1GOVA

Ribonuclease bi(g specific endonuclease) complexed with sulfate ions
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
molecule tags Hydrolase
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1govA00
1RGKA 1TTOA 1I8VA 4HAAA 2AADA 7GSPA 3D5IA 1BAOA 3D5GA 1FYSA 1YNVX 5RNTA 9RNTA 8RNTA 1BNRA 2KF5A 2RNTA 1RMSA 4RNTA 1RGCA 2GSPA 1YGWA 1BRIA 1BSAA 2F5MA 1LRAA 1BRSA 1RSNA 2AAEA 1X1UA 3A5EA 1B2UA 1RGEA 2ZA4A 1AQZA 3AHSA 6RNTA 1A2PA 4GHOA 2HOHA 1AY7A 1BRHA 1BVIA 2KF6A 4HOHA 1B27A 1I0XA 1FW7A 1GOVA 7RNTA 1B2ZA 2C4BA 1BUJA 3AHWA 2RBIA 1LOVA 3DGYA 1SARA 5BU4A 3AGOA 1BNGA 1BNIA 1I2EA 1JBSA 1BRGA 1RLSA 1CH0A 2KAAA 5BIRA 1RHLA 1T2IA 1BU4A 1RTUA 1X1WA 1HZ1A 1ZGXA 1JBTA 3BU4A 1RN1A 5HOHA 1UCKA 1BANA 2KF3A 1HYFA 1GOUA 1FZUA 2KF4A 1C54A 1BNSA 1BSEA 1BRJA 1GMPA 2BU4A 1MGRA 1RDSA 3WR2A 1X1XA 1I3FA 4J5KA 1Q9EA 1RGLA 1B21A 3GSPA 1I2GA 1BRNL 2BIRA 1BOXA 3D4AA 1RCLA 3URPA 1BRKA 1RGFA 1DETA 1RGGA 1TRPA 3WHOA 1I2FA 2F4YA 3Q3FA 4J5GA 1RNBA 3HOHA 1UCIA 4BU4A 1G02A 1RN4A 1TRQA 1BSCA 1LNIA 2F5WA 1B2SA 1GOYA 1RGAA 1B20A 3RNTA 4GSPA 1B2XA 3BIRA 1BNJA 1GMQA 1GSPA 1BIRA 1YVSA 1B3SA 1RCKA 2F56A 1T2HA 1R4YA 1MGWA 1X1YA 1FUSA 1PYLA 4BIRA 1I0VA 1DE3A 1BNFA 1BNEA 1UCLA 1PY3A 3KCHA 3SYUA 1FUTA 1I70A 1JBRA 1UCJA 2SARA 6GSPA 1BGSA 1BSBA 3DH2A 1LOYA 3AGNA 1B2MA 1IYYA 1LOWA 5GSPA 1RNTA 1GMRA 1RGHA 1BSDA 1I3IA
chains in the Genus database with same CATH superfamily
3BB9A 2ML5A 5FW5A 4MMYB 3MG1A 4XDVA 3CC23 1W2ZA 7GSPA 4FMBA 1WQLB 1BAOA 3D5GA 1FYSA 1W6CA 1YNVX 4WP5A 2P38A 3CCL3 3MG2A 2YFJB 1JN5B 9RNTA 3DGMA 2JDIH 2ZDJA 4DKIA 5IG5A 1UGIA 5IF6A 1LRAA 3G16A 1QAKA 1JB4A 3KSED 1RSNA 1B2UA 1RGEA 4N6V0 1AQZA 3KE7A 3OWUA 2OQEA 3GRDA 3UNLA 5M19A 3CCS3 3AMOB 1BRHA 5CF2A 2LQVA 2OCTA 1L5GB 1I0XA 1IVVA 1GOVA 1IV9A 3GAXA 3FZWA 3EBYA 2RCDA 4GL6A 1LOVA 2RFRA 3DGYA 3Q2PA 3LH4A 2K54A 2CG1A 1DYUA 5AIFA 3PCRA 1AR0A 1LQMB 1Q42A 1QMAA 1BRGA 1VQQA 3NXJA 5DREA 1CH0A 1A90A 1T3BA 1BU4A 1F8NA 2XGNA 1O7PB 4R1KA 3LT9A 5TGNA 1O7WB 5IENA 2CFKA 3BU4A 2W03A 3CPW2 3GZXB 1O7NB 1BANA 2KF3A 3MYTA 1YI23 1FGRA 3N9HA 1KD14 1C54A 2XFSA 2GBXB 3ZG0A 3NM2A 1RDSA 3EC9A 2E2TA 3V98A 1S723 3UJMA 2IYJA 2W9QA 4KFFA 1B21A 3CME3 5CK6A 2ML6A 2CIUA 1NNVA 5IG4A 5A0OB 4CPKA 4I5QA 4EBGA 5CLKA 3D4AA 3MHEA 2CFDA 1VQM3 4N6TA 4FCMA 4EW5A 1IT7A 1I2FA 3Q3FA 3IPTA 1QVG2 1U8CB 3HOHA 1GY5A 1GS3A 1G02A 4HBRA 5EEOA 2H0HA 1N5HA 1BSCA 1O7MB 4RNZA 3I0YA 2INXA 4XBYA 1B20A 3RNTA 1WMPA 2HMMB 4G1MB 1B2XA 3ZFZA 1Q40B 5AYRB 1YVSA 1BIRA 1TP6A 1IQXA 2P0XA 5AIHA 1G0TA 2GU3A 1R4YA 1PYLA 3H3HA 5HGRA 3BNCA 1W5ZA 2E2UA 3CCJ3 2CWVA 2Y74A 1JB2A 3X3XA 4FCJA 3EHCA 1FUTA 1V74A 4FR9A 1JBRA 1JKGB 2SARA 2W6JH 3UL6A 6GSPA 1D6YA 1JZDA 1W02A 2CK3H 2GU1A 3EJVA 2UUGC 1NB5I 2W56B 1TJDA 3MWZA 1KWIA 1LOWA 5GSPA 3KKGA 1RNTA 3GZRA 1GMRA 3SVAA 5G1LA 1NO3A 2XEPA 3V99A 1RKYA 4EXRA 3EX9A 3G8ZA 4RNYA 1TFOA 3S5CA 4R80A 2XFTA 1TTOA 4QWTA 1OF5B 3FCSB 2L1SA 1OHOA 4HAAA 2WOHA 4R9KA 3D5IA 1VQN3 1JZOA 4AEQA 1UUWB 3H51A 2Y73A 4RZMA 1UI7A 3JUMA 3NBBA 8RNTA 4R9LA 1BNRA 1DMMA 4RNTA 1RMSA 1SIHA 1ZO2A 3PS8A 4HM4B 1RGCA 4NHFA 1YGWA 1YVBI 5STDA 2LYXA 3BNBA 1K9M4 2OTL3 1UGHI 1IQYA 2BNGA 2R41A 4WYKB 2AAEA 2XF3A 2Z6BA 2Z77A 1EG9B 4HM0B 5EQLA 1ZX2A 4Q53A 3AHSA 1W6GA 3LT8A 3S28A 1UUGB 1EA2A 3SOYA 1BVIA 4HJLB 1KSIA 2PZVA 3FG1A 4HOHA 2MC8A 2YFIB 3MG3A 3M8CA 4HM3B 1B27A 1LVNA 3NV0B 7RNTA 1B2ZA 3G6E3 3NHXA 3AHWA 1GY7A 1SARA 3AGOA 3L0RA 3BLZA 1N5PA 3NM7A 1JBSA 1AVKA 2W04A 3HK4A 3ECFA 3K7CA 1T2IA 2HMLB 4MMZB 2OTJ3 3SOAA 3UB1A 1HZ1A 1K41A 1J2BA 2OOVA 1FZUA 2KF4A 3ALAA 5EVHA 1IU7A 1BSEA 1O7GB 2KXGA 5M18A 3D79A 1GMPA 2BU4A 2F99A 1MGRA 1YIJ3 1GYBA 3LTAA 1X1XA 1ROVA 4J5KA 1RGLA 1W6YA 1HKXA 1EEJA 1GD3A 3GSPA 4KZ1A 3DGOA 4X2HA 1IDPA 4HM7B 1WMNA 1IVWA 3CC43 1CEWI 1BOXA 1RCLA 4FMDA 1A2KA 4R4KA 5IERA 3RGAA 3UL5A 1MWSA 3URPA 1BRKA 2V1LA 2BMOB 4HM1B 8CHOA 1Q7Y4 1W00A 2D42A 2F4YA 2B24B 5AI1A 1K8A4 2CKFB 1TUHA 1JN5A 4HZ9B 4K61A 3KFQC 3I563 1TRQA 5JPPA 3PGBA 4X2OA 2GEXA 3CCU3 1B2SA 1RGAA 1W01A 2Z7AA 4EYCA 2F86B 4L8PA 1E97A 4HYZA 1MWRA 5CXOA 2IUJA 2L4VA 4CJNA 3E99A 3CNMA 5KP3A 5IG3A 1BNJA 3WA3A 1GSPA 4H61A 1M904 4LZIA 5KP4A 2O3OA 3WOFB 5JBSA 3F9SA 2HMKB 3CCE3 3AMOA 3F8HA 3CMA3 1BNEA 1SJWA 3HX8A 3MPHA 3VGNA 1FUWA 1I70A 2P09A 1UCJA 1VQK3 1MOLA 4LYLB 2QIYA 5IEOA 1UUVB 4HM5B 1N8R4 1VQ63 1B2MA 2STDA 1IYYA 3IMAB 5AEWB 2IY2A 1N9JA 1Y4KA 3CPOA 1EKMA 1AVLA 3U97A 3EN8A 1US1A 1VZZA 4NPBA 1IT8A 1YHQ3 1N9EA 1HU9A 1BSDA 2P05A 3LMLA 1FA3A 1VQ53 3CC73 4XBXA 1LXEA 1ULJB 1RGKA 3GZYB 3FKAA 5IW9A 2BO9B 1PU4A 1YJ93 4XB5A 1CYUA 3S29A 5RNTA 3MSOA 3QK9A 2XSHB 4MMXB 2RGQA 4OVMA 4TX4A 1JNQA 3CD63 3DGNA 2KF5A 3HIGA 4XBTA 3WDGB 2O9UX 1E3VA 4IIAA 4J9AA 1JRQA 1M1XB 2GEYA 2F5MA 2KRTA 3N8BA 1ASKA 2H0GA 3PYJA 4FCZA 1GD4A 3A5EA 2XRXB 2ZA4A 1ISKA 2IUKA 3GZBA 1JV2B 1O7HB 3JUQA 1Z1SA 6RNTA 1A2PA 2HOHA 1YIT3 1OUNA 3LZAA 1IVUA 1AY7A 3DXOA 3LTBA 2KF6A 5G1KA 2QA43 4MEIA 3KN4A 5I97A 1VQ83 1V57A 3LXUX 2CH9A 2WGOA 3SXXA 3T8NA 1OGXA 1OH0A 2GBWB 1RN7A 2RBIA 3HIIA 5BU4A 1Q864 1VQO3 3SX1A 2CFWA 1BNIA 3KIIA 4I4KA 3WOEB 1NJI4 1D6UA 3CU3A 1Q40A 3DZLA 3X41A 4EV5A 2I9WA 1JB5A 2OWPA 4HM6B 3S27A 2PNCA 2WGQA 1RN1A 3JUNA 3CCM3 2W0QA 1QVF2 3RGRA 3NQYA 1STFI 1HYFA 1GOUA 3EN1B 5BVBA 1A67A 2K0MA 1BNSA 2W2CA 5AIIA 3OWSA 3CXC2 1Q7HA 2CC3A 1FGOA 1A2VA 2OOVC 2OQEC 2W56A 3DMCA 4GB5A 4ZM8A 4WFOA 3U1WA 3F7SA 1DVCA 5LC7A 5CF1A 3KSPA 4XM4A 4BL2A 1ROAA 1TIJA 3K9MC 3JVCA 3OWYA 4WHAA 5AIGA 3X42A 4JRFA 1ULIB 3I553 1KC84 1DETA 2IA7A 2K3DA 2CX1A 4AKZA 2JQ5A 4J5GA 3MKIA 3DM8A 3CCV3 4K90B 1RN4A 2SBLA 3X3YA 4H3UA 3JUPA 3PCSA 2ZL8A 4BTYA 3DUKA 3BNDA 4WWUC 1GOYA 2XGLA 3EF8A 3GWRA 4GSPA 4N6MA 3G4S3 3OW22 1IV7A 2FNQA 4WYKA 2BHMA 1FGQA 1GY6A 1DMQA 1N8QA 4N6OB 1VQL3 1RCKA 2F56A 3EE1A 3J7Yd 1T2HA 1W7CA 2BMRB 2HMNB 2MF7A 4L8OA 2QEX3 1RRHA 4EC6A 4BIRA 1QALA 2FXTA 1MNLA 3OXAA 5LC6A 1OGZA 4U13A 1VQ43 1PY3A 3SYUA 6STDA 3FH1A 3X40A 2CX0A 3NV0A 3QRDA 1NDOB 2WO0A 2XSOB 4BL3A 1JBTA 2Z76A 4KFDA 3DH2A 4HZBB 1LOYA 1OHSA 3O8YA 1UW1A 4PEJA 4CDLA 3T8UA 1NU3A 1YJW3 1Q824 5AYSC 1CYVA 3D9RA 3OX9A 3G0KA 1QAFA 2UGIA 1BUQA 2HMOB 3LYGA 4HM2B 3VSYA 1I3IA 5ELUA 1OACA 5M1AA 1FGTA 1I8VA 5ELJA 3HZPA 4LSOA 2AADA 4BTXA 2CFGA 4KVHA 5AEUB 3VF1A 3CNXA 3BNEA 3DY5A 3B4OA 3F7XA 2J8XB 3NBJA 3WMDA 2RNTA 4N6NB 7STDA 4STDA 2GSPA 1BRIA 1BSAA 1LQGC 3OV4A 1VQ73 2F98A 4J8TA 2QGUA 3FG3A 1EUIC 5D82A 1BRSA 4HVNA 1W2B2 1X1UA 2D1WA 4AKYA 3NX0A 1M1K4 4KT3B 5DRVA 4O8SA 2CW9A 1YJN3 3EB8A 1E3RA 4LEHA 3EQQB 1PFPA 3CCR3 4GHOA 1W4NA 3ER7A 3FF2A 4NREA 1UI8A 1AV4A 2XH9A 1FW7A 3DGLA 4XDWA 2C4BA 4HKVB 4JF8A 4N3VA 1JJ22 1R4CA 5FGOA 1Q814 1VQ93 1BUJA 2BT3A 2FGTA 3LOYA 1BNGA 4N6UA 5G2GA 1I2EA 2RSXA 3K5TA 3F14A 3CCQ3 1RLSA 2XR8B 2KAAA 4CCVA 1STDA 5BIRA 1RHLA 1M9GA 1T5YA 2W9PA 1VQP3 3PXMA 2CHCA 1IK3A 2WOFA 5D83A 1RTUA 1X1WA 1ZGXA 3NBRA 3NUVA 3FGYA 2ZHXB 4LGQA 4O2HA 3B4PA 1IQ8A 1WNHA 4HM8B 3SEDA 3V92A 1UCKA 2P0MA 5HOHA 5IEPA 1G96A 4O3VA 3SLUA 5BXQA 2C10A 2E2VA 3IJEB 1WMOA 3PZWA 3HI7A 4N6LA 1BRJA 2GXFA 1LOXA 3ZG5A 3WR2A 3S67A 1RRLA 1I3FA 1MWTA 1Q9EA 2BMQB 1DMNA 2H0IA 4ORLA 1FGMA 1LNHA 1D6ZA 3JUOA 3A76A 1I2GA 1OCVA 1K734 1UDII 3TDGA 1BRNL 4OUQA 1K28A 1RJOA 2BIRA 3T0UA 3Q90A 4KFEA 4EV2A 2C11A 1RGFA 3Q1CA 1U5OA 1RGGA 1TRPA 2R4IA 4ILFA 4FMCA 3ROBA 3WHOA 1RNBA 3X3ZA 1UCIA 3F40A 3FLJA 3NQZA 1SIIA 2HMJB 4L7KA 4BU4A 3G713 1SQWA 2CG0A 3F8XA 1LNIA 2CFLA 4O02B 1NWWA 2F5WA 5JPUA 3N54B 2Q07A 3B8LA 3STDA 5D81A 1JKGA 1KQS2 1IVXA 4LMIA 3FSDA 2YX9A 3BIRA 4IT7A 3WA2X 1TU5A 1GMQA 3WODG 1QJGA 2CWUA 1B3SA 2IMJA 1C7HA 1CQSA 5KP1A 1MGWA 1X1YA 1FUSA 2YFLB 1OPYA 3LTDA 2KCDA 3KZTA 1MWUA 1SPUA 1I0VA 1DE3A 1BNFA 5IG0A 1UCLA 3RDEA 3D3LA 1TFKA 3FF0A 3KCHA 3EBTA 1V58A 1YGEA 3K0ZA 3LTCA 1DVDA 4MJDA 2CWTA 1BGSA 4FMAA 4OK0A 2A15A 1BSBA 1OF5A 1OHPA 2UX0A 3B7CA 1NB3I 4K1UA 4BTWA 3AGNA 4RBNA 2B1XB 2M7OA 1ZS7A 3K63A 1WTHA 1S5AA 1EQKA 1RGHA 4K1VA 3FG4A 4IPBA
chains in the Genus database with same CATH topology
1RGKA 1TTOA 1I8VA 4HAAA 2AADA 7GSPA 3D5IA 1BAOA 3D5GA 1FYSA 1YNVX 5RNTA 9RNTA 8RNTA 1BNRA 2KF5A 2RNTA 1RMSA 4RNTA 1RGCA 2GSPA 1YGWA 1BRIA 1BSAA 2F5MA 1LRAA 1BRSA 1RSNA 2AAEA 1X1UA 3A5EA 1B2UA 1RGEA 2ZA4A 1AQZA 3AHSA 6RNTA 1A2PA 4GHOA 2HOHA 1AY7A 1BRHA 1BVIA 2KF6A 4HOHA 1B27A 1I0XA 1FW7A 1GOVA 7RNTA 1B2ZA 2C4BA 1BUJA 3AHWA 2RBIA 1LOVA 3DGYA 1SARA 5BU4A 3AGOA 1BNGA 1BNIA 1I2EA 1JBSA 1BRGA 1RLSA 1CH0A 2KAAA 5BIRA 1RHLA 1T2IA 1BU4A 1RTUA 1X1WA 1HZ1A 1ZGXA 1JBTA 3BU4A 1RN1A 5HOHA 1UCKA 1BANA 2KF3A 1HYFA 1GOUA 1FZUA 2KF4A 1C54A 1BNSA 1BSEA 1BRJA 1GMPA 2BU4A 1MGRA 1RDSA 3WR2A 1X1XA 1I3FA 4J5KA 1Q9EA 1RGLA 1B21A 3GSPA 1I2GA 1BRNL 2BIRA 1BOXA 3D4AA 1RCLA 3URPA 1BRKA 1RGFA 1DETA 1RGGA 1TRPA 3WHOA 1I2FA 2F4YA 3Q3FA 4J5GA 1RNBA 3HOHA 1UCIA 4BU4A 1G02A 1RN4A 1TRQA 1BSCA 1LNIA 2F5WA 1B2SA 1GOYA 1RGAA 1B20A 3RNTA 4GSPA 1B2XA 3BIRA 1BNJA 1GMQA 1GSPA 1BIRA 1YVSA 1B3SA 1RCKA 2F56A 1T2HA 1R4YA 1MGWA 1X1YA 1FUSA 1PYLA 4BIRA 1I0VA 1DE3A 1BNFA 1BNEA 1UCLA 1PY3A 3KCHA 3SYUA 1FUTA 1I70A 1JBRA 1UCJA 2SARA 6GSPA 1BGSA 1BSBA 3DH2A 1LOYA 3AGNA 1B2MA 1IYYA 1LOWA 5GSPA 1RNTA 1GMRA 1RGHA 1BSDA 1I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGK A;  1TTO A;  1I8V A;  4HAA A;  2AAD A;  7GSP A;  3D5I A;  1BAO A;  3D5G A;  1FYS A;  1YNV X;  5RNT A;  9RNT A;  8RNT A;  1BNR A;  2KF5 A;  2RNT A;  1RMS A;  4RNT A;  1RGC A;  2GSP A;  1YGW A;  1BRI A;  1BSA A;  2F5M A;  1LRA A;  1BRS A;  1RSN A;  2AAE A;  1X1U A;  3A5E A;  1B2U A;  1RGE A;  2ZA4 A;  1AQZ A;  3AHS A;  6RNT A;  1A2P A;  4GHO A;  2HOH A;  1AY7 A;  1BRH A;  1BVI A;  2KF6 A;  4HOH A;  1B27 A;  1I0X A;  1FW7 A;  1GOV A;  7RNT A;  1B2Z A;  2C4B A;  1BUJ A;  3AHW A;  2RBI A;  1LOV A;  3DGY A;  1SAR A;  5BU4 A;  3AGO A;  1BNG A;  1BNI A;  1I2E A;  1JBS A;  1BRG A;  1RLS A;  1CH0 A;  2KAA A;  5BIR A;  1RHL A;  1T2I A;  1BU4 A;  1RTU A;  1X1W A;  1HZ1 A;  1ZGX A;  1JBT A;  3BU4 A;  1RN1 A;  5HOH A;  1UCK A;  1BAN A;  2KF3 A;  1HYF A;  1GOU A;  1FZU A;  2KF4 A;  1C54 A;  1BNS A;  1BSE A;  1BRJ A;  1GMP A;  2BU4 A;  1MGR A;  1RDS A;  3WR2 A;  1X1X A;  1I3F A;  4J5K A;  1Q9E A;  1RGL A;  1B21 A;  3GSP A;  1I2G A;  1BRN L;  2BIR A;  1BOX A;  3D4A A;  1RCL A;  3URP A;  1BRK A;  1RGF A;  1DET A;  1RGG A;  1TRP A;  3WHO A;  1I2F A;  2F4Y A;  3Q3F A;  4J5G A;  1RNB A;  3HOH A;  1UCI A;  4BU4 A;  1G02 A;  1RN4 A;  1TRQ A;  1BSC A;  1LNI A;  2F5W A;  1B2S A;  1GOY A;  1RGA A;  1B20 A;  3RNT A;  4GSP A;  1B2X A;  3BIR A;  1BNJ A;  1GMQ A;  1GSP A;  1BIR A;  1YVS A;  1B3S A;  1RCK A;  2F56 A;  1T2H A;  1R4Y A;  1MGW A;  1X1Y A;  1FUS A;  1PYL A;  4BIR A;  1I0V A;  1DE3 A;  1BNF A;  1BNE A;  1UCL A;  1PY3 A;  3KCH A;  3SYU A;  1FUT A;  1I70 A;  1JBR A;  1UCJ A;  2SAR A;  6GSP A;  1BGS A;  1BSB A;  3DH2 A;  1LOY A;  3AGN A;  1B2M A;  1IYY A;  1LOW A;  5GSP A;  1RNT A;  1GMR A;  1RGH A;  1BSD A;  1I3I A; 
#chains in the Genus database with same CATH topology
 3BB9 A;  2ML5 A;  5FW5 A;  4MMY B;  3MG1 A;  4XDV A;  3CC2 3;  1W2Z A;  7GSP A;  4FMB A;  1WQL B;  1BAO A;  3D5G A;  1FYS A;  1W6C A;  1YNV X;  4WP5 A;  2P38 A;  3CCL 3;  3MG2 A;  2YFJ B;  1JN5 B;  9RNT A;  3DGM A;  2JDI H;  2ZDJ A;  4DKI A;  5IG5 A;  1UGI A;  5IF6 A;  1LRA A;  3G16 A;  1QAK A;  1JB4 A;  3KSE D;  1RSN A;  1B2U A;  1RGE A;  4N6V 0;  1AQZ A;  3KE7 A;  3OWU A;  2OQE A;  3GRD A;  3UNL A;  5M19 A;  3CCS 3;  3AMO B;  1BRH A;  5CF2 A;  2LQV A;  2OCT A;  1L5G B;  1I0X A;  1IVV A;  1GOV A;  1IV9 A;  3GAX A;  3FZW A;  3EBY A;  2RCD A;  4GL6 A;  1LOV A;  2RFR A;  3DGY A;  3Q2P A;  3LH4 A;  2K54 A;  2CG1 A;  1DYU A;  5AIF A;  3PCR A;  1AR0 A;  1LQM B;  1Q42 A;  1QMA A;  1BRG A;  1VQQ A;  3NXJ A;  5DRE A;  1CH0 A;  1A90 A;  1T3B A;  1BU4 A;  1F8N A;  2XGN A;  1O7P B;  4R1K A;  3LT9 A;  5TGN A;  1O7W B;  5IEN A;  2CFK A;  3BU4 A;  2W03 A;  3CPW 2;  3GZX B;  1O7N B;  1BAN A;  2KF3 A;  3MYT A;  1YI2 3;  1FGR A;  3N9H A;  1KD1 4;  1C54 A;  2XFS A;  2GBX B;  3ZG0 A;  3NM2 A;  1RDS A;  3EC9 A;  2E2T A;  3V98 A;  1S72 3;  3UJM A;  2IYJ A;  2W9Q A;  4KFF A;  1B21 A;  3CME 3;  5CK6 A;  2ML6 A;  2CIU A;  1NNV A;  5IG4 A;  5A0O B;  4CPK A;  4I5Q A;  4EBG A;  5CLK A;  3D4A A;  3MHE A;  2CFD A;  1VQM 3;  4N6T A;  4FCM A;  4EW5 A;  1IT7 A;  1I2F A;  3Q3F A;  3IPT A;  1QVG 2;  1U8C B;  3HOH A;  1GY5 A;  1GS3 A;  1G02 A;  4HBR A;  5EEO A;  2H0H A;  1N5H A;  1BSC A;  1O7M B;  4RNZ A;  3I0Y A;  2INX A;  4XBY A;  1B20 A;  3RNT A;  1WMP A;  2HMM B;  4G1M B;  1B2X A;  3ZFZ A;  1Q40 B;  5AYR B;  1YVS A;  1BIR A;  1TP6 A;  1IQX A;  2P0X A;  5AIH A;  1G0T A;  2GU3 A;  1R4Y A;  1PYL A;  3H3H A;  5HGR A;  3BNC A;  1W5Z A;  2E2U A;  3CCJ 3;  2CWV A;  2Y74 A;  1JB2 A;  3X3X A;  4FCJ A;  3EHC A;  1FUT A;  1V74 A;  4FR9 A;  1JBR A;  1JKG B;  2SAR A;  2W6J H;  3UL6 A;  6GSP A;  1D6Y A;  1JZD A;  1W02 A;  2CK3 H;  2GU1 A;  3EJV A;  2UUG C;  1NB5 I;  2W56 B;  1TJD A;  3MWZ A;  1KWI A;  1LOW A;  5GSP A;  3KKG A;  1RNT A;  3GZR A;  1GMR A;  3SVA A;  5G1L A;  1NO3 A;  2XEP A;  3V99 A;  1RKY A;  4EXR A;  3EX9 A;  3G8Z A;  4RNY A;  1TFO A;  3S5C A;  4R80 A;  2XFT A;  1TTO A;  4QWT A;  1OF5 B;  3FCS B;  2L1S A;  1OHO A;  4HAA A;  2WOH A;  4R9K A;  3D5I A;  1VQN 3;  1JZO A;  4AEQ A;  1UUW B;  3H51 A;  2Y73 A;  4RZM A;  1UI7 A;  3JUM A;  3NBB A;  8RNT A;  4R9L A;  1BNR A;  1DMM A;  4RNT A;  1RMS A;  1SIH A;  1ZO2 A;  3PS8 A;  4HM4 B;  1RGC A;  4NHF A;  1YGW A;  1YVB I;  5STD A;  2LYX A;  3BNB A;  1K9M 4;  2OTL 3;  1UGH I;  1IQY A;  2BNG A;  2R41 A;  4WYK B;  2AAE A;  2XF3 A;  2Z6B A;  2Z77 A;  1EG9 B;  4HM0 B;  5EQL A;  1ZX2 A;  4Q53 A;  3AHS A;  1W6G A;  3LT8 A;  3S28 A;  1UUG B;  1EA2 A;  3SOY A;  1BVI A;  4HJL B;  1KSI A;  2PZV A;  3FG1 A;  4HOH A;  2MC8 A;  2YFI B;  3MG3 A;  3M8C A;  4HM3 B;  1B27 A;  1LVN A;  3NV0 B;  7RNT A;  1B2Z A;  3G6E 3;  3NHX A;  3AHW A;  1GY7 A;  1SAR A;  3AGO A;  3L0R A;  3BLZ A;  1N5P A;  3NM7 A;  1JBS A;  1AVK A;  2W04 A;  3HK4 A;  3ECF A;  3K7C A;  1T2I A;  2HML B;  4MMZ B;  2OTJ 3;  3SOA A;  3UB1 A;  1HZ1 A;  1K41 A;  1J2B A;  2OOV A;  1FZU A;  2KF4 A;  3ALA A;  5EVH A;  1IU7 A;  1BSE A;  1O7G B;  2KXG A;  5M18 A;  3D79 A;  1GMP A;  2BU4 A;  2F99 A;  1MGR A;  1YIJ 3;  1GYB A;  3LTA A;  1X1X A;  1ROV A;  4J5K A;  1RGL A;  1W6Y A;  1HKX A;  1EEJ A;  1GD3 A;  3GSP A;  4KZ1 A;  3DGO A;  4X2H A;  1IDP A;  4HM7 B;  1WMN A;  1IVW A;  3CC4 3;  1CEW I;  1BOX A;  1RCL A;  4FMD A;  1A2K A;  4R4K A;  5IER A;  3RGA A;  3UL5 A;  1MWS A;  3URP A;  1BRK A;  2V1L A;  2BMO B;  4HM1 B;  8CHO A;  1Q7Y 4;  1W00 A;  2D42 A;  2F4Y A;  2B24 B;  5AI1 A;  1K8A 4;  2CKF B;  1TUH A;  1JN5 A;  4HZ9 B;  4K61 A;  3KFQ C;  3I56 3;  1TRQ A;  5JPP A;  3PGB A;  4X2O A;  2GEX A;  3CCU 3;  1B2S A;  1RGA A;  1W01 A;  2Z7A A;  4EYC A;  2F86 B;  4L8P A;  1E97 A;  4HYZ A;  1MWR A;  5CXO A;  2IUJ A;  2L4V A;  4CJN A;  3E99 A;  3CNM A;  5KP3 A;  5IG3 A;  1BNJ A;  3WA3 A;  1GSP A;  4H61 A;  1M90 4;  4LZI A;  5KP4 A;  2O3O A;  3WOF B;  5JBS A;  3F9S A;  2HMK B;  3CCE 3;  3AMO A;  3F8H A;  3CMA 3;  1BNE A;  1SJW A;  3HX8 A;  3MPH A;  3VGN A;  1FUW A;  1I70 A;  2P09 A;  1UCJ A;  1VQK 3;  1MOL A;  4LYL B;  2QIY A;  5IEO A;  1UUV B;  4HM5 B;  1N8R 4;  1VQ6 3;  1B2M A;  2STD A;  1IYY A;  3IMA B;  5AEW B;  2IY2 A;  1N9J A;  1Y4K A;  3CPO A;  1EKM A;  1AVL A;  3U97 A;  3EN8 A;  1US1 A;  1VZZ A;  4NPB A;  1IT8 A;  1YHQ 3;  1N9E A;  1HU9 A;  1BSD A;  2P05 A;  3LML A;  1FA3 A;  1VQ5 3;  3CC7 3;  4XBX A;  1LXE A;  1ULJ B;  1RGK A;  3GZY B;  3FKA A;  5IW9 A;  2BO9 B;  1PU4 A;  1YJ9 3;  4XB5 A;  1CYU A;  3S29 A;  5RNT A;  3MSO A;  3QK9 A;  2XSH B;  4MMX B;  2RGQ A;  4OVM A;  4TX4 A;  1JNQ A;  3CD6 3;  3DGN A;  2KF5 A;  3HIG A;  4XBT A;  3WDG B;  2O9U X;  1E3V A;  4IIA A;  4J9A A;  1JRQ A;  1M1X B;  2GEY A;  2F5M A;  2KRT A;  3N8B A;  1ASK A;  2H0G A;  3PYJ A;  4FCZ A;  1GD4 A;  3A5E A;  2XRX B;  2ZA4 A;  1ISK A;  2IUK A;  3GZB A;  1JV2 B;  1O7H B;  3JUQ A;  1Z1S A;  6RNT A;  1A2P A;  2HOH A;  1YIT 3;  1OUN A;  3LZA A;  1IVU A;  1AY7 A;  3DXO A;  3LTB A;  2KF6 A;  5G1K A;  2QA4 3;  4MEI A;  3KN4 A;  5I97 A;  1VQ8 3;  1V57 A;  3LXU X;  2CH9 A;  2WGO A;  3SXX A;  3T8N A;  1OGX A;  1OH0 A;  2GBW B;  1RN7 A;  2RBI A;  3HII A;  5BU4 A;  1Q86 4;  1VQO 3;  3SX1 A;  2CFW A;  1BNI A;  3KII A;  4I4K A;  3WOE B;  1NJI 4;  1D6U A;  3CU3 A;  1Q40 A;  3DZL A;  3X41 A;  4EV5 A;  2I9W A;  1JB5 A;  2OWP A;  4HM6 B;  3S27 A;  2PNC A;  2WGQ A;  1RN1 A;  3JUN A;  3CCM 3;  2W0Q A;  1QVF 2;  3RGR A;  3NQY A;  1STF I;  1HYF A;  1GOU A;  3EN1 B;  5BVB A;  1A67 A;  2K0M A;  1BNS A;  2W2C A;  5AII A;  3OWS A;  3CXC 2;  1Q7H A;  2CC3 A;  1FGO A;  1A2V A;  2OOV C;  2OQE C;  2W56 A;  3DMC A;  4GB5 A;  4ZM8 A;  4WFO A;  3U1W A;  3F7S A;  1DVC A;  5LC7 A;  5CF1 A;  3KSP A;  4XM4 A;  4BL2 A;  1ROA A;  1TIJ A;  3K9M C;  3JVC A;  3OWY A;  4WHA A;  5AIG A;  3X42 A;  4JRF A;  1ULI B;  3I55 3;  1KC8 4;  1DET A;  2IA7 A;  2K3D A;  2CX1 A;  4AKZ A;  2JQ5 A;  4J5G A;  3MKI A;  3DM8 A;  3CCV 3;  4K90 B;  1RN4 A;  2SBL A;  3X3Y A;  4H3U A;  3JUP A;  3PCS A;  2ZL8 A;  4BTY A;  3DUK A;  3BND A;  4WWU C;  1GOY A;  2XGL A;  3EF8 A;  3GWR A;  4GSP A;  4N6M A;  3G4S 3;  3OW2 2;  1IV7 A;  2FNQ A;  4WYK A;  2BHM A;  1FGQ A;  1GY6 A;  1DMQ A;  1N8Q A;  4N6O B;  1VQL 3;  1RCK A;  2F56 A;  3EE1 A;  3J7Y d;  1T2H A;  1W7C A;  2BMR B;  2HMN B;  2MF7 A;  4L8O A;  2QEX 3;  1RRH A;  4EC6 A;  4BIR A;  1QAL A;  2FXT A;  1MNL A;  3OXA A;  5LC6 A;  1OGZ A;  4U13 A;  1VQ4 3;  1PY3 A;  3SYU A;  6STD A;  3FH1 A;  3X40 A;  2CX0 A;  3NV0 A;  3QRD A;  1NDO B;  2WO0 A;  2XSO B;  4BL3 A;  1JBT A;  2Z76 A;  4KFD A;  3DH2 A;  4HZB B;  1LOY A;  1OHS A;  3O8Y A;  1UW1 A;  4PEJ A;  4CDL A;  3T8U A;  1NU3 A;  1YJW 3;  1Q82 4;  5AYS C;  1CYV A;  3D9R A;  3OX9 A;  3G0K A;  1QAF A;  2UGI A;  1BUQ A;  2HMO B;  3LYG A;  4HM2 B;  3VSY A;  1I3I A;  5ELU A;  1OAC A;  5M1A A;  1FGT A;  1I8V A;  5ELJ A;  3HZP A;  4LSO A;  2AAD A;  4BTX A;  2CFG A;  4KVH A;  5AEU B;  3VF1 A;  3CNX A;  3BNE A;  3DY5 A;  3B4O A;  3F7X A;  2J8X B;  3NBJ A;  3WMD A;  2RNT A;  4N6N B;  7STD A;  4STD A;  2GSP A;  1BRI A;  1BSA A;  1LQG C;  3OV4 A;  1VQ7 3;  2F98 A;  4J8T A;  2QGU A;  3FG3 A;  1EUI C;  5D82 A;  1BRS A;  4HVN A;  1W2B 2;  1X1U A;  2D1W A;  4AKY A;  3NX0 A;  1M1K 4;  4KT3 B;  5DRV A;  4O8S A;  2CW9 A;  1YJN 3;  3EB8 A;  1E3R A;  4LEH A;  3EQQ B;  1PFP A;  3CCR 3;  4GHO A;  1W4N A;  3ER7 A;  3FF2 A;  4NRE A;  1UI8 A;  1AV4 A;  2XH9 A;  1FW7 A;  3DGL A;  4XDW A;  2C4B A;  4HKV B;  4JF8 A;  4N3V A;  1JJ2 2;  1R4C A;  5FGO A;  1Q81 4;  1VQ9 3;  1BUJ A;  2BT3 A;  2FGT A;  3LOY A;  1BNG A;  4N6U A;  5G2G A;  1I2E A;  2RSX A;  3K5T A;  3F14 A;  3CCQ 3;  1RLS A;  2XR8 B;  2KAA A;  4CCV A;  1STD A;  5BIR A;  1RHL A;  1M9G A;  1T5Y A;  2W9P A;  1VQP 3;  3PXM A;  2CHC A;  1IK3 A;  2WOF A;  5D83 A;  1RTU A;  1X1W A;  1ZGX A;  3NBR A;  3NUV A;  3FGY A;  2ZHX B;  4LGQ A;  4O2H A;  3B4P A;  1IQ8 A;  1WNH A;  4HM8 B;  3SED A;  3V92 A;  1UCK A;  2P0M A;  5HOH A;  5IEP A;  1G96 A;  4O3V A;  3SLU A;  5BXQ A;  2C10 A;  2E2V A;  3IJE B;  1WMO A;  3PZW A;  3HI7 A;  4N6L A;  1BRJ A;  2GXF A;  1LOX A;  3ZG5 A;  3WR2 A;  3S67 A;  1RRL A;  1I3F A;  1MWT A;  1Q9E A;  2BMQ B;  1DMN A;  2H0I A;  4ORL A;  1FGM A;  1LNH A;  1D6Z A;  3JUO A;  3A76 A;  1I2G A;  1OCV A;  1K73 4;  1UDI I;  3TDG A;  1BRN L;  4OUQ A;  1K28 A;  1RJO A;  2BIR A;  3T0U A;  3Q90 A;  4KFE A;  4EV2 A;  2C11 A;  1RGF A;  3Q1C A;  1U5O A;  1RGG A;  1TRP A;  2R4I A;  4ILF A;  4FMC A;  3ROB A;  3WHO A;  1RNB A;  3X3Z A;  1UCI A;  3F40 A;  3FLJ A;  3NQZ A;  1SII A;  2HMJ B;  4L7K A;  4BU4 A;  3G71 3;  1SQW A;  2CG0 A;  3F8X A;  1LNI A;  2CFL A;  4O02 B;  1NWW A;  2F5W A;  5JPU A;  3N54 B;  2Q07 A;  3B8L A;  3STD A;  5D81 A;  1JKG A;  1KQS 2;  1IVX A;  4LMI A;  3FSD A;  2YX9 A;  3BIR A;  4IT7 A;  3WA2 X;  1TU5 A;  1GMQ A;  3WOD G;  1QJG A;  2CWU A;  1B3S A;  2IMJ A;  1C7H A;  1CQS A;  5KP1 A;  1MGW A;  1X1Y A;  1FUS A;  2YFL B;  1OPY A;  3LTD A;  2KCD A;  3KZT A;  1MWU A;  1SPU A;  1I0V A;  1DE3 A;  1BNF A;  5IG0 A;  1UCL A;  3RDE A;  3D3L A;  1TFK A;  3FF0 A;  3KCH A;  3EBT A;  1V58 A;  1YGE A;  3K0Z A;  3LTC A;  1DVD A;  4MJD A;  2CWT A;  1BGS A;  4FMA A;  4OK0 A;  2A15 A;  1BSB A;  1OF5 A;  1OHP A;  2UX0 A;  3B7C A;  1NB3 I;  4K1U A;  4BTW A;  3AGN A;  4RBN A;  2B1X B;  2M7O A;  1ZS7 A;  3K63 A;  1WTH A;  1S5A A;  1EQK A;  1RGH A;  4K1V A;  3FG4 A;  4IPB A; 
#chains in the Genus database with same CATH homology
 1RGK A;  1TTO A;  1I8V A;  4HAA A;  2AAD A;  7GSP A;  3D5I A;  1BAO A;  3D5G A;  1FYS A;  1YNV X;  5RNT A;  9RNT A;  8RNT A;  1BNR A;  2KF5 A;  2RNT A;  1RMS A;  4RNT A;  1RGC A;  2GSP A;  1YGW A;  1BRI A;  1BSA A;  2F5M A;  1LRA A;  1BRS A;  1RSN A;  2AAE A;  1X1U A;  3A5E A;  1B2U A;  1RGE A;  2ZA4 A;  1AQZ A;  3AHS A;  6RNT A;  1A2P A;  4GHO A;  2HOH A;  1AY7 A;  1BRH A;  1BVI A;  2KF6 A;  4HOH A;  1B27 A;  1I0X A;  1FW7 A;  1GOV A;  7RNT A;  1B2Z A;  2C4B A;  1BUJ A;  3AHW A;  2RBI A;  1LOV A;  3DGY A;  1SAR A;  5BU4 A;  3AGO A;  1BNG A;  1BNI A;  1I2E A;  1JBS A;  1BRG A;  1RLS A;  1CH0 A;  2KAA A;  5BIR A;  1RHL A;  1T2I A;  1BU4 A;  1RTU A;  1X1W A;  1HZ1 A;  1ZGX A;  1JBT A;  3BU4 A;  1RN1 A;  5HOH A;  1UCK A;  1BAN A;  2KF3 A;  1HYF A;  1GOU A;  1FZU A;  2KF4 A;  1C54 A;  1BNS A;  1BSE A;  1BRJ A;  1GMP A;  2BU4 A;  1MGR A;  1RDS A;  3WR2 A;  1X1X A;  1I3F A;  4J5K A;  1Q9E A;  1RGL A;  1B21 A;  3GSP A;  1I2G A;  1BRN L;  2BIR A;  1BOX A;  3D4A A;  1RCL A;  3URP A;  1BRK A;  1RGF A;  1DET A;  1RGG A;  1TRP A;  3WHO A;  1I2F A;  2F4Y A;  3Q3F A;  4J5G A;  1RNB A;  3HOH A;  1UCI A;  4BU4 A;  1G02 A;  1RN4 A;  1TRQ A;  1BSC A;  1LNI A;  2F5W A;  1B2S A;  1GOY A;  1RGA A;  1B20 A;  3RNT A;  4GSP A;  1B2X A;  3BIR A;  1BNJ A;  1GMQ A;  1GSP A;  1BIR A;  1YVS A;  1B3S A;  1RCK A;  2F56 A;  1T2H A;  1R4Y A;  1MGW A;  1X1Y A;  1FUS A;  1PYL A;  4BIR A;  1I0V A;  1DE3 A;  1BNF A;  1BNE A;  1UCL A;  1PY3 A;  3KCH A;  3SYU A;  1FUT A;  1I70 A;  1JBR A;  1UCJ A;  2SAR A;  6GSP A;  1BGS A;  1BSB A;  3DH2 A;  1LOY A;  3AGN A;  1B2M A;  1IYY A;  1LOW A;  5GSP A;  1RNT A;  1GMR A;  1RGH A;  1BSD A;  1I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...