1GQFA

Crystal structure of human procaspase-7
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
265
structure length
265
Chain Sequence
SIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQAARGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of human procaspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-7
total genus 69
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gqfA00
3D6MA 4HVAA 1F9EA 3K7EA 3GJSA 3R7NA 5IASA 4QTXA 2H4WA 1RHUA 2H51A 2XYPA 4IEFB 3V3KA 4JQZA 5IARA 5IAGA 3R7SA 5IABA 4D3YA 5IANA 4QUIA 1I3OA 1I51A 2NN3C 4M9RA 4NBNA 2QLFA 4PRYA 4PS0A 3NKFA 3KJQA 1GQFA 2FP3A 4EHFA 4QUHA 2QLJA 3DEIA 3PD0A 4NBLA 4QUBA 2CNLA 1RHJA 4EHDA 1RHQA 4JJ8A 5IBCA 4FXOA 2H65A 2CJYA 4D3ZA 2CNOA 2H54A 4LSZA 4PRZA 3IBCA 1CVRA 4JQYA 3V55A 2HBYA 2J32A 2Y1LA 4FDLA 5IBRA 2FQQA 2C1EA 3PCXA 4EHAA 1SC3A 4QULA 4ZVOA 4N6NA 4EHKA 2CNNA 4QU5A 4QUEA 3UOAB 4NOMA 5LU9A 3H11B 1RHRA 3P45A 3H13A 4QUDA 4QUAA 3EDRA 1KMCA 3RJMA 1CP3A 1RWPA 4I1RA 1NMEA 2QL7A 2HBRA 4QU9A 4DCOA 2K7ZA 3D6HA 3IBFA 4ZVRA 5IAKA 2C2KA 4I1PA 3R6LA 4QU0A 5IBPA 1RHKA 3KJNA 4EHLA 5IC4A 5K20A 4N7JA 1RWOA 1SHJA 1QDUA 2J30A 5LU8A 2QL5A 2QLBA 1K86A 3PD1A 4ZVPA 5IAJA 1K88A 2C2MA 5I9BA 3SIPA 3GJTA 2XZTA 3ITNA 2Y0BA 4DCPA 2AR9A 1PYOA 4PS1A 5IC6A 4QTYA 3QNWA 4QUJA 3UO8B 4DCJA 3GJRA 4N7MA 4FGUA 1RWKA 3SIRA 4HQ0A 4NBKA 4N6OA 4JJEA 4AWAA 4QU8A 1RWNA 2DKOA 3DEKA 3DEHA 4N6GA 3R6GA 3H0EA 2H5JA 3OD5A 2C2ZA 2CDRA 3KJFA 3R7BA 4NOJA 5JFTA 1RHMA 1PAUA 2H4YA 4IYRA 5H0IA 1BMQA 4NOLA 3EDQA 3DEJA 4N5DA 3V6LA 2XYGA 3R5JA 1NMQA 2HBZA 3R5KA 4JB8A 4JR0A 4NOKA 4ZVTA 2XZDA 3V4OA 3GJQA 3D6FA 1RWWA 3NS7A 4QUGA 5LUBA 1I4EB 4JR1A 2CNKA 1RWVA 4ZVSA 3NR2A 2HBQA 1M72A 4AWBA 2J33A 5LUAA 4ZVQA 4EHNA 4EJFA 4JR2A 3S8EA 4EHHA 1IBCA 1F1JA 2FUNB 1NMSA 2CJXA 1QTNA 1SC4A 5IAEA 3H11A 2XYHA 1SC1A 3H1PA 1RE1A 4FEAA 1SHLA 2WDPA 4HQRA 3S70A 3P4UA 1JXQA 3V6MA 2C2OA 1RWXA 2J31A 3BIJA 4D3XA 5I9TA 2H5IA 1GFWA 2P2CA 2H48A 1RWMA 1QX3A 2QL9A 4JJ7A 4ZVUA 3V4LA 4AW9A 1NW9B 3E4CA 1ICEA 1I4OA
chains in the Genus database with same CATH superfamily
5JPCA 3E5NA 4YJKA 1XMVA 3FNFA 2IUEA 2RI6A 2YFYA 2GBLC 3DHNA 3EG5A 1FU8A 3LGAA 3PFCA 4MWBA 4OQXA 5B57C 3QVGB 1G3IA 2XYVA 1J8QA 4JEIA 3IBGA 4QGSA 1USUA 2FPLA 3B8HA 2CYAA 4DUZB 4RPHA 4JUFA 2PCJA 5LXTF 4C9BA 3LQFA 4A8HA 4YJ2A 4D9HA 3RT9A 1PIWA 5C32A 2QLJA 1TL7C 4QYXA 2O5VA 1XMIA 4G4GA 1WQ4A 3FMPB 1UBLS 4TWRA 3DOCA 2QI9F 4UFNA 5DULA 1CY1A 1PZFA 3VTZA 1QQTA 4MS3A 3RTDA 1MVOA 4KE8A 1ULTA 3NEAA 3I9KA 4LSZA 1UFRA 1QE5A 2W2KB 5FCDA 4BMVA 4YYZA 5IT0A 5B37A 4DG5A 5KNBD 3FWHA 1UUFA 4DQKA 2R6ZA 4RQUA 1TZKA 1BXGA 4KGVA 3OJFA 4IWYA 2JJ1A 4KBGA 4MV8A 1M5TA 3EFEA 3SBDA 1WEHA 1YL6A 2MTBA 3NHZA 3NONA 5EFZA 3ZZ0A 4ARZA 1UKVY 3UIEA 2QRUA 1FK8A 1T10A 2HIGA 2AB0A 4J4BA 3RSCA 3UM9A 4B6EA 2H00A 4XYBA 1BEUB 5IMSA 1V95A 4OGLA 1XDGA 4CHGA 3QP9A 3IIJA 3BS4A 1CRQA 2WAMA 3I1YA 3SKYA 2EEPA 4RCZA 3AR3A 1U8EA 4FFBB 2CZGA 2F6RA 3V32A 1IUNA 5H68A 2R47A 4DNXA 1E7QA 2FWMX 3M1LA 2IDJA 5BN4A 2O2IA 1RKXA 2QBYB 1PYOA 3B2EA 4NXNB 2HO5A 4KO8A 2V6BA 1L4UA 1V39A 2JCYA 2QPAA 3UK1A 4OYYA 1Y4UA 5DYYA 1MVLA 4E5DA 4JLWA 4LOHA 1DV1A 3LRXA 1JA9A 2OL4A 1SKQA 1R27A 1ULAA 4HJRA 4KLRA 4U7FA 2WC1A 4N40A 3WE7A 1BCRB 3D43A 4Y1FA 2FWJA 2P5YA 1FC0A 2I03A 3UH0A 1T0UA 4G65A 1TADA 4ZVLA 1G16A 1OTHA 3FOWA 4MEJA 5T3YA 4POOA 2ZR9A 4YRAA 2FR1A 1KYWA 3MT0A 1HNXB 3FTEA 4Y2VA 4EI8A 4U63A 1H8HA 1L4NA 1PG5A 5AOBA 1V48A 3MT7A 3LECA 3SZOA 1BE0A 4M8SA 3NBXX 3SX2A 2QP4A 3WLEA 1RTTA 5AW7A 4KQFA 1YZUA 2P2NA 4YIHA 1J6UA 4UW9A 4BMZA 1NGSA 3C48A 3UMJA 5REQB 3NP9A 4MWOA 3NOOA 4RIIA 4C5CA 3GLGB 1RQ2A 3D6UA 4IX9A 1JWBB 1SHZA 2H06A 2PUJA 1R9JA 3GI1A 1IATA 1PFYA 2PT5A 1KO4A 3BXOA 3DBOB 4FHDA 4BNVA 1SIBE 2VTBA 5K2MA 4OJQA 2ZZMA 1X7DA 4B3RB 1HYEA 3SS7X 5BN3B 1J1ZA 1JXMA 4AM8A 1SIUA 1J1UA 2IA5A 1ZKDA 2VIIA 3AERA 4OXNA 4I8IA 3URKA 4B4VA 4MH0R 2ZW9A 2W22A 1E0DA 1T8UA 1YR9A 4JJ7A 3ZDBA 1KEEB 1G5PA 1QGUA 4Q9HA 5AW0A 3VDQA 2F62A 2PWPA 1ULHA 3TSOA 1YRBA 3D3KA 1EBFA 1NY6A 1XALA 3WNZA 2EZ4A 2AOWA 1GUAA 3OQBA 3BRWD 5LLSA 2FSSA 1A9XB 3IV6A 5AXAA 4J0HA 1C81A 2R86A 3IUYA 1CUUA 2CLIB 3C39A 2V74B 4O8CA 4CMIA 1M0TA 2OSBA 1KEPA 2GNPA 1K3FA 3KJQA 3MUOA 5TT1A 1XFDA 5FOVA 1CWUA 4A6XA 1U9IC 4JT2A 1Z13A 3V5NA 1H3FA 1EBBA 1NW7A 3QWFA 1NI4A 2ORED 3ZHSA 4D96A 1E3EA 5K0BA 3TJZA 4Q21A 1W5EA 3BBLA 3OEHD 4X3OA 4EMTA 1XD9A 2DPMA 3AEUB 2FN7A 5DBIA 2AI3A 1SQGA 2A84A 4B6SA 4YP7A 1YRQA 5TPZD 5AMXA 4JI5B 3WMGA 5ICSA 3FNGA 2ZE6A 1C7RA 5ALXA 1Y4ZA 1C9JA 3T5MA 1JWLA 1ZPDA 1TEZA 5LKRA 4ZICA 3FRIA 4OQEA 3IP5A 5E1OA 4HNHA 1YO6A 1V7CA 4INAA 4DRXA 1E9BA 3EUEA 3G3EA 1KFEB 3LI2A 5LC1A 3UJ9A 5JEDA 1QHNA 1CDDA 5FBQB 1HTBA 1T36B 1R0XA 1Q15A 3IBFA 2P35A 3L82B 3HJBA 5C4GB 4F1JA 1FLAA 5ALOA 4W5NA 4I9UA 4I8DA 4N7JA 2Z9DA 4EABA 1XDDA 2QJFA 2IOHA 2VWHA 3IBTA 1DQSA 5I45A 1W85B 1YB6A 3NIDB 2IU3A 3BJIC 3JARB 1SIOA 1D1TA 3ONWA 4EFKA 4JDPA 1N2GA 3AR2A 3JVUA 5DYIA 3U3MA 5K99A 5H1YA 4HOYA 2BZ0A 1EFTA 1O03A 3GJRA 4RD3A 4HDRB 3R3YA 3I6BA 1QFMA 2CNWD 4OLFA 2GESA 4E03A 5JNRA 4QNNA 5KYXA 2C4KA 4PYLA 2XB6A 1TEHA 4GOMD 4JI2B 1CE8A 1WMAA 3T3MB 1OLXB 2O0MA 1AQLA 5K0TA 3AR8A 1JA1A 1QK5A 1LNQA 2X19A 1R8SA 2RSLA 3LA6A 1NNEA 2CHEA 5DGHA 5J58A 1IUOA 2GBFA 1VCIA 1BNCA 3L8DA 5DW3A 1KRWA 3PX2A 4MRSA 2XYGA 3U3OA 1L4FA 1X87A 3F6PA 4L0MA 4MUIA 5BT9A 2CVQA 3SDBA 3H5LA 3U1VA 4NCAA 1SZJG 2RH5A 1LSSA 1CUXA 4UTOA 1C0LA 4AULA 4XDHA 4J29A 3JQCA 1F14A 1SELA 5FBWB 3WOHA 5LP6B 2O3QA 1UPBA 3EPRA 3PF8A 3RGGA 4J9UE 1KZ7B 2FMIA 3EF3A 1DG9A 2C0QA 3F98A 3QF4A 4R41A 5AM5A 3RSOA 4OHRA 2FTKE 3TBKA 2PUDA 2P3OA 3EK2A 4Q4CA 3AQ4A 3IQXA 1JI0A 1H6CA 5D5HA 1QB7A 3LKBA 1L5FA 4YAUA 5ALWA 1JR3D 3PQ3A 3EGDA 2AW3A 5DXAA 4BKPA 4DJTA 1W88A 1V96A 1LI5A 5EEGA 1LK0A 1DGQA 4CMEC 4Y67A 4KI0A 1KMHB 5EKDA 1SIWA 1A0OA 1J8YF 1F0NA 1Z35A 2C7VA 4F8YA 3S99A 3PLAE 3R0ZA 4M99A 1RJFA 3LE8A 4YIKA 2XUQA 4ZRMA 2Y1GA 3A7EA 1N6LA 4ZVUA 4BLTA 2BFFB 4MKIA 1E2DA 2CVPA 1LZKA 1QORA 2YXLA 3F5FA 4OIMA 3HCBA 2WVAA 1NASA 4LDJA 1P2SA 2VDRB 2NZVG 2PQ0A 5B1HA 3TOSA 4LJ5A 3EQ7A 5J4HA 4FM9A 2P62A 1BWQA 2WJHA 1CJMA 5K45A 5AW6A 4L6CA 3LRTA 3ZV4A 4RW0A 3NKVA 2IXDA 4BDTA 1EDOA 1Y6GA 2ROQA 5EXPA 1ZGHA 1A1VA 1Q91A 1QBGA 2C77A 3HZRA 3AKZA 1RHJA 3UTDA 3MINB 1YGPA 1GZSA 1O3YA 2I34A 4XFKA 1SG9A 2WNHA 4KAAA 1YHYA 3S2IA 3N8IA 5LBTA 1HYHA 2ENWA 1FX1A 1GAJA 2PAAA 2YY6A 4MJLA 1G21E 1VPDA 2WTNA 4P38A 4D7AA 4Q4HA 5EUCA 3FSGA 4DZTA 1CD5A 1QRAA 4G9EA 1PJ4A 2I4IA 2HA5A 5KDOA 2W2PA 2UVQA 5CRIA 1O4VA 1XZQA 1XMXA 4NMMA 1BVHA 2YFQA 3WNBA 1UMCB 2QR3A 1H9BA 1QG6A 1RYEA 4D98A 4CQLB 4QYWA 2O8EB 1ZQ1A 3CRRA 3BH0A 4FEYA 1G1MA 1EGQA 3DD1A 3HUDA 2QLLA 1PJ2A 2OR3A 4WOKA 5JRJA 3MWDB 3RVJA 3H18A 5DN6D 2C58A 1UQUA 2XTNA 1LSOA 4E0BA 2Q5LA 1M75A 4Z99A 4NCKA 5IBPA 3F4KA 1WP9A 2FRDA 2VPWA 3L7DA 1I5EA 4LZLA 2X13A 2YXEA 1EFHA 4EG3A 3NBYC 4DLPA 2FK8A 3WA6A 1JHYA 2ZBRA 1XXLA 4C4OA 3PNBA 4D45A 2QLTA 4AXXA 4UHDA 3JQGA 2AW5A 3ACCA 4XD7A 1I7QB 4KCGA 2PKQP 2NU9B 3ZTWA 4ZQFA 8LDHA 4KQJA 4BKOA 5C8YB 4EVSA 4FDAA 5M34A 3NBQA 1R10A 1ZJ5A 3IBSA 3U44A 1H5QA 1SY7A 2Y2VA 2V3WA 2VAMA 3I45A 4BBPA 2HB6A 1XJWA 1VMIA 3TLGB 1T1GA 2O2EA 2WTAA 221PA 5CVJA 4QQKA 4YI3A 1DHRA 1J24A 2VF7A 3QPDA 1FJ2A 1AKQA 4G0UA 1ZD1A 1TCAA 2GCEA 2I6GA 4BASA 1BVRA 1E3QA 2Q27A 3KXPA 1F06A 4URZR 4AJNA 3LPLA 4MWTA 1UZNA 4Q3CA 3WVNA 5ICEA 2P2YA 1U2TA 2X9GA 3EGXB 1XX6A 3R3JA 3MEQA 4A6PA 3LT4A 3TVTA 4M98A 1XCPA 2YWRA 1U0NA 2E4UA 2YJGA 3T3GA 1PKXA 3CMCO 2Q3DA 3H5VA 1L7OA 3AF2A 1P44A 1YDFA 3C85A 3OAAD 3UXMA 3H16A 2I29A 1PV4A 4AMYA 5DBEX 3VZQA 5KVAA 4MVJH 1YQUA 3QU2A 3QY0A 4E5VA 4HQRA 1RXSA 1G5QA 1TZMA 2PJDA 1HEUA 1YR6A 4PC6A 1O95A 5EESA 1ACJA 2O1EA 5L6LB 4RELA 3FWNA 3TMAA 1N34B 1Z5OA 3ASZA 5I9TA 2BSQA 1LEHA 1SXJC 4P81A 1UEJA 3FWKA 4DEYA 5IEBA 3QM1A 1Y4DE 3MIZA 3WL6A 4DEVA 1ZU4A 3N2GA 1E2BA 4GI7A 3GH1A 3DMTC 1Y37A 4OG2A 4AG3A 3W79A 1C7EA 5TARA 2IVZA 3BMOB 1MQ9A 2V54A 5KHLB 1L7NA 1GITA 3KFVA 4WESB 1TQHA 1A97A 3WLHA 4B80A 4F92B 3OVMA 2EHDA 4OCZA 2VP6A 3NTVA 4B7ZA 2GBIA 3FNRA 3L8ZA 4GR5A 1PR5A 1GNTA 1X86B 3OZIA 5E9JA 4CEJA 3L6OO 1TJPB 2PLFA 2CYCA 3LSTA 4IF6A 1BMDA 1EGMB 4LHWA 5JYEA 1YQGA 4DEXA 1ORWA 2WTUA 3QVTA 1VRWA 1OWPA 1I3MA 3OKPA 3STXA 1OGJA 4DT1B 2H5LA 3I9MA 4UVGA 3HO1A 3RS2A 1GZDA 2PL5A 1HQDA 4IFIA 4PGGA 1S96A 4ZYWA 1N9GA 3S3TA 2FUG6 5DWQA 1ZAYA 2JI9A 2BSXA 1TJ4A 1TAHA 3D8NA 1VCMA 2YVUA 5FBZA 2PWAA 1O9BA 3JQQA 1OR8A 3T7RA 3JD1A 3JWPA 4EK9A 3TCKA 1P0QA 5AKXA 2W2LA 1Q0LA 4B6QA 3U62A 4PC2A 1N77A 3ZCUA 4MZDA 4BNZA 3MC1A 4ZT3A 3HA5A 4KNVA 2OGSA 3R6TA 3AFMA 3MCAA 3OOYA 4G85A 4KIJA 3RC8A 5I9NA 5EGSA 2QN2A 1FU4A 1RPNA 4OYRA 5D86A 5I9BA 3ILYA 1N7HA 4WVLA 3FVRA 2ZIFA 1AJEA 4ZQGA 2GK7A 4O2BA 4ZYUA 2HQBA 1YJ5A 3NOVA 2B34A 2QVCA 1KI9A 2HGSA 1RYNA 1UJCA 4TXJA 1THMA 2YHBA 5EINA 5BV2P 3I2GA 2KBFA 4PSUA 1NZFA 1ZCFA 1I2DA 4IFBA 3ZKWA 2A9JA 4MWSA 2HY7A 3GP3A 4XWGA 5C5CA 1RJ9B 1Z2DA 1BD3A 5JMOA 3E3AA 3RUHA 2AZTA 4M1MA 3QBTA 1Z7BA 2Y1OA 3KCQA 1E2UA 3KQMA 4IH4A 5BN5B 5CCBA 2QQFA 1I0IA 1PU2A 1MAUA 2OHOA 3QIAA 2QTNA 3W2FA 1IULA 3BOSA 3PDJA 1ITZA 2Z5LA 3N1UA 1NMQA 1B1AA 3V33A 5LUBA 5CB4B 3VR0A 1MCZA 2HDHA 3C8MA 1XQ1A 5ETJA 4FI3F 1FNNA 1SVSA 4RHYA 4BATA 2CZCA 3WDLA 3C3AA 4FFVA 1D4FA 3CV3A 4P2GA 3OSZA 4PYKA 3NWOA 5G0UA 2W4QA 3PGXA 1XTPA 1L1FA 3OQJA 2W6PA 4HEA6 4C08A 3T12A 3T5BA 2AZ4A 2R7AA 4QHSA 4EJ6A 5KTMA 1FIUA 1FYXA 4C2TA 1YF3A 1TGYA 3AVQA 5JISA 3K09A 3WJ7A 1X7WA 4WXYB 1JF8A 3KHKA 3ZBPA 5E6RB 1DRWA 1QDLB 2BKAA 4H15A 4UUOA 4DQUA 2OD9A 4MGKR 1RYFA 2O05A 3BXXA 3E4CA 3UB4A 4HV4A 1M1NA 1QAQA 1U8ZA 5FNVB 4D9GA 2XKJE 1VG8A 2QM8A 3K9CA 5IMBA 2JCSA 3KQQA 3WGLA 3D0RA 4RIGA 4ZCIA 1V25A 4XIJA 5ES3A 3E5MA 2A9RA 5IARA 4F86A 1PSZA 4MYHA 3ZHOA 5IHPA 1CJUC 1EFPA 3BWBA 3OPQA 5F5NA 5K4HA 4HLUA 1O96A 2W8BA 5LP1A 2QP3A 3WGUA 1IVNA 3GG9A 3BTUA 1T6XA 1G42A 5DVZA 1P9LA 4QTYA 5G0WA 1TTHA 4KR7A 1VLLA 1IB6A 1EVZA 4WCDA 1L7EA 3X1KA 2OXEA 1G18A 3GLIA 2AOVA 1U7OA 1LLQA 2GN0A 2HREA 3I6QA 4B3GA 1X13A 4I1IA 4A0HA 3KJIA 5F1KA 3LVQE 3D8RA 4ZZ3A 1KVTA 3GGPA 1KI8A 5CITA 1PQYA 1EK0A 2FMFA 3FOEC 4JVOA 2I4NA 1DIHA 1SVMA 4CFSA 4ZAYA 4A5SA 5CDFE 1V1MB 1TJNA 4S3MA 4YWHA 4GOND 4F3CA 2HBRA 2OV4A 4GM4A 2P7HA 4DCOA 4EFNA 4HFNA 4TYNA 4ZP1A 2XDAA 5CJPA 1QF9A 2JF0A 4LVCA 1LGYA 1IPFA 2CL6X 2IW3A 1XZJA 1DWOA 2J30A 4GYKA 1KI7A 3WMRA 4MCJA 1GXSA 3FYCA 3RKRA 1OZAA 1K86A 3OWOA 1F0YA 2C95A 2GPBA 3FDFA 2LDXA 1BX3A 3BICA 4KPFC 3S8YA 4GPZA 2WWFA 4OMUA 3KK0A 4MI3A 4YASA 3EWIA 1ZVVA 3NXSA 1JB1A 1ZAKA 3EUWA 3N0XA 4N3BA 1Y8QB 3DR5A 5A62A 1DHTA 1R0RE 4NL4H 1A9YA 3N5KA 3R7FA 4BV9A 2EQBA 4MCIA 4ND7A 4TT3A 5DM60 3OE1A 1EHCA 4LQ4A 4DT1A 2ZB2A 4FEEA 2YR0A 1UF9A 2ZSJA 4XM2A 1ULZA 4L74A 3J7AC 3RDPA 5I9IA 5H4HA 1XXHE 3WGHA 4QICA 1XKXA 1OXSC 2R25B 2V5UA 3WBKA 2HK6A 3QXJA 4Y30A 3P1JA 3DKKA 2QNRA 3PYLA 3AF6A 4CEJB 4JS0A 2GD6A 1NUAA 4MW5A 4G84A 4AFNA 2RHCA 1WCXA 1YB5A 2ZT8A 2ZCVA 3NC4A 2QTCA 3Q98A 5B3JC 1O94A 1H2AS 5EMNA 4ZVQA 2WG1A 1MENA 3EPJA 3JQAB 2BFBA 1V4BA 1JXAA 1EB9A 4GPTA 3WHLA 3WGMA 5FH9A 3HKBA 1NIJA 2QGNA 3KC2A 1RT9A 1KJNA 2JBAB 3MMZA 4H2DA 3M3HA 2GRJA 4MCHA 1XNJA 4KTVE 1L7MA 5LMZA 2I71A 2H2AA 2IUYA 3ZLVA 2ENUA 2F55A 2OCDA 1ND6A 4B3SB 3B5JA 1D6SA 4O33A 4P7FA 4O4HB 2Y92A 4RM3A 3W6NA 4DV1B 2FJUA 1L9XA 4PC7A 4BJ6A 3STWA 1E5VA 1C8VB 1UBOS 1MIOB 3IESA 3EGWA 1UBRS 3KUKA 1JLRA 4ASUD 3WZLA 3CVVA 4U2EA 1Q1QA 3S2EA 4DA6A 1JR3E 2H4WA 3HCNA 4KSBA 4RF2A 4DYVA 3T4EA 4JMLA 3GUYA 3C5HA 4KDFA 3OSUA 1Q44A 5JRDS 1N5JA 1W93A 1YMUA 2O4CA 3BAZA 3CXUA 1BMTA 3G0DA 2HYDA 4FUTA 4UJ3A 4I0WB 4EF4A 2WVJA 4QOSA 3OLXA 4W4TA 5AI0A 4HUQA 2RGGA 5B53A 4C0XA 4ND5A 5FA5A 1LA2A 5AKHA 4XGNA 3SBEA 1EQ2A 3EVGA 2P69A 1F38A 1OFGA 4ENPA 1A2KC 5KYUB 4HDAA 3GEPA 2ZFUA 2Y1LA 5BVHB 2QTMA 2WT8A 3TZCA 3ZHQA 3INRA 4EHAA 4JH0A 5ALZA 4UNNA 2PGAA 1R5OA 4FGKA 1UDXA 1W5AA 4IIJF 2F64A 4UUNA 6NULA 1U5BA 2V97A 5IUKC 1J49A 4ZC8A 2DHCA 2H1CA 3FLMA 3OX3A 2QROA 4M88A 1ODJA 3IX7A 1IDOA 4MQEB 4R0MA 5TEWA 4E30A 2HJWA 5BSWA 2HPZA 5K6AC 1VMAA 3KB1A 4RM2A 4K46A 1TMKA 3KQOA 3UYLA 2XTMA 3SM9A 1KHHA 4A2PA 2H1IA 1VYHA 5JCZA 1SHUX 4G5RA 1V0JA 2J9GA 1KSHA 1Y82A 1HKHA 3BWXA 4Q19A 2X0FA 3SOPA 1UKEA 1T5SA 1WY7A 2A3NA 2C2MA 2HDNB 3OFNA 2OKCA 5L3SB 4Q39A 4UUQA 3RREA 2IYLD 10MHA 1UWVA 2RGBA 3FVWA 4OJMX 4XCVA 1XZDA 3R3SA 1YTLA 2EDAA 1ESDA 1SPXA 1B43A 3ZWKA 4KH1A 4ECEA 3N70A 4V0QA 1B23P 1ORRA 3VSBA 4PQYA 1QO0A 4R4JA 1FRZA 4XJTA 4Y2XA 1FDVA 2J9RA 3IUEA 3PQ8A 2PT7A 4OB7A 3RFVA 4XLZA 2IXAA 3W8RA 4O59O 4R2MA 4CE6A 2GX6A 2HWXA 1LWNA 1ULSA 3FI0A 4JQSA 4AY3A 3A2KA 1JU3A 3HEAA 3TZBA 4I3HA 3MG9A 2HIMA 1CUDA 4QVKA 2J7KA 1N32B 1JLMA 2ZYRA 1U7ZA 2XE4A 1XVIA 2IBSA 4F85A 5LM3A 3P2IA 5KYWA 3K9WA 5HF6A 5JALA 4CEIA 3A4TA 1TRKA 2BFBB 3OCYA 2XTAA 1NOKA 5ARCA 3NCTA 1KAMA 2H11A 5EZQA 4AZ3B 5I7VA 2PH5A 5CXSA 5KQLA 5JJIA 2I3DA 3ZV5A 5DO9A 2HPHA 2ZLBA 3FGOA 3N6XA 1WUHS 4PFJA 5TMEA 4H0NA 4C4SA 5IT9A 1D9XA 1UFOA 5LIRA 4NP6A 1GGNA 4HWTA 4O4HF 4CNQA 1S3FA 5TE9A 5G40A 2H2FA 3H1PA 1IBSA 2REQB 3MAAC 1XD2A 3DL0A 3AR5A 3KAPA 5KS2A 1PX0A 4OP3A 4R8SA 4OBWA 5H9VA 4HJXA 4MYRA 2RH4A 2CB0A 1KJYA 2ZI6A 3W6PA 4HDSB 3GJ0A 1J7KA 1KS9A 2CLSA 3DZBA 3VPXA 2IQ5A 3L40A 3K7EA 3L6RA 3QPCA 5BT8A 1NG1A 5LL6P 3DHWC 4LZOA 3MW8A 5FUXA 2BFWA 2X86A 2Z8XA 1LQTA 1HZJA 3B6JA 1UBHS 1E89A 5LXTB 4PQGA 2WZQA 4AF8A 3WYEA 1O95C 5ES4B 4CLEA 5LYJF 1PZXA 3CZPA 3DEIA 4X8OA 3WK8A 5CFLA 4LMRA 4P7GA 4EG4A 4Q4DA 1QG4A 2JNWA 4G1CA 4WJKB 4LWPA 3ON5A 2XKKA 2F59A 3ZY2A 4MKXA 5IVPA 1KI6B 2FVXA 2GTPA 2IC5A 3OTIA 5DYWA 1HH4A 2JZNA 2WKWA 2DFVA 4EI2A 1G3MA 3AM5A 2Q3BA 1PO7A 2X0KA 1V6SA 3LZ6A 1PEDA 4QULA 3LBIA 3L93A 1YZTA 5CLIA 3BXZA 3A4LA 2XUPA 2ZTUA 3C97A 4X8LA 1NVGA 2WWHA 5FPSA 3VYRB 3TXYA 3V2IA 5HQ3A 1I0ZA 3P9CA 2VQEB 2VPIA 2PHZA 1PR3A 5MDHA 4LF4B 1UWLA 3FMVA 4K9RA 4QATA 2JCXA 3L43A 3VSDA 4BQFA 4PZEA 3WIBA 1DT3A 3VO8A 1ZGAA 2ZTMA 5BSHA 1I4WA 4WA8A 1Z29A 2X22A 1KKUA 1J25A 3EMVA 4DC0A 3QGMA 1SJ9A 3C7DB 4FFMA 1Y5IA 1GGVA 4FFOA 2GT1A 1T36A 3L1IA 3S7TA 4B3BA 1KJZA 3IE0A 3JYNA 1NR1A 3L3BA 2IPAB 1GA1A 3GZNB 2XQGA 1Q1EA 3RASA 2GWRA 3UGTA 4CUZA 1U0TA 5DHUA 3FN4A 4TKUA 4DLKA 1MX1A 4XVRA 2AR7A 1T2VA 1QF6A 4CI9A 4P84A 2RK4A 4FHEA 1K06A 1UBCA 4J0DA 2IKQA 4LYEA 5ENDA 1FW8A 5L6MB 2EP8A 4YJHA 1SXQA 2WUWE 3DEHA 5DMHA 1E2FA 4TV8B 2YJNA 4M0CA 2NO6A 3CEHA 1THZA 5L95A 1V16A 4S1VA 1T9GS 2HMWA 4Y1RB 4FKZA 2WD7A 3CISA 4R2JA 3OE4A 4RU1A 1ZMTA 4R9VA 1GOTA 3VPBA 5GM2A 1NN1A 1NVMB 3GYBA 3ZDQA 1P4GA 5HK9A 4JOQA 2B1QA 5KTKA 2MSWA 2PMDA 4R81A 2XOEA 2X2OA 1VL8A 1VPLA 1NJGA 1Z3IX 1Q92A 4DYDA 4ABTA 4ZRDA 3AONB 3OOWA 4JP1A 4M0LA 3RF7A 4IILA 4CQMA 1AS2A 1NUSA 2XB9A 4TWBA 3DDWA 3WK5A 2QSUA 4CNBA 5C52B 1ST2A 3UB3A 3RIXA 5HKKA 5BPHA 4WSOA 1IY9A 3MBIA 2NZUG 4I7EA 3ZYCA 4YT4A 1L5QA 1JHPA 2WJPA 4JGBA 3U1BA 3N3AC 4QHTA 4RTLA 1GPDG 3U3KA 3QSYA 2HLDD 1PR6A 2JH3A 2WSLA 2XB2A 3WWYA 4COKA 4REQB 1Y9EA 4EITA 1Z4MA 4K9MA 2SKCA 2UUOA 4RS3A 3VNSA 5T7BA 1Y1QA 1E7RA 3DWGA 3RU9A 3NRCA 3R3XA 4ND2A 4P08A 2DHEA 4GR4A 2IDMA 1GR1A 1HQCA 4ME6A 2DY0A 5TC4A 1P19A 3RVOA 1IK4A 2ANBA 4M7OA 4D3YA 5IANA 3D3NA 1UJNA 4WQMA 1KSFX 3UG7A 2GAIA 1FX0B 2PN1A 3CUSA 3LG2A 3OM8A 2GJKA 1RMYA 3UJ6A 3CWCA 4RTJA 1U2PA 3C3PA 5AWFC 1P0IA 1RHQA 4GSLA 1WKVA 4ZJZA 5CHEA 3KEQA 3BWMA 2A5JA 2QJTA 3OE7D 2JL1A 2Y2UA 1D3AA 2YX1A 1PTJC 4D4GA 4YFVA 3WR5A 4Y2HA 5FUYA 1HDRA 4DV7B 4P9NA 3NDIA 1P1FA 5B1YA 5ALMA 4DLVA 2NSHA 3N2KB 3VU9A 4DC9A 4NULA 3ZV7A 2FEMA 2XYRA 3TVYA 4HLUC 2FW8A 5JS2A 4LBWA 1U28A 2PS9A 1IZ8A 2VP2A 4QUDA 3GQBB 4N01A 5D3MB 4D80A 5LNK6 3EDRA 1XMPA 3RSGA 5TVKA 1E2QA 3ER9A 2ZJOA 2CKMA 2CN1A 4KL8S 4WASA 3ZDYB 4TYQA 1B6RA 2IY7A 3UOWA 2HJGA 2GD1O 3JALB 2HA7A 1FUUA 1XCBA 4BGEA 4A8TA 5LU8A 4G0WA 3TNDA 1ECJA 2QLBA 1YE8A 2P9JA 3JRXA 3UKDA 4CMEA 4RKFA 2DFPA 1TM3E 4EY4A 2EJUA 1I24A 2HFKA 4N5HX 5IEJA 2BGMA 2QZJA 3DVAB 4BLPA 5F9HA 3U0BA 3R5TA 2Q3FA 4RPKA 4Z9XA 1K98A 5IC6A 4GEKA 1CERA 5BN3A 4W5QA 4XQ9A 3V48A 1L7XA 2Z8YM 1AZTA 1T2DA 3C24A 3ZD7A 1K63A 2QTBA 1E77A 3R20A 4GX1A 4LJ7A 1PWHA 1QKKA 1BCSA 4R83A 2LKDA 1H6BA 4YREA 4WBXC 3PDIA 1WCWA 5HF8A 4UMDA 1SK9A 1JYSA 1V5WA 2XGMA 2ZPAA 3B5IA 3H0EA 2F17A 5ECGC 5FKJA 5ELMA 1HT0A 4NS1A 2V4UA 3BILA 1UAAA 1ZY2A 3RD5A 1KMNA 4QJ3A 3JD3A 5JNVA 5AUQA 1BVYF 1ARZA 3V7FA 3NTRA 3VR5H 1U3UA 3H2KA 1PL7A 1EX1A 3TDKA 1NP3A 1N8TA 4PQRA 3QE4A 3VC2A 4BB0A 1NYLA 3O74A 4N4AA 4L0DA 1Q11A 4JLSA 4B33A 3O8NA 2R8EA 5K5EA 4DDHA 3MN1A 3Q7TA 4FFBA 1T4CB 4H16A 3HGTA 1VL2A 4B84A 1OWOA 4RA9B 1C50A 1RZ3A 1AF7A 4RWEA 1FZQA 1RE1A 2BMAA 4JA2A 1ZGJA 1U3FA 3KKQA 3WISA 2JGMA 1QIJA 1ECBA 2QPOA 3KTAA 4PBRA 1O0BA 4HATA 3QMPA 4U3JA 4QPJC 2VYND 4PEVA 5LZ5A 1CUAA 1MBZA 2WUGA 1KMIY 1EWTA 5DHQA 5BQ5A 3CLSD 3ZVRA 3ZG6A 2BD0A 1WZNA 4HVAA 5JY1A 4I5GA 2IYRA 1AKMA 3LKVA 4ZU6X 4QBKA 2JHAA 5EN4A 4R9RA 1PEAA 3V1NA 4QFMA 1D5WA 1NJ8A 5E3HA 3DFFA 1NX9A 2NZWA 1EX7A 1GYRA 3MTDA 4QBGB 3EEOA 1XHLA 2QD5A 4BWFB 2OAGA 5HF9A 4ABYA 1FCJA 1X7YA 2ZJ2A 2GK4A 4G4IA 5DXJA 4JWTA 3CKKA 4Q7MB 1LQUA 2IUTA 3H9JA 3S2YA 4B40A 5JASA 3CR7A 2R44A 1A9ZA 4YTEA 5KYNA 1N5MA 3M8KA 1W5FA 3CB2A 2CXSA 3ZE8A 1CEYA 5CH3A 2PRSA 1JBKA 3H6KA 1NN3A 5CA0F 4IUCS 5CXQA 1WOYA 1ZVMA 2WWWA 3A32A 1FTQA 1ZZGA 2R79A 2O52A 4YP5A 3UBTA 2KM1A 3VHLB 3WLQA 1YVEI 4QG3A 1U8YA 4KQXA 5CTJA 1K08A 4P7KA 1GY8A 2JGJA 5DX8A 1R4ZA 2G6BA 1LPNA 3R4VA 5AO9A 5A3SA 3IVGA 1U2DC 2C7BA 1MQ8B 3ICVA 5DHTA 2BKXA 3FKSD 3KD3A 4LPKA 1ZESA 1ISHA 2PZAA 4AZSA 1SRQA 4K86A 3C8DA 3CLUC 4YRKA 1AIPA 1U8AA 4Q48A 4KPEC 4RLHA 3RC7A 2BY4A 1HV8A 5FHRA 4D4IA 1P8JA 2WABA 3USZA 4RTRA 1Y8RA 4TZKA 4YP0A 4NIMA 4RXTA 1F17A 2CF5A 3LPCA 4G4JA 4U6SA 3GFFA 1U81A 5CYOA 1VKNA 1T1IA 4HWPA 3QVKA 1FVHA 5CEFA 1VJTA 2L19A 3UMSA 3K2QA 1KRXA 1Y98A 4HYEA 1FYEA 2J4CA 2BGGA 4MUMA 5CM2Z 4Z9FA 4QOHA 1PFQA 1VC2A 5EG5A 3HB9A 5J63A 4ZIRA 1EFLA 1UAGA 3E53A 4P4TA 5EHGA 5EE5B 4PQEA 1GEGA 4ARVA 5JXJA 1KWKA 4G1FA 2R7LA 5JNLA 2PJZA 4EVIA 2NO7A 1HRKA 2VDVE 2XR1A 4J3FA 4M1SA 1SUWA 1AQNA 1P73A 1DO0A 2HLHA 4PN7A 2EF0A 2W0SA 4HZGA 3NTUA 4NOJA 3W3AH 4B44A 8GPBA 4UXHA 1KK3A 3BBPA 5AM0A 1QC5A 2COKA 2VPZA 4EZEA 4UNIA 2ABWA 3JR3A 1D03A 3EGXA 4N0DA 4O8ZA 5HIJA 3WC4A 4A2WA 1BXZA 4DR1B 3IPLA 2JH9A 2YCBA 3B78A 4XQ0A 5JT1A 4TPKA 4M7PA 1LVUA 3B1XA 5G0VA 3P52A 1JQEA 2QP9X 2XMBA 1NX6A 4AWBA 1DP4A 2GEFA 4RANA 3BDIA 2VTDA 3FTNA 3X1MA 1B2RA 1E3DA 3LV8A 2XH8A 1LK5A 3ETNA 5BQ3A 1Z5PA 2O0HA 1DXHA 3DDSA 3NWJA 5AKGA 5BW8A 3JQFC 4DCVA 4IOMA 4OGFA 3LYUA 3LWNA 3W8EA 2EBHX 9LDBA 2O1SA 4RX1A 1EVJA 1KFJB 2IYVA 4WZBB 3W4IA 5JAMA 4F45A 1DEKA 3KVNA 3PFHA 4NYJR 3EPHA 2VXBA 2M1ZA 2D6FA 3CEMA 2FF7A 4FMCB 1PLJA 1T8RA 1K68A 2HEIA 4YJ3B 4QJ4A 1PNVA 2NO1A 2OBFA 1GNQA 2IZ6A 4FKMA 3KJGA 2AC7A 3H2HA 4GRAA 3E3MA 1N5RA 3OLYA 2JFBA 3R5HA 5SY4A 5IULC 1L8AA 2Z4RA 2VC2B 1EH5A 1X77A 3LF2A 5ALUA 3RUAA 3TWOA 4DSOA 2HGZA 4HGQA 3IE2A 3R75A 4V2IA 5AJVB 1R0KA 4FBGA 1PGJA 4WADA 1YQEA 1R37A 3MF4A 4W9NC 4U7TB 4UPDA 4NBNA 3DEZA 1KKLA 4UNPA 3KYBA 1M1NB 1H2EA 4RHTA 3G9XA 1ZGZA 2QZ4A 2A35A 5AUPB 4PYMA 1PJAA 2CLEB 4KWHA 3TMYA 4Z4IA 2XGJA 1LS6A 1SVNA 5EFOA 1VP9A 3CUKA 1JR6A 1NVEA 3EY4A 2NIPA 1GPWB 4RK7A 2DWOA 3QLVA 1REQB 2YVKA 3H05A 1KOGA 4F46A 3AP2A 5EHZA 3DZFA 1Z8HA 2X77A 4Q24A 2R5FA 2V0NA 2VT3A 1WP4A 2Z3VA 4ZT2A 3VYUB 4D79A 2OGUA 1CUFA 5KTNA 4FGJA 2J5BA 1G0OA 2Z57A 2Q4BA 5EIXA 3KV3O 1MTZA 2Z2ZA 1LDEA 5F2NA 5IKMA 3AT1A 3JXEA 4PCUA 1Y7LA 4KVFA 4LS3A 3DB2A 1NW6A 2HAEA 4GVXA 2JLSA 2P1DA 2XMQA 3KT3A 2F1RA 3VZSA 3F78A 3ME5A 4RD2A 8AT1A 1XL0A 3PIDA 5LZ7A 5C53B 1KQFA 3DDOA 2Q4DA 3QE9Y 1I6WA 2I4TA 2YWGA 4EUHA 4H35A 4PFSA 2X0IA 3V1YA 2VDOB 4YMGA 1N7GA 2JGKA 3F8TA 1KR5A 4GT1A 4IV5A 2ORIA 4MS4B 1LV8A 2R6R1 5CNJA 5F78A 4I81A 2A33A 4MPPA 3FCAA 4QLAA 2AC4A 3UB2A 2JGLA 1C9YA 1H5UA 2HF9A 1M2KA 1KIMA 1XTVA 3N2NA 3OCWA 5THXA 1WV0A 1DC5A 1Z6AA 2JIOA 1LPBB 1FFBA 3SLRA 4BLOA 1FDRA 2FPOA 3VJRA 3MD0A 1EESA 1FYFA 1T2NA 2N3ZA 3O94A 1WETA 3WGNA 4D46A 4RHFA 1QFJA 2VWGA 1X94A 2J5RA 2X7JA 3PNVA 4OUDA 2H5JA 1E2NA 1YK1A 5DKFA 4RMJA 5AXDA 3R24A 4LOKA 2FWPA 3E3NA 1TJ3A 2IZOA 5TS2A 3IPCA 1CLEA 1OV4A 3DF7A 5KU7A 3IHLA 5JATA 3TQFA 1CVIA 1FUYB 4L9AA 3ETDA 4DM4A 1O87A 4DR7B 2IP2A 1JDJA 1Z0JA 2D59A 2VK8A 1SG0A 3E84A 4L4RA 3ZIAD 1YJBA 2E89A 5K05A 5DNYB 2DFTA 4LWOA 4NCHA 2B69A 4DBZA 3HFJA 2PZMA 4ZZ1A 5I7RA 1SBTA 2SCUB 5BORA 2ACWA 4L5BA 5TQ0A 2Q1XA 3AP3A 1C3EA 3SC3A 1JQBA 1TM2A 5T64A 4EW2A 4H6WA 3CF6R 4GMKA 2MOKA 4XYEA 1A04A 2X0NA 4OVKA 1TCCA 2CL7X 3P7MA 1AVTA 2VCHA 2XMGA 2O8BB 1KI6A 2VHYA 4MUAA 1IHXA 1OBHA 2CVZA 4NV0A 4B2LA 4PBSA 1YR8A 3ESAA 2WFAA 1VIAA 1RRPA 4RCYA 2ZYVX 3Q8WA 3HDYA 3HABA 3N8NA 4E2YA 3VVCA 5I7FA 1A95A 3RG8A 3T3DA 1AMOA 4N9WA 4B1FA 3EDOA 5FPKA 5JPDA 3TTUA 3RU2A 5MFZA 3I09A 5J43A 4DC1A 1OWMA 1X1SA 3C43A 4IRXA 1KY2A 4N3NA 5LSAA 1PV2A 1CK4A 3PBKA 4PTYA 2CJWB 3O9VA 1S8OA 2P5TB 1P80A 4RDXA 2VI5A 4DRXB 2AUNA 3ZX4A 4MJ3A 3SYNA 3HCEA 3Q2IA 1JTVA 4MUKA 4AICA 2VZ9A 4OP2A 4YV7A 4JI4B 1QZXA 1RDFA 3ZE9A 4CR7A 5JCJD 5AVJA 4HNVA 1V6AA 2G4CA 3H5TA 1DQRA 5AJWA 3U3XA 1P6UA 4EECA 1C3JA 2NU6A 1BQEA 1KVRA 3O2NA 1ISIA 5CJJA 3MWLA 3B1FA 2VPPA 3HP7A 5HRCA 1G9XA 2AE2A 5JFOA 4J07A 3V55A 1OX4B 2NSYA 3HWSA 4MIOA 2IWHA 4MYDA 5HBGA 2B1JA 3TGWA 3JS5A 3L6DA 4NMWA 1ZMBA 2ZOSA 1HM5A 1IQUA 1CULC 4JYBA 5LPNA 3TG2A 2Q49A 3RS0A 2GQ0A 3F1KA 2HPVA 4DA9A 4EX6A 4LHYA 3H13A 2HFJA 3W3ZB 1JEQA 3ZE1B 1BXKA 5BVGA 5BVGB 1JBEA 1ZP6A 3QHAA 4R7TA 2RGXA 2TECE 4N8EA 3T7IA 3FTPA 2WYHA 2P0AA 3ND6A 1EWVA 1FRQA 2WSMA 3WWCA 1G20E 1SXJD 2E6KA 1GWNA 2IIQA 3BB3A 3P27A 2WKSA 2J9FB 2L0XA 2IJGX 1D7AA 1WDMA 4RY2A 4F3NA 1HYGA 2QG6A 2XRFA 4YCNA 5EJ6A 3CT4A 1EVEA 1JLLA 1YZVA 2BBWA 3HY3A 3VZRA 3BT7A 3DLTA 9LDTA 1N57A 4FZJA 4FX5A 2VSYA 2ZAIA 1ZXXA 3GLVA 5CXUA 2OFPA 1KU0A 4EEXA 3ACDA 4RAOA 3TO5A 1TECE 5DLPA 3X2FA 1QRSA 3GROA 4B3MB 3NBFA 4ERXA 1WR8A 4S1WA 3K9FC 4LZWA 4U2BA 2NPIA 5IXJA 1ODFA 1UC8A 4X66B 2VN8A 4AT1A 1GQRA 4UEQA 4MAFA 1ESZA 1SKYE 2BKVA 3MWDA 3V9AA 3KXKA 3F3SA 1MFZA 1YL7A 3NIGB 4V02A 5BW5A 1SCAA 1QIKA 1RI4A 4NCXA 1UDWA 3H5NA 2B7LA 4KOAA 2BZSA 4E4RA 4Q37A 2H17A 2BM8A 3NBKA 4A8JC 4PSDA 2IFTA 3T0FA 4MUYA 2PT6A 2HA2A 4ID3A 3W5HA 5M04A 1QU2A 3GA7A 3DVAA 1Z28A 2Q1SA 3ET4A 1TT5A 4WN9B 1XMSA 5JSQA 4BUJA 1QTQA 4Z0PA 2CJFA 5ALRA 2IYZA 3TSZA 1X80B 4KO4S 1NR5A 1EUCA 3HJTA 3LDGA 1B00A 1F1JA 4PHGA 4IJ6A 1CS4C 3WKEA 1A1SA 2WV9A 3N2EA 1V3TA 3QIVA 2B9VA 3NGXA 4Z8XA 4LOIA 2OYRA 3HXLA 1D6NA 4JVNA 3ZY6A 2YRXA 3RB8A 1BAPA 4ZGWA 4GMFA 2CV1A 3CRW1 3OM9A 3IUJA 3HUFA 4IRUB 4I5EA 3DMTA 3AHIA 3IUMA 1T2UA 1I1HA 4XB6B 5KNBA 4D9MA 3GN2A 4WI1A 6LDHA 4GFDA 1NVXQ 2FY8A 2Y68A 3F47A 3IVAA 3LY8A 4GWLA 1FBTA 5H9WA 1A8IA 1P4SA 4RIHA 4WZBE 4LJ8A 5E0OA 5IKOA 1D1SA 1XELA 2PWZA 1L3IA 2N47A 2PPVA 1Y3IA 1ISFA 1EFRD 3G5TA 3GLHA 4WL0A 3RTAA 4RTMA 1QVVA 4JXXA 2ZJ8A 3DONA 2ILTA 4GICA 2QIOA 5CVUA 3WYAA 4Y6QA 3RBAA 3SQMA 1XEXA 1E79D 4R1PA 1Z12A 5CFZA 1NQXA 2GYUA 2HWUA 1K6IA 2QL6A 4FVTA 1O0CA 4DRZA 2HR1A 1BXGB 2B8JA 2OO3A 3BB4A 2X7HA 4IPTA 3HR7A 5E6UB 5JS7A 3O83A 3GLUA 4E4TA 3C2QA 2XE7A 2CHQA 1UJBA 3H9BA 2ZUSA 1RR6A 1Q20A 2BFEA 2V7GA 2VJOA 1BGVA 2M6LA 3X1DA 5IPFA 4KR9A 1ZNWA 1BROA 3ONVA 4HNQA 3E35A 2XAUA 4OXRA 3KOUA 2QNBA 4GWKA 1FQOA 3HJFA 3ZU4A 1D5CA 5GV7A 4BNMA 2PX6A 3G2QA 3IP6A 2PLNA 3X3HA 3AF1A 2NTNA 3EXAA 1Q7CA 5AI4A 4CXMA 2ZJ4A 4HS9A 2XOXA 1DOAA 1U7WA 2JAXA 4IR7A 3R5XA 3RO7A 1ZN7A 3DFMA 4JUIA 1J5PA 1P3DA 2J3HA 2XRMA 4M1TA 5IX8A 1T1JA 3ZHYA 1U98A 3AY7A 4I1UA 1R3UA 2GF0A 3OTWA 3VR4D 2O7SA 3UHFA 1T5LA 1WBJB 2PK3A 5FORA 5TSDA 2FG6C 2DRIA 3VPCA 5LMUB 1MGPA 3EPLA 1SZPA 4IZHA 4NZYA 5FDFA 1U65A 4HGPA 4CKBB 2PUGA 1BSVA 4GQBA 4P1ZA 4PS1A 4EQZA 2YIMA 1M6NA 1L7BA 2TYSB 3UW1A 5G1OA 4BNTA 1VE5A 4A91A 2C96A 2FWAA 3BWCA 4LAFA 5IDXA 1J00A 3ZK8A 1EB8A 2DQ4A 1PJ3A 1VOTA 2JIQA 3U7QB 3O8DA 1HLPA 1GRQA 3B1ZA 4DR4B 3AKDA 5JYBA 1JLSA 4ND8B 4I4LA 4UQPA 1T1SA 2B7CA 2P3SA 4TTIA 1UPTA 3NG1A 4TMXA 5FFMA 3ZE6A 3D7SA 3P2JA 1OXVA 4EYSA 4QRDA 3SHOA 1E8NA 4JJ4A 2D0PB 5HK8A 3ZH9B 1A9SA 4CKZA 4Z53A 3RVKA 4MDFA 2C3UA 1NXSA 1NL3A 4MA5A 4EHNA 3AHDA 1QIFA 3BE6A 4TLEA 2ZVQX 4ND4A 1SZDA 2JA1A 5FOTA 4RZ2A 5DGTA 3BAFA 3WI7A 4DLXA 4LMAA 1DX6A 2HBQA 1E1LA 2NUPB 3AUYA 3HWWA 4CIWA 4NHOA 2C2XA 1J8VA 3G59A 4E5MA 3CH7A 1HFJA 4W7HA 2PVSA 3RHSA 4RPCA 4HB2A 4F04A 5G2OA 4UBLA 3NEJA 1Q21A 2VUTA 3B36A 3DBHA 3KLMX 3RNLA 1W4BA 2WA1A 2PUFA 1A5SB 1GU0A 2YJTD 5A5GA 4B09A 1E63A 1Z25A 3GFSA 3OPMA 4Q9AA 2FMHA 3ST7A 4GSYA 3AVVA 3DC2A 1TNDA 3RI3A 1NYRA 4RKWA 4F72A 1B6GA 3JQ9A 2PGIA 4IV8A 2FZEA 4KX3A 2XDQB 5DASA 4I1OA 2X5XA 4EPRA 4F06A 2C7OA 1XPUA 1T8WA 3QFHA 4JBGA 3PFGA 3N86A 4HRAA 1XZ8A 1IY2A 1A4RA 1RI5A 3D4BA 5D3QA 5DNUA 3K53A 5CIWA 4C0AC 4K3VA 3OX4A 5DM1A 4GX0A 5JSYA 4AK9A 2DM6A 2O0KA 1H3NA 3HDJA 4IIDA 4M0DA 3FVTA 4PZUA 1C3XA 1R6TA 4QUIA 4MOWA 2ISCA 2VL7A 3M2PA 4JX8A 5L4NA 1WEKA 3M49A 2XDWA 1FZTA 3NH6A 4I66A 3F67A 4ZEMA 4RK4A 2FPMA 3MYYA 3HNOA 4JASB 4CWAA 1YZQA 3T0GA 2JKYA 2C9CA 1HO3A 4IJUA 2IEBA 3LO5A 1IOZA 1J90A 1BS1A 1DG3A 3AUUA 3N76A 4X1KA 1U0SY 5KOHB 4KNWA 2AEMA 3HADA 5FP0A 2D1SA 5FLXA 2LCFA 1GARA 4LSGA 2GUGA 2RIPA 2Z95A 2EFCB 1D2HA 2C2GA 4NEQA 4PZZA 4WY2A 3TRJA 1GAXA 3H2BA 2K7FA 4KZKA 4ZYTA 1C9NA 2IOFA 4MK4A 1DT5A 3KU1A 2CFTA 2NUAB 3DNFA 1IZ9A 4PU0A 2XLCA 2YQ5A 3IA7A 4X93A 2NACA 4X54A 5DRYA 2OK8A 2WIDA 4D0LB 4LHVA 2JHCA 1W8DA 3JQ6A 4LHSA 3KPUA 1YUNA 3GUZA 3MS2A 2LVBA 5FUQA 3PQ7A 1JZQA 4MARA 4ND3A 1YAJA 3AHEA 2D7DA 4M46A 1GG9A 3SJ7A 4B3TB 4G81A 1T5HX 1HTWA 2JB9A 2H2GA 4OTZA 5AKEA 1P74A 1A9XA 2G5TA 2R11A 4TLAA 2YUTA 3HFGA 4DPKA 4HNSA 4LNHA 4U5QA 3ZCQA 1PR0A 4QUJA 1X0XA 4GPAA 3ZZ1A 2R2GA 1ABFA 1QHFA 4Z7JA 3IH5A 3FOBA 3JW8A 3ETHA 4HR7A 4KMMA 1TM1E 3NETA 5I4BA 2GJAA 1WDKA 1AGPA 2PVCA 2QUBA 1P5HA 1GAWA 5FTNA 4IIUA 4E3ZA 1I7DA 4IH9A 4IGEA 3UAWA 3S2ZA 4UXJA 2YV4A 3P0JA 3VDRA 4PNPA 3EPKA 1HTTA 1QFSA 3OUUA 4B6OA 3M2TA 1K27A 2GEVA 3IQZA 3O92A 3IODA 3OU6A 4LJ9A 3ADDA 1EVIA 5JD4A 1MX5A 4F4HA 1M10A 2XOKA 2O4UX 3JQBA 3BCHA 2WNSA 3EWAA 3KKOA 1EFVB 4KRYA 4YMLA 4JC5A 1AKYA 5FWDA 4EGJA 2JANA 1T24A 4NENA 5DOVA 5C3MA 4KFCA 5JC8A 1RXIA 3QELB 5T67A 1J06A 2AKYA 2GA8A 5I3ZA 3RIYA 5JG7A 2WD9A 5TV2A 2AG6A 3WIOA 1R6DA 2EX1A 2VYVA 4NDNE 1OW3B 3LHSA 1TT7A 2CJXA 3EQ9A 2FPUA 3GLQA 5EP2A 5TXGA 1XN4A 1WD7A 3ZQ4A 4Q02A 4W63A 5BWNA 4AIIA 4NR0A 3IERA 2LR0A 3JVEA 1KIFA 3E23A 3ZS8A 2LGJA 1FMTA 5C5DA 1CQZA 1D2EA 4EJSA 3JAMA 1ZSYA 2NSJA 1Z22A 1JWAB 2WVGA 3Q9LA 2H57A 3HRKA 3T4PA 1ORTA 2W4MA 4G5YA 1HFKA 2FSFA 3FJOA 5EZSA 4DCGA 3FOZA 3FTFA 1MAAA 4GLFA 4YA6A 3GFTA 2I9KA 1W4AA 1U7XA 3DT9A 1X9GA 4MP8A 4MPTA 1NUHA 1Z8DA 1KYZA 3PL5A 2XT6A 3DTVD 1I3OA 4MRVA 5C8ZA 1STOA 1I2MA 4HTAA 3L2OB 1KFKB 3NHFA 2WSIA 4Y1RA 1S01A 1F48A 1SHTX 3GMDA 1DKNA 4P34A 1Y6ZA 4GGOA 4L27A 5DI3B 3SYLA 2CFOA 1N1EA 3FD8A 5HJEA 5KQSA 4BUZA 3AUFA 4FXOA 3GZ4A 3E05A 1XVLA 4X7RA 3LQRA 1ORDA 3M1AA 3EXHA 1T4BA 1XLTA 2IYNA 3G82C 3R1IA 1PJQA 4FHCA 1IWBB 1DCFA 5ALLA 5K3SA 3B12A 3F6EX 4Y8VA 5EKUA 1Q1ZA 2ZBPA 5DWDA 621PA 3HO6A 5FB3A 2OAP1 3AQIA 1JPVA 3B89A 3LHDA 2P5SA 4MP6A 4Q3OA 3RVLA 5HJ2A 4CZ2A 4EHKA 5JZOA 3PEFA 3UPUA 3CEJA 4ER0A 1W76A 4IJMA 4GI1A 3INGA 3L6EA 2VRWA 1G55A 4R16A 5K0JA 5JADA 2AG0A 1NXVA 1D2MA 1Z9BA 1VCHA 1HOXA 3A36A 4BN5A 3BXPA 4ALLA 4JBNA 5F2KA 4RA9A 3RWOA 3NVMB 4OXQA 3DE2X 5HKLA 5KNLA 1J4AA 3I30X 4DLSA 1TKRA 3RT1A 5EA2A 3ZWBA 1N2OA 1RYZA 3AU8A 3DCYA 5LDDC 2O50A 3S68A 1XTJA 3DEFA 1A72A 3ZUGA 5ESDA 3DSRA 1WMBA 1MIHA 3AWIA 3PHJA 1MN6A 4A03A 4Z4GA 1U80A 2FW6A 1BMFA 4CN9A 1XZCA 3B3GA 3I42A 2XUDA 2CXXA 1SOWA 1YBHA 2CXOA 1EE9A 1AURA 1EDZA 5DH9A 3UO8B 1WABA 3SIRA 3GNSA 4TMVA 4JUCA 4BP9A 3NYWA 4K6KA 5KNCA 1E32A 1ESNA 2QXYA 1T43A 3I23A 4O2BF 3VAAA 5GY7A 4EW6A 2JFOA 3BIFA 2A2ZA 2G9QA 1J8DA 2QZSA 3DKVA 2P1RA 4V0ME 3P19A 2WLTA 3NO4A 2HSJA 3W5UA 3DZDA 2AJLI 3PICA 5ESXA 1GNSA 4B6GA 3IEIA 5BRJA 2E4ZA 1T3ZA 2ZXEA 3DBRB 1KO5A 4KYIB 1MEEA 2MWMA 1HLDA 2KB0A 1UOEA 1FNBA 4MHSA 4RNCA 1RKUA 1KFBB 1Y8CA 5F98A 1DADA 4RY9A 3OHPA 1R00A 4IKPA 2ZWIA 2QUKA 3DAHA 3DO6A 2HKIA 1UOOA 3KKMA 3T54A 3WKBA 3R8FA 3EW7A 1B8UA 1H2HA 3D3WA 1IRIA 1UMCA 3EC1A 1IBMB 3BJZA 5CW2A 2NXCA 1JLHA 4R71A 4YQFA 2CLHB 3ZU3A 2PCLA 3ZGVA 1HPLA 3QBEA 4JEHA 3NOQA 5FPTA 1SHLA 1JNYA 3DE1X 4EUFA 3BERA 1E9CA 1A9TA 2XXAA 2I3GA 5KTSA 4YAWA 5A4MS 1HL7A 1SH7A 2NTYC 1U9IA 1E6LA 1Y7PA 3KJEA 3KZKA 2FSIA 4U7GA 5LZ8A 1L5KA 3Q8XB 1M2EA 1IJBA 1DKQA 1Q0UA 2HX1A 2ST1A 4RNDB 5JH7A 2R96A 4KNYA 4C7BA 2V59A 5CP8A 4AF7A 4C4RA 1NW9B 1D8AA 1X8LA 4CF3A 2EWVA 4N3GA 1MKYA 2FPGB 1FDTA 3CC8A 2FPKA 3K1AA 3MOIA 1JG7A 4X44A 1JAXA 2PQ2A 1X2EA 4EG5A 2NXNA 3O38A 3ISJA 2CMGA 3TLAA 3A2NA 3OA0A 2DJ5A 1M6HA 2XQKA 2FKAA 1Y9DA 4IAOA 3WLMA 4HBGA 4HTFA 2FP3A 2DYKA 2APJA 3BDVA 4J7UA 1NBME 3KKKA 3KTDA 1QIIA 4FFWA 2A1IA 3T41A 2I5PO 4L51A 4KGZA 4TXMA 3CLHA 2RCNA 3ZDDA 1DRJA 4U00A 3U7JA 4B48A 2HSWA 4UNRA 3EUAA 2H54A 2FWRA 1GAEO 2ZR7A 3EVEA 3F7OA 1SAYA 2FQWA 3PXBA 1NTOA 3QNMA 4BVEA 4P32A 4ACBA 1UOPA 1KA9H 1TQ8A 2ORVA 4E6EA 4GQIA 4O2LA 4HVCA 2Y4OA 1F60A 1CBUA 1X1DA 2AZXA 3JWGA 4KQGA 2NV0A 1Z6XA 3KZXA 3BFJA 1LBHA 4RGBA 3Q8LA 1ZNQO 3FRHA 1E62A 4MQBA 2DF8A 3ELWA 3ULKA 2H31A 1RYBA 2ZJZA 1HE8B 1N9GB 2Q5QA 4R1MA 1QZZA 2ORWA 5HKAA 3D6HA 3IOYA 4BJHB 4BGDA 5HFAA 4Z7NB 1BA3A 1ZLXA 2F00A 1L5HA 1R6VA 4RF4A 3MZ0A 3TRFA 3T5CA 4JSTA 2AFIE 4TYYA 4RVGA 1U90A 3RSZA 5IXYA 3PHHA 3LBFA 4Z4CA 3L1UA 1WNFA 1OLSA 2Q3EA 3FFWA 1QV7A 3WL7A 1ZM3A 2WICA 3DBLB 3SQOA 3E9NA 3ZZNA 4EJSB 4G5XA 2ZVDA 4IIFA 2VAWA 3EZ9A 5AVXA 1NBMD 1BYUA 1UFKA 2OZLB 2P6UA 2WF5A 3EG9A 3H0KA 7GPBA 5IF3A 1SBIA 2WT9A 3L7BA 3H1BA 3T1NA 4WJZA 2FHSA 9MHTA 5DLEA 5JCOC 2VQFB 5LP6C 2P40A 1MTOA 4RHUA 2G04A 1BHSA 1VJ1A 3DAYA 2I7DA 4WFIA 3SFZA 3U9SA 1NVVQ 5LD2B 1IRXA 4N12A 4IHAA 3LUCA 2Z30A 3ZKWB 5IF9A 4IGIA 5CLHA 2V9ZA 4PVCA 2XTZA 3VO1A 4EG1A 3LYLA 1OTYA 3CCBA 1TJYA 4UBOA 2UXCB 3TUIC 2X76A 1VI2A 2XZDA 3EQ6A 4KFUA 5FOQA 5KOIA 2R1VB 2NTEA 3IRUA 3PU6A 5AK3A 4D8YA 1FS6A 4ANFA 3HFSA 3UAVA 3RQIA 1GILA 5CVEA 1O97D 4UUAA 4B8ZA 1M9NA 4ER7A 2GNAA 7MHTA 3HYCA 2JA2A 3B85A 4W5HA 1DL5A 2PLRA 4IS2A 1BH6A 4RK1A 2VATA 5HEKA 2I55A 5ESWA 1WB5A 1BWSA 2I8AA 1JMVA 5ICGA 1P45A 3ORYA 1UBTS 3FVVA 4ZT7A 2ASEA 4BLWA 4FYVA 1JIUA 1ODSA 3D59A 1I3LA 2EKPA 2D2FA 1Z63A 4NZMA 1VZ3A 2RONA 3CFYA 2JAHA 4NJEB 1KZ1A 2XA2A 3IUSA 3I0MA 1IOVA 2BJHA 1YQ9A 3D4IA 2XT0A 1IEXA 1OTXA 1USGA 3P5BA 1N92A 2CE7A 4WOBA 1FFWA 4NYIQ 2BUBA 3ZR4B 5CDSA 2V6JA 2GCOA 3WWEA 1V8DA 3B3QA 4CLOB 3KWMA 3KFLA 4G4SO 3LPAA 1Z8FA 2AYYA 3ORFA 3I2JA 4U7HA 3O8CA 5L3VA 4K9DA 4IEIA 1JH8A 3E9QA 2ZM5A 2YYAA 4DWOA 1JQAA 1RHUA 4BV2A 4RHEA 1NBAA 1SU6A 3MJHA 4A7PA 1R4NB 3IDAA 4GUAA 4B7UA 1ZI6A 3WICA 4E11A 4REMA 5KTPA 2P8JA 4BX3A 2P9FA 4QUHA 4WFKA 1RXUA 4JJAA 1YOVA 2B2XA 2VDLB 4PXYA 5CX4A 1G5RA 1OIWA 5EIBC 4BFSA 1T4MA 3MWYW 4TV9F 2HCFA 2QTRA 4OQLA 1M73E 1C9MA 4XLTA 4YLGA 2EZ8A 4S35A 3NTOA 1JILA 1BWPA 4ZWNA 3ZWAA 2WOOA 2HA3A 1XOIA 2I6FA 3G5AA 3M6FA 3Q88A 4B9AA 1CZRA 1DFGA 1WW8A 2B6NA 2BF7A 3SYTA 4E12A 1V9LA 2AN4A 5JMTA 4Z2YA 5JO0A 2Z83A 3C3EA 2EF1A 4HPWA 1ZIOA 5C5EA 1EDBA 3AF0A 2BKUA 4HNTA 3A27A 1I2AA 3GZTB 1X9IA 3IXQA 3IT1A 3ZI7A 3HSKA 1QQBA 2O8VA 2WNIA 2HK7A 3OZFA 1RQPA 1PUJA 2AVDA 4RJIA 4GI3A 4J16C 7ABPA 2OOKA 2OP1A 3H5WA 4WEQA 1H2FA 1E98A 5IU6A 3DZ8A 2I7VA 3O2SB 2Z6QA 1L7PA 3Q2OA 2OQVA 2D62A 4XEHA 1VB5A 3SR3A 4G0VA 1VG0B 1XZEA 3UMRA 1OE0A 1TFRA 5L51A 1DKOA 3GJ8A 4CT0A 3GLSA 2HUNA 2AR9A 3KQYA 3L8YA 1W7AA 4KWCA 2HHHB 5IVIA 2WIAA 3LT1A 1MRNA 5TGTA 3DVQX 2WPNA 2HMYB 3NV9A 4AP5A 5K4AA 3KKZA 4WACA 4JJGA 5ALVA 4OLJA 4KXWA 4RMIA 5BYBA 1M8FA 1P1BA 2Q9CA 3QPWA 4P0QB 2FOIA 5IG2A 3BSFA 2KX7A 2QE7D 3QI2A 2Z3WA 4CRWB 4EMUA 4Z6KA 4YUYA 1CR0A 4DSZA 1X7XA 3U1TA 2OSVA 4FE3A 2Y1KA 4IWNA 4DFDA 1AD2A 3KU4A 2Q5FA 4PWZA 4TN1A 3T5PA 3ER8A 1QH1A 1G8FA 2IPMA 2VQSA 4GZMA 4JI0B 4NOKA 2JLAA 4DG9A 4UOZA 1PS8A 3NCHA 2VS1A 4G6ZA 2B0CA 3DHEA 3S1AB 1R18A 2E3JA 3TZ6A 4D9BA 3DW1X 1XT6A 2Q5IA 4UE6A 1CDEA 3IR5A 3E03A 3G5LA 4EPVA 3FPSA 2UXDB 4XPIB 1OLUA 4IG9A 1HY3A 3F3YA 3LTNC 2IBMA 4YALA 1NHGA 3E9ZA 3OJEA 4UTXA 4P5EA 2H5EA 1Y5NA 4GOJA 3P32A 1VBNA 3P2KA 2RGUA 1SC4A 5JAQA 1I7LA 3B2NA 3H8WA 3QUAA 3WL3A 1LZLA 3QHQA 1TMGE 1USKA 3L9WA 2VWQA 4V0OA 3UJ7A 4LI3X 1XEWX 1MGOA 3IAM1 4YC7A 2ZPTX 3P4UA 3AETB 5HILA 1R88A 2NYRA 3CPSA 2QD3A 4GOXA 1FSSA 3COYA 1S2OA 2I6TA 1ODIA 3IAUA 4PG7A 3SHFA 5K8IA 4CM1A 2GAJA 1K75A 1EX9A 3VR2D 1XVTA 1ZL2A 4ZMRA 4GKBA 1YJAA 2WU4A 3TX2A 3MTAA 5HSGA 1AS3A 3QU7A 4RKQA 1XTZA 2Z9CA 2A57A 1KMQA 2W6JD 4CDNA 5CCXA 1Z17A 2ZYAA 4JQZA 4NVRA 5EJ2A 2QT1A 4HUQB 1DLIA 2ZS8A 1R0BA 4IEEA 3SZGA 5DGIA 2A9FA 1Q16A 3O91A 1N0UA 4MR9A 4PS0A 5BN1A 1V8BA 1T15A 1TM5E 4YJ3F 1GYPA 2ZIXB 4NBSA 3E81A 3MNFA 4L5CA 4GECA 1GNLA 2PY6A 3JYHA 4NU8X 4PR0A 1OROA 3IEXA 4JLMA 4OH7A 3S2SA 4INZA 2L18A 1OYWA 2E85A 1S8NA 3G7UA 3IKVA 2W93A 4NDZA 2W2XA 5DBFA 3WRYC 3DD5A 4AP6A 4CIDA 5LXTA 3FPKA 4JKIA 1W0KD 1XK6A 3WWZA 3ZDEA 3WYBA 5K09A 3MAJA 1Z5GA 4ZO7A 2FR8C 4G8JA 1TM7E 2JFZA 1RBMA 3D8TA 4X1YB 1OVMA 4FUQA 5AK5A 1CNFA 3MLBA 1L9KA 1ML4A 3ENKA 2WP0A 5ICMA 1CUYA 4NJOA 1VPWA 4TMYA 4UTZA 4EG0A 2PKQO 5ALNA 2NSDA 2L2QA 5H82A 5B3AA 1ZGCA 4B45A 3K5WA 5AT1A 4LK3A 4J0CA 4UHEA 5HQ3B 2QAIA 3F5SA 3ZV3A 3L79A 4C7JA 2O8FA 2XAAA 4P4GA 2HTEA 3RBXA 4TVSA 2UUBB 1DMRA 4GP9A 3IT0A 2B92A 1MJHA 3HCWA 1O94C 3UAZA 4BXOA 1JVSA 2J3JA 2NAFA 3UHPA 1MXHA 2X1VA 3LP5A 4YV0A 4G41A 4J1TA 2XRZA 1UPXA 2R65A 4HDKA 4DF3A 3COJA 1EVYA 1E64A 1W36C 1HDEA 1E92A 3FFXA 3KDAA 4IOLA 2EW1A 2VZ0A 2HSZA 5HNKA 5H80A 4MVJP 1OC2A 3H3XA 1ZIPA 1XTQA 4O4IA 3PUJA 3TNLA 1QIGA 4ZQBA 5EJ8A 5FA8A 1EUCB 3ENWA 1LBIA 2YMPA 3HCDA 1S2LA 1SVLA 2DC1A 4YH1A 1JAYA 1G5HA 4C5BA 1Y8QA 1L8QA 3REQB 4IUYA 4B82A 4MWZA 1RI1A 2EERA 4TSRA 3IAS6 2JAUA 3GBVA 4LE0A 4PGHA 1E3TA 1NQ5A 4OQZA 1JPJA 3WG9A 1R8QA 2HU5A 4V24A 4D99A 3PXGA 1WXIA 4N82A 2X41A 4DSUA 2IYYA 3LQ1A 4JR2A 2VUIB 1XJCA 1LBTA 1ZH8A 3RTGA 4WHMA 1I4LD 2KWIA 1IOWA 3AIOA 3ED1A 4I5FA 1LFAA 1L4GA 3CUTA 3MJDA 4IHKA 4LI0A 5ALSA 4DNOA 1G8JA 3H3JA 5FO1A 2BMWA 3DE7X 5J2UB 3BZWA 1PQ4A 5M5BA 2DR0A 4HQFA 3W4KA 1W5TA 1SD2A 5DRTA 2I87A 1CF4A 1C3LA 1A96A 3K9BA 4LNUB 1XYYA 4M9XA 2VHWA 4IIBA 4YP6A 5CTAA 4YVFA 5JZBA 1V9CA 5G4LA 5DTJA 1CG6A 2P27A 3EXG2 4UEOA 2EIXA 4GOLD 4OL9A 5EP3A 5B5SA 2GHQA 3Q8MA 1PJRA 2WPDD 1DWUA 3K9NA 3U5TA 5DU2A 5BWLA 3S81A 4PNEA 1HSZA 2F3PA 5FBHA 2B2NA 3I6MA 1R50A 1ZCJA 2XITA 3OICA 1AHPA 2ZT5A 4C5AA 1PJCA 1FXUA 3H42B 2D54A 4XXHA 3G02A 4DTIA 4MDEA 4J2OA 5DTMA 4O4JA 4LK2A 5TS3A 1E9SA 2XRYA 3HZOA 3PWSA 1TA4A 1Z68A 3U7EB 3WIUA 4BPRA 5FYDA 4CQMD 1QCCA 4DIBA 5K6AA 1OB2A 1Q83A 2K4MA 4UZSA 1UT6A 3U4GA 5AW9A 4DUGA 2OZVA 2B37A 2G07A 5AK4A 2Y0PA 5HRUA 4RSHA 3U4DA 1PVOA 3QX3A 2JJ1D 5IVDA 2EJWA 5F3RA 5AUOB 2ZK7A 1MB0A 2HRZA 3PI7A 1L4KA 4BX2A 2Z1MA 1YUMA 5A9SB 1K97A 1Q0ZA 1QQ6A 2HMVA 3OJ0A 3IDSA 4RSGA 5HWSA 2IYTA 3WRWA 4RYDA 4K0KB 1X80A 1FNSA 1ML3A 5DW0A 1KQGA 4V3CA 1ORVA 3ICPA 1P4HA 2V7BA 1EEXB 5K0SA 3OC0A 1XZLA 2G08A 1PFVA 4IGKA 3TE7A 3CMMA 5CLGA 1U63A 1VFPA 2EXXA 2KYRA 3AL3A 3IJEB 4DLZA 4QBHA 1CP3A 2ZWPA 3AZOA 3JQDA 3U19A 1AKWA 1G20A 4IVQA 3R77A 3WX0A 2OHXA 4M38A 2DG2A 2FSPA 3NHSA 3R7AA 3VR3D 3OZDA 3NUZA 2VPTA 4PHTA 3SG0A 4MW1A 3VPGA 1RLMA 2C3MA 2P6PA 5LJIA 4IHQA 1TPZA 3VH1A 4PZ9A 2ZIWB 5K3CA 1GCGA 1I01A 1UKBA 3LNCA 3U26A 3QA3E 4TVOA 1M2WA 5C8DA 5JJKA 1AUVA 3GPDG 3KKLA 2GYWA 2W90A 2XE6A 4O3FA 4JYAB 5FTMA 3TIXB 3FBTA 1N3BA 5IM4A 5B58T 1LI7A 4TS4A 1KH3A 4CT4B 1VMDA 1P0PA 2FP4B 2WIFA 3RFFA 1OILA 3N3BC 4H7HA 4I8XA 5A3JA 2QIPA 4J1QA 4S1NA 4US2R 4C4YA 4X63A 3ZCTA 3B82A 3AINA 1D8TA 4BV8A 1IIRA 3QV2A 1GCIA 3MGAA 3STVA 2XNSA 3LVFO 3RKUA 3KSBC 1U0OC 3LCRA 5JAUA 1JFLA 1EINA 3FMIA 5L3ZA 1WV1A 3VZCA 2F1IA 3KNZA 3LBAA 1G21B 3N8KA 3DMHA 1UPAA 4GBMA 4IFTA 3UK2A 4LJRA 2FFHA 5KSWB 2O0LA 1OASA 3PC3A 3AW8A 3DXXA 1TYZA 5AJYA 5T3UA 5BVHA 2Q8PA 3R5JA 2YV1A 1OZHA 2CUNA 2QG9A 2AF3C 3DXFA 4XGKA 1HNNA 3E1GA 2R48A 1LU9A 3RV3A 1YJCA 2VBCA 2OGTA 4HQNA 5CB8A 4DY6A 1WW2A 2GSDA 2QM3A 1SKBA 2I2DA 2VF8A 3CG4A 1O95D 3VYVA 1MPTA 2XMDA 4KVAA 5HG0A 4E7PA 3ZBUA 3KETA 1IBCA 2V8OA 3EGIA 2GZ1A 3VJMA 1YA6A 2PMCA 4BGUA 4UTRA 2YVQA 3RVSA 4NENB 1HX7A 4KV7A 2IXEA 4DMGA 4LV5B 5IBQA 2DT5A 4KWEA 4HQLA 5IXSA 3AKCA 5FV7A 4CMCA 1P61B 4LF6B 3LOUA 1P1HA 1OKKD 4CI0B 3I5XA 1LPMA 4GD3Q 4OB8A 4EDHA 1Q0SA 3FNQA 4DPLA 1JT9A 2XB4A 5EIAA 4WTOA 4OGKA 2XSZA 1RM4A 2ERXA 3S1LA 5GIPE 3FLBA 4P82A 1CB0A 4PVDA 4DVGA 1XJQA 3RFCA 3N8HA 1DCTA 1K5HA 1ID1A 2A0KA 3NM4A 1U1DA 3I5MA 2ZBFA 1MT0A 2B30A 2QYHA 2X6QA 3FCEA 4MVJD 4E13A 5DM70 2ZWVA 2ZJ6A 3ADOA 3BF8A 2AF4C 2AD5A 3NHBA 4K9LA 1E3JA 2ICAA 4LVUA 4TS9A 4G89A 4BNDB 2X8BA 4G25A 2A9PA 4A2QA 1N78A 1S9HA 5FPQA 1KOLA 3TD9A 1TK2A 2WOJA 3HKEA 4H7IA 2QRLA 3SIXA 5EJGA 3IGFA 4AXBA 2ZSKA 2AT1A 3H1GA 4DIEA 5KYXB 1NUTA 3B3FA 5EP1A 1R0YA 3PJDA 5A4FS 1QTIA 2ACVA 2JGFA 4OB6A 3V8QA 4ZYVA 4LJ6A 1VE1A 2NQ8A 5KOHA 4FFPA 4C0WA 3H3FA 1KC3A 4KQEA 3WLIA 3ZZUA 4CTMA 1ILWA 1L1EA 1ZU5A 1V7ZA 2O2YA 3FF1A 4AY2A 2NG1A 1AX9A 2OB2A 1D6MA 4KLZA 4HAXA 4YRCA 4DLUA 5JC1A 2QMQA 3BKXA 1VSVA 3ZX5A 2PGNA 2ECPA 2OHFA 4XFJA 2GZ2A 4S24A 1VA5A 4NABA 1GV1A 1YZHA 2EQAA 1PD0A 4PWYA 1D6JA 4HDMA 4Y2RA 3CR3C 4XTRA 3ZDFA 3PEEA 4C21A 1AKRA 1Q3KA 3NAMA 4A0SA 2Y27A 3FHCB 3QVUA 1EVQA 3EISA 1EP3B 4X92A 3U4HA 2KE5A 3F8SA 4KFTA 1YU6A 2BWJA 5AKJA 5JBNA 3A2MA 3PNYA 4MEAA 2YH2A 3QLUA 2BZ1A 3K20A 4TKVB 4U02A 5KVQA 2R6DA 4C3OB 3HKCB 2F3TA 3B1WA 7REQA 4TMWA 4FWBA 4FC7A 3MTJA 2VYCA 1DC7A 5HGJA 4F5YA 2HL6A 5JSHA 3IFSA 3DCJA 1NUPA 3QNUA 5TF0A 4I55B 3HNPA 3RYTC 1L5RA 3VM6A 1IEWA 2AQIA 3HFRA 5BSMA 2PPLA 2D1RA 4YRRA 1KDYA 4DQDA 3MTEA 1M67A 4NI5A 4B83A 1JHVA 1U7DA 3JQAD 1Q22A 1OREA 3HSYA 5G53C 2A1TR 3HH8A 2X1HA 3P9RA 3PT5A 3DLBA 5C7YA 3LX5A 1KYVA 1QVWA 2QG4A 3HA2A 3L1KA 4BO6A 4IZIA 3DEJA 4N5DA 3K1JA 2BGUA 4HWGA 3PC7A 4ENSA 4E33A 4BLRA 1GTL1 5KWJA 3I6YA 3E9DA 4IBOA 1B14A 2IZZA 2JHPA 2SECE 3AF5A 1YSCA 4JENA 5C1DA 2GEKA 3EGDB 3QH4A 1QP0A 2YFHA 1WMFA 1XHFA 4EX7A 1RJDA 4C89A 4EPXA 4Q82A 4UULA 4MHTA 2J9YB 4IHJA 3JAWA 2VP3A 2PUTA 4KODA 1P7YA 4ZQCB 5FBKA 2E49A 4QGBA 5AOVA 4ESVA 1DKMA 2P4QA 4R9SA 2FPXA 5EZYB 4KR2A 5LP6A 3TZLA 1FMLA 3IT3A 1JHZA 1Z83A 4KITB 1V11A 2WHXA 4L22A 2VT2A 3D3WB 4OKSA 4RZXA 4O2AF 4OHMA 3RU3A 5K0EA 4WXEA 4HNUA 3TECE 4R1TA 1M0WA 1RM3A 2PNFA 3ANXA 1DLJA 5FL7D 3V00A 3FMOB 5LYJA 5NLLA 5JQWA 1LDNA 3KSZO 1JIVA 2VHXA 1GQQA 1DWPA 1T0BA 1Z4NA 1G64A 2XE8A 4ND8A 3UJNA 3F3MA 3GT7A 5FAXA 1WZ2A 4J8PA 1SGWA 2NYAA 3W7BA 2ZYUX 1USVA 1DXYA 2P9EA 3LBNA 5ADVA 5KVCA 3Q7QA 1YIDA 3TAXA 4F8JA 1K8YB 3WNCA 3ESQA 2GNOA 1U28C 1S5PA 3ET5A 5IJAA 2CVOA 2PSFA 3DFZA 4CM4A 4D41A 5SY6A 1Y6FA 2ZB8A 3WB9A 1Z6TA 4PG6A 1Z34A 4HZIA 1ONSA 2PMEA 1PDWA 1GLVA 1B8OA 2EARA 3K4HA 2GLUA 1OLSB 3FSEA 3AEZA 4YRTA 3RQSA 4JFRA 1EZ4A 3OWXA 5T6BA 4CCAA 3D5EA 1Q1BA 5CM8B 2GK6A 3DF9A 5EIHA 1CY0A 2JKZA 4ISBA 5J59A 2DSNA 2MMCA 2QN8A 3IQGX 3WHIA 4MICA 4Q7EA 1FP7A 3DCNA 4YV1A 1VM6A 2QA5A 1LLUA 3M6XA 1LH0A 4QYMA 1CLUA 1H42A 2YC2C 2IX3A 4JC0A 2H3EA 1AHNA 1O6GA 1VJ0A 3PQEA 2XUHA 3VU0A 2G4LA 4KO2S 2OUIA 1YCFA 5FWYA 4QOFA 1C9EA 1TXGA 3VTFA 2BRUA 3BD6A 2R68A 3I52A 1OOEA 4PLGA 4M6WA 2Q4EA 3CRZA 2PRZA 2GLXA 2QAJA 4PPFA 4L1KA 2QVGA 4HDNA 4KXMA 1YZGA 2V3VA 1EMDA 2WAAA 4OJTA 5IDVA 5KSYA 2C3PA 4M76B 1XA4A 4Y6PA 1QVRA 3SQWA 4BBJA 4G26A 2X8AA 1HT3A 2XUIA 3LLMA 4HXFB 4PSVA 1IN5A 4X45A 3QE2A 3LO8A 2HNAA 4HGYA 4EYGA 1W5BA 2E2WA 4JBHA 4JLBA 1Z6PA 2EFGA 3BTSA 3THYA 2FLVA 5LQRA 3Q6MA 4FHGA 5KSOA 5DOZA 2OG2A 2P90A 4QYIB 4WXMA 1AGRA 2XB8A 3H1TA 3TCNA 2B7BA 2FG7C 1UM9A 3OTOB 3CVWA 4N7MA 4NZPA 3IQFA 1UJ6A 1LBSA 4HQ0A 4YP1A 2W2KA 2R84A 2ZSBA 5P8WA 5SZIA 1PJ8A 5I3CA 4FSXA 1GU1A 3MPUA 2HMAA 2VZLA 3ROZA 1OV6A 4EYEA 2FE1A 2PGLA 3LGSA 5LD2C 3IPXA 2IHUA 3O90A 2B4KA 4X6XA 5EHNA 2C61A 3H5OA 1JHMA 4CLHA 2V7UA 1MG5A 2C31A 1RHMA 2C2WA 3VNAA 4GDFA 1TYAE 4BTVA 5B7GA 3HJRA 5HCNA 2C5GA 1S8AA 3CX4A 4PZLA 3BMOA 5CLLA 3RJ5A 3M6LA 3TD6A 5KMGB 1LXCA 2AN5A 2WFLB 2M6SA 3AVWA 1CFZA 3RTBA 3OCJA 3PXDA 3FOCA 2QRVA 2AQ8A 1KZ6A 2UZ1A 4KAXA 2HQRA 3HV2A 4MX8A 5IFLA 5BSTA 3GPLA 2YN0A 3G2HA 1Q6YA 4HXYA 5ITVA 4W5RA 4YECA 3LX8A 4RVDA 3UEOA 2QE7A 1PWEA 1OJLA 1C8KA 3BHJA 2YCLA 2IYXA 1Y4AE 1T2AA 1O6BA 2Q99A 4ZK2A 4WLEA 2DQSA 3B6ZA 2FZ4A 3IP1A 1Q1GA 4GRDA 3VH2A 4PC3A 5JDIC 4K1LA 4GE0A 4ID9A 3OM0A 3GLRA 1NF3A 3EODA 3K6JA 4WFQA 2UYGA 4C3UA 4H1WA 4PLCA 5K0GA 1BN7A 1M2VA 1CY4A 5DB4A 5ALTA 4O02B 2PUBA 4FYHA 2Y6UA 5DSZA 3WFJA 5CFQA 4AKTA 5DK4A 3IHKA 1KI1A 3T8YA 4G2TA 4E15A 2ECQA 2AMFA 2ZRPA 4L8GA 2DP4E 5CT9A 3R0QA 4KGXA 4AQYB 2E4WA 3UMGA 4PG8A 2ZR0A 2BZGA 3KYJB 2OV2A 2YKGA 2C97A 3QG5A 4HH1A 2IS6A 3N7AA 4L3WA 4M60A 2IZ0A 4LRUA 1JLLB 2JIRA 3ZIAA 5KJFA 1YZNA 4BJ5A 4LQDA 4MLDA 3BL5A 3RVRA 3LSYA 1Z26A 2JAQA 5AW3A 4E1BA 1IMJA 1XYGA 2V8BA 3SF8B 4NQZA 5BV1A 5J23A 1II0A 4YAKA 5EP4A 1NNI1 3D5QA 4R54A 5B6JA 1R1DA 2ZYWX 1QGUB 2LIVA 3PCXA 3ADPA 4ON9A 4ZI7A 1E5XA 3KXIA 3LQQA 1H1LA 2P7IA 3EZ7A 1VBFA 4BCBA 3P71T 1FYVA 1RHRA 4F6LA 2O7NA 1DRKA 4P2BA 3PITA 1J39A 5I4IA 3KG2A 3VJKA 1G38A 3HVUA 1J0XO 1W1WA 1FX0A 2NUBA 2PD6A 1NY5A 5IK2A 1X15A 3WL8A 4TS1A 3EBPA 4IQFA 1OX4A 2DPXA 3HJUA 5MFPA 1GPKA 4TQUS 5HFNA 4F5ZA 1U8FO 3S7ZA 1TUEA 1KU6A 2HF2A 4V0LA 3SM3A 1GGFA 4IO0A 1U1FA 3R23A 1KE2A 1N6PA 4BQPA 5AIBA 5C18A