1GQAA

Cytochrome c' from rhodobacter spheriodes
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
b'ADAEHVVEARKGYFSLVALEFGPLAAMAKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSADDVKGTAAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKELAAAVGKVGGTCKSCHDDFRVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title High Resolution Crystal Structure of Ferricytochrome C' from Rhodobacter Sphaeroides
rcsb
molecule tags Electron transport
total genus 49
structure length 130
sequence length 130
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1gqaA00
2YL1A 1CGNA 3ZQYA 2YKZA 4NC3A 4L6RA 4WGZA 3C63A 1APCA 4CJGA 1M6TA 4EIYA 3M15A 2YL7A 3C62A 3HNLA 5JRAA 1YZAA 1E84A 5JUAA 4U9DA 3NMJA 5JS5A 3ZTZA 1YZCA 4U9EA 3QW0A 3NMIA 256BA 2YLIA 5JSLA 1NBBA 4CIPA 2YLDA 1E86A 5B3IA 4ER9A 5JLIA 4D4NA 3HNJA 3NMKA 3M4CA 5JT4A 1JAFA 2XL8A 3FOPA 1RCPA 2BC5A 2YL3A 3DE9A 1E85A 2XM4A 1QPUA 4JE9A 4IB4A 1QQ3A 2YLGA 4D4XA 3QVZA 2XLDA 3HNKA 3HNIA 4N6HA 3TOMA 1BBHA 2XLVA 2XLHA 3IQ5A 2QLAA 5JVEA 1EKYA 3M79A 3L1MA 2XL6A 4N4WA 3TOLA 3VRCA 4IAQA 4CDVA 1CPRA 1CPQA 3QVYA 1LM3B 4CJOA 4ULVA 4JEBA 3ZQVA 1S05A 2J9BA 3QW1A 2XLWA 3FOOA 4CDAA 5JP7A 3U8PA 1E83A 1MQVA 3ZWIA 4WGYA 2XM0A 3IQ6A 5AGFA 1YYJA 2XLEA 4JEAA 1YYXA 1A7VA 3DE8A 4IARA 1CGOA 2CCYA 4JKVA 2YL0A 1GQAA 2J8WA 2XLOA 2XLMA 4CX9A 3M4BA 3ZTMA 4CDYA
chains in the Genus database with same CATH superfamily
1G8XA 3DI5A 4XPXA 2YKZA 5A69A 1OCZC 3LLKA 3T6BA 3EHMA 4OIPF 1I4ZA 2J7PD 4MW3A 4WGZA 2DYRC 3EZIA 3RVZA 5CIVA 4MNDA 2Y3HA 1VLTA 2EPLX 4BJ6C 2Q3TA 4CJGA 1FMVA 3AQBA 4G7HF 3M15A 3DAFA 2IXPA 2YL7A 1EA8A 3G50A 1MMGA 2Y69C 1A0BA 3NG1A 2Q9AA 3H2UA 4LLEA 3GWNA 5JS5A 4QDLA 4EBBA 4U9EA 4EUKB 3EH2A 1Q0KA 4U5HA 4WABA 2NSFA 3LNMB 2J9VA 3EFOB 2XRHA 4W8PA 1VOMA 2KJGA 256BA 2YLIA 3O6XA 1QLEC 4CS9A 1GGQA 1MMDA 1L3PA 3UNGC 3FHDA 2KW3C 5L0GA 4CIPA 3HJCA 4OINF 4PJMA 2GAQA 2EIJC 2YWAA 4ER9A 3F47A 4KI2A 4O79A 2J0WA 3NMKA 4GYTA 4JZAA 2AP3A 3A9CA 4U5GA 2XS8A 3SP1A 2WVQA 4XEVA 3KYJA 3Q7GA 5DLJA 1E85A 3DAGA 3WHNA 3AG3C 5DS5A 4LDQA 1AVOB 1UG7A 1W2WA 2KC3A 2P61A 3AG2C 1PD1A 3JSEO 3K66A 4JE9A 2OU6A 5T3TA 2C03A 3NYLA 4BG0A 1VK5A 3MYFA 2HMZA 2Q4FA 4IB4A 3KMIA 4XLNF 4D4XA 3CSKA 4YK5A 2R7SA 2XLDA 3GEEA 4IGGA 3N2ZB 2ZXOA 1D1CA 3C8GB 3IPMO 1VTMP 4BEJA 4Q7CA 2G3VA 2R7WA 2AVKA 2AU5A 2QLAA 5JVEA 2XL4A 1BZ4A 3SEOA 3EFOA 4AL0A 2R7TA 1M57C 3M79A 3L1MA 2Q9CA 2XL6A 4N4WA 4PR9A 3R7CA 4CBEA 1OQCA 4CS8C 4DBQA 4X0RA 1FMWA 3TOLA 1BR4A 4Q5SF 1PD0A 1T9KA 3S0XA 4I1MA 3DZAA 3GEIA 4BJ5A 1YARO 3N0TA 3ZC4A 4CDVA 2GFHA 2NSGA 3E9VA 1D1BA 4JC7A 3FDQA 2VB6A 4XQ1A 1V54C 2HMQA 4FESA 4UDVA 3ZG1A 3DXJF 3CZ6A 4JEBA 3EGXB 1WGWA 1RKEB 2IXNA 4JTDB 3Q7LA 1TWGA 3KH2A 1SMYF 1HE9A 3T9OA 1K40A 5E33A 1RKCA 2R25A 3PCVA 3CAXA 3OWTA 4CSAA 1ZHZA 2M4EA 5EHHA 1F1MA 4CDAA 1H7IA 1HE1A 1Y6DA 2O9XA 3GORA 3JTLO 2EPOA 3C8GA 3RYLA 1XZPA 3ZDLA 3L34A 1ZYRF 4NTBA 3OEOA 4JW1A 5L0HA 1Z7Qc 4QI0A 3SXYA 1TFOB 4FAPB 2J9UA 3UMHA 1S7ZA 3V5YA 1G4US 2ICWG 1NU9C 4JEAA 4AK9A 2A69F 2Y39A 3Q6NA 3O39A 4U5DE 3T6GB 2D5RB 3DD7A 3C18A 2OG2A 5A6JA 4PFPA 3EH1A 4XWJA 2CCYA 1T6UA 4A2NB 3POVA 4LLCA 2OEXA 1GQAA 2ZD9A 3B29A 4HFFB 5L0DA 2F22A 2ZPAA 4EBJA 3WAQA 4BJTA 1V55C 2OKUA 3EGXA 4Z9IA 1NSGB 5TJ5E 1RKEA 2JPUA 2IXMA 2LQGA 1QSPA 1G4WR 2QE9A 3NYJA 2J45A 2BE5F 1ZZPA 1MMNA 1VYIA 4K0DA 4YT4A 2L7AA 2YL1A 4B6IA 3BRJA 2YVKA 4I44A 4E17A 1ZW2A 1I4YA 3I5PA 1A7EA 5BQGA 2H7BA 3PHF2 4JVSA 1XWJA 1VLSA 2M64A 2Y3GA 3DWWA 3JRTA 2R9RB 3C63A 2MWQA 4QI2A 5HV9A 1D0ZA 3JYYA 4EIYA 2JX0A 1OR3A 3NRHA 2Z15A 3H2VA 1BR1A 2WZLA 3HNLA 4C3EA 5JRAA 1E84A 2HSBA 2LK4A 3ITFA 2GWWA 4U9DA 1YJGA 4RDAA 3V5XA 4P9FA 3RF3A 1YZCA 2YZSA 1UFBA 1SZIA 3RIPA 2R7OA 4BJ1A 2CNWD 2H7OA 2VCAA 1U89A 2C04A 1M2OA 4U5CE 5COMA 1OXBA 1ZHXA 4I3MA 2KSFA 3DMDA 1ZW3A 4O6NA 1K04A 2ZXRA 1NBBA 2HFIA 1LI7A 2J9WA 3GANA 1HW2A 1TWHA 2CW0F 3JZ0A 1M2VB 2QNLA 2MHRA 3OA1A 4JRZA 2NUPA 3RQEA 1T6QA 2LFFA 3LAYA 3IQCA 1ORJA 5L0CA 3ZVRA 5KYXB 1N1CA 4C3DA 3EG9B 3M4CA 5JT4A 2XL8A 3X2QC 4Q4ZF 4E7ZA 1NFOA 3DE9A 2ASRA 5L0IA 4LDKA 3RKOF 2J7PA 1O5HA 2E87A 3CQZA 3AJMA 4JCHA 1QQ3A 2NUTB 2G62A 5E3AA 2Q7RA 3B0VC 3QVZA 1QKRA 3HNKA 4N6HA 3MYIA 2X0CA 3TJ5A 2H7VC 3TOMA 1BBHA 1T6IA 2XLVA 4HEAJ 3IQ5A 3LEVA 4YT8A 1Z3IX 2R05A 3G4ZA 2ZXWC 3EZHA 2NG1A 2XXAB 5F5FA 4XTKA 3ASOC 3V7OA 1ZU4A 5A6BD 1IW7F 2B0HA 1T5OA 2CYDA 4JJFA 3SXMA 3U2MA 1FAPB 2IXOA 2LD6A 3VRCA 1CGME 3AGUA 1JRAA 1CPRA 2JD3A 2YRFA 4DRIB 5KYXA 1R4TA 3KYIA 4J7YA 3N24A 2W9YA 1LM3B 3U5SA 2J0XA 2PBEA 2AWCA 4PJLA 3LS0A 3U9MA 2YHSA 1NLXA 4U5BE 2PFDA 4ULVA 4BJ5C 4J32B 1YVIA 2XSEA 4YT5A 4XLPF 1T01A 2EPMX 3O55A 2LFDA 4F4BA 4GEHA 2XLWA 3AG1C 4EKWA 3S29A 4MVSA 2NUTA 1K05A 4P9TA 1GS9A 1LE2A 3B0PA 1E83A 4PACA 4AE4B 1MQVA 2L6FA 3I4UA 4WGYA 2R7VA 2R03A 2XM0A 4CSAC 3UMIA 2XXAA 4NCQA 1ZU5A 2ZXPA 3PMRA 5L0FA 1LPEA 2XLEA 5K0IA 4CIHA 1HMOA 5DVWA 1BDJB 3SXZA 5KYNA 4DVYP 3SXKA 2NPUA 4E18A 1A7DA 3EJNA 2VH3A 1MMAA 4DVZA 4MTFA 2I8BA 3DJNB 2EINC 2V3CC 2J8WA 2XLOA 1OKKD 4K1OA 2XLMA 1H9GA 4MVZA 3TQOA 3W2VA 3K1HA 2OJQA 1TKNA 3ABKC 4KBLA 2WZFA 3S27A 3ZTMA 4IRUA 4NY3A 5DQZA 1KTMA 3FXHA 1RXQA 5KYUB 2Y3BA 1CGNA 2RSEB 3ZQYA 4NC3A 3TULA 5B3SC 1QVXA 3JSZA 1C17M 2QTVA 3VYWA 1O3UA 2HS5A 4MVMA 2VCBA 2IYLD 4MVUA 2OCCC 3IQTA 4NTFA 3S84A 5DS6A 3ATPA 2GA0A 1HY5A 4G0HA 4DOZA 1YA7O 4IJJA 3K33A 5T3WA 1RJ9B 3IHUA 2PX3A 3I5QA 2LCHA 2KGOA 2OJED 2PP4A 3NMJA 2UUHA 3QTHA 4H54A 1LVKA 3K1IA 3UGOA 1U6HA 3KPHA 1ZHTA 3GEHA 3QW0A 4R32A 3ASNC 2W4MA 3US6A 1TWAA 3LS1A 4NQFA 3GM2A 4PFOA 4YT2A 1XZQA 3CEXA 4LERA 4HE8D 2G3KA 3LUTB 2A1DD 1J8YF 2A68F 3F46A 4KNWA 4AL1A 3SYNA 3LNRA 5F28E 4DRJB 1ORSC 2DGJA 2WVOA 2X51A 3FOPA 3ABMC 3FVYA 1HW1A 2Y3DA 4EWCA 3MLGA 1RCPA 3WG7C 2BC5A 2L81A 2VC9A 2YL3A 3JYHA 4RD9A 5BQIA 4XPYA 3VAYA 1QPUA 4M63A 4J7TA 5L3QA 4EBKA 2HV7A 3AG4C 3ZIBA 1RJ9A 5CI8A 4E0HA 3HNIA 3U9JA 2HUJA 2LIGA 3W8IA 3JRMO 3NDBB 4MW8A 1C02A 4YWQA 1JMWA 3MBGA 1OXKA 4OD4A 1SYQA 2A6EF 1WWPA 3DM9B 2CNWA 1JOGA 4KC9A 4C3BA 1OW6A 5A6KA 1OCOC 4IWBA 1PCXA 4OIRF 3U8VA 1WN0A 4LDRA 2PF4E 3B71A 4CS9C 2IM8A 2XS1A 2KNHA 1LKXA 2L6GA 2PNOA 4WJ0A 2PX0A 4E0IA 5EGYA 3QVYA 5A6AA 2EIMC 3NYMA 2H8AA 2DYSC 1D0XA 1SF8A 2OOCA 3FMSA 1LE4A 4XEKA 4DRHB 2UUIA 4OIQF 1VMAA 4CJOA 1Q0DA 4PJJA 4PK4A 2DI3A 1E2XA 4Z9HA 2KQ9A 1ZHYA 5B1AC 3ZQVA 1Q0MA 1NFNA 3B9QA 1GM5A 3QZCA 5BQHA 3U2LA 1FNTc 1L7CA 1NZEA 3E70C 2A6HF 2HV6A 1EI7A 1LS1A 4RBNA 2R02A 5JP7A 3AOUA 3W4YA 3C7JA 4XPWA 4O6MA 3W2WA 3FAPB 4U5FE 2FFHA 3MX3A 5AC4A 2V26A 2VCCA 3IQ6A 1U0BB 1YYJA 4KNVA 1WTYA 2EILC 1JPNA 3JCUQ 1TR2A 2EPNA 3R2PA 4H4KC 1M2VA 2WL8A 1Z63A 2ETSA 2FAPB 3U3FA 1YYXA 1A7VA 4IARA 2W4BA 1IZMA 5DS4A 3Q6MA 1TQGA 5EK0A 3EG9A 3EPVA 1CGOA 5E3CA 3BEHA 2YEVA 2KK1A 2YL0A 5A6BA 5B1BC 2P1AA 3J06A 3QMKA 2P7VA 4YL1A 2MYSA 2W45A 4K7BA 4GQHA 3B0UX 4A4AA 2QY9A 3HLZA 4CX9A 3ZSUA 4YJWA 5L3VA 2LP4A 2HSQA 3M4BA 1YA9A 3G4XA 4CDYA 2WB7A 4N06A 2P6VA 3RVYA 1KNYA 3O10A 4G7OF 3S28A 4BJ6A 1Q0GA 1KU2A 5F5HA 3AQCA 1RMVA 1J8MF 1VYKA 3AGTA 1ST6A 4L6RA 4CS7A 4BEMJ 1V74B 1Z23A 3RQGA 5KYWB 1D1AA 3UMKA 1JPJA 1H6GA 5CI9A 1R5ID 1ORYA 3L0IA 4MVOA 1APCA 1M6TA 1BR2A 1OW7A 4DXWA 3C62A 3GM3A 1YZAA 4YL0A 2B0JA 5JUAA 5FCLA 3RQFA 4ULWA 4ZLDA 3ZTZA 1FTSA 2CGEA 2LSEA 3C8ZA 3UGPA 5COFA 2QUPA 2TMVP 1B68A 2HKVA 3NMIA 3SNHA 3RH3A 3LJBA 4C7OB 3WODF 1M56C 1PV3A 5JSLA 2DB4A 3K1IC 4YL3A 3VM6A 4ANJA 3DKAA 2IBFA 2YLDA 5KYYB 1OW8A 3HKKA 4PJNA 1E86A 2VASA 1OKKA 3EQLF 5B3IA 5IY5C 4LACB 4XEFA 4HFKB 4JTCB 4W8KA 4D4NA 5JLIA 1O87A 3LESA 3M1CB 3HNJA 1FFHA 3GM1A 4AE4A 4EHPA 3NKDA 1A41A 1JAFA 2FGYA 4OIOF 5KYWA 3TJ6A 3VF0A 1WATA 2HZ8A 4IAOA 2XM4A 3GWLA 1ZHWA 4MS2A 2D4UA 3C8GD 2J46A 4MTOA 2YLGA 4N6CA 1LI5A 4J30B 5FZTA 4NTAA 5T1DB 5HSWA 3FAJA 3U3BA 1NG1A 4CS8A 5DQTA 1ZVZA 3LLIA 5D91A 4JTAB 4P6IC 5GPGB 2R7XA 2XLHA 1AUEA 4OD5A 1MNEA 4O6YA 3A11A 4U5EE 3K6BA 2GDCA 4Z9JA 2RD9A 3GODA 3KL4A 1OCRC 3ABLC 3PDMP 1Q0FA 4C7OA 1EKYA 1FR0A 3TK0A 4I1OB 3HTKC 1YAUO 4E7SA 3LEOA 5KYYA 2Q9BA 1DOWA 1LIHA 2WVNA 5KYUA 1Z6AA 3RFYA 2OEVA 1YLMA 2BL2A 4IAQA 2AWYA 5L0JA 3T6JA 2L9JA 1JR8A 4BPMA 2R7UA 1CPQA 4G78A 2L6HA 3IEEA 3S90A 3K7DA 3ECSA 1H9TA 1FFTC 2KYHA 1Y4CA 3EGDB 3S9OA 2R7QA 2EIKC 4MVQA 4YN0B 1TWCA 1OCCC 4JCZA 4O7GA 1S05A 2J9BA 3QW1A 1LS4A 4MVRA 3V5ZA 4AX2A 3UR3C 4JJGA 3H65A 3L8IA 3FOOA 1C03A 2NUPB 3EHNA 4ONSA 2Q00A 3U8PA 1MNDA 2I15A 2HJ3A 4FWVA 1HMDA 2WZGA 3JT1A 1V4AA 3DJUB 5COGA 1OR2A 3T4RA 3ZWIA 1EQ1A 1DOVA 2OQMA 4DBRA 3W8HA 1D0YA 2YQYA 5AGFA 4JURI 2IOQA 2A0UA 2R7RA 1WASA 5E2QA 5D92A 3DE8A 1Z5ZA 4DJ9A 3L8JA 1VB5A 1YDIA 3TD7A 4JIOA 3SZRA 4JKVA 2A0BA 4MTGA 1QZXA 4ZLCA 2HJMA 3RW0A 1G5ZA 2P0NA 2CDQA 2EPKX 3KKBA 3EGDA 4MQ9F 4G7ZF 1NU7D 5BUOA 1AEPA 1TFKB 3U0CA 1I5NA 5AC5A 3X1OA 4FX5A 1WOLA 3NKEA 3DM5A 3MFNA 1SR2A
chains in the Genus database with same CATH topology
2YL1A 1CGNA 3ZQYA 2YKZA 4NC3A 4L6RA 4WGZA 3C63A 1APCA 4CJGA 1M6TA 4EIYA 3M15A 2YL7A 3C62A 3HNLA 5JRAA 1YZAA 1E84A 5JUAA 4U9DA 3NMJA 5JS5A 3ZTZA 1YZCA 4U9EA 3QW0A 3NMIA 256BA 2YLIA 5JSLA 1NBBA 4CIPA 2YLDA 1E86A 5B3IA 4ER9A 5JLIA 4D4NA 3HNJA 3NMKA 3M4CA 5JT4A 1JAFA 2XL8A 3FOPA 1RCPA 2BC5A 2YL3A 3DE9A 1E85A 2XM4A 1QPUA 4JE9A 4IB4A 1QQ3A 2YLGA 4D4XA 3QVZA 2XLDA 3HNKA 3HNIA 4N6HA 3TOMA 1BBHA 2XLVA 2XLHA 3IQ5A 2QLAA 5JVEA 1EKYA 3M79A 3L1MA 2XL6A 4N4WA 3TOLA 3VRCA 4IAQA 4CDVA 1CPRA 1CPQA 3QVYA 1LM3B 4CJOA 4ULVA 4JEBA 3ZQVA 1S05A 2J9BA 3QW1A 2XLWA 3FOOA 4CDAA 5JP7A 3U8PA 1E83A 1MQVA 3ZWIA 4WGYA 2XM0A 3IQ6A 5AGFA 1YYJA 2XLEA 4JEAA 1YYXA 1A7VA 3DE8A 4IARA 1CGOA 2CCYA 4JKVA 2YL0A 1GQAA 2J8WA 2XLOA 2XLMA 4CX9A 3M4BA 3ZTMA 4CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL1 A;  1CGN A;  3ZQY A;  2YKZ A;  4NC3 A;  4L6R A;  4WGZ A;  3C63 A;  1APC A;  4CJG A;  1M6T A;  4EIY A;  3M15 A;  2YL7 A;  3C62 A;  3HNL A;  5JRA A;  1YZA A;  1E84 A;  5JUA A;  4U9D A;  3NMJ A;  5JS5 A;  3ZTZ A;  1YZC A;  4U9E A;  3QW0 A;  3NMI A;  256B A;  2YLI A;  5JSL A;  1NBB A;  4CIP A;  2YLD A;  1E86 A;  5B3I A;  4ER9 A;  5JLI A;  4D4N A;  3HNJ A;  3NMK A;  3M4C A;  5JT4 A;  1JAF A;  2XL8 A;  3FOP A;  1RCP A;  2BC5 A;  2YL3 A;  3DE9 A;  1E85 A;  2XM4 A;  1QPU A;  4JE9 A;  4IB4 A;  1QQ3 A;  2YLG A;  4D4X A;  3QVZ A;  2XLD A;  3HNK A;  3HNI A;  4N6H A;  3TOM A;  1BBH A;  2XLV A;  2XLH A;  3IQ5 A;  2QLA A;  5JVE A;  1EKY A;  3M79 A;  3L1M A;  2XL6 A;  4N4W A;  3TOL A;  3VRC A;  4IAQ A;  4CDV A;  1CPR A;  1CPQ A;  3QVY A;  1LM3 B;  4CJO A;  4ULV A;  4JEB A;  3ZQV A;  1S05 A;  2J9B A;  3QW1 A;  2XLW A;  3FOO A;  4CDA A;  5JP7 A;  3U8P A;  1E83 A;  1MQV A;  3ZWI A;  4WGY A;  2XM0 A;  3IQ6 A;  5AGF A;  1YYJ A;  2XLE A;  4JEA A;  1YYX A;  1A7V A;  3DE8 A;  4IAR A;  1CGO A;  2CCY A;  4JKV A;  2YL0 A;  1GQA A;  2J8W A;  2XLO A;  2XLM A;  4CX9 A;  3M4B A;  3ZTM A;  4CDY A; 
#chains in the Genus database with same CATH topology
 1G8X A;  3DI5 A;  4XPX A;  2YKZ A;  5A69 A;  1OCZ C;  3LLK A;  3T6B A;  3EHM A;  4OIP F;  1I4Z A;  2J7P D;  4MW3 A;  4WGZ A;  2DYR C;  3EZI A;  3RVZ A;  5CIV A;  4MND A;  2Y3H A;  1VLT A;  2EPL X;  4BJ6 C;  2Q3T A;  4CJG A;  1FMV A;  3AQB A;  4G7H F;  3M15 A;  3DAF A;  2IXP A;  2YL7 A;  1EA8 A;  3G50 A;  1MMG A;  2Y69 C;  1A0B A;  3NG1 A;  2Q9A A;  3H2U A;  4LLE A;  3GWN A;  5JS5 A;  4QDL A;  4EBB A;  4U9E A;  4EUK B;  3EH2 A;  1Q0K A;  4U5H A;  4WAB A;  2NSF A;  3LNM B;  2J9V A;  3EFO B;  2XRH A;  4W8P A;  1VOM A;  2KJG A;  256B A;  2YLI A;  3O6X A;  1QLE C;  4CS9 A;  1GGQ A;  1MMD A;  1L3P A;  3UNG C;  3FHD A;  2KW3 C;  5L0G A;  4CIP A;  3HJC A;  4OIN F;  4PJM A;  2GAQ A;  2EIJ C;  2YWA A;  4ER9 A;  3F47 A;  4KI2 A;  4O79 A;  2J0W A;  3NMK A;  4GYT A;  4JZA A;  2AP3 A;  3A9C A;  4U5G A;  2XS8 A;  3SP1 A;  2WVQ A;  4XEV A;  3KYJ A;  3Q7G A;  5DLJ A;  1E85 A;  3DAG A;  3WHN A;  3AG3 C;  5DS5 A;  4LDQ A;  1AVO B;  1UG7 A;  1W2W A;  2KC3 A;  2P61 A;  3AG2 C;  1PD1 A;  3JSE O;  3K66 A;  4JE9 A;  2OU6 A;  5T3T A;  2C03 A;  3NYL A;  4BG0 A;  1VK5 A;  3MYF A;  2HMZ A;  2Q4F A;  4IB4 A;  3KMI A;  4XLN F;  4D4X A;  3CSK A;  4YK5 A;  2R7S A;  2XLD A;  3GEE A;  4IGG A;  3N2Z B;  2ZXO A;  1D1C A;  3C8G B;  3IPM O;  1VTM P;  4BEJ A;  4Q7C A;  2G3V A;  2R7W A;  2AVK A;  2AU5 A;  2QLA A;  5JVE A;  2XL4 A;  1BZ4 A;  3SEO A;  3EFO A;  4AL0 A;  2R7T A;  1M57 C;  3M79 A;  3L1M A;  2Q9C A;  2XL6 A;  4N4W A;  4PR9 A;  3R7C A;  4CBE A;  1OQC A;  4CS8 C;  4DBQ A;  4X0R A;  1FMW A;  3TOL A;  1BR4 A;  4Q5S F;  1PD0 A;  1T9K A;  3S0X A;  4I1M A;  3DZA A;  3GEI A;  4BJ5 A;  1YAR O;  3N0T A;  3ZC4 A;  4CDV A;  2GFH A;  2NSG A;  3E9V A;  1D1B A;  4JC7 A;  3FDQ A;  2VB6 A;  4XQ1 A;  1V54 C;  2HMQ A;  4FES A;  4UDV A;  3ZG1 A;  3DXJ F;  3CZ6 A;  4JEB A;  3EGX B;  1WGW A;  1RKE B;  2IXN A;  4JTD B;  3Q7L A;  1TWG A;  3KH2 A;  1SMY F;  1HE9 A;  3T9O A;  1K40 A;  5E33 A;  1RKC A;  2R25 A;  3PCV A;  3CAX A;  3OWT A;  4CSA A;  1ZHZ A;  2M4E A;  5EHH A;  1F1M A;  4CDA A;  1H7I A;  1HE1 A;  1Y6D A;  2O9X A;  3GOR A;  3JTL O;  2EPO A;  3C8G A;  3RYL A;  1XZP A;  3ZDL A;  3L34 A;  1ZYR F;  4NTB A;  3OEO A;  4JW1 A;  5L0H A;  1Z7Q c;  4QI0 A;  3SXY A;  1TFO B;  4FAP B;  2J9U A;  3UMH A;  1S7Z A;  3V5Y A;  1G4U S;  2ICW G;  1NU9 C;  4JEA A;  4AK9 A;  2A69 F;  2Y39 A;  3Q6N A;  3O39 A;  4U5D E;  3T6G B;  2D5R B;  3DD7 A;  3C18 A;  2OG2 A;  5A6J A;  4PFP A;  3EH1 A;  4XWJ A;  2CCY A;  1T6U A;  4A2N B;  3POV A;  4LLC A;  2OEX A;  1GQA A;  2ZD9 A;  3B29 A;  4HFF B;  5L0D A;  2F22 A;  2ZPA A;  4EBJ A;  3WAQ A;  4BJT A;  1V55 C;  2OKU A;  3EGX A;  4Z9I A;  1NSG B;  5TJ5 E;  1RKE A;  2JPU A;  2IXM A;  2LQG A;  1QSP A;  1G4W R;  2QE9 A;  3NYJ A;  2J45 A;  2BE5 F;  1ZZP A;  1MMN A;  1VYI A;  4K0D A;  4YT4 A;  2L7A A;  2YL1 A;  4B6I A;  3BRJ A;  2YVK A;  4I44 A;  4E17 A;  1ZW2 A;  1I4Y A;  3I5P A;  1A7E A;  5BQG A;  2H7B A;  3PHF 2;  4JVS A;  1XWJ A;  1VLS A;  2M64 A;  2Y3G A;  3DWW A;  3JRT A;  2R9R B;  3C63 A;  2MWQ A;  4QI2 A;  5HV9 A;  1D0Z A;  3JYY A;  4EIY A;  2JX0 A;  1OR3 A;  3NRH A;  2Z15 A;  3H2V A;  1BR1 A;  2WZL A;  3HNL A;  4C3E A;  5JRA A;  1E84 A;  2HSB A;  2LK4 A;  3ITF A;  2GWW A;  4U9D A;  1YJG A;  4RDA A;  3V5X A;  4P9F A;  3RF3 A;  1YZC A;  2YZS A;  1UFB A;  1SZI A;  3RIP A;  2R7O A;  4BJ1 A;  2CNW D;  2H7O A;  2VCA A;  1U89 A;  2C04 A;  1M2O A;  4U5C E;  5COM A;  1OXB A;  1ZHX A;  4I3M A;  2KSF A;  3DMD A;  1ZW3 A;  4O6N A;  1K04 A;  2ZXR A;  1NBB A;  2HFI A;  1LI7 A;  2J9W A;  3GAN A;  1HW2 A;  1TWH A;  2CW0 F;  3JZ0 A;  1M2V B;  2QNL A;  2MHR A;  3OA1 A;  4JRZ A;  2NUP A;  3RQE A;  1T6Q A;  2LFF A;  3LAY A;  3IQC A;  1ORJ A;  5L0C A;  3ZVR A;  5KYX B;  1N1C A;  4C3D A;  3EG9 B;  3M4C A;  5JT4 A;  2XL8 A;  3X2Q C;  4Q4Z F;  4E7Z A;  1NFO A;  3DE9 A;  2ASR A;  5L0I A;  4LDK A;  3RKO F;  2J7P A;  1O5H A;  2E87 A;  3CQZ A;  3AJM A;  4JCH A;  1QQ3 A;  2NUT B;  2G62 A;  5E3A A;  2Q7R A;  3B0V C;  3QVZ A;  1QKR A;  3HNK A;  4N6H A;  3MYI A;  2X0C A;  3TJ5 A;  2H7V C;  3TOM A;  1BBH A;  1T6I A;  2XLV A;  4HEA J;  3IQ5 A;  3LEV A;  4YT8 A;  1Z3I X;  2R05 A;  3G4Z A;  2ZXW C;  3EZH A;  2NG1 A;  2XXA B;  5F5F A;  4XTK A;  3ASO C;  3V7O A;  1ZU4 A;  5A6B D;  1IW7 F;  2B0H A;  1T5O A;  2CYD A;  4JJF A;  3SXM A;  3U2M A;  1FAP B;  2IXO A;  2LD6 A;  3VRC A;  1CGM E;  3AGU A;  1JRA A;  1CPR A;  2JD3 A;  2YRF A;  4DRI B;  5KYX A;  1R4T A;  3KYI A;  4J7Y A;  3N24 A;  2W9Y A;  1LM3 B;  3U5S A;  2J0X A;  2PBE A;  2AWC A;  4PJL A;  3LS0 A;  3U9M A;  2YHS A;  1NLX A;  4U5B E;  2PFD A;  4ULV A;  4BJ5 C;  4J32 B;  1YVI A;  2XSE A;  4YT5 A;  4XLP F;  1T01 A;  2EPM X;  3O55 A;  2LFD A;  4F4B A;  4GEH A;  2XLW A;  3AG1 C;  4EKW A;  3S29 A;  4MVS A;  2NUT A;  1K05 A;  4P9T A;  1GS9 A;  1LE2 A;  3B0P A;  1E83 A;  4PAC A;  4AE4 B;  1MQV A;  2L6F A;  3I4U A;  4WGY A;  2R7V A;  2R03 A;  2XM0 A;  4CSA C;  3UMI A;  2XXA A;  4NCQ A;  1ZU5 A;  2ZXP A;  3PMR A;  5L0F A;  1LPE A;  2XLE A;  5K0I A;  4CIH A;  1HMO A;  5DVW A;  1BDJ B;  3SXZ A;  5KYN A;  4DVY P;  3SXK A;  2NPU A;  4E18 A;  1A7D A;  3EJN A;  2VH3 A;  1MMA A;  4DVZ A;  4MTF A;  2I8B A;  3DJN B;  2EIN C;  2V3C C;  2J8W A;  2XLO A;  1OKK D;  4K1O A;  2XLM A;  1H9G A;  4MVZ A;  3TQO A;  3W2V A;  3K1H A;  2OJQ A;  1TKN A;  3ABK C;  4KBL A;  2WZF A;  3S27 A;  3ZTM A;  4IRU A;  4NY3 A;  5DQZ A;  1KTM A;  3FXH A;  1RXQ A;  5KYU B;  2Y3B A;  1CGN A;  2RSE B;  3ZQY A;  4NC3 A;  3TUL A;  5B3S C;  1QVX A;  3JSZ A;  1C17 M;  2QTV A;  3VYW A;  1O3U A;  2HS5 A;  4MVM A;  2VCB A;  2IYL D;  4MVU A;  2OCC C;  3IQT A;  4NTF A;  3S84 A;  5DS6 A;  3ATP A;  2GA0 A;  1HY5 A;  4G0H A;  4DOZ A;  1YA7 O;  4IJJ A;  3K33 A;  5T3W A;  1RJ9 B;  3IHU A;  2PX3 A;  3I5Q A;  2LCH A;  2KGO A;  2OJE D;  2PP4 A;  3NMJ A;  2UUH A;  3QTH A;  4H54 A;  1LVK A;  3K1I A;  3UGO A;  1U6H A;  3KPH A;  1ZHT A;  3GEH A;  3QW0 A;  4R32 A;  3ASN C;  2W4M A;  3US6 A;  1TWA A;  3LS1 A;  4NQF A;  3GM2 A;  4PFO A;  4YT2 A;  1XZQ A;  3CEX A;  4LER A;  4HE8 D;  2G3K A;  3LUT B;  2A1D D;  1J8Y F;  2A68 F;  3F46 A;  4KNW A;  4AL1 A;  3SYN A;  3LNR A;  5F28 E;  4DRJ B;  1ORS C;  2DGJ A;  2WVO A;  2X51 A;  3FOP A;  3ABM C;  3FVY A;  1HW1 A;  2Y3D A;  4EWC A;  3MLG A;  1RCP A;  3WG7 C;  2BC5 A;  2L81 A;  2VC9 A;  2YL3 A;  3JYH A;  4RD9 A;  5BQI A;  4XPY A;  3VAY A;  1QPU A;  4M63 A;  4J7T A;  5L3Q A;  4EBK A;  2HV7 A;  3AG4 C;  3ZIB A;  1RJ9 A;  5CI8 A;  4E0H A;  3HNI A;  3U9J A;  2HUJ A;  2LIG A;  3W8I A;  3JRM O;  3NDB B;  4MW8 A;  1C02 A;  4YWQ A;  1JMW A;  3MBG A;  1OXK A;  4OD4 A;  1SYQ A;  2A6E F;  1WWP A;  3DM9 B;  2CNW A;  1JOG A;  4KC9 A;  4C3B A;  1OW6 A;  5A6K A;  1OCO C;  4IWB A;  1PCX A;  4OIR F;  3U8V A;  1WN0 A;  4LDR A;  2PF4 E;  3B71 A;  4CS9 C;  2IM8 A;  2XS1 A;  2KNH A;  1LKX A;  2L6G A;  2PNO A;  4WJ0 A;  2PX0 A;  4E0I A;  5EGY A;  3QVY A;  5A6A A;  2EIM C;  3NYM A;  2H8A A;  2DYS C;  1D0X A;  1SF8 A;  2OOC A;  3FMS A;  1LE4 A;  4XEK A;  4DRH B;  2UUI A;  4OIQ F;  1VMA A;  4CJO A;  1Q0D A;  4PJJ A;  4PK4 A;  2DI3 A;  1E2X A;  4Z9H A;  2KQ9 A;  1ZHY A;  5B1A C;  3ZQV A;  1Q0M A;  1NFN A;  3B9Q A;  1GM5 A;  3QZC A;  5BQH A;  3U2L A;  1FNT c;  1L7C A;  1NZE A;  3E70 C;  2A6H F;  2HV6 A;  1EI7 A;  1LS1 A;  4RBN A;  2R02 A;  5JP7 A;  3AOU A;  3W4Y A;  3C7J A;  4XPW A;  4O6M A;  3W2W A;  3FAP B;  4U5F E;  2FFH A;  3MX3 A;  5AC4 A;  2V26 A;  2VCC A;  3IQ6 A;  1U0B B;  1YYJ A;  4KNV A;  1WTY A;  2EIL C;  1JPN A;  3JCU Q;  1TR2 A;  2EPN A;  3R2P A;  4H4K C;  1M2V A;  2WL8 A;  1Z63 A;  2ETS A;  2FAP B;  3U3F A;  1YYX A;  1A7V A;  4IAR A;  2W4B A;  1IZM A;  5DS4 A;  3Q6M A;  1TQG A;  5EK0 A;  3EG9 A;  3EPV A;  1CGO A;  5E3C A;  3BEH A;  2YEV A;  2KK1 A;  2YL0 A;  5A6B A;  5B1B C;  2P1A A;  3J06 A;  3QMK A;  2P7V A;  4YL1 A;  2MYS A;  2W45 A;  4K7B A;  4GQH A;  3B0U X;  4A4A A;  2QY9 A;  3HLZ A;  4CX9 A;  3ZSU A;  4YJW A;  5L3V A;  2LP4 A;  2HSQ A;  3M4B A;  1YA9 A;  3G4X A;  4CDY A;  2WB7 A;  4N06 A;  2P6V A;  3RVY A;  1KNY A;  3O10 A;  4G7O F;  3S28 A;  4BJ6 A;  1Q0G A;  1KU2 A;  5F5H A;  3AQC A;  1RMV A;  1J8M F;  1VYK A;  3AGT A;  1ST6 A;  4L6R A;  4CS7 A;  4BEM J;  1V74 B;  1Z23 A;  3RQG A;  5KYW B;  1D1A A;  3UMK A;  1JPJ A;  1H6G A;  5CI9 A;  1R5I D;  1ORY A;  3L0I A;  4MVO A;  1APC A;  1M6T A;  1BR2 A;  1OW7 A;  4DXW A;  3C62 A;  3GM3 A;  1YZA A;  4YL0 A;  2B0J A;  5JUA A;  5FCL A;  3RQF A;  4ULW A;  4ZLD A;  3ZTZ A;  1FTS A;  2CGE A;  2LSE A;  3C8Z A;  3UGP A;  5COF A;  2QUP A;  2TMV P;  1B68 A;  2HKV A;  3NMI A;  3SNH A;  3RH3 A;  3LJB A;  4C7O B;  3WOD F;  1M56 C;  1PV3 A;  5JSL A;  2DB4 A;  3K1I C;  4YL3 A;  3VM6 A;  4ANJ A;  3DKA A;  2IBF A;  2YLD A;  5KYY B;  1OW8 A;  3HKK A;  4PJN A;  1E86 A;  2VAS A;  1OKK A;  3EQL F;  5B3I A;  5IY5 C;  4LAC B;  4XEF A;  4HFK B;  4JTC B;  4W8K A;  4D4N A;  5JLI A;  1O87 A;  3LES A;  3M1C B;  3HNJ A;  1FFH A;  3GM1 A;  4AE4 A;  4EHP A;  3NKD A;  1A41 A;  1JAF A;  2FGY A;  4OIO F;  5KYW A;  3TJ6 A;  3VF0 A;  1WAT A;  2HZ8 A;  4IAO A;  2XM4 A;  3GWL A;  1ZHW A;  4MS2 A;  2D4U A;  3C8G D;  2J46 A;  4MTO A;  2YLG A;  4N6C A;  1LI5 A;  4J30 B;  5FZT A;  4NTA A;  5T1D B;  5HSW A;  3FAJ A;  3U3B A;  1NG1 A;  4CS8 A;  5DQT A;  1ZVZ A;  3LLI A;  5D91 A;  4JTA B;  4P6I C;  5GPG B;  2R7X A;  2XLH A;  1AUE A;  4OD5 A;  1MNE A;  4O6Y A;  3A11 A;  4U5E E;  3K6B A;  2GDC A;  4Z9J A;  2RD9 A;  3GOD A;  3KL4 A;  1OCR C;  3ABL C;  3PDM P;  1Q0F A;  4C7O A;  1EKY A;  1FR0 A;  3TK0 A;  4I1O B;  3HTK C;  1YAU O;  4E7S A;  3LEO A;  5KYY A;  2Q9B A;  1DOW A;  1LIH A;  2WVN A;  5KYU A;  1Z6A A;  3RFY A;  2OEV A;  1YLM A;  2BL2 A;  4IAQ A;  2AWY A;  5L0J A;  3T6J A;  2L9J A;  1JR8 A;  4BPM A;  2R7U A;  1CPQ A;  4G78 A;  2L6H A;  3IEE A;  3S90 A;  3K7D A;  3ECS A;  1H9T A;  1FFT C;  2KYH A;  1Y4C A;  3EGD B;  3S9O A;  2R7Q A;  2EIK C;  4MVQ A;  4YN0 B;  1TWC A;  1OCC C;  4JCZ A;  4O7G A;  1S05 A;  2J9B A;  3QW1 A;  1LS4 A;  4MVR A;  3V5Z A;  4AX2 A;  3UR3 C;  4JJG A;  3H65 A;  3L8I A;  3FOO A;  1C03 A;  2NUP B;  3EHN A;  4ONS A;  2Q00 A;  3U8P A;  1MND A;  2I15 A;  2HJ3 A;  4FWV A;  1HMD A;  2WZG A;  3JT1 A;  1V4A A;  3DJU B;  5COG A;  1OR2 A;  3T4R A;  3ZWI A;  1EQ1 A;  1DOV A;  2OQM A;  4DBR A;  3W8H A;  1D0Y A;  2YQY A;  5AGF A;  4JUR I;  2IOQ A;  2A0U A;  2R7R A;  1WAS A;  5E2Q A;  5D92 A;  3DE8 A;  1Z5Z A;  4DJ9 A;  3L8J A;  1VB5 A;  1YDI A;  3TD7 A;  4JIO A;  3SZR A;  4JKV A;  2A0B A;  4MTG A;  1QZX A;  4ZLC A;  2HJM A;  3RW0 A;  1G5Z A;  2P0N A;  2CDQ A;  2EPK X;  3KKB A;  3EGD A;  4MQ9 F;  4G7Z F;  1NU7 D;  5BUO A;  1AEP A;  1TFK B;  3U0C A;  1I5N A;  5AC5 A;  3X1O A;  4FX5 A;  1WOL A;  3NKE A;  3DM5 A;  3MFN A;  1SR2 A; 
#chains in the Genus database with same CATH homology
 2YL1 A;  1CGN A;  3ZQY A;  2YKZ A;  4NC3 A;  4L6R A;  4WGZ A;  3C63 A;  1APC A;  4CJG A;  1M6T A;  4EIY A;  3M15 A;  2YL7 A;  3C62 A;  3HNL A;  5JRA A;  1YZA A;  1E84 A;  5JUA A;  4U9D A;  3NMJ A;  5JS5 A;  3ZTZ A;  1YZC A;  4U9E A;  3QW0 A;  3NMI A;  256B A;  2YLI A;  5JSL A;  1NBB A;  4CIP A;  2YLD A;  1E86 A;  5B3I A;  4ER9 A;  5JLI A;  4D4N A;  3HNJ A;  3NMK A;  3M4C A;  5JT4 A;  1JAF A;  2XL8 A;  3FOP A;  1RCP A;  2BC5 A;  2YL3 A;  3DE9 A;  1E85 A;  2XM4 A;  1QPU A;  4JE9 A;  4IB4 A;  1QQ3 A;  2YLG A;  4D4X A;  3QVZ A;  2XLD A;  3HNK A;  3HNI A;  4N6H A;  3TOM A;  1BBH A;  2XLV A;  2XLH A;  3IQ5 A;  2QLA A;  5JVE A;  1EKY A;  3M79 A;  3L1M A;  2XL6 A;  4N4W A;  3TOL A;  3VRC A;  4IAQ A;  4CDV A;  1CPR A;  1CPQ A;  3QVY A;  1LM3 B;  4CJO A;  4ULV A;  4JEB A;  3ZQV A;  1S05 A;  2J9B A;  3QW1 A;  2XLW A;  3FOO A;  4CDA A;  5JP7 A;  3U8P A;  1E83 A;  1MQV A;  3ZWI A;  4WGY A;  2XM0 A;  3IQ6 A;  5AGF A;  1YYJ A;  2XLE A;  4JEA A;  1YYX A;  1A7V A;  3DE8 A;  4IAR A;  1CGO A;  2CCY A;  4JKV A;  2YL0 A;  1GQA A;  2J8W A;  2XLO A;  2XLM A;  4CX9 A;  3M4B A;  3ZTM A;  4CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...