1GQPA

Apc10/doc1 subunit of s. cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
180
Chain Sequence
SVLVLDDRIVDAATKDLYVNGFQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOC1/APC10
publication title Implications for the Ubiquitination Reaction of the Anaphase-Promoting Complex from the Crystal Structure of the Doc1/Apc10 Subunit.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 48
structure length 180
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gqpA00
3VD7A 1UMHA 4XUNA 1CX1A 3WQBA 4DEQA 4UOJA 1JZ5A 3T0BA 3ZM8A 4XVHA 3VDBA 1H6XA 4XUQA 4LQRA 1YQ2A 4XUTA 1NX9A 3SKVA 5IYYA 1OT5A 5F7UA 4QB1A 3VD3A 4GWJA 4LHSA 4DEVA 3VDAA 1GU3A 2QQLA 1W0NA 2ZEWA 3I2FA 3JXSA 3HNMA 1JU3A 4ARYA 1GOFA 2VZ3A 1UY1A 2J1UA 2Y64A 3ACGA 4KMQA 3NJVA 4KWUA 5J1XA 3OGSA 3I2KA 3D3AA 2W1QA 1F4HA 4XUPA 2WYSA 2ORXA 3DECA 4DUWA 2BGPA 3CMGA 4RYDA 1JZ7A 2W1SA 2HYXA 1NUKA 1CZSA 1UXZA 4D8MA 2VZQA 3T0AA 1NAEA 1DP0A 2E26A 3ECQA 1WKYA 2ZXQA 2W9XA 5I0DA 2V5DA 3W5MA 2W91A 4ZXEA 4OMCA 4OZOA 5JUVA 1LNSA 5EJZB 2VQTA 3OEBA 5LCWL 2L9LA 1H6YA 4PF1A 2VZUA 4GZ9A 3WNNA 3ACHA 3U37A 2DCKA 1IQDC 2CDPA 4QDSA 1K3IA 1W9SA 2CDOA 3LQCA 1JZ4A 1J83A 3NJXA 3K4DA 1XNTA 4L0PA 3I3BA 3P1IA 1XC6A 2KD7A 3CQOA 3I3EA 4BK5A 4TTGA 3SEPA 4PQQA 3I97A 5HXMA 5B4XA 1UXXX 4ZZ8A 5LA1A 4FI9A 3HPNA 3UESA 3I3DA 3WF0A 2VL4A 3NNGA 1EUUA 4W8JA 1P8JA 3E1F1 2J1RA 2C9KA 4CUBA 2W94A 1UY2A 3FHAA 3K4AA 2YG0A 3T2OA 2X05A 4A3ZA 3I2HA 2EIDA 1TG7A 2QQKA 3DYOA 3BGAA 3ACFA 3I2GA 4A42A 3OG2A 1GQPA 4CVUA 4QDRA 1ULPA 3MO4A 1UMIA 2LS6A 5C71A 1UX7A 5JXHA 2W3JA 1TVGA 4A4AA 2J1AA 2QQIA 2RJ2A 2BBAA 3T2QA 3GM8A 4ET7A 4E8CA 2J1EA 3PUHA 1UWWA 4QB6A 2BZDA 3A21A 4P5YA 1JYVA 3HJRA 2QBXA 3LEIA 2EICA 4UAPA 2ZEZA 3OB8A 1GOHA 3WF2A 1BHGA 3HOBA 3MV11 1ULOA 2YC4A 2B4KA 2Y6HA 2YFZA 4M4PA 4ZY9A 2E31A 3MUY1 1JU4A 1O59A 5EJ1B 3ABZA 2VMFA 2JKXA 2PQSA 2Y6GA 2DDUA 4AAXA 3WF1A 5DQ0A 4CUCA 1I5PA 2W87A 4TXWA 2JE8A 2WDBA 3CIHA 4RN5A 4AG4A 3EYPA 3VD9A 2ID4A 2WAAA 4BK4A 2Y6LA 2ZEXA 1JHJA 3HN3A 1W8NA 1W9WA 1KEXA 3WF3A 5JMOA 2EIBA 2VCAA 3MV01 2VZRA 3C7OA 1UYZA 3EB7A 5DN2A 2XQXA 1UZ0A 5DPNA 2VO5A 2VZVA 3K46A 1T2XA 1DLCA 1US2A 2RV9A 1SG3A 3LPFA 4LPLA 1KGYA 4QB2A 2VMCA 4MO3M 2VZPA 3NRUA 1W99A 3IDAA 1JZ8A 1JI6A 2VZTA 3THDA 5JR2A 2R7EB 3DYMA 3DYPA 4QX3A 4DUVA 1OD3A 5LA2A 1GUIA 2ZEYA 3UETA 4DXRA 1HN1A 3IAQA 5G04L 2WN2A 4DXSA 3C7FA 5JXJA 2Z4FA 3FHQA 4IUGA 1D7PM 2HLEA 3CZJA 4PT6A 2VMDA 4Z2AA 2W1UA 4ZZ5A 2C26A 1SHWB 2BERA 2WQ8A 3WNPA 3SKJE 2ORZA 4QDQA 4A6OA 3A23A 3K75B 2VZSA 1JYXA 4W50A 4BXSV 1JZ3A 4XUOA 4OYUA 5HPOA 1F4AA 4BDVB 1PMHX 1SDDB 4JKMA 3I2IA 1PX3A 1MPXA 2XONA 4OUEA 2VC9A 2YFUA 3I2JA 3OGRA 4DXTA 1UY4A 3OEAA 4CUAA 2W46A 5FUIA 3OBAA 3WEZA 3C7GA 3HEIA 3C8XA 2VQUA 2JDAA 5A1AA 3IB3A 4JHZA 3WNMA 3WF4A 3CKHA 2YB7A 3MBWA 1PMJX 4KI5M 4MGSA 1DYOA 2QQOA 2OKXA 1W9TA 5IJRA 5IFTA 1GOGA 4E8DA 1RYYA 2E32A 3MUZ1 3WNLA 1UYYA 1CZTA 1PX4A 2J1SA 2XOMA 3HNYM 3ACIA 4CU8A 2JD9A 2VM9A 4A45A 1JZ2A 4D0QA 2VCBA 1OH4A 3VDCA 3T0DA 2Y6JA 4UI9L 4A44A 2WO2A 2WAOA 1GMMA 4W4ZA 4CU7A 4M4RA 4QX2A 4QPWA 3BN6A 3THCA 3WNKA 5G05L 5CYYA 1J84A 1EUTA 2X09A 2VJXA 2J1TA 4A41A 2VMEA 3VD4A 2BGOA 4JKKA 4ARXA 2VZOA 2WN3A 3J7HA 3OGVA 1O8SA 1O8PA 2X10A 3K77A 2QQNA 2WABA 4JKLA 2WBKA 1OF4A 2V72A 4JX0A 3C7HA 2W5FA 2VOTA 2DCJA 2VTFA 1JYWA 5LA0A 3CDZB 3ETPA 5CZKA 3T2PA 2QQJA 2W1WA 3AC0A 3WSOA 3FN9A 2J1VA 5IHRA 2WUHA 1K42A 2EIEA 2YC2A 4MGQA 1W8OA 4OMDA 5C7GA 3GGLA 1US3A 1NKGA 4P02B 2QQMA 1K45A 2WO3A 2WZEA 3LEKA 4XURA 4CU9A 3FL7A 1CZVA 3T08A 2XHNA 2V4VA 3SEEA 4XZUG 5C70A 3CZUA 1JYNA 2W47A 2C4XA 2B9VA 1WCQA 4GWIA 2W92A 4MOAA 3VD5A 1UYXA 1UY0A 1JZ6A 1R64A 3GXUA 2Y6KA 2Y8KA 5EIYB 3W5NA 4HG6B 3F2ZA 3LE0A 3WNOA 2RVAA 3GDBA 2VR4A 3UNPA 3NQHA 2LW8A 2WZ8A 2J22A 3HNBM 4MADA 4CU6A 3PUIA 1XNAA 1L7QA 1XPWA 2VZ1A 4P08A 1CIYA 4DUXA 1GNYA 3T09A 5B4NA 1OF3A 3K4ZA 3C7EA 5JXIA 4LKSA 4QAWA 5IFPA 1UY3A 3IIIA 4BJ0A 4YPJA 2J7MA 3IAPA 3P6BA 2W95A 4QX0A 1L7RA 3A22A 3A7QA 5JXGA 4P00B 1K12A 3LPGA 2WO1A 5DMYA 2E33A 4QX1A 3LEGA 2VCCA
chains in the Genus database with same CATH superfamily
3KHCA 1LGCA 3VD7A 4ZS3A 1RUC1 5CFDC 3I2DA 4DEQA 2GC2A 4LLFA 4ZONA 5CEHA 1JZ5A 3PMEA 4QHOA 1CIWA 1K5MC 3GCWA 1MEC2 3WG1A 3PTRB 1LOCA 4UFIA 2TNFA 4IXLA 1RUD2 3OBTA 4XUTA 5DG2A 4QMAA 1O5UA 1QNWA 4YM1A 2BWAA 4CCMA 4MGYE 3ZFGB 1JODA 2CWSA 1JYIA 1VRH2 4LHSA 4XTPA 1OH3A 5T55A 2ZTNA 2X29A 4AOCA 1RXGA 3DXTA 2QQLA 2NN8A 1W0NA 1EV13 1REDA 3A0NA 3I2FA 5C3OA 3JXSA 3LIGA 4LORA 1S2BA 2Y64A 5JZGC 2J1UA 1HB1A 1ND3C 2FDJA 3NJVA 4JGZB 4QPIB 4GJZA 5GALA 5J1XA 2QFEA 1LENA 3POBA 4XDOA 3D3AA 2CNAA 3N9QA 1IGOA 2ZX1A 1SEFA 5JR7B 2R0HA 3CL1A 3O7OA 4GKXA 1DGLA 2BGPA 3CMGA 1VB2A 1B35C 3PNAA 3DPRA 4RYDA 1ASJ3 1W0PA 1NCQB 1XNBA 1LODA 2BNMA 2FBEA 2HYXA 1RINA 2R043 1YQ6A 1NUKA 4XQ4A 3JD71 2GSYA 2ZHLA 4XCBA 3T0AA 3VBRC 1W8HA 4YM2A 2H0VA 4MHUA 3VKMA 5FJKA 3H8OA 2E26A 4D7YA 5FPZA 2FQPA 1WKYA 2ZXQA 3M1HA 1O3RA 1AZDA 2W9XA 3LFMA 5FMBA 3VBUB 4BU2A 5IVJA 5F5QA 2JDMA 2W91A 1W2TA 3WQ7A 4C90A 1BBT2 3NV3A 1LGBA 1ZA4A 3RSJA 4LBQB 3J8F3 2AH2A 3RWNA 4H7MA 5EJZB 4CSWA 1VBC2 4IDZA 2ZJCA 4HSJA 1HDKA 4IV1B 1UZZA 2WKKA 5CFCC 4YG3A 1V9U3 2L9LA 4I02A 2XUMA 5GKAC 4PF1A 4OI2A 4E27A 4YW6A 3TB0A 2OS2A 3ACHA 1W6MB 4LJHA 3IKWA 2DVBA 3OD4A 1CAVA 1ULDA 5JPMB 1IQDC 3CF6E 2D7FA 1R092 1K3IA 2OQ6A 3D8CA 3OTFA 1JZ4A 4COWA 2CL2A 1AR71 1XNTA 3ES4A 1YJLA 4DXZA 5T5LA 3I3BA 5AFBA 1RUG3 4NR1A 3U07A 2UURA 4QGMA 2D6MA 2HWB2 4KWLA 3ZO0B 4KU7A 1UOFA 1UOBA 2MEV3 1HV0A 2AACA 4L11A 1SCSA 2WFPA 1NLQA 3I3EA 1V70A 5FZ1A 4TTGA 3SEPA 4PQQA 4XACA 1RMU2 2IXHA 1ZZBA 3WDVA 1S0CA 4YZ4A 5B4XA 1BK1A 4HVQA 4ZZ8A 2Q1MA 4M0NA 4TZDA 1EP0A 3HPNA 3FLPA 3N35A 4C0BA 5FR3A 2W2IA 3WF0A 1HRI1 1DHKB 1EUUA 4LXLA 2FCTA 3E1F1 3LD8A 1IPKA 4E2GA 1KJRA 2VBDA 4Q4W3 5J3UA 2G4IA 2VAUA 3VBSA 5A32B 5A7NA 2X05A 2JICA 2I74A 5GZDA 5FKBA 4A3ZA 1SMVA 2ATFA 2HKXA 2HH9A 4PI0A 4UFJA 1NXMA 2JB4A 1TMF3 5ACA2 1X9PA 2HWF2 4AEDC 2XL9A 4BISA 3ZSKA 5BNNC 5FZBA 4CEYB 1COV2 1RUE3 2CYFA 2QQUA 3KQ4B 4RA0A 4XF9A 2P17A 3VKNA 3ZYIB 4WM7B 5F3GA 1HRV3 3T1MA 3HBZA 5D21A 3ZXAC 1JS9A 4C91A 3H8UA 1GZWA 3M7AA 4F3JA 3E6BA 1PZ7A 4AHYA 1G9DA 3MLLA 2J1AA 2QQIA 5JPNB 1Z7S3 3HR9A 1V6IA 1YO8A 3GJAA 4PI2A 1UW8A 5DZGA 4E4SA 5B2GB 1T6GC 2NZ9A 1OLQA 2P3IA 2ZGNA 3N9LA 1OOPA 1MS9A 3WW3A 5KWRA 1S0EA 3FC0A 2ET7A 2EXHA 3NVCA 2UYBA 3E97A 5A33A 1C3HA 3SCGA 2DVAA 4Q4X2 3WOGA 2KA3A 4KL1A 3TBDA 1X9TA 4XF4A 3VL8A 3ZXEA 5ABJC 2ZEZA 1A34A 3N9NA 2V4AA 3R05A 1MR5A 2BOIA 1K5MB 4M01A 4AR2A 1QQP1 3WF2A 4BB3A 1BHGA 1XE0A 2D97A 1ULOA 2VBPA 1QJU1 4A7KA 4Q4V2 2O1QA 4AI1A 3VBHC 1BVP1 2JWPA 2YFZA 4HK8A 5FQ0B 4BMEA 1PGL1 2E31A 3MUY1 2DWRA 2X53S 2O8QA 4O61A 4S2GA 1H9WA 5LBBA 1QF3A 3SHRA 1GBGA 1QJX1 2VMFA 4IW3A 2Q1ZB 3DGTA 3WDTA 4W65A 2DDUA 3WF1A 4NUBA 1POV0 1Q8QA 4LHKA 3OF1A 4EYUA 2XLGA 4Q8KA 1I5PA 4AG4A 2FDFA 3EYPA 1QXRA 1VP6A 1IG3A 3FUQA 3AZXA 2R6QA 1JH5A 5D8AC 1S2EA 2CY6A 4D69A 1KQRA 3USUA 1DYPA 2BP6A 3O1OA 4AK3A 2BFUS 4AFCA 1KEXA 2MHFA 1V6NA 3AP9A 4XF0A 4QQOA 3RNSA 5FZ6A 5FXVA 5FTTC 1J59A 2VZRA 2OT7A 3W58A 2XQXA 5DAPA 4PCRA 4B29A 3S30A 3BB6A 3MHZA 4CDXA 1ZZ6A 2H6CA 1T2XA 4QXHA 3BODA 2ZGLA 4K1YA 3POJA 4MXVA 5LK7B 4LPLA 2WFF3 5CADA 3POGA 1E5RA 1TME2 4PJYA 4A3XA 4QB2A 4MO3M 2D6OX 2Y34A 2VZPA 5K0UC 1W99A 4DPNA 1BMV2 1CN1A 2RS32 1FMD2 2ZZJA 2VZTA 1EY2A 1GZCA 3DYPA 4QX3A 1GKBA 1OD3A 5LA2A 2VMIA 5FYVA 4YFZA 5F1RA 4XBLA 5BUVA 2ZEYA 4Z92B 1FPN1 3DN7A 3UETA 1HN1A 2FMYA 4I0WB 2QE3A 2FCUA 2PAEA 4KBZA 3ZLIA 4U2AA 2WLQA 5FZHA 5GLVA 5T54A 4O7XA 1BJQA 1H2LA 3VBFB 2WN2A 4K20A 2Z4FA 3D5OA 1C57A 1RVF1 4WV8A 5FV3A 5FP4A 1D7PM 3RMYA 3RG0A 1QJEA 1QOSA 1DZQA 4GALA 5FCCA 4NAMA 4Y26A 2EA7A 3AXDA 3LA7A 4EQVA 2VXRA 5E8AA 2C26A 3MLKA 3WG4A 2D3RA 3PTYA 1SHWB 5L7OC 3PIJA 2WZR2 2WQ8A 1IKQA 3ZKUA 4AQ6A 2IVJA 4LO8A 3RJRA 3DV8A 3WNPA 3QLQA 3SKJE 2NYYA 4QDQA 1VR3A 4A6OA 5AFEA 5FPUA 2NMNA 3RRDA 2ZGMA 3JBG2 1JYXA 1FOD2 4GWNA 2MNGA 1JZ3A 1W06A 5DDJ2 4JAAA 4Y5Z0 2PHDA 3H7YA 5HCBA 1HB4A 4QKDA 1MPXA 5FUPA 2VC9A 3H42B 1EPWA 2ZGQA 1UY4A 1PK6C 1CJPA 4ONUA 4JZRA 5HV0A 1K42A 1AR92 1I9RA 3OBAA 5KXEA 4JTNA 1L3JA 1SBDA 4MYEA 4NIAA 5GZCA 2ES3A 2VQUA 1W6NB 2JDAA 4B3NA 3WNMA 1R1A1 3WF4A 1ENRA 2JDZA 1RUJ2 4XFAA 5IVVA 1MEC1 3I3MA 2E7AA 2RR12 4KI5M 5T50A 4NRMA 4HZFA 1RUD1 4MGSA 5FIXA 1AL21 1DYOA 4J1XA 2QQOA 2QQVA 4C1WA 4PLMA 1VRH1 1QXJA 2XGXA 4LKDA 1X36A 5FY0A 3KV5A 2ZGOA 1GP5A 5T52A 1SDWA 1RYYA 2WNVA 4QHZA 1N1SA 2B8MA 2PAMA 4COUA 4PF5A 4I30A 2YU2A 3ETQA 3OY8A 1UQXA 4FQ4A 5EJ3A 4RSUA 4FPJA 4Y20A 1HB3A 4CU8A 4TLFA 5BXXA 3OD0A 4D0QA 1MQTC 4AI8A 1JZ2A 4OUMA 3VDCA 1RUH2 2BUKA 4IEVA 4Y4RA 5LBEA 2GNDA 4AVVA 5F9TA 4DOUA 1X8EA 2WAOA 4NMIA 1W8WA 1VMFA 2VOKA 5C5TA 2WINB 2UY8A 3ZFEC 2XKOA 3WQ1A 4E4HA 3BU0A 5FKCA 4AVSA 1YYNA 4XILA 1GR3A 2W68A 2VW0A 3ZN5A 3CO2A 4J6GA 4ES8A 2X5IA 4BQXA 5T5OA 2VJXA 4GH4B 4WM8B 3TAYA 1DGWA 2Y38A 4CP2A 1V6MA 4CEWC 3VD4A 2XJTA 3INAA 1VBB2 2P4EA 5APAA 4JKKA 1Y9MA 2VZOA 2RS53 4AVAA 2BU9A 2CGNA 3VV1A 2FZ2A 3AB0A 1AYM3 3MW3A 3JZVA 1F9KA 2JG8C 3N4MA 3I3QA 1O8PA 2QQNA 2WABA 3AK0A 3B5LB 3DL3A 4N9HA 1NE4A 2V72A 4UBGA 2JDNA 3C7HA 2IFWA 4RR3B 4XFFA 1KJLA 3RGBA 4P9IA 3WVJA 2AC1A 3ZMNA 3R4UA 2VTFA 2WA4A 4RGAA 3CDZB 3ETPA 5CZKA 3O1PA 1LHUA 3DKQA 5D1IA 4IEPA 4QX7A 1R091 2I45A 3AC0A 5FLHA 3T2PA 3W59A 4YZ2A 3SITA 4E4DX 1DQ6A 3JD72 3WSOA 2WNUC 3FN9A 2EF6A 4YW5A 2ADEA 3GBGA 5K0UB 5IHRA 2ET1A 3AMQA 4X8NA 2D3SA 1DIWA 2WUHA 2OA2A 2EIEA 3AKPA 2YDEA 3AP6A 3N9MA 1W8OA 4OMDA 4P9LA 4QKBA 2WZPP 4D6QA 3GGLA 3U11A 1V00A 2Z69A 2PHRA 3TEWA 5EZWA 5LRSA 2WWSA 4MUVA 4RFT0 1AXKA 3B01A 1RMU1 1WA6X 2ZKNA 1OA3A 2CSGA 2A3YA 5LK5A 3SNMA 3TEZA 2PMWB 3RZLA 2FDGA 2CAUA 2G1MA 1ULFA 2QZ2A 2VCMA 3LEKA 4GB32 4XFGA 4XDQA 4XURA 1F15A 5FP7A 4CU9A 1DYKA 3SEEA 2GNTA 2Z42A 4XZUG 1BBT3 5F5AA 3KF5A 4XETA 4E9KA 3N9OA 4K8RB 1OLMA 2DTYA 3P3PA 2DVGA 4IERA 5LB6A 2C4XA 2A7AA 4GWIA 3V65A 1VBC3 3ZIXA 4P5HA 5I0SA 4NWVA 4Q0PA 4W6YA 5LZ6A 1PK6A 1UX6A 2RM22 4CDWA 3WDUA 3OPZA 1C5IA 4W6XA 1R082 1D0HA 1AR82 1PO13 1CPMA 1R64A 1WMDA 2HWF1 2OW4A 4YVWC 2KM2A 2RMU2 1LECA 2XJPA 1BEV3 3AP7A 3KV4A 3W5NA 1LGNA 1COV1 4IEUA 1YRZA 4GIQA 3PVOA 5GZGA 1M4WA 2WS93 3LE0A 3WNOA 2RVAA 5K8SA 1FNYA 2ZACA 1JYTA 3H1WA 2HWB3 2J22A 2GMEA 3AL6A 3ZYJB 1MVQA 2Q1FA 1W6PB 5FY9A 2Y0OA 2LM3A 2D6NA 2E7QA 1KXGA 1VB4A 2BFUL 1L7QA 4HKLA 1U5XA 1Y9QA 4DUXA 1CX4A 1ZBE2 1MS3A 1YI9A 5HI0A 1OF3A 3LOIA 5C9AC 1GP4A 2Q4SA 5IFPA 1HN0A 2AEYA 3W9AA 1QGLA 2VOVA 3IMMA 1OA4A 2JECA 2NMOA 3VHOA 1H8TB 4YPJA 4B4RA 5CBLA 2BEOA 4RQPA 4AZZA 3B9CA 4Y24A 3BOWA 3JQWA 2W95A 3PMSA 4XJ9A 3BIEA 2WRAA 3A22A 1D4M3 1LOAA 2WL1A 3AMMA 4HLTA 4P00B 1K12A 2XVLA 3NWKA 4L8QA 3GCXA 2WO1A 4WVZA 5ACA3 4NHMA 4PIXA 4QX1A 3ZYFA 3ILNA 1QEXA 3LA2A 2VCCA 3MICA 4GMP1 4S2FA 3WHUA 4LA2A 3WQBA 3ORJA 2GMMA 3IIAA 4CDUB 3O1RA 1RHI2 1VBD3 2GNMA 4Q4Y2 4XVHA 1AR63 2BVBA 4NIHA 3AKSA 1H6XA 3ZYGA 4CEWA 2PLV3 1H0BA 1HV1A 1YQ2A 2VGDA 5FZOA 1MZ5A 2D6LX 5E6HA 2R32A 2RS13 3EO6A 5A3WA 5FAXA 4NRQA 2BYVE 4OCTA 1YQ8A 4URTA 3K3NA 5HBAA 5IVEA 4OHWA 4Y1XA 3VD3A 2F4PA 2ZBJA 5FPAA 2P1BA 4DEVA 1EYBA 1OSGA 3ILFA 1E5IA 1D2QA 4N90A 3ZFEB 4XABA 5KHJA 2A75A 4FO9A 2GC0A 3SC7X 5FPXA 4FQZA 1GANA 1PNGA 4Q4X3 1STMA 4RS5C 3JCIA 1QH7A 1WCKA 4FFHA 1D0GA 1N3QA 4MGZE 4CXXA 4D94A 4XW3A 1PZ9A 5F5IA 3T4VA 4XJUA 4ARYA 4KMQA 1I5ZA 4EJRA 2VECA 5C4WC 4FBFA 5FY5A 1QJY2 1SFNA 2OUHA 3I7DA 4N53A 5LEKA 1TME1 4Q4V3 1LHNA 2TUNA 2WIIB 5DG1A 5I8TA 2WYSA 4MH0E 5C8CB 2AENA 1BMV1 2ZMLA 1NA1B 2RS31 4N43A 4BZ4A 2DBIA 4DUWA 2W1SA 3TNPB 1W2UA 4QPGA 1JN2P 2DV9A 4M0HA 4BE3A 1MS0A 4GA9A 3ECQA 5FMCA 3H0OA 2EALA 3MIDA 4GKYA 3WG2A 4D3WA 3L9JT 1OUSA 1O7FA 4META 4ZXEA 2QZ3A 3DPRC 4M3CE 3EMRA 5F6LB 1HXS1 2ZS6B 2W08A 5CNAA 3W20A 4E4ZA 2B45X 5IVBA 1YWKA 4QM9A 4KWKA 1JOPA 4XAAA 4FVVA 1POV1 2XG3A 2VQTA 1IOAA 4ATEA 1DCSA 2WZR1 3FBYA 3Q8BA 4AVCA 5FP8A 3NNFA 3PURA 4GZ9A 5DXDA 1Q3EA 1OKOA 2DCKA 3VHNA 3OGGA 4RHV2 1OHFA 2CDOA 5FPLA 1O3QA 1S4CA 1W6OA 3JBG1 4RGKA 1DG6A 1FOD1 1N47A 4H7LA 5AC93 5DDJ1 4B1LA 4IE7A 1F8VA 4KWJA 3RWKX 1FMD3 3VB9A 3PUQA 3PVNA 4YM3A 2HWC3 1DQ0A 3CQOA 4K1ZA 5FMDA 1D4VB 4GWMA 2HWD3 3ZN6B 3VKOA 4AGGA 1DZTA 4IV3B 2OYZA 1IS5A 4Q0VA 2CTVA 2LALA 3I97A 2XBO2 1AR91 5C8WA 1NT0A 1UXXX 2JDYA 1GLHA 2XJUA 2ZGPA 2SLIA 4JGYB 5A3MA 4Q0UA 5IVYA 3WV6A 3H7JA 1W8FA 1TNFA 2VL4A 3CHXA 3NNGA 2ZGUA 2RG4A 3O14A 2GP5A 4LO7A 4Q0QA 1RUJ1 4W8JA 3VBOB 4F7ZA 2A70A 2RR11 1AXZA 4ZHNA 2W94A 3SLIA 4YW3A 4TWTA 1UY2A 1ND2A 3FHAA 5A3OA 3AMNA 2YG0A 5KXBA 4YW1A 1JBCA 3LDRA 5BNOB 3I2HA 4R9CA 2QQKA 2O8OA 1C1LA 4UFLA 1SPPB 3BGAA 4CCJA 4EWAA 1YIFA 2Q0AA 3I2GA 4LO4B 4FP2A 3WINE 1OQ1A 4QDRA 2RDSA 5J98B 2QDRA 3CJIB 3IN9A 3NNMA 3OPTA 2WC2A 3BPSA 3TN93 5CKMA 3PUAA 3WUDA 4DINB 5JXHA 4FTEA 2JXAA 4YVSB 4A4AA 2VOXA 3OBZA 1MS8A 1AYN2 2AYHA 4BXFA 3R0RA 4LHNA 3GM8A 4ET7A 1LB2A 5F3EA 1I3HA 2DCYA 2J1EA 3RZMA 3B7MA 1IQAA 1S0FA 3VUOA 1AL0G 1R1A2 2BWCA 3POEA 4CCNA 3WP4A 2QQPA 1JYVA 1AX0A 2JE9A 5HCFA 3RI8A 2PHXA 2EICA 4RS5A 4Q1RA 4CP9A 5FZKA 2DVFA 1AL22 4AEMA 1HIXA 2JDPA 4I0AA 2DUPA 1FX5A 1AJOA 3FFZA 2D44A 5C4WA 1JMUB 3CNAA 1VBB1 4N9IA 3POIA 5H9PA 1OOPC 2B4KA 2DCTA 1XYPA 3KCCA 3JB8A 4M4PA 5L9VA 4LT5A 4ZY9A 2XLFA 3H1MA 5JSOA 1UU6A 1JU4A 1L7LA 2QJVA 3NMBA 2JKBA 1WMEA 4XFCA 5EJ1B 2V73A 1FYUA 1IHMA 5C3QA 4IEYA 5F2SA 4KG0A 1JOBA 3OJBA 2O0OA 2KR2A 3LKJA 3Q8CA 3UGGA 4CUCA 5BNQA 2W87A 4TXWA 2XMLA 4QD2A 1SZBA 2OZ6A 1CVNA 5J96B 2B39A 2ID4A 1NCQA 3AZWA 4IEXA 1TEIA 1K5JA 1RUH3 1QY4A 2ZEXA 4AI3A 4BK4A 1H1IA 3RZZA 4N7IA 1ZRRA 1RUC3 5JMOA 3H3ZA 2EIBA 1RUI2 4XFHA 3UJQA 3E6DA 5FYCA 1C5HA 3MV01 2WSUA 3MEPA 1UYZA 3ES1A 3VBUA 4Y22A 5FY4A 2NLRA 3APBA 5HCAA 1BLZA 1NE6A 1BCXA 5IVFA 5DPNA 2JIGA 2VO5A 4BIOA 4EZHA 4FPGA 1TZOA 2MPFA 5FZFA 1US2A 1WCDJ 2RV9A 2VQAA 4LBQA 1YFWA 2QNKA 2Q8DA 1W0OA 3HWJA 1KGYA 3U10A 4ES9A 1FI2A 3WZ1A 4GB31 4IV1A 5DAVA 3AP5A 2DTWA 3MIBA 4Y4YA 1ULEA 3AVRA 5A7PA 4CCLA 1RB8G 3LIHA 3WDYA 1W6MA 2EXKA 3NAPB 4CDXC 4OHYA 3UKTA 5JR2A 4GQ7A 1IS6A 4BQYA 4JQRA 5IWFA 2OXBA 4AXOA 3O1UA 2RM21 4DXRA 4HONA 3HT1A 1R081 1IKPA 3NJZA 1SBEA 1AR81 1YEWA 2GAUA 2GMPA 3IAQA 5CA6A 5IK4A 1KS4A 2GC3A 2RMU1 4M3CB 4XCAA 1RUOA 5DUUA 2ZHMA 3GZEA 5FUNA 4PT6A 4DZGA 4PDWB 3JD73 5CU1A 1ALYA 3ZKYA 4CZSA 4EN7B 5DAXA 4Z2AA 2PHUA 3SH4A 2ZX2A 5A7WA 4HOOA 3RJ2X 3ITQA 2P34A 3WW2A 4EWEA 3I2OA 1S2KA 2BERA 3O0XA 3M3QA 3ZVXA 4Z1VA 1KITA 5A1FA 1YJKA 1PO22 3B00A 1ZBE1 3L2HA 3HQRA 3KVBA 2VXJA 1UN1A 1U5ZA 4QGLA 4IQPA 4EN6B 2K0GA 1MZEA 3K75B 2VZSA 3AYDA 4MX3A 4XUOA 4KU8A 1G9BA 1PVXA 1SLAA 1ZYBA 4HSLA 3WP3A 4CXWA 1SDDB 4AYUA 5FXWA 3POFA 1PX3A 3I4IA 2RHPA 4AW7A 1UD1A 4CEYA 2XONA 4OUEA 4QXKA 3MLJA 4HN1A 4WM7A 1DQ4A 3UL2A 2VOWA 3OGJA 5GLWA 3OUHA 2BJSA 1F5JA 5DUXA 4I3PA 1AR73 3AVSA 5FUIA 5DUWA 5A7QA 5C33A 3KVAA 4QKNA 3B3QE 5FO7B 5H9QA 3C7GA 3K51A 2OX0A 3HEIA 3GZAA 5D2AA 1J58A 1RHI1 4Z8BA 2XDVA 3IB3A 4JHZA 1EAH2 2E51A 2YYOA 4Q4Y1 2YB7A 4UT5A 3VBSB 4EN8B 1PHMA 5DZEA 2RJLA 4AWDA 1WLWA 2A71A 2ZHNA 1ACCA 4XJWA 2D5HA 1G7YA 2GNBA 4CA9A 4B8EA 4HFSA 1XE7A 1CD3G 1M06G 1UPIA 1GZTA 4I3GA 2OKXA 1W9TA 2DCZA 5CFDB 1HRI3 1MS5A 1T6BX 2DURA 1GOGA 3PL0A 4E8DA 2E53A 1PVC2 1O4YA 4YZ3A 3V64A 2E7TA 3WNLA 3LSDA 3TYJA 5I0TA 5FQ0A 1DGRA 1PX4A 4K6BA 4R4XA 2A3XA 3ACIA 3OPWA 1GZWB 5DAWA 1EPZA 2JD9A 2PYTA 1YC61 2DUOA 2VCBA 4XXAA 4XHXA 4QHBA 4ZU4A 3ZR5A 3KT7A 3T0DA 1QJY1 4FTBA 1O6UA 1GQGA 3FE5A 3NW4A 4W4ZA 2YROA 2VU9A 1DQ1A 2WNVC 3PU3A 4LBQD 4M4RA 5F37A 3H8RA 4J25A 4MV2A 5A3UA 2XJRA 2DBNA 3VZNA 5A33B 5HV4A 5G05L 3IT8A 1XBFA 3AKTA 4Q8LA 3QCWA 1A8MA 2C1FA 1J84A 2G9ZA 2J42A 1EUTA 3FMGA 5BNPC 5JZGB 1ND3B 2X09A 4MGKE 2F6BA 5FXXA 1VBE2 5EHDA 1LULA 3K48A 3KT1A 3FUOA 1UKGA 3B02A 4AFBA 4AI0A 4IEWA 1NCRC 4NPLA 1UNBA 3MIFA 2QQWA 1YI7A 4OI1A 1LEDA 1SLIA 5FYBA 2BGOA 5E16A 3IZOA 1B35B 4HKWA 1GV9A 3N7JA 5F8PA 1ZBA2 4D7TA 4URAA 4LBOA 5A7OA 1LCLA 2HBUA 1WGPA 2X5IC 3VBRB 5A6XA 3IM0A 3K77A 2XR4A 4K7JA 3MFCA 2VVDA 1QQP3 2WBKA 1OF4A 1A78A 4JTOA 1QJU3 3FWEA 2W5FA 4IL7A 3WQ0A 3GZUC 4E2SA 5JSPA 3MFAA 1PM4A 3USUB 4BPZA 1GP6A 2RE9A 4QXCA 2P3YA 1WMFA 1YFYA 4RHV1 2XJVA 1QJX3 3MW4A 4XMIA 2K2SA 1UCXA 1NQDA 1G9CA 4ISRA 2TBVA 1VAMA 5CFCB 1DBNA 3PIGA 1QJZA 3BTAA 1W3VA 3MW2A 2H0BA 5FK8A 4TYSA 1DLLA 2ETEA 4AHWA 1NKGA 3HD8B 3ZYBA 4GJYA 4P02B 1HKDA 3P5BA 4AQTA 4LKEA 3U78A 1HXS2 2WZEA 1F2NA 1OBNA 2XBO1 1QKQA 1ZNPA 3O1TA 3T2TA 1WLDA 1CZVA 3T08A 4QQHA 2B42B 4JHTA 4OI4A 1GWMA 2D6PA 4SLIA 4HMZA 5FO8B 4FPOB 5C70A 4CXYA 3CZUA 3ENRA 2BVVA 4QGNA 3BOPA 4HL0A 4LE3A 4Z2WA 4XJZA 3V0BA 2JDHA 4YGEA 4MOAA 3DUIA 2IXJA 3I8TA 3VD5A 1UY0A 2HWE2 2D98A 1JZ6A 3WX5A 2ILMA 4XF3A 1MS4A 3THTA 1F35A 4X6QB 2F4LA 2YMZA 2Z5WA 4D7SA 3GF6A 5F3IA 3O1SA 2HEYF 3ZFFC 3MIGA 1AHSA 4HG6B 4DY3A 2RDNA 1U0AA 4WVVA 2JB8A 2JDUA 2XPJA 3F2ZA 1CONA 2TEPA 1QIQA 1MVEA 1VALA 1O4ZA 1QHDA 3J7LA 2LRPA 2A5ZA 2LW8A 2YHJA 4KG8A 1FPN3 4LBJA 4CDWC 3HNBM 1C8M1 4FOWA 3RMXA 2JG9C 3IDBB 4CUGA 1FXZA 4QKFA 3WR0A 1VAKA 4LIVA 3PUIA 1AYN1 4AEDB 5JWPA 1W6NA 1XPWA 3VDDC 4MGTA 1YLLA 5IT6A 1CIYA 2PHTA 1XU1A 1WWYA 2XVGA 1WW6A 1RVF3 5BNNB 4YZ1A 4BMBA 1RUF1 2PXJA 2EXJA 2GN7A 2ZMKA 3MI8A 5JXIA 4H2AA 1CPNA 4OHVA 5C3RA 3LA3A 3LDKA 4BQWA 2R062 2VMGA 4DS0A 1Y3TA 4BJ0A 1NY71 2J7MA 2Q8EA 2HBTA 3M3IA 3PU8A 4QX5A 3V0AB 4P14A 2NM1A 4HPKA 4QX0A 1WMXA 4BIFA 4ASLA 2C9AA 1SBFA 4NN0A 5FXZA 1OPOA 1L7RA 4BWOA 5JIAA 2ZHKA 4MLOA 2VNGA 5FYYA 4E2QA 1IZ3A 2GU9A 2DVDA 4NVPA 2E33A 1S0IA 2ZA9A 3LOBA 3LEGA 5EP9A 4CCDA 2ZOEB 5IK5A 4CDQC 5BNPA 1H2NA 1UMHA 4RQPC 1LHOA 3M4FA 3MGUA 3OUIA 4QXBA 1CX1A 4UOJA 2I07B 5BYNA 2R30A 5JI7A 1ZRDA 2WNEA 4KH9A 3QH6A 3VDBA 2Y6FA 1NCRA 3A0KA 4XUQA 5E1RA 1REFA 4LQRA 3VBHB 1AYM1 1EV12 1NX9A 1V6LA 5CKQA 4CPBA 4R9BA 5IYYA 1JW6A 1OT5A 3B69A 3WLUA 5LRRA 5F7UA 3DCQA 1ST8A 3MF6A 3WXPA 4QB1A 4GH4A 3ZSMA 2GN3A 1CAWA 3KGZA 1RUI1 1XNKA 1ENSA 3SH3A 2VTXA 3VDAA 4N8MA 1R1A3 4C8DA 3S7IA 1E57A 1S0DA 1MEC3 3EXUA 2Q8OA 3PUSA 3OY8B 4UFMA 5L19A 4Y20B 3H1YA 1RUD3 2ZEWA 1W05A 3LAGA 5L9RA 1ASJ2 5D8AB 2R042 2PN5A 4DB5A 1AL23 4CYDA 2BPA2 2Y33A 2VZ3A 2IWGB 4FTSA 4V2WA 1VRH3 3SQOA 1HQLA 4Y5SA 5CIRA 5LY2A 3I2KA 5IK8A 1DF0A 1GSLA 3D6EA 2ZPXA 3KM5A 4OVEA 1UAIA 1WBFA 3IPVA 2EVXA 3M2MA 2GP3A 4OUSA 4RR3A 3DECA 3VL9A 5KC6A 3VHPA 1CR7A 4S2HA 4AVBA 4FXGB 5LA9A 1OD5A 2A6VA 4QX8A 1GNZA 1UXZA 3JB4C 1JTZX 3JQXA 3J8F2 4YFWA 2NP0A 1O5LA 1NAEA 1DP0A 4N53C 5A6ZA 4MXWA 3ZPOA 3FJSA 4W6WA 3ROUA 3I54A 1HW5A 1V9U2 4YM0A 5I0DA 5BV6A 4N43C 1RJ7A 2V5DA 3V56A 4D6RA 3W5MA 4Q27A 1IS4A 3OSDA 5J37A 2BW8A 3LFIA 4OMCA 4UF0B 1PGSA 3IDCB 4QPGC 1OKQA 4CP1A 2AGSA 3AJZA 4OZOA 4XJ8A 5JDBA 1OI6A 3NNJA 2B7YA 3AX4A 5IVCA 5ANQA 3POSA 4F83A 5JUVA 1HJGA 1HLCA 1LNSA 1WA4A 4BCUA 1XXNA 1Z78A 1RUG2 2VE1A 4BQ2A 3GZTB 3GJBA 2A1XA 4JV4A 1H6YA 2Q8CA 4IEOA 3AM2A 2VZUA 1PO21 5ERLA 2BOJA 2MEV2 2BNOA 4X6RB 3SXWA 1LU1A 4QU1A 5J36A 1NXD1 3ZFFA 2YBPA 4BA6A 2FZ1A 3M3EA 4KGGA 4QDSA 3ZIWA 3KHBA 1S0JA 3LQCA 4FOQA 1XJAA 5KHIA 5FO9B 3BKZA 1C8NA 2XWBB 3P1IA 5E89A 3JU9A 4CCOA 5L7OB 2JG9A 4XFIA 3LCPA 1HX6A 1RJ8A 3VGIA 2P6HA 3ALQA 1XYOA 4IETA 2VUCA 4QQ2A 4EWDA 3VDDA 4DY5A 4BK5A 2ZAAA 2HEWF 1R093 1PIV1 4Q4W2 4XMAA 4FOVA 3TNQA 4MGIE 5HXMA 3DEMA 2XLAA 1W6PA 2LTNA 2OPKA 1LRHA 3HQUA 1Q8PA 1LHWA 2GH8A 4D6SA 1TMF2 4XQDA 5JLVA 1O3TA 3IMNA 3I3DA 4AFMA 1D2SA 1JXNA 4XTMA 1EAH1 1P8JA 1WD3A 3UGHA 1RUE2 1VMJA 2J1RA 2C9KA 1RMU3 5I93A 5BPXA 4TLGA 1AJKA 1HRV2 1PK6B 1OVSA 4WVWA 4MVTA 3BTZA 1TG7A 3DYOA 1H8TA 3KQRA 1PMIA 3Q9OA 4CPBD 4CDQA 1G86A 5FZ3A 1UZVA 1Z7S2 2Q30A 1GQPA 1PVC1 5JI9A 4CVUA 4FSJA 5FWJA 1VBA1 3ZPYA 5A6YA 4A6SA 1ND2C 1UMIA 2W52A 4EN9B 1UZWA 1TE1B 1UX7A 3FLTA 5C71A 2WQZC 1W6QA 1G9AA 2BGCA 2HWF3 1ZRFA 2FMDA 1RIRA 5IAXA 1OC1A 4CDUA 2RJ2A 4AEKA 3SCFA 1COV3 4JVAA 2BBAA 4GULA 4UFKA 4DFSA 4E8CA 4C0HA 5FYIA 4XAEA 2W39A 4QB6A 4FAGA 1NOVA 3QOPA 3FHIB 1AF9A 4LUMA 2EIGA 4P5YA 5FZ0A 3HJRA 5FZ7A 5K9YA 4Y33A 2QBXA 2ARBA 2VUDA 1MQTB 3BALA 4ZPIA 4RQPB 1Q8VA 4OI0A 4UAPA 1VRBA 1VBE1 3VZLA 1DQ5A 1NG0A 4LR4A 2EXIA 3OB8A 3RQ0A 3AZZA 3ZOIA 5EFUA 3HOBA 3BPZA 3MV11 2YC4A 4YGDA 4UW4A 1JZ7A 1VE0A 4AFDA 2Y6HA 4XHBA 3NL1A 1NQJA 1QDOA 1ZBA1 2YY1A 2XHKA 2VW2A 1O59A 3BI3A 1DFQA 4K3UA 3ABZA 3TRSB 3ZFGC 2PQSA 4UFHA 4Q5OA 3KGLA 1OQEA 1WD4A 4HKOA 4AAXA 1FV3A 1NZIA 2XJSA 4CEWB 4LK6A 5C8CA 5H9RA 4AE2A 3VZOA 2JE8A 2XKPA 3CIHA 3VKLA 4MG2A 1H30A 5FRAA 3KF3A 4AF9A 4AI9A 4RGGA 2JEMA 5FP9A 4CTEA 3MDPA 2OQ7A 5KBFA 4IEQA 3UKVA 2VUAA 4V1PA 3HN3A 1OPMA 1W9WA 2VY0A 4GMP3 4JGZC 2WQ4A 2JG8B 2RDQA 4QPIC 3WF3A 1CAXB 4I2OA 2WFF2 1J3QA 2VCAA 4L92A 1N1TA 4LO5B 4QPYA 4YLZA 4UW5A 4YWAA 4YNIA 4AQSA 2Q5TA 2YZ4A 2FDKA 3KZ4C 4UYBA 3HVDA 5F32A 2B46X 4AI2A 4FCAA 1BYHA 2DFBA 4ZU5A 1NCQC 1UL9A 1UZ0A 4COYA 2Y26A 3TEYA 4DO0A 4A7YA 4NOTA 2YV8A 4OHZA 3LPFA 4ITCA 3I59B 4N53B 4XOGA 5FZMA 2CHHA 2CWMA 4NO4A 5LY1A 2WNUB 4BLIA 1X82A 2D40A 2VMCA 5FBZA 3LB9A 5ABJB 2OZJA 3NRUA 3VBUC 3S7EA 1ZRIA 5FBJA 4H3WA 4FT8A 5FP3A 1JZ8A 1LAJA 1JI6A 2P6CA 3N7MA 4LE4A 2QUOA 4NHXA 1UKRA 4A2UA 3DYMA 4L99A 4DUVA 1H2MA 4XDPA 3K2OA 4UWDA 2NQYA 1WLTA 1YFXA 3KSCA 5KR7A 4NIDA 1CWPA 2HWE1 1LTEA 1TME3 4IV1C 4DIQA 4ATFA 1YHFA 4NPRA 1QU0A 5G04L 1CQ9A 3NV1A 3P3NA 1OURA 3ZN6A 2RS33 4MSVA 5CB7A 4DXSA 5JXJA 3BUCA 3D0SA 2BRTA 3FHQA 3UYJA 5A70A 4WVMB 4IV3A 5KXDA 4JDMA 2A6ZA 3EHKA 4L2NA 4H55A 3N9PA 2R16A 4PBPA 2VMDA 3GBFA 2UYAA 1XYNA 2W1UA 3N7KA 4P9YA 4UW6A 5IW0A 1PGW2 1FT9A 1AXYA 4YVWB 2OVUA 1CJDA 1RTVA 2SBAA 3VBOA 3T3YA 5C3PA 4DQAA 1HJFA 4G9SB 1OMIA 1HXS3 1W6OB 2ARXA 2ORZA 2R071 3LSEA 5EQUA 1UO9A 1AUYA 2C24A 2WT1A 1GZ9A 1POV3 3M70A 3N3HA 2R061 4IGOA 4W50A 1ENXA 4IE5A 5HPOA 4BDVB 1OA2A 2WZR3 3H3LA 4R4ZA 1CAUA 2P3KA 3LWCA 3WDXA 1KFUL 5IAVA 4OZXA 1LR5A 2BNNA 3BCWA 4GD4A 3I2JA 1WW4A 3OGRA 4DXTA 2AZ5A 1WUVA 3CJIA 2WWUA 5KXCA 4P9GA 4CUAA 3JBG3 3POYA 3ZXGA 1FOD3 1SFYA 1SLLA 1ZZCA 5FMOS 5DDJ3 3OYWB 4K21A 4YVSA 3UKNA 5C9AB 3WT3A 1LU2A 4INDA 1C8M2 1U5IA 1VIWB 4AVTA 5J09A 3RS6A 1WZXA 2ZMNA 4CEYC 1XU2A 2A6WA 5LASA 5A1AA 4XEZA 1PM7A 5FY7A 3ST7A 4LULA 4WM7C 1RUF2 1EV11 3BYWA 1AR93 3GYDA 4EZ4A 4Y1ZA 3AMHA 3T4HB 5JOZA 2GZWA 3UJOA 3GHNA 3FX3A 1VMHA 3ZFGA 1NY72 5IJRA 2VNVA 3VN4A 1GWKA 1RUJ3 2E32A 3MUZ1 4YARA 4LOTA 2RR13 1O4TA 4IGPA 1DDLA 1RGSA 5FZ9A 3HNYM 3BU7A 5JOXA 1ASJ1 5K4LA 2R041 1OVPA 2VM9A 5EV7A 4BH9A 5A7SA 1GNHA 1B09A 4UI9L 3KMHA 4JGZA 1ODMA 4QPIA 4NIIA 3Q8AA 4A44A 3R6SA 2WO2A 4CU7A 3O1MA 4QX2A 4NJ4A 1X7NA 4QPWA 4EE2A 4JDOA 4RFRB 4YZ5A 3KLSA 2WT2A 2RS52 1ONAA 2R1BA 3QH7A 2PAKA 2UWBA 4RS5B 5CYYA 1UOGA 1W3XA 5L36A 4CP9B 2IVIB 4EROA 1AYM2 1ZX5A 1QXPA 2P5BA 3J8F1 1XOYA 2WR9A 3KV9A 5C4WB 2WJSA 4LMFA 3U1XA 2JENA 3QD6A 3LF7A 4IGQA 1ULGA 4AL9A 1V9U1 3AZVA 2FDIA 1W8ZA 4JDNA 2JIJA 2VUJA 4P9JA 2WSVA 5AVPA 5L9BA 2WN3A 2JD4A 4SBVA 2PA7A 4NRPA 1FNZA 5EYYA 2FHRA 4Q1PA 3Q8FA 1I1EA 3OGVA 1BVVA 1C1FA 2ZGTA 4AQ2A 1RUG1 3AYCA 2VTXJ 4LKFA 1URXA 4JX0A 2DFCA 1VBB3 4NHLA 1HB2A 1C28A 5FZ8A 4LK7A 2MEV1 3RPQA 2VOTA 1WCSA 3NAPA 3ATGA 1E5HA 3DPRB 5FPBA 5LA0A 1XSQA 1XNCA 1QOOA 2XB6C 2W1WA 2VQ0A 4PHZA 4FAHA 4L9BA 1H1AA 1APNA 4C1XA 5KC5A 3ZXDA 2DF7A 2HJIA 2ARAA 4Y22B 2ZX0A 4M3CA 4AGVA 3AKRA 2YC2A 3OCPA 4MGQA 3NO8A 5DUVA 5C7GA 2PFWA 5JOYA 1AX2A 2LUWA 1GYKA 5ANNA 4PDWA 3S5AA 2YGLA 1S1AA 4ZU7A 4Q4W1 5FZDA 1K45A 1Y4WA 3J7NA 1RC6A 2WO3A 1TNRA 1UU5A 3E6CC 1MACA 4LO6B 5LBFA 3O12A 3FL7A 3C3VA 5FYHA 2V4VA 1TMF1 1PO12 3VBFC 2IZWA 5FWEA 4B7KA 4BYYA 1ZZ7A 2XWJB 3LZZA 1BEV2 3WY6A 1G8WA 1AVBA 1RUE1 4FFIA 2PHFA 1CAVB 2WS92 5EXOA 2B9VA 3HN1A 1HRV1 2VVEA 3PVBB 2XVKA 1UYXA 3ON7A 4GB33 5A32A 1XB9A 3S57A 4EV0A 3J4UH 4PIZA 5I0RA 1ODNA 3CEWA 5GLUA 3O0VA 3ZSLA 1SACA 2ZX3A 4A7ZA 1Z7S1 3ZYRA 5FZ4A 3LDBA 3PJYA 2CGOA 2QDNA 3NV2A 3GHMA 1QWRA 1YUDA 1LOFA 2VR4A 5F39A 5A7WB 3SH5A 3UNPA 2RM23 2WZ8A 1O3SA 1YNAA 1PIV2 3PJQA 1XNDA 1R083 1AR83 2P37A 4GMP0 4QT6A 4CU6A 1S0GA 2RMU3 2C0ZA 2VZ1A 3B93A 3RYRA 4KQ7A 1GNYA 1N3PA 3SCHA 3J26N 1H4GA 5B4NA 5CISA 1D4M2 1KS5A 3C7EA 4B7EA 4LKSA 5A80A 5FY1A 4KBBA 2OPWA 2PQQA 3OBRA 4FXKB 1C4RA 2D43A 4DMIA 3IIIA 1LESA 2UY9A 4PIYA 5CFDA 4DNYA 2Y60A 3MYXA 1J1TA 4YRDA 4R8HA 2R1DA 2O14A 1A8DA 3PDQA 3ZXFA 1ZBE3 2BDRA 1VBD2 2D93A 1K5MA 1NLRA 4B1MA 1XRUA 1WW7A 2IXIA 3A7QA 1AR62 2PLV2 4QQLA 3LPGA 1SCRA 3I49A 5J7MA 1VBA2 5DMYA 2RS12 1OUXA 3AYEA 3QBQA 4BQ3A 1LHVA 3ACLA 1REEA 1Y9GA 2W0XA 3TEXA 4XUNA 2PTMA 4BM8A 3OUJA 3GBWA 3T0BA 4PBOA 3AFKA 3ZM8A 4LUKA 1OOPB 5M0TA 5KHHA 2FD8A 3SKVA 4OQ8A 4Y1VA 2AEZA 4HN0A 1G6NA 3KV6A 5JZGA 4CRQA 1ND3A 5CG9A 2EAAA 2WFF1 5GM0A 4GWJA 4NAOA 5SV8A 3ZXLA 5LW9A 1RHI3 1OQDA 4UXAA 3EQEA 4QWNA 5FYTA 1GU3A 2WA3A 4Q4Y3 5A3NA 4O65A 5HXVA 1VLNA 5FOJB 1LOBA 3NKGA 1JHNA 3VZKA 2B9UA 3N7LA 1B35A 3WUCA 4FPKA 3HNMA 1JYCA 3G7DA 1JU3A 1UPSA 2CGPA 1GOFA 1QH6A 1UY1A 4X8PA 5JOWA 3ACGA 4KWUA 4QQPA 4YGBA 3VBRA 4GH4C 4WM8C 3OGSA 5GLTA 3T30A 5FDBA 3TWIA 5I8YA 1A6CA 1WBLA 2W1QA 2G9GA 1POQA 4FP3A 1F4HA 5FYMA 4XUPA 2BV4A 1SLTA 1ULCA 4LIUA 3RZKA 2ORXA 2DU1A 3Q8EA 5FLIA 1W39A 2GH2A 5L73A 1UYPA 2GALA 1V6OA 1CZSA 2BTVC 4N7UA 4D8MA 2VZQA 2VW1A 3UK9A 1QJY3 2I2SA 3EBRA 1DGWX 3FLRA 5TSWA 4P9WA 5FMOL 5CFCA 5A1LA 1DU3D 4FPFA 4NE9A 4RR3C 2F17A 5F5CA 3VBFA 1LKNA 1JUIA 4HK9A 5J48A 3UGFA 3HMYA 4CDXB 3DXUA 1W04A 3ZXJA 1J3PA 2A73B 2YGMA 3VZMA 1N1YA 5FYSA 1YFUA 4ORFA 5FYUA 1OXCA 4AAPA 4OLLA 1PGW1 3WW1A 1W8TA 5AC92 1FAYA 5T5PA 1N3OA 4FOYA 3OEBA 1F31A 4LEJA 4MHRA 4R9DA 3URFA 5LCWL 3CBNA 4LBMA 1UZYA 2HWC2 1KFXL 3WCRA 1KDKA 4O9GA 4RD7A 1AX1A 3WNNA 2HWD2 3U37A 2OIIA 5GZFA 2CDPA 1J1LA 1W9SA 2VPVA 2R49A 1S0BA 1OLME 2IXKA 1J83A 4JCKA 1RITA 3K4DA 3NJXA 4L0PA 5FYZA 1RL3A 3ASIA 4FFGA 2QVSB 1OFSA 1XC6A 2ZCWA 3H50A 5FJHA 5BY5A 1IS3A 4NIGA 2KD7A 4R52A 1TQ5A 3AYAA 3ZN4A 1I6XA 3AKQA 3CLPA 4RHV3 5I8SA 3CU7A 1W28A 3RYPA 2OUJA 1W9FA 5LA1A 2K9ZA 3IBMA 4FI9A 3PLQA 1W2AX 4XE9A 4AEDA 5F3CA 3AXEA 1FV2A 3UESA 1LOGA 5BNNA 2EAKA 1SFPA 4COVA 3V0BB 3WNXA 1H9PA 1YQCA 4CUBA 4XPVA 3K4AA 1H8VA 1U12A 3T2OA 2WLPA 3TN92 2G9FA 2XBO3 4ZKTB 2CU5A 4FPLA 2R072 2EIDA 3KWVA 2YBKA 4HVRA 3ACFA 3V0AA 3K3OA 1PZ8A 4XJAA 4A42A 1ENQA 5I91A 1W90A 3DKWA 1JUHA 3OG2A 4IE6A 5CVRA 3MPBA 4ZS2A 2BQPA 3MZHA 1ULPA 1E5SA 2ZX4A 1PNFA 3M3OA 3M8LA 3MO4A 4I01A 3O1VA 5C5UA 4ZXKA 3NNLA 2LS6A 3NV4A 2W3JA 5FY8A 2WT0A 1TVGA 4LA3A 1H8TC 3VLBB 1ZZ8A 2AUYA 4MZUA 4P9XA 4K40A 3E5QA 3T2QA 1UF2C 5FPVA 3O5SA 1VAVA 4XF1A 2B5HA 3PUHA 2E6VA 1UWWA 3VBHA 2VNRA 2BZDA 3A21A 3HT2A 4LOSA 4NPMA 2RS51 4XQWA 3B9IA 1FATA 3ZDSA 1C8M3 3LEIA 2IFRA 1CESA 2XH6A 2JJ6A 2PHWA 4UBHA 5FFOC 3RZHA 1AYN3 5IATA 4HPKB 4CDUC 5FZCA 1W03A 1GOHA 4WM8A 3USSA 4K8FA 3RVHA 1RUF3 2WNVB 2D6KA 3MPPG 3AFGA 3N36A 4YYOA 1YXWA 2JE7A 5SV5A 3U14A 1N1VA 1WCUA 5D8AA 3WW4A 5FOBB 5FZAA 3H8XA 4QM8A 2VH9A 3KS7A 2HEVF 4XFBA 1G9FA 1Q8SA 5BNPB 2ZAHA 5IUQA 2JKXA 1RUC2 1ZZ9A 2Y6GA 2A3WA 2ERFA 2DYCA 1VJ2A 2XL7A 5DQ0A 1NCRB 1V6KA 3R4DB 3D82A 2RJKA 3ZSJA 2WDBA 4RN5A 1YIPA 3OOXA 3VD9A 2WAAA 4BQ1A 3NKTA 5CKNA 2Y6LA 5FZGA 2ENRA 2DUQA 3T1LA 5A6QA 1JHJA 1CAWB 1W8NA 4Z07A 1LOEA 2X5IB 3D0JA 1GWLA 2ZGKA 3AZYA 4OULA 1UOJA 5LBCA 4CCCA 4DRVA 5ISLA 1RXFA 3C7OA 2IUWA 3U4SA 3EB7A 5DN2A 5K0UA 4HT1T 4ASMB 5C8CC 4PQ9A 1NA1C 1BBT1 4Y3OA 3AMPA 5FLJA 3KCYA 3MIHA 4UF0A 4OQ9A 2VZVA 3K46A 5JSRA 5KHKA 4HETA 1QOTA 1DLCA 1SLBA 1WW5A 1SG3A 1VBC1 1MS1A 3KD4A 4TN7A 4GAZA 4Y1UA 1X8MA 1RUI3 1W2NA 1H4HA 3HIFA 3IPVB 5HCHA 4LHLA 1PO11 2P2KA 3A4UA 2FDHA 2VVFA 1X50A 2WWJA 3IDAA 3RDIA 1BEV1 4J1WA 4BHPA 3VHRA 2C6SA 4Q29A 4NHKA 3THDA 1IPJA 2R7EB 2WS91 1Q8OA 1ZM1A 4UW3A 2XXZA 4YW2A 4AHXA 2FCVA 1GUIA 4PLNA 2PHLA 2HWB1 1W8UA 4MXWB 5F6KA 5GJ6A 2IXLA 5GZEA 1DQ2A 1KDMA 1LJ7A 3UV9A 5DABA 4G3YC 5L7OA 3KB5A 1VPHA 3H9AA 4ISQA 4CCKA 3C7FA 3RZJA 4IUGA 3S0MA 4B4PA 3CZJA 2HLEA 4TSVA 4BQ4A 4COZA 3LEMA 4S2DA 4FPEA 1ZA7A 3SMHA 3ILRA 4Q0SA 2GC1A 5EYXA 3WDWA 4Q26A 4ZZ5A 2ADDA 4ASKA 1DGRN 3ZYHA 2ZZQA 5EWSA 1NLSA 2JX9A 4AGRA 4I0BA 4XXPA 3ZFFB 3ELNA 5H9SA 1U5YA 1QDCA 3GALA 5EPAA 2UWAA 4IV3C 3FFQA 5CG8A 2CAVA 1D4M1 2HYKA 3JUUA 1BXHA 2ZKLA 5KHGA 3A23A 4YGCA 1AR72 3KT4A 4G4FA 4KNCA 4CDWB 4FFFA 4BXSV 4OYUA 5ACA1 3RZGA 3U75A 2WNOA 3D4KA 2JG9B 1F4AA 4JGYC 3SISA 1PMHX 4I09A 4B4QA 4YSFA 5JCTA 3IWZA 4NROA 4JKMA 1PO23 3I2IA 1ZVFA 3VDDB 5LATA 3VBOC 1VBD1 4LNVA 2VG9A 2YFUA 3E5UA 3VKFC 2IC1A 1AR61 2LROA 3M3CA 4OFGA 5FZLA 2PLV1 2NPIA 5FREA 3G6JB 3WP6A 4IE0A 3OEAA 3S6PA 4CP0A 4F8AA 4LITA 2RS11 3R4SA 1V0AA 2W46A 2PELA 5BNOC 2WYFA 4IESA 3WEZA 5GLZA 1NYWA 3U4XA 3C8XA 4PLOA 1SQ4A 1UIKA 4K9SA 1HRI2 1Q43A 5JMCA 3X29B 1J3RA 3F95A 3CKHA 3MIEA 3MBWA 3VZJA 1XE8A 1PMJX 3AP4A 1PIV3 4CE8A 1GQHA 3CJIC 3WD5A 3HBKA 3QACA 4Q4X1 2UWCA 3DF0A 2UU8A 4EN0A 1MQTA 4YVSC 2G19A 3EJKA 1XSRA 4CDQB 3HAGA 1EAH3 1V6JA 3E5XA 4Q4V1 5IFTA 4LTAA 4XIOA 1Q5OA 4AHZA 2X8KA 1UYYA 3ZFEA 1QJFA 1CZTA 2AREA 2XOMA 2J1SA 5F2WA 1W6QB 4A45A 1KD7A 1NZCA 3H3UA 1S55A 1OH4A 1ZREA 2VBBA 4NWWA 2Y6JA 3CJXA 3POWA 3GNEA 4M3CF 1GMMA 2XJQA 2V09A 5LWBA 1PVC3 3WP5A 5FK7A 4JQTA 1VBA3 4QU2A 3BN6A 2YPJA 3THCA 3WNKA 4U36A 5FZOB 1NA1A 4XIKA 4XBNA 2DU0A 3ZMOA 5A3PA 4LBNA 2JG8A 4AFAA 1CAXA 4YW4A 2V5YA 4L97A 3THPA 2J1TA 4A41A 2D5FA 2QCSB 1GFF2 3PVEA 1QQP2 2VMEA 2CV6A 1OLRA 3ME2A 3WHTA 4YW7A 2A6YA 2D3PA 1QJU2 1QMJA 2Z79A 1W2OA 4ARXA 3ZX7A 5JVVA 5DAQA 4IEZA 1Y43B 4HANA 4WZCA 3J7HA 4LBLA 1PGL2 4LLOA 2E9QA 3I59A 1QJX2 1VBE3 4XYXA 1O8SA 3B94A 1Q56A 2A6XA 2WNUA 2X10A 1MZ6A 1IPSA 4Q2FA 4XC9A 4Y5TA 5FZIA 5AC91 4JKLA 4GXLA 4CCEA 2RDRA 5ABJA 1BZWA 1RUNA 3LGRA 3BTYA 1FMD1 2N7GA 4YG6A 3BIWE 2HWC1 4H14A 4N43B 2DCJA 2Z2SB 2HWD1 3RI9A 1JYWA 1ZBA3 2H6BA 2ZABA 4QPGB 2QQJA 2YUEA 3UT0A 1HQNA 1IG0A 1OFNA 1HQWA 2E63A 1BQPA 3MF9A 4WBBA 1QNYA 3S5QA 1KRIA 4HBNA 4XBQA 2J1VA 4RL7A 4AEJA 4JRLA 5CAZA 2ZGRA 3AL5A 1DZRA 4BQ5A 3FBMA 1US3A 3NAPC 2VD7A 4WVMA 1BK0A 1Z0HA 4JRAA 4IE4A 2QQMA 2GDFA 4YG0A 5AVAA 2YXSA 5I0UA 1UIJA 2YC0A 2ZGSA 4JC1A 4R9AA 2YPDA 3ZXKA 2XHNA 4OHXA 4V2VA 3AJYA 4YVWA 2ARCA 2JDKA 4JGYA 4HVOA 5A3TA 4O9EA 1R1ZA 3ZSEA 3FZ3A 3O0WA 1JYNA 2K46A 1O91A 2W47A 1BKZA 3PHMA 4PDWC 5T5JA 1UMZA 2VNOA 3RYKA 1H1MA 1WCQA 4DRRA 1CGPA 2W92A 2WO7A 2XQRA 3J7MA 3TN91 5C3SA 1FPN2 3U0ZA 1SLCA 4Y1YA 5LEJA 1LEMA 2QTWB 4FPYA 4XZPA 3W21A 5BNOA 3GXUA 2Y6KA 2YBSA 1SPPA 2Y8KA 5EIYB 5JIUA 3NJYA 3KCXA 4Z82A 4BOWA 1RVF2 2YU1A 3IDEA 3ZYPA 5E88A 3WG3A 3GDBA 2KXLA 3NQHA 2Y0IA 3BTXA 5A3LA 5C9AA 1JOJA 1XQNA 2HWE3 2VULA 3OYWA 5JAXA 4MADA 2BBVA 1A3KA 1XNAA 3HQXA 2P3JA 2XUEA 4P08A 1WLCA 1YCIA 1X33A 3T09A 2QKDA 2VMHA 4KGQA 4NHYA 2AR6A 3K4ZA 3L2YA 1H2KA 1LOFC 5IK7A 1ND2B 3BVCA 3C2UA 4HXCA 4M00A 4BLJA 4WZFA 5K7PA 4QAWA 1UY3A 1CAUB 1F5FA 3NSTA 2IXCA 3IAPA 1YQ5A 3ZR6A 3P6BA 5FZEA 3J9SA 2R0FA 3TOJA 3VBSC 1ZRCA 5DZFA 5JXGA 5C6CA 1MZFA 4LBKA 2R073 4FPHA 5T3NA 4FPCA 1RUH1 3ZDVA 3WCSA 2R063 1UU4A 2C5DA 1W9YA 1Y7BA 3RFRA 1GICA
chains in the Genus database with same CATH topology
3VD7A 1UMHA 4XUNA 1CX1A 3WQBA 4DEQA 4UOJA 1JZ5A 3T0BA 3ZM8A 4XVHA 3VDBA 1H6XA 4XUQA 4LQRA 1YQ2A 4XUTA 1NX9A 3SKVA 5IYYA 1OT5A 5F7UA 4QB1A 3VD3A 4GWJA 4LHSA 4DEVA 3VDAA 1GU3A 2QQLA 1W0NA 2ZEWA 3I2FA 3JXSA 3HNMA 1JU3A 4ARYA 1GOFA 2VZ3A 1UY1A 2J1UA 2Y64A 3ACGA 4KMQA 3NJVA 4KWUA 5J1XA 3OGSA 3I2KA 3D3AA 2W1QA 1F4HA 4XUPA 2WYSA 2ORXA 3DECA 4DUWA 2BGPA 3CMGA 4RYDA 1JZ7A 2W1SA 2HYXA 1NUKA 1CZSA 1UXZA 4D8MA 2VZQA 3T0AA 1NAEA 1DP0A 2E26A 3ECQA 1WKYA 2ZXQA 2W9XA 5I0DA 2V5DA 3W5MA 2W91A 4ZXEA 4OMCA 4OZOA 5JUVA 1LNSA 5EJZB 2VQTA 3OEBA 5LCWL 2L9LA 1H6YA 4PF1A 2VZUA 4GZ9A 3WNNA 3ACHA 3U37A 2DCKA 1IQDC 2CDPA 4QDSA 1K3IA 1W9SA 2CDOA 3LQCA 1JZ4A 1J83A 3NJXA 3K4DA 1XNTA 4L0PA 3I3BA 3P1IA 1XC6A 2KD7A 3CQOA 3I3EA 4BK5A 4TTGA 3SEPA 4PQQA 3I97A 5HXMA 5B4XA 1UXXX 4ZZ8A 5LA1A 4FI9A 3HPNA 3UESA 3I3DA 3WF0A 2VL4A 3NNGA 1EUUA 4W8JA 1P8JA 3E1F1 2J1RA 2C9KA 4CUBA 2W94A 1UY2A 3FHAA 3K4AA 2YG0A 3T2OA 2X05A 4A3ZA 3I2HA 2EIDA 1TG7A 2QQKA 3DYOA 3BGAA 3ACFA 3I2GA 4A42A 3OG2A 1GQPA 4CVUA 4QDRA 1ULPA 3MO4A 1UMIA 2LS6A 5C71A 1UX7A 5JXHA 2W3JA 1TVGA 4A4AA 2J1AA 2QQIA 2RJ2A 2BBAA 3T2QA 3GM8A 4ET7A 4E8CA 2J1EA 3PUHA 1UWWA 4QB6A 2BZDA 3A21A 4P5YA 1JYVA 3HJRA 2QBXA 3LEIA 2EICA 4UAPA 2ZEZA 3OB8A 1GOHA 3WF2A 1BHGA 3HOBA 3MV11 1ULOA 2YC4A 2B4KA 2Y6HA 2YFZA 4M4PA 4ZY9A 2E31A 3MUY1 1JU4A 1O59A 5EJ1B 3ABZA 2VMFA 2JKXA 2PQSA 2Y6GA 2DDUA 4AAXA 3WF1A 5DQ0A 4CUCA 1I5PA 2W87A 4TXWA 2JE8A 2WDBA 3CIHA 4RN5A 4AG4A 3EYPA 3VD9A 2ID4A 2WAAA 4BK4A 2Y6LA 2ZEXA 1JHJA 3HN3A 1W8NA 1W9WA 1KEXA 3WF3A 5JMOA 2EIBA 2VCAA 3MV01 2VZRA 3C7OA 1UYZA 3EB7A 5DN2A 2XQXA 1UZ0A 5DPNA 2VO5A 2VZVA 3K46A 1T2XA 1DLCA 1US2A 2RV9A 1SG3A 3LPFA 4LPLA 1KGYA 4QB2A 2VMCA 4MO3M 2VZPA 3NRUA 1W99A 3IDAA 1JZ8A 1JI6A 2VZTA 3THDA 5JR2A 2R7EB 3DYMA 3DYPA 4QX3A 4DUVA 1OD3A 5LA2A 1GUIA 2ZEYA 3UETA 4DXRA 1HN1A 3IAQA 5G04L 2WN2A 4DXSA 3C7FA 5JXJA 2Z4FA 3FHQA 4IUGA 1D7PM 2HLEA 3CZJA 4PT6A 2VMDA 4Z2AA 2W1UA 4ZZ5A 2C26A 1SHWB 2BERA 2WQ8A 3WNPA 3SKJE 2ORZA 4QDQA 4A6OA 3A23A 3K75B 2VZSA 1JYXA 4W50A 4BXSV 1JZ3A 4XUOA 4OYUA 5HPOA 1F4AA 4BDVB 1PMHX 1SDDB 4JKMA 3I2IA 1PX3A 1MPXA 2XONA 4OUEA 2VC9A 2YFUA 3I2JA 3OGRA 4DXTA 1UY4A 3OEAA 4CUAA 2W46A 5FUIA 3OBAA 3WEZA 3C7GA 3HEIA 3C8XA 2VQUA 2JDAA 5A1AA 3IB3A 4JHZA 3WNMA 3WF4A 3CKHA 2YB7A 3MBWA 1PMJX 4KI5M 4MGSA 1DYOA 2QQOA 2OKXA 1W9TA 5IJRA 5IFTA 1GOGA 4E8DA 1RYYA 2E32A 3MUZ1 3WNLA 1UYYA 1CZTA 1PX4A 2J1SA 2XOMA 3HNYM 3ACIA 4CU8A 2JD9A 2VM9A 4A45A 1JZ2A 4D0QA 2VCBA 1OH4A 3VDCA 3T0DA 2Y6JA 4UI9L 4A44A 2WO2A 2WAOA 1GMMA 4W4ZA 4CU7A 4M4RA 4QX2A 4QPWA 3BN6A 3THCA 3WNKA 5G05L 5CYYA 1J84A 1EUTA 2X09A 2VJXA 2J1TA 4A41A 2VMEA 3VD4A 2BGOA 4JKKA 4ARXA 2VZOA 2WN3A 3J7HA 3OGVA 1O8SA 1O8PA 2X10A 3K77A 2QQNA 2WABA 4JKLA 2WBKA 1OF4A 2V72A 4JX0A 3C7HA 2W5FA 2VOTA 2DCJA 2VTFA 1JYWA 5LA0A 3CDZB 3ETPA 5CZKA 3T2PA 2QQJA 2W1WA 3AC0A 3WSOA 3FN9A 2J1VA 5IHRA 2WUHA 1K42A 2EIEA 2YC2A 4MGQA 1W8OA 4OMDA 5C7GA 3GGLA 1US3A 1NKGA 4P02B 2QQMA 1K45A 2WO3A 2WZEA 3LEKA 4XURA 4CU9A 3FL7A 1CZVA 3T08A 2XHNA 2V4VA 3SEEA 4XZUG 5C70A 3CZUA 1JYNA 2W47A 2C4XA 2B9VA 1WCQA 4GWIA 2W92A 4MOAA 3VD5A 1UYXA 1UY0A 1JZ6A 1R64A 3GXUA 2Y6KA 2Y8KA 5EIYB 3W5NA 4HG6B 3F2ZA 3LE0A 3WNOA 2RVAA 3GDBA 2VR4A 3UNPA 3NQHA 2LW8A 2WZ8A 2J22A 3HNBM 4MADA 4CU6A 3PUIA 1XNAA 1L7QA 1XPWA 2VZ1A 4P08A 1CIYA 4DUXA 1GNYA 3T09A 5B4NA 1OF3A 3K4ZA 3C7EA 5JXIA 4LKSA 4QAWA 5IFPA 1UY3A 3IIIA 4BJ0A 4YPJA 2J7MA 3IAPA 3P6BA 2W95A 4QX0A 1L7RA 3A22A 3A7QA 5JXGA 4P00B 1K12A 3LPGA 2WO1A 5DMYA 2E33A 4QX1A 3LEGA 2VCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD7 A;  1UMH A;  4XUN A;  1CX1 A;  3WQB A;  4DEQ A;  4UOJ A;  1JZ5 A;  3T0B A;  3ZM8 A;  4XVH A;  3VDB A;  1H6X A;  4XUQ A;  4LQR A;  1YQ2 A;  4XUT A;  1NX9 A;  3SKV A;  5IYY A;  1OT5 A;  5F7U A;  4QB1 A;  3VD3 A;  4GWJ A;  4LHS A;  4DEV A;  3VDA A;  1GU3 A;  2QQL A;  1W0N A;  2ZEW A;  3I2F A;  3JXS A;  3HNM A;  1JU3 A;  4ARY A;  1GOF A;  2VZ3 A;  1UY1 A;  2J1U A;  2Y64 A;  3ACG A;  4KMQ A;  3NJV A;  4KWU A;  5J1X A;  3OGS A;  3I2K A;  3D3A A;  2W1Q A;  1F4H A;  4XUP A;  2WYS A;  2ORX A;  3DEC A;  4DUW A;  2BGP A;  3CMG A;  4RYD A;  1JZ7 A;  2W1S A;  2HYX A;  1NUK A;  1CZS A;  1UXZ A;  4D8M A;  2VZQ A;  3T0A A;  1NAE A;  1DP0 A;  2E26 A;  3ECQ A;  1WKY A;  2ZXQ A;  2W9X A;  5I0D A;  2V5D A;  3W5M A;  2W91 A;  4ZXE A;  4OMC A;  4OZO A;  5JUV A;  1LNS A;  5EJZ B;  2VQT A;  3OEB A;  5LCW L;  2L9L A;  1H6Y A;  4PF1 A;  2VZU A;  4GZ9 A;  3WNN A;  3ACH A;  3U37 A;  2DCK A;  1IQD C;  2CDP A;  4QDS A;  1K3I A;  1W9S A;  2CDO A;  3LQC A;  1JZ4 A;  1J83 A;  3NJX A;  3K4D A;  1XNT A;  4L0P A;  3I3B A;  3P1I A;  1XC6 A;  2KD7 A;  3CQO A;  3I3E A;  4BK5 A;  4TTG A;  3SEP A;  4PQQ A;  3I97 A;  5HXM A;  5B4X A;  1UXX X;  4ZZ8 A;  5LA1 A;  4FI9 A;  3HPN A;  3UES A;  3I3D A;  3WF0 A;  2VL4 A;  3NNG A;  1EUU A;  4W8J A;  1P8J A;  3E1F 1;  2J1R A;  2C9K A;  4CUB A;  2W94 A;  1UY2 A;  3FHA A;  3K4A A;  2YG0 A;  3T2O A;  2X05 A;  4A3Z A;  3I2H A;  2EID A;  1TG7 A;  2QQK A;  3DYO A;  3BGA A;  3ACF A;  3I2G A;  4A42 A;  3OG2 A;  1GQP A;  4CVU A;  4QDR A;  1ULP A;  3MO4 A;  1UMI A;  2LS6 A;  5C71 A;  1UX7 A;  5JXH A;  2W3J A;  1TVG A;  4A4A A;  2J1A A;  2QQI A;  2RJ2 A;  2BBA A;  3T2Q A;  3GM8 A;  4ET7 A;  4E8C A;  2J1E A;  3PUH A;  1UWW A;  4QB6 A;  2BZD A;  3A21 A;  4P5Y A;  1JYV A;  3HJR A;  2QBX A;  3LEI A;  2EIC A;  4UAP A;  2ZEZ A;  3OB8 A;  1GOH A;  3WF2 A;  1BHG A;  3HOB A;  3MV1 1;  1ULO A;  2YC4 A;  2B4K A;  2Y6H A;  2YFZ A;  4M4P A;  4ZY9 A;  2E31 A;  3MUY 1;  1JU4 A;  1O59 A;  5EJ1 B;  3ABZ A;  2VMF A;  2JKX A;  2PQS A;  2Y6G A;  2DDU A;  4AAX A;  3WF1 A;  5DQ0 A;  4CUC A;  1I5P A;  2W87 A;  4TXW A;  2JE8 A;  2WDB A;  3CIH A;  4RN5 A;  4AG4 A;  3EYP A;  3VD9 A;  2ID4 A;  2WAA A;  4BK4 A;  2Y6L A;  2ZEX A;  1JHJ A;  3HN3 A;  1W8N A;  1W9W A;  1KEX A;  3WF3 A;  5JMO A;  2EIB A;  2VCA A;  3MV0 1;  2VZR A;  3C7O A;  1UYZ A;  3EB7 A;  5DN2 A;  2XQX A;  1UZ0 A;  5DPN A;  2VO5 A;  2VZV A;  3K46 A;  1T2X A;  1DLC A;  1US2 A;  2RV9 A;  1SG3 A;  3LPF A;  4LPL A;  1KGY A;  4QB2 A;  2VMC A;  4MO3 M;  2VZP A;  3NRU A;  1W99 A;  3IDA A;  1JZ8 A;  1JI6 A;  2VZT A;  3THD A;  5JR2 A;  2R7E B;  3DYM A;  3DYP A;  4QX3 A;  4DUV A;  1OD3 A;  5LA2 A;  1GUI A;  2ZEY A;  3UET A;  4DXR A;  1HN1 A;  3IAQ A;  5G04 L;  2WN2 A;  4DXS A;  3C7F A;  5JXJ A;  2Z4F A;  3FHQ A;  4IUG A;  1D7P M;  2HLE A;  3CZJ A;  4PT6 A;  2VMD A;  4Z2A A;  2W1U A;  4ZZ5 A;  2C26 A;  1SHW B;  2BER A;  2WQ8 A;  3WNP A;  3SKJ E;  2ORZ A;  4QDQ A;  4A6O A;  3A23 A;  3K75 B;  2VZS A;  1JYX A;  4W50 A;  4BXS V;  1JZ3 A;  4XUO A;  4OYU A;  5HPO A;  1F4A A;  4BDV B;  1PMH X;  1SDD B;  4JKM A;  3I2I A;  1PX3 A;  1MPX A;  2XON A;  4OUE A;  2VC9 A;  2YFU A;  3I2J A;  3OGR A;  4DXT A;  1UY4 A;  3OEA A;  4CUA A;  2W46 A;  5FUI A;  3OBA A;  3WEZ A;  3C7G A;  3HEI A;  3C8X A;  2VQU A;  2JDA A;  5A1A A;  3IB3 A;  4JHZ A;  3WNM A;  3WF4 A;  3CKH A;  2YB7 A;  3MBW A;  1PMJ X;  4KI5 M;  4MGS A;  1DYO A;  2QQO A;  2OKX A;  1W9T A;  5IJR A;  5IFT A;  1GOG A;  4E8D A;  1RYY A;  2E32 A;  3MUZ 1;  3WNL A;  1UYY A;  1CZT A;  1PX4 A;  2J1S A;  2XOM A;  3HNY M;  3ACI A;  4CU8 A;  2JD9 A;  2VM9 A;  4A45 A;  1JZ2 A;  4D0Q A;  2VCB A;  1OH4 A;  3VDC A;  3T0D A;  2Y6J A;  4UI9 L;  4A44 A;  2WO2 A;  2WAO A;  1GMM A;  4W4Z A;  4CU7 A;  4M4R A;  4QX2 A;  4QPW A;  3BN6 A;  3THC A;  3WNK A;  5G05 L;  5CYY A;  1J84 A;  1EUT A;  2X09 A;  2VJX A;  2J1T A;  4A41 A;  2VME A;  3VD4 A;  2BGO A;  4JKK A;  4ARX A;  2VZO A;  2WN3 A;  3J7H A;  3OGV A;  1O8S A;  1O8P A;  2X10 A;  3K77 A;  2QQN A;  2WAB A;  4JKL A;  2WBK A;  1OF4 A;  2V72 A;  4JX0 A;  3C7H A;  2W5F A;  2VOT A;  2DCJ A;  2VTF A;  1JYW A;  5LA0 A;  3CDZ B;  3ETP A;  5CZK A;  3T2P A;  2QQJ A;  2W1W A;  3AC0 A;  3WSO A;  3FN9 A;  2J1V A;  5IHR A;  2WUH A;  1K42 A;  2EIE A;  2YC2 A;  4MGQ A;  1W8O A;  4OMD A;  5C7G A;  3GGL A;  1US3 A;  1NKG A;  4P02 B;  2QQM A;  1K45 A;  2WO3 A;  2WZE A;  3LEK A;  4XUR A;  4CU9 A;  3FL7 A;  1CZV A;  3T08 A;  2XHN A;  2V4V A;  3SEE A;  4XZU G;  5C70 A;  3CZU A;  1JYN A;  2W47 A;  2C4X A;  2B9V A;  1WCQ A;  4GWI A;  2W92 A;  4MOA A;  3VD5 A;  1UYX A;  1UY0 A;  1JZ6 A;  1R64 A;  3GXU A;  2Y6K A;  2Y8K A;  5EIY B;  3W5N A;  4HG6 B;  3F2Z A;  3LE0 A;  3WNO A;  2RVA A;  3GDB A;  2VR4 A;  3UNP A;  3NQH A;  2LW8 A;  2WZ8 A;  2J22 A;  3HNB M;  4MAD A;  4CU6 A;  3PUI A;  1XNA A;  1L7Q A;  1XPW A;  2VZ1 A;  4P08 A;  1CIY A;  4DUX A;  1GNY A;  3T09 A;  5B4N A;  1OF3 A;  3K4Z A;  3C7E A;  5JXI A;  4LKS A;  4QAW A;  5IFP A;  1UY3 A;  3III A;  4BJ0 A;  4YPJ A;  2J7M A;  3IAP A;  3P6B A;  2W95 A;  4QX0 A;  1L7R A;  3A22 A;  3A7Q A;  5JXG A;  4P00 B;  1K12 A;  3LPG A;  2WO1 A;  5DMY A;  2E33 A;  4QX1 A;  3LEG A;  2VCC A; 
#chains in the Genus database with same CATH topology
 3KHC A;  1LGC A;  3VD7 A;  4ZS3 A;  1RUC 1;  5CFD C;  3I2D A;  4DEQ A;  2GC2 A;  4LLF A;  4ZON A;  5CEH A;  1JZ5 A;  3PME A;  4QHO A;  1CIW A;  1K5M C;  3GCW A;  1MEC 2;  3WG1 A;  3PTR B;  1LOC A;  4UFI A;  2TNF A;  4IXL A;  1RUD 2;  3OBT A;  4XUT A;  5DG2 A;  4QMA A;  1O5U A;  1QNW A;  4YM1 A;  2BWA A;  4CCM A;  4MGY E;  3ZFG B;  1JOD A;  2CWS A;  1JYI A;  1VRH 2;  4LHS A;  4XTP A;  1OH3 A;  5T55 A;  2ZTN A;  2X29 A;  4AOC A;  1RXG A;  3DXT A;  2QQL A;  2NN8 A;  1W0N A;  1EV1 3;  1RED A;  3A0N A;  3I2F A;  5C3O A;  3JXS A;  3LIG A;  4LOR A;  1S2B A;  2Y64 A;  5JZG C;  2J1U A;  1HB1 A;  1ND3 C;  2FDJ A;  3NJV A;  4JGZ B;  4QPI B;  4GJZ A;  5GAL A;  5J1X A;  2QFE A;  1LEN A;  3POB A;  4XDO A;  3D3A A;  2CNA A;  3N9Q A;  1IGO A;  2ZX1 A;  1SEF A;  5JR7 B;  2R0H A;  3CL1 A;  3O7O A;  4GKX A;  1DGL A;  2BGP A;  3CMG A;  1VB2 A;  1B35 C;  3PNA A;  3DPR A;  4RYD A;  1ASJ 3;  1W0P A;  1NCQ B;  1XNB A;  1LOD A;  2BNM A;  2FBE A;  2HYX A;  1RIN A;  2R04 3;  1YQ6 A;  1NUK A;  4XQ4 A;  3JD7 1;  2GSY A;  2ZHL A;  4XCB A;  3T0A A;  3VBR C;  1W8H A;  4YM2 A;  2H0V A;  4MHU A;  3VKM A;  5FJK A;  3H8O A;  2E26 A;  4D7Y A;  5FPZ A;  2FQP A;  1WKY A;  2ZXQ A;  3M1H A;  1O3R A;  1AZD A;  2W9X A;  3LFM A;  5FMB A;  3VBU B;  4BU2 A;  5IVJ A;  5F5Q A;  2JDM A;  2W91 A;  1W2T A;  3WQ7 A;  4C90 A;  1BBT 2;  3NV3 A;  1LGB A;  1ZA4 A;  3RSJ A;  4LBQ B;  3J8F 3;  2AH2 A;  3RWN A;  4H7M A;  5EJZ B;  4CSW A;  1VBC 2;  4IDZ A;  2ZJC A;  4HSJ A;  1HDK A;  4IV1 B;  1UZZ A;  2WKK A;  5CFC C;  4YG3 A;  1V9U 3;  2L9L A;  4I02 A;  2XUM A;  5GKA C;  4PF1 A;  4OI2 A;  4E27 A;  4YW6 A;  3TB0 A;  2OS2 A;  3ACH A;  1W6M B;  4LJH A;  3IKW A;  2DVB A;  3OD4 A;  1CAV A;  1ULD A;  5JPM B;  1IQD C;  3CF6 E;  2D7F A;  1R09 2;  1K3I A;  2OQ6 A;  3D8C A;  3OTF A;  1JZ4 A;  4COW A;  2CL2 A;  1AR7 1;  1XNT A;  3ES4 A;  1YJL A;  4DXZ A;  5T5L A;  3I3B A;  5AFB A;  1RUG 3;  4NR1 A;  3U07 A;  2UUR A;  4QGM A;  2D6M A;  2HWB 2;  4KWL A;  3ZO0 B;  4KU7 A;  1UOF A;  1UOB A;  2MEV 3;  1HV0 A;  2AAC A;  4L11 A;  1SCS A;  2WFP A;  1NLQ A;  3I3E A;  1V70 A;  5FZ1 A;  4TTG A;  3SEP A;  4PQQ A;  4XAC A;  1RMU 2;  2IXH A;  1ZZB A;  3WDV A;  1S0C A;  4YZ4 A;  5B4X A;  1BK1 A;  4HVQ A;  4ZZ8 A;  2Q1M A;  4M0N A;  4TZD A;  1EP0 A;  3HPN A;  3FLP A;  3N35 A;  4C0B A;  5FR3 A;  2W2I A;  3WF0 A;  1HRI 1;  1DHK B;  1EUU A;  4LXL A;  2FCT A;  3E1F 1;  3LD8 A;  1IPK A;  4E2G A;  1KJR A;  2VBD A;  4Q4W 3;  5J3U A;  2G4I A;  2VAU A;  3VBS A;  5A32 B;  5A7N A;  2X05 A;  2JIC A;  2I74 A;  5GZD A;  5FKB A;  4A3Z A;  1SMV A;  2ATF A;  2HKX A;  2HH9 A;  4PI0 A;  4UFJ A;  1NXM A;  2JB4 A;  1TMF 3;  5ACA 2;  1X9P A;  2HWF 2;  4AED C;  2XL9 A;  4BIS A;  3ZSK A;  5BNN C;  5FZB A;  4CEY B;  1COV 2;  1RUE 3;  2CYF A;  2QQU A;  3KQ4 B;  4RA0 A;  4XF9 A;  2P17 A;  3VKN A;  3ZYI B;  4WM7 B;  5F3G A;  1HRV 3;  3T1M A;  3HBZ A;  5D21 A;  3ZXA C;  1JS9 A;  4C91 A;  3H8U A;  1GZW A;  3M7A A;  4F3J A;  3E6B A;  1PZ7 A;  4AHY A;  1G9D A;  3MLL A;  2J1A A;  2QQI A;  5JPN B;  1Z7S 3;  3HR9 A;  1V6I A;  1YO8 A;  3GJA A;  4PI2 A;  1UW8 A;  5DZG A;  4E4S A;  5B2G B;  1T6G C;  2NZ9 A;  1OLQ A;  2P3I A;  2ZGN A;  3N9L A;  1OOP A;  1MS9 A;  3WW3 A;  5KWR A;  1S0E A;  3FC0 A;  2ET7 A;  2EXH A;  3NVC A;  2UYB A;  3E97 A;  5A33 A;  1C3H A;  3SCG A;  2DVA A;  4Q4X 2;  3WOG A;  2KA3 A;  4KL1 A;  3TBD A;  1X9T A;  4XF4 A;  3VL8 A;  3ZXE A;  5ABJ C;  2ZEZ A;  1A34 A;  3N9N A;  2V4A A;  3R05 A;  1MR5 A;  2BOI A;  1K5M B;  4M01 A;  4AR2 A;  1QQP 1;  3WF2 A;  4BB3 A;  1BHG A;  1XE0 A;  2D97 A;  1ULO A;  2VBP A;  1QJU 1;  4A7K A;  4Q4V 2;  2O1Q A;  4AI1 A;  3VBH C;  1BVP 1;  2JWP A;  2YFZ A;  4HK8 A;  5FQ0 B;  4BME A;  1PGL 1;  2E31 A;  3MUY 1;  2DWR A;  2X53 S;  2O8Q A;  4O61 A;  4S2G A;  1H9W A;  5LBB A;  1QF3 A;  3SHR A;  1GBG A;  1QJX 1;  2VMF A;  4IW3 A;  2Q1Z B;  3DGT A;  3WDT A;  4W65 A;  2DDU A;  3WF1 A;  4NUB A;  1POV 0;  1Q8Q A;  4LHK A;  3OF1 A;  4EYU A;  2XLG A;  4Q8K A;  1I5P A;  4AG4 A;  2FDF A;  3EYP A;  1QXR A;  1VP6 A;  1IG3 A;  3FUQ A;  3AZX A;  2R6Q A;  1JH5 A;  5D8A C;  1S2E A;  2CY6 A;  4D69 A;  1KQR A;  3USU A;  1DYP A;  2BP6 A;  3O1O A;  4AK3 A;  2BFU S;  4AFC A;  1KEX A;  2MHF A;  1V6N A;  3AP9 A;  4XF0 A;  4QQO A;  3RNS A;  5FZ6 A;  5FXV A;  5FTT C;  1J59 A;  2VZR A;  2OT7 A;  3W58 A;  2XQX A;  5DAP A;  4PCR A;  4B29 A;  3S30 A;  3BB6 A;  3MHZ A;  4CDX A;  1ZZ6 A;  2H6C A;  1T2X A;  4QXH A;  3BOD A;  2ZGL A;  4K1Y A;  3POJ A;  4MXV A;  5LK7 B;  4LPL A;  2WFF 3;  5CAD A;  3POG A;  1E5R A;  1TME 2;  4PJY A;  4A3X A;  4QB2 A;  4MO3 M;  2D6O X;  2Y34 A;  2VZP A;  5K0U C;  1W99 A;  4DPN A;  1BMV 2;  1CN1 A;  2RS3 2;  1FMD 2;  2ZZJ A;  2VZT A;  1EY2 A;  1GZC A;  3DYP A;  4QX3 A;  1GKB A;  1OD3 A;  5LA2 A;  2VMI A;  5FYV A;  4YFZ A;  5F1R A;  4XBL A;  5BUV A;  2ZEY A;  4Z92 B;  1FPN 1;  3DN7 A;  3UET A;  1HN1 A;  2FMY A;  4I0W B;  2QE3 A;  2FCU A;  2PAE A;  4KBZ A;  3ZLI A;  4U2A A;  2WLQ A;  5FZH A;  5GLV A;  5T54 A;  4O7X A;  1BJQ A;  1H2L A;  3VBF B;  2WN2 A;  4K20 A;  2Z4F A;  3D5O A;  1C57 A;  1RVF 1;  4WV8 A;  5FV3 A;  5FP4 A;  1D7P M;  3RMY A;  3RG0 A;  1QJE A;  1QOS A;  1DZQ A;  4GAL A;  5FCC A;  4NAM A;  4Y26 A;  2EA7 A;  3AXD A;  3LA7 A;  4EQV A;  2VXR A;  5E8A A;  2C26 A;  3MLK A;  3WG4 A;  2D3R A;  3PTY A;  1SHW B;  5L7O C;  3PIJ A;  2WZR 2;  2WQ8 A;  1IKQ A;  3ZKU A;  4AQ6 A;  2IVJ A;  4LO8 A;  3RJR A;  3DV8 A;  3WNP A;  3QLQ A;  3SKJ E;  2NYY A;  4QDQ A;  1VR3 A;  4A6O A;  5AFE A;  5FPU A;  2NMN A;  3RRD A;  2ZGM A;  3JBG 2;  1JYX A;  1FOD 2;  4GWN A;  2MNG A;  1JZ3 A;  1W06 A;  5DDJ 2;  4JAA A;  4Y5Z 0;  2PHD A;  3H7Y A;  5HCB A;  1HB4 A;  4QKD A;  1MPX A;  5FUP A;  2VC9 A;  3H42 B;  1EPW A;  2ZGQ A;  1UY4 A;  1PK6 C;  1CJP A;  4ONU A;  4JZR A;  5HV0 A;  1K42 A;  1AR9 2;  1I9R A;  3OBA A;  5KXE A;  4JTN A;  1L3J A;  1SBD A;  4MYE A;  4NIA A;  5GZC A;  2ES3 A;  2VQU A;  1W6N B;  2JDA A;  4B3N A;  3WNM A;  1R1A 1;  3WF4 A;  1ENR A;  2JDZ A;  1RUJ 2;  4XFA A;  5IVV A;  1MEC 1;  3I3M A;  2E7A A;  2RR1 2;  4KI5 M;  5T50 A;  4NRM A;  4HZF A;  1RUD 1;  4MGS A;  5FIX A;  1AL2 1;  1DYO A;  4J1X A;  2QQO A;  2QQV A;  4C1W A;  4PLM A;  1VRH 1;  1QXJ A;  2XGX A;  4LKD A;  1X36 A;  5FY0 A;  3KV5 A;  2ZGO A;  1GP5 A;  5T52 A;  1SDW A;  1RYY A;  2WNV A;  4QHZ A;  1N1S A;  2B8M A;  2PAM A;  4COU A;  4PF5 A;  4I30 A;  2YU2 A;  3ETQ A;  3OY8 A;  1UQX A;  4FQ4 A;  5EJ3 A;  4RSU A;  4FPJ A;  4Y20 A;  1HB3 A;  4CU8 A;  4TLF A;  5BXX A;  3OD0 A;  4D0Q A;  1MQT C;  4AI8 A;  1JZ2 A;  4OUM A;  3VDC A;  1RUH 2;  2BUK A;  4IEV A;  4Y4R A;  5LBE A;  2GND A;  4AVV A;  5F9T A;  4DOU A;  1X8E A;  2WAO A;  4NMI A;  1W8W A;  1VMF A;  2VOK A;  5C5T A;  2WIN B;  2UY8 A;  3ZFE C;  2XKO A;  3WQ1 A;  4E4H A;  3BU0 A;  5FKC A;  4AVS A;  1YYN A;  4XIL A;  1GR3 A;  2W68 A;  2VW0 A;  3ZN5 A;  3CO2 A;  4J6G A;  4ES8 A;  2X5I A;  4BQX A;  5T5O A;  2VJX A;  4GH4 B;  4WM8 B;  3TAY A;  1DGW A;  2Y38 A;  4CP2 A;  1V6M A;  4CEW C;  3VD4 A;  2XJT A;  3INA A;  1VBB 2;  2P4E A;  5APA A;  4JKK A;  1Y9M A;  2VZO A;  2RS5 3;  4AVA A;  2BU9 A;  2CGN A;  3VV1 A;  2FZ2 A;  3AB0 A;  1AYM 3;  3MW3 A;  3JZV A;  1F9K A;  2JG8 C;  3N4M A;  3I3Q A;  1O8P A;  2QQN A;  2WAB A;  3AK0 A;  3B5L B;  3DL3 A;  4N9H A;  1NE4 A;  2V72 A;  4UBG A;  2JDN A;  3C7H A;  2IFW A;  4RR3 B;  4XFF A;  1KJL A;  3RGB A;  4P9I A;  3WVJ A;  2AC1 A;  3ZMN A;  3R4U A;  2VTF A;  2WA4 A;  4RGA A;  3CDZ B;  3ETP A;  5CZK A;  3O1P A;  1LHU A;  3DKQ A;  5D1I A;  4IEP A;  4QX7 A;  1R09 1;  2I45 A;  3AC0 A;  5FLH A;  3T2P A;  3W59 A;  4YZ2 A;  3SIT A;  4E4D X;  1DQ6 A;  3JD7 2;  3WSO A;  2WNU C;  3FN9 A;  2EF6 A;  4YW5 A;  2ADE A;  3GBG A;  5K0U B;  5IHR A;  2ET1 A;  3AMQ A;  4X8N A;  2D3S A;  1DIW A;  2WUH A;  2OA2 A;  2EIE A;  3AKP A;  2YDE A;  3AP6 A;  3N9M A;  1W8O A;  4OMD A;  4P9L A;  4QKB A;  2WZP P;  4D6Q A;  3GGL A;  3U11 A;  1V00 A;  2Z69 A;  2PHR A;  3TEW A;  5EZW A;  5LRS A;  2WWS A;  4MUV A;  4RFT 0;  1AXK A;  3B01 A;  1RMU 1;  1WA6 X;  2ZKN A;  1OA3 A;  2CSG A;  2A3Y A;  5LK5 A;  3SNM A;  3TEZ A;  2PMW B;  3RZL A;  2FDG A;  2CAU A;  2G1M A;  1ULF A;  2QZ2 A;  2VCM A;  3LEK A;  4GB3 2;  4XFG A;  4XDQ A;  4XUR A;  1F15 A;  5FP7 A;  4CU9 A;  1DYK A;  3SEE A;  2GNT A;  2Z42 A;  4XZU G;  1BBT 3;  5F5A A;  3KF5 A;  4XET A;  4E9K A;  3N9O A;  4K8R B;  1OLM A;  2DTY A;  3P3P A;  2DVG A;  4IER A;  5LB6 A;  2C4X A;  2A7A A;  4GWI A;  3V65 A;  1VBC 3;  3ZIX A;  4P5H A;  5I0S A;  4NWV A;  4Q0P A;  4W6Y A;  5LZ6 A;  1PK6 A;  1UX6 A;  2RM2 2;  4CDW A;  3WDU A;  3OPZ A;  1C5I A;  4W6X A;  1R08 2;  1D0H A;  1AR8 2;  1PO1 3;  1CPM A;  1R64 A;  1WMD A;  2HWF 1;  2OW4 A;  4YVW C;  2KM2 A;  2RMU 2;  1LEC A;  2XJP A;  1BEV 3;  3AP7 A;  3KV4 A;  3W5N A;  1LGN A;  1COV 1;  4IEU A;  1YRZ A;  4GIQ A;  3PVO A;  5GZG A;  1M4W A;  2WS9 3;  3LE0 A;  3WNO A;  2RVA A;  5K8S A;  1FNY A;  2ZAC A;  1JYT A;  3H1W A;  2HWB 3;  2J22 A;  2GME A;  3AL6 A;  3ZYJ B;  1MVQ A;  2Q1F A;  1W6P B;  5FY9 A;  2Y0O A;  2LM3 A;  2D6N A;  2E7Q A;  1KXG A;  1VB4 A;  2BFU L;  1L7Q A;  4HKL A;  1U5X A;  1Y9Q A;  4DUX A;  1CX4 A;  1ZBE 2;  1MS3 A;  1YI9 A;  5HI0 A;  1OF3 A;  3LOI A;  5C9A C;  1GP4 A;  2Q4S A;  5IFP A;  1HN0 A;  2AEY A;  3W9A A;  1QGL A;  2VOV A;  3IMM A;  1OA4 A;  2JEC A;  2NMO A;  3VHO A;  1H8T B;  4YPJ A;  4B4R A;  5CBL A;  2BEO A;  4RQP A;  4AZZ A;  3B9C A;  4Y24 A;  3BOW A;  3JQW A;  2W95 A;  3PMS A;  4XJ9 A;  3BIE A;  2WRA A;  3A22 A;  1D4M 3;  1LOA A;  2WL1 A;  3AMM A;  4HLT A;  4P00 B;  1K12 A;  2XVL A;  3NWK A;  4L8Q A;  3GCX A;  2WO1 A;  4WVZ A;  5ACA 3;  4NHM A;  4PIX A;  4QX1 A;  3ZYF A;  3ILN A;  1QEX A;  3LA2 A;  2VCC A;  3MIC A;  4GMP 1;  4S2F A;  3WHU A;  4LA2 A;  3WQB A;  3ORJ A;  2GMM A;  3IIA A;  4CDU B;  3O1R A;  1RHI 2;  1VBD 3;  2GNM A;  4Q4Y 2;  4XVH A;  1AR6 3;  2BVB A;  4NIH A;  3AKS A;  1H6X A;  3ZYG A;  4CEW A;  2PLV 3;  1H0B A;  1HV1 A;  1YQ2 A;  2VGD A;  5FZO A;  1MZ5 A;  2D6L X;  5E6H A;  2R32 A;  2RS1 3;  3EO6 A;  5A3W A;  5FAX A;  4NRQ A;  2BYV E;  4OCT A;  1YQ8 A;  4URT A;  3K3N A;  5HBA A;  5IVE A;  4OHW A;  4Y1X A;  3VD3 A;  2F4P A;  2ZBJ A;  5FPA A;  2P1B A;  4DEV A;  1EYB A;  1OSG A;  3ILF A;  1E5I A;  1D2Q A;  4N90 A;  3ZFE B;  4XAB A;  5KHJ A;  2A75 A;  4FO9 A;  2GC0 A;  3SC7 X;  5FPX A;  4FQZ A;  1GAN A;  1PNG A;  4Q4X 3;  1STM A;  4RS5 C;  3JCI A;  1QH7 A;  1WCK A;  4FFH A;  1D0G A;  1N3Q A;  4MGZ E;  4CXX A;  4D94 A;  4XW3 A;  1PZ9 A;  5F5I A;  3T4V A;  4XJU A;  4ARY A;  4KMQ A;  1I5Z A;  4EJR A;  2VEC A;  5C4W C;  4FBF A;  5FY5 A;  1QJY 2;  1SFN A;  2OUH A;  3I7D A;  4N53 A;  5LEK A;  1TME 1;  4Q4V 3;  1LHN A;  2TUN A;  2WII B;  5DG1 A;  5I8T A;  2WYS A;  4MH0 E;  5C8C B;  2AEN A;  1BMV 1;  2ZML A;  1NA1 B;  2RS3 1;  4N43 A;  4BZ4 A;  2DBI A;  4DUW A;  2W1S A;  3TNP B;  1W2U A;  4QPG A;  1JN2 P;  2DV9 A;  4M0H A;  4BE3 A;  1MS0 A;  4GA9 A;  3ECQ A;  5FMC A;  3H0O A;  2EAL A;  3MID A;  4GKY A;  3WG2 A;  4D3W A;  3L9J T;  1OUS A;  1O7F A;  4MET A;  4ZXE A;  2QZ3 A;  3DPR C;  4M3C E;  3EMR A;  5F6L B;  1HXS 1;  2ZS6 B;  2W08 A;  5CNA A;  3W20 A;  4E4Z A;  2B45 X;  5IVB A;  1YWK A;  4QM9 A;  4KWK A;  1JOP A;  4XAA A;  4FVV A;  1POV 1;  2XG3 A;  2VQT A;  1IOA A;  4ATE A;  1DCS A;  2WZR 1;  3FBY A;  3Q8B A;  4AVC A;  5FP8 A;  3NNF A;  3PUR A;  4GZ9 A;  5DXD A;  1Q3E A;  1OKO A;  2DCK A;  3VHN A;  3OGG A;  4RHV 2;  1OHF A;  2CDO A;  5FPL A;  1O3Q A;  1S4C A;  1W6O A;  3JBG 1;  4RGK A;  1DG6 A;  1FOD 1;  1N47 A;  4H7L A;  5AC9 3;  5DDJ 1;  4B1L A;  4IE7 A;  1F8V A;  4KWJ A;  3RWK X;  1FMD 3;  3VB9 A;  3PUQ A;  3PVN A;  4YM3 A;  2HWC 3;  1DQ0 A;  3CQO A;  4K1Z A;  5FMD A;  1D4V B;  4GWM A;  2HWD 3;  3ZN6 B;  3VKO A;  4AGG A;  1DZT A;  4IV3 B;  2OYZ A;  1IS5 A;  4Q0V A;  2CTV A;  2LAL A;  3I97 A;  2XBO 2;  1AR9 1;  5C8W A;  1NT0 A;  1UXX X;  2JDY A;  1GLH A;  2XJU A;  2ZGP A;  2SLI A;  4JGY B;  5A3M A;  4Q0U A;  5IVY A;  3WV6 A;  3H7J A;  1W8F A;  1TNF A;  2VL4 A;  3CHX A;  3NNG A;  2ZGU A;  2RG4 A;  3O14 A;  2GP5 A;  4LO7 A;  4Q0Q A;  1RUJ 1;  4W8J A;  3VBO B;  4F7Z A;  2A70 A;  2RR1 1;  1AXZ A;  4ZHN A;  2W94 A;  3SLI A;  4YW3 A;  4TWT A;  1UY2 A;  1ND2 A;  3FHA A;  5A3O A;  3AMN A;  2YG0 A;  5KXB A;  4YW1 A;  1JBC A;  3LDR A;  5BNO B;  3I2H A;  4R9C A;  2QQK A;  2O8O A;  1C1L A;  4UFL A;  1SPP B;  3BGA A;  4CCJ A;  4EWA A;  1YIF A;  2Q0A A;  3I2G A;  4LO4 B;  4FP2 A;  3WIN E;  1OQ1 A;  4QDR A;  2RDS A;  5J98 B;  2QDR A;  3CJI B;  3IN9 A;  3NNM A;  3OPT A;  2WC2 A;  3BPS A;  3TN9 3;  5CKM A;  3PUA A;  3WUD A;  4DIN B;  5JXH A;  4FTE A;  2JXA A;  4YVS B;  4A4A A;  2VOX A;  3OBZ A;  1MS8 A;  1AYN 2;  2AYH A;  4BXF A;  3R0R A;  4LHN A;  3GM8 A;  4ET7 A;  1LB2 A;  5F3E A;  1I3H A;  2DCY A;  2J1E A;  3RZM A;  3B7M A;  1IQA A;  1S0F A;  3VUO A;  1AL0 G;  1R1A 2;  2BWC A;  3POE A;  4CCN A;  3WP4 A;  2QQP A;  1JYV A;  1AX0 A;  2JE9 A;  5HCF A;  3RI8 A;  2PHX A;  2EIC A;  4RS5 A;  4Q1R A;  4CP9 A;  5FZK A;  2DVF A;  1AL2 2;  4AEM A;  1HIX A;  2JDP A;  4I0A A;  2DUP A;  1FX5 A;  1AJO A;  3FFZ A;  2D44 A;  5C4W A;  1JMU B;  3CNA A;  1VBB 1;  4N9I A;  3POI A;  5H9P A;  1OOP C;  2B4K A;  2DCT A;  1XYP A;  3KCC A;  3JB8 A;  4M4P A;  5L9V A;  4LT5 A;  4ZY9 A;  2XLF A;  3H1M A;  5JSO A;  1UU6 A;  1JU4 A;  1L7L A;  2QJV A;  3NMB A;  2JKB A;  1WME A;  4XFC A;  5EJ1 B;  2V73 A;  1FYU A;  1IHM A;  5C3Q A;  4IEY A;  5F2S A;  4KG0 A;  1JOB A;  3OJB A;  2O0O A;  2KR2 A;  3LKJ A;  3Q8C A;  3UGG A;  4CUC A;  5BNQ A;  2W87 A;  4TXW A;  2XML A;  4QD2 A;  1SZB A;  2OZ6 A;  1CVN A;  5J96 B;  2B39 A;  2ID4 A;  1NCQ A;  3AZW A;  4IEX A;  1TEI A;  1K5J A;  1RUH 3;  1QY4 A;  2ZEX A;  4AI3 A;  4BK4 A;  1H1I A;  3RZZ A;  4N7I A;  1ZRR A;  1RUC 3;  5JMO A;  3H3Z A;  2EIB A;  1RUI 2;  4XFH A;  3UJQ A;  3E6D A;  5FYC A;  1C5H A;  3MV0 1;  2WSU A;  3MEP A;  1UYZ A;  3ES1 A;  3VBU A;  4Y22 A;  5FY4 A;  2NLR A;  3APB A;  5HCA A;  1BLZ A;  1NE6 A;  1BCX A;  5IVF A;  5DPN A;  2JIG A;  2VO5 A;  4BIO A;  4EZH A;  4FPG A;  1TZO A;  2MPF A;  5FZF A;  1US2 A;  1WCD J;  2RV9 A;  2VQA A;  4LBQ A;  1YFW A;  2QNK A;  2Q8D A;  1W0O A;  3HWJ A;  1KGY A;  3U10 A;  4ES9 A;  1FI2 A;  3WZ1 A;  4GB3 1;  4IV1 A;  5DAV A;  3AP5 A;  2DTW A;  3MIB A;  4Y4Y A;  1ULE A;  3AVR A;  5A7P A;  4CCL A;  1RB8 G;  3LIH A;  3WDY A;  1W6M A;  2EXK A;  3NAP B;  4CDX C;  4OHY A;  3UKT A;  5JR2 A;  4GQ7 A;  1IS6 A;  4BQY A;  4JQR A;  5IWF A;  2OXB A;  4AXO A;  3O1U A;  2RM2 1;  4DXR A;  4HON A;  3HT1 A;  1R08 1;  1IKP A;  3NJZ A;  1SBE A;  1AR8 1;  1YEW A;  2GAU A;  2GMP A;  3IAQ A;  5CA6 A;  5IK4 A;  1KS4 A;  2GC3 A;  2RMU 1;  4M3C B;  4XCA A;  1RUO A;  5DUU A;  2ZHM A;  3GZE A;  5FUN A;  4PT6 A;  4DZG A;  4PDW B;  3JD7 3;  5CU1 A;  1ALY A;  3ZKY A;  4CZS A;  4EN7 B;  5DAX A;  4Z2A A;  2PHU A;  3SH4 A;  2ZX2 A;  5A7W A;  4HOO A;  3RJ2 X;  3ITQ A;  2P34 A;  3WW2 A;  4EWE A;  3I2O A;  1S2K A;  2BER A;  3O0X A;  3M3Q A;  3ZVX A;  4Z1V A;  1KIT A;  5A1F A;  1YJK A;  1PO2 2;  3B00 A;  1ZBE 1;  3L2H A;  3HQR A;  3KVB A;  2VXJ A;  1UN1 A;  1U5Z A;  4QGL A;  4IQP A;  4EN6 B;  2K0G A;  1MZE A;  3K75 B;  2VZS A;  3AYD A;  4MX3 A;  4XUO A;  4KU8 A;  1G9B A;  1PVX A;  1SLA A;  1ZYB A;  4HSL A;  3WP3 A;  4CXW A;  1SDD B;  4AYU A;  5FXW A;  3POF A;  1PX3 A;  3I4I A;  2RHP A;  4AW7 A;  1UD1 A;  4CEY A;  2XON A;  4OUE A;  4QXK A;  3MLJ A;  4HN1 A;  4WM7 A;  1DQ4 A;  3UL2 A;  2VOW A;  3OGJ A;  5GLW A;  3OUH A;  2BJS A;  1F5J A;  5DUX A;  4I3P A;  1AR7 3;  3AVS A;  5FUI A;  5DUW A;  5A7Q A;  5C33 A;  3KVA A;  4QKN A;  3B3Q E;  5FO7 B;  5H9Q A;  3C7G A;  3K51 A;  2OX0 A;  3HEI A;  3GZA A;  5D2A A;  1J58 A;  1RHI 1;  4Z8B A;  2XDV A;  3IB3 A;  4JHZ A;  1EAH 2;  2E51 A;  2YYO A;  4Q4Y 1;  2YB7 A;  4UT5 A;  3VBS B;  4EN8 B;  1PHM A;  5DZE A;  2RJL A;  4AWD A;  1WLW A;  2A71 A;  2ZHN A;  1ACC A;  4XJW A;  2D5H A;  1G7Y A;  2GNB A;  4CA9 A;  4B8E A;  4HFS A;  1XE7 A;  1CD3 G;  1M06 G;  1UPI A;  1GZT A;  4I3G A;  2OKX A;  1W9T A;  2DCZ A;  5CFD B;  1HRI 3;  1MS5 A;  1T6B X;  2DUR A;  1GOG A;  3PL0 A;  4E8D A;  2E53 A;  1PVC 2;  1O4Y A;  4YZ3 A;  3V64 A;  2E7T A;  3WNL A;  3LSD A;  3TYJ A;  5I0T A;  5FQ0 A;  1DGR A;  1PX4 A;  4K6B A;  4R4X A;  2A3X A;  3ACI A;  3OPW A;  1GZW B;  5DAW A;  1EPZ A;  2JD9 A;  2PYT A;  1YC6 1;  2DUO A;  2VCB A;  4XXA A;  4XHX A;  4QHB A;  4ZU4 A;  3ZR5 A;  3KT7 A;  3T0D A;  1QJY 1;  4FTB A;  1O6U A;  1GQG A;  3FE5 A;  3NW4 A;  4W4Z A;  2YRO A;  2VU9 A;  1DQ1 A;  2WNV C;  3PU3 A;  4LBQ D;  4M4R A;  5F37 A;  3H8R A;  4J25 A;  4MV2 A;  5A3U A;  2XJR A;  2DBN A;  3VZN A;  5A33 B;  5HV4 A;  5G05 L;  3IT8 A;  1XBF A;  3AKT A;  4Q8L A;  3QCW A;  1A8M A;  2C1F A;  1J84 A;  2G9Z A;  2J42 A;  1EUT A;  3FMG A;  5BNP C;  5JZG B;  1ND3 B;  2X09 A;  4MGK E;  2F6B A;  5FXX A;  1VBE 2;  5EHD A;  1LUL A;  3K48 A;  3KT1 A;  3FUO A;  1UKG A;  3B02 A;  4AFB A;  4AI0 A;  4IEW A;  1NCR C;  4NPL A;  1UNB A;  3MIF A;  2QQW A;  1YI7 A;  4OI1 A;  1LED A;  1SLI A;  5FYB A;  2BGO A;  5E16 A;  3IZO A;  1B35 B;  4HKW A;  1GV9 A;  3N7J A;  5F8P A;  1ZBA 2;  4D7T A;  4URA A;  4LBO A;  5A7O A;  1LCL A;  2HBU A;  1WGP A;  2X5I C;  3VBR B;  5A6X A;  3IM0 A;  3K77 A;  2XR4 A;  4K7J A;  3MFC A;  2VVD A;  1QQP 3;  2WBK A;  1OF4 A;  1A78 A;  4JTO A;  1QJU 3;  3FWE A;  2W5F A;  4IL7 A;  3WQ0 A;  3GZU C;  4E2S A;  5JSP A;  3MFA A;  1PM4 A;  3USU B;  4BPZ A;  1GP6 A;  2RE9 A;  4QXC A;  2P3Y A;  1WMF A;  1YFY A;  4RHV 1;  2XJV A;  1QJX 3;  3MW4 A;  4XMI A;  2K2S A;  1UCX A;  1NQD A;  1G9C A;  4ISR A;  2TBV A;  1VAM A;  5CFC B;  1DBN A;  3PIG A;  1QJZ A;  3BTA A;  1W3V A;  3MW2 A;  2H0B A;  5FK8 A;  4TYS A;  1DLL A;  2ETE A;  4AHW A;  1NKG A;  3HD8 B;  3ZYB A;  4GJY A;  4P02 B;  1HKD A;  3P5B A;  4AQT A;  4LKE A;  3U78 A;  1HXS 2;  2WZE A;  1F2N A;  1OBN A;  2XBO 1;  1QKQ A;  1ZNP A;  3O1T A;  3T2T A;  1WLD A;  1CZV A;  3T08 A;  4QQH A;  2B42 B;  4JHT A;  4OI4 A;  1GWM A;  2D6P A;  4SLI A;  4HMZ A;  5FO8 B;  4FPO B;  5C70 A;  4CXY A;  3CZU A;  3ENR A;  2BVV A;  4QGN A;  3BOP A;  4HL0 A;  4LE3 A;  4Z2W A;  4XJZ A;  3V0B A;  2JDH A;  4YGE A;  4MOA A;  3DUI A;  2IXJ A;  3I8T A;  3VD5 A;  1UY0 A;  2HWE 2;  2D98 A;  1JZ6 A;  3WX5 A;  2ILM A;  4XF3 A;  1MS4 A;  3THT A;  1F35 A;  4X6Q B;  2F4L A;  2YMZ A;  2Z5W A;  4D7S A;  3GF6 A;  5F3I A;  3O1S A;  2HEY F;  3ZFF C;  3MIG A;  1AHS A;  4HG6 B;  4DY3 A;  2RDN A;  1U0A A;  4WVV A;  2JB8 A;  2JDU A;  2XPJ A;  3F2Z A;  1CON A;  2TEP A;  1QIQ A;  1MVE A;  1VAL A;  1O4Z A;  1QHD A;  3J7L A;  2LRP A;  2A5Z A;  2LW8 A;  2YHJ A;  4KG8 A;  1FPN 3;  4LBJ A;  4CDW C;  3HNB M;  1C8M 1;  4FOW A;  3RMX A;  2JG9 C;  3IDB B;  4CUG A;  1FXZ A;  4QKF A;  3WR0 A;  1VAK A;  4LIV A;  3PUI A;  1AYN 1;  4AED B;  5JWP A;  1W6N A;  1XPW A;  3VDD C;  4MGT A;  1YLL A;  5IT6 A;  1CIY A;  2PHT A;  1XU1 A;  1WWY A;  2XVG A;  1WW6 A;  1RVF 3;  5BNN B;  4YZ1 A;  4BMB A;  1RUF 1;  2PXJ A;  2EXJ A;  2GN7 A;  2ZMK A;  3MI8 A;  5JXI A;  4H2A A;  1CPN A;  4OHV A;  5C3R A;  3LA3 A;  3LDK A;  4BQW A;  2R06 2;  2VMG A;  4DS0 A;  1Y3T A;  4BJ0 A;  1NY7 1;  2J7M A;  2Q8E A;  2HBT A;  3M3I A;  3PU8 A;  4QX5 A;  3V0A B;  4P14 A;  2NM1 A;  4HPK A;  4QX0 A;  1WMX A;  4BIF A;  4ASL A;  2C9A A;  1SBF A;  4NN0 A;  5FXZ A;  1OPO A;  1L7R A;  4BWO A;  5JIA A;  2ZHK A;  4MLO A;  2VNG A;  5FYY A;  4E2Q A;  1IZ3 A;  2GU9 A;  2DVD A;  4NVP A;  2E33 A;  1S0I A;  2ZA9 A;  3LOB A;  3LEG A;  5EP9 A;  4CCD A;  2ZOE B;  5IK5 A;  4CDQ C;  5BNP A;  1H2N A;  1UMH A;  4RQP C;  1LHO A;  3M4F A;  3MGU A;  3OUI A;  4QXB A;  1CX1 A;  4UOJ A;  2I07 B;  5BYN A;  2R30 A;  5JI7 A;  1ZRD A;  2WNE A;  4KH9 A;  3QH6 A;  3VDB A;  2Y6F A;  1NCR A;  3A0K A;  4XUQ A;  5E1R A;  1REF A;  4LQR A;  3VBH B;  1AYM 1;  1EV1 2;  1NX9 A;  1V6L A;  5CKQ A;  4CPB A;  4R9B A;  5IYY A;  1JW6 A;  1OT5 A;  3B69 A;  3WLU A;  5LRR A;  5F7U A;  3DCQ A;  1ST8 A;  3MF6 A;  3WXP A;  4QB1 A;  4GH4 A;  3ZSM A;  2GN3 A;  1CAW A;  3KGZ A;  1RUI 1;  1XNK A;  1ENS A;  3SH3 A;  2VTX A;  3VDA A;  4N8M A;  1R1A 3;  4C8D A;  3S7I A;  1E57 A;  1S0D A;  1MEC 3;  3EXU A;  2Q8O A;  3PUS A;  3OY8 B;  4UFM A;  5L19 A;  4Y20 B;  3H1Y A;  1RUD 3;  2ZEW A;  1W05 A;  3LAG A;  5L9R A;  1ASJ 2;  5D8A B;  2R04 2;  2PN5 A;  4DB5 A;  1AL2 3;  4CYD A;  2BPA 2;  2Y33 A;  2VZ3 A;  2IWG B;  4FTS A;  4V2W A;  1VRH 3;  3SQO A;  1HQL A;  4Y5S A;  5CIR A;  5LY2 A;  3I2K A;  5IK8 A;  1DF0 A;  1GSL A;  3D6E A;  2ZPX A;  3KM5 A;  4OVE A;  1UAI A;  1WBF A;  3IPV A;  2EVX A;  3M2M A;  2GP3 A;  4OUS A;  4RR3 A;  3DEC A;  3VL9 A;  5KC6 A;  3VHP A;  1CR7 A;  4S2H A;  4AVB A;  4FXG B;  5LA9 A;  1OD5 A;  2A6V A;  4QX8 A;  1GNZ A;  1UXZ A;  3JB4 C;  1JTZ X;  3JQX A;  3J8F 2;  4YFW A;  2NP0 A;  1O5L A;  1NAE A;  1DP0 A;  4N53 C;  5A6Z A;  4MXW A;  3ZPO A;  3FJS A;  4W6W A;  3ROU A;  3I54 A;  1HW5 A;  1V9U 2;  4YM0 A;  5I0D A;  5BV6 A;  4N43 C;  1RJ7 A;  2V5D A;  3V56 A;  4D6R A;  3W5M A;  4Q27 A;  1IS4 A;  3OSD A;  5J37 A;  2BW8 A;  3LFI A;  4OMC A;  4UF0 B;  1PGS A;  3IDC B;  4QPG C;  1OKQ A;  4CP1 A;  2AGS A;  3AJZ A;  4OZO A;  4XJ8 A;  5JDB A;  1OI6 A;  3NNJ A;  2B7Y A;  3AX4 A;  5IVC A;  5ANQ A;  3POS A;  4F83 A;  5JUV A;  1HJG A;  1HLC A;  1LNS A;  1WA4 A;  4BCU A;  1XXN A;  1Z78 A;  1RUG 2;  2VE1 A;  4BQ2 A;  3GZT B;  3GJB A;  2A1X A;  4JV4 A;  1H6Y A;  2Q8C A;  4IEO A;  3AM2 A;  2VZU A;  1PO2 1;  5ERL A;  2BOJ A;  2MEV 2;  2BNO A;  4X6R B;  3SXW A;  1LU1 A;  4QU1 A;  5J36 A;  1NXD 1;  3ZFF A;  2YBP A;  4BA6 A;  2FZ1 A;  3M3E A;  4KGG A;  4QDS A;  3ZIW A;  3KHB A;  1S0J A;  3LQC A;  4FOQ A;  1XJA A;  5KHI A;  5FO9 B;  3BKZ A;  1C8N A;  2XWB B;  3P1I A;  5E89 A;  3JU9 A;  4CCO A;  5L7O B;  2JG9 A;  4XFI A;  3LCP A;  1HX6 A;  1RJ8 A;  3VGI A;  2P6H A;  3ALQ A;  1XYO A;  4IET A;  2VUC A;  4QQ2 A;  4EWD A;  3VDD A;  4DY5 A;  4BK5 A;  2ZAA A;  2HEW F;  1R09 3;  1PIV 1;  4Q4W 2;  4XMA A;  4FOV A;  3TNQ A;  4MGI E;  5HXM A;  3DEM A;  2XLA A;  1W6P A;  2LTN A;  2OPK A;  1LRH A;  3HQU A;  1Q8P A;  1LHW A;  2GH8 A;  4D6S A;  1TMF 2;  4XQD A;  5JLV A;  1O3T A;  3IMN A;  3I3D A;  4AFM A;  1D2S A;  1JXN A;  4XTM A;  1EAH 1;  1P8J A;  1WD3 A;  3UGH A;  1RUE 2;  1VMJ A;  2J1R A;  2C9K A;  1RMU 3;  5I93 A;  5BPX A;  4TLG A;  1AJK A;  1HRV 2;  1PK6 B;  1OVS A;  4WVW A;  4MVT A;  3BTZ A;  1TG7 A;  3DYO A;  1H8T A;  3KQR A;  1PMI A;  3Q9O A;  4CPB D;  4CDQ A;  1G86 A;  5FZ3 A;  1UZV A;  1Z7S 2;  2Q30 A;  1GQP A;  1PVC 1;  5JI9 A;  4CVU A;  4FSJ A;  5FWJ A;  1VBA 1;  3ZPY A;  5A6Y A;  4A6S A;  1ND2 C;  1UMI A;  2W52 A;  4EN9 B;  1UZW A;  1TE1 B;  1UX7 A;  3FLT A;  5C71 A;  2WQZ C;  1W6Q A;  1G9A A;  2BGC A;  2HWF 3;  1ZRF A;  2FMD A;  1RIR A;  5IAX A;  1OC1 A;  4CDU A;  2RJ2 A;  4AEK A;  3SCF A;  1COV 3;  4JVA A;  2BBA A;  4GUL A;  4UFK A;  4DFS A;  4E8C A;  4C0H A;  5FYI A;  4XAE A;  2W39 A;  4QB6 A;  4FAG A;  1NOV A;  3QOP A;  3FHI B;  1AF9 A;  4LUM A;  2EIG A;  4P5Y A;  5FZ0 A;  3HJR A;  5FZ7 A;  5K9Y A;  4Y33 A;  2QBX A;  2ARB A;  2VUD A;  1MQT B;  3BAL A;  4ZPI A;  4RQP B;  1Q8V A;  4OI0 A;  4UAP A;  1VRB A;  1VBE 1;  3VZL A;  1DQ5 A;  1NG0 A;  4LR4 A;  2EXI A;  3OB8 A;  3RQ0 A;  3AZZ A;  3ZOI A;  5EFU A;  3HOB A;  3BPZ A;  3MV1 1;  2YC4 A;  4YGD A;  4UW4 A;  1JZ7 A;  1VE0 A;  4AFD A;  2Y6H A;  4XHB A;  3NL1 A;  1NQJ A;  1QDO A;  1ZBA 1;  2YY1 A;  2XHK A;  2VW2 A;  1O59 A;  3BI3 A;  1DFQ A;  4K3U A;  3ABZ A;  3TRS B;  3ZFG C;  2PQS A;  4UFH A;  4Q5O A;  3KGL A;  1OQE A;  1WD4 A;  4HKO A;  4AAX A;  1FV3 A;  1NZI A;  2XJS A;  4CEW B;  4LK6 A;  5C8C A;  5H9R A;  4AE2 A;  3VZO A;  2JE8 A;  2XKP A;  3CIH A;  3VKL A;  4MG2 A;  1H30 A;  5FRA A;  3KF3 A;  4AF9 A;  4AI9 A;  4RGG A;  2JEM A;  5FP9 A;  4CTE A;  3MDP A;  2OQ7 A;  5KBF A;  4IEQ A;  3UKV A;  2VUA A;  4V1P A;  3HN3 A;  1OPM A;  1W9W A;  2VY0 A;  4GMP 3;  4JGZ C;  2WQ4 A;  2JG8 B;  2RDQ A;  4QPI C;  3WF3 A;  1CAX B;  4I2O A;  2WFF 2;  1J3Q A;  2VCA A;  4L92 A;  1N1T A;  4LO5 B;  4QPY A;  4YLZ A;  4UW5 A;  4YWA A;  4YNI A;  4AQS A;  2Q5T A;  2YZ4 A;  2FDK A;  3KZ4 C;  4UYB A;  3HVD A;  5F32 A;  2B46 X;  4AI2 A;  4FCA A;  1BYH A;  2DFB A;  4ZU5 A;  1NCQ C;  1UL9 A;  1UZ0 A;  4COY A;  2Y26 A;  3TEY A;  4DO0 A;  4A7Y A;  4NOT A;  2YV8 A;  4OHZ A;  3LPF A;  4ITC A;  3I59 B;  4N53 B;  4XOG A;  5FZM A;  2CHH A;  2CWM A;  4NO4 A;  5LY1 A;  2WNU B;  4BLI A;  1X82 A;  2D40 A;  2VMC A;  5FBZ A;  3LB9 A;  5ABJ B;  2OZJ A;  3NRU A;  3VBU C;  3S7E A;  1ZRI A;  5FBJ A;  4H3W A;  4FT8 A;  5FP3 A;  1JZ8 A;  1LAJ A;  1JI6 A;  2P6C A;  3N7M A;  4LE4 A;  2QUO A;  4NHX A;  1UKR A;  4A2U A;  3DYM A;  4L99 A;  4DUV A;  1H2M A;  4XDP A;  3K2O A;  4UWD A;  2NQY A;  1WLT A;  1YFX A;  3KSC A;  5KR7 A;  4NID A;  1CWP A;  2HWE 1;  1LTE A;  1TME 3;  4IV1 C;  4DIQ A;  4ATF A;  1YHF A;  4NPR A;  1QU0 A;  5G04 L;  1CQ9 A;  3NV1 A;  3P3N A;  1OUR A;  3ZN6 A;  2RS3 3;  4MSV A;  5CB7 A;  4DXS A;  5JXJ A;  3BUC A;  3D0S A;  2BRT A;  3FHQ A;  3UYJ A;  5A70 A;  4WVM B;  4IV3 A;  5KXD A;  4JDM A;  2A6Z A;  3EHK A;  4L2N A;  4H55 A;  3N9P A;  2R16 A;  4PBP A;  2VMD A;  3GBF A;  2UYA A;  1XYN A;  2W1U A;  3N7K A;  4P9Y A;  4UW6 A;  5IW0 A;  1PGW 2;  1FT9 A;  1AXY A;  4YVW B;  2OVU A;  1CJD A;  1RTV A;  2SBA A;  3VBO A;  3T3Y A;  5C3P A;  4DQA A;  1HJF A;  4G9S B;  1OMI A;  1HXS 3;  1W6O B;  2ARX A;  2ORZ A;  2R07 1;  3LSE A;  5EQU A;  1UO9 A;  1AUY A;  2C24 A;  2WT1 A;  1GZ9 A;  1POV 3;  3M70 A;  3N3H A;  2R06 1;  4IGO A;  4W50 A;  1ENX A;  4IE5 A;  5HPO A;  4BDV B;  1OA2 A;  2WZR 3;  3H3L A;  4R4Z A;  1CAU A;  2P3K A;  3LWC A;  3WDX A;  1KFU L;  5IAV A;  4OZX A;  1LR5 A;  2BNN A;  3BCW A;  4GD4 A;  3I2J A;  1WW4 A;  3OGR A;  4DXT A;  2AZ5 A;  1WUV A;  3CJI A;  2WWU A;  5KXC A;  4P9G A;  4CUA A;  3JBG 3;  3POY A;  3ZXG A;  1FOD 3;  1SFY A;  1SLL A;  1ZZC A;  5FMO S;  5DDJ 3;  3OYW B;  4K21 A;  4YVS A;  3UKN A;  5C9A B;  3WT3 A;  1LU2 A;  4IND A;  1C8M 2;  1U5I A;  1VIW B;  4AVT A;  5J09 A;  3RS6 A;  1WZX A;  2ZMN A;  4CEY C;  1XU2 A;  2A6W A;  5LAS A;  5A1A A;  4XEZ A;  1PM7 A;  5FY7 A;  3ST7 A;  4LUL A;  4WM7 C;  1RUF 2;  1EV1 1;  3BYW A;  1AR9 3;  3GYD A;  4EZ4 A;  4Y1Z A;  3AMH A;  3T4H B;  5JOZ A;  2GZW A;  3UJO A;  3GHN A;  3FX3 A;  1VMH A;  3ZFG A;  1NY7 2;  5IJR A;  2VNV A;  3VN4 A;  1GWK A;  1RUJ 3;  2E32 A;  3MUZ 1;  4YAR A;  4LOT A;  2RR1 3;  1O4T A;  4IGP A;  1DDL A;  1RGS A;  5FZ9 A;  3HNY M;  3BU7 A;  5JOX A;  1ASJ 1;  5K4L A;  2R04 1;  1OVP A;  2VM9 A;  5EV7 A;  4BH9 A;  5A7S A;  1GNH A;  1B09 A;  4UI9 L;  3KMH A;  4JGZ A;  1ODM A;  4QPI A;  4NII A;  3Q8A A;  4A44 A;  3R6S A;  2WO2 A;  4CU7 A;  3O1M A;  4QX2 A;  4NJ4 A;  1X7N A;  4QPW A;  4EE2 A;  4JDO A;  4RFR B;  4YZ5 A;  3KLS A;  2WT2 A;  2RS5 2;  1ONA A;  2R1B A;  3QH7 A;  2PAK A;  2UWB A;  4RS5 B;  5CYY A;  1UOG A;  1W3X A;  5L36 A;  4CP9 B;  2IVI B;  4ERO A;  1AYM 2;  1ZX5 A;  1QXP A;  2P5B A;  3J8F 1;  1XOY A;  2WR9 A;  3KV9 A;  5C4W B;  2WJS A;  4LMF A;  3U1X A;  2JEN A;  3QD6 A;  3LF7 A;  4IGQ A;  1ULG A;  4AL9 A;  1V9U 1;  3AZV A;  2FDI A;  1W8Z A;  4JDN A;  2JIJ A;  2VUJ A;  4P9J A;  2WSV A;  5AVP A;  5L9B A;  2WN3 A;  2JD4 A;  4SBV A;  2PA7 A;  4NRP A;  1FNZ A;  5EYY A;  2FHR A;  4Q1P A;  3Q8F A;  1I1E A;  3OGV A;  1BVV A;  1C1F A;  2ZGT A;  4AQ2 A;  1RUG 1;  3AYC A;  2VTX J;  4LKF A;  1URX A;  4JX0 A;  2DFC A;  1VBB 3;  4NHL A;  1HB2 A;  1C28 A;  5FZ8 A;  4LK7 A;  2MEV 1;  3RPQ A;  2VOT A;  1WCS A;  3NAP A;  3ATG A;  1E5H A;  3DPR B;  5FPB A;  5LA0 A;  1XSQ A;  1XNC A;  1QOO A;  2XB6 C;  2W1W A;  2VQ0 A;  4PHZ A;  4FAH A;  4L9B A;  1H1A A;  1APN A;  4C1X A;  5KC5 A;  3ZXD A;  2DF7 A;  2HJI A;  2ARA A;  4Y22 B;  2ZX0 A;  4M3C A;  4AGV A;  3AKR A;  2YC2 A;  3OCP A;  4MGQ A;  3NO8 A;  5DUV A;  5C7G A;  2PFW A;  5JOY A;  1AX2 A;  2LUW A;  1GYK A;  5ANN A;  4PDW A;  3S5A A;  2YGL A;  1S1A A;  4ZU7 A;  4Q4W 1;  5FZD A;  1K45 A;  1Y4W A;  3J7N A;  1RC6 A;  2WO3 A;  1TNR A;  1UU5 A;  3E6C C;  1MAC A;  4LO6 B;  5LBF A;  3O12 A;  3FL7 A;  3C3V A;  5FYH A;  2V4V A;  1TMF 1;  1PO1 2;  3VBF C;  2IZW A;  5FWE A;  4B7K A;  4BYY A;  1ZZ7 A;  2XWJ B;  3LZZ A;  1BEV 2;  3WY6 A;  1G8W A;  1AVB A;  1RUE 1;  4FFI A;  2PHF A;  1CAV B;  2WS9 2;  5EXO A;  2B9V A;  3HN1 A;  1HRV 1;  2VVE A;  3PVB B;  2XVK A;  1UYX A;  3ON7 A;  4GB3 3;  5A32 A;  1XB9 A;  3S57 A;  4EV0 A;  3J4U H;  4PIZ A;  5I0R A;  1ODN A;  3CEW A;  5GLU A;  3O0V A;  3ZSL A;  1SAC A;  2ZX3 A;  4A7Z A;  1Z7S 1;  3ZYR A;  5FZ4 A;  3LDB A;  3PJY A;  2CGO A;  2QDN A;  3NV2 A;  3GHM A;  1QWR A;  1YUD A;  1LOF A;  2VR4 A;  5F39 A;  5A7W B;  3SH5 A;  3UNP A;  2RM2 3;  2WZ8 A;  1O3S A;  1YNA A;  1PIV 2;  3PJQ A;  1XND A;  1R08 3;  1AR8 3;  2P37 A;  4GMP 0;  4QT6 A;  4CU6 A;  1S0G A;  2RMU 3;  2C0Z A;  2VZ1 A;  3B93 A;  3RYR A;  4KQ7 A;  1GNY A;  1N3P A;  3SCH A;  3J26 N;  1H4G A;  5B4N A;  5CIS A;  1D4M 2;  1KS5 A;  3C7E A;  4B7E A;  4LKS A;  5A80 A;  5FY1 A;  4KBB A;  2OPW A;  2PQQ A;  3OBR A;  4FXK B;  1C4R A;  2D43 A;  4DMI A;  3III A;  1LES A;  2UY9 A;  4PIY A;  5CFD A;  4DNY A;  2Y60 A;  3MYX A;  1J1T A;  4YRD A;  4R8H A;  2R1D A;  2O14 A;  1A8D A;  3PDQ A;  3ZXF A;  1ZBE 3;  2BDR A;  1VBD 2;  2D93 A;  1K5M A;  1NLR A;  4B1M A;  1XRU A;  1WW7 A;  2IXI A;  3A7Q A;  1AR6 2;  2PLV 2;  4QQL A;  3LPG A;  1SCR A;  3I49 A;  5J7M A;  1VBA 2;  5DMY A;  2RS1 2;  1OUX A;  3AYE A;  3QBQ A;  4BQ3 A;  1LHV A;  3ACL A;  1REE A;  1Y9G A;  2W0X A;  3TEX A;  4XUN A;  2PTM A;  4BM8 A;  3OUJ A;  3GBW A;  3T0B A;  4PBO A;  3AFK A;  3ZM8 A;  4LUK A;  1OOP B;  5M0T A;  5KHH A;  2FD8 A;  3SKV A;  4OQ8 A;  4Y1V A;  2AEZ A;  4HN0 A;  1G6N A;  3KV6 A;  5JZG A;  4CRQ A;  1ND3 A;  5CG9 A;  2EAA A;  2WFF 1;  5GM0 A;  4GWJ A;  4NAO A;  5SV8 A;  3ZXL A;  5LW9 A;  1RHI 3;  1OQD A;  4UXA A;  3EQE A;  4QWN A;  5FYT A;  1GU3 A;  2WA3 A;  4Q4Y 3;  5A3N A;  4O65 A;  5HXV A;  1VLN A;  5FOJ B;  1LOB A;  3NKG A;  1JHN A;  3VZK A;  2B9U A;  3N7L A;  1B35 A;  3WUC A;  4FPK A;  3HNM A;  1JYC A;  3G7D A;  1JU3 A;  1UPS A;  2CGP A;  1GOF A;  1QH6 A;  1UY1 A;  4X8P A;  5JOW A;  3ACG A;  4KWU A;  4QQP A;  4YGB A;  3VBR A;  4GH4 C;  4WM8 C;  3OGS A;  5GLT A;  3T30 A;  5FDB A;  3TWI A;  5I8Y A;  1A6C A;  1WBL A;  2W1Q A;  2G9G A;  1POQ A;  4FP3 A;  1F4H A;  5FYM A;  4XUP A;  2BV4 A;  1SLT A;  1ULC A;  4LIU A;  3RZK A;  2ORX A;  2DU1 A;  3Q8E A;  5FLI A;  1W39 A;  2GH2 A;  5L73 A;  1UYP A;  2GAL A;  1V6O A;  1CZS A;  2BTV C;  4N7U A;  4D8M A;  2VZQ A;  2VW1 A;  3UK9 A;  1QJY 3;  2I2S A;  3EBR A;  1DGW X;  3FLR A;  5TSW A;  4P9W A;  5FMO L;  5CFC A;  5A1L A;  1DU3 D;  4FPF A;  4NE9 A;  4RR3 C;  2F17 A;  5F5C A;  3VBF A;  1LKN A;  1JUI A;  4HK9 A;  5J48 A;  3UGF A;  3HMY A;  4CDX B;  3DXU A;  1W04 A;  3ZXJ A;  1J3P A;  2A73 B;  2YGM A;  3VZM A;  1N1Y A;  5FYS A;  1YFU A;  4ORF A;  5FYU A;  1OXC A;  4AAP A;  4OLL A;  1PGW 1;  3WW1 A;  1W8T A;  5AC9 2;  1FAY A;  5T5P A;  1N3O A;  4FOY A;  3OEB A;  1F31 A;  4LEJ A;  4MHR A;  4R9D A;  3URF A;  5LCW L;  3CBN A;  4LBM A;  1UZY A;  2HWC 2;  1KFX L;  3WCR A;  1KDK A;  4O9G A;  4RD7 A;  1AX1 A;  3WNN A;  2HWD 2;  3U37 A;  2OII A;  5GZF A;  2CDP A;  1J1L A;  1W9S A;  2VPV A;  2R49 A;  1S0B A;  1OLM E;  2IXK A;  1J83 A;  4JCK A;  1RIT A;  3K4D A;  3NJX A;  4L0P A;  5FYZ A;  1RL3 A;  3ASI A;  4FFG A;  2QVS B;  1OFS A;  1XC6 A;  2ZCW A;  3H50 A;  5FJH A;  5BY5 A;  1IS3 A;  4NIG A;  2KD7 A;  4R52 A;  1TQ5 A;  3AYA A;  3ZN4 A;  1I6X A;  3AKQ A;  3CLP A;  4RHV 3;  5I8S A;  3CU7 A;  1W28 A;  3RYP A;  2OUJ A;  1W9F A;  5LA1 A;  2K9Z A;  3IBM A;  4FI9 A;  3PLQ A;  1W2A X;  4XE9 A;  4AED A;  5F3C A;  3AXE A;  1FV2 A;  3UES A;  1LOG A;  5BNN A;  2EAK A;  1SFP A;  4COV A;  3V0B B;  3WNX A;  1H9P A;  1YQC A;  4CUB A;  4XPV A;  3K4A A;  1H8V A;  1U12 A;  3T2O A;  2WLP A;  3TN9 2;  2G9F A;  2XBO 3;  4ZKT B;  2CU5 A;  4FPL A;  2R07 2;  2EID A;  3KWV A;  2YBK A;  4HVR A;  3ACF A;  3V0A A;  3K3O A;  1PZ8 A;  4XJA A;  4A42 A;  1ENQ A;  5I91 A;  1W90 A;  3DKW A;  1JUH A;  3OG2 A;  4IE6 A;  5CVR A;  3MPB A;  4ZS2 A;  2BQP A;  3MZH A;  1ULP A;  1E5S A;  2ZX4 A;  1PNF A;  3M3O A;  3M8L A;  3MO4 A;  4I01 A;  3O1V A;  5C5U A;  4ZXK A;  3NNL A;  2LS6 A;  3NV4 A;  2W3J A;  5FY8 A;  2WT0 A;  1TVG A;  4LA3 A;  1H8T C;  3VLB B;  1ZZ8 A;  2AUY A;  4MZU A;  4P9X A;  4K40 A;  3E5Q A;  3T2Q A;  1UF2 C;  5FPV A;  3O5S A;  1VAV A;  4XF1 A;  2B5H A;  3PUH A;  2E6V A;  1UWW A;  3VBH A;  2VNR A;  2BZD A;  3A21 A;  3HT2 A;  4LOS A;  4NPM A;  2RS5 1;  4XQW A;  3B9I A;  1FAT A;  3ZDS A;  1C8M 3;  3LEI A;  2IFR A;  1CES A;  2XH6 A;  2JJ6 A;  2PHW A;  4UBH A;  5FFO C;  3RZH A;  1AYN 3;  5IAT A;  4HPK B;  4CDU C;  5FZC A;  1W03 A;  1GOH A;  4WM8 A;  3USS A;  4K8F A;  3RVH A;  1RUF 3;  2WNV B;  2D6K A;  3MPP G;  3AFG A;  3N36 A;  4YYO A;  1YXW A;  2JE7 A;  5SV5 A;  3U14 A;  1N1V A;  1WCU A;  5D8A A;  3WW4 A;  5FOB B;  5FZA A;  3H8X A;  4QM8 A;  2VH9 A;  3KS7 A;  2HEV F;  4XFB A;  1G9F A;  1Q8S A;  5BNP B;  2ZAH A;  5IUQ A;  2JKX A;  1RUC 2;  1ZZ9 A;  2Y6G A;  2A3W A;  2ERF A;  2DYC A;  1VJ2 A;  2XL7 A;  5DQ0 A;  1NCR B;  1V6K A;  3R4D B;  3D82 A;  2RJK A;  3ZSJ A;  2WDB A;  4RN5 A;  1YIP A;  3OOX A;  3VD9 A;  2WAA A;  4BQ1 A;  3NKT A;  5CKN A;  2Y6L A;  5FZG A;  2ENR A;  2DUQ A;  3T1L A;  5A6Q A;  1JHJ A;  1CAW B;  1W8N A;  4Z07 A;  1LOE A;  2X5I B;  3D0J A;  1GWL A;  2ZGK A;  3AZY A;  4OUL A;  1UOJ A;  5LBC A;  4CCC A;  4DRV A;  5ISL A;  1RXF A;  3C7O A;  2IUW A;  3U4S A;  3EB7 A;  5DN2 A;  5K0U A;  4HT1 T;  4ASM B;  5C8C C;  4PQ9 A;  1NA1 C;  1BBT 1;  4Y3O A;  3AMP A;  5FLJ A;  3KCY A;  3MIH A;  4UF0 A;  4OQ9 A;  2VZV A;  3K46 A;  5JSR A;  5KHK A;  4HET A;  1QOT A;  1DLC A;  1SLB A;  1WW5 A;  1SG3 A;  1VBC 1;  1MS1 A;  3KD4 A;  4TN7 A;  4GAZ A;  4Y1U A;  1X8M A;  1RUI 3;  1W2N A;  1H4H A;  3HIF A;  3IPV B;  5HCH A;  4LHL A;  1PO1 1;  2P2K A;  3A4U A;  2FDH A;  2VVF A;  1X50 A;  2WWJ A;  3IDA A;  3RDI A;  1BEV 1;  4J1W A;  4BHP A;  3VHR A;  2C6S A;  4Q29 A;  4NHK A;  3THD A;  1IPJ A;  2R7E B;  2WS9 1;  1Q8O A;  1ZM1 A;  4UW3 A;  2XXZ A;  4YW2 A;  4AHX A;  2FCV A;  1GUI A;  4PLN A;  2PHL A;  2HWB 1;  1W8U A;  4MXW B;  5F6K A;  5GJ6 A;  2IXL A;  5GZE A;  1DQ2 A;  1KDM A;  1LJ7 A;  3UV9 A;  5DAB A;  4G3Y C;  5L7O A;  3KB5 A;  1VPH A;  3H9A A;  4ISQ A;  4CCK A;  3C7F A;  3RZJ A;  4IUG A;  3S0M A;  4B4P A;  3CZJ A;  2HLE A;  4TSV A;  4BQ4 A;  4COZ A;  3LEM A;  4S2D A;  4FPE A;  1ZA7 A;  3SMH A;  3ILR A;  4Q0S A;  2GC1 A;  5EYX A;  3WDW A;  4Q26 A;  4ZZ5 A;  2ADD A;  4ASK A;  1DGR N;  3ZYH A;  2ZZQ A;  5EWS A;  1NLS A;  2JX9 A;  4AGR A;  4I0B A;  4XXP A;  3ZFF B;  3ELN A;  5H9S A;  1U5Y A;  1QDC A;  3GAL A;  5EPA A;  2UWA A;  4IV3 C;  3FFQ A;  5CG8 A;  2CAV A;  1D4M 1;  2HYK A;  3JUU A;  1BXH A;  2ZKL A;  5KHG A;  3A23 A;  4YGC A;  1AR7 2;  3KT4 A;  4G4F A;  4KNC A;  4CDW B;  4FFF A;  4BXS V;  4OYU A;  5ACA 1;  3RZG A;  3U75 A;  2WNO A;  3D4K A;  2JG9 B;  1F4A A;  4JGY C;  3SIS A;  1PMH X;  4I09 A;  4B4Q A;  4YSF A;  5JCT A;  3IWZ A;  4NRO A;  4JKM A;  1PO2 3;  3I2I A;  1ZVF A;  3VDD B;  5LAT A;  3VBO C;  1VBD 1;  4LNV A;  2VG9 A;  2YFU A;  3E5U A;  3VKF C;  2IC1 A;  1AR6 1;  2LRO A;  3M3C A;  4OFG A;  5FZL A;  2PLV 1;  2NPI A;  5FRE A;  3G6J B;  3WP6 A;  4IE0 A;  3OEA A;  3S6P A;  4CP0 A;  4F8A A;  4LIT A;  2RS1 1;  3R4S A;  1V0A A;  2W46 A;  2PEL A;  5BNO C;  2WYF A;  4IES A;  3WEZ A;  5GLZ A;  1NYW A;  3U4X A;  3C8X A;  4PLO A;  1SQ4 A;  1UIK A;  4K9S A;  1HRI 2;  1Q43 A;  5JMC A;  3X29 B;  1J3R A;  3F95 A;  3CKH A;  3MIE A;  3MBW A;  3VZJ A;  1XE8 A;  1PMJ X;  3AP4 A;  1PIV 3;  4CE8 A;  1GQH A;  3CJI C;  3WD5 A;  3HBK A;  3QAC A;  4Q4X 1;  2UWC A;  3DF0 A;  2UU8 A;  4EN0 A;  1MQT A;  4YVS C;  2G19 A;  3EJK A;  1XSR A;  4CDQ B;  3HAG A;  1EAH 3;  1V6J A;  3E5X A;  4Q4V 1;  5IFT A;  4LTA A;  4XIO A;  1Q5O A;  4AHZ A;  2X8K A;  1UYY A;  3ZFE A;  1QJF A;  1CZT A;  2ARE A;  2XOM A;  2J1S A;  5F2W A;  1W6Q B;  4A45 A;  1KD7 A;  1NZC A;  3H3U A;  1S55 A;  1OH4 A;  1ZRE A;  2VBB A;  4NWW A;  2Y6J A;  3CJX A;  3POW A;  3GNE A;  4M3C F;  1GMM A;  2XJQ A;  2V09 A;  5LWB A;  1PVC 3;  3WP5 A;  5FK7 A;  4JQT A;  1VBA 3;  4QU2 A;  3BN6 A;  2YPJ A;  3THC A;  3WNK A;  4U36 A;  5FZO B;  1NA1 A;  4XIK A;  4XBN A;  2DU0 A;  3ZMO A;  5A3P A;  4LBN A;  2JG8 A;  4AFA A;  1CAX A;  4YW4 A;  2V5Y A;  4L97 A;  3THP A;  2J1T A;  4A41 A;  2D5F A;  2QCS B;  1GFF 2;  3PVE A;  1QQP 2;  2VME A;  2CV6 A;  1OLR A;  3ME2 A;  3WHT A;  4YW7 A;  2A6Y A;  2D3P A;  1QJU 2;  1QMJ A;  2Z79 A;  1W2O A;  4ARX A;  3ZX7 A;  5JVV A;  5DAQ A;  4IEZ A;  1Y43 B;  4HAN A;  4WZC A;  3J7H A;  4LBL A;  1PGL 2;  4LLO A;  2E9Q A;  3I59 A;  1QJX 2;  1VBE 3;  4XYX A;  1O8S A;  3B94 A;  1Q56 A;  2A6X A;  2WNU A;  2X10 A;  1MZ6 A;  1IPS A;  4Q2F A;  4XC9 A;  4Y5T A;  5FZI A;  5AC9 1;  4JKL A;  4GXL A;  4CCE A;  2RDR A;  5ABJ A;  1BZW A;  1RUN A;  3LGR A;  3BTY A;  1FMD 1;  2N7G A;  4YG6 A;  3BIW E;  2HWC 1;  4H14 A;  4N43 B;  2DCJ A;  2Z2S B;  2HWD 1;  3RI9 A;  1JYW A;  1ZBA 3;  2H6B A;  2ZAB A;  4QPG B;  2QQJ A;  2YUE A;  3UT0 A;  1HQN A;  1IG0 A;  1OFN A;  1HQW A;  2E63 A;  1BQP A;  3MF9 A;  4WBB A;  1QNY A;  3S5Q A;  1KRI A;  4HBN A;  4XBQ A;  2J1V A;  4RL7 A;  4AEJ A;  4JRL A;  5CAZ A;  2ZGR A;  3AL5 A;  1DZR A;  4BQ5 A;  3FBM A;  1US3 A;  3NAP C;  2VD7 A;  4WVM A;  1BK0 A;  1Z0H A;  4JRA A;  4IE4 A;  2QQM A;  2GDF A;  4YG0 A;  5AVA A;  2YXS A;  5I0U A;  1UIJ A;  2YC0 A;  2ZGS A;  4JC1 A;  4R9A A;  2YPD A;  3ZXK A;  2XHN A;  4OHX A;  4V2V A;  3AJY A;  4YVW A;  2ARC A;  2JDK A;  4JGY A;  4HVO A;  5A3T A;  4O9E A;  1R1Z A;  3ZSE A;  3FZ3 A;  3O0W A;  1JYN A;  2K46 A;  1O91 A;  2W47 A;  1BKZ A;  3PHM A;  4PDW C;  5T5J A;  1UMZ A;  2VNO A;  3RYK A;  1H1M A;  1WCQ A;  4DRR A;  1CGP A;  2W92 A;  2WO7 A;  2XQR A;  3J7M A;  3TN9 1;  5C3S A;  1FPN 2;  3U0Z A;  1SLC A;  4Y1Y A;  5LEJ A;  1LEM A;  2QTW B;  4FPY A;  4XZP A;  3W21 A;  5BNO A;  3GXU A;  2Y6K A;  2YBS A;  1SPP A;  2Y8K A;  5EIY B;  5JIU A;  3NJY A;  3KCX A;  4Z82 A;  4BOW A;  1RVF 2;  2YU1 A;  3IDE A;  3ZYP A;  5E88 A;  3WG3 A;  3GDB A;  2KXL A;  3NQH A;  2Y0I A;  3BTX A;  5A3L A;  5C9A A;  1JOJ A;  1XQN A;  2HWE 3;  2VUL A;  3OYW A;  5JAX A;  4MAD A;  2BBV A;  1A3K A;  1XNA A;  3HQX A;  2P3J A;  2XUE A;  4P08 A;  1WLC A;  1YCI A;  1X33 A;  3T09 A;  2QKD A;  2VMH A;  4KGQ A;  4NHY A;  2AR6 A;  3K4Z A;  3L2Y A;  1H2K A;  1LOF C;  5IK7 A;  1ND2 B;  3BVC A;  3C2U A;  4HXC A;  4M00 A;  4BLJ A;  4WZF A;  5K7P A;  4QAW A;  1UY3 A;  1CAU B;  1F5F A;  3NST A;  2IXC A;  3IAP A;  1YQ5 A;  3ZR6 A;  3P6B A;  5FZE A;  3J9S A;  2R0F A;  3TOJ A;  3VBS C;  1ZRC A;  5DZF A;  5JXG A;  5C6C A;  1MZF A;  4LBK A;  2R07 3;  4FPH A;  5T3N A;  4FPC A;  1RUH 1;  3ZDV A;  3WCS A;  2R06 3;  1UU4 A;  2C5D A;  1W9Y A;  1Y7B A;  3RFR A;  1GIC A; 
#chains in the Genus database with same CATH homology
 3VD7 A;  1UMH A;  4XUN A;  1CX1 A;  3WQB A;  4DEQ A;  4UOJ A;  1JZ5 A;  3T0B A;  3ZM8 A;  4XVH A;  3VDB A;  1H6X A;  4XUQ A;  4LQR A;  1YQ2 A;  4XUT A;  1NX9 A;  3SKV A;  5IYY A;  1OT5 A;  5F7U A;  4QB1 A;  3VD3 A;  4GWJ A;  4LHS A;  4DEV A;  3VDA A;  1GU3 A;  2QQL A;  1W0N A;  2ZEW A;  3I2F A;  3JXS A;  3HNM A;  1JU3 A;  4ARY A;  1GOF A;  2VZ3 A;  1UY1 A;  2J1U A;  2Y64 A;  3ACG A;  4KMQ A;  3NJV A;  4KWU A;  5J1X A;  3OGS A;  3I2K A;  3D3A A;  2W1Q A;  1F4H A;  4XUP A;  2WYS A;  2ORX A;  3DEC A;  4DUW A;  2BGP A;  3CMG A;  4RYD A;  1JZ7 A;  2W1S A;  2HYX A;  1NUK A;  1CZS A;  1UXZ A;  4D8M A;  2VZQ A;  3T0A A;  1NAE A;  1DP0 A;  2E26 A;  3ECQ A;  1WKY A;  2ZXQ A;  2W9X A;  5I0D A;  2V5D A;  3W5M A;  2W91 A;  4ZXE A;  4OMC A;  4OZO A;  5JUV A;  1LNS A;  5EJZ B;  2VQT A;  3OEB A;  5LCW L;  2L9L A;  1H6Y A;  4PF1 A;  2VZU A;  4GZ9 A;  3WNN A;  3ACH A;  3U37 A;  2DCK A;  1IQD C;  2CDP A;  4QDS A;  1K3I A;  1W9S A;  2CDO A;  3LQC A;  1JZ4 A;  1J83 A;  3NJX A;  3K4D A;  1XNT A;  4L0P A;  3I3B A;  3P1I A;  1XC6 A;  2KD7 A;  3CQO A;  3I3E A;  4BK5 A;  4TTG A;  3SEP A;  4PQQ A;  3I97 A;  5HXM A;  5B4X A;  1UXX X;  4ZZ8 A;  5LA1 A;  4FI9 A;  3HPN A;  3UES A;  3I3D A;  3WF0 A;  2VL4 A;  3NNG A;  1EUU A;  4W8J A;  1P8J A;  3E1F 1;  2J1R A;  2C9K A;  4CUB A;  2W94 A;  1UY2 A;  3FHA A;  3K4A A;  2YG0 A;  3T2O A;  2X05 A;  4A3Z A;  3I2H A;  2EID A;  1TG7 A;  2QQK A;  3DYO A;  3BGA A;  3ACF A;  3I2G A;  4A42 A;  3OG2 A;  1GQP A;  4CVU A;  4QDR A;  1ULP A;  3MO4 A;  1UMI A;  2LS6 A;  5C71 A;  1UX7 A;  5JXH A;  2W3J A;  1TVG A;  4A4A A;  2J1A A;  2QQI A;  2RJ2 A;  2BBA A;  3T2Q A;  3GM8 A;  4ET7 A;  4E8C A;  2J1E A;  3PUH A;  1UWW A;  4QB6 A;  2BZD A;  3A21 A;  4P5Y A;  1JYV A;  3HJR A;  2QBX A;  3LEI A;  2EIC A;  4UAP A;  2ZEZ A;  3OB8 A;  1GOH A;  3WF2 A;  1BHG A;  3HOB A;  3MV1 1;  1ULO A;  2YC4 A;  2B4K A;  2Y6H A;  2YFZ A;  4M4P A;  4ZY9 A;  2E31 A;  3MUY 1;  1JU4 A;  1O59 A;  5EJ1 B;  3ABZ A;  2VMF A;  2JKX A;  2PQS A;  2Y6G A;  2DDU A;  4AAX A;  3WF1 A;  5DQ0 A;  4CUC A;  1I5P A;  2W87 A;  4TXW A;  2JE8 A;  2WDB A;  3CIH A;  4RN5 A;  4AG4 A;  3EYP A;  3VD9 A;  2ID4 A;  2WAA A;  4BK4 A;  2Y6L A;  2ZEX A;  1JHJ A;  3HN3 A;  1W8N A;  1W9W A;  1KEX A;  3WF3 A;  5JMO A;  2EIB A;  2VCA A;  3MV0 1;  2VZR A;  3C7O A;  1UYZ A;  3EB7 A;  5DN2 A;  2XQX A;  1UZ0 A;  5DPN A;  2VO5 A;  2VZV A;  3K46 A;  1T2X A;  1DLC A;  1US2 A;  2RV9 A;  1SG3 A;  3LPF A;  4LPL A;  1KGY A;  4QB2 A;  2VMC A;  4MO3 M;  2VZP A;  3NRU A;  1W99 A;  3IDA A;  1JZ8 A;  1JI6 A;  2VZT A;  3THD A;  5JR2 A;  2R7E B;  3DYM A;  3DYP A;  4QX3 A;  4DUV A;  1OD3 A;  5LA2 A;  1GUI A;  2ZEY A;  3UET A;  4DXR A;  1HN1 A;  3IAQ A;  5G04 L;  2WN2 A;  4DXS A;  3C7F A;  5JXJ A;  2Z4F A;  3FHQ A;  4IUG A;  1D7P M;  2HLE A;  3CZJ A;  4PT6 A;  2VMD A;  4Z2A A;  2W1U A;  4ZZ5 A;  2C26 A;  1SHW B;  2BER A;  2WQ8 A;  3WNP A;  3SKJ E;  2ORZ A;  4QDQ A;  4A6O A;  3A23 A;  3K75 B;  2VZS A;  1JYX A;  4W50 A;  4BXS V;  1JZ3 A;  4XUO A;  4OYU A;  5HPO A;  1F4A A;  4BDV B;  1PMH X;  1SDD B;  4JKM A;  3I2I A;  1PX3 A;  1MPX A;  2XON A;  4OUE A;  2VC9 A;  2YFU A;  3I2J A;  3OGR A;  4DXT A;  1UY4 A;  3OEA A;  4CUA A;  2W46 A;  5FUI A;  3OBA A;  3WEZ A;  3C7G A;  3HEI A;  3C8X A;  2VQU A;  2JDA A;  5A1A A;  3IB3 A;  4JHZ A;  3WNM A;  3WF4 A;  3CKH A;  2YB7 A;  3MBW A;  1PMJ X;  4KI5 M;  4MGS A;  1DYO A;  2QQO A;  2OKX A;  1W9T A;  5IJR A;  5IFT A;  1GOG A;  4E8D A;  1RYY A;  2E32 A;  3MUZ 1;  3WNL A;  1UYY A;  1CZT A;  1PX4 A;  2J1S A;  2XOM A;  3HNY M;  3ACI A;  4CU8 A;  2JD9 A;  2VM9 A;  4A45 A;  1JZ2 A;  4D0Q A;  2VCB A;  1OH4 A;  3VDC A;  3T0D A;  2Y6J A;  4UI9 L;  4A44 A;  2WO2 A;  2WAO A;  1GMM A;  4W4Z A;  4CU7 A;  4M4R A;  4QX2 A;  4QPW A;  3BN6 A;  3THC A;  3WNK A;  5G05 L;  5CYY A;  1J84 A;  1EUT A;  2X09 A;  2VJX A;  2J1T A;  4A41 A;  2VME A;  3VD4 A;  2BGO A;  4JKK A;  4ARX A;  2VZO A;  2WN3 A;  3J7H A;  3OGV A;  1O8S A;  1O8P A;  2X10 A;  3K77 A;  2QQN A;  2WAB A;  4JKL A;  2WBK A;  1OF4 A;  2V72 A;  4JX0 A;  3C7H A;  2W5F A;  2VOT A;  2DCJ A;  2VTF A;  1JYW A;  5LA0 A;  3CDZ B;  3ETP A;  5CZK A;  3T2P A;  2QQJ A;  2W1W A;  3AC0 A;  3WSO A;  3FN9 A;  2J1V A;  5IHR A;  2WUH A;  1K42 A;  2EIE A;  2YC2 A;  4MGQ A;  1W8O A;  4OMD A;  5C7G A;  3GGL A;  1US3 A;  1NKG A;  4P02 B;  2QQM A;  1K45 A;  2WO3 A;  2WZE A;  3LEK A;  4XUR A;  4CU9 A;  3FL7 A;  1CZV A;  3T08 A;  2XHN A;  2V4V A;  3SEE A;  4XZU G;  5C70 A;  3CZU A;  1JYN A;  2W47 A;  2C4X A;  2B9V A;  1WCQ A;  4GWI A;  2W92 A;  4MOA A;  3VD5 A;  1UYX A;  1UY0 A;  1JZ6 A;  1R64 A;  3GXU A;  2Y6K A;  2Y8K A;  5EIY B;  3W5N A;  4HG6 B;  3F2Z A;  3LE0 A;  3WNO A;  2RVA A;  3GDB A;  2VR4 A;  3UNP A;  3NQH A;  2LW8 A;  2WZ8 A;  2J22 A;  3HNB M;  4MAD A;  4CU6 A;  3PUI A;  1XNA A;  1L7Q A;  1XPW A;  2VZ1 A;  4P08 A;  1CIY A;  4DUX A;  1GNY A;  3T09 A;  5B4N A;  1OF3 A;  3K4Z A;  3C7E A;  5JXI A;  4LKS A;  4QAW A;  5IFP A;  1UY3 A;  3III A;  4BJ0 A;  4YPJ A;  2J7M A;  3IAP A;  3P6B A;  2W95 A;  4QX0 A;  1L7R A;  3A22 A;  3A7Q A;  5JXG A;  4P00 B;  1K12 A;  3LPG A;  2WO1 A;  5DMY A;  2E33 A;  4QX1 A;  3LEG A;  2VCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...