOA 4W9MC 1JNYA 5FOUA 2EVWX 4DEYA 5CK5A 2FE4A 1ZD8A 2ERXA 4IDQA 4GP7A 3RDPA 1XJ0A 4TT3A 3A37A 2J0QA 3W5JA 3V4RA 4CF7A 3SJZA 3H84A 3NBZC 3ZVNA 1E2NA 4FMBB 5G41A 5FOXA 4Q1AA 4B71A 2IYSA 2XOKA 3I3SR 3B1VA 2OXRA 4F93B 2O8FA 2H16A 5HZHA 4XJXA 1MR3F 1FUUA 1T0JB 1G5RA 1NG9A 5K8UA 3QF7A 4HATA 4IHQA 2GXUA 5EP1A 1JI0A 3K9HA 1T3LA 1CJTC 1ZM7A 4MGYR 4DEXA 3NBXX 4AIIA 1JR6A 3L0IB 2FX3A 3MJHA 3EXAA 2GXAA 3WYGA 3ZZ0A 3PEYA 3CX7A 2PMKA 1YE8A 3PEWA 1KO1A 3SE0A 4R2HA 3IBYA 4JBWA 4AD8A 5JBQA 4K81B 4US1R 4Y0VA 1US8A 4GFDA 4OQMA 2GA8A 3KQUA 3FKSD 3CKLA 2ZE5A 2FSHA 4D6PA 2FSFA 1CU1A 1I2MA 1N2CE 1FP6A 2GVDC 2Q3HA 4JSTA 1P9RA 4I1SA 4Q47A 3EPKA 1XCPA 1XU4A 2JA1A 4M1WA 4QBIA 4C4PA 3OAAD 4MQBA 5AJXA 2QM7A 4GOXA 3IO3A 3QPUA 2V6IA 2AFHE 1SVWA 4KSBA 1U98A 3KXLA 1KI6A 2ZI7A 1SKYE 2ZYWX 3BB4A 2AL7A 1YHNA 2G6BA 3PXGA 2GZDA 4MRVA 2FG5A 1NJGA 3R8CA 3WYAA 1NMYA 1V43A 2L0XA 3LWNA 3QKRA 3VR4A 4ERNA 2FPMA 1J70A 2IEYA 4TSFA 5KNCA 1XPRA 4XVUA 2BMEA 1YZQA 4JS0A 1H8HD 3X1WA 1DAGA 1XXHA 5KTYA 3QG1A 5DYIA 3HP1A 3TMKA 1VCNA 2N42A 3CONA 3GPLA 1XEFA 2FZLA 2ZE7A 3B1YA 4X8LA 4GMXA 3OEED 4TQUS 2XZPA 4TMVA 4RD6A 2J1LA 3P20A 3T34A 5HKKD 1IBRA 1PUIA 3PEVA 1S0UA 1SKQA 4D0NA 121PA 1ODFA 3OESA 1WF3A 1IONA 4DWJA 3QENA 5ELXA 3U3MA 2FPLA 2CHVA 3PR1A 5B2ZA 3ZD7A 3O8BA 4LX0A 5CB6A 3VNVA 3EW9A 1RRGA 4PO8A 2FN4A 5P21A 1W0JD 4QBHA 1XEXB 3IQXA 2J46A 2O8DB 1G8GA 2BBWA 2ZYVX 4Z54A 3FHTA 1F3OA 1ESMA 4HB2A 3G5UA 4CZ2A 1VIAA 2NO9A 1UKYA 1I4LD 5AUNB 4F92B 3ICEA 2QEQA 2BJVA 2QORA 2YOHA 5BQ5A 1KDOA 3NC0C 5FH9A 3P4XA 4HAVA 5HZKA 2VYFA 4OHWA 1KMHB 4QGAA 4G0NA 1S3GA 4IFBA 2YWGA 4LJ4A 1GILA 3HU3A 3RYTC 2WAXA 1YR8A 2ZANA 2BBSA 1IN8A 2ZXUA 2WMOB 2OSBA 1ZRHA 4IVQA 1Z29A 1R7RA 1W2HA 1NJFA 1Z3IX 2IYWA 4EPTA 1VTKA 2Q9BA 3I8XA 2D7CA 1AA9A 5HCNA 4F4CA 1P7CA 4NTZA 3TLXA 4BRUA 1MKYA 5DGXA 5KPJA 3I32A 4UNSA 1W47A 1DADA 1U9IC 1GL7A 1HH4A 1EFTA 1KKLA 4QC2A 2G9NA 5HTKA 4F4IA 1QHHA 1Q44A 3KQLA 4TTQA 1F2TA 4BZQA 1KIMA 1XD2B 2PJZA 2PZGA 1DARA 4JKYA 2QRNA 4OYHA 1DG3A 3PUXA 3UMRA 5BN5A 3A4MA 3DDCA 2BMDA 1JBKA 2CVFA 3SFVA 5FOSA 3IIMA 4DSOA 1EFUA 3TR5A 2IS2A 1HA3A 4OI1A 3EX7C 1E2HA 3WNDA 2F7SA 2OHFA 3LH5A 3ZD6A 1FUKA 4RD1A 4NYIR 2UZ3A 4H9GA 4Z51A 3LO5A 4TLDA 1IN7A 5TVKA 4P4TA 1VDZA 3GEIA 2WSSA 5IRCD 1JR3A 2NPIA 3BE4A 4RCZA 4XH9B 4DDWA 1RRCA 5BN4A 4CT5A 3CWQA 1O3YA 4G5SA 4J0QA 1AGRA 1TNDA 3BK7A 4XTRA 2XSZA 1SXJA 1WBBA 1GL6A 2WHXA 4MRRA 2C95A 2ZPTX 2ZRNA 2GDJA 5LB2A 5JI3E 1R4AA 2OBMA 3SC3A 4PC6A 1LB1B 1OH6A 3KTAB 1KJYA 2VL7A 4I1UA 1US8B 5EUQB 3CM0A 3MRSA 3B13B 2JJ1A 1EG7A 3AF3A 1JXOA 2O52A 1E2KA 4PHHA 1GKIA 2NQ2C 2DWOA 4QOSA 2BM1A 3OE7D 2RGGA 1ZUHA 4DLUA 4IDOA 1ZC4A 4Q00A 3KQHA 4RFVA 2HF9A 1EGAA 3E2IA 1W48A 4V0KA 3G82C 2V1UA 3QPVA 1JJ7A 2XGJA 1N6KA 3B85A 1BYUA 1T3HA 1NKTA 3U7GA 1Z47A 3TSOA 1XDBA 2QE7A 2WPDD 3RS0A 1G4UR 2GJ8A 1NMXA 4YLGA 1QBKC 3BXZA 2R2AA 2GBLC 3DZDA 5FL7D 2IYYA 4LJ7A 1JB1A 4DSUA 1JPJA 1ZMXA 4WVFA 1W36C 5FR2A 1UKEA 2F3TA 5CDFA 3VR3A 4LV8B 3E70C 1P3JA 1WCV1 5DE3A 3ZZUA 2W00A 1BMFD 4BZXA 4CYMA 3Q7QA 5DH9A 3KKMA 2QAGB 1ZBDA 5JEEA 4MGKR 4Z1MA 3ETLA 5AJZA 2W6ID 4B47A 4Q4JB 5JJLA 2GCNA 2CLCX 4U5XA 4XVRA 3CR7A 2B7CA 4CVNA 5CITA 4PPNA 5J4VA 4QGFA 2ZM5A 1XTSA 1X6VA 5B57C 3IKJA 4C0AC 3GJ5A 2BM0A 3KQNA 2RGXA 1KO4A 1IN6A 2BHRA 1YZUA 3IEVA 2C96A 1HEIA 2OAP1 4GNKA 2EFHB 4MKFA 4OHVA 1W2GA 2G3YA 5FFMA 3VU9A 2IA5A 3MCAA 4PO9A 4ZKDA 2O8BB 1Q0UA 3VHLB 2AHOA 2Q21A 4JYBA 1CKEA 2ORIA 4FMDB 3MWLA 4Q01A 2V8OA 1IAQA 1G8PA 4CEHA 3SQWA 2WKPA 4IVRA 3C8UA 4HLCA 1Q1ZA 1UKVY 1KK2A 2YOFA 1FNMA 1VMAA 1GSIA 3NVAA 3ZGXA 5BWMA 5TMPA 2WJVA 2QP4A 2R6GA 1G3RA 2ZSDA 4G5RA 3SFZA 5KSPA 2JDIA 4JLOA 3OAAA 1XFAA 2GILA 3BB3A 1JQJC 3T1OA 2O8CB 4Q9IA 5J47A 5C1BA 1I4DD 4TYQA 1SGWA 1NNEA 3RRYA 4LCBA 3FPAA 5FUXA 4JT4A 2XXAB 4OQLA 3FKQA 4URZR 2LCFA 5KDLA 1LTQA 3LXXA 4O2LA 1GNPA 1XMJA 1COWA 1F2TB 3SOPA 1FNNA 5LB4A 1AS0A 1XD2A 1OB5A 1YVDA 4BLQA 4BQSA 2EFGA 4D81A 5KNBA 2NZJA 2VQSA 2OV2A 2ZJ8A 5A0FA 2GTPA 2JLZA 2Z43A 2PMDA 4Z8XA 2P5SA 5KYKA 2WM9B 2H5EA 2ZI6A 1H8HA 3EZ6A 2VRWA 2BVNA 3GCGA 4AYXA 1P2SA 4IRUB 2XAUA 2ODEA 3OZXA 1ZJ6A 4OQFA 4TMKA 2ZSEA 1XNJA 3B1XA 5E3HA 3WHLA 2HLDD 4YMSA 3ECCA 4L9WA 4MYCA 5D3MA 5FOWA 4EPRA 3KUCA 2IYQA 1IXZA 4JLJA 2Y8EA 4YDHB 5L3SB 3DO6A 1Q21A 1P2UA 2F43A 2NO1A 4NDZA 4RD3A 5FBQB 1E0KA 5JI2E 2ZUDA 4LBZA 3IBGA 2X77A 1N6OA 3SYNA 3R9WA 3I1FA 4Q9KA 1FMJA 4LYHA 2TMKA 2AK2A 3K53A 3ZQ6A 1F60A 2ZRCA 4M9ZA 2JJ1D 3EZFA 2ZRKA 721PA 1YU9A 2QY9A 4XIGS 4YDSA 2QU8A 4ZI3A 1VPLA 4ZO4A 2CJWA 2HCJB 3EPJA 1IHUA 4GOKA 1SXJC 2ZI5A 3EC2A 4EPXA 1E79A 2IEZA 2QMHA 1NIPA 3TBKA 1IXRC 3VMFA 3KDSE 3T61A 1Q3TA 3RS4A 2H7VA 2Q0HA 1EFRA 4PHTA 1GUAA 2A2ZA 3BAFA 4TYWA 3I8SA 2KWIA 3GLGE 1KDTA 4RD4A 1S1CA 2J45A 4KCGA 2IW3A 2J0VA 2QRZA 1FX0A 1RC8A 3U6KA 1A4RA 2HYDA 4BUJA 1Z0FA 1AS3A 3HR7A 1UBGA 1LW7A 5FL7A 5FUVA 2HCBA 5IDVA 1GZSA 1VG0B 4D80A 3UXMA 1KDRA 4NYJQ 4LHWA 1XTRA 1M7GA 1TPZA 4Q1CA 3VQTA 1HE1C 3PIRA 3TUZC 4B2LA 1Z0JA 2ZTSA 3CF0A 3LBNA 2CHGA 3W6PA 4DDTA 3BFVA 1GDDA 5FOVA 4YXWD 4TTPA 2IL1A 5LD2B 4ZCIA 4NKRA 4KYIB 2QAGA 2W6IA 5EE5B 4A8JB 2QENA 4HUQB 1G19A 5BN3A 3PCRB 1AZTA 4I1VA 1AGPA 4TLAA 1EWQA 3NDPA 4FMCB 4JMPA 1D9XA 1E0SA 2F9MA 5TDHA 2WWGA 5IF9A 2ECKA 1MV5A 1AM4D 4JVLA 2CXXA 4LHZA 4D2IA 4DLZA 1M2OB 1T4GA 4ZI2A 1RVDA 3RHFA 1DBSA 4PPQA 1RJ9B 3KKQA 3LBHA 4PC1A 5AUOB 3UMSA 2JJ2A 2ODWA 2GESA 2XSZD 3B9QA 4LOAA 3CRQA 1G7TA 3NC1C 1S9HA 2GJAA 1W5SA 2OBLA 1VYVA 3KZ1E 4BPBA 4CEHB 3IILA 5FOTA 5FUYA 3B82A 2OUKA 1NVUQ 3GJ6A 2DFTA 1TEVA 5GADl 3GLHE 4LJ5A 1G3MA 3SYLA 2F6RA 2R62A 2QMUA 1CIPA 4DRZA 1O87A 3KQKA 5HPYB 4LYAA 2P6NA 4B3GA 4A15A 4DVGA 4CW7A 5DI3A 4KFUA 1J8MF 3BOSA 3OIYA 4GZMA 1U0JA 2XTNA 3U7HB 5FTNA 3QSYA 1IN5A 1NBME 2VO1A 2W2XA 4A0RA 3MUFA 4A2WA 2QE7D 3THYB 1FZQA 2R44A 3REGA 1G41A 3M6AA 4DJTA 4EAQA 3R7WB 1P9WA 2CCKA 4C0LA 4OK6A 1RPZA 1G17A 4NL4H 4DCSA 1XD8A 4MRPA 3B5JA 4MYHA 3BERA 3VR6A 1DE0A 1CTQA 3ZVMA 4KSCA 421PA 3ZIAD 4S2EA 3P26A 3MGCA 2E87A 2KB0A 5C4GB 3OFNA 2Z4RA 2QROA 2IHBA 2WKQA 3A36A 4TLEA 2ZS7A 1NSFA 2QMOA 2ONJA 3B7GA 4L8GA 4JZKA 5KPDA 1KAGA 3PFIA 2OLKA 5DO9A 2D74A 2EU8A 2FZ4A 1GKYA 3N2EA 2B92A 2ZJOA 4Q4LA 4Q02A 3KB1A 4MKHA 2BMFA 3GJXC 3BC1A 2NPFA 3O47A 3LQQA 1Z07A 2HLDA 1U99A 4QJ5A 1CJUC 3FMFA 4N1AA 3HPRA 2BWJA 1E4YA 1UBEA 4O25A 1HQCA 2ZS9A 1ELOA 4Q1DA 4A0HA 1KY2A 4URYR 3I62A 3CNLA 4WIAA 2EQBA 2N1BA 1VCIA 5JWRA 1R0ZA 2QL6A 1R8SA 1E9DA 1UJ2A 1AKYA 3GLHB 2J7PD 3I73A 2XTZA 3QKSA 3QKUA 4P4SA 3ZJYA 1ZYUA 3LQRA 2VPPA 3D6TB 4M0LA 4TQ9A 5L3SA 4BFSA 4F38A 4RJLA 1KO8A 3CNOA 3CRMA 2QZ4A 1I4TD 1E9RA 2DYKA 4KVGA 2B6HA 2R6CA 3N2IA 2C99A 2HEIA 1TL7C 2ANBA 5L3RA 1ZU5A 1Q22A 1G16A 2PLFA 3HYTA 3R9XA 4YONB 4DLRA 3K09A 3HWSA 1N5KA 4MH0R 1HUQA 2ORWA 2YOGA 2VSFA 2QPTA 3Q9LA 4GPTA 4BFZA 4IKEA 3D31A 1A82A 4WZAE 2RH5A 1N6IA 3X1DA 4DCUA 4ZCMA 2O8FB 1IXSB 2CL7X 2IXFA 1E2DA 3QF4A 4LC0A 1SVMA 5KO2A 4DKXA 2F1JA 2PEZA 3AVOA 1FOEB 2ZAOA 3KFXA 2IF2A 3FDIA 3OF5A 2R6FA 2UKDA 3VKGA 1HTWA 3P1JA 1DS6A 2LKDA 2YV5A 1D5CA 3NHBA 1L8QA 1FFHA 4RKFA 4WXPA 2ATXA 1G3QA 1Z0IA 2P6UA 4JLMA 5IK2A 3QXJA 5BW8A 1CXZA 1BKDR 1G9XA 3GLFB 5G3YA 3NXSA 3NBYC 3CRW1 3U44A 3C4JA 3UWKA 1TF7A 4YMWA 3M0EA 4US0R 1U8ZA 2H92A 3TNFA 4DSNA 1TMKA 1M8PA 4M1TA 4E07A 3THOA 2GAOA 1MRSA 4PZLA 2OESA 2ZSBA 1T6NA 2H57A 1E4VA 4M2LA 2CL6X 4HB3A 4BLPA 2JAQA 4BLTA 4FMDF 1CRQA 4HUQA 4RZ3A 4U7DA 1Q1BA 3THXA 4G1UC 2AR7A 3B78A 1PZNA 4JSYA 1W46A 2DFLA 1VG9B 3BFXA 4HDQB 5G40A 2FSGA 5J4LA 1W49A 2GRJA 4P3YA 4B3XA 1KDPA 4NU0A 4LI0A 3GLGB 3B8HA 1HV8A 1CR4A 4LJYA 2O0HA 4LHYA 5KDOA 5FTLA 3LX8A 4TLCA 1WP9A 3B1ZA 2IBMA 2RGEA 2WIBA 3I72A 5J5CA 3TK1A 5FR1A 3WRXC 2A5FA 4K8OA 5AJYA 4ESHA 3DZ8A 5GVSA 1SHZA 1Q1EA 1EESA 1E9FA 3WBKA 3A6PC 2FSIA 4M1OA 4AY2A 5C18A 5FTMA 4KFRA 4C3ZA 4NYMR 4PFSA 2CHQA 4TMXA 3C5CA 5EZ6B 2VHQA 4M8NE 1W1WA 2PCJA 1W0KD 4MKIA 4WW0A 3EZ2A 4IDNA 4NCIA 2B7BA 2OCAA 3QE0A 2F9LA 4D25A 1GNQA 2G1KA 4N3NA 5LPNA 4G5GA 5DI3B 3A8TA 4OBEA 2EYUA 4P4UA 3THWA 3JVVA 2IT1A 2IWHA 1TQ2A 5K8TA 1MABA 1M1YE 2EW1A 2ZI3A 2XZLA 3THYA 3NIBA 1NLYA 2FJUA 1XX6A 1YRAA 2WWWA 4Z8YA 4LC1A 5LD2C 4Q7LA 4EPWA 1WMSA 5FPYA 1JJVA 2ZYUX 4EPVA 1EX7A 1LNZA 4OJQA 4BFTA 4JLNA 4E09A 1KZ7B 3B60A 1G1MA 4GL2A 4F7WA 1R2QA 2DY1A 3GJ0A 4QL3A 1NKSA 3CZQA 4HB0A 1WA5A 1YJ5A 3QIAA 2P2LA 1E9BA 3L8YA 3WHKA 4O3MA 2OFXA 1ZM2A 2VHCA 3U4QB 2OLJA 1XXHE 1E1RD 4Y0AA 1E2FA 1JAHA 2JGNA 2R65A 1FP7A 4V0ME 1MRNA 2QP3A 5F9HA 1KI7A 3V4FA 5EXSA 4HUTA 5CJ2A 1YZKA 4PSAA 1OXTA 4AURA 4D4LA 2BKUA 1E6CA 2F1RA 2GXSA 3K0EA 4IDPA 4DUGD 1ZNZA 4FIDA 3GEHA 3GLHA 4R71A 2WWYA 3QKSB 2NG1A 4PPFA 4TYYA 2JJ2D 1WE2A 3AF2A 4BEBA 4WAUA 1GRRA 1P6XA 2FPKA 5KNDA 3UANA 3QVUA 4CT4B 1UDXA 4AG5A 1X8LA 2GK7A 1VCOA 3K9LA 1JQLB 5EZ5A 5HE9A 4B35A 4AKEA 1NY6A 4IFEA 1BYIA 2IS4A 2J0UA 1W4AA 3X1ZA 4UNQA 2R8RA 4TL6A 2AWNA 2KBFA 4URWR 4V02A 1XEXA 2CLDX 3L2OB 3C16C 4Q4HB 5JSZA 3R20A 3K70D 4D26A 3C14C 2NZ8A 4B2IA 3LBIA 1D9ZA 4URXR 1R10A 5EP3A 3AVWA 2RHDA 2GCOB 2OG2A 4QHSA 4QNMA 3AVXA 5IT5A 4P0TA 2QMEA 4DSTA 2CVHA 1G5PA 3RNLA 1RRFA 1E1QD 3SJAA 2W2VA 1Z0DA 3TW8B 1E99A 4LDJA 4PC7A 2YKGA 2YWEA 1NN5A 5JWHA 1ANKA 2JLQA 3LV8A 3GLFA 2ZI9A 2QQ0A 4FWIB 2IYLD 3CNNA 3U44B 1S9DA 3ZVLA 4Q9LA 4TYNA 1DAEA 2V6JA 4XTCS 2GF9A 3VR1A 1RZ3A 1OJLA 3UPUA 2VH5R 1Z5ZA 5SZJA 4QJ3A 2QTVB 2AD1A 2ZU0C 5DLQC 4HYYA 5DN6D 3TW4A 4BFVA 2ZE8A 4NYIQ 5B58C 1VG8A 5KHOC 1XBTA 4B76A 4EIWA 4EQ6B 4JIMA 1ZINA 3FB4A 4A6XA 1R6BX 4HDOB 1JALA 5EP2A 2Z6VA 2A5YB 4DCTA 4Q4AB 2C2HA 1W4CA 3MJRA 3K0AA 3TQCA 1MH1A 1NIJA 2QGNA 2XNDD 2HF8A 2GKSA 1Z2AA 1E2PA 2X8AA 2ZJBA 2ZAMA 1N6PA 3AVYA 1OPXA 3LDAA 3U3KA 1RRPA 2OFWA 2RGDA 5B64A 1GOTA 3LXRA 1WDTA 4MUBA 1KTVA 1XTIA 1FL9A 4BEJA 2XB4A 2G83A 2JATA 3GLIA 3HPQA 1W0KA 2ASEA 4KJZA 1XEWX 4A2QA 2FMXA 1G291 4B74A 1D2NA 1KSJA 1M7BA 4M9QA 4DLWA 1E9SA 3DVLA 1KSGA 1IN4A 2SHKA 4QBFA 2C9OA 1KNQA 3GFTA 4UXHA 1QRAA 1YRBA 2YC4C 5HCIA 2KE5A 1NVVR 2VP6A 2QUZA 3QUSA 3ADKA 1YZTA 4B43A 3RS2A 3ZS9A 3VU9B 2NO6A 2ZRMA 4LJ8A 4ZIRA 2DB3A 1SHKA 4DT1B 2KI5A 3D8BA 2RGCA 4W5JA 1ZD9A 4N0DA 2QPOA 1NP6A 1DPFA 2BEKA 1ZM3A 4L5BA 5IK2D 4PZYA 1LS6A 1LF5A 1PJRA 4HAYA 1G7CA 5EUMA 5L8VA 1DO0A 2A5JA 2RGBA 1YR6A 4NH0A 2AD5A 1KGDA 3F0TA 1Y63A 3TR0A 4NPHA 2DR3A 5D3QA 2GXQA 3IO5A 2JLWA 1TTTA 4C0BA 1QF9A 1E2EA 3JZAA 4HEJA 4A6PA 1E2QA 3SI7A 3FFAA 1NBMD 2J3EA 2CCGA 3RABA 2AWOA 1E1RA 1T0HB 1S4QA 1XTJA 2OBNA 2VEDA 2O8CA 2BJWA 3E1SA 3ADBA 3U4QA 1YZLA 4RFSB 4UKDA 5JZVA 2WSSD 1KMQA 2ZYTX 4B2PA 2JCSA 5FI0B 2WSMA 1AK2A 1OXUA 1UADA 1ZNXA 2PL3A 1II0A 4UJ3A 1E32A 5EE1A 4DHEA 5C2JB 1SXJE 1E2MA 2PH1A 4B32A 5J4YA 5JECA 2DWPA 4B3FX 5JFGA 4FCVA 4F4JA 3AP1A 1Y3AA 3SN6A 4G5OA 1SXJD 1CULC 1GRNA 2ZQ5A 2AFIE 1CBUA 3TUIC 2Q9CA 1GM5A 4NBSA 4DLYA 1UF9A 5JCPA 2XTMA 3BBPA 3D3QA 1FPMA 1QVRA 1FTSA 4JT2A 4YQFA 1VIYA 1MO3A 3EA5A 4WXRA 5UKDA 1I2DA 3UMFA 3A1WA 1UPTA 3A58B 4DT1A 1UEIA 2ZRIA 3CWZA 4PQYA 2WOOA 1B0UA 4DDVA 3EWSA 4EFMA 3I92A 5DISB 1S1MA 1NLZA 5JLJA 4D0GA 1Z08A 1U94A 3L0OA 4Q1EA 4TN1A 4Q9HA 4QM7A 1LF0A 3W8NA 5KOYA 1XCMA 4Q4HA 4W7SA 4JJKA 3RVBA 3IIJA 5BYKA 4PC3A 4MDEA 2ZETA 2QPAA 4HLUA 1H8ED 3SBEA 1VHTA 2ZJZA 2F43B 2REOA 2Z4SA 4WA7A 5EXTA 1NN3A 4OHZA 1F48A 2J7KA 2REBA 4POAA 3F8TA 1E9AA 1E98A 4R9UC 4OJKA 2VSOA 2IUTA 4H1VA 5HE8A 5BYJA 2QT1A 1DELA 1OHHA 4I99A 4P32A 1RE0A 4L9SA 5CIQA 1EFHA 1U9IA 3AF0A 4QG7A 3PENA 2WWXA 3EG5A 5L3QB 3B9PA 1SKYB 2IS1A 2RGNA 2BCGY 4I81A 2J9RA 3UATA 1Z22A 4Z1MD 4TMWA 4V0LA 3U5ZB 1EFCA 4GSYA 1II8A 3HJNA 3BD9A 4PZZA 4IEEA 2X2EA 1TEXA 3QQ5A 3UKDA 3LVQE 4OKSA 3ZDQA 3NEYA 5JRJA 2F3RA 4D4JA 1ETUA 3VHXA 3CR8A 1OYYA 4R7ZA 3RWMB 2FFHA 5FI1B 3TSWA 4RY2A 2ZRJA 1G7RA 1F5NA 5FTJA 2RCNA 5H70A 2IXEA 2GETA 2YHSA 1XEWY 3LLMA 1NF3A 4OL0A 2V3CC 1T5LA 4S35A 5HR5A 4LJ9A 4LJAA 221PA 2ZE6A 4XD7A 3UG7A 1N0UA 4RSGA 4KBGA 4UNPA 3BS4A 1II9A 4KHZA 1GFIA 1SZPA 4HZUA 1OSNA 1AQUA 2FH5B 1KK1A 3RS7A 4B3BA 4PHFA 1CS4C 3HU2A 3GEEA 1ZD1A 2VP4A 3U6BA 3CF6R 1DAIA 4A8JA 1Z6XA 3LLUA 3E5HA 1XWIA 1C9KA 1CJMA 5AK0A 3FMIA 3BGWA 4IOKA 2IYZA 2VLIA 1MT0A 1SVIA 4KLZA 4B44A 3RSLA 1R0YA 1G8FA 3Q7PA 2IUSA 5KDDA 1ZU4A 3AH8A 5CK4A 3A1VA 3RRMA 5CYOA 4RD2A 2GWHA 1KNXA 1KAOA 5CJPA 3TSZA 3W8RA 4UJ5A 5F3WB 2I1QA 4GP6A 4PANA 3TJZA 4ZIRB 5H1YA 1XPOA 3RANA 2W6JA 1M34E 2ZVQX 1C4OA 3U61B 1OIWA 2CL0X 1PUJA 3U7EB 1R0WA 4WOPA 4DCNA 3DOFA 2C9CA 3LVRE 1BMFA 4E5UA 4MDFA 3NBFA 4W5WA 4PQRA 3KJHA 3X1XA 4M1SA 3K1JA 4Q1BA 1U8AA 4YMTA 4FCWA 1Z83A 4JVNA 4BWYA 1E2IA 5KU1A 3RAPR 4YMUA 1DAFA 4TWZA 4CEIB 2YWHA 4BE7B 4DCVA 1W4RA 2Q3MA 3ZYCA 1UAAA 2RB4A 4US2R 2BC9A 2HXSA 1XTQA 1OXSC 3JZMA 3Q5EA 2ZUBA 4ESVA 1DAHA 1ZVQA 4ARZB 4RZUA 4LRWA 3CX6A 2XNDA 4MKGA 1D2EA 2GEVA 3I4LA 3C15C 2ZVPX 4NMMA 4RCYA 4LUCA 2WWIA 2EWVA 5GJWC 2J5XA 2HUPA 2GJ9A 4DLVA 4QM6A 1L4UA 2ERYA 3KJGA 1GWNA 3K09C 4P4SB 4UXJA 4A36A 1KI8A 4DLTA 4PSVA 3EIHA 1J8YF 1QHNA 1J99A 1SQ5A 3KKPA 4A8JC 2QTHA 2QT0A 4PAOA 5FPKA 2D2FA 2F1IA 2PBRA 3FE2A 5J4KA 3K9NA 3W3ZB 2GEDA 1QDEA 1G21E 2ZRLA 1U0LA 3BH6A 4ASUD 2QNRA 3AKYA 5FBVB 1TAGA 3K70B 1SVOA 5H8WA 4OQXA 1UEJA 3SR0A 4K46A 4EFNA 1EX6A 2FFBA 3AUXA 1XMVA 1KI9A 1V5WA 4PSKA 5SZKB 2P67A 2XEXA 5AJWA 4CIDA 4IVPA 2FGJA 1N6LA 3T5GA 4O2RA 2AKYA 5F9FA 1JR3E 1QZXA 2O0JA 4R98A 4C30A 2DBYA 4ILEA 3PV0A 2XX3A 4A0GA 1OHHD 4BGDA 5JRZA 3C5HA 3NHAA 1TADA 1RYFA 2QSYA 2ZIAA 4LHVA 3DL0A 1X86B 1A1VA 4YC7A 3TRFA 1NY5A 3A1SA 4TMZA 4YXWA 1ZUIA 4TT3D 2FWRA 3W3AA 1XRJA 1EK0A 2C04A 3QF4B 5CLLA 3O8CA 3AP2A 4RZ2A 4D4MA 5EP4A 3EWAA 1W44A 5L3VA 4H1UA 3M1IA 2BBOA 4PPGA 5DHFA 3Q85A 4L4UA 3WNCA 2EYQA 1S8FA 2ZJ5A 4Q7KA 1CP2A 4G5QA 2EWWA 1RFLA 1K5GA 1W4BA 2HXYA 4JJZA 1OB2A 2HJGA 4QFMA 3K8YA 4XVQA 2R6AA 5CYPA 2XITA 2IF0A 5AR1A 3CBQA 1RW4A 4DB4A 4A82A 4FXPA 3THXB 3EIEA 3FKSA 2FNAA 4EKDA 1U8YA 3CPEA 3AGQA 1G6HA 2P3SA 2NMVA 2PLRA 4L15A 1NRJB 1U2RA 1F2UA 5JHHB 3NTUA 3SZRA 4V0OA 3VAAA 3UIEA 3WY9A 4IW3B 4XWOA 1CJVC 1U81A 5TB5A 3VX3A 1DG1G 1T9HA 3O8RA 1IY2A 1G64A 4CEJA 1TF5A 1E79D 3QY0A 4FD2A 2BEJA 4C0KA 2V1XA 1AKEA 1DOAA 2WMNB 3WBJA 1OFUX 4FINA 3TIFA 2ODNA 2CE2X 4NONA 1OYWA 4DIEA 3OEHD 3IHWA 2GAAA 3VKHA 2ZJAA 1KI3A 2VP5A 5GJVC 4QHTA 4NYMQ 3H4MA 4II7A 2GEUA 3NH9A 3AVPA 4URUR 2ZR9A 2IWRA 2XZOA 3PQCA 1LFDB 1G7SA 1YQTA 3VNUA 1PLLA 3NG1A 4AWXA 2YYZA 5AUPB 1P2TA 1SVLA 3HR8A 2ZS8A 4JL8A 1QHXA 3ZIAA 8OHMA 1E2JA 1P5ZB 3IDQA 1TUIA 2JLRA 3PVSA 2ZROA 5DYGA 2JJ8A 4F91B 1UFQA 4EUNA 4UNNA 1MABB 2GJKA 1G8YA 4QBGB 4BRWA 2QBYA 4GDFA 3WP0A 4MITA 2R6DA 4ON9A 3U3OA 5F2EA 2QM8A 2ATVA 1ZC3A 3PITA 2ZSAA 4Q7MB 3A1TA 1PLJA 4FW9A 2GZHA 1G20E 4XSHA 3AKDA 4HB4A 2OCBA 1JECA 3K9GA 3QPWA 5C4MA 2I4IA 5HKKA 3X1YA 4OHXA 1JAIA 1N0WA 2A5GA 2W58A 5M04A 3MWJA 1GAJA 2IK8A 3H0KA 4JBXA 1P73A 3ASZA 5EE0A 3P32A 2WJIA 2ZR7A 1KJWA 2UZIR 4HSEA 3S1AA 5E7JA 2WZQA 4NYJR 3ZZTA 4Q66C 4UXIA 3UG6A 3U7FB 3PUYA 1E0AA 2G77B 4TZ6A 4OI0A 4NE2A 1ZNWA 2CBZA 2VBCA 2G88A 3TGPA 3VX4A 3SJCA 1K6MA 2PT7A 2IX3A 4B33A 2V55B 4IJMA 3ZLJA 3NEJA 1J90A 3AQ4A 4PQFA 4PAMA 1T8UA 4NCHA 4BFWA 3IGFA 2C78A 1LV7A 3TAUA 1G6OA 4QGHA 5JEDA 3GLGA 3GJ7A 4E22A 1P4SA 5G53C 2F1HA 1DVRA 3RRZA 5E4FA 1MO5A 2O8EA 4A1FA 2YC2C 2CCJA 1HT2E 3EZ7A 4EJSB 3LW7A 4YMVA 4C7OB 3L0PA 4OQNA 1LVGA 3VFDA 3AM1A 2VTKA 621PA 3B1WA 4A0FA 1VG1A 2WIAA 2JLSA 1GP2A 1QHGA 2ZRPA 2AX4A 3DMDA 5CIWA 3T15A 2PZEA 1Z2CA 4AG6A 5JSZB 3FYHA 1NSTA 4BZPA 2QSZA 1NN0A 2IS6A 1OT3A 2GNOA 1VYUA 4U00A 4M1MA 4CRWB 4DC9A 5TY0A 2GCOA 2J0UB 5SZHB 3THWB 1P60A 3QBTA 1NVXQ 2CMKA 1OH8A 3GJ8A 3GLIE 4MYTA 3TAHA 1TUEA 4ACAA 4EFLA 3RS5A 1E3MA 4KV9A 1TX4B 3MWYW 3QXHA 3O8DA 1L2TA 1Q57A 2CEAA 3EASA 3IQWA 4JLVA 2IUUA 1ZNYA 2F55A 2CLSA 1A5TA 4LYFA 3U60B 2HYIC 4AKHA 4ABYA 2C03A 4NCJA 5J40A 1YR7A 4AYWA 5CDFE 2C5LA 1B23P 2IXGA 2HV8A 1WRBA 2WJYA 4BECA 4UNRA 2N46A 2W0SA 3KKNA 2JLXA 2QP9X 1W36B 2CE7A 4I4LA 2WJJA 4C0JA 2ZU6A 1VHLA 1DAMA 1VCMA 4QXAA 2D06A 2V54A 2YVUA 2WTUA 3QXSA 1KI6B 4Q03A 1OV4A 3SQXA 4NZYA 3KXIA 3K0AB 4KFSA 3WMFA 3MWKA 4FN5A 4V03A 2FEMA 1SVSA 2KJQA 1UDWA 1QHYA 4MYUA 3ADDA 3CH4B 3SHWA 4HAWA 5JJIA 1AIPA 3PUZA 1WQ1R 3Q5DA 1JEEA 3U3RA 2XNSA 5JJKA 2JIZA 3SHFA 5TXGA 2FGKA 4CEJB 4EQ6A 2C98A 2Z0MA 1TQ6A 2OO7A 4Q1FA 1G18A 1XXHB 3HU1A 4KBFA 4RZXA 1S2MA 2NGRA 4Q4AA 3T1TA 4U02A 4LK2A 3GLIB 2J0SA 3RC3A 2OCYC 3GFPA 3WMGA 2H17A 2ZRDA 3B6EA 1K8RA 1XJCA 3BFKA 3NWJA 4LYJA 1T8TA 3CW2A 2AKAB 1LY1A 2G0NA 2GF0A 4LV5B 3QI2A 3DKPA 4EDHA 4JBYA 5KSOA 4BLRA 3ONWA 4KAXA 3X2SA 2D3WA 2ZRGA 1JPNA 1PVOA 1HQYE 1UKZA 2PCLA 2ZR0A 1Q20A 3K0FA 3ND9A 1KI4A 3F5FA 1YKSA 2I3BA 3BH7A 3WXMA 3CPJB 4OK3A 2G1JA 6Q21A 4GRAA 3F3YA 1KO7A 1FW6A 1CR1A 1KK3A 1N3BA 2XJ4A 4G3XA 4MA4A 3BH0A 3DOEA 1Z8FA 2GCPA 2MSCB 2KBEA 2ZSFA 3FHCB 4MGZR 2HT1A 1TF2A 1X8KA 2BOVA 5DIFA 4DB2A 1QVAA 3LY5A 2B8TA 3TUJC 2OFOA 3H86A 4A2PA 1L7VC 2MSEB 2FOLA 4NHOA 1OLOA 2OEPA 4ZDWA 4DIDA 3NKVA 2CK3A 4FMCF 4ZCLA 2Z83A 3CIOA 3FHOA 1N25A 1M7HA 3CRVA 4TL7A 4ZV4A 3L82B 3L8ZA 3R9IA 3AGPA 1NG1A 2WWHA 3C41J 1HE8B 2A7QA 1UBFA 2D2EA 2HT6A 4I1OA 5KUTA 3PG5A 1TQ4A 4B75A 4D0LB 1OH5A 5F98A 3OE7A 2J59A 4URVR 2FA9A 5E95A 1T91A 1OFHA 1T5IA 4RFSA 1ZAKA 3QKRB 1FQKA 1GTVA 1N6HA 2ZI4A 3BB1A 4P31A 1IY1A 3AVUA 1NMZA 4EJSA 4C9BA 3RRNA 4HLUC 5GJCA 2P6RA 3MMPA 2WPDA 3TKLA 1G3UA 3ZQJA 2YWFA 4A4DA 1G8HA 1COWD 2A5DA 3VR2A 2YJTD 1IQPA 1E9EA 2BIFA 1D2MA 1OF1A 4N0EA 1D8TA 2BKEA 2FFAA 1A7JA 1T3SA 1ZM9A 4X8MA 2GHIA 1AQYA 1W36D 3WP1B 1X3SA 3JVUA 1R5OA 2VHJA 5LDDC 1D6JA 3WMEA 2H18A 3KKOA 3SU8A 4ZPXA 4AYTA 4LBYA 4NP6A 4MUAA 2YZ2A 3TH5A 4LGMA 2D62A 1WXQA 1AJEA 1UBCA 1L4YA 3GJ4A 3QG5A 4PR0A 3ZS8A 1YZNA 1CR0A 1YR9A 2KSQA 3RWOA 2OM2A 3EZ9A 4OI2A 4PC2A 5TARA 4PAQA 1XMSA 1OXVA 2ZRHA 2PX0A 5C46F 3EARA 1XCGB 3VKWA 2GBLA 4BASA 3AKCA 4DDUA 2QA5A 2O8DA 4M22A 3KTAA 3T12A 5JS7A 5AWFC 1P9NA 3I5YA 4LPSA 1Q1QA
chains in the Genus database with same CATH superfamily
2PYIA 3DVQX 4KNWA 4G8CA 5ALKA 2IHYA 3EPRA 3F49S 5MN5A 1RT9A 4C08A 5DHAA 3LDFA 1CERA 1JR2A 1XZBA 4CLOB 5K8VA 3UMCA 7YASA 4X85A 4ZO8A 2RHTA 4AP5A 2NIPA 1W8IA 1DTSA 2DQ4A 2XAAA 4LJ6A 3HWRA 2F4NA 2WF6A 2DWQA 1N32B 3EQ8A 4OB8A 1ST3A 3RKSA 3WIBA 5E1MA 2QQEA 2VF4X 2BGTA 4E2XA 3CFYA 5KNDD 2J3JA 3VH2A 2CHUA 4LDNA 4IOMA 2WSIA 1IEVA 1QRRA 1HZZA 2RI6A 4HDSB 1U2QA 4XIJA 4DXAA 5I7RA 1SQ0A 2LXNA 4BIMA 1P62B 1MG5A 4H1TA 1LI7A 4LSMA 2NO7A 4RMIA 1VL8A 3GJ3A 2LUOA 4UVIA 1V25A 2G9ZA 2CXQA 3Q3VA 5ALYA 4MUJA 1TAQA 5E2IA 4KQKA 1J23A 2QRVB 2FMHA 4UE2A 3R1IA 3ZCUA 2FW8A 1E6LA 1BH2A 3ES9A 1CEYA 2VBIA 2GN8A 2GPNA 3GZNB 3VPXA 1DT5A 1XF1A 3AM5A 1A9RA 4WZBE 3BWYA 5AVSA 1SB9A 2QGZA 5M34A 2DGDA 2GHRA 5EMHA 3UA3A 4EPYA 2LIPA 1IVNA 2PWYA 2CNLA 1BEZA 4ER5A 2B21A 3AB3A 1MJGA 3GDOA 3VYRB 2J6HA 3L8GA 4KN8A 5B4VA 1GTL1 1SD5A 2BDUA 1ICEA 2IX9A 3VZBA 5K8LA 1SXJB 3KSMA 1YGYA 3H11A 2PV7A 3HS3A 5L6MB 1BX0A 1PNVA 4D82A 4IINA 4RJJA 3IR7A 3QU4A 4WHMA 1XTKA 1Z17A 4QXRA 2P4EA 5KNBD 1KSHA 2QYHA 1UIMA 4J43A 5CB8A 3VOBA 1UODA 4D44A 2HI0A 1IZZA 3QXXA 3D4IA 1NFFA 1UJBA 2B1IA 2C1ZA 1ZAYA 1M1YB 5JU6A 3W5IA 3OE4A 4BFLA 3S8YA 1BZYA 1BAPA 4WK6A 3DKVA 1YJCA 3AUAA 2HHLA 1VA5A 3Q8XB 2ID8A 1NATA 1UK7A 5AM1A 1Y3CE 1EKXA 2FSVC 2NVUB 1L5QA 1EM6A 1R1DA 3ANYB 4RL4A 4UHFA 5KREA 4OMUA 4FDMA 4NU5A 3BORA 4FQ8A 4MUYA 3BVPA 5AW0A 3N0XA 3OOEA 4Q19A 1YZGA 4HDRA 1UUFA 4JJAA 1XF9A 3EH2A 1AXGA 1D2AA 5B5SA 3GF4A 2W2KA 4KXMA 1XYYA 4V38A 1WBDA 2HU5A 2LDBA 1EQAA 1BWPA 5EKUA 2IDZA 4V0NA 2FEOA 3MWEB 1THMA 3B51X 3VR5A 5A4JA 2K7ZA 2YIJA 5G4KA 1LPPA 5CEFA 1XPUA 2BD0A 4EITA 3RFXA 1CQWA 2WJHA 1G0NA 3MK31 3WNBA 1JWAB 3OQOA 4DY4A 3L77A 1DUSA 4M53A 3TRHA 5BO5A 4MPPA 5H0IA 4GOJA 1L7EA 1I4EB 3DM5A 3E1KA 3ZPXA 1QYXA 2RAPA 4ARZA 3WWCA 1N6RA 1R3DA 1XKLA 1KZ4A 2P40A 4QKQA 4OB6A 9ATCA 2EF1A 5K01A 4U7JA 1RE1A 4A26A 3QOWA 4BX2A 1AE1A 2NO5A 3CVJA 1FJ2A 4HQNA 1VJCA 2VRCD 4ZYWA 4BY9E 3R0VA 1HG0A 4TQAA 2J3MA 2WICA 1ABFA 2GERA 3C5EA 2Q6TA 2GUGA 3IDSA 3DVRX 1ZSVA 1BD3A 3MZ0A 1TJ3A 1ZMOA 3E2PA 4PIVA 4COOA 1CEEA 3I4CA 1H2XA 4WTOA 4LY6A 2V9PA 5IBQA 4UAUA 3D0QA 1I01A 1NW9B 1ZUNB 3EBLA 4IUDS 5JSYA 4QO7A 5BOSB 4RTLA 1E3WB 3NFYA 3O3CA 2E82A 3PDCA 4FEYA 2WQZA 5J2UF 3QHPA 5F78A 1YONA 3RVNA 1H3NA 2Q2OA 4WPGA 4NCKA 1CJCA 1X87A 2YTZA 3HZRA 2GFIA 2APJA 2JVJA 1MP0A 2CNWD 3VH1A 2YVAA 4RPIA 1P0MA 1ND6A 4HAXA 1W75A 2NZUG 3W77A 3AY6A 2PMWB 4DXHA 2PD3A 3DZIA 3SLGA 2VF8A 3KXKA 5I7UA 4FJ2A 4YRBA 1V8DA 1EGVB 3GUUA 3QV2A 4YMHA 5H3HA 3OFND 4IOJA 1ESZA 5B58T 3HO8A 3PPIA 1PCXA 4X84A 1V47A 3MCUA 3NBMA 5CVEA 1YFLA 3FR8A 2WWRA 4IYJA 1ZCAA 1RRKA 3P9XA 2H11A 3NOQA 4TTIA 1DIGA 2J3IA 2OQRA 4JVSB 4RY9A 4BO3A 5KX5F 2HQBA 4CGZA 3ITNA 1M6NA 2BCJQ 4ZVMA 1NUAA 4R01A 2P2CA 1J2JA 1I7PA 2AFIA 3ZH2A 1EVYA 1LU9A 3D8UA 3W6NA 1NI4B 1LWNA 3AEQA 3L49A 1EUCA 1K6EA 5I3CA 1CY4A 3OZIA 4HN4B 4M4SA 4XWAA 5EXPA 4QA9A 5AQ1A 2MSDB 1MHTA 4MDHA 2ZRBA 5BMOA 1YMQA 3INRA 4FILA 4HK4A 4PNEA 4CDGA 1C7EA 2X0RA 3G59A 3KO8A 4KK4A 4S12A 1V45E 4X3CA 4B6FA 1KYIA 1KOFA 3R0QA 4YP1A 5EHGA 2NU7B 3CUUA 4C5BA 4FS8A 3UGQA 4BFXA 1K5DA 1T9BA 1NQTA 1FMCA 1OX4B 4U7HA 3PHJA 3BKXA 3L9XA 1X0VA 3KOYA 13PKA 2PJUA 5ED0A 1XYVA 2C8VA 4JL6A 1BVYF 3RU7A 5A5GA 2P9BA 4NOJA 5JMOA 2Q41A 3MQ2A 1QYDA 3AW8A 3KV3O 2EFEB 3RSOA 5KQPA 5LYJF 2QAJA 2P5TB 2O07A 2AS0A 1CF4A 4U3JA 4QGBA 1RM5A 4TKLA 1XDUA 2XNKA 4D9KA 1GEEA 1K75A 1WVIA 3TQRA 2O5CA 2E4XA 1B8NA 1TYBE 3GG9A 2IW1A 1BU5A 1U2TA 1HRDA 2BEUB 5IX8A 2HHAA 3MRXA 1NJSA 1X1SA 1JHZA 1YAHA 5E7IA 5FBWB 3TVDA 2G9UA 3DMNA 2DT8A 2F3PA 4R6WA 1EWRA 4FXOA 4UHEA 5ER9A 1THZA 2G07A 3P5SA 1M2EA 1DRJA 2EHDA 4TL9A 4XSGA 3SBDA 1D0SA 3BFPA 2N0SA 2Q3BA 4X3PA 5D3MB 4B7AA 1J0AA 1VJ0A 1WEKA 3MG9A 1H8EA 2JL1A 3EQ6A 4JL5A 4CM9A 3MJFA 5I6DA 3A3OA 4FP9A 1RI5A 2CVPA 1CJKC 3NH6A 2QAGC 4WLFA 3V1NA 2C5FA 1I7QB 2ZT8A 3FGNA 5SV2A 1J2RA 4ZOEA 2C61A 4TSFD 1FPQA 4M0EA 4MO9A 1LK7A 4RWEA 3T3IA 1G8AA 2AEEA 2Q1XA 3COSA 1JQKA 1AZSC 1B93A 5L4LA 4QJ4A 5HG0A 4FZJA 1CYDA 1TUBA 3H19A 3KS9A 3ZTWA 4R51A 1YS1X 2G6TA 2CXPA 1JIUA 5BR7A 5JZSA 2K5UA 3HUDA 1RMYA 2P3LA 2YIVX 3ROQA 4IXNA 2IYRA 2YNMA 3TLBA 3RC8A 3P27A 1Z0AA 3MLEA 1WIWA 3W9YA 4XRRA 5ALMA 4RD0A 1FUIA 1OLSB 2GHQA 3LMKA 1W85A 2QN6A 2YICA 4UQOA 5J63A 8ATCA 1WCWA 1A2BA 1F8UA 2GRAA 1DX4A 1G3IA 2WJ3A 1E6EA 4YRTA 5EINA 3X1KA 1DJOA 5J2TB 1M6HA 2ZIFA 3C3AA 1JF8A 4KITB 2EEPA 2VIIA 3DE6X 4ZZ0A 4YUYA 4ESEA 3UPTA 2NVUA 3QP9A 4PX9A 3O4GA 3NPMA 1K9SA 2P1ZA 5D1NA 1GQ2A 2WV9A 3GFFA 1OFVA 2UXDB 2P2YA 2SKCA 3TE6A 1PX2A 2VXYA 1DO2A 2O3RA 1MENA 1Y5NA 3ZNNA 5BQXA 1LVHA 3K0CA 3TDNA 3DHWC 2ARKA 1ZR4A 1ZHOA 1KY3A 1JAXA 1P91A 1VGRA 1WUKS 3MFYA 3IPYA 3R0JA 4WZ6A 1MHPA 3B53X 1K7CA 3EPLA 3ZIUA 2JW5A 2RSLA 2ZRFA 2FQXA 3KOXA 1OZGA 1CLUA 2MYTA 2VI5A 3B1FA 1LFAA 3PPXA 4KZPA 3AVQA 4ZWNA 3SZ3A 3OIVA 2DCUA 2PYZA 3AP3A 1ZISA 4GPBA 3S1AB 5DOZA 4RVOA 5JJCA 5IULC 1RXYA 1VJRA 2FUNB 2CMFA 4X44A 3DDSA 2A9KA 4KX3A 4QFBA 3BF8A 1FX0B 2WSLA 4AUEA 1RZUA 2PL1A 3NHYA 4DBLC 1XROA 2Q6OA 3DOJA 1GU7A 5TC4A 4FOSA 4ZGGA 1A2KC 3HNRA 3DAOA 3ZHBA 4PXAA 4Y2TA 1SPXA 4ENUA 2D2VA 1R64A 4ZHQF 5NLLA 5BW6B 5MN6A 2CDNA 2CNDA 2Y2VA 3LA6A 3ZCXA 2CLLB 3M1LA 1CZRA 5TV2A 4PYRA 4ND3A 3ZDBA 4UU1A 1VPWA 4AI6A 3IEUA 2AB0A 5ALSA 1Y4DE 3I0MA 4KO3S 1F2UB 5EQTA 4M9SA 3ELUA 3JARA 3BWDD 3K15A 4GECA 5LMNB 2DUNA 4EEZA 2YV4A 2VHUA 5ARDA 821PA 2BKXA 2WEKA 4IWNA 1GTZA 5TGTA 1JTFA 2ENUA 2EP5A 3R75A 2JPDA 2DE0X 2L18A 3HK2A 2IZ5A 3D6NB 4PGHA 3PRHA 5FP0A 3V3KA 3WGGA 3K9WA 3ZU3A 1C3EA 3MTAA 3P52A 2WTNA 3BIFA 2B4TO 2P9QA 2OD7A 2VSQA 5AI0A 4AZ3A 3EH1A 1Z0KA 3R0XA 1Q0PA 3RBVA 3WLPA 1JMYA 3ESQA 3H2YA 4KXUA 4RK5A 1KZ6A 5EXXA 3WFZA 1VA4A 3KAKA 1UOEA 3IRUA 4LY3A 2CXRA 1SXGA 2V3WA 5IW8A 4YY3B 2FDRA 2VYVA 1OIVA 5C81A 1OKKD 2GD6A 3RK4A 4Q3KA 2I2BA 3UUFA 4UZSA 2W2QA 1P0QA 3V8NA 4AICA 3EQ7A 4MR8A 1VKHA 1AF7A 2XUKA 2VBFA 4ZVLA 1E1LA 1W5TA 3F8SA 1G5HA 4LW8A 1V95A 4TVSA 1EINA 2HC9A 4FI3F 3TLJA 4JLAA 1KMCA 5IZCA 4EYKA 2R7MA 3PHCA 2Q2NA 1FQJA 2BHTA 2GK4A 2OHGA 2R00C 3N5CA 2W6NA 4LG1A 1PR5A 3LPAA 1JB9A 3FBTA 2LKCA 4WXMA 1KHTA 2C83A 5GVRA 4EBBA 1Z4JA 3ZV5A 4EG4A 5LOVF 1PG0A 4FFVA 1I2BA 5B6JA 4FGSA 4K88A 4I3HA 2UZ4A 1HGXA 2WVGA 3ROEA 2WJGA 1BE1A 1EQ2A 2XTJA 2PFKA 3CLVA 5LZ5A 5JZ9A 4I5IA 3F7NA 4PY2A 5CXQA 5I51A 5IDWA 4M1KA 2FQYA 1N5JA 2WSYB 2JKYA 3L8FA 3AEUA 1KEEA 3ZGZA 2GVZC 2O7QA 3GP5A 2LV8A 1D7AA 2OZLA 3I8OA 4B34A 3T95A 4IJWA 3HJBA 1UK9A 1S8NA 3CZ9A 3G5MA 3QWIA 4IF6A 5A0VA 4LOLA 3DEYX 4O2BB 1QO9A 4P33A 1RYEA 1EEXB 4FBLA 3H1TA 4LRSB 4CBVA 4OQQA 2RMKA 2FZGA 4ZOLB 2F3SA 4JOBA 3U4HA 1J49A 5TT0A 3PRKE 5JR3A 4V1CA 2FDXA 1BE8A 2OILA 1DEOA 3QPBA 2X6QA 2IPNA 4FCTA 1XLWA 1Z6YA 3PHIA 1JLLA 5B2FA 2Z4TA 3LC1O 3HFSA 3JQBA 3NBUA 1QG2A 1SVKA 3OIWA 4KWTA 5JAMA 5C51B 4HDCA 3BMCB 1ID1A 5EVJA 4GBMA 2M1ZA 4D5EA 1GXSB 1EJ6A 2XUHA 1QFZA 4Q93A 4AT1A 3DKIA 4CUKA 1BOFA 2FFQA 2VZ8A 5DTQA 2IOHA 1O1YA 1MO6A 3IP8A 1X8JA 2ZGVA 3MERA 3QBVA 4KXWA 2CT8A 4DLXA 1QG4A 4H60A 1JFVA 4DARA 3DLBA 1ISHA 2QQ5A 1Y6RA 4DEYA 3A4TA 2GH1A 5CK5A 3ZNQA 2ERXA 5F73A 4GP7A 1XJ0A 1GGKA 2JRCA 3PJDA 3A37A 2B4KA 3KK0A 4LE1A 3WA7A 3V4RA 5A5VA 3ACBA 3TG2A 3N8GA 3ZVNA 1L5YA 1IG0A 2EKPA 4GXQA 4JI5B 1DOZA 3OZVA 1PJ2A 1TDJA 1JMKC 3G1WA 1CQZA 1M34B 4HWOA 5CLHA 4F93B 2H16A 4JBIA 5HZHA 1FUUA 1GFWA 1T0JB 4N9WA 2R66A 4JBLA 1NG9A 3QF7A 4FSHA 1JEOA 1LC0A 1NP3A 4FBMA 4QULA 5CNIA 2GXUA 4MI6A 5CB4F 1T3LA 1CJTC 3RVSA 1TKAA 5IFLA 1BXRA 1Y5LA 3E22B 3L0IB 4FDAA 3MJHA 4IJ6A 3ZE2B 2JLAA 3HB9A 2HXGA 1G21A 1TRKA 5ESWA 1VB3A 5EJGA 1RDFA 3ZW7A 2E4YA 4AD8A 1TVEA 2V9ZA 4US1R 1J09A 3DBHB 4NZZA 2D0OB 2VYND 4OQ4A 1NF2A 3QPDA 4OQMA 4ZOLF 1L7NA 3G2IA 4KMRA 1RABA 3MGBA 1YC2A 4RPLA 3FKSD 3VVBA 3T5PA 1GUZA 3CKLA 2ZE5A 3O9ZA 1M66A 2XQJA 4KL8S 1JSRA 4S1PA 1TZMA 2OGUA 3JZDA 3W9UA 2VDRB 3ZDAA 1P81A 3JYLA 1EM8A 2GVDC 4JP1A 1OLUA 3KQSA 4NAVA 2Q3HA 4HPJB 3GT3A 4BV2A 1P9RA 2J4FA 3DBRB 4I1SA 3AHEA 4HUJA 4ZAWA 1XCPA 1XU4A 4NEQA 2FW0A 2LW7A 3CW8X 4MQBA 4OXXA 4QBIA 4C4PA 4YMGA 1JQ5A 1ZZEA 2QM7A 1DLIA 2PZKA 1E66A 3HN6A 1N1DA 4B0OA 2CXHA 4KSBA 3IBTA 3SHVA 1ZDMA 1K8ZB 1GQYA 1QM5A 3VOAA 4UBJA 3JRXA 4BQEA 2WQ6A 3LPDA 3BB4A 4UCFA 1QSGA 1KMNA 3DR5A 1WR8A 4X5OA 5K4AA 2KMLA 1HFEL 2PFSA 4MRVA 3FRIA 5TGZA 4AF8A 4UE6A 3R8CA 3CC8A 4GQIA 3WYAA 4J7UA 1V43A 4RTJA 1J70A 3V1MA 4KWEA 4HYQA 1GZVA 1G59A 2C5HA 4NJEB 5AD1A 3DLAA 1A7KA 1JSXA 3EQZA 2BMWA 3ZWOA 3T1HB 4ZJYA 1S4MA 3DHNA 3QVTA 3UY4A 4MZDA 4JS0A 4AZ3B 2BUBA 5DBEX 3USCS 5HCUA 3EIUA 2OD2A 1JFLA 4MVJI 1CVIA 2OGZA 3QG1A 5F7XA 2ERCA 3BHMA 3W8DA 3KTFA 4E6EA 1XEFA 2FZLA 2JCBA 3AOGA 3B1YA 3OEED 2QYTA 2ZATA 2NO4A 4YRFA 3JWIA 3T34A 4X61A 3PEVA 4D3ZA 3OICA 2YZMA 3LVBA 4MARA 1K4MA 5EJ9A 1IONA 1GA4A 1MW9X 4IIJF 4YUZA 4CHTA 1Z4OA 3LF2A 4LGCA 1EVIA 5ELXA 1G60A 2JHPA 5B2ZA 2ZRQA 3HI6A 3MTIA 4AJ4A 2OB2A 4P22A 3ZD7A 3P7MA 4PO8A 1CDZA 1W0JD 3D7NA 1QB7A 1BU8A 2JFGA 2WM3A 1L1RA 2BBWA 3DWGA 3STYA 4Z54A 3FHTA 3I9KA 3L9WA 1ESMA 4HB2A 4MJ7A 2NO9A 1UKYA 1I4LD 3ICEA 5JHHB 3AC0A 3M2TA 1QR2A 4MEAA 1CUWA 1SBCA 2P77A 1KDOA 5BQ5A 4BB0A 4DLKA 2XE7A 5A1JA 1OFUA 3P4XA 1NW6A 1WQ3A 1A97A 4BMCA 2R68A 4CDRA 3PD7A 1JT9A 1SH7A 3GEPA 4YCCA 3AJ8A 3FNEA 2BBSA 5DEOA 2OSBA 2H9YA 1ZRHA 1USUA 1RNLA 1GR1A 3EZYA 4ROTA 3DAPA 2HZ7A 1T0BA 5LP6C 3HBFA 1Z3IX 4EPTA 1HO3A 2GNAA 2B37A 2D7CA 2FP3A 3G9TA 5HCNA 3TLXA 4BRUA 6GPBA 2HJHA 4DAOA 3I0NA 5KPJA 5JNTA 1P1FA 4UNSA 2RIPA 4U7WA 1DADA 1YIDA 3A10A 2GFHA 2NWQA 4JLUA 3NWEA 1ZK4A 4BP1A 4XRGA 1JLLB 1KJIA 4QC2A 2PGXA 4F4IA 1UIRA 4BZQA 3AHFA 2PJZA 3LPLA 3RUDA 3UJDA 1DARA 2PNJA 3CH6A 2FR8A 1ZOPA 1XQWA 1DG3A 1NZFA 4EY7A 4NBUA 2A14A 2QYSA 4HPWA 4Q82A 5I9SA 1WXGA 3FWHA 2JCGA 1FNCA 3A4MA 5BSEA 4LMAA 2BMDA 5BV2P 3H1EA 5FOSA 2ZJFA 1Y80A 4I4CA 5A02A 2VKQA 2P3QA 1A27A 3TR5A 5L9AA 2IS2A 4LEIA 4REMA 2H54A 4LWPA 1K6IA 5JW6A 5DFAA 1C8VB 4MVJF 4RD1A 1DKPA 4MP3A 4E15A 2XA9A 1MA3A 2YQ4A 3LO5A 1RWPA 2LPMA 3MJCA 1FP4B 2DPHA 2EKBA 1O9BA 4RLQA 4ZT7A 4CMBA 1AVTA 2XDQB 3CEHA 4P4TA 2BEVA 3PQDA 1P7PA 4PYLA 1U0BB 4ZODA 1Q1AA 2OB1A 4JCCA 2C8JA 5FWXB 3DQZA 3L7KA 4JQOA 4J0QA 5TX7A 2BONA 2BJHA 4MTCA 4RHEA 1Q95A 3NDIA 4IHKA 3BXPA 1H5NA 4ONEA 4ZQHA 5EKXA 5F7ZA 3FMVA 2P9HA 1L1EA 1ZSNA 2CB9A 3JAKA 2FLVA 2WHXA 4DA8A 4MRRA 3TNYA 1M2GA 2ZPTX 3A0RB 2GDJA 1M73E 4YJFA 5EWJB 3JQAA 4P86A 4QOJA 2OBMA 3P8ZA 4OJYA 5ALWA 5ULLA 3SC3A 3FM9A 1QQBA 1CSEE 5D85A 5SYMA 1OJ7A 5JD4A 2VL7A 4YCJA 3MTDA 3PWKA 4WUVA 3WG9A 2JJ1A 4L5AA 3AF3A 1JXOA 4P84A 2YDXA 3JYHA 2W2KB 4ZAYA 4BB5A 4UMDA 4QOSA 4LNUA 1FXWA 4INPA 4BP8A 1N2IA 3OE7D 4H6VA 1FC0A 5CVVA 1VJGA 4DLUA 3TTUA 3KQHA 2O19A 2C5AA 2HF9A 1EGAA 2JHCA 3E2IA 4GKBA 4NI5A 1EGMB 4RFVA 3W3AH 1KP9A 5FWYA 1K2VN 4EUSA 2XGJA 1N6KA 4RIIA 1DFGA 2XMQA 1NKTA 2IXBA 3KAQA 4P3KA 1KDYA 1K3FA 3ET4A 3TSOA 3QLUC 2ZJ4A 5I9BA 5CDUA 3WJ7A 1DQYA 4K8RB 2BTEA 1G4UR 2PO5A 4HZGA 5DT9A 1HORA 4PRLA 3TQSA 3VO9A 3VZRA 3Q41A 5JSQA 5C8ZA 1HNZB 1JKJA 1N8NA 3VR4D 3DL4A 2ABWA 2YN0A 2ZTHA 1QBKC 3ZC3A 1OWPA 2R2AA 5C4IA 3IAS1 1P33A 2GBLC 5FL7D 2IZ7A 2YJGA 1D2HA 1D03A 2VUSA 3DV2A 4HVCA 1V71A 1YNSA 4OQDA 4UVHA 1PEYA 4RKWA 4QXMA 3UUEA 3NT5A 4M88A 4ER7A 1W36C 2I6GA 3BTOA 2J8ZA 2FMIA 3FTPA 5AI6A 5EJMA 5CDFA 3LVFO 5A03A 5FB3A 2AZ4A 1V11B 3R7FA 2W00A 2O3QA 2ZG6A 3Q7QA 3IKLA 5DH9A 5ERYA 3A2LA 1ZBDA 4GR9A 1RYNA 3WOVA 5M2QA 1GCIA 4Z1MA 5AJZA 2W6ID 4B47A 3E58A 4I3GA 5AW4A 1FU4A 2GPJA 4PW0A 4JI7B 3OA0A 5AHXA 2PV0A 2B7CA 2X5KO 1TTQB 2QPLA 2XD9A 4QGFA 4YFVA 5AOCA 4Y9DA 3IKJA 4EHKA 3GJ5A 3IHTA 5CM2Z 3KQNA 1WD5A 3BTVA 1E3WA 1RBMA 3OM9A 3QLUA 2HA6A 5LA6B 1IN6A 3F90A 4G67A 3GK3A 3MC1A 1M5TA 4I1RA 5TJ9A 2C96A 5FFMA 5AK5A 2EFHB 2Y9MB 4IV0A 4DREA 2OXFA 1IXYA 2IA5A 3MCAA 1CNEA 4PO9A 3VKFA 2AHOA 2J4DA 2Q21A 3FFTA 4ZT5A 3SIWA 4CU5A 3GJSA 1E61A 2ORIA 2XKJE 4Q01A 3FF4A 1L3BA 2AC7A 4MJ3A 3Q3GE 2A9QA 2QZPA 4Q9DA 1CDDA 4IAOA 3CNEA 4CEHA 5T57A 3X1JA 3UXEA 5FEUA 1GTMA 3IULA 2B1GA 2YHBA 3BWBA 3F4BA 4J2TA 2QSUA 3TN7A 1M0SA 3AG5A 3MCTA 3G79A 4NJOA 1YTLA 4KPUB 4NC9A 3C8UA 1XAJA 4Q16A 2RK3A 1FNMA 1VMAA 2ZUSA 3N0WA 2Q4EA 2X8JA 3JQFC 3MYRA 3WO0A 2WJVA 4ZI7F 2HHHB 2QTTA 2LCIA 3NJ4A 3OQPA 1IOWA 1KXJA 3GAMA 4NG5A 2QL7A 3EAFA 1C0PA 3HP7A 3USES 1I10A 1ORVA 3FPBA 3OAAA 3IUBA 3QMWA 1T10A 1UP6A 1XCOA 4I3FA 3WK8A 3WLHA 2O8CB 2PKQP 3RODA 5ITWA 2PFGA 1KVUA 1I4DD 1Y8RB 1JDPA 2XXAB 4JT4A 2O8NA 4MUIA 3FVRA 4D9FA 4U3JB 4TV8B 1JSLA 2Y1XA 3L1IA 4HGPA 1A2QA 1RLMA 1JQBA 2HTFA 3FHJA 4N03A 2PX4A 5DP2A 4JYZA 1RWKA 2PKYX 1GNPA 5ALRA 2XY4A 1BJRE 3GL9A 1F2TB 4RADA 5IKXA 2GYWA 4WCFC 2IU4A 4FW8A 1YVDA 3IQIX 5I7SA 4BQSA 5KNBA 2ZJ8A 3L6DA 1T9ZA 2Z2XA 3QX3A 3UICA 4NBNA 3EZ6A 4D3YA 1FFEA 4B3MB 5HS6A 4DV7B 2XAUA 4PHCA 3STVA 3T7AA 4PLHA 2M6SA 3NOXA 3UT5B 3ZJVA 4BO0A 4HADA 1ZJ6A 2JC3A 1GZDA 4MA0A 4Q12A 4D4HA 2Z5VA 1XNJA 4NARA 4NECA 4WQMA 3EGVA 3RV3A 3ABQB 1QIEA 3F4LA 5DEIA 1FYVA 2ZJ7A 3BQ9A 3WHLA 4QQKA 2DQYA 4YMSA 2ODQA 3IDOA 4YPFA 1MN6A 1RXCA 4L9WA 4DRXA 5DM1A 1D1PA 3AI3A 3BWMA 5A5DA 4R1UA 2Y8EA 4YDHB 5AW1A 2ECQA 3KJZA 5JG7A 4TKUB 5FBQB 3G5AA 1MTOA 4IM7A 1E0KA 1R8YA 2R1VB 2ZUDA 3QU5A 1Q50A 3GFSA 2X77A 1N6OA 1Z68A 1BH6A 2JI8A 3MGAA 4H77A 1N77A 2TMKA 4ZA2A 2AK2A 4K9DA 4UARA 5GOZA 3FJ1A 1KDZA 3WK4A 3ZQ6A 5JMPA 1XAIA 4RA6B 2OXTA 3EZFA 721PA 4UTPA 3FUWA 1L4BA 1YV9A 1PQUA 5IH7A 2ECPA 2HU7A 1QCYA 2JBAB 2QY9A 4ETWA 4UVDA 3U4MA 4GLLA 5C8XA 4XDGA 1EP1B 3T0GA 4LX8A 1M2WA 1SXJC 2ZI5A 1NRWA 4L76A 3C3BA 1X9HA 3HUUA 4MKXA 4WKCA 3VPBA 1NIPA 3WDLA 1IXRC 2EJVA 3A28A 3G0IA 3M9XA 1EFRA 1OX4A 1SKMA 4EY8A 1GUAA 2NV2B 2Z98A 4HN2A 2C1EA 1F9EA 3LM8A 3M89A 3O4IA 3BSWA 4Q7EA 5AKXA 4Y9UA 2ZW9A 4ZYLA 1CUUA 2C0PA 2J45A 4GMGA 2J0VA 2QRZA 1FX0A 1KAHA 3WI7A 4K9QA 2VLBA 4ZZ2A 1A4RA 1BCSA 3PDIB 3HR7A 3HZHA 4PZUA 2B9VA 1LW7A 3OOSA 2HCBA 4ZOAA 2HY7A 3IIIA 3AR2A 1KF0A 1GPJA 1VG0B 3G0BA 4KYVA 2D5LA 1WSDA 2XMZA 4WK4B 3WGTA 1ZNQO 2BFMA 1DINA 1EAYA 3QEMA 3THRA 2IE8A 1EK2A 3DQQA 2VPYA 4D41A 1E7QA 1RWQA 2NTVA 4HD8A 3OOJA 3SIXA 3I01M 4I50F 3HJUA 3P2EA 1Z0JA 4HX5A 2CHGA 4I4TA 4KTTE 1H1DA 2WFLB 4DDTA 1GDDA 4OOEA 4QO8A 3H1PA 5LQRA 5ALXA 3OC6A 2JFHA 5AVTA 1C50A 4CM1A 4KYIB 1PZEA 4A8JB 3ZWXA 3WGZA 5IKPA 2VAXA 3RYHA 3MIZA 4D92A 2PXHA 2OMEA 4I1VA 1LJUA 3AIMA 2CNBA 1SU6A 3B1JA 3GB9A 4TLAA 5A9SB 2CXUA 3DOCA 4GRDA 4NE9A 1O8CA 4ETIA 1EWQA 3T3NA 1E0SA 2WWGA 5HIJA 2ECKA 3BX1A 4N7BA 5EJ7A 1YQ9A 3F1LA 3LO8A 2IITA 3OBIA 4HBGA 1T4GA 1Y8CA 6REQB 1OUMA 4MB0A 5D7NA 3RHFA 4NRDA 5KVAA 3JARB 4PC1A 4MV1A 1TK3A 2JJ2A 3TGLA 2IYOA 2MIIA 4LOAA 4ATNA 2WUWE 4ZI5A 1YB6A 2HOQA 2Q7XA 1PO7A 5SY6A 3NTOA 1QWOA 4IQ8A 5BNIA 1JQEA 3OFSA 2AT1A 4IH4A 5HYVA 3IILA 3PNSA 1NVUQ 2OCIA 1QFMA 7ADHA 1PHPA 1OI3A 2G8LA 3OZUA 1AKRA 1YACA 5GADl 2PR2A 4LJ5A 5DMHA 3VAZA 2GZRA 3AUJB 1E4OA 4ZEWA 3WK5A 5EJ4A 1TVCA 1ZXXA 3PFKA 1C8LA 2JHFA 3GR6A 2O3SA 4DNPA 1O87A 4XYEA 4LYAA 1NJ5A 1IHYA 2WVHA 4CI9A 1CQJA 4JGGA 4PRZA 1QRSA 1H22A 3OIYA 4GZMA 5P8WA 3TM4A 2XTNA 3ID6C 3UWSA 3QSYA 2WE8A 1R0KA 1Y8RA 4HGYA 4N01A 4X92A 5FHRA 5ERGB 4F4HA 5JAUA 3ZQUA 1YDFA 1G41A 2WM8A 1N3IA 5DASA 4O59O 3MCVA 2GEBA 1BEEA 3IVGA 2ZQYA 3BERA 3PK0A 3O4RA 2Q2QA 1DBVO 1E5LA 1LX7A 3ZIAD 1WEHA 2E87A 1KEWA 5AT1A 2GO1A 3MS2A 1MF7A 3PI7A 4JJGA 3SX2A 2Z4RA 3PJEA 5BUCA 2WKQA 2QMOA 5T8KA 2WHPB 2P9GA 4LFCB 2Q99A 2ONJA 3ROGA 1AOXA 1KY5A 2B7LA 5BUZA 2IZ1A 4OQPA 1NUTA 4Q02A 1T29A 4MKHA 2M1XA 2HNBA 1VHWA 1LPSA 3BEDA 4Y2RA 1BJKA 2WDZA 1T5OA 1UR5A 3O47A 3ZV7A 1Z07A 4WOPA 4EEXA 3O75A 3Q0TA 3HPRA 4N1AA 3ZBPA 5I5EA 4Z99A 4F6RB 1J8VA 4GUDA 1TGYA 1CF2O 1ZMRA 3DMGA 3QX9A 4BKRA 4P5DA 3HA2A 4XOIA 5LMZA 1R8SA 1UJ2A 3GLHB 3QKUA 2DF8A 3FOZA 2QVYX 2PL5A 3B20A 3RFUA 3LQRA 5IAGA 2VPPA 3ZCVA 1WL8A 1ZQ1A 2QN9A 3OKCA 4ITUA 2CMGA 2OP0A 3DVSX 4RJLA 1YD7A 3ANXA 1KO8A 4B17A 1UBTS 3CNOA 3T9CA 4EX6A 2HJSA 4BTVA 3N2IA 4RDIA 4PFKA 1Z2EA 3F74A 3JWJA 1EHIA 2ANBA 3HXLA 1G16A 4WDQA 3OQMA 4B7UA 1NVGA 3VNSA 4YONB 3K09A 4O3MA 3BT7A 4MTLA 2ZUVA 3GGCA 3ANLA 3RHZA 3DBIA 3ZDDA 2PQ6A 4XCXA 2MJLA 3Q9LA 4GPTA 5IDYA 3WMXA 1TCBA 4WZAE 3VPCA 1YAJA 2XLCA 3K5WA 3X44A 1PFQA 4UTRA 1N6IA 1NR1A 3IAUA 1JHPA 4ZPJA 1CY7A 1E2DA 2EV9A 3TE7A 1E1KA 4CI0B 4DKXA 3OUZA 1H6BA 2F1JA 2X3UA 4OTZA 2HO5A 4Y2XA 2RBGA 4XJTA 4WD3A 4YBZA 3A9RA 3FDIA 3M49A 2EWMA 3B8EA 1WXDA 1BXRB 2RK6A 2UKDA 3E22A 3K8QA 5TS3A 3TTWA 3U7QA 5CEEA 5IABA 4HVTA 4MDYA 3COYA 1D5CA 3NHBA 2EARA 4YT5A 5JDIA 3JSXA 2HO4A 1FQOA 2X41A 3HLYA 1PHRA 3MTBA 2ZJ1A 4XPIB 4ED9A 2VSYA 3PDIA 3K4QA 4BZWA 1W19A 4IPTA 2XEDA 4JLMA 3FYCA 3FZNA 4UUMA 1Y7IA 1G9XA 5JMWA 1VJTA 3L6EA 3RGGA 5ENDA 1BHQ1 1VI2A 3D3WB 2XVAA 4IXTA 3E0XA 1QXSA 2P0YA 1GCOA 1YSCA 3ENWA 4US0R 3UH1A 1JSCA 1U8ZA 2H92A 1PWZA 2HWXA 1IM5A 2A1TS 2AXQA 3SR3A 3SX4A 3V4VB 1SPBS 2XMPA 5I48A 2CZQA 5CX1B 3OY7A 4IHJB 4AN4A 4E5VA 3AUSA 3ORHA 2XZDA 2WYVA 1X13A 2AOUB 2PY6A 3AZPA 1RQPA 3VH3A 3EMDA 3H16A 3R3SA 2IHTA 2PUWA 2PS9A 1ZJYA 1WMEA 4L8YA 4YP9A 2BEWB 4JSYA 2BFDB 1CRLA 1T3ZA 1Z33A 1J0BA 1TOAA 1V6CA 1EG2A 3HFRA 5AQEA 3VNBA 4BAGA 5A9SA 4JUCA 1JQDA 4ARUA 3NHPA 1TYEB 3HBMA 2PZAA 3IVCA 1O0BA 3IR5A 2FSGA 2ICAA 5DHRA 3EGOA 3M4JA 4QUAA 3ZGNA 3BRWA 3PA6A 3ZGLA 1QDLB 2FWMX 4P3YA 4B3XA 3N9IA 5K8JB 1O6FA 2Z3ZA 2ZBFA 1F4VA 2VT2A 1EZZA 3O9MA 4NU0A 2M2IA 3ICWA 3MHPA 3PEFA 2QLFA 3B8HA 5AI8A 3U39A 1UMDA 5IMBA 4EG8A 1T15A 3ZWCA 2OENG 4LHYA 5CDGA 5FTLA 1I36A 1V8BA 1WVMA 3B1KA 2Y1EA 3GJRA 1EJ2A 5J5CA 4ENQA 3G2NA 2ZZNA 3WRXC 4K8OA 4ZYZA 3DZ8A 4OSPA 3UJPA 1EESA 4ZU1X 2GEKA 2FSIA 2QKYA 1ZW1A 2JK1A 3KNZA 4DCOA 1FS5A 3KEQA 3PUJA 3D9QX 4KFRA 4KH0A 5FTMA 2DSNA 3RYFA 2QR3A 3U31A 2BFFB 3RU9A 2I9KA 5H02A 1W1WA 2UYQA 4R3WA 3WL7A 4QT4A 1Q77A 2PCJA 3MS7A 3QVXA 1XNRB 4MKIA 1HF3A 4IDNA 4ZI7A 3FZQA 4NCIA 1QZ3A 4IH9A 2OCAA 5B1HA 1DXOA 4S0XA 3QE0A 5F52A 2F9LA 3S2EA 3U7JA 3HY6A 1DFIA 3HB1A 3A8TA 3J7TA 3LUGA 1V37A 2VZ0A 2YWDA 3U7RA 3ZBTA 4QYSA 1UBSB 2B98A 4DXDA 3Q40A 1M6YA 3P9YA 1M1YE 3WDSA 4BVBA 4FHDA 3CR3C 2G4LA 5GIPE 4GUAA 1OLUB 4AMYA 1I5RA 5J2TF 1YRAA 1HOTA 5LD2C 1FP2A 3ZV6A 5HWSA 1JJVA 4QELA 1VJ1A 4KHPB 3OJWA 2Z04A 2BFEA 3CZ5A 4J90A 2MOKA 2HM7A 3NO4A 1G1MA 3TNDA 4GL2A 2R85A 3M5PA 1JA0A 1R2QA 2DY1A 1GA6A 2BTQB