1GOVA

Ribonuclease bi(g specific endonuclease) complexed with sulfate ions
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIGGDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords RIBONUCLEASE
total genus 24
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1govA00
1GMPA 1LOYA 2KF5A 1BRKA 1BRHA 2KAAA 1LOWA 2ZA4A 1LOVA 5GSPA 1GMRA 1RNTA 4BIRA 3DGYA 1BRNL 1TRQA 2BIRA 2KF6A 1RGAA 1RGCA 1BSBA 1CH0A 1B27A 1BVIA 7RNTA 5RNTA 1BNJA 7GSPA 1BSEA 1GOYA 1I3FA 1RSNA 3KCHA 2F56A 1GMQA 1B3SA 1X1UA 3D5GA 4J5KA 1BNRA 1BRJA 2BU4A 3WHOA 1RN4A 2KF4A 1ZGXA 1B2ZA 1BIRA 3AHWA 1HYFA 4HAAA 1BUJA 3RNTA 1C54A 2SARA 1I2FA 1RGGA 1UCIA 1BANA 1RMSA 3BIRA 1B2XA 1RDSA 3HOHA 1AY7A 1LRAA 1YVSA 1BNGA 1RLSA 1TTOA 1I0XA 1DETA 3GSPA 1B20A 3D5IA 6RNTA 1BRGA 1RN1A 1YNVX 1B2MA 1RNBA 1UCJA 1I70A 2GSPA 1BRSA 3BU4A 3WR2A 1I8VA 1X1XA 1RCKA 1B2SA 2RNTA 4GSPA 1LNIA 1B21A 1I2GA 1TRPA 1RGHA 3D4AA 4HOHA 1I2EA 1Q9EA 4BU4A 2C4BA 1BU4A 1X1WA 1HZ1A 2F4YA 1BOXA 1BNFA 4RNTA 1G02A 4J5GA 9RNTA 1R4YA 2F5WA 1JBSA 1UCKA 1AQZA 1FUTA 1B2UA 3AGNA 1RGFA 6GSPA 3URPA 3Q3FA 1GOUA 1BAOA 3AHSA 1I0VA 1SARA 1PY3A 1JBRA 1RGEA 3AGOA 1UCLA 1BNSA 1RGLA 1FW7A 1PYLA 8RNTA 1I3IA 1BSAA 5BU4A 4GHOA 2RBIA 1RHLA 1RGKA 1FUSA 1A2PA 1BGSA 1FYSA 2F5MA 3SYUA 1DE3A 1BSCA 1FZUA 1T2HA 1MGRA 1YGWA 2HOHA 1RTUA 1T2IA 3DH2A 2AAEA 3A5EA 1IYYA 1X1YA 1JBTA 1BSDA 5BIRA 1MGWA 1BNEA 1BRIA 1GOVA 1GSPA 1BNIA 5HOHA 1RCLA 2AADA 2KF3A
chains in the Genus database with same CATH superfamily
4BL2A 1LOYA 2KXGA 1BRKA 1QJGA 4HM5B 1IVXA 1ULIB 4XDVA 5GSPA 3X3ZA 3S29A 3JUOA 3DGYA 3JUPA 1BRNL 2OQEC 2K54A 1ASKA 2CFKA 3L0RA 5CXOA 1AVLA 2IYJA 4CDLA 2HMNB 1WQLB 4STDA 5IF6A 1QAKA 5A0OB 2CFLA 2Y74A 1UUWB 2F56A 3BNCA 4R80A 3UB1A 1VQQA 1B3SA 5M1AA 3D5GA 3GZBA 4HZBB 1BRJA 2BU4A 6STDA 1TJDA 2P05A 2GEYA 1OUNA 1FGQA 3RDEA 1QVF2 2ZHXB 3FF2A 3RNTA 4L8PA 1AVKA 1JNQA 3VF1A 3BB9A 2XGLA 3NHXA 3V98A 3CC43 1EQKA 3NBJA 2XF3A 2UGIA 3EHCA 2F98A 1MOLA 2C10A 1B2XA 2BHMA 3B7CA 3S67A 1W5ZA 3HIGA 2CG1A 1QVG2 1AY7A 3GZXB 2WO0A 1YJ93 3NV0B 1YVSA 3MG1A 3SOAA 3UJMA 1DETA 2ML6A 3FKAA 5AIFA 3GSPA 2HMJB 6RNTA 1RNBA 4HKVB 5AYRB 3MG2A 1SPUA 3WDGB 1NNVA 1G96A 3DUKA 4XBYA 1SIIA 1D6UA 4HM8B 1I8VA 1IV7A 5D83A 1YIJ3 3NUVA 4HM7B 5DREA 4GL6A 1O7HB 5IW9A 2IY2A 1Q42A 3AMOB 1I2GA 1W7CA 3LZAA 3HX8A 1JB2A 1VQM3 3J7Yd 1I2EA 5FGOA 1A67A 3DZLA 4FMDA 4CJNA 2C4BA 1BU4A 2F86B 3EBTA 1VQ73 1PFPA 2UX0A 1OHPA 2IUJA 1R4YA 1UCKA 3LTCA 2CW9A 1B2UA 3AGNA 4HYZA 3U97A 4KFFA 3Q3FA 1E97A 3FG4A 3PGBA 2W03A 1NB3I 3NQZA 1TU5A 2GBWB 1A2VA 2XSOB 3N9HA 1VQK3 4K1UA 1UCLA 1N5PA 1N5HA 2P0XA 2OOVA 1K9M4 1RGLA 1STFI 1SQWA 1J2BA 1Q40A 2IUKA 5LC7A 1DVDA 1OACA 3DXOA 4OUQA 3LH4A 2QA43 3SOYA 2ML5A 4HVNA 1JB5A 5IG5A 1RHLA 1O7GB 1UGHI 1W6GA 2J8XB 2XFTA 3QRDA 1FUSA 1Z1SA 1FA3A 7STDA 1A2PA 1FYSA 3SYUA 5IG3A 1WMNA 4H3UA 1ROAA 3LTBA 3G713 5KP1A 1O7MB 2HMMB 4EV5A 1JBRA 1DMMA 2INXA 1YVBI 1AR0A 3Q1CA 3A5EA 4N3VA 3NBRA 4ILFA 1TUHA 1W02A 2WOFA 3EE1A 4O02B 2SBLA 1BRIA 1NJI4 1E3RA 1IQYA 1GY7A 2XRXB 1VQ93 2CHCA 2KF3A 2W6JH 1W01A 1W2ZA 2HMOB 4WYKA 2H0HA 4I5QA 4EV2A 2D42A 1WNHA 3QK9A 1BRHA 4IPBA 1FGMA 3WODG 1D6YA 2CX0A 2BT3A 1GMRA 2BIRA 5AI1A 2R41A 2CFGA 3M8CA 1RGCA 1BSBA 1Q7HA 3MYTA 1YJW3 2W56B 4FMBA 2P09A 3Q90A 5RNTA 4HM1B 3ZG0A 4HZ9B 3GZRA 4N6UA 2MC8A 2CX1A 3EF8A 2E2VA 4N6V0 1GOYA 3KCHA 1OF5B 3SVAA 1V74A 5CLKA 1HKXA 1BNRA 1W00A 4TX4A 4O3VA 1LXEA 1WTHA 3BNDA 3NM7A 2KF4A 3F8XA 4N6LA 4HJLB 4H61A 3MWZA 3CCE3 1W6CA 4FMCA 3X3YA 1HYFA 4HAAA 3F40A 4GB5A 4WYKB 2W56A 4KFDA 5IEOA 3VGNA 3CCQ3 2K3DA 3NQYA 5IERA 1CYUA 3CMA3 3DGOA 3TDGA 3CNXA 2FGTA 3E99A 1RGGA 4X2HA 1K8A4 1UCIA 2XFSA 3ALAA 4N6NB 3EX9A 4OVMA 1Q814 1STDA 3V99A 2L1SA 1U5OA 4L7KA 3CNMA 5DRVA 3WA3A 3OWYA 1Y4KA 3KE7A 1GYBA 2GEXA 2P38A 1BNGA 4J9AA 4RNYA 3KIIA 5JPUA 4OK0A 2CIUA 1BRGA 1RN1A 1VQ43 1UCJA 1I70A 3IPTA 5BXQA 4RBNA 1DYUA 2RNTA 3CCL3 4ORLA 3NBBA 1TRPA 4MMYB 5JPPA 1Q864 3G0KA 3SXXA 1A2KA 4FCZA 1W4NA 1Q9EA 3PXMA 5IG0A 3UL6A 4KZ1A 1IU7A 1QALA 4NPBA 1X1WA 3K9MC 1UW1A 1BNFA 3EJVA 5CF1A 4RNTA 1G02A 2CWTA 3I0YA 1E3VA 3KZTA 2RSXA 1CYVA 6GSPA 3CCU3 3I563 2XSHB 3JUNA 4FMAA 1IV9A 2Z7AA 2OWPA 1MWSA 5ELUA 1BAOA 1O7NB 3X3XA 1F8NA 1M1XB 3D9RA 3LXUX 3PYJA 4IIAA 4WP5A 5EEOA 3S27A 4AKYA 1RGEA 4EW5A 1VQ53 1DMQA 3B4OA 1TFKA 1PYLA 2PNCA 3N8BA 4LEHA 3WOEB 1U8CB 4HM3B 4K90B 1BSAA 3KSPA 2QGUA 3PCRA 4KT3B 3X42A 1T5YA 4LZIA 2UUGC 2W9QA 2Z77A 4O8SA 3EN8A 3FZWA 1WMOA 3FF0A 5ELJA 2CKFB 5LC6A 4X2OA 2F5MA 1BGSA 4O2HA 5G1LA 3I553 3F7XA 2CFWA 2XGNA 4JRFA 1IDPA 1T2HA 4LGQA 1MGRA 3A76A 3D3LA 1YGEA 3JUMA 4WFOA 1M1K4 4R1KA 1KC84 3BLZA 1T2IA 3O8YA 3G16A 1C7HA 2IA7A 2AAEA 1VQL3 1IYYA 1JZDA 3F9SA 3PZWA 4R9LA 1FUWA 1W2B2 2RGQA 2BMQB 1BNEA 1ZS7A 3WA2X 1GOVA 1OGZA 1OPYA 2KRTA 3K63A 4WHAA 2W2CA 5HOHA 1OF5A 1LVNA 1RCLA 2AADA 1JN5B 1LNHA 5CK6A 1K41A 2KF5A 1NWWA 4XDWA 1Q7Y4 4XB5A 1ROVA 2ZA4A 1LOVA 1R4CA 3PCSA 1TRQA 2IMJA 2ZDJA 3G6E3 2OQEA 2I9WA 1VQ83 1B27A 3CU3A 3RGRA 3F7SA 2WOHA 2W9PA 1YHQ3 4AEQA 3H3HA 1JKGA 3KKGA 1ZO2A 1I3FA 1RSNA 1V57A 2E2UA 2WGOA 1GMQA 1X1UA 1RRHA 3JVCA 1QAFA 3NX0A 4N6TA 3CXC2 1YIT3 2H0GA 1PU4A 5G1KA 1RN4A 2RFRA 3ECFA 3DGMA 5D82A 3WMDA 2XEPA 4QWTA 1B2ZA 1BIRA 3AHWA 3HK4A 3PS8A 1FGTA 2V1LA 3K5TA 5AIHA 2YX9A 3STDA 2C11A 3EQQB 3OXAA 1BUJA 3LTDA 2SARA 2GU3A 1I2FA 1QMAA 1W6YA 3KSED 1KWIA 1JZOA 3IMAB 3BIRA 2O9UX 3DM8A 3EN1B 4U13A 3HOHA 3CCS3 2QIYA 1IVUA 1Q40B 1VQO3 1FGOA 3EC9A 4Q53A 1KD14 5AIGA 4CCVA 1I0XA 2P0MA 3OWUA 4FCJA 3FLJA 4FCMA 3ZG5A 1B2MA 1YNVX 3EBYA 5IENA 2GSPA 3BU4A 3X41A 3MG3A 3LT9A 2QEX3 1X1XA 1B2SA 3KN4A 3T8UA 1VQN3 3LTAA 4GSPA 3MSOA 4MEIA 1OHOA 8CHOA 1B21A 3FSDA 3FG3A 2BMRB 3SEDA 1RGHA 3F8HA 1K734 5AEWB 1GD3A 2YFJB 1HZ1A 4HM2B 2GBXB 3DGLA 1LQGC 4J5GA 1JBSA 1CEWI 2STDA 1RGFA 4WWUC 3F14A 1TP6A 3URPA 4NHFA 3OW22 1IQXA 1GOUA 1NDOB 4EYCA 1IVVA 3UL5A 3AHSA 3MHEA 1KSIA 2XH9A 3CC73 1UUGB 2A15A 2OOVC 2GU1A 1IK3A 2CG0A 1FW7A 3K7CA 1HU9A 3NV0A 3SLUA 8RNTA 1AV4A 2E2TA 3FCSB 1JN5A 3CC23 4GHOA 1NO3A 3N54B 1JB4A 3SX1A 3Q2PA 1VQP3 3FGYA 4PEJA 3U1WA 1VQ63 5STDA 1IT8A 1RGKA 1T3BA 4R9KA 1RN7A 5M18A 2HMKB 4G1MB 2FXTA 1UUVB 1OHSA 1BSCA 1FZUA 1GD4A 3B8LA 2XR8B 3S5CA 5CF2A 1OCVA 3LOYA 1SIHA 2HOHA 2JDIH 2CWUA 1RTUA 2JQ5A 3MPHA 1O7WB 2R4IA 1X1YA 1LOXA 1MNLA 1BSDA 4DKIA 4MMZB 4HM0B 3AMOA 3GAXA 3GRDA 5KP3A 3CME3 2ZL8A 1N9EA 5I97A 1K28A 1ULJB 2KCDA 2LQVA 3OWSA 3OV4A 1BNIA 3GWRA 1N8QA 4R4KA 3H51A 2HMLB 1GMPA 3BNBA 4IT7A 1RRLA 2KAAA 2K0MA 1JJ22 1JRQA 1LOWA 2YFIB 4XBXA 2CK3H 1RNTA 4BIRA 3GZYB 5EQLA 1JV2B 2KF6A 1RGAA 1OH0A 2CH9A 1CH0A 1IQ8A 1SJWA 2B24B 2Q07A 1BVIA 7RNTA 1BNJA 7GSPA 1BSEA 1BUQA 4LYLB 3G4S3 3B4PA 2FNQA 4J5KA 1EUIC 3S28A 4JF8A 4XBTA 4CPKA 1N8R4 4RZMA 3CCV3 3WHOA 4K61A 3D79A 1UDII 1ZGXA 1EKMA 1UGIA 4BTWA 3X40A 1UI8A 3LT8A 5TGNA 2D1WA 1M9GA 3HI7A 1C54A 3CCR3 3CPW2 2CWVA 3G8ZA 1ISKA 3JUQA 2W0QA 4L8OA 1LQMB 1KQS2 1OGXA 4HM6B 2M7OA 1BANA 1NB5I 1RMSA 4EXRA 1RDSA 2W04A 3MKIA 5D81A 1RJOA 2MF7A 4FR9A 1FGRA 1LRAA 3DGNA 1RLSA 1L5GB 1TTOA 5AYSC 5M19A 4J8TA 1B20A 3D5IA 2YFLB 1YI23 5G2GA 2O3OA 2Z76A 1BRSA 3IJEB 3WR2A 4BL3A 2F99A 1RCKA 4AKZA 1LNIA 1DMNA 1DVCA 2Y73A 3D4AA 4HOHA 2BNGA 4N6MA 4BU4A 4ZM8A 1A90A 3ER7A 5HGRA 1VZZA 3ZFZA 2F4YA 1BOXA 3CCJ3 9RNTA 2F5WA 1UI7A 1WMPA 4MMXB 2B1XB 1AQZA 1FUTA 2BMOB 5FW5A 3K0ZA 5AIIA 5IG4A 4EC6A 2OTJ3 2LYXA 1G0TA 1CQSA 4HBRA 3CCM3 1IVWA 3DY5A 1I0VA 4HM4B 4EBGA 3NM2A 1MWTA 1SARA 2CC3A 1US1A 1PY3A 1EEJA 1TIJA 1GS3A 3AGOA 2OCTA 4I4KA 4XM4A 3DMCA 3UNLA 1BNSA 5IEPA 1M904 1Q824 1MWRA 1I3IA 5BU4A 5KP4A 1MWUA 3LYGA 2CFDA 4N6OB 3VSYA 5BVBA 3BNEA 3T8NA 1IT7A 1EG9B 1JKGB 1EA2A 1O7PB 1V58A 1ZX2A 2RBIA 5AEUB 3OX9A 1TFOA 2WGQA 2L4VA 1YJN3 1GY6A 3EB8A 4MJDA 3FG1A 1DE3A 1RKYA 4KFEA 2PZVA 1NU3A 3NXJA 3CD63 1YGWA 2Z6BA 3RGAA 3T0UA 3WOFB 4BTXA 1D6ZA 1S5AA 4RNZA 3CPOA 4BTYA 3DH2A 1N9JA 5JBSA 3LMLA 3V92A 1GY5A 4K1VA 1JBTA 4LSOA 5BIRA 1MGWA 3HZPA 4LMIA 2RCDA 4KVHA 5EVHA 2H0IA 3FH1A 1S723 3ROBA 1GSPA 4NREA 3HIIA 2BO9B 3KFQC 2GXFA 2OTL3
chains in the Genus database with same CATH topology
1GMPA 1LOYA 2KF5A 1BRKA 1BRHA 2KAAA 1LOWA 2ZA4A 1LOVA 5GSPA 1GMRA 1RNTA 4BIRA 3DGYA 1BRNL 1TRQA 2BIRA 2KF6A 1RGAA 1RGCA 1BSBA 1CH0A 1B27A 1BVIA 7RNTA 5RNTA 1BNJA 7GSPA 1BSEA 1GOYA 1I3FA 1RSNA 3KCHA 2F56A 1GMQA 1B3SA 1X1UA 3D5GA 4J5KA 1BNRA 1BRJA 2BU4A 3WHOA 1RN4A 2KF4A 1ZGXA 1B2ZA 1BIRA 3AHWA 1HYFA 4HAAA 1BUJA 3RNTA 1C54A 2SARA 1I2FA 1RGGA 1UCIA 1BANA 1RMSA 3BIRA 1B2XA 1RDSA 3HOHA 1AY7A 1LRAA 1YVSA 1BNGA 1RLSA 1TTOA 1I0XA 1DETA 3GSPA 1B20A 3D5IA 6RNTA 1BRGA 1RN1A 1YNVX 1B2MA 1RNBA 1UCJA 1I70A 2GSPA 1BRSA 3BU4A 3WR2A 1I8VA 1X1XA 1RCKA 1B2SA 2RNTA 4GSPA 1LNIA 1B21A 1I2GA 1TRPA 1RGHA 3D4AA 4HOHA 1I2EA 1Q9EA 4BU4A 2C4BA 1BU4A 1X1WA 1HZ1A 2F4YA 1BOXA 1BNFA 4RNTA 1G02A 4J5GA 9RNTA 1R4YA 2F5WA 1JBSA 1UCKA 1AQZA 1FUTA 1B2UA 3AGNA 1RGFA 6GSPA 3URPA 3Q3FA 1GOUA 1BAOA 3AHSA 1I0VA 1SARA 1PY3A 1JBRA 1RGEA 3AGOA 1UCLA 1BNSA 1RGLA 1FW7A 1PYLA 8RNTA 1I3IA 1BSAA 5BU4A 4GHOA 2RBIA 1RHLA 1RGKA 1FUSA 1A2PA 1BGSA 1FYSA 2F5MA 3SYUA 1DE3A 1BSCA 1FZUA 1T2HA 1MGRA 1YGWA 2HOHA 1RTUA 1T2IA 3DH2A 2AAEA 3A5EA 1IYYA 1X1YA 1JBTA 1BSDA 5BIRA 1MGWA 1BNEA 1BRIA 1GOVA 1GSPA 1BNIA 5HOHA 1RCLA 2AADA 2KF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMP A;  1LOY A;  2KF5 A;  1BRK A;  1BRH A;  2KAA A;  1LOW A;  2ZA4 A;  1LOV A;  5GSP A;  1GMR A;  1RNT A;  4BIR A;  3DGY A;  1BRN L;  1TRQ A;  2BIR A;  2KF6 A;  1RGA A;  1RGC A;  1BSB A;  1CH0 A;  1B27 A;  1BVI A;  7RNT A;  5RNT A;  1BNJ A;  7GSP A;  1BSE A;  1GOY A;  1I3F A;  1RSN A;  3KCH A;  2F56 A;  1GMQ A;  1B3S A;  1X1U A;  3D5G A;  4J5K A;  1BNR A;  1BRJ A;  2BU4 A;  3WHO A;  1RN4 A;  2KF4 A;  1ZGX A;  1B2Z A;  1BIR A;  3AHW A;  1HYF A;  4HAA A;  1BUJ A;  3RNT A;  1C54 A;  2SAR A;  1I2F A;  1RGG A;  1UCI A;  1BAN A;  1RMS A;  3BIR A;  1B2X A;  1RDS A;  3HOH A;  1AY7 A;  1LRA A;  1YVS A;  1BNG A;  1RLS A;  1TTO A;  1I0X A;  1DET A;  3GSP A;  1B20 A;  3D5I A;  6RNT A;  1BRG A;  1RN1 A;  1YNV X;  1B2M A;  1RNB A;  1UCJ A;  1I70 A;  2GSP A;  1BRS A;  3BU4 A;  3WR2 A;  1I8V A;  1X1X A;  1RCK A;  1B2S A;  2RNT A;  4GSP A;  1LNI A;  1B21 A;  1I2G A;  1TRP A;  1RGH A;  3D4A A;  4HOH A;  1I2E A;  1Q9E A;  4BU4 A;  2C4B A;  1BU4 A;  1X1W A;  1HZ1 A;  2F4Y A;  1BOX A;  1BNF A;  4RNT A;  1G02 A;  4J5G A;  9RNT A;  1R4Y A;  2F5W A;  1JBS A;  1UCK A;  1AQZ A;  1FUT A;  1B2U A;  3AGN A;  1RGF A;  6GSP A;  3URP A;  3Q3F A;  1GOU A;  1BAO A;  3AHS A;  1I0V A;  1SAR A;  1PY3 A;  1JBR A;  1RGE A;  3AGO A;  1UCL A;  1BNS A;  1RGL A;  1FW7 A;  1PYL A;  8RNT A;  1I3I A;  1BSA A;  5BU4 A;  4GHO A;  2RBI A;  1RHL A;  1RGK A;  1FUS A;  1A2P A;  1BGS A;  1FYS A;  2F5M A;  3SYU A;  1DE3 A;  1BSC A;  1FZU A;  1T2H A;  1MGR A;  1YGW A;  2HOH A;  1RTU A;  1T2I A;  3DH2 A;  2AAE A;  3A5E A;  1IYY A;  1X1Y A;  1JBT A;  1BSD A;  5BIR A;  1MGW A;  1BNE A;  1BRI A;  1GOV A;  1GSP A;  1BNI A;  5HOH A;  1RCL A;  2AAD A;  2KF3 A; 
#chains in the Genus database with same CATH topology
 4BL2 A;  1LOY A;  2KXG A;  1BRK A;  1QJG A;  4HM5 B;  1IVX A;  1ULI B;  4XDV A;  5GSP A;  3X3Z A;  3S29 A;  3JUO A;  3DGY A;  3JUP A;  1BRN L;  2OQE C;  2K54 A;  1ASK A;  2CFK A;  3L0R A;  5CXO A;  1AVL A;  2IYJ A;  4CDL A;  2HMN B;  1WQL B;  4STD A;  5IF6 A;  1QAK A;  5A0O B;  2CFL A;  2Y74 A;  1UUW B;  2F56 A;  3BNC A;  4R80 A;  3UB1 A;  1VQQ A;  1B3S A;  5M1A A;  3D5G A;  3GZB A;  4HZB B;  1BRJ A;  2BU4 A;  6STD A;  1TJD A;  2P05 A;  2GEY A;  1OUN A;  1FGQ A;  3RDE A;  1QVF 2;  2ZHX B;  3FF2 A;  3RNT A;  4L8P A;  1AVK A;  1JNQ A;  3VF1 A;  3BB9 A;  2XGL A;  3NHX A;  3V98 A;  3CC4 3;  1EQK A;  3NBJ A;  2XF3 A;  2UGI A;  3EHC A;  2F98 A;  1MOL A;  2C10 A;  1B2X A;  2BHM A;  3B7C A;  3S67 A;  1W5Z A;  3HIG A;  2CG1 A;  1QVG 2;  1AY7 A;  3GZX B;  2WO0 A;  1YJ9 3;  3NV0 B;  1YVS A;  3MG1 A;  3SOA A;  3UJM A;  1DET A;  2ML6 A;  3FKA A;  5AIF A;  3GSP A;  2HMJ B;  6RNT A;  1RNB A;  4HKV B;  5AYR B;  3MG2 A;  1SPU A;  3WDG B;  1NNV A;  1G96 A;  3DUK A;  4XBY A;  1SII A;  1D6U A;  4HM8 B;  1I8V A;  1IV7 A;  5D83 A;  1YIJ 3;  3NUV A;  4HM7 B;  5DRE A;  4GL6 A;  1O7H B;  5IW9 A;  2IY2 A;  1Q42 A;  3AMO B;  1I2G A;  1W7C A;  3LZA A;  3HX8 A;  1JB2 A;  1VQM 3;  3J7Y d;  1I2E A;  5FGO A;  1A67 A;  3DZL A;  4FMD A;  4CJN A;  2C4B A;  1BU4 A;  2F86 B;  3EBT A;  1VQ7 3;  1PFP A;  2UX0 A;  1OHP A;  2IUJ A;  1R4Y A;  1UCK A;  3LTC A;  2CW9 A;  1B2U A;  3AGN A;  4HYZ A;  3U97 A;  4KFF A;  3Q3F A;  1E97 A;  3FG4 A;  3PGB A;  2W03 A;  1NB3 I;  3NQZ A;  1TU5 A;  2GBW B;  1A2V A;  2XSO B;  3N9H A;  1VQK 3;  4K1U A;  1UCL A;  1N5P A;  1N5H A;  2P0X A;  2OOV A;  1K9M 4;  1RGL A;  1STF I;  1SQW A;  1J2B A;  1Q40 A;  2IUK A;  5LC7 A;  1DVD A;  1OAC A;  3DXO A;  4OUQ A;  3LH4 A;  2QA4 3;  3SOY A;  2ML5 A;  4HVN A;  1JB5 A;  5IG5 A;  1RHL A;  1O7G B;  1UGH I;  1W6G A;  2J8X B;  2XFT A;  3QRD A;  1FUS A;  1Z1S A;  1FA3 A;  7STD A;  1A2P A;  1FYS A;  3SYU A;  5IG3 A;  1WMN A;  4H3U A;  1ROA A;  3LTB A;  3G71 3;  5KP1 A;  1O7M B;  2HMM B;  4EV5 A;  1JBR A;  1DMM A;  2INX A;  1YVB I;  1AR0 A;  3Q1C A;  3A5E A;  4N3V A;  3NBR A;  4ILF A;  1TUH A;  1W02 A;  2WOF A;  3EE1 A;  4O02 B;  2SBL A;  1BRI A;  1NJI 4;  1E3R A;  1IQY A;  1GY7 A;  2XRX B;  1VQ9 3;  2CHC A;  2KF3 A;  2W6J H;  1W01 A;  1W2Z A;  2HMO B;  4WYK A;  2H0H A;  4I5Q A;  4EV2 A;  2D42 A;  1WNH A;  3QK9 A;  1BRH A;  4IPB A;  1FGM A;  3WOD G;  1D6Y A;  2CX0 A;  2BT3 A;  1GMR A;  2BIR A;  5AI1 A;  2R41 A;  2CFG A;  3M8C A;  1RGC A;  1BSB A;  1Q7H A;  3MYT A;  1YJW 3;  2W56 B;  4FMB A;  2P09 A;  3Q90 A;  5RNT A;  4HM1 B;  3ZG0 A;  4HZ9 B;  3GZR A;  4N6U A;  2MC8 A;  2CX1 A;  3EF8 A;  2E2V A;  4N6V 0;  1GOY A;  3KCH A;  1OF5 B;  3SVA A;  1V74 A;  5CLK A;  1HKX A;  1BNR A;  1W00 A;  4TX4 A;  4O3V A;  1LXE A;  1WTH A;  3BND A;  3NM7 A;  2KF4 A;  3F8X A;  4N6L A;  4HJL B;  4H61 A;  3MWZ A;  3CCE 3;  1W6C A;  4FMC A;  3X3Y A;  1HYF A;  4HAA A;  3F40 A;  4GB5 A;  4WYK B;  2W56 A;  4KFD A;  5IEO A;  3VGN A;  3CCQ 3;  2K3D A;  3NQY A;  5IER A;  1CYU A;  3CMA 3;  3DGO A;  3TDG A;  3CNX A;  2FGT A;  3E99 A;  1RGG A;  4X2H A;  1K8A 4;  1UCI A;  2XFS A;  3ALA A;  4N6N B;  3EX9 A;  4OVM A;  1Q81 4;  1STD A;  3V99 A;  2L1S A;  1U5O A;  4L7K A;  3CNM A;  5DRV A;  3WA3 A;  3OWY A;  1Y4K A;  3KE7 A;  1GYB A;  2GEX A;  2P38 A;  1BNG A;  4J9A A;  4RNY A;  3KII A;  5JPU A;  4OK0 A;  2CIU A;  1BRG A;  1RN1 A;  1VQ4 3;  1UCJ A;  1I70 A;  3IPT A;  5BXQ A;  4RBN A;  1DYU A;  2RNT A;  3CCL 3;  4ORL A;  3NBB A;  1TRP A;  4MMY B;  5JPP A;  1Q86 4;  3G0K A;  3SXX A;  1A2K A;  4FCZ A;  1W4N A;  1Q9E A;  3PXM A;  5IG0 A;  3UL6 A;  4KZ1 A;  1IU7 A;  1QAL A;  4NPB A;  1X1W A;  3K9M C;  1UW1 A;  1BNF A;  3EJV A;  5CF1 A;  4RNT A;  1G02 A;  2CWT A;  3I0Y A;  1E3V A;  3KZT A;  2RSX A;  1CYV A;  6GSP A;  3CCU 3;  3I56 3;  2XSH B;  3JUN A;  4FMA A;  1IV9 A;  2Z7A A;  2OWP A;  1MWS A;  5ELU A;  1BAO A;  1O7N B;  3X3X A;  1F8N A;  1M1X B;  3D9R A;  3LXU X;  3PYJ A;  4IIA A;  4WP5 A;  5EEO A;  3S27 A;  4AKY A;  1RGE A;  4EW5 A;  1VQ5 3;  1DMQ A;  3B4O A;  1TFK A;  1PYL A;  2PNC A;  3N8B A;  4LEH A;  3WOE B;  1U8C B;  4HM3 B;  4K90 B;  1BSA A;  3KSP A;  2QGU A;  3PCR A;  4KT3 B;  3X42 A;  1T5Y A;  4LZI A;  2UUG C;  2W9Q A;  2Z77 A;  4O8S A;  3EN8 A;  3FZW A;  1WMO A;  3FF0 A;  5ELJ A;  2CKF B;  5LC6 A;  4X2O A;  2F5M A;  1BGS A;  4O2H A;  5G1L A;  3I55 3;  3F7X A;  2CFW A;  2XGN A;  4JRF A;  1IDP A;  1T2H A;  4LGQ A;  1MGR A;  3A76 A;  3D3L A;  1YGE A;  3JUM A;  4WFO A;  1M1K 4;  4R1K A;  1KC8 4;  3BLZ A;  1T2I A;  3O8Y A;  3G16 A;  1C7H A;  2IA7 A;  2AAE A;  1VQL 3;  1IYY A;  1JZD A;  3F9S A;  3PZW A;  4R9L A;  1FUW A;  1W2B 2;  2RGQ A;  2BMQ B;  1BNE A;  1ZS7 A;  3WA2 X;  1GOV A;  1OGZ A;  1OPY A;  2KRT A;  3K63 A;  4WHA A;  2W2C A;  5HOH A;  1OF5 A;  1LVN A;  1RCL A;  2AAD A;  1JN5 B;  1LNH A;  5CK6 A;  1K41 A;  2KF5 A;  1NWW A;  4XDW A;  1Q7Y 4;  4XB5 A;  1ROV A;  2ZA4 A;  1LOV A;  1R4C A;  3PCS A;  1TRQ A;  2IMJ A;  2ZDJ A;  3G6E 3;  2OQE A;  2I9W A;  1VQ8 3;  1B27 A;  3CU3 A;  3RGR A;  3F7S A;  2WOH A;  2W9P A;  1YHQ 3;  4AEQ A;  3H3H A;  1JKG A;  3KKG A;  1ZO2 A;  1I3F A;  1RSN A;  1V57 A;  2E2U A;  2WGO A;  1GMQ A;  1X1U A;  1RRH A;  3JVC A;  1QAF A;  3NX0 A;  4N6T A;  3CXC 2;  1YIT 3;  2H0G A;  1PU4 A;  5G1K A;  1RN4 A;  2RFR A;  3ECF A;  3DGM A;  5D82 A;  3WMD A;  2XEP A;  4QWT A;  1B2Z A;  1BIR A;  3AHW A;  3HK4 A;  3PS8 A;  1FGT A;  2V1L A;  3K5T A;  5AIH A;  2YX9 A;  3STD A;  2C11 A;  3EQQ B;  3OXA A;  1BUJ A;  3LTD A;  2SAR A;  2GU3 A;  1I2F A;  1QMA A;  1W6Y A;  3KSE D;  1KWI A;  1JZO A;  3IMA B;  3BIR A;  2O9U X;  3DM8 A;  3EN1 B;  4U13 A;  3HOH A;  3CCS 3;  2QIY A;  1IVU A;  1Q40 B;  1VQO 3;  1FGO A;  3EC9 A;  4Q53 A;  1KD1 4;  5AIG A;  4CCV A;  1I0X A;  2P0M A;  3OWU A;  4FCJ A;  3FLJ A;  4FCM A;  3ZG5 A;  1B2M A;  1YNV X;  3EBY A;  5IEN A;  2GSP A;  3BU4 A;  3X41 A;  3MG3 A;  3LT9 A;  2QEX 3;  1X1X A;  1B2S A;  3KN4 A;  3T8U A;  1VQN 3;  3LTA A;  4GSP A;  3MSO A;  4MEI A;  1OHO A;  8CHO A;  1B21 A;  3FSD A;  3FG3 A;  2BMR B;  3SED A;  1RGH A;  3F8H A;  1K73 4;  5AEW B;  1GD3 A;  2YFJ B;  1HZ1 A;  4HM2 B;  2GBX B;  3DGL A;  1LQG C;  4J5G A;  1JBS A;  1CEW I;  2STD A;  1RGF A;  4WWU C;  3F14 A;  1TP6 A;  3URP A;  4NHF A;  3OW2 2;  1IQX A;  1GOU A;  1NDO B;  4EYC A;  1IVV A;  3UL5 A;  3AHS A;  3MHE A;  1KSI A;  2XH9 A;  3CC7 3;  1UUG B;  2A15 A;  2OOV C;  2GU1 A;  1IK3 A;  2CG0 A;  1FW7 A;  3K7C A;  1HU9 A;  3NV0 A;  3SLU A;  8RNT A;  1AV4 A;  2E2T A;  3FCS B;  1JN5 A;  3CC2 3;  4GHO A;  1NO3 A;  3N54 B;  1JB4 A;  3SX1 A;  3Q2P A;  1VQP 3;  3FGY A;  4PEJ A;  3U1W A;  1VQ6 3;  5STD A;  1IT8 A;  1RGK A;  1T3B A;  4R9K A;  1RN7 A;  5M18 A;  2HMK B;  4G1M B;  2FXT A;  1UUV B;  1OHS A;  1BSC A;  1FZU A;  1GD4 A;  3B8L A;  2XR8 B;  3S5C A;  5CF2 A;  1OCV A;  3LOY A;  1SIH A;  2HOH A;  2JDI H;  2CWU A;  1RTU A;  2JQ5 A;  3MPH A;  1O7W B;  2R4I A;  1X1Y A;  1LOX A;  1MNL A;  1BSD A;  4DKI A;  4MMZ B;  4HM0 B;  3AMO A;  3GAX A;  3GRD A;  5KP3 A;  3CME 3;  2ZL8 A;  1N9E A;  5I97 A;  1K28 A;  1ULJ B;  2KCD A;  2LQV A;  3OWS A;  3OV4 A;  1BNI A;  3GWR A;  1N8Q A;  4R4K A;  3H51 A;  2HML B;  1GMP A;  3BNB A;  4IT7 A;  1RRL A;  2KAA A;  2K0M A;  1JJ2 2;  1JRQ A;  1LOW A;  2YFI B;  4XBX A;  2CK3 H;  1RNT A;  4BIR A;  3GZY B;  5EQL A;  1JV2 B;  2KF6 A;  1RGA A;  1OH0 A;  2CH9 A;  1CH0 A;  1IQ8 A;  1SJW A;  2B24 B;  2Q07 A;  1BVI A;  7RNT A;  1BNJ A;  7GSP A;  1BSE A;  1BUQ A;  4LYL B;  3G4S 3;  3B4P A;  2FNQ A;  4J5K A;  1EUI C;  3S28 A;  4JF8 A;  4XBT A;  4CPK A;  1N8R 4;  4RZM A;  3CCV 3;  3WHO A;  4K61 A;  3D79 A;  1UDI I;  1ZGX A;  1EKM A;  1UGI A;  4BTW A;  3X40 A;  1UI8 A;  3LT8 A;  5TGN A;  2D1W A;  1M9G A;  3HI7 A;  1C54 A;  3CCR 3;  3CPW 2;  2CWV A;  3G8Z A;  1ISK A;  3JUQ A;  2W0Q A;  4L8O A;  1LQM B;  1KQS 2;  1OGX A;  4HM6 B;  2M7O A;  1BAN A;  1NB5 I;  1RMS A;  4EXR A;  1RDS A;  2W04 A;  3MKI A;  5D81 A;  1RJO A;  2MF7 A;  4FR9 A;  1FGR A;  1LRA A;  3DGN A;  1RLS A;  1L5G B;  1TTO A;  5AYS C;  5M19 A;  4J8T A;  1B20 A;  3D5I A;  2YFL B;  1YI2 3;  5G2G A;  2O3O A;  2Z76 A;  1BRS A;  3IJE B;  3WR2 A;  4BL3 A;  2F99 A;  1RCK A;  4AKZ A;  1LNI A;  1DMN A;  1DVC A;  2Y73 A;  3D4A A;  4HOH A;  2BNG A;  4N6M A;  4BU4 A;  4ZM8 A;  1A90 A;  3ER7 A;  5HGR A;  1VZZ A;  3ZFZ A;  2F4Y A;  1BOX A;  3CCJ 3;  9RNT A;  2F5W A;  1UI7 A;  1WMP A;  4MMX B;  2B1X B;  1AQZ A;  1FUT A;  2BMO B;  5FW5 A;  3K0Z A;  5AII A;  5IG4 A;  4EC6 A;  2OTJ 3;  2LYX A;  1G0T A;  1CQS A;  4HBR A;  3CCM 3;  1IVW A;  3DY5 A;  1I0V A;  4HM4 B;  4EBG A;  3NM2 A;  1MWT A;  1SAR A;  2CC3 A;  1US1 A;  1PY3 A;  1EEJ A;  1TIJ A;  1GS3 A;  3AGO A;  2OCT A;  4I4K A;  4XM4 A;  3DMC A;  3UNL A;  1BNS A;  5IEP A;  1M90 4;  1Q82 4;  1MWR A;  1I3I A;  5BU4 A;  5KP4 A;  1MWU A;  3LYG A;  2CFD A;  4N6O B;  3VSY A;  5BVB A;  3BNE A;  3T8N A;  1IT7 A;  1EG9 B;  1JKG B;  1EA2 A;  1O7P B;  1V58 A;  1ZX2 A;  2RBI A;  5AEU B;  3OX9 A;  1TFO A;  2WGQ A;  2L4V A;  1YJN 3;  1GY6 A;  3EB8 A;  4MJD A;  3FG1 A;  1DE3 A;  1RKY A;  4KFE A;  2PZV A;  1NU3 A;  3NXJ A;  3CD6 3;  1YGW A;  2Z6B A;  3RGA A;  3T0U A;  3WOF B;  4BTX A;  1D6Z A;  1S5A A;  4RNZ A;  3CPO A;  4BTY A;  3DH2 A;  1N9J A;  5JBS A;  3LML A;  3V92 A;  1GY5 A;  4K1V A;  1JBT A;  4LSO A;  5BIR A;  1MGW A;  3HZP A;  4LMI A;  2RCD A;  4KVH A;  5EVH A;  2H0I A;  3FH1 A;  1S72 3;  3ROB A;  1GSP A;  4NRE A;  3HII A;  2BO9 B;  3KFQ C;  2GXF A;  2OTL 3; 
#chains in the Genus database with same CATH homology
 1GMP A;  1LOY A;  2KF5 A;  1BRK A;  1BRH A;  2KAA A;  1LOW A;  2ZA4 A;  1LOV A;  5GSP A;  1GMR A;  1RNT A;  4BIR A;  3DGY A;  1BRN L;  1TRQ A;  2BIR A;  2KF6 A;  1RGA A;  1RGC A;  1BSB A;  1CH0 A;  1B27 A;  1BVI A;  7RNT A;  5RNT A;  1BNJ A;  7GSP A;  1BSE A;  1GOY A;  1I3F A;  1RSN A;  3KCH A;  2F56 A;  1GMQ A;  1B3S A;  1X1U A;  3D5G A;  4J5K A;  1BNR A;  1BRJ A;  2BU4 A;  3WHO A;  1RN4 A;  2KF4 A;  1ZGX A;  1B2Z A;  1BIR A;  3AHW A;  1HYF A;  4HAA A;  1BUJ A;  3RNT A;  1C54 A;  2SAR A;  1I2F A;  1RGG A;  1UCI A;  1BAN A;  1RMS A;  3BIR A;  1B2X A;  1RDS A;  3HOH A;  1AY7 A;  1LRA A;  1YVS A;  1BNG A;  1RLS A;  1TTO A;  1I0X A;  1DET A;  3GSP A;  1B20 A;  3D5I A;  6RNT A;  1BRG A;  1RN1 A;  1YNV X;  1B2M A;  1RNB A;  1UCJ A;  1I70 A;  2GSP A;  1BRS A;  3BU4 A;  3WR2 A;  1I8V A;  1X1X A;  1RCK A;  1B2S A;  2RNT A;  4GSP A;  1LNI A;  1B21 A;  1I2G A;  1TRP A;  1RGH A;  3D4A A;  4HOH A;  1I2E A;  1Q9E A;  4BU4 A;  2C4B A;  1BU4 A;  1X1W A;  1HZ1 A;  2F4Y A;  1BOX A;  1BNF A;  4RNT A;  1G02 A;  4J5G A;  9RNT A;  1R4Y A;  2F5W A;  1JBS A;  1UCK A;  1AQZ A;  1FUT A;  1B2U A;  3AGN A;  1RGF A;  6GSP A;  3URP A;  3Q3F A;  1GOU A;  1BAO A;  3AHS A;  1I0V A;  1SAR A;  1PY3 A;  1JBR A;  1RGE A;  3AGO A;  1UCL A;  1BNS A;  1RGL A;  1FW7 A;  1PYL A;  8RNT A;  1I3I A;  1BSA A;  5BU4 A;  4GHO A;  2RBI A;  1RHL A;  1RGK A;  1FUS A;  1A2P A;  1BGS A;  1FYS A;  2F5M A;  3SYU A;  1DE3 A;  1BSC A;  1FZU A;  1T2H A;  1MGR A;  1YGW A;  2HOH A;  1RTU A;  1T2I A;  3DH2 A;  2AAE A;  3A5E A;  1IYY A;  1X1Y A;  1JBT A;  1BSD A;  5BIR A;  1MGW A;  1BNE A;  1BRI A;  1GOV A;  1GSP A;  1BNI A;  5HOH A;  1RCL A;  2AAD A;  2KF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...