1GQPA

Apc10/doc1 subunit of s. cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
180
Chain Sequence
SVLVLDDRIVDAATKDLYVNGFQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for the Ubiquitination Reaction of the Anaphase-Promoting Complex from the Crystal Structure of the Doc1/Apc10 Subunit.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOC1/APC10
total genus 48
structure length 180
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gqpA00
2W47A 4LKSA 4QX2A 3I2IA 5IHRA 3ACHA 3OGVA 4L0PA 1US3A 3T0BA 2VZOA 3WF1A 2L9LA 4OMDA 3T2OA 2VZUA 1GQPA 4PF1A 3HNYM 4QDRA 1MPXA 4LQRA 3HN3A 4RYDA 1UMHA 4GZ9A 2W5FA 1JZ6A 2VCCA 3E1F1 4W50A 3SKVA 4E8CA 2YFZA 3T09A 2CDOA 2WN3A 3MO4A 2BGPA 5IFPA 1JZ7A 5IYYA 2BZDA 5CZKA 2YB7A 4XURA 2BERA 1TG7A 2Y6KA 2DDUA 1JU4A 2BBAA 4OMCA 2VZ1A 3NRUA 2YC2A 4AAXA 4QDSA 1JZ3A 3GGLA 4CU9A 3WQBA 1J84A 5CYYA 3LEKA 4Z2AA 3OGRA 3K4DA 4TTGA 3OBAA 4CU6A 1JHJA 1WKYA 4RN5A 1O8PA 2BGOA 4BXSV 1CIYA 2XHNA 2W3JA 3CDZB 3J7HA 5HXMA 3ETPA 2C26A 2Y6HA 2QQLA 1PMJX 2YC4A 3I3DA 1UZ0A 5B4XA 2X09A 3WNKA 2W1UA 1I5PA 3I2HA 2ZEXA 1UY1A 1KGYA 4JX0A 3HNBM 2W1WA 4MOAA 1W99A 2VZRA 1PMHX 3K4ZA 3OEBA 4KWUA 4XVHA 2WAAA 3T08A 1JYNA 2JE8A 3SKJE 2J1TA 2QBXA 4CU7A 3D3AA 4QX1A 1US2A 3WF4A 1JZ4A 1GU3A 1ULPA 4DUWA 4CU8A 3VDCA 1NAEA 3C7OA 4OYUA 1CX1A 3EB7A 2V4VA 2YFUA 1EUTA 3ACFA 1JYVA 5JXJA 1T2XA 1OF4A 1WCQA 3LPFA 1DLCA 5DPNA 3U37A 2WBKA 1JI6A 3MBWA 4BK4A 4ET7A 2VOTA 5C7GA 5G04L 1H6YA 2W91A 2J1RA 1CZSA 4DXTA 3HEIA 4A41A 1H6XA 2E26A 2J7MA 1K45A 2QQJA 2VCAA 3F2ZA 1PX4A 4MADA 1K3IA 4W4ZA 3WF0A 5I0DA 4CUAA 3DYMA 3CZJA 1W9SA 3JXSA 3VDBA 2C9KA 3CZUA 5FUIA 3WSOA 2ORXA 3UETA 3HPNA 3T0DA 3CMGA 1J83A 1XC6A 2WABA 4M4PA 4DXSA 5JXHA 2E31A 2XQXA 3OG2A 2WUHA 1UYYA 3SEPA 2Y6LA 3P6BA 2WO1A 2HYXA 2X05A 4KI5M 5HPOA 4W8JA 2RVAA 5G05L 2R7EB 3C8XA 2V72A 4OUEA 3A21A 3THCA 1CZTA 1GOGA 1K12A 2VZTA 4HG6B 2C4XA 4A44A 4ZXEA 2VC9A 2RJ2A 3I2JA 4TXWA 1GOHA 4ARXA 2Y6GA 2JKXA 2VTFA 1JZ5A 4XUPA 5C70A 2E33A 2ORZA 1W0NA 5JMOA 3VD9A 1W8NA 2ID4A 3LE0A 4XUQA 3HOBA 1UYXA 5JUVA 1HN1A 2ZXQA 1XNAA 3CQOA 4P08A 1EUUA 3W5MA 2QQIA 4XUOA 3BN6A 2VL4A 3I3BA 3VD3A 4ZZ8A 2X10A 3FL7A 1OT5A 3NJVA 2V5DA 3ABZA 3GM8A 3I3EA 3FHAA 3MV01 3K75B 5J1XA 3IIIA 2JDAA 5JR2A 2LS6A 5LA0A 3MUZ1 4A45A 2W1SA 5DN2A 2Y6JA 4LHSA 1NX9A 3VDAA 2VO5A 4P02B 3W5NA 2VZQA 2J1AA 2WQ8A 3C7GA 3HNMA 4LPLA 2CDPA 1CZVA 3BGAA 3ACGA 3DYPA 1JYWA 3GDBA 1TVGA 5IJRA 2QQKA 3P1IA 5B4NA 1F4HA 2ZEZA 3WNOA 3IAQA 4PT6A 3K77A 4P00B 3ECQA 4DXRA 1D7PM 1JYXA 1SG3A 4A3ZA 2E32A 4AG4A 1W8OA 1KEXA 5LA1A 3ACIA 1GMMA 3T2PA 2WAOA 3DYOA 1K42A 3CIHA 4UAPA 1NKGA 2B4KA 1W9WA 3DECA 4A4AA 4JKKA 4QDQA 1O8SA 2WO3A 1UY3A 2W1QA 1SHWB 2WZEA 3WEZA 4QB6A 3OB8A 3GXUA 2J1VA 2VQUA 4D8MA 3C7EA 3VD7A 3T2QA 5DQ0A 4ARYA 4GWIA 4XZUG 3C7FA 4DUXA 4DUVA 4CVUA 4ZY9A 1YQ2A 4UOJA 2J1UA 2WDBA 2VQTA 3A23A 3LEIA 3T0AA 1GUIA 1UX7A 5EJZB 3LEGA 1UY2A 2YG0A 4DEVA 2RV9A 1XPWA 4YPJA 5EIYB 5JXGA 2EIBA 2QQOA 1RYYA 2VM9A 2XONA 4IUGA 2VCBA 2LW8A 2W87A 5DMYA 2W94A 2B9VA 2WZ8A 3ZM8A 2VMCA 4M4RA 2QQMA 1NUKA 4A6OA 5LA2A 5JXIA 4XUNA 2Y8KA 3VD4A 3I2FA 2WYSA 4QX3A 1UXXX 1L7RA 2W46A 2DCJA 4BK5A 2VMDA 3AC0A 1GNYA 3C7HA 2WO2A 5C71A 3FHQA 3I2KA 3MUY1 3WNNA 1XNTA 1IQDC 1ULOA 4D0QA 1R64A 5IFTA 4P5YA 1BHGA 2OKXA 3SEEA 1O59A 2W92A 2XOMA 3LPGA 4QAWA 2EIEA 3EYPA 2Z4FA 1L7QA 3WNMA 2VZVA 3A7QA 1GOFA 1OH4A 3WNPA 4DEQA 4ZZ5A 2EIDA 2J1SA 3I2GA 3MV11 1DP0A 1UYZA 2DCKA 4OZOA 2VMFA 3IB3A 4MGQA 3WF3A 4BDVB 1PX3A 4QB1A 4CUBA 3WF2A 3IDAA 2VZPA 3THDA 1JZ8A 4JKLA 1JU3A 3VD5A 2ZEWA 3NQHA 4A42A 2VJXA 1SDDB 4QPWA 1UWWA 1P8JA 2VZSA 3OGSA 4KMQA 2W95A 3OEAA 5F7UA 5EJ1B 4QX0A 3NJXA 4UI9L 1W9TA 3FN9A 5LCWL 4E8DA 4QB2A 1DYOA 4XUTA 3UESA 4MGSA 1OD3A 2WN2A 3HJRA 1JZ2A 3IAPA 2J1EA 2VMEA 2W9XA 1UY0A 2PQSA 3PUIA 2VZ3A 3UNPA 3LQCA 3K4AA 1UMIA 2JD9A 1OF3A 3K46A 2QQNA 4JKMA 4JHZA 2EICA 3I97A 4FI9A 4PQQA 4CUCA 3A22A 4GWJA 4MO3M 4BJ0A 1LNSA 3PUHA 2KD7A 3NNGA 1F4AA 2J22A 2ZEYA 1UY4A 2HLEA 5A1AA 2Y64A 2VR4A 1UXZA 3CKHA 3WNLA
chains in the Genus database with same CATH superfamily
1UU5A 4PLOA 4Y1XA 5FZ4A 4LKEA 3URFA 3I2IA 5AC93 3OGVA 5F1RA 4L0PA 1Q8VA 2AREA 1US3A 4S2DA 1NY72 1JXNA 4JV4A 3LAGA 1DG6A 1Z0HA 2VZOA 3PURA 1ND3A 5FYTA 2O1QA 3C2UA 1MS1A 1C3HA 1TMF2 1VBB1 3MHZA 4OMDA 2XB6C 3NJZA 1CVNA 2VZUA 2ARAA 2Q0AA 1UNBA 1YO8A 2PELA 4AI0A 1DDLA 4KNCA 4PF1A 3AP4A 3VBUC 1W9YA 2ERFA 1BQPA 3B9IA 2JKBA 3HNYM 1D2QA 3KV5A 3OOXA 5F3EA 5JZGC 3PMEA 1S0BA 4CP9B 4YVWC 5F2WA 4AEDC 3MLKA 4RHV3 5ERLA 5C9AC 3L2YA 1WA6X 3HVDA 1OUSA 4W50A 4DRVA 3THTA 2W08A 3T09A 5C9AB 3MO4A 2OQ7A 2WO7A 5GZDA 2JECA 2VNOA 1LHWA 4XFBA 1HJGA 1PO23 1W8ZA 4QGNA 3ZVXA 1OKOA 1BXHA 1XYOA 4GJYA 5FYCA 3S7IA 4Q8KA 4Q26A 3Q8EA 5CZKA 4TWTA 1RB8G 2RS11 1NXD1 5FXXA 1GZCA 2NLRA 2OYZA 3VBOB 4ZXKA 1VBE3 2TBVA 5J37A 3AVRA 2BERA 1TG7A 3R4DB 3SCFA 1AYN2 4PCRA 1JU4A 3FJSA 2DFCA 2VZ1A 3NRUA 2YC2A 4LBJA 3SITA 4FBFA 5C8CB 5J09A 4AAXA 4V2VA 4EJRA 3KGLA 4IEYA 4QDSA 4IQPA 4RGGA 4QQHA 1HDKA 2VUDA 2R6QA 2VOVA 4RS5C 4X8NA 3TBDA 4C1XA 3LEKA 1OH3A 1VBA2 3MLLA 2FZ1A 5FXWA 1LU2A 1PO21 1RUC3 2DYCA 3AK0A 4C90A 1TNRA 4V1PA 3OUIA 3ZXJA 2XL7A 1TZOA 3CJIA 4BB3A 2UU8A 1OLQA 1WKYA 3PUSA 4TN7A 3POEA 4EV0A 3J8F1 5KXEA 1CIYA 3GBFA 5A80A 4OVEA 2VXJA 2AC1A 4D6SA 5D8AA 4CDWB 1CIWA 2W3JA 5FP7A 1BEV2 3I59A 3J7HA 4DY3A 1UIJA 3ETPA 1W9FA 3AYAA 2RS31 1NCQA 3GCXA 1CESA 2DCYA 3Q8FA 3SXWA 1BVP1 5KHHA 5B4XA 2VVFA 5KXDA 4PJYA 2X09A 3L9JT 2IFRA 4Q4V3 4UFHA 4CCOA 3I2HA 4LUMA 1UZVA 2KXLA 5M0TA 5A1FA 1LHUA 4JTOA 4D7TA 4OI0A 2VZRA 1PMHX 1VBE1 3CJXA 3K4ZA 3ZN5A 4HL0A 2F4PA 3B9CA 4LHNA 3ZMNA 1SLCA 3T08A 5I93A 2D6KA 1TMF3 4CYDA 3H8RA 3SKJE 5CNAA 2J1TA 2A6XA 4CZSA 3D3AA 1UQXA 2V73A 3ZXKA 2ZGQA 4BWOA 5KC6A 1US2A 2P1BA 1PVC3 2HWE3 1GSLA 3A0KA 4Z07A 2GALA 1BCXA 5FMDA 1RHI1 1RXGA 3BI3A 1GNZA 4FP2A 1PHMA 4D69A 1U12A 5F5IA 3VDCA 3BTAA 4UFLA 2R043 1KRIA 1RUH1 1H0BA 1WUVA 5FZLA 5KR7A 1CX1A 1UOJA 2R061 5CKQA 1LGNA 1BYHA 2V4VA 3IDBB 2D6MA 2YFUA 4EQVA 5FK8A 4Y1UA 1T2XA 1OHFA 1SQ4A 1HIXA 1LR5A 2RMU2 1OF4A 3ZSEA 3LPFA 2G9GA 3VZLA 3U37A 5KXBA 3H8XA 3T30A 3BB6A 5T5LA 4XIKA 3JB4C 1RUE3 1D4M2 3GBGA 2ZGMA 5FZOA 1RUH3 5G04L 3WDXA 2VW1A 5FWEA 3G7DA 3VBRA 1H4GA 4AVTA 4DXTA 1N1TA 1QJY1 4XDQA 4WM8A 3D6EA 4OI1A 1RHI3 1S0IA 3N9NA 3WV6A 3WXPA 1M06G 1TEIA 1K45A 1U5XA 1R1ZA 4AFMA 3O1SA 5FKBA 4QHOA 4CPBD 1KXGA 4LLFA 2XLAA 2R16A 2WS91 3J7MA 4FPLA 1OKQA 4OLLA 1IS3A 1M4WA 3DN7A 4MZUA 4M3CB 1W9SA 3JXSA 4Y3OA 4Z8BA 1B35C 3OBZA 5FUIA 5L9RA 3ZFEB 3V0AB 2ORXA 5FYHA 4DIQA 1OI6A 4R4ZA 3CMGA 2RE9A 3SCGA 1NYWA 1UF2C 3PIJA 4K7JA 1A6CA 1V0AA 2ZBJA 4FPGA 5IWFA 4GALA 5FYUA 4NIDA 3GCWA 1CAUA 3OG2A 3BCWA 4ONUA 4JZRA 2AGSA 3M3QA 2ENRA 2WO1A 4Y5TA 2JG9B 3OSDA 2V5YA 4LJHA 1L3JA 2E9QA 5LK5A 2ZA9A 1RMU3 2VUCA 2ZX3A 2RVAA 3KQRA 5FZ1A 3HAGA 4MGTA 2R7EB 3C8XA 4QX5A 2Y0IA 4CDQA 2V72A 4GB32 5HBAA 3OJBA 3PJYA 2NYYA 5FY9A 3NNLA 1NCQC 1VPHA 2Q8OA 4BLIA 2VXRA 1PIV2 4X6QB 2VMGA 3VGIA 5BNOC 1JYIA 3ON7A 1K12A 1PO13 2VZTA 3WDUA 4A44A 2RJ2A 4AHWA 2TUNA 2FMYA 3I2JA 3PLQA 5CKNA 2Y6GA 3ZXDA 1IS6A 4XUPA 3D4KA 4Q0QA 3CJIC 5C70A 2YXSA 4P9IA 1V9U2 2ORZA 1WW7A 5IVYA 1PGL1 4NIGA 2A7AA 1W2AX 3I3QA 2OIIA 1W6OA 3FFQA 4NR1A 2ID4A 2UY9A 3LE0A 1S0FA 1A78A 4NIAA 1XYPA 3E5QA 1SPPB 1QJX3 2FCTA 4LBOA 2ZXQA 3OPZA 2JDYA 5TSWA 4O61A 3N3HA 2UWCA 3RG0A 4COZA 3GF6A 2B7YA 1JODA 1PK6A 1O91A 1NE4A 2AZ5A 2DUPA 3V65A 3Q9OA 4IXLA 4AHZA 1QEXA 3VBUB 2FD8A 2ZPXA 4R9AA 4SBVA 1GFF2 3RJ2X 3B01A 1VBC1 3RSJA 5BNOB 2XKOA 1YFUA 3BIEA 3NJVA 5LY1A 2GZWA 4FOYA 2V5DA 4EN6B 4AGGA 2HWD2 2X5IB 5GZEA 2A3YA 1AXZA 3MV01 2HJIA 1R092 1CAXA 1WZXA 2JDAA 5FYSA 3M70A 4XQ4A 5BNPB 1SLTA 2X5IC 1BBT2 3M2MA 1H2LA 3O1RA 3B69A 4LHSA 3VDDB 3VBHA 2EAKA 4YZ1A 4F8AA 5FPUA 1I1EA 2VZQA 2FHRA 3ZXLA 5GALA 3FFZA 1DGRA 5FY4A 1LOBA 2CDPA 1CZVA 1GWKA 2E7QA 3DYPA 1JYWA 4BU2A 3GDBA 1FV3A 4N43B 5FMCA 1DFQA 1NOVA 1OQEA 4CCLA 4Y1VA 4OQ9A 4B4PA 5F5AA 2HEVF 1BK0A 1DQ1A 2BUKA 4P00B 5GZGA 5GZFA 4I0BA 3WNXA 1U5ZA 4DXRA 5IAVA 2E53A 1VJ2A 1S0DA 4ISRA 3U10A 4DXZA 2D93A 1W8OA 3ZXAC 1YRZA 4GA9A 3PTRB 1K42A 2EXKA 2YUEA 2B4KA 3DECA 4M3CF 2DU0A 3WW2A 4CDQB 5IVJA 1E5SA 1ND2B 2R041 4JKKA 5GLZA 1QJY2 4QMAA 2P3YA 4Y20A 4HLTA 3RZHA 4E2QA 1U5YA 1GV9A 1PIV3 4CUGA 2W1QA 3W9AA 4CDQC 1XNCA 3FZ3A 3WUCA 4QB6A 2GC1A 2ARCA 3NV4A 2WT2A 2VQUA 1ZA4A 3R05A 5F32A 3EQEA 3C7EA 1A34A 3VD7A 5E6HA 3Q8CA 3I2OA 1YJLA 4LBQB 5EZWA 3PMSA 2PAKA 3ALQA 3NAPC 1X8EA 2YPDA 3LDKA 1ASJ2 2CSGA 3C7FA 4AFCA 1WCSA 4OHYA 3SH4A 4DUVA 3X29B 3H8UA 5FPLA 2XJTA 3U4XA 1VRH2 2JG8A 3EJKA 1W6QB 4Q4V1 5BY5A 2VMHA 1JMUB 2ZX2A 1XE8A 1LGCA 1O4TA 3T1MA 5JMCA 1MZ5A 2W2IA 3RVHA 3LEIA 2RM21 4TLGA 3USUA 1K5MB 3O12A 3LCPA 2AEZA 4XACA 1XOYA 2ZGTA 2QQWA 2ZKLA 1SCRA 2QZ3A 5L36A 4YPJA 5JXGA 4E4HA 2B42B 2IXHA 3VKMA 1RUJ1 2YC0A 2XONA 5LWBA 5DMYA 2W87A 4YG6A 1UX6A 2WZ8A 4Y5SA 1JH5A 3RWNA 2D97A 3BPZA 1VAVA 2VE1A 3KMHA 4MLOA 1HB1A 1N1YA 5I8SA 1BBT3 3H1WA 2ZX1A 1OA3A 5JXIA 4Y4RA 4YVSC 1VBC3 1YHFA 4EN8B 3KQ4B 3FUOA 4FXKB 3GNEA 4LBKA 5EFUA 1CJDA 3I2FA 5CG8A 3CU7A 1JYCA 4LKDA 1UXXX 1IPKA 5JOXA 1VRH1 2RM22 4N9IA 5FZKA 3HN1A 3B7MA 1K5MC 2UWBA 4HKLA 2D3PA 4BK5A 2VMDA 1YFWA 3OY8B 5JOWA 4YW6A 3AC0A 4LITA 4ZONA 5FY5A 1AJOA 3ZXGA 4UXAA 4D3WA 3MLJA 4UF0B 1ZBA2 3R4SA 2J42A 1PO22 1ZYBA 4B8EA 1QOSA 2GP5A 2XVLA 4LIUA 5EYYA 1NLSA 4RD7A 2A1XA 4NAOA 4UW5A 5JI9A 1IQDC 2NM1A 1DZQA 5C3PA 3VZKA 3RYPA 3ZN6A 1QDOA 3P3NA 4DS0A 5DZEA 5AVAA 3V64A 1E5HA 2W92A 1AL23 2XOMA 4XMIA 3SEEA 4AXOA 1IQAA 1LOFA 2EIEA 2RJKA 3EYPA 4PIXA 3ATGA 3WNMA 2VZVA 1C1LA 1COV3 2GNBA 3A7QA 4Y1YA 3TNQA 3WNPA 1XNKA 4XF1A 3I2GA 3A0NA 3WP4A 4RSUA 4L9BA 1UYZA 5FPXA 3T2TA 3M7AA 1BBT1 3BODA 1RVF2 5KHKA 3WG2A 3WP5A 5JOZA 2R063 1LODA 2CGOA 1JZ8A 4JKLA 3WG3A 2Y38A 3AP9A 5E88A 3VD5A 3BOPA 2WJSA 4QKDA 1NA1B 2E7AA 3KLSA 5GJ6A 2R1DA 3SISA 5L73A 1LHVA 2DVFA 5D1IA 4DINB 4HMZA 2VZSA 1AR93 4KMQA 2DU1A 4AZZA 1YIPA 4TSVA 1X9TA 1S0GA 2E63A 2PHFA 3TN92 5F7UA 5C8WA 3DL3A 3NJXA 3KGZA 3OGJA 1R093 1W9TA 5FZMA 4BHPA 4BM8A 3ME2A 1H1AA 2D6PA 4HK8A 1BK1A 5LY2A 3P5BA 4XAAA 1JUHA 4QM8A 4GKXA 1U0AA 4YGCA 4RR3C 5BNPC 1AYM2 2Q5TA 4GQ7A 1C1FA 1WLCA 5JZGA 2H6CA 3ZLIA 2MNGA 4Y22A 2WNVA 1WW6A 5F8PA 2RS13 5A3UA 3POYA 1Z7S3 2Z79A 1VRBA 1ZX5A 1EAH1 5FWJA 1PM4A 4J6GA 1TE1B 1COV1 4DO0A 5L7OB 3UNPA 4D7SA 1XXNA 1J1TA 2O8OA 1DQ6A 4UBHA 3K4AA 3RRDA 3MGUA 4LA3A 2BP6A 3J4UH 5JIAA 3UYJA 1QJU2 3K46A 2QQNA 3ZSJA 3ZYPA 2EICA 4IEXA 1H2NA 1LENA 2G1MA 3N9OA 3U14A 4CEWA 1CPNA 2WT1A 5EQUA 1YQ8A 5T50A 4COUA 2RDRA 4HOOA 2KD7A 2F17A 2DUQA 2UY8A 1F4AA 2IXLA 1GP6A 4NUBA 1QJFA 4RFT0 5C8CA 5I0SA 1Y9MA 2ZEYA 2HLEA 5A1AA 5F3CA 4QPIB 2VW2A 2VNRA 3CKHA 3MIEA 3QH7A 1AR62 1VE0A 3PJQA 4QX2A 4YFWA 1RUE2 5JPNB 2OUHA 4FPYA 5CFDB 2NN8A 1NXMA 3AYEA 2HWF1 1SLBA 1Q43A 5J96B 2E6VA 5IUQA 4HSJA 4QXKA 2QDNA 5LBEA 3O1VA 1XE7A 3RMYA 3WF1A 3N9LA 2DWRA 2VH9A 3APBA 1W6PA 3T2OA 4KWKA 1SCSA 2C1FA 2X29A 5ACA2 5J7MA 2XJRA 4HBNA 5I8YA 5A7NA 3EXUA 4DPNA 2K0GA 1W0PA 1C8M3 2AYHA 4CDXC 4B4RA 4YGDA 1H9PA 4LQRA 3HN3A 2MHFA 1PZ7A 1RIRA 1XQNA 4GZ9A 4S2FA 3JD72 1ZZ8A 2W5FA 2JG8C 5FPZA 3JB8A 4LE4A 4LBQD 3UKNA 1D4M1 3ZYGA 2YFZA 1JZ6A 1GANA 4W6YA 4AVSA 5DUWA 4PI2A 2OZ6A 4OZXA 1JZ4A 1FPN2 4KG0A 1HRV1 1F2NA 1AR71 5DZFA 5GLWA 1WLDA 3HBZA 4BCUA 1YFYA 5AVPA 2BVVA 4LMFA 5IFPA 1QNYA 2BZDA 3TNPB 3D5OA 3FLPA 3I8TA 4GMP1 4P9YA 2X8KA 2YB7A 3LF7A 3M4FA 4Y26A 1H9WA 5A3TA 1V6KA 1QH7A 2R30A 2ZJCA 2HWF2 5FZ7A 1A8MA 2JDMA 1CJPA 4QQPA 2BBAA 4UFKA 2VMIA 2HH9A 1E57A 4EZHA 4CCMA 1DQ0A 4MSVA 2K46A 2XLFA 3LSEA 3P3PA 4K9SA 1S0EA 4SLIA 3WQBA 1ULDA 3KM5A 4GMP3 5FP3A 3MW2A 4GAZA 2F6BA 1IKPA 4CP0A 5A7OA 2XVKA 4E2GA 4EYUA 1SMVA 3MF6A 3W21A 3MIDA 1DQ5A 1AR73 5F3GA 3AMHA 3K4DA 5FPBA 4TTGA 2Z5WA 1FPN1 4L8QA 2QDRA 3ELNA 4QPGB 5I91A 3TEYA 4BH9A 3GHMA 3NV2A 3GZAA 4RN5A 1O8PA 1IPJA 5HCFA 2BGOA 2XXZA 4AQTA 4CCDA 1O4ZA 4GWNA 3RYKA 1DYPA 4NAMA 2EA7A 1R081 1MACA 1GZTA 5FMOS 5CFCC 2ZGOA 4AQ6A 1MS0A 5EHDA 1DGWX 2C26A 1NCQB 4LT5A 2QQLA 1ULGA 2MEV3 3N36A 1UO9A 3OY8A 3WNKA 2ZGUA 1I5PA 2IUWA 3HQXA 1WD3A 2XBO1 4R52A 4XF3A 5D8AB 4CDWA 1OFSA 2C9AA 3KHCA 3I54A 1J3RA 4P14A 2PQQA 2WIIB 3NKTA 2RR12 3HNBM 3VBSA 1R091 2K9ZA 1AX0A 5I0RA 5LZ6A 1XNDA 3ETQA 4J1WA 4KU7A 3RWKX 4HVRA 1X8MA 3LEMA 4HT1T 2R32A 1GQGA 4FFHA 4CU7A 1GQHA 1NCRC 1LESA 5DDJ1 5DDJ3 4QX1A 4JQTA 1T6BX 4YVSA 2PFWA 1Y3TA 1STMA 1OBNA 2WNUB 3OPWA 4OCTA 1CD3G 3KV9A 2YHJA 3AP6A 1RUI1 2VNGA 3CNAA 3IN9A 3AZYA 1AZDA 4CDXB 5BXXA 2HWC1 3AMNA 4FOQA 4PDWA 3QH6A 2LM3A 1KDKA 1FAYA 1O3QA 1OFNA 3I49A 1ACCA 4AEJA 1WCUA 1QJZA 5FZHA 1JW6A 3AKPA 4Q0UA 2H0VA 3AMMA 5FTTC 5JXJA 3H8OA 3OBTA 3VBOA 4NMIA 1AX1A 2KA3A 4K21A 4BQXA 1EAH3 1HX6A 1SLIA 4LBLA 4EZ4A 1WCQA 3CL1A 1HRV2 1RUD1 5DPNA 4GB33 5A6ZA 1YQCA 1D0HA 2VOWA 2CWSA 2D7FA 3AP5A 1S0CA 3IWZA 3MBWA 4XF4A 5FXZA 4BK4A 5I0TA 2DBNA 3J8F2 2VOTA 4XJZA 1DGLA 2W91A 2G19A 1LB2A 4QM9A 4I30A 1OQDA 4A41A 3LOIA 2LRPA 4JDOA 1EP0A 2WZR2 4KGGA 5CFCB 2J7MA 2BYVE 1LOFC 3GZEA 3F2ZA 1MEC1 2D5HA 1U5IA 1V9U3 2OPWA 1G8WA 3K3NA 1RXFA 3UGFA 1N1VA 2A75A 3L2HA 4MADA 1BJQA 1K3IA 2WS92 3HQUA 4GULA 1TMF1 4R9CA 5FFOC 5FDBA 3WF0A 5CU1A 2YMZA 3QD6A 4CUAA 3DYMA 5C5TA 5FMOL 1FATA 1OVSA 2B46X 2VOXA 3B94A 3VDBA 2VUAA 1LRHA 2C5DA 2C9KA 1NLQA 1ASJ3 3UETA 3BKZA 4OHXA 1J83A 1QWRA 3JQWA 1VRH3 1KITA 4YG3A 1Q8SA 1XC6A 2WABA 4A6SA 4DXSA 2E31A 2WUHA 1WCDJ 1UYYA 2AH2A 2VCMA 3D0JA 2D5FA 3P6BA 1MS5A 2OVUA 1SLLA 2WSVA 4N43C 5HPOA 3PUQA 4QPYA 4RQPC 4W8JA 5G05L 1LHNA 4FTBA 4NJ4A 1JTZX 4G4FA 4CEYB 2ZABA 2I2SA 2ZAHA 1CONA 1O6UA 3CEWA 4OUEA 4R9DA 4XYXA 1ST8A 1VMJA 5FRAA 4E9KA 2OXBA 2VY0A 3THCA 5IK8A 3RZMA 2Q1ZB 3SLIA 1W05A 4DY5A 2RR13 3H3LA 3O0WA 4KBBA 4HG6B 4CDWC 5D8AC 2I74A 5HXVA 3ILNA 4XFIA 1QH6A 5FZ3A 4TXWA 4HPKA 4IEOA 1UYPA 1VIWB 3WW4A 1YQ6A 2VVEA 1W39A 1RUF2 1LHOA 3VZMA 4WM7A 1I6XA 1W0NA 2W39A 4YM3A 5JMOA 1AYM1 4CSWA 1V6NA 2WWJA 3ZSMA 4NO4A 1W8NA 3WDVA 4XUQA 5IVCA 2JJ6A 4Q4Y1 3AB0A 3VKOA 3WCRA 1UYXA 2WKKA 3WZ1A 1LECA 3QCWA 4FCAA 2BFUS 3RDIA 4QPIA 1HN1A 3AKSA 2GH8A 4BMBA 4BE3A 4D6QA 2GH2A 5DAVA 1EUUA 2VBDA 3AZVA 4YFZA 3W5MA 5A7WA 3TEWA 1ENSA 1J58A 4CDUB 4LBNA 2DUOA 3W59A 2RS51 1ENRA 4JGZA 2HWB2 1MZFA 2ZTNA 4UW3A 5FK7A 3OBRA 4CEWB 1HRV3 4Y33A 4Q4V2 4F3JA 4QX7A 2W0XA 1LOEA 4WM8C 3WOGA 3ABZA 4DNYA 3I3EA 2LTNA 4QKNA 5J1XA 3FBMA 5EP9A 2BOJA 4Q0PA 2B39A 4QKFA 3WR0A 1OMIA 3MUZ1 1VAKA 2MPFA 5FYYA 4A45A 4XCBA 1FNZA 1ZVFA 2WZR3 4QKBA 3ZIWA 4IV1B 4YG0A 3IKWA 2JICA 4JGYA 4P02B 3W5NA 2FMDA 3VBRB 2Q8CA 2WQ8A 5FO8B 1Q3EA 3C7GA 3NNJA 4YVWA 3ASIA 3VKNA 4LHKA 3AZZA 1WGPA 1HJFA 2D44A 2JX9A 2QQKA 2VULA 2ZMNA 3GJAA 1ZM1A 4OI2A 5B4NA 4M00A 4AFDA 2ZEZA 3N9MA 4UF0A 3K77A 3ECQA 4ZU4A 5DUVA 2B5HA 1SACA 2PLV3 2VGDA 1W6NA 3KCCA 2ZGSA 4R8HA 4XJ8A 2ZHKA 1JUIA 1QQP2 4A3ZA 4LBQA 3HT1A 4IV1A 3TN91 3AKTA 1POQA 2X53S 4MXWB 3I3MA 1O3RA 3DYOA 1R083 1QQP1 1N1SA 1NKGA 4XHBA 1W9WA 1HRI3 1O8SA 5FY0A 1NZIA 5CFDC 4PLNA 1ZBE3 4RGKA 4XHXA 1UY3A 3O1MA 3PU8A 3TWIA 2RDNA 1S2BA 2A3WA 5FP8A 5FQ0B 4GXLA 1O3TA 4L2NA 3MIBA 5DDJ2 1Q8QA 2RS52 4CP1A 1EV11 2A71A 4DB5A 1C28A 1Q8OA 2RS12 3ZFEA 3H3UA 3O14A 5DQ0A 4GWIA 1IHMA 1X50A 5F6LB 3PVBB 4PBPA 4XZUG 4XC9A 4E27A 4K20A 2CL2A 2D6OX 3NMBA 1VLNA 3BU0A 4YGBA 1W3XA 4Q29A 4A7YA 4JDMA 4AEDB 4CVUA 2FZ2A 4Y5Z0 4ZY9A 2CWMA 4A3XA 2XDVA 5E89A 1OC1A 1T6GC 5LBFA 3ZN4A 2J1UA 3T3YA 1CAWB 3J26N 2WDBA 4M01A 3LA2A 4PBOA 4XFHA 3A23A 5FYVA 5JLVA 3QBQA 4ZU5A 1UY2A 2YG0A 3WW3A 1RUD2 1ZZ7A 2NMNA 4HSLA 4XJAA 5GZCA 4GD4A 4EN0A 2HWB3 1XPWA 5EIYB 3RS6A 3USSA 2QQOA 4NHYA 3J8F3 3VBHB 3VDDA 2E51A 4NVPA 3ROUA 4DZGA 4CTEA 3FLTA 2VM9A 4IUGA 2ADDA 3WT3A 3MIGA 1WBLA 4H14A 3CLPA 3NO8A 1ZZBA 5F9TA 4JHTA 4D94A 3H1YA 1W8HA 5ABJB 4OULA 5FJHA 3LZZA 1W28A 4MG2A 2Z2SB 4CEYA 1W8WA 5A3NA 4CCCA 1NUKA 2IXIA 3AL6A 5FJKA 2IC1A 4C0HA 1RC6A 4A6OA 3GZTB 5FOBB 1VR3A 5A3LA 4ZS3A 3VD4A 3IMNA 4YZ3A 5ACA3 5FZEA 2DCZA 5FY7A 2WYSA 3UKVA 5JSOA 4LNVA 1C8M2 4XFGA 4BQ4A 3G6JB 4JAAA 2DVAA 3RYRA 3OD4A 3RNSA 3VLBB 1RL3A 3MYXA 4P9LA 5LASA 4QHBA 4ATEA 5CAZA 5A32A 4FQZA 2CGNA 4NWWA 3C7HA 5F5CA 5FUPA 4XETA 2WO2A 1KS5A 5C71A 2QJVA 2XVGA 2ES3A 2Q30A 2ZGLA 3SQOA 5A3OA 2XHKA 3I2KA 4EWDA 5IT6A 3GALA 1YUDA 4BISA 3WNNA 2GMEA 1Q56A 4PIYA 2BWCA 1XSQA 1SLAA 4WBBA 1A8DA 3W58A 3GHNA 4AE2A 1XNTA 1G9DA 3QOPA 4D0QA 2LROA 3U07A 3IPVB 3ZFFC 4KU8A 3RJRA 1YNAA 4LLOA 4XDOA 3DV8A 3RQ0A 1NE6A 1PO11 4HFSA 5JOYA 2P3JA 1ODNA 1XJAA 2ATFA 2DTYA 2BDRA 4META 4ITCA 3ZXEA 4AFBA 4UW4A 3WHTA 3AMQA 3JUUA 1OH4A 4NHXA 2EIDA 2RS53 3C3VA 3WX5A 4BIFA 1VBB3 3MV11 1DP0A 1UKGA 4YLZA 4OZOA 1FX5A 1C4RA 1JOJA 2VMFA 2XJVA 3IB3A 3R0RA 3OF1A 1G86A 4NRQA 4W6XA 3U11A 4B1LA 4FTSA 1KDMA 3IDAA 2VZPA 1UN1A 2GAUA 2ZHMA 4S2HA 2ZEWA 2HBTA 4OHVA 5FZ0A 1W2TA 5FV3A 4A42A 1SDDB 4QPWA 3DXTA 5FYBA 4HKWA 1P8JA 3VB9A 1UIKA 4CRQA 3B3QE 5KHIA 2D40A 3U0ZA 3O7OA 4O9EA 2W95A 3AFGA 4BZ4A 3ZX7A 1W6OB 4Q4X3 3AKQA 1VALA 1IKQA 3O0VA 2CV6A 2H0BA 2MEV2 1VBE2 1YCIA 2ZGRA 4ASKA 2G4IA 4UI9L 1DBNA 2VTXA 2ZACA 4XQWA 4WM8B 2KM2A 3VBSB 1QKQA 2UYAA 4FAHA 1POV0 1R1A3 3ZR6A 3K3OA 5K4LA 4I0WB 1QY4A 4AYUA 1HLCA 4E8DA 3JD71 5HI0A 2QTWB 4XUTA 3UESA 2DURA 5T5JA 1OD3A 2VQ0A 2WN2A 4G3YC 5KWRA 4JTNA 2RS33 3HJRA 2J1EA 1LOAA 1WW4A 2VMEA 2JB4A 3POFA 5FZFA 3S30A 4XW3A 1WLTA 1POV1 1UY0A 1H30A 1VBA3 1VBD3 4QPGC 4IEUA 2PQSA 4AQ2A 2C0ZA 2VZ3A 1E5RA 3JD73 2Y0OA 3LQCA 2WNVB 1QJU1 4N90A 4LOSA 4QQOA 2TNFA 3ZDVA 1FOD1 1FPN3 4JKMA 1OOPB 1UAIA 2PLV2 5KXCA 2JXAA 1PK6C 1KQRA 3HR9A 3N7KA 1QQP3 2ZMKA 4GWJA 4Q2FA 4YM2A 5H9QA 5H9RA 4MO3M 5LRSA 1LNSA 4RA0A 1YFXA 1VP6A 3NNGA 5LA9A 3WG1A 5D21A 4CE8A 4I02A 4LTAA 3U78A 1XRUA 1V9U1 2R072 3DGTA 3KV4A 4BQYA 1ND3C 1UY4A 3AZWA 2X5IA 2Y64A 1VMHA 1UX7A 1LKNA 2FDJA 1RMU2 2XUMA 5BPXA 3WNLA 4ASMB 2HEWF 2W47A 2XWBB 4LKSA 1JOBA 1HV1A 5H9SA 3SC7X 4FSJA 3ACLA 4NHLA 3ACHA 3T4VA 4URAA 4MYEA 2VG9A 3LGRA 3T0BA 4BA6A 4C1WA 3QACA 1F5FA 4BQ5A 2XUEA 2L9LA 5E1RA 4DOUA 5FYZA 3AL5A 5FXVA 1AYM3 4FPEA 2CAUA 2IXCA 3JCIA 3KWVA 4XJWA 3ZN6B 2ADEA 2D43A 2FQPA 3EBRA 4BQ2A 3LIGA 4TZDA 1GQPA 4X8PA 1V00A 1ZREA 1OURA 2WFF2 4FFGA 1OLME 1GKBA 5J48A 3WINE 1MPXA 4JCKA 4RYDA 3ZO0B 2ZGNA 1JS9A 4XILA 1J59A 1OD5A 1ZZ6A 1XBFA 1ZRCA 3I2DA 3JZVA 3E1F1 1FXZA 4RHV1 3SKVA 1F9KA 4A2UA 4E8CA 2CDOA 1F35A 3CJIB 1YLLA 3LKJA 3LWCA 4FPFA 3KS7A 5H9PA 1QXPA 1AUYA 5JWPA 2BGPA 1QJU3 3MFAA 4JRAA 2PHUA 3B93A 1NLRA 1ENXA 4HN1A 1LTEA 4Q5OA 4K8RB 2FDGA 3K2OA 3ILRA 1ZRIA 3DCQA 3KD4A 4CP2A 4RGAA 4YW7A 1Y43B 2BFUL 2GC0A 5JR7B 2D98A 1Z7S1 5A32B 3FLRA 1JZ7A 3DPRA 3AYDA 4G9SB 3U75A 5DG2A 2BU9A 2IXJA 4Q0SA 5GLVA 4XQDA 4E4DX 3VKFC 1RUH2 3ZFFB 1AL0G 2CYFA 2PHDA 2Y6KA 4YVSB 1DZRA 1YI7A 1N47A 4Q4Y3 2XBO3 4HKOA 2RG4A 4COWA 4LK6A 4K40A 4JGZB 1JZ3A 1H8TA 3WVJA 1CAUB 2PHTA 1J84A 2WFF1 4MGKE 2I07B 5F5QA 5A33A 2YGLA 5FP4A 5L9BA 5FY8A 3ZYJB 2YBKA 5BNNB 4WVMA 4DMIA 1QJEA 4Z2AA 3NVCA 3OGRA 4YM1A 1BKZA 4MUVA 2CHHA 4XABA 3RMXA 1L7LA 4R9BA 1JHJA 1IG0A 3KVBA 1DF0A 3AFKA 3AMPA 4FTEA 2WNVC 5K0UA 1WBFA 5LW9A 2JB8A 2QQPA 2WINB 1S2EA 1EAH2 3V56A 2XHNA 5CEHA 3H42B 1QF3A 2PAEA 3CDZB 3T4HB 5BV6A 5DAQA 2PHXA 1MS3A 4LBMA 4Y22B 1PMJX 3E5XA 1PZ8A 4WVMB 2W1UA 2EVXA 2EAAA 2ZEXA 2YPJA 4MHRA 1UY1A 4O65A 1KGYA 4JX0A 4MX3A 1DGWA 2HWF3 1W6QA 2W1WA 5LK7B 2V4AA 5FUNA 2R1BA 4IEVA 2Z69A 4V2WA 3WQ1A 4BOWA 2VVDA 1URXA 2WS93 2WAAA 3N7JA 2Y6FA 4AEKA 4CEYC 4NRMA 1YYNA 2QBXA 1ND2C 1OPOA 4RQPB 3OYWA 5A7QA 1MZEA 2P6HA 1IZ3A 4M0HA 4LULA 3WF4A 1OLMA 2BNOA 3ENRA 5ANQA 1ZRFA 3J7LA 4K6BA 1GU3A 3OTFA 3E6BA 1OA2A 5LBBA 4CU8A 4ORFA 2XJPA 1AYN1 3C7OA 2Z42A 2HYKA 1YIFA 4L97A 3EB7A 5A6XA 5T3NA 1JBCA 1UW8A 1W6NB 4KBZA 3NV1A 3AJZA 5FZDA 2OW4A 1JYVA 4Q4X2 2WFPA 3UT0A 1G9AA 1VBA1 3SH3A 4WZFA 1F15A 2PMWB 3FX3A 5BNNC 1OPMA 1VB4A 2WBKA 2WWUA 4HVOA 1OVPA 2R49A 5I0UA 3NL1A 4JVAA 5C7GA 3TEZA 1H6YA 4AI2A 4BQWA 1CZSA 2OQ6A 2QQUA 1PNFA 2P6CA 1PGSA 4YW2A 1H6XA 2DBIA 1DCSA 1UU4A 3D82A 4YGEA 2WA3A 4YSFA 1MVQA 2QQJA 2Y60A 1PX4A 1MEC2 3JBG3 2PXJA 1ULEA 3OUJA 3VUOA 5DAPA 1QU0A 3DEMA 3AVSA 3H1MA 3UK9A 2B45X 5I0DA 5T54A 3CZJA 1ZNPA 4RR3A 4W65A 2RDSA 3CZUA 4IE4A 1W2NA 4I0AA 1JN2P 2BGCA 2LUWA 2XWJB 4ATFA 3PDQA 3LOBA 2YY1A 1RUNA 2PHWA 3VBFB 4YZ2A 3ZXFA 1B35B 5JXHA 3KT1A 2XQXA 3RZLA 3SEPA 3BTZA 2A6YA 2BV4A 2OUJA 2WC2A 2Y6LA 4HXCA 5FAXA 4D6RA 4I2OA 5KC5A 4IERA 1ZBA3 3AJYA 4ZKTB 4IDZA 1GLHA 3HQRA 4I09A 5FZ6A 4LIVA 3DKWA 4FPJA 3AYCA 1WW5A 1V6OA 2G9ZA 1R1A1 1YWKA 1F5JA 3PUAA 3PL0A 4IV3B 4KWLA 3JQXA 3LDRA 4OUSA 4UWDA 5E16A 1NY71 2PN5A 5BUVA 3NSTA 1RUOA 2XH6A 1GOGA 2VC9A 3UJQA 2HWB1 3LA7A 5JI7A 3TB0A 2JKXA 3ZYFA 3TRSB 2D3RA 1JZ5A 2FCUA 2WFF3 4AFAA 1VMFA 1K5MA 1ND3B 4UFJA 5E8AA 5SV5A 4ZPIA 4B4QA 3MW4A 4QGLA 4XEZA 4XXPA 1H8VA 4YVWB 3VD9A 1DHKB 2RR11 5T52A 3VL8A 2WQ4A 5JAXA 5KHGA 1H1IA 1ZA7A 2QVSB 5C6CA 5CG9A 3VV1A 3HOBA 5CBLA 4TYSA 3OPTA 1W6PB 5DZGA 5EPAA 5JUVA 4OUMA 2CGPA 1TQ5A 3T1LA 1H8TC 2KR2A 3CQOA 4YW1A 2QQIA 4XUOA 4LHLA 1C5IA 2VL4A 3I3BA 2QZ2A 1EV13 2X10A 1R082 3GYDA 3FL7A 4NIHA 4GKYA 2A73B 2XGXA 4ASLA 1V6IA 4MVTA 1OT5A 1W2OA 3K51A 2A6WA 4XIOA 4N53A 1WLWA 2ZX4A 4IGPA 1PIV1 3LFIA 3ZFGC 2PA7A 5K9YA 3J9SA 1V70A 1ND2A 1W90A 1GNHA 4FPCA 1CQ9A 1FT9A 1REFA 2LS6A 5C4WB 3S7EA 5LA0A 1DGRN 1N3OA 2SBAA 2W1SA 5DN2A 1SDWA 3VZNA 1NX9A 4I01A 4IEWA 4QPIC 3VDAA 5FZOB 2VO5A 1PGL2 3WDYA 4AWDA 4KL1A 2WQZC 2J1AA 3BVCA 2VU9A 2Y26A 1SPPA 2EXHA 3HNMA 4IE0A 4LPLA 3BGAA 3MW3A 1AF9A 4WM7B 1TVGA 3E6CC 1FMD3 1DZTA 2BRTA 1LEMA 5CKMA 5CA6A 1FV2A 5F2SA 1NQDA 4FOWA 3LD8A 5C3RA 3ZPYA 3J7NA 5FZGA 4N43A 4YZ4A 3WNOA 2N7GA 4AEDA 4PT6A 3MIHA 1LULA 5FYMA 4XOGA 5ACA1 1SG3A 1AHSA 4QXHA 4RS5B 1UPSA 5F39A 2E32A 3ZKYA 4CCEA 2PYTA 1Z78A 4M0NA 4Z2WA 1GWMA 4JDNA 1KEXA 4YWAA 3ACIA 5FCCA 4AI9A 5LA1A 1GMMA 4OHZA 3T2PA 4Z92B 3VKLA 3CIHA 4O7XA 5BNPA 1TME3 3WLUA 3IDEA 1UU6A 2GMMA 3GBWA 2YYOA 4C0BA 4NPLA 4QU2A 1AR61 1AR63 4YW5A 3RI9A 3VBHC 5APAA 1SHWB 3VHRA 4YNIA 4BPZA 2A5ZA 1RUC1 3OB8A 3GXUA 4XPVA 4D8MA 1MQTC 2GN3A 1PVC2 2HWE2 3HD8B 5LEKA 4H3WA 1OLRA 3T2QA 4W6WA 1ZRDA 1AR82 1S4CA 1G9BA 4PIZA 3FBYA 4XFFA 3VHOA 2C6SA 2RJLA 2R062 3V0BB 2BPA2 5K7PA 2WNUC 1Y7BA 1RUG3 1C57A 2R0FA 4HVQA 5ANNA 1V6LA 2JDNA 4OQ8A 1AXKA 4GMP0 2IXKA 2OT7A 2BNNA 3BIWE 4FPOB 2F4LA 5CFCA 3H7JA 3RGBA 4ZHNA 2O8QA 2VQTA 3ZYRA 1KFXL 1N3QA 1D2SA 1GUIA 1RTVA 3LEGA 1PMIA 2PHRA 5D2AA 1G9FA 2ZOEB 5EJZB 5FP9A 3O1UA 2JG8B 2VQAA 2R071 4DEVA 1UZZA 2RV9A 3M3CA 2EIBA 5JIUA 1RYYA 4X6RB 1SBEA 2LW8A 3IPVA 1IS4A 2XQRA 2YDEA 5IVEA 2W94A 2B9VA 3M8LA 1HRI2 1NCRA 3IZOA 3LDBA 4LO7A 4XMAA 1IG3A 2VMCA 5C9AA 5A3WA 1FOD2 1MQTA 1NQJA 1TME1 2YU2A 4Q1RA 3ZFGA 3KZ4C 4Q27A 5A7SA 1ULFA 1I5ZA 1WMEA 3H0OA 2YBPA 5LA2A 1CGPA 4XUNA 5EJ3A 2Y8KA 2PTMA 2P3IA 2WNUA 2BBVA 2OS2A 4CDUA 3ZYIB 4B7KA 3RZKA 4QX3A 2DVDA 3ITQA 1V6MA 4NWVA 3TYJA 3F95A 4FPKA 5HCHA 4IESA 3LA3A 2JDKA 1DQ4A 1L7RA 2W46A 1XB9A 2DCJA 4FFIA 4HK9A 2ZGPA 2YU1A 3AXEA 1GNYA 1RVF1 5FPVA 5CADA 1MQTB 4JRLA 3FHQA 3R4UA 1PVC1 2GU9A 2HWE1 2VUJA 2ZZJA 3E6DA 3MUY1 2WZPP 3THPA 1HXS2 1O3SA 4CP9A 4LE3A 2WRAA 5ABJA 1APNA 3TAYA 2EXJA 4UBGA 1W8UA 2AR6A 1BEV1 1ULOA 3AM2A 1R64A 2QNKA 1G9CA 2P3KA 1CR7A 1BHGA 3H50A 1OUXA 1F31A 1W8TA 3CHXA 4UFIA 1O59A 4OI4A 4QAWA 5F3IA 5IK7A 5LBCA 1MZ6A 2UWAA 1L7QA 2Z4FA 5DUUA 3UGGA 4AR2A 4LOTA 2WNOA 1HQWA 4QU1A 5DABA 1GOFA 1VBD2 2BNMA 2P4EA 4DEQA 4F83A 1XU2A 3E97A 4JC1A 4U2AA 4B3NA 5FLHA 2J1SA 4L99A 4MHUA 2JDPA 1H4HA 2FDFA 4QWNA 1RITA 1PX3A 3D8CA 4QB1A 4PHZA 3ZSKA 1RUC2 2DTWA 3S0MA 5AC91 2D3SA 3THDA 4Z82A 4FXGB 5BYNA 2BW8A 3NQHA 3OCPA 3WP6A 2JDZA 3Q8BA 2VBBA 1OOPA 5GLUA 4MXWA 4AVCA 1UWWA 5FO9B 1I3HA 2GNMA 4RQPA 1NA1C 2R073 4RL7A 5FZ8A 3OGSA 5IVFA 2XJSA 4QGMA 3U1XA 4CA9A 2DFBA 5C4WC 2XLGA 1YC61 3OEAA 4BXFA 2OX0A 5EJ1B 1WA4A 1W3VA 1G6NA 2ET7A 1K5JA 2HWD3 4N53C 4QX0A 4Y4YA 3POJA 3FN9A 4LUKA 5LCWL 4N7IA 2TEPA 2D6NA 1AJKA 4IE6A 2VPVA 2R0HA 2OZJA 5IAXA 1RUJ2 1UZWA 3BALA 1DYOA 4A7ZA 5AFBA 4MGSA 1RUE1 4EROA 5AFEA 1BZWA 2YGMA 4EN7B 4AEMA 2B8MA 3IT8A 3IAPA 2XR4A 3N35A 2W9XA 3ST7A 3NKGA 4GH4A 4AVAA 1OA4A 4IV3A 4LK7A 2BEOA 4IETA 4LO8A 3UGHA 3ZOIA 3PVOA 1KS4A 1LJ7A 5JSRA 1UMZA 1UD1A 2AEYA 3WCSA 4XAEA 3DKQA 1GZ9A 1UMIA 2HWC3 1OF3A 2JD9A 2VTXJ 1X82A 4JHZA 4FI9A 5A70A 2SLIA 2VW0A 3KT4A 4FQ4A 3V0BA 1RJ8A 3NAPA 4NHMA 2FBEA 1RUF1 1C8M1 5LEJA 2VAUA 3PUHA 4M3CE 5LRRA 1ONAA 5CFDA 1SBDA 1W06A 1W6MB 4XE9A 2P5BA 2WT0A 3WD5A 2J22A 2JE9A 4AVVA 4AI3A 2QUOA 3SCHA 1CAVB 2VR4A 3KCYA 1QJY3 4PLMA 1IOAA 4Z1VA 5F37A 3KSCA 4DRRA 1NZCA 2VECA 1S0JA 3WDWA 5L19A 5IHRA 3WW1A 3TEXA 1W03A 5DUXA 3IMMA 1FMD1 1R1A2 1QOTA 3QLQA 2JDUA 3BU7A 4FFFA 4IGOA 1COV2 4IV3C 4L92A 2MEV1 1W0OA 1RINA 4XBQA 1AR81 1NG0A 4P9XA 1RUG2 3HBKA 3S5QA 4CXWA 3PU3A 1RUF3 1UKRA 4FO9A 4QDRA 4CCNA 4B1MA 4IL7A 2P2KA 2C24A 1UMHA 3KF5A 1S55A 5A6QA 3LSDA 3N4MA 2VCCA 4O9GA 2XKPA 4N8MA 3N7MA 4COVA 1TNFA 1ULCA 2WN3A 2XPJA 2GP3A 3LIHA 2FDKA 1QGLA 4H7LA 5T55A 2EIGA 2UURA 4KQ7A 4CDXA 3CBNA 2JE7A 2WWSA 1BVVA 1IGOA 2VD7A 3UV9A 2VOKA 5IYYA 3VZOA 2AACA 2BJSA 2CNAA 3N7LA 4GJZA 3AX4A 4XURA 1WMFA 1UZYA 2NMOA 2VNVA 2Y34A 5A7PA 2DCTA 2P17A 2JDHA 1WCKA 2DDUA 3FHIB 4UFMA 5HV4A 1YJKA 4XFCA 2XJUA 4IGQA 4JQRA 4OMCA 4YZ5A 1ODMA 1RUG1 1PO12 4MXVA 4XCAA 1VBC2 2Q4SA 1KJLA 3E5UA 1QXRA 5KHJA 3GGLA 3POBA 1HQLA 3ZMOA 4CU9A 3ES1A 5CYYA 4N7UA 1FYUA 1O7FA 4H2AA 2WLQA 1REDA 3MFCA 2BVBA 5GM0A 5J36A 5CIRA 3IIAA 3CF6E 3OBAA 4CU6A 1HB3A 2VBPA 2QQVA 1QJX2 1YEWA 3BYWA 4KGQA 4BXSV 4QT6A 1E5IA 4GWMA 1AX2A 4BLJA 1BMV2 4NROA 2XMLA 4QPGA 5HXMA 3SMHA 1PM7A 3O1PA 3O1TA 2Y6HA 4DFSA 4KG8A 2WL1A 4BYYA 1WD4A 4QQLA 3K48A 1KJRA 2YC4A 1UZ0A 2PLV1 3I3DA 1CWPA 4ES8A 5F6KA 5IATA 4Q0VA 3ZR5A 3NW4A 1QOOA 1GBGA 1MS8A 5FPAA 3M1HA 1SFYA 5ISLA 4IEZA 5FZAA 4Q4W2 5C4WA 4JGZC 4MOAA 4ZU7A 1MVEA 1W99A 5A33B 1AYN3 2GNDA 1FI2A 3I4IA 2LALA 3ES4A 3OEBA 4XF0A 4Q4Y2 1GZWA 1CAVA 2P34A 4KWUA 1LU1A 4XVHA 5EV7A 4WVZA 5BNOA 1JYNA 1QHDA 2JE8A 1MS9A 1AR91 4NPRA 4MH0E 4MV2A 1XSRA 1J3QA 1IPSA 2FCVA 1D4VB 3AKRA 3AZXA 4K1YA 2QFEA 3AXDA 2ZZQA 4FP3A 3WHUA 4B29A 5FR3A 1H8TB 3H9AA 5CVRA 1ULPA 3ORJA 4K8FA 5LB6A 5T5OA 3NAPB 4DUWA 2D6LX 4P9JA 1NAEA 2NZ9A 1UPIA 4QQ2A 4OYUA 4LKFA 1YXWA 3ZYBA 1EUTA 3ACFA 3ZFFA 4P9GA 4EN9B 4IE7A 5FY1A 3M3EA 3MPPG 3TN93 4KH9A 4Q1PA 4FOVA 5C3QA 1VBD1 1AVBA 3PHMA 2AUYA 3M3IA 5FBJA 3O0XA 1DLCA 1LCLA 3LB9A 4E4SA 4NHKA 2QCSB 2YZ4A 1JI6A 3KT7A 3PIGA 3OGGA 2GSYA 1GICA 4AGVA 1O4YA 4JGYB 4ET7A 3PVNA 4HZFA 1QJX1 1V6JA 2J1RA 3I59B 4IEPA 3VBOC 2IZWA 3IBMA 4JGYC 5IW0A 3HEIA 1XYNA 3IM0A 2FDIA 4QD2A 5FBZA 2E26A 2A70A 1D0GA 1QDCA 1GYKA 1OSGA 4CDUC 2VCAA 1W8FA 3PTYA 5FZCA 2WZR1 1KFUL 4W4ZA 5DG1A 1DU3D 2A6ZA 2HWC2 2DVGA 3UL2A 1B09A 2ZHLA 3WSOA 1X7NA 1SEFA 4AL9A 3T0DA 3HPNA 1S2KA 1AXYA 3MEPA 5IVVA 1SBFA 1EYBA 3VHNA 1Y9GA 1GP4A 2R042 4M4PA 1PK6B 4KWJA 3VDDC 2WYFA 3WY6A 2EALA 1XU1A 4RS5A 3INAA 4XZPA 2HYXA 4XJ9A 2X05A 3ZIXA 3EO6A 4KI5M 4LO4B 4Y24A 4LO6B 3I7DA 1PGW1 1IS5A 2K2SA 4UYBA 5GKAC 3LFMA 3A21A 4P9WA 1DLLA 1RUI2 4AI1A 2HBUA 4AQSA 1SFPA 1CZTA 3HWJA 1ZBE2 2WR9A 4FPHA 4Q4W3 1D4M3 1GR3A 2OA2A 1C8NA 2C4XA 2G9FA 4ZXEA 3H7YA 3IDCB 4B7EA 1GOHA 1OXCA 2JIJA 4AK3A 4ARXA 1UCXA 2CY6A 2ZGKA 5FOJB 2VTFA 4YYOA 4NE9A 4NIIA 1ZZ9A 1G7YA 2E7TA 1WWYA 3HT2A 2E33A 2ZAAA 3A4UA 3VZJA 4C91A 3BOWA 1MEC3 2YROA 3JBG2 1F8VA 1CAWA 2ILMA 1MR5A 4LEJA 5T5PA 1BLZA 3ZPOA 5IK5A 1S1AA 4IEQA 4TLFA 3POIA 3EHKA 4R4XA 4Y1ZA 5FYIA 4CXXA 4YARA 1H1MA 4E2SA 2WNEA 2JEMA 1XNAA 4P08A 1CX4A 4AGRA 1PGW2 3H3ZA 3NNMA 3VBUA 1RMU1 3B02A 3BN6A 5BNNA 2Q8DA 1RUD3 2XL9A 3DF0A 4J1XA 3VD3A 4LA2A 3VBFA 4AI8A 4ZZ8A 3WQ0A 3R6SA 4QHZA 4I3PA 4NRPA 5JVVA 3UKTA 1UOGA 4PF5A 4N9HA 2GN7A 1UL9A 4YW4A 5FIXA 1ZBE1 5C8CC 1YQ5A 4ES9A 3GM8A 3DPRC 3FHAA 4GH4C 3K75B 3RZJA 1ZZCA 3IIIA 3MDPA 5JR2A 5JPMB 5A6YA 1AL22 4XDPA 3POSA 4P5HA 4E4ZA 3BPSA 4GH4B 3VHPA 2Y6JA 2NP0A 1REEA 2JIGA 4I3GA 1AR83 3JBG1 3O5SA 1YI9A 3VBSC 1AR72 4D7YA 3ACGA 5IK4A 2GNTA 1Q8PA 2JD4A 3FE5A 1RVF3 4XFAA 5IJRA 5HCBA 3SNMA 1CN1A 3P1IA 4HANA 1F4HA 4CPBA 2CTVA 5IVBA 4NN0A 3IAQA 2AENA 2BOIA 4S2GA 4XF9A 4GB31 1QIQA 3ZSLA 4QXCA 5HCAA 4EWEA 1D7PM 5JZGB 2GC2A 5A3MA 1JYXA 2RMU3 1H2KA 4FAGA 4CCKA 4AG4A 3KVAA 1VB2A 2ET1A 1HN0A 2V09A 3ZYHA 2WAOA 1B35A 3BUCA 4IW3A 4COYA 2BTVC 4UAPA 4HETA 4PDWC 3OD0A 3Q8AA 4A4AA 3S57A 4XJUA 4BQ3A 4QDQA 3ZKUA 3V0AA 1FOD3 1RUI3 2PAMA 4PDWB 2WO3A 1Y4WA 4Y20B 4Q8LA 4RR3B 4RFRB 4L11A 1RHI2 2JG9C 1I9RA 1RUJ3 2WZEA 3PVEA 2Q8EA 3KB5A 3WEZA 5AC92 5LATA 3VL9A 2J1VA 3HMYA 4XTPA 5C3SA 3WQ7A 5JSPA 2JENA 1O5UA 2GC3A 1POV3 3RZZA 3W20A 1C5HA 1VBB2 1Z7S2 1NA1A 5FREA 5DXDA 1CPMA 2W52A 2YV8A 4ARYA 2OPKA 2RM23 1DIWA 1N3PA 1MS4A 3M3OA 5A7WB 1HXS1 5B2GB 5C3OA 2ZHNA 1GWLA 1GZWB 4DUXA 4NOTA 1RJ7A 1ENQA 1PZ9A 2IFWA 1AL21 1QMJA 2ETEA 3USUB 4CXYA 1YQ2A 4RHV2 4F7ZA 3B5LB 1QXJA 4UOJA 3POGA 5BNQA 1Q5OA 2BWAA 4YM0A 3WUDA 3BTYA 3RZGA 1HXS3 2HWD1 4C8DA 3NNFA 3T0AA 4WVWA 2IVIB 2A6VA 5K0UB 2NQYA 3O1OA 1X9PA 2I45A 3VBRC 4PI0A 4XBNA 2RDQA 5I8TA 2RHPA 3MIFA 1A3KA 3RI8A 4QX8A 5CISA 4MGIE 5J3UA 1HV0A 2Q1MA 4H7MA 5FZ9A 2VCBA 2ARBA 2ZCWA 1X36A 1PVXA 5GLTA 1TME2 2PHLA 1X33A 3NV3A 3ZM8A 4HN0A 4M4RA 5SV8A 1HRI1 3WG4A 2QQMA 2ZS6B 3AP7A 5FO7B 1NT0A 2ARXA 2RS32 2XBO2 4N53B 5ABJC 4CEWC 4LXLA 1WMDA 2QKDA 1XE0A 2YBSA 3EMRA 3HIFA 2P37A 3MZHA 2ZMLA 3RFRA 3ZFGB 2Y33A 5DAXA 5FZIA 1GP5A 1OOPC 2HKXA 2XG3A 4H55A 5KBFA 1J3PA 4EE2A 4J25A 5FQ0A 5FMBA 1XNBA 1UOFA 4OFGA 5DAWA 3VBFC 3BTXA 3NJYA 5A1LA 1DQ2A 4GIQA 4AHXA 1Y9QA 4LO5B 3N9QA 4AHYA 3KCXA 1EV12 4AAPA 1NCRB 4K1ZA 5IFTA 1VAMA 2DVBA 2ZX0A 4P5YA 2EF6A 3PNAA 3KV6A 4FVVA 5CB7A 1HW5A 1O5LA 2OKXA 5FKCA 1QNWA 3LPGA 5JCTA 3N9PA 2W68A 2HEYF 4MGYE 3FUQA 4NPMA 4QXBA 2IWGB 4OHWA 5JDBA 4AW7A 4ZZ5A 5HV0A 4LORA 1JYTA 1H2MA 3TOJA 1SZBA 1ZBA1 3CO2A 4BQ1A 2DCKA 4XBLA 1EY2A 3KHBA 3B00A 2O14A 4MGQA 3WF3A 4K3UA 4BDVB 1FMD2 5K0UC 1LAJA 2WA4A 4BIOA 4CUBA 1W6MA 4FT8A 3WF2A 5L9VA 3MICA 4INDA 1JU3A 4AVBA 3POWA 1JHNA 1EPWA 2DV9A 3MPBA 3GJBA 4UT5A 1WMXA 2VJXA 4WV8A 5FZBA 1LGBA 3NWKA 5J98B 3KF3A 3JU9A 5FLIA 3UJOA 1J1LA 1HB2A 4LR4A 1PNGA 2H6BA 3FWEA 3RPQA 1SFNA 4Q4X1 4MGZE 3S5AA 4DQAA 4HONA 2CAVA 5EXOA 3FC0A 3SHRA 2RMU1 4EWAA 5A3PA 4A7KA 2IVJA 2ZKNA 3DPRB 4ZS2A 4BMEA 3FMGA 4Q4W1 4IV1C 2BQPA 4WVVA 4CCJA 2XJQA 4QB2A 4XTMA 1HQNA 5EYXA 2FDHA 4HPKB 3MI8A 5K8SA 2DF7A 4ISQA 1LEDA 1JZ2A 2EXIA 1HB4A 5C5UA 1EPZA 5L7OA 1LOCA 2WLPA 1FNYA 3ILFA 1HKDA 3OUHA 4U36A 3DXUA 1UOBA 5EWSA 3MF9A 3WDTA 1BMV1 3PUIA 4WZCA 4PQ9A 3GZUC 3U4SA 3VN4A 4YW3A 3S6PA 1LOGA 4AOCA 4WM7C 2JG9A 2Q1FA 2WSUA 3ZFEC 1KD7A 5L7OC 1ASJ1 2GDFA 3D0SA 3I97A 4PQQA 5C33A 3DUIA 4XXAA 4CUCA 2NPIA 1RGSA 3A22A 1DYKA 1JOPA 1ALYA 2A3XA 2QE3A 1BEV3 3SH5A 4AF9A 4BJ0A 2JWPA 4URTA 2O0OA 3ZDSA 3OYWB 1W04A 4UW6A 4M3CA 1CAXB 1AR92 5FLJA 1ZRRA 2GMPA 3WP3A 4IE5A 4YRDA 2CU5A 2UYBA 1W2UA 1UXZA 2B9UA 1OQ1A
chains in the Genus database with same CATH topology
2W47A 4LKSA 4QX2A 3I2IA 5IHRA 3ACHA 3OGVA 4L0PA 1US3A 3T0BA 2VZOA 3WF1A 2L9LA 4OMDA 3T2OA 2VZUA 1GQPA 4PF1A 3HNYM 4QDRA 1MPXA 4LQRA 3HN3A 4RYDA 1UMHA 4GZ9A 2W5FA 1JZ6A 2VCCA 3E1F1 4W50A 3SKVA 4E8CA 2YFZA 3T09A 2CDOA 2WN3A 3MO4A 2BGPA 5IFPA 1JZ7A 5IYYA 2BZDA 5CZKA 2YB7A 4XURA 2BERA 1TG7A 2Y6KA 2DDUA 1JU4A 2BBAA 4OMCA 2VZ1A 3NRUA 2YC2A 4AAXA 4QDSA 1JZ3A 3GGLA 4CU9A 3WQBA 1J84A 5CYYA 3LEKA 4Z2AA 3OGRA 3K4DA 4TTGA 3OBAA 4CU6A 1JHJA 1WKYA 4RN5A 1O8PA 2BGOA 4BXSV 1CIYA 2XHNA 2W3JA 3CDZB 3J7HA 5HXMA 3ETPA 2C26A 2Y6HA 2QQLA 1PMJX 2YC4A 3I3DA 1UZ0A 5B4XA 2X09A 3WNKA 2W1UA 1I5PA 3I2HA 2ZEXA 1UY1A 1KGYA 4JX0A 3HNBM 2W1WA 4MOAA 1W99A 2VZRA 1PMHX 3K4ZA 3OEBA 4KWUA 4XVHA 2WAAA 3T08A 1JYNA 2JE8A 3SKJE 2J1TA 2QBXA 4CU7A 3D3AA 4QX1A 1US2A 3WF4A 1JZ4A 1GU3A 1ULPA 4DUWA 4CU8A 3VDCA 1NAEA 3C7OA 4OYUA 1CX1A 3EB7A 2V4VA 2YFUA 1EUTA 3ACFA 1JYVA 5JXJA 1T2XA 1OF4A 1WCQA 3LPFA 1DLCA 5DPNA 3U37A 2WBKA 1JI6A 3MBWA 4BK4A 4ET7A 2VOTA 5C7GA 5G04L 1H6YA 2W91A 2J1RA 1CZSA 4DXTA 3HEIA 4A41A 1H6XA 2E26A 2J7MA 1K45A 2QQJA 2VCAA 3F2ZA 1PX4A 4MADA 1K3IA 4W4ZA 3WF0A 5I0DA 4CUAA 3DYMA 3CZJA 1W9SA 3JXSA 3VDBA 2C9KA 3CZUA 5FUIA 3WSOA 2ORXA 3UETA 3HPNA 3T0DA 3CMGA 1J83A 1XC6A 2WABA 4M4PA 4DXSA 5JXHA 2E31A 2XQXA 3OG2A 2WUHA 1UYYA 3SEPA 2Y6LA 3P6BA 2WO1A 2HYXA 2X05A 4KI5M 5HPOA 4W8JA 2RVAA 5G05L 2R7EB 3C8XA 2V72A 4OUEA 3A21A 3THCA 1CZTA 1GOGA 1K12A 2VZTA 4HG6B 2C4XA 4A44A 4ZXEA 2VC9A 2RJ2A 3I2JA 4TXWA 1GOHA 4ARXA 2Y6GA 2JKXA 2VTFA 1JZ5A 4XUPA 5C70A 2E33A 2ORZA 1W0NA 5JMOA 3VD9A 1W8NA 2ID4A 3LE0A 4XUQA 3HOBA 1UYXA 5JUVA 1HN1A 2ZXQA 1XNAA 3CQOA 4P08A 1EUUA 3W5MA 2QQIA 4XUOA 3BN6A 2VL4A 3I3BA 3VD3A 4ZZ8A 2X10A 3FL7A 1OT5A 3NJVA 2V5DA 3ABZA 3GM8A 3I3EA 3FHAA 3MV01 3K75B 5J1XA 3IIIA 2JDAA 5JR2A 2LS6A 5LA0A 3MUZ1 4A45A 2W1SA 5DN2A 2Y6JA 4LHSA 1NX9A 3VDAA 2VO5A 4P02B 3W5NA 2VZQA 2J1AA 2WQ8A 3C7GA 3HNMA 4LPLA 2CDPA 1CZVA 3BGAA 3ACGA 3DYPA 1JYWA 3GDBA 1TVGA 5IJRA 2QQKA 3P1IA 5B4NA 1F4HA 2ZEZA 3WNOA 3IAQA 4PT6A 3K77A 4P00B 3ECQA 4DXRA 1D7PM 1JYXA 1SG3A 4A3ZA 2E32A 4AG4A 1W8OA 1KEXA 5LA1A 3ACIA 1GMMA 3T2PA 2WAOA 3DYOA 1K42A 3CIHA 4UAPA 1NKGA 2B4KA 1W9WA 3DECA 4A4AA 4JKKA 4QDQA 1O8SA 2WO3A 1UY3A 2W1QA 1SHWB 2WZEA 3WEZA 4QB6A 3OB8A 3GXUA 2J1VA 2VQUA 4D8MA 3C7EA 3VD7A 3T2QA 5DQ0A 4ARYA 4GWIA 4XZUG 3C7FA 4DUXA 4DUVA 4CVUA 4ZY9A 1YQ2A 4UOJA 2J1UA 2WDBA 2VQTA 3A23A 3LEIA 3T0AA 1GUIA 1UX7A 5EJZB 3LEGA 1UY2A 2YG0A 4DEVA 2RV9A 1XPWA 4YPJA 5EIYB 5JXGA 2EIBA 2QQOA 1RYYA 2VM9A 2XONA 4IUGA 2VCBA 2LW8A 2W87A 5DMYA 2W94A 2B9VA 2WZ8A 3ZM8A 2VMCA 4M4RA 2QQMA 1NUKA 4A6OA 5LA2A 5JXIA 4XUNA 2Y8KA 3VD4A 3I2FA 2WYSA 4QX3A 1UXXX 1L7RA 2W46A 2DCJA 4BK5A 2VMDA 3AC0A 1GNYA 3C7HA 2WO2A 5C71A 3FHQA 3I2KA 3MUY1 3WNNA 1XNTA 1IQDC 1ULOA 4D0QA 1R64A 5IFTA 4P5YA 1BHGA 2OKXA 3SEEA 1O59A 2W92A 2XOMA 3LPGA 4QAWA 2EIEA 3EYPA 2Z4FA 1L7QA 3WNMA 2VZVA 3A7QA 1GOFA 1OH4A 3WNPA 4DEQA 4ZZ5A 2EIDA 2J1SA 3I2GA 3MV11 1DP0A 1UYZA 2DCKA 4OZOA 2VMFA 3IB3A 4MGQA 3WF3A 4BDVB 1PX3A 4QB1A 4CUBA 3WF2A 3IDAA 2VZPA 3THDA 1JZ8A 4JKLA 1JU3A 3VD5A 2ZEWA 3NQHA 4A42A 2VJXA 1SDDB 4QPWA 1UWWA 1P8JA 2VZSA 3OGSA 4KMQA 2W95A 3OEAA 5F7UA 5EJ1B 4QX0A 3NJXA 4UI9L 1W9TA 3FN9A 5LCWL 4E8DA 4QB2A 1DYOA 4XUTA 3UESA 4MGSA 1OD3A 2WN2A 3HJRA 1JZ2A 3IAPA 2J1EA 2VMEA 2W9XA 1UY0A 2PQSA 3PUIA 2VZ3A 3UNPA 3LQCA 3K4AA 1UMIA 2JD9A 1OF3A 3K46A 2QQNA 4JKMA 4JHZA 2EICA 3I97A 4FI9A 4PQQA 4CUCA 3A22A 4GWJA 4MO3M 4BJ0A 1LNSA 3PUHA 2KD7A 3NNGA 1F4AA 2J22A 2ZEYA 1UY4A 2HLEA 5A1AA 2Y64A 2VR4A 1UXZA 3CKHA 3WNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W47 A;  4LKS A;  4QX2 A;  3I2I A;  5IHR A;  3ACH A;  3OGV A;  4L0P A;  1US3 A;  3T0B A;  2VZO A;  3WF1 A;  2L9L A;  4OMD A;  3T2O A;  2VZU A;  1GQP A;  4PF1 A;  3HNY M;  4QDR A;  1MPX A;  4LQR A;  3HN3 A;  4RYD A;  1UMH A;  4GZ9 A;  2W5F A;  1JZ6 A;  2VCC A;  3E1F 1;  4W50 A;  3SKV A;  4E8C A;  2YFZ A;  3T09 A;  2CDO A;  2WN3 A;  3MO4 A;  2BGP A;  5IFP A;  1JZ7 A;  5IYY A;  2BZD A;  5CZK A;  2YB7 A;  4XUR A;  2BER A;  1TG7 A;  2Y6K A;  2DDU A;  1JU4 A;  2BBA A;  4OMC A;  2VZ1 A;  3NRU A;  2YC2 A;  4AAX A;  4QDS A;  1JZ3 A;  3GGL A;  4CU9 A;  3WQB A;  1J84 A;  5CYY A;  3LEK A;  4Z2A A;  3OGR A;  3K4D A;  4TTG A;  3OBA A;  4CU6 A;  1JHJ A;  1WKY A;  4RN5 A;  1O8P A;  2BGO A;  4BXS V;  1CIY A;  2XHN A;  2W3J A;  3CDZ B;  3J7H A;  5HXM A;  3ETP A;  2C26 A;  2Y6H A;  2QQL A;  1PMJ X;  2YC4 A;  3I3D A;  1UZ0 A;  5B4X A;  2X09 A;  3WNK A;  2W1U A;  1I5P A;  3I2H A;  2ZEX A;  1UY1 A;  1KGY A;  4JX0 A;  3HNB M;  2W1W A;  4MOA A;  1W99 A;  2VZR A;  1PMH X;  3K4Z A;  3OEB A;  4KWU A;  4XVH A;  2WAA A;  3T08 A;  1JYN A;  2JE8 A;  3SKJ E;  2J1T A;  2QBX A;  4CU7 A;  3D3A A;  4QX1 A;  1US2 A;  3WF4 A;  1JZ4 A;  1GU3 A;  1ULP A;  4DUW A;  4CU8 A;  3VDC A;  1NAE A;  3C7O A;  4OYU A;  1CX1 A;  3EB7 A;  2V4V A;  2YFU A;  1EUT A;  3ACF A;  1JYV A;  5JXJ A;  1T2X A;  1OF4 A;  1WCQ A;  3LPF A;  1DLC A;  5DPN A;  3U37 A;  2WBK A;  1JI6 A;  3MBW A;  4BK4 A;  4ET7 A;  2VOT A;  5C7G A;  5G04 L;  1H6Y A;  2W91 A;  2J1R A;  1CZS A;  4DXT A;  3HEI A;  4A41 A;  1H6X A;  2E26 A;  2J7M A;  1K45 A;  2QQJ A;  2VCA A;  3F2Z A;  1PX4 A;  4MAD A;  1K3I A;  4W4Z A;  3WF0 A;  5I0D A;  4CUA A;  3DYM A;  3CZJ A;  1W9S A;  3JXS A;  3VDB A;  2C9K A;  3CZU A;  5FUI A;  3WSO A;  2ORX A;  3UET A;  3HPN A;  3T0D A;  3CMG A;  1J83 A;  1XC6 A;  2WAB A;  4M4P A;  4DXS A;  5JXH A;  2E31 A;  2XQX A;  3OG2 A;  2WUH A;  1UYY A;  3SEP A;  2Y6L A;  3P6B A;  2WO1 A;  2HYX A;  2X05 A;  4KI5 M;  5HPO A;  4W8J A;  2RVA A;  5G05 L;  2R7E B;  3C8X A;  2V72 A;  4OUE A;  3A21 A;  3THC A;  1CZT A;  1GOG A;  1K12 A;  2VZT A;  4HG6 B;  2C4X A;  4A44 A;  4ZXE A;  2VC9 A;  2RJ2 A;  3I2J A;  4TXW A;  1GOH A;  4ARX A;  2Y6G A;  2JKX A;  2VTF A;  1JZ5 A;  4XUP A;  5C70 A;  2E33 A;  2ORZ A;  1W0N A;  5JMO A;  3VD9 A;  1W8N A;  2ID4 A;  3LE0 A;  4XUQ A;  3HOB A;  1UYX A;  5JUV A;  1HN1 A;  2ZXQ A;  1XNA A;  3CQO A;  4P08 A;  1EUU A;  3W5M A;  2QQI A;  4XUO A;  3BN6 A;  2VL4 A;  3I3B A;  3VD3 A;  4ZZ8 A;  2X10 A;  3FL7 A;  1OT5 A;  3NJV A;  2V5D A;  3ABZ A;  3GM8 A;  3I3E A;  3FHA A;  3MV0 1;  3K75 B;  5J1X A;  3III A;  2JDA A;  5JR2 A;  2LS6 A;  5LA0 A;  3MUZ 1;  4A45 A;  2W1S A;  5DN2 A;  2Y6J A;  4LHS A;  1NX9 A;  3VDA A;  2VO5 A;  4P02 B;  3W5N A;  2VZQ A;  2J1A A;  2WQ8 A;  3C7G A;  3HNM A;  4LPL A;  2CDP A;  1CZV A;  3BGA A;  3ACG A;  3DYP A;  1JYW A;  3GDB A;  1TVG A;  5IJR A;  2QQK A;  3P1I A;  5B4N A;  1F4H A;  2ZEZ A;  3WNO A;  3IAQ A;  4PT6 A;  3K77 A;  4P00 B;  3ECQ A;  4DXR A;  1D7P M;  1JYX A;  1SG3 A;  4A3Z A;  2E32 A;  4AG4 A;  1W8O A;  1KEX A;  5LA1 A;  3ACI A;  1GMM A;  3T2P A;  2WAO A;  3DYO A;  1K42 A;  3CIH A;  4UAP A;  1NKG A;  2B4K A;  1W9W A;  3DEC A;  4A4A A;  4JKK A;  4QDQ A;  1O8S A;  2WO3 A;  1UY3 A;  2W1Q A;  1SHW B;  2WZE A;  3WEZ A;  4QB6 A;  3OB8 A;  3GXU A;  2J1V A;  2VQU A;  4D8M A;  3C7E A;  3VD7 A;  3T2Q A;  5DQ0 A;  4ARY A;  4GWI A;  4XZU G;  3C7F A;  4DUX A;  4DUV A;  4CVU A;  4ZY9 A;  1YQ2 A;  4UOJ A;  2J1U A;  2WDB A;  2VQT A;  3A23 A;  3LEI A;  3T0A A;  1GUI A;  1UX7 A;  5EJZ B;  3LEG A;  1UY2 A;  2YG0 A;  4DEV A;  2RV9 A;  1XPW A;  4YPJ A;  5EIY B;  5JXG A;  2EIB A;  2QQO A;  1RYY A;  2VM9 A;  2XON A;  4IUG A;  2VCB A;  2LW8 A;  2W87 A;  5DMY A;  2W94 A;  2B9V A;  2WZ8 A;  3ZM8 A;  2VMC A;  4M4R A;  2QQM A;  1NUK A;  4A6O A;  5LA2 A;  5JXI A;  4XUN A;  2Y8K A;  3VD4 A;  3I2F A;  2WYS A;  4QX3 A;  1UXX X;  1L7R A;  2W46 A;  2DCJ A;  4BK5 A;  2VMD A;  3AC0 A;  1GNY A;  3C7H A;  2WO2 A;  5C71 A;  3FHQ A;  3I2K A;  3MUY 1;  3WNN A;  1XNT A;  1IQD C;  1ULO A;  4D0Q A;  1R64 A;  5IFT A;  4P5Y A;  1BHG A;  2OKX A;  3SEE A;  1O59 A;  2W92 A;  2XOM A;  3LPG A;  4QAW A;  2EIE A;  3EYP A;  2Z4F A;  1L7Q A;  3WNM A;  2VZV A;  3A7Q A;  1GOF A;  1OH4 A;  3WNP A;  4DEQ A;  4ZZ5 A;  2EID A;  2J1S A;  3I2G A;  3MV1 1;  1DP0 A;  1UYZ A;  2DCK A;  4OZO A;  2VMF A;  3IB3 A;  4MGQ A;  3WF3 A;  4BDV B;  1PX3 A;  4QB1 A;  4CUB A;  3WF2 A;  3IDA A;  2VZP A;  3THD A;  1JZ8 A;  4JKL A;  1JU3 A;  3VD5 A;  2ZEW A;  3NQH A;  4A42 A;  2VJX A;  1SDD B;  4QPW A;  1UWW A;  1P8J A;  2VZS A;  3OGS A;  4KMQ A;  2W95 A;  3OEA A;  5F7U A;  5EJ1 B;  4QX0 A;  3NJX A;  4UI9 L;  1W9T A;  3FN9 A;  5LCW L;  4E8D A;  4QB2 A;  1DYO A;  4XUT A;  3UES A;  4MGS A;  1OD3 A;  2WN2 A;  3HJR A;  1JZ2 A;  3IAP A;  2J1E A;  2VME A;  2W9X A;  1UY0 A;  2PQS A;  3PUI A;  2VZ3 A;  3UNP A;  3LQC A;  3K4A A;  1UMI A;  2JD9 A;  1OF3 A;  3K46 A;  2QQN A;  4JKM A;  4JHZ A;  2EIC A;  3I97 A;  4FI9 A;  4PQQ A;  4CUC A;  3A22 A;  4GWJ A;  4MO3 M;  4BJ0 A;  1LNS A;  3PUH A;  2KD7 A;  3NNG A;  1F4A A;  2J22 A;  2ZEY A;  1UY4 A;  2HLE A;  5A1A A;  2Y64 A;  2VR4 A;  1UXZ A;  3CKH A;  3WNL A; 
#chains in the Genus database with same CATH topology
 1UU5 A;  4PLO A;  4Y1X A;  5FZ4 A;  4LKE A;  3URF A;  3I2I A;  5AC9 3;  3OGV A;  5F1R A;  4L0P A;  1Q8V A;  2ARE A;  1US3 A;  4S2D A;  1NY7 2;  1JXN A;  4JV4 A;  3LAG A;  1DG6 A;  1Z0H A;  2VZO A;  3PUR A;  1ND3 A;  5FYT A;  2O1Q A;  3C2U A;  1MS1 A;  1C3H A;  1TMF 2;  1VBB 1;  3MHZ A;  4OMD A;  2XB6 C;  3NJZ A;  1CVN A;  2VZU A;  2ARA A;  2Q0A A;  1UNB A;  1YO8 A;  2PEL A;  4AI0 A;  1DDL A;  4KNC A;  4PF1 A;  3AP4 A;  3VBU C;  1W9Y A;  2ERF A;  1BQP A;  3B9I A;  2JKB A;  3HNY M;  1D2Q A;  3KV5 A;  3OOX A;  5F3E A;  5JZG C;  3PME A;  1S0B A;  4CP9 B;  4YVW C;  5F2W A;  4AED C;  3MLK A;  4RHV 3;  5ERL A;  5C9A C;  3L2Y A;  1WA6 X;  3HVD A;  1OUS A;  4W50 A;  4DRV A;  3THT A;  2W08 A;  3T09 A;  5C9A B;  3MO4 A;  2OQ7 A;  2WO7 A;  5GZD A;  2JEC A;  2VNO A;  1LHW A;  4XFB A;  1HJG A;  1PO2 3;  1W8Z A;  4QGN A;  3ZVX A;  1OKO A;  1BXH A;  1XYO A;  4GJY A;  5FYC A;  3S7I A;  4Q8K A;  4Q26 A;  3Q8E A;  5CZK A;  4TWT A;  1RB8 G;  2RS1 1;  1NXD 1;  5FXX A;  1GZC A;  2NLR A;  2OYZ A;  3VBO B;  4ZXK A;  1VBE 3;  2TBV A;  5J37 A;  3AVR A;  2BER A;  1TG7 A;  3R4D B;  3SCF A;  1AYN 2;  4PCR A;  1JU4 A;  3FJS A;  2DFC A;  2VZ1 A;  3NRU A;  2YC2 A;  4LBJ A;  3SIT A;  4FBF A;  5C8C B;  5J09 A;  4AAX A;  4V2V A;  4EJR A;  3KGL A;  4IEY A;  4QDS A;  4IQP A;  4RGG A;  4QQH A;  1HDK A;  2VUD A;  2R6Q A;  2VOV A;  4RS5 C;  4X8N A;  3TBD A;  4C1X A;  3LEK A;  1OH3 A;  1VBA 2;  3MLL A;  2FZ1 A;  5FXW A;  1LU2 A;  1PO2 1;  1RUC 3;  2DYC A;  3AK0 A;  4C90 A;  1TNR A;  4V1P A;  3OUI A;  3ZXJ A;  2XL7 A;  1TZO A;  3CJI A;  4BB3 A;  2UU8 A;  1OLQ A;  1WKY A;  3PUS A;  4TN7 A;  3POE A;  4EV0 A;  3J8F 1;  5KXE A;  1CIY A;  3GBF A;  5A80 A;  4OVE A;  2VXJ A;  2AC1 A;  4D6S A;  5D8A A;  4CDW B;  1CIW A;  2W3J A;  5FP7 A;  1BEV 2;  3I59 A;  3J7H A;  4DY3 A;  1UIJ A;  3ETP A;  1W9F A;  3AYA A;  2RS3 1;  1NCQ A;  3GCX A;  1CES A;  2DCY A;  3Q8F A;  3SXW A;  1BVP 1;  5KHH A;  5B4X A;  2VVF A;  5KXD A;  4PJY A;  2X09 A;  3L9J T;  2IFR A;  4Q4V 3;  4UFH A;  4CCO A;  3I2H A;  4LUM A;  1UZV A;  2KXL A;  5M0T A;  5A1F A;  1LHU A;  4JTO A;  4D7T A;  4OI0 A;  2VZR A;  1PMH X;  1VBE 1;  3CJX A;  3K4Z A;  3ZN5 A;  4HL0 A;  2F4P A;  3B9C A;  4LHN A;  3ZMN A;  1SLC A;  3T08 A;  5I93 A;  2D6K A;  1TMF 3;  4CYD A;  3H8R A;  3SKJ E;  5CNA A;  2J1T A;  2A6X A;  4CZS A;  3D3A A;  1UQX A;  2V73 A;  3ZXK A;  2ZGQ A;  4BWO A;  5KC6 A;  1US2 A;  2P1B A;  1PVC 3;  2HWE 3;  1GSL A;  3A0K A;  4Z07 A;  2GAL A;  1BCX A;  5FMD A;  1RHI 1;  1RXG A;  3BI3 A;  1GNZ A;  4FP2 A;  1PHM A;  4D69 A;  1U12 A;  5F5I A;  3VDC A;  3BTA A;  4UFL A;  2R04 3;  1KRI A;  1RUH 1;  1H0B A;  1WUV A;  5FZL A;  5KR7 A;  1CX1 A;  1UOJ A;  2R06 1;  5CKQ A;  1LGN A;  1BYH A;  2V4V A;  3IDB B;  2D6M A;  2YFU A;  4EQV A;  5FK8 A;  4Y1U A;  1T2X A;  1OHF A;  1SQ4 A;  1HIX A;  1LR5 A;  2RMU 2;  1OF4 A;  3ZSE A;  3LPF A;  2G9G A;  3VZL A;  3U37 A;  5KXB A;  3H8X A;  3T30 A;  3BB6 A;  5T5L A;  4XIK A;  3JB4 C;  1RUE 3;  1D4M 2;  3GBG A;  2ZGM A;  5FZO A;  1RUH 3;  5G04 L;  3WDX A;  2VW1 A;  5FWE A;  3G7D A;  3VBR A;  1H4G A;  4AVT A;  4DXT A;  1N1T A;  1QJY 1;  4XDQ A;  4WM8 A;  3D6E A;  4OI1 A;  1RHI 3;  1S0I A;  3N9N A;  3WV6 A;  3WXP A;  1M06 G;  1TEI A;  1K45 A;  1U5X A;  1R1Z A;  4AFM A;  3O1S A;  5FKB A;  4QHO A;  4CPB D;  1KXG A;  4LLF A;  2XLA A;  2R16 A;  2WS9 1;  3J7M A;  4FPL A;  1OKQ A;  4OLL A;  1IS3 A;  1M4W A;  3DN7 A;  4MZU A;  4M3C B;  1W9S A;  3JXS A;  4Y3O A;  4Z8B A;  1B35 C;  3OBZ A;  5FUI A;  5L9R A;  3ZFE B;  3V0A B;  2ORX A;  5FYH A;  4DIQ A;  1OI6 A;  4R4Z A;  3CMG A;  2RE9 A;  3SCG A;  1NYW A;  1UF2 C;  3PIJ A;  4K7J A;  1A6C A;  1V0A A;  2ZBJ A;  4FPG A;  5IWF A;  4GAL A;  5FYU A;  4NID A;  3GCW A;  1CAU A;  3OG2 A;  3BCW A;  4ONU A;  4JZR A;  2AGS A;  3M3Q A;  2ENR A;  2WO1 A;  4Y5T A;  2JG9 B;  3OSD A;  2V5Y A;  4LJH A;  1L3J A;  2E9Q A;  5LK5 A;  2ZA9 A;  1RMU 3;  2VUC A;  2ZX3 A;  2RVA A;  3KQR A;  5FZ1 A;  3HAG A;  4MGT A;  2R7E B;  3C8X A;  4QX5 A;  2Y0I A;  4CDQ A;  2V72 A;  4GB3 2;  5HBA A;  3OJB A;  3PJY A;  2NYY A;  5FY9 A;  3NNL A;  1NCQ C;  1VPH A;  2Q8O A;  4BLI A;  2VXR A;  1PIV 2;  4X6Q B;  2VMG A;  3VGI A;  5BNO C;  1JYI A;  3ON7 A;  1K12 A;  1PO1 3;  2VZT A;  3WDU A;  4A44 A;  2RJ2 A;  4AHW A;  2TUN A;  2FMY A;  3I2J A;  3PLQ A;  5CKN A;  2Y6G A;  3ZXD A;  1IS6 A;  4XUP A;  3D4K A;  4Q0Q A;  3CJI C;  5C70 A;  2YXS A;  4P9I A;  1V9U 2;  2ORZ A;  1WW7 A;  5IVY A;  1PGL 1;  4NIG A;  2A7A A;  1W2A X;  3I3Q A;  2OII A;  1W6O A;  3FFQ A;  4NR1 A;  2ID4 A;  2UY9 A;  3LE0 A;  1S0F A;  1A78 A;  4NIA A;  1XYP A;  3E5Q A;  1SPP B;  1QJX 3;  2FCT A;  4LBO A;  2ZXQ A;  3OPZ A;  2JDY A;  5TSW A;  4O61 A;  3N3H A;  2UWC A;  3RG0 A;  4COZ A;  3GF6 A;  2B7Y A;  1JOD A;  1PK6 A;  1O91 A;  1NE4 A;  2AZ5 A;  2DUP A;  3V65 A;  3Q9O A;  4IXL A;  4AHZ A;  1QEX A;  3VBU B;  2FD8 A;  2ZPX A;  4R9A A;  4SBV A;  1GFF 2;  3RJ2 X;  3B01 A;  1VBC 1;  3RSJ A;  5BNO B;  2XKO A;  1YFU A;  3BIE A;  3NJV A;  5LY1 A;  2GZW A;  4FOY A;  2V5D A;  4EN6 B;  4AGG A;  2HWD 2;  2X5I B;  5GZE A;  2A3Y A;  1AXZ A;  3MV0 1;  2HJI A;  1R09 2;  1CAX A;  1WZX A;  2JDA A;  5FYS A;  3M70 A;  4XQ4 A;  5BNP B;  1SLT A;  2X5I C;  1BBT 2;  3M2M A;  1H2L A;  3O1R A;  3B69 A;  4LHS A;  3VDD B;  3VBH A;  2EAK A;  4YZ1 A;  4F8A A;  5FPU A;  1I1E A;  2VZQ A;  2FHR A;  3ZXL A;  5GAL A;  3FFZ A;  1DGR A;  5FY4 A;  1LOB A;  2CDP A;  1CZV A;  1GWK A;  2E7Q A;  3DYP A;  1JYW A;  4BU2 A;  3GDB A;  1FV3 A;  4N43 B;  5FMC A;  1DFQ A;  1NOV A;  1OQE A;  4CCL A;  4Y1V A;  4OQ9 A;  4B4P A;  5F5A A;  2HEV F;  1BK0 A;  1DQ1 A;  2BUK A;  4P00 B;  5GZG A;  5GZF A;  4I0B A;  3WNX A;  1U5Z A;  4DXR A;  5IAV A;  2E53 A;  1VJ2 A;  1S0D A;  4ISR A;  3U10 A;  4DXZ A;  2D93 A;  1W8O A;  3ZXA C;  1YRZ A;  4GA9 A;  3PTR B;  1K42 A;  2EXK A;  2YUE A;  2B4K A;  3DEC A;  4M3C F;  2DU0 A;  3WW2 A;  4CDQ B;  5IVJ A;  1E5S A;  1ND2 B;  2R04 1;  4JKK A;  5GLZ A;  1QJY 2;  4QMA A;  2P3Y A;  4Y20 A;  4HLT A;  3RZH A;  4E2Q A;  1U5Y A;  1GV9 A;  1PIV 3;  4CUG A;  2W1Q A;  3W9A A;  4CDQ C;  1XNC A;  3FZ3 A;  3WUC A;  4QB6 A;  2GC1 A;  2ARC A;  3NV4 A;  2WT2 A;  2VQU A;  1ZA4 A;  3R05 A;  5F32 A;  3EQE A;  3C7E A;  1A34 A;  3VD7 A;  5E6H A;  3Q8C A;  3I2O A;  1YJL A;  4LBQ B;  5EZW A;  3PMS A;  2PAK A;  3ALQ A;  3NAP C;  1X8E A;  2YPD A;  3LDK A;  1ASJ 2;  2CSG A;  3C7F A;  4AFC A;  1WCS A;  4OHY A;  3SH4 A;  4DUV A;  3X29 B;  3H8U A;  5FPL A;  2XJT A;  3U4X A;  1VRH 2;  2JG8 A;  3EJK A;  1W6Q B;  4Q4V 1;  5BY5 A;  2VMH A;  1JMU B;  2ZX2 A;  1XE8 A;  1LGC A;  1O4T A;  3T1M A;  5JMC A;  1MZ5 A;  2W2I A;  3RVH A;  3LEI A;  2RM2 1;  4TLG A;  3USU A;  1K5M B;  3O12 A;  3LCP A;  2AEZ A;  4XAC A;  1XOY A;  2ZGT A;  2QQW A;  2ZKL A;  1SCR A;  2QZ3 A;  5L36 A;  4YPJ A;  5JXG A;  4E4H A;  2B42 B;  2IXH A;  3VKM A;  1RUJ 1;  2YC0 A;  2XON A;  5LWB A;  5DMY A;  2W87 A;  4YG6 A;  1UX6 A;  2WZ8 A;  4Y5S A;  1JH5 A;  3RWN A;  2D97 A;  3BPZ A;  1VAV A;  2VE1 A;  3KMH A;  4MLO A;  1HB1 A;  1N1Y A;  5I8S A;  1BBT 3;  3H1W A;  2ZX1 A;  1OA3 A;  5JXI A;  4Y4R A;  4YVS C;  1VBC 3;  1YHF A;  4EN8 B;  3KQ4 B;  3FUO A;  4FXK B;  3GNE A;  4LBK A;  5EFU A;  1CJD A;  3I2F A;  5CG8 A;  3CU7 A;  1JYC A;  4LKD A;  1UXX X;  1IPK A;  5JOX A;  1VRH 1;  2RM2 2;  4N9I A;  5FZK A;  3HN1 A;  3B7M A;  1K5M C;  2UWB A;  4HKL A;  2D3P A;  4BK5 A;  2VMD A;  1YFW A;  3OY8 B;  5JOW A;  4YW6 A;  3AC0 A;  4LIT A;  4ZON A;  5FY5 A;  1AJO A;  3ZXG A;  4UXA A;  4D3W A;  3MLJ A;  4UF0 B;  1ZBA 2;  3R4S A;  2J42 A;  1PO2 2;  1ZYB A;  4B8E A;  1QOS A;  2GP5 A;  2XVL A;  4LIU A;  5EYY A;  1NLS A;  4RD7 A;  2A1X A;  4NAO A;  4UW5 A;  5JI9 A;  1IQD C;  2NM1 A;  1DZQ A;  5C3P A;  3VZK A;  3RYP A;  3ZN6 A;  1QDO A;  3P3N A;  4DS0 A;  5DZE A;  5AVA A;  3V64 A;  1E5H A;  2W92 A;  1AL2 3;  2XOM A;  4XMI A;  3SEE A;  4AXO A;  1IQA A;  1LOF A;  2EIE A;  2RJK A;  3EYP A;  4PIX A;  3ATG A;  3WNM A;  2VZV A;  1C1L A;  1COV 3;  2GNB A;  3A7Q A;  4Y1Y A;  3TNQ A;  3WNP A;  1XNK A;  4XF1 A;  3I2G A;  3A0N A;  3WP4 A;  4RSU A;  4L9B A;  1UYZ A;  5FPX A;  3T2T A;  3M7A A;  1BBT 1;  3BOD A;  1RVF 2;  5KHK A;  3WG2 A;  3WP5 A;  5JOZ A;  2R06 3;  1LOD A;  2CGO A;  1JZ8 A;  4JKL A;  3WG3 A;  2Y38 A;  3AP9 A;  5E88 A;  3VD5 A;  3BOP A;  2WJS A;  4QKD A;  1NA1 B;  2E7A A;  3KLS A;  5GJ6 A;  2R1D A;  3SIS A;  5L73 A;  1LHV A;  2DVF A;  5D1I A;  4DIN B;  4HMZ A;  2VZS A;  1AR9 3;  4KMQ A;  2DU1 A;  4AZZ A;  1YIP A;  4TSV A;  1X9T A;  1S0G A;  2E63 A;  2PHF A;  3TN9 2;  5F7U A;  5C8W A;  3DL3 A;  3NJX A;  3KGZ A;  3OGJ A;  1R09 3;  1W9T A;  5FZM A;  4BHP A;  4BM8 A;  3ME2 A;  1H1A A;  2D6P A;  4HK8 A;  1BK1 A;  5LY2 A;  3P5B A;  4XAA A;  1JUH A;  4QM8 A;  4GKX A;  1U0A A;  4YGC A;  4RR3 C;  5BNP C;  1AYM 2;  2Q5T A;  4GQ7 A;  1C1F A;  1WLC A;  5JZG A;  2H6C A;  3ZLI A;  2MNG A;  4Y22 A;  2WNV A;  1WW6 A;  5F8P A;  2RS1 3;  5A3U A;  3POY A;  1Z7S 3;  2Z79 A;  1VRB A;  1ZX5 A;  1EAH 1;  5FWJ A;  1PM4 A;  4J6G A;  1TE1 B;  1COV 1;  4DO0 A;  5L7O B;  3UNP A;  4D7S A;  1XXN A;  1J1T A;  2O8O A;  1DQ6 A;  4UBH A;  3K4A A;  3RRD A;  3MGU A;  4LA3 A;  2BP6 A;  3J4U H;  5JIA A;  3UYJ A;  1QJU 2;  3K46 A;  2QQN A;  3ZSJ A;  3ZYP A;  2EIC A;  4IEX A;  1H2N A;  1LEN A;  2G1M A;  3N9O A;  3U14 A;  4CEW A;  1CPN A;  2WT1 A;  5EQU A;  1YQ8 A;  5T50 A;  4COU A;  2RDR A;  4HOO A;  2KD7 A;  2F17 A;  2DUQ A;  2UY8 A;  1F4A A;  2IXL A;  1GP6 A;  4NUB A;  1QJF A;  4RFT 0;  5C8C A;  5I0S A;  1Y9M A;  2ZEY A;  2HLE A;  5A1A A;  5F3C A;  4QPI B;  2VW2 A;  2VNR A;  3CKH A;  3MIE A;  3QH7 A;  1AR6 2;  1VE0 A;  3PJQ A;  4QX2 A;  4YFW A;  1RUE 2;  5JPN B;  2OUH A;  4FPY A;  5CFD B;  2NN8 A;  1NXM A;  3AYE A;  2HWF 1;  1SLB A;  1Q43 A;  5J96 B;  2E6V A;  5IUQ A;  4HSJ A;  4QXK A;  2QDN A;  5LBE A;  3O1V A;  1XE7 A;  3RMY A;  3WF1 A;  3N9L A;  2DWR A;  2VH9 A;  3APB A;  1W6P A;  3T2O A;  4KWK A;  1SCS A;  2C1F A;  2X29 A;  5ACA 2;  5J7M A;  2XJR A;  4HBN A;  5I8Y A;  5A7N A;  3EXU A;  4DPN A;  2K0G A;  1W0P A;  1C8M 3;  2AYH A;  4CDX C;  4B4R A;  4YGD A;  1H9P A;  4LQR A;  3HN3 A;  2MHF A;  1PZ7 A;  1RIR A;  1XQN A;  4GZ9 A;  4S2F A;  3JD7 2;  1ZZ8 A;  2W5F A;  2JG8 C;  5FPZ A;  3JB8 A;  4LE4 A;  4LBQ D;  3UKN A;  1D4M 1;  3ZYG A;  2YFZ A;  1JZ6 A;  1GAN A;  4W6Y A;  4AVS A;  5DUW A;  4PI2 A;  2OZ6 A;  4OZX A;  1JZ4 A;  1FPN 2;  4KG0 A;  1HRV 1;  1F2N A;  1AR7 1;  5DZF A;  5GLW A;  1WLD A;  3HBZ A;  4BCU A;  1YFY A;  5AVP A;  2BVV A;  4LMF A;  5IFP A;  1QNY A;  2BZD A;  3TNP B;  3D5O A;  3FLP A;  3I8T A;  4GMP 1;  4P9Y A;  2X8K A;  2YB7 A;  3LF7 A;  3M4F A;  4Y26 A;  1H9W A;  5A3T A;  1V6K A;  1QH7 A;  2R30 A;  2ZJC A;  2HWF 2;  5FZ7 A;  1A8M A;  2JDM A;  1CJP A;  4QQP A;  2BBA A;  4UFK A;  2VMI A;  2HH9 A;  1E57 A;  4EZH A;  4CCM A;  1DQ0 A;  4MSV A;  2K46 A;  2XLF A;  3LSE A;  3P3P A;  4K9S A;  1S0E A;  4SLI A;  3WQB A;  1ULD A;  3KM5 A;  4GMP 3;  5FP3 A;  3MW2 A;  4GAZ A;  2F6B A;  1IKP A;  4CP0 A;  5A7O A;  2XVK A;  4E2G A;  4EYU A;  1SMV A;  3MF6 A;  3W21 A;  3MID A;  1DQ5 A;  1AR7 3;  5F3G A;  3AMH A;  3K4D A;  5FPB A;  4TTG A;  2Z5W A;  1FPN 1;  4L8Q A;  2QDR A;  3ELN A;  4QPG B;  5I91 A;  3TEY A;  4BH9 A;  3GHM A;  3NV2 A;  3GZA A;  4RN5 A;  1O8P A;  1IPJ A;  5HCF A;  2BGO A;  2XXZ A;  4AQT A;  4CCD A;  1O4Z A;  4GWN A;  3RYK A;  1DYP A;  4NAM A;  2EA7 A;  1R08 1;  1MAC A;  1GZT A;  5FMO S;  5CFC C;  2ZGO A;  4AQ6 A;  1MS0 A;  5EHD A;  1DGW X;  2C26 A;  1NCQ B;  4LT5 A;  2QQL A;  1ULG A;  2MEV 3;  3N36 A;  1UO9 A;  3OY8 A;  3WNK A;  2ZGU A;  1I5P A;  2IUW A;  3HQX A;  1WD3 A;  2XBO 1;  4R52 A;  4XF3 A;  5D8A B;  4CDW A;  1OFS A;  2C9A A;  3KHC A;  3I54 A;  1J3R A;  4P14 A;  2PQQ A;  2WII B;  3NKT A;  2RR1 2;  3HNB M;  3VBS A;  1R09 1;  2K9Z A;  1AX0 A;  5I0R A;  5LZ6 A;  1XND A;  3ETQ A;  4J1W A;  4KU7 A;  3RWK X;  4HVR A;  1X8M A;  3LEM A;  4HT1 T;  2R32 A;  1GQG A;  4FFH A;  4CU7 A;  1GQH A;  1NCR C;  1LES A;  5DDJ 1;  5DDJ 3;  4QX1 A;  4JQT A;  1T6B X;  4YVS A;  2PFW A;  1Y3T A;  1STM A;  1OBN A;  2WNU B;  3OPW A;  4OCT A;  1CD3 G;  3KV9 A;  2YHJ A;  3AP6 A;  1RUI 1;  2VNG A;  3CNA A;  3IN9 A;  3AZY A;  1AZD A;  4CDX B;  5BXX A;  2HWC 1;  3AMN A;  4FOQ A;  4PDW A;  3QH6 A;  2LM3 A;  1KDK A;  1FAY A;  1O3Q A;  1OFN A;  3I49 A;  1ACC A;  4AEJ A;  1WCU A;  1QJZ A;  5FZH A;  1JW6 A;  3AKP A;  4Q0U A;  2H0V A;  3AMM A;  5FTT C;  5JXJ A;  3H8O A;  3OBT A;  3VBO A;  4NMI A;  1AX1 A;  2KA3 A;  4K21 A;  4BQX A;  1EAH 3;  1HX6 A;  1SLI A;  4LBL A;  4EZ4 A;  1WCQ A;  3CL1 A;  1HRV 2;  1RUD 1;  5DPN A;  4GB3 3;  5A6Z A;  1YQC A;  1D0H A;  2VOW A;  2CWS A;  2D7F A;  3AP5 A;  1S0C A;  3IWZ A;  3MBW A;  4XF4 A;  5FXZ A;  4BK4 A;  5I0T A;  2DBN A;  3J8F 2;  2VOT A;  4XJZ A;  1DGL A;  2W91 A;  2G19 A;  1LB2 A;  4QM9 A;  4I30 A;  1OQD A;  4A41 A;  3LOI A;  2LRP A;  4JDO A;  1EP0 A;  2WZR 2;  4KGG A;  5CFC B;  2J7M A;  2BYV E;  1LOF C;  3GZE A;  3F2Z A;  1MEC 1;  2D5H A;  1U5I A;  1V9U 3;  2OPW A;  1G8W A;  3K3N A;  1RXF A;  3UGF A;  1N1V A;  2A75 A;  3L2H A;  4MAD A;  1BJQ A;  1K3I A;  2WS9 2;  3HQU A;  4GUL A;  1TMF 1;  4R9C A;  5FFO C;  5FDB A;  3WF0 A;  5CU1 A;  2YMZ A;  3QD6 A;  4CUA A;  3DYM A;  5C5T A;  5FMO L;  1FAT A;  1OVS A;  2B46 X;  2VOX A;  3B94 A;  3VDB A;  2VUA A;  1LRH A;  2C5D A;  2C9K A;  1NLQ A;  1ASJ 3;  3UET A;  3BKZ A;  4OHX A;  1J83 A;  1QWR A;  3JQW A;  1VRH 3;  1KIT A;  4YG3 A;  1Q8S A;  1XC6 A;  2WAB A;  4A6S A;  4DXS A;  2E31 A;  2WUH A;  1WCD J;  1UYY A;  2AH2 A;  2VCM A;  3D0J A;  2D5F A;  3P6B A;  1MS5 A;  2OVU A;  1SLL A;  2WSV A;  4N43 C;  5HPO A;  3PUQ A;  4QPY A;  4RQP C;  4W8J A;  5G05 L;  1LHN A;  4FTB A;  4NJ4 A;  1JTZ X;  4G4F A;  4CEY B;  2ZAB A;  2I2S A;  2ZAH A;  1CON A;  1O6U A;  3CEW A;  4OUE A;  4R9D A;  4XYX A;  1ST8 A;  1VMJ A;  5FRA A;  4E9K A;  2OXB A;  2VY0 A;  3THC A;  5IK8 A;  3RZM A;  2Q1Z B;  3SLI A;  1W05 A;  4DY5 A;  2RR1 3;  3H3L A;  3O0W A;  4KBB A;  4HG6 B;  4CDW C;  5D8A C;  2I74 A;  5HXV A;  3ILN A;  4XFI A;  1QH6 A;  5FZ3 A;  4TXW A;  4HPK A;  4IEO A;  1UYP A;  1VIW B;  3WW4 A;  1YQ6 A;  2VVE A;  1W39 A;  1RUF 2;  1LHO A;  3VZM A;  4WM7 A;  1I6X A;  1W0N A;  2W39 A;  4YM3 A;  5JMO A;  1AYM 1;  4CSW A;  1V6N A;  2WWJ A;  3ZSM A;  4NO4 A;  1W8N A;  3WDV A;  4XUQ A;  5IVC A;  2JJ6 A;  4Q4Y 1;  3AB0 A;  3VKO A;  3WCR A;  1UYX A;  2WKK A;  3WZ1 A;  1LEC A;  3QCW A;  4FCA A;  2BFU S;  3RDI A;  4QPI A;  1HN1 A;  3AKS A;  2GH8 A;  4BMB A;  4BE3 A;  4D6Q A;  2GH2 A;  5DAV A;  1EUU A;  2VBD A;  3AZV A;  4YFZ A;  3W5M A;  5A7W A;  3TEW A;  1ENS A;  1J58 A;  4CDU B;  4LBN A;  2DUO A;  3W59 A;  2RS5 1;  1ENR A;  4JGZ A;  2HWB 2;  1MZF A;  2ZTN A;  4UW3 A;  5FK7 A;  3OBR A;  4CEW B;  1HRV 3;  4Y33 A;  4Q4V 2;  4F3J A;  4QX7 A;  2W0X A;  1LOE A;  4WM8 C;  3WOG A;  3ABZ A;  4DNY A;  3I3E A;  2LTN A;  4QKN A;  5J1X A;  3FBM A;  5EP9 A;  2BOJ A;  4Q0P A;  2B39 A;  4QKF A;  3WR0 A;  1OMI A;  3MUZ 1;  1VAK A;  2MPF A;  5FYY A;  4A45 A;  4XCB A;  1FNZ A;  1ZVF A;  2WZR 3;  4QKB A;  3ZIW A;  4IV1 B;  4YG0 A;  3IKW A;  2JIC A;  4JGY A;  4P02 B;  3W5N A;  2FMD A;  3VBR B;  2Q8C A;  2WQ8 A;  5FO8 B;  1Q3E A;  3C7G A;  3NNJ A;  4YVW A;  3ASI A;  3VKN A;  4LHK A;  3AZZ A;  1WGP A;  1HJF A;  2D44 A;  2JX9 A;  2QQK A;  2VUL A;  2ZMN A;  3GJA A;  1ZM1 A;  4OI2 A;  5B4N A;  4M00 A;  4AFD A;  2ZEZ A;  3N9M A;  4UF0 A;  3K77 A;  3ECQ A;  4ZU4 A;  5DUV A;  2B5H A;  1SAC A;  2PLV 3;  2VGD A;  1W6N A;  3KCC A;  2ZGS A;  4R8H A;  4XJ8 A;  2ZHK A;  1JUI A;  1QQP 2;  4A3Z A;  4LBQ A;  3HT1 A;  4IV1 A;  3TN9 1;  3AKT A;  1POQ A;  2X53 S;  4MXW B;  3I3M A;  1O3R A;  3DYO A;  1R08 3;  1QQP 1;  1N1S A;  1NKG A;  4XHB A;  1W9W A;  1HRI 3;  1O8S A;  5FY0 A;  1NZI A;  5CFD C;  4PLN A;  1ZBE 3;  4RGK A;  4XHX A;  1UY3 A;  3O1M A;  3PU8 A;  3TWI A;  2RDN A;  1S2B A;  2A3W A;  5FP8 A;  5FQ0 B;  4GXL A;  1O3T A;  4L2N A;  3MIB A;  5DDJ 2;  1Q8Q A;  2RS5 2;  4CP1 A;  1EV1 1;  2A71 A;  4DB5 A;  1C28 A;  1Q8O A;  2RS1 2;  3ZFE A;  3H3U A;  3O14 A;  5DQ0 A;  4GWI A;  1IHM A;  1X50 A;  5F6L B;  3PVB B;  4PBP A;  4XZU G;  4XC9 A;  4E27 A;  4K20 A;  2CL2 A;  2D6O X;  3NMB A;  1VLN A;  3BU0 A;  4YGB A;  1W3X A;  4Q29 A;  4A7Y A;  4JDM A;  4AED B;  4CVU A;  2FZ2 A;  4Y5Z 0;  4ZY9 A;  2CWM A;  4A3X A;  2XDV A;  5E89 A;  1OC1 A;  1T6G C;  5LBF A;  3ZN4 A;  2J1U A;  3T3Y A;  1CAW B;  3J26 N;  2WDB A;  4M01 A;  3LA2 A;  4PBO A;  4XFH A;  3A23 A;  5FYV A;  5JLV A;  3QBQ A;  4ZU5 A;  1UY2 A;  2YG0 A;  3WW3 A;  1RUD 2;  1ZZ7 A;  2NMN A;  4HSL A;  4XJA A;  5GZC A;  4GD4 A;  4EN0 A;  2HWB 3;  1XPW A;  5EIY B;  3RS6 A;  3USS A;  2QQO A;  4NHY A;  3J8F 3;  3VBH B;  3VDD A;  2E51 A;  4NVP A;  3ROU A;  4DZG A;  4CTE A;  3FLT A;  2VM9 A;  4IUG A;  2ADD A;  3WT3 A;  3MIG A;  1WBL A;  4H14 A;  3CLP A;  3NO8 A;  1ZZB A;  5F9T A;  4JHT A;  4D94 A;  3H1Y A;  1W8H A;  5ABJ B;  4OUL A;  5FJH A;  3LZZ A;  1W28 A;  4MG2 A;  2Z2S B;  4CEY A;  1W8W A;  5A3N A;  4CCC A;  1NUK A;  2IXI A;  3AL6 A;  5FJK A;  2IC1 A;  4C0H A;  1RC6 A;  4A6O A;  3GZT B;  5FOB B;  1VR3 A;  5A3L A;  4ZS3 A;  3VD4 A;  3IMN A;  4YZ3 A;  5ACA 3;  5FZE A;  2DCZ A;  5FY7 A;  2WYS A;  3UKV A;  5JSO A;  4LNV A;  1C8M 2;  4XFG A;  4BQ4 A;  3G6J B;  4JAA A;  2DVA A;  3RYR A;  3OD4 A;  3RNS A;  3VLB B;  1RL3 A;  3MYX A;  4P9L A;  5LAS A;  4QHB A;  4ATE A;  5CAZ A;  5A32 A;  4FQZ A;  2CGN A;  4NWW A;  3C7H A;  5F5C A;  5FUP A;  4XET A;  2WO2 A;  1KS5 A;  5C71 A;  2QJV A;  2XVG A;  2ES3 A;  2Q30 A;  2ZGL A;  3SQO A;  5A3O A;  2XHK A;  3I2K A;  4EWD A;  5IT6 A;  3GAL A;  1YUD A;  4BIS A;  3WNN A;  2GME A;  1Q56 A;  4PIY A;  2BWC A;  1XSQ A;  1SLA A;  4WBB A;  1A8D A;  3W58 A;  3GHN A;  4AE2 A;  1XNT A;  1G9D A;  3QOP A;  4D0Q A;  2LRO A;  3U07 A;  3IPV B;  3ZFF C;  4KU8 A;  3RJR A;  1YNA A;  4LLO A;  4XDO A;  3DV8 A;  3RQ0 A;  1NE6 A;  1PO1 1;  4HFS A;  5JOY A;  2P3J A;  1ODN A;  1XJA A;  2ATF A;  2DTY A;  2BDR A;  4MET A;  4ITC A;  3ZXE A;  4AFB A;  4UW4 A;  3WHT A;  3AMQ A;  3JUU A;  1OH4 A;  4NHX A;  2EID A;  2RS5 3;  3C3V A;  3WX5 A;  4BIF A;  1VBB 3;  3MV1 1;  1DP0 A;  1UKG A;  4YLZ A;  4OZO A;  1FX5 A;  1C4R A;  1JOJ A;  2VMF A;  2XJV A;  3IB3 A;  3R0R A;  3OF1 A;  1G86 A;  4NRQ A;  4W6X A;  3U11 A;  4B1L A;  4FTS A;  1KDM A;  3IDA A;  2VZP A;  1UN1 A;  2GAU A;  2ZHM A;  4S2H A;  2ZEW A;  2HBT A;  4OHV A;  5FZ0 A;  1W2T A;  5FV3 A;  4A42 A;  1SDD B;  4QPW A;  3DXT A;  5FYB A;  4HKW A;  1P8J A;  3VB9 A;  1UIK A;  4CRQ A;  3B3Q E;  5KHI A;  2D40 A;  3U0Z A;  3O7O A;  4O9E A;  2W95 A;  3AFG A;  4BZ4 A;  3ZX7 A;  1W6O B;  4Q4X 3;  3AKQ A;  1VAL A;  1IKQ A;  3O0V A;  2CV6 A;  2H0B A;  2MEV 2;  1VBE 2;  1YCI A;  2ZGR A;  4ASK A;  2G4I A;  4UI9 L;  1DBN A;  2VTX A;  2ZAC A;  4XQW A;  4WM8 B;  2KM2 A;  3VBS B;  1QKQ A;  2UYA A;  4FAH A;  1POV 0;  1R1A 3;  3ZR6 A;  3K3O A;  5K4L A;  4I0W B;  1QY4 A;  4AYU A;  1HLC A;  4E8D A;  3JD7 1;  5HI0 A;  2QTW B;  4XUT A;  3UES A;  2DUR A;  5T5J A;  1OD3 A;  2VQ0 A;  2WN2 A;  4G3Y C;  5KWR A;  4JTN A;  2RS3 3;  3HJR A;  2J1E A;  1LOA A;  1WW4 A;  2VME A;  2JB4 A;  3POF A;  5FZF A;  3S30 A;  4XW3 A;  1WLT A;  1POV 1;  1UY0 A;  1H30 A;  1VBA 3;  1VBD 3;  4QPG C;  4IEU A;  2PQS A;  4AQ2 A;  2C0Z A;  2VZ3 A;  1E5R A;  3JD7 3;  2Y0O A;  3LQC A;  2WNV B;  1QJU 1;  4N90 A;  4LOS A;  4QQO A;  2TNF A;  3ZDV A;  1FOD 1;  1FPN 3;  4JKM A;  1OOP B;  1UAI A;  2PLV 2;  5KXC A;  2JXA A;  1PK6 C;  1KQR A;  3HR9 A;  3N7K A;  1QQP 3;  2ZMK A;  4GWJ A;  4Q2F A;  4YM2 A;  5H9Q A;  5H9R A;  4MO3 M;  5LRS A;  1LNS A;  4RA0 A;  1YFX A;  1VP6 A;  3NNG A;  5LA9 A;  3WG1 A;  5D21 A;  4CE8 A;  4I02 A;  4LTA A;  3U78 A;  1XRU A;  1V9U 1;  2R07 2;  3DGT A;  3KV4 A;  4BQY A;  1ND3 C;  1UY4 A;  3AZW A;  2X5I A;  2Y64 A;  1VMH A;  1UX7 A;  1LKN A;  2FDJ A;  1RMU 2;  2XUM A;  5BPX A;  3WNL A;  4ASM B;  2HEW F;  2W47 A;  2XWB B;  4LKS A;  1JOB A;  1HV1 A;  5H9S A;  3SC7 X;  4FSJ A;  3ACL A;  4NHL A;  3ACH A;  3T4V A;  4URA A;  4MYE A;  2VG9 A;  3LGR A;  3T0B A;  4BA6 A;  4C1W A;  3QAC A;  1F5F A;  4BQ5 A;  2XUE A;  2L9L A;  5E1R A;  4DOU A;  5FYZ A;  3AL5 A;  5FXV A;  1AYM 3;  4FPE A;  2CAU A;  2IXC A;  3JCI A;  3KWV A;  4XJW A;  3ZN6 B;  2ADE A;  2D43 A;  2FQP A;  3EBR A;  4BQ2 A;  3LIG A;  4TZD A;  1GQP A;  4X8P A;  1V00 A;  1ZRE A;  1OUR A;  2WFF 2;  4FFG A;  1OLM E;  1GKB A;  5J48 A;  3WIN E;  1MPX A;  4JCK A;  4RYD A;  3ZO0 B;  2ZGN A;  1JS9 A;  4XIL A;  1J59 A;  1OD5 A;  1ZZ6 A;  1XBF A;  1ZRC A;  3I2D A;  3JZV A;  3E1F 1;  1FXZ A;  4RHV 1;  3SKV A;  1F9K A;  4A2U A;  4E8C A;  2CDO A;  1F35 A;  3CJI B;  1YLL A;  3LKJ A;  3LWC A;  4FPF A;  3KS7 A;  5H9P A;  1QXP A;  1AUY A;  5JWP A;  2BGP A;  1QJU 3;  3MFA A;  4JRA A;  2PHU A;  3B93 A;  1NLR A;  1ENX A;  4HN1 A;  1LTE A;  4Q5O A;  4K8R B;  2FDG A;  3K2O A;  3ILR A;  1ZRI A;  3DCQ A;  3KD4 A;  4CP2 A;  4RGA A;  4YW7 A;  1Y43 B;  2BFU L;  2GC0 A;  5JR7 B;  2D98 A;  1Z7S 1;  5A32 B;  3FLR A;  1JZ7 A;  3DPR A;  3AYD A;  4G9S B;  3U75 A;  5DG2 A;  2BU9 A;  2IXJ A;  4Q0S A;  5GLV A;  4XQD A;  4E4D X;  3VKF C;  1RUH 2;  3ZFF B;  1AL0 G;  2CYF A;  2PHD A;  2Y6K A;  4YVS B;  1DZR A;  1YI7 A;  1N47 A;  4Q4Y 3;  2XBO 3;  4HKO A;  2RG4 A;  4COW A;  4LK6 A;  4K40 A;  4JGZ B;  1JZ3 A;  1H8T A;  3WVJ A;  1CAU B;  2PHT A;  1J84 A;  2WFF 1;  4MGK E;  2I07 B;  5F5Q A;  5A33 A;  2YGL A;  5FP4 A;  5L9B A;  5FY8 A;  3ZYJ B;  2YBK A;  5BNN B;  4WVM A;  4DMI A;  1QJE A;  4Z2A A;  3NVC A;  3OGR A;  4YM1 A;  1BKZ A;  4MUV A;  2CHH A;  4XAB A;  3RMX A;  1L7L A;  4R9B A;  1JHJ A;  1IG0 A;  3KVB A;  1DF0 A;  3AFK A;  3AMP A;  4FTE A;  2WNV C;  5K0U A;  1WBF A;  5LW9 A;  2JB8 A;  2QQP A;  2WIN B;  1S2E A;  1EAH 2;  3V56 A;  2XHN A;  5CEH A;  3H42 B;  1QF3 A;  2PAE A;  3CDZ B;  3T4H B;  5BV6 A;  5DAQ A;  2PHX A;  1MS3 A;  4LBM A;  4Y22 B;  1PMJ X;  3E5X A;  1PZ8 A;  4WVM B;  2W1U A;  2EVX A;  2EAA A;  2ZEX A;  2YPJ A;  4MHR A;  1UY1 A;  4O65 A;  1KGY A;  4JX0 A;  4MX3 A;  1DGW A;  2HWF 3;  1W6Q A;  2W1W A;  5LK7 B;  2V4A A;  5FUN A;  2R1B A;  4IEV A;  2Z69 A;  4V2W A;  3WQ1 A;  4BOW A;  2VVD A;  1URX A;  2WS9 3;  2WAA A;  3N7J A;  2Y6F A;  4AEK A;  4CEY C;  4NRM A;  1YYN A;  2QBX A;  1ND2 C;  1OPO A;  4RQP B;  3OYW A;  5A7Q A;  1MZE A;  2P6H A;  1IZ3 A;  4M0H A;  4LUL A;  3WF4 A;  1OLM A;  2BNO A;  3ENR A;  5ANQ A;  1ZRF A;  3J7L A;  4K6B A;  1GU3 A;  3OTF A;  3E6B A;  1OA2 A;  5LBB A;  4CU8 A;  4ORF A;  2XJP A;  1AYN 1;  3C7O A;  2Z42 A;  2HYK A;  1YIF A;  4L97 A;  3EB7 A;  5A6X A;  5T3N A;  1JBC A;  1UW8 A;  1W6N B;  4KBZ A;  3NV1 A;  3AJZ A;  5FZD A;  2OW4 A;  1JYV A;  4Q4X 2;  2WFP A;  3UT0 A;  1G9A A;  1VBA 1;  3SH3 A;  4WZF A;  1F15 A;  2PMW B;  3FX3 A;  5BNN C;  1OPM A;  1VB4 A;  2WBK A;  2WWU A;  4HVO A;  1OVP A;  2R49 A;  5I0U A;  3NL1 A;  4JVA A;  5C7G A;  3TEZ A;  1H6Y A;  4AI2 A;  4BQW A;  1CZS A;  2OQ6 A;  2QQU A;  1PNF A;  2P6C A;  1PGS A;  4YW2 A;  1H6X A;  2DBI A;  1DCS A;  1UU4 A;  3D82 A;  4YGE A;  2WA3 A;  4YSF A;  1MVQ A;  2QQJ A;  2Y60 A;  1PX4 A;  1MEC 2;  3JBG 3;  2PXJ A;  1ULE A;  3OUJ A;  3VUO A;  5DAP A;  1QU0 A;  3DEM A;  3AVS A;  3H1M A;  3UK9 A;  2B45 X;  5I0D A;  5T54 A;  3CZJ A;  1ZNP A;  4RR3 A;  4W65 A;  2RDS A;  3CZU A;  4IE4 A;  1W2N A;  4I0A A;  1JN2 P;  2BGC A;  2LUW A;  2XWJ B;  4ATF A;  3PDQ A;  3LOB A;  2YY1 A;  1RUN A;  2PHW A;  3VBF B;  4YZ2 A;  3ZXF A;  1B35 B;  5JXH A;  3KT1 A;  2XQX A;  3RZL A;  3SEP A;  3BTZ A;  2A6Y A;  2BV4 A;  2OUJ A;  2WC2 A;  2Y6L A;  4HXC A;  5FAX A;  4D6R A;  4I2O A;  5KC5 A;  4IER A;  1ZBA 3;  3AJY A;  4ZKT B;  4IDZ A;  1GLH A;  3HQR A;  4I09 A;  5FZ6 A;  4LIV A;  3DKW A;  4FPJ A;  3AYC A;  1WW5 A;  1V6O A;  2G9Z A;  1R1A 1;  1YWK A;  1F5J A;  3PUA A;  3PL0 A;  4IV3 B;  4KWL A;  3JQX A;  3LDR A;  4OUS A;  4UWD A;  5E16 A;  1NY7 1;  2PN5 A;  5BUV A;  3NST A;  1RUO A;  2XH6 A;  1GOG A;  2VC9 A;  3UJQ A;  2HWB 1;  3LA7 A;  5JI7 A;  3TB0 A;  2JKX A;  3ZYF A;  3TRS B;  2D3R A;  1JZ5 A;  2FCU A;  2WFF 3;  4AFA A;  1VMF A;  1K5M A;  1ND3 B;  4UFJ A;  5E8A A;  5SV5 A;  4ZPI A;  4B4Q A;  3MW4 A;  4QGL A;  4XEZ A;  4XXP A;  1H8V A;  4YVW B;  3VD9 A;  1DHK B;  2RR1 1;  5T52 A;  3VL8 A;  2WQ4 A;  5JAX A;  5KHG A;  1H1I A;  1ZA7 A;  2QVS B;  5C6C A;  5CG9 A;  3VV1 A;  3HOB A;  5CBL A;  4TYS A;  3OPT A;  1W6P B;  5DZG A;  5EPA A;  5JUV A;  4OUM A;  2CGP A;  1TQ5 A;  3T1L A;  1H8T C;  2KR2 A;  3CQO A;  4YW1 A;  2QQI A;  4XUO A;  4LHL A;  1C5I A;  2VL4 A;  3I3B A;  2QZ2 A;  1EV1 3;  2X10 A;  1R08 2;  3GYD A;  3FL7 A;  4NIH A;  4GKY A;  2A73 B;  2XGX A;  4ASL A;  1V6I A;  4MVT A;  1OT5 A;  1W2O A;  3K51 A;  2A6W A;  4XIO A;  4N53 A;  1WLW A;  2ZX4 A;  4IGP A;  1PIV 1;  3LFI A;  3ZFG C;  2PA7 A;  5K9Y A;  3J9S A;  1V70 A;  1ND2 A;  1W90 A;  1GNH A;  4FPC A;  1CQ9 A;  1FT9 A;  1REF A;  2LS6 A;  5C4W B;  3S7E A;  5LA0 A;  1DGR N;  1N3O A;  2SBA A;  2W1S A;  5DN2 A;  1SDW A;  3VZN A;  1NX9 A;  4I01 A;  4IEW A;  4QPI C;  3VDA A;  5FZO B;  2VO5 A;  1PGL 2;  3WDY A;  4AWD A;  4KL1 A;  2WQZ C;  2J1A A;  3BVC A;  2VU9 A;  2Y26 A;  1SPP A;  2EXH A;  3HNM A;  4IE0 A;  4LPL A;  3BGA A;  3MW3 A;  1AF9 A;  4WM7 B;  1TVG A;  3E6C C;  1FMD 3;  1DZT A;  2BRT A;  1LEM A;  5CKM A;  5CA6 A;  1FV2 A;  5F2S A;  1NQD A;  4FOW A;  3LD8 A;  5C3R A;  3ZPY A;  3J7N A;  5FZG A;  4N43 A;  4YZ4 A;  3WNO A;  2N7G A;  4AED A;  4PT6 A;  3MIH A;  1LUL A;  5FYM A;  4XOG A;  5ACA 1;  1SG3 A;  1AHS A;  4QXH A;  4RS5 B;  1UPS A;  5F39 A;  2E32 A;  3ZKY A;  4CCE A;  2PYT A;  1Z78 A;  4M0N A;  4Z2W A;  1GWM A;  4JDN A;  1KEX A;  4YWA A;  3ACI A;  5FCC A;  4AI9 A;  5LA1 A;  1GMM A;  4OHZ A;  3T2P A;  4Z92 B;  3VKL A;  3CIH A;  4O7X A;  5BNP A;  1TME 3;  3WLU A;  3IDE A;  1UU6 A;  2GMM A;  3GBW A;  2YYO A;  4C0B A;  4NPL A;  4QU2 A;  1AR6 1;  1AR6 3;  4YW5 A;  3RI9 A;  3VBH C;  5APA A;  1SHW B;  3VHR A;  4YNI A;  4BPZ A;  2A5Z A;  1RUC 1;  3OB8 A;  3GXU A;  4XPV A;  4D8M A;  1MQT C;  2GN3 A;  1PVC 2;  2HWE 2;  3HD8 B;  5LEK A;  4H3W A;  1OLR A;  3T2Q A;  4W6W A;  1ZRD A;  1AR8 2;  1S4C A;  1G9B A;  4PIZ A;  3FBY A;  4XFF A;  3VHO A;  2C6S A;  2RJL A;  2R06 2;  3V0B B;  2BPA 2;  5K7P A;  2WNU C;  1Y7B A;  1RUG 3;  1C57 A;  2R0F A;  4HVQ A;  5ANN A;  1V6L A;  2JDN A;  4OQ8 A;  1AXK A;  4GMP 0;  2IXK A;  2OT7 A;  2BNN A;  3BIW E;  4FPO B;  2F4L A;  5CFC A;  3H7J A;  3RGB A;  4ZHN A;  2O8Q A;  2VQT A;  3ZYR A;  1KFX L;  1N3Q A;  1D2S A;  1GUI A;  1RTV A;  3LEG A;  1PMI A;  2PHR A;  5D2A A;  1G9F A;  2ZOE B;  5EJZ B;  5FP9 A;  3O1U A;  2JG8 B;  2VQA A;  2R07 1;  4DEV A;  1UZZ A;  2RV9 A;  3M3C A;  2EIB A;  5JIU A;  1RYY A;  4X6R B;  1SBE A;  2LW8 A;  3IPV A;  1IS4 A;  2XQR A;  2YDE A;  5IVE A;  2W94 A;  2B9V A;  3M8L A;  1HRI 2;  1NCR A;  3IZO A;  3LDB A;  4LO7 A;  4XMA A;  1IG3 A;  2VMC A;  5C9A A;  5A3W A;  1FOD 2;  1MQT A;  1NQJ A;  1TME 1;  2YU2 A;  4Q1R A;  3ZFG A;  3KZ4 C;  4Q27 A;  5A7S A;  1ULF A;  1I5Z A;  1WME A;  3H0O A;  2YBP A;  5LA2 A;  1CGP A;  4XUN A;  5EJ3 A;  2Y8K A;  2PTM A;  2P3I A;  2WNU A;  2BBV A;  2OS2 A;  4CDU A;  3ZYI B;  4B7K A;  3RZK A;  4QX3 A;  2DVD A;  3ITQ A;  1V6M A;  4NWV A;  3TYJ A;  3F95 A;  4FPK A;  5HCH A;  4IES A;  3LA3 A;  2JDK A;  1DQ4 A;  1L7R A;  2W46 A;  1XB9 A;  2DCJ A;  4FFI A;  4HK9 A;  2ZGP A;  2YU1 A;  3AXE A;  1GNY A;  1RVF 1;  5FPV A;  5CAD A;  1MQT B;  4JRL A;  3FHQ A;  3R4U A;  1PVC 1;  2GU9 A;  2HWE 1;  2VUJ A;  2ZZJ A;  3E6D A;  3MUY 1;  2WZP P;  3THP A;  1HXS 2;  1O3S A;  4CP9 A;  4LE3 A;  2WRA A;  5ABJ A;  1APN A;  3TAY A;  2EXJ A;  4UBG A;  1W8U A;  2AR6 A;  1BEV 1;  1ULO A;  3AM2 A;  1R64 A;  2QNK A;  1G9C A;  2P3K A;  1CR7 A;  1BHG A;  3H50 A;  1OUX A;  1F31 A;  1W8T A;  3CHX A;  4UFI A;  1O59 A;  4OI4 A;  4QAW A;  5F3I A;  5IK7 A;  5LBC A;  1MZ6 A;  2UWA A;  1L7Q A;  2Z4F A;  5DUU A;  3UGG A;  4AR2 A;  4LOT A;  2WNO A;  1HQW A;  4QU1 A;  5DAB A;  1GOF A;  1VBD 2;  2BNM A;  2P4E A;  4DEQ A;  4F83 A;  1XU2 A;  3E97 A;  4JC1 A;  4U2A A;  4B3N A;  5FLH A;  2J1S A;  4L99 A;  4MHU A;  2JDP A;  1H4H A;  2FDF A;  4QWN A;  1RIT A;  1PX3 A;  3D8C A;  4QB1 A;  4PHZ A;  3ZSK A;  1RUC 2;  2DTW A;  3S0M A;  5AC9 1;  2D3S A;  3THD A;  4Z82 A;  4FXG B;  5BYN A;  2BW8 A;  3NQH A;  3OCP A;  3WP6 A;  2JDZ A;  3Q8B A;  2VBB A;  1OOP A;  5GLU A;  4MXW A;  4AVC A;  1UWW A;  5FO9 B;  1I3H A;  2GNM A;  4RQP A;  1NA1 C;  2R07 3;  4RL7 A;  5FZ8 A;  3OGS A;  5IVF A;  2XJS A;  4QGM A;  3U1X A;  4CA9 A;  2DFB A;  5C4W C;  2XLG A;  1YC6 1;  3OEA A;  4BXF A;  2OX0 A;  5EJ1 B;  1WA4 A;  1W3V A;  1G6N A;  2ET7 A;  1K5J A;  2HWD 3;  4N53 C;  4QX0 A;  4Y4Y A;  3POJ A;  3FN9 A;  4LUK A;  5LCW L;  4N7I A;  2TEP A;  2D6N A;  1AJK A;  4IE6 A;  2VPV A;  2R0H A;  2OZJ A;  5IAX A;  1RUJ 2;  1UZW A;  3BAL A;  1DYO A;  4A7Z A;  5AFB A;  4MGS A;  1RUE 1;  4ERO A;  5AFE A;  1BZW A;  2YGM A;  4EN7 B;  4AEM A;  2B8M A;  3IT8 A;  3IAP A;  2XR4 A;  3N35 A;  2W9X A;  3ST7 A;  3NKG A;  4GH4 A;  4AVA A;  1OA4 A;  4IV3 A;  4LK7 A;  2BEO A;  4IET A;  4LO8 A;  3UGH A;  3ZOI A;  3PVO A;  1KS4 A;  1LJ7 A;  5JSR A;  1UMZ A;  1UD1 A;  2AEY A;  3WCS A;  4XAE A;  3DKQ A;  1GZ9 A;  1UMI A;  2HWC 3;  1OF3 A;  2JD9 A;  2VTX J;  1X82 A;  4JHZ A;  4FI9 A;  5A70 A;  2SLI A;  2VW0 A;  3KT4 A;  4FQ4 A;  3V0B A;  1RJ8 A;  3NAP A;  4NHM A;  2FBE A;  1RUF 1;  1C8M 1;  5LEJ A;  2VAU A;  3PUH A;  4M3C E;  5LRR A;  1ONA A;  5CFD A;  1SBD A;  1W06 A;  1W6M B;  4XE9 A;  2P5B A;  2WT0 A;  3WD5 A;  2J22 A;  2JE9 A;  4AVV A;  4AI3 A;  2QUO A;  3SCH A;  1CAV B;  2VR4 A;  3KCY A;  1QJY 3;  4PLM A;  1IOA A;  4Z1V A;  5F37 A;  3KSC A;  4DRR A;  1NZC A;  2VEC A;  1S0J A;  3WDW A;  5L19 A;  5IHR A;  3WW1 A;  3TEX A;  1W03 A;  5DUX A;  3IMM A;  1FMD 1;  1R1A 2;  1QOT A;  3QLQ A;  2JDU A;  3BU7 A;  4FFF A;  4IGO A;  1COV 2;  4IV3 C;  4L92 A;  2MEV 1;  1W0O A;  1RIN A;  4XBQ A;  1AR8 1;  1NG0 A;  4P9X A;  1RUG 2;  3HBK A;  3S5Q A;  4CXW A;  3PU3 A;  1RUF 3;  1UKR A;  4FO9 A;  4QDR A;  4CCN A;  4B1M A;  4IL7 A;  2P2K A;  2C24 A;  1UMH A;  3KF5 A;  1S55 A;  5A6Q A;  3LSD A;  3N4M A;  2VCC A;  4O9G A;  2XKP A;  4N8M A;  3N7M A;  4COV A;  1TNF A;  1ULC A;  2WN3 A;  2XPJ A;  2GP3 A;  3LIH A;  2FDK A;  1QGL A;  4H7L A;  5T55 A;  2EIG A;  2UUR A;  4KQ7 A;  4CDX A;  3CBN A;  2JE7 A;  2WWS A;  1BVV A;  1IGO A;  2VD7 A;  3UV9 A;  2VOK A;  5IYY A;  3VZO A;  2AAC A;  2BJS A;  2CNA A;  3N7L A;  4GJZ A;  3AX4 A;  4XUR A;  1WMF A;  1UZY A;  2NMO A;  2VNV A;  2Y34 A;  5A7P A;  2DCT A;  2P17 A;  2JDH A;  1WCK A;  2DDU A;  3FHI B;  4UFM A;  5HV4 A;  1YJK A;  4XFC A;  2XJU A;  4IGQ A;  4JQR A;  4OMC A;  4YZ5 A;  1ODM A;  1RUG 1;  1PO1 2;  4MXV A;  4XCA A;  1VBC 2;  2Q4S A;  1KJL A;  3E5U A;  1QXR A;  5KHJ A;  3GGL A;  3POB A;  1HQL A;  3ZMO A;  4CU9 A;  3ES1 A;  5CYY A;  4N7U A;  1FYU A;  1O7F A;  4H2A A;  2WLQ A;  1RED A;  3MFC A;  2BVB A;  5GM0 A;  5J36 A;  5CIR A;  3IIA A;  3CF6 E;  3OBA A;  4CU6 A;  1HB3 A;  2VBP A;  2QQV A;  1QJX 2;  1YEW A;  3BYW A;  4KGQ A;  4BXS V;  4QT6 A;  1E5I A;  4GWM A;  1AX2 A;  4BLJ A;  1BMV 2;  4NRO A;  2XML A;  4QPG A;  5HXM A;  3SMH A;  1PM7 A;  3O1P A;  3O1T A;  2Y6H A;  4DFS A;  4KG8 A;  2WL1 A;  4BYY A;  1WD4 A;  4QQL A;  3K48 A;  1KJR A;  2YC4 A;  1UZ0 A;  2PLV 1;  3I3D A;  1CWP A;  4ES8 A;  5F6K A;  5IAT A;  4Q0V A;  3ZR5 A;  3NW4 A;  1QOO A;  1GBG A;  1MS8 A;  5FPA A;  3M1H A;  1SFY A;  5ISL A;  4IEZ A;  5FZA A;  4Q4W 2;  5C4W A;  4JGZ C;  4MOA A;  4ZU7 A;  1MVE A;  1W99 A;  5A33 B;  1AYN 3;  2GND A;  1FI2 A;  3I4I A;  2LAL A;  3ES4 A;  3OEB A;  4XF0 A;  4Q4Y 2;  1GZW A;  1CAV A;  2P34 A;  4KWU A;  1LU1 A;  4XVH A;  5EV7 A;  4WVZ A;  5BNO A;  1JYN A;  1QHD A;  2JE8 A;  1MS9 A;  1AR9 1;  4NPR A;  4MH0 E;  4MV2 A;  1XSR A;  1J3Q A;  1IPS A;  2FCV A;  1D4V B;  3AKR A;  3AZX A;  4K1Y A;  2QFE A;  3AXD A;  2ZZQ A;  4FP3 A;  3WHU A;  4B29 A;  5FR3 A;  1H8T B;  3H9A A;  5CVR A;  1ULP A;  3ORJ A;  4K8F A;  5LB6 A;  5T5O A;  3NAP B;  4DUW A;  2D6L X;  4P9J A;  1NAE A;  2NZ9 A;  1UPI A;  4QQ2 A;  4OYU A;  4LKF A;  1YXW A;  3ZYB A;  1EUT A;  3ACF A;  3ZFF A;  4P9G A;  4EN9 B;  4IE7 A;  5FY1 A;  3M3E A;  3MPP G;  3TN9 3;  4KH9 A;  4Q1P A;  4FOV A;  5C3Q A;  1VBD 1;  1AVB A;  3PHM A;  2AUY A;  3M3I A;  5FBJ A;  3O0X A;  1DLC A;  1LCL A;  3LB9 A;  4E4S A;  4NHK A;  2QCS B;  2YZ4 A;  1JI6 A;  3KT7 A;  3PIG A;  3OGG A;  2GSY A;  1GIC A;  4AGV A;  1O4Y A;  4JGY B;  4ET7 A;  3PVN A;  4HZF A;  1QJX 1;  1V6J A;  2J1R A;  3I59 B;  4IEP A;  3VBO C;  2IZW A;  3IBM A;  4JGY C;  5IW0 A;  3HEI A;  1XYN A;  3IM0 A;  2FDI A;  4QD2 A;  5FBZ A;  2E26 A;  2A70 A;  1D0G A;  1QDC A;  1GYK A;  1OSG A;  4CDU C;  2VCA A;  1W8F A;  3PTY A;  5FZC A;  2WZR 1;  1KFU L;  4W4Z A;  5DG1 A;  1DU3 D;  2A6Z A;  2HWC 2;  2DVG A;  3UL2 A;  1B09 A;  2ZHL A;  3WSO A;  1X7N A;  1SEF A;  4AL9 A;  3T0D A;  3HPN A;  1S2K A;  1AXY A;  3MEP A;  5IVV A;  1SBF A;  1EYB A;  3VHN A;  1Y9G A;  1GP4 A;  2R04 2;  4M4P A;  1PK6 B;  4KWJ A;  3VDD C;  2WYF A;  3WY6 A;  2EAL A;  1XU1 A;  4RS5 A;  3INA A;  4XZP A;  2HYX A;  4XJ9 A;  2X05 A;  3ZIX A;  3EO6 A;  4KI5 M;  4LO4 B;  4Y24 A;  4LO6 B;  3I7D A;  1PGW 1;  1IS5 A;  2K2S A;  4UYB A;  5GKA C;  3LFM A;  3A21 A;  4P9W A;  1DLL A;  1RUI 2;  4AI1 A;  2HBU A;  4AQS A;  1SFP A;  1CZT A;  3HWJ A;  1ZBE 2;  2WR9 A;  4FPH A;  4Q4W 3;  1D4M 3;  1GR3 A;  2OA2 A;  1C8N A;  2C4X A;  2G9F A;  4ZXE A;  3H7Y A;  3IDC B;  4B7E A;  1GOH A;  1OXC A;  2JIJ A;  4AK3 A;  4ARX A;  1UCX A;  2CY6 A;  2ZGK A;  5FOJ B;  2VTF A;  4YYO A;  4NE9 A;  4NII A;  1ZZ9 A;  1G7Y A;  2E7T A;  1WWY A;  3HT2 A;  2E33 A;  2ZAA A;  3A4U A;  3VZJ A;  4C91 A;  3BOW A;  1MEC 3;  2YRO A;  3JBG 2;  1F8V A;  1CAW A;  2ILM A;  1MR5 A;  4LEJ A;  5T5P A;  1BLZ A;  3ZPO A;  5IK5 A;  1S1A A;  4IEQ A;  4TLF A;  3POI A;  3EHK A;  4R4X A;  4Y1Z A;  5FYI A;  4CXX A;  4YAR A;  1H1M A;  4E2S A;  2WNE A;  2JEM A;  1XNA A;  4P08 A;  1CX4 A;  4AGR A;  1PGW 2;  3H3Z A;  3NNM A;  3VBU A;  1RMU 1;  3B02 A;  3BN6 A;  5BNN A;  2Q8D A;  1RUD 3;  2XL9 A;  3DF0 A;  4J1X A;  3VD3 A;  4LA2 A;  3VBF A;  4AI8 A;  4ZZ8 A;  3WQ0 A;  3R6S A;  4QHZ A;  4I3P A;  4NRP A;  5JVV A;  3UKT A;  1UOG A;  4PF5 A;  4N9H A;  2GN7 A;  1UL9 A;  4YW4 A;  5FIX A;  1ZBE 1;  5C8C C;  1YQ5 A;  4ES9 A;  3GM8 A;  3DPR C;  3FHA A;  4GH4 C;  3K75 B;  3RZJ A;  1ZZC A;  3III A;  3MDP A;  5JR2 A;  5JPM B;  5A6Y A;  1AL2 2;  4XDP A;  3POS A;  4P5H A;  4E4Z A;  3BPS A;  4GH4 B;  3VHP A;  2Y6J A;  2NP0 A;  1REE A;  2JIG A;  4I3G A;  1AR8 3;  3JBG 1;  3O5S A;  1YI9 A;  3VBS C;  1AR7 2;  4D7Y A;  3ACG A;  5IK4 A;  2GNT A;  1Q8P A;  2JD4 A;  3FE5 A;  1RVF 3;  4XFA A;  5IJR A;  5HCB A;  3SNM A;  1CN1 A;  3P1I A;  4HAN A;  1F4H A;  4CPB A;  2CTV A;  5IVB A;  4NN0 A;  3IAQ A;  2AEN A;  2BOI A;  4S2G A;  4XF9 A;  4GB3 1;  1QIQ A;  3ZSL A;  4QXC A;  5HCA A;  4EWE A;  1D7P M;  5JZG B;  2GC2 A;  5A3M A;  1JYX A;  2RMU 3;  1H2K A;  4FAG A;  4CCK A;  4AG4 A;  3KVA A;  1VB2 A;  2ET1 A;  1HN0 A;  2V09 A;  3ZYH A;  2WAO A;  1B35 A;  3BUC A;  4IW3 A;  4COY A;  2BTV C;  4UAP A;  4HET A;  4PDW C;  3OD0 A;  3Q8A A;  4A4A A;  3S57 A;  4XJU A;  4BQ3 A;  4QDQ A;  3ZKU A;  3V0A A;  1FOD 3;  1RUI 3;  2PAM A;  4PDW B;  2WO3 A;  1Y4W A;  4Y20 B;  4Q8L A;  4RR3 B;  4RFR B;  4L11 A;  1RHI 2;  2JG9 C;  1I9R A;  1RUJ 3;  2WZE A;  3PVE A;  2Q8E A;  3KB5 A;  3WEZ A;  5AC9 2;  5LAT A;  3VL9 A;  2J1V A;  3HMY A;  4XTP A;  5C3S A;  3WQ7 A;  5JSP A;  2JEN A;  1O5U A;  2GC3 A;  1POV 3;  3RZZ A;  3W20 A;  1C5H A;  1VBB 2;  1Z7S 2;  1NA1 A;  5FRE A;  5DXD A;  1CPM A;  2W52 A;  2YV8 A;  4ARY A;  2OPK A;  2RM2 3;  1DIW A;  1N3P A;  1MS4 A;  3M3O A;  5A7W B;  1HXS 1;  5B2G B;  5C3O A;  2ZHN A;  1GWL A;  1GZW B;  4DUX A;  4NOT A;  1RJ7 A;  1ENQ A;  1PZ9 A;  2IFW A;  1AL2 1;  1QMJ A;  2ETE A;  3USU B;  4CXY A;  1YQ2 A;  4RHV 2;  4F7Z A;  3B5L B;  1QXJ A;  4UOJ A;  3POG A;  5BNQ A;  1Q5O A;  2BWA A;  4YM0 A;  3WUD A;  3BTY A;  3RZG A;  1HXS 3;  2HWD 1;  4C8D A;  3NNF A;  3T0A A;  4WVW A;  2IVI B;  2A6V A;  5K0U B;  2NQY A;  3O1O A;  1X9P A;  2I45 A;  3VBR C;  4PI0 A;  4XBN A;  2RDQ A;  5I8T A;  2RHP A;  3MIF A;  1A3K A;  3RI8 A;  4QX8 A;  5CIS A;  4MGI E;  5J3U A;  1HV0 A;  2Q1M A;  4H7M A;  5FZ9 A;  2VCB A;  2ARB A;  2ZCW A;  1X36 A;  1PVX A;  5GLT A;  1TME 2;  2PHL A;  1X33 A;  3NV3 A;  3ZM8 A;  4HN0 A;  4M4R A;  5SV8 A;  1HRI 1;  3WG4 A;  2QQM A;  2ZS6 B;  3AP7 A;  5FO7 B;  1NT0 A;  2ARX A;  2RS3 2;  2XBO 2;  4N53 B;  5ABJ C;  4CEW C;  4LXL A;  1WMD A;  2QKD A;  1XE0 A;  2YBS A;  3EMR A;  3HIF A;  2P37 A;  3MZH A;  2ZML A;  3RFR A;  3ZFG B;  2Y33 A;  5DAX A;  5FZI A;  1GP5 A;  1OOP C;  2HKX A;  2XG3 A;  4H55 A;  5KBF A;  1J3P A;  4EE2 A;  4J25 A;  5FQ0 A;  5FMB A;  1XNB A;  1UOF A;  4OFG A;  5DAW A;  3VBF C;  3BTX A;  3NJY A;  5A1L A;  1DQ2 A;  4GIQ A;  4AHX A;  1Y9Q A;  4LO5 B;  3N9Q A;  4AHY A;  3KCX A;  1EV1 2;  4AAP A;  1NCR B;  4K1Z A;  5IFT A;  1VAM A;  2DVB A;  2ZX0 A;  4P5Y A;  2EF6 A;  3PNA A;  3KV6 A;  4FVV A;  5CB7 A;  1HW5 A;  1O5L A;  2OKX A;  5FKC A;  1QNW A;  3LPG A;  5JCT A;  3N9P A;  2W68 A;  2HEY F;  4MGY E;  3FUQ A;  4NPM A;  4QXB A;  2IWG B;  4OHW A;  5JDB A;  4AW7 A;  4ZZ5 A;  5HV0 A;  4LOR A;  1JYT A;  1H2M A;  3TOJ A;  1SZB A;  1ZBA 1;  3CO2 A;  4BQ1 A;  2DCK A;  4XBL A;  1EY2 A;  3KHB A;  3B00 A;  2O14 A;  4MGQ A;  3WF3 A;  4K3U A;  4BDV B;  1FMD 2;  5K0U C;  1LAJ A;  2WA4 A;  4BIO A;  4CUB A;  1W6M A;  4FT8 A;  3WF2 A;  5L9V A;  3MIC A;  4IND A;  1JU3 A;  4AVB A;  3POW A;  1JHN A;  1EPW A;  2DV9 A;  3MPB A;  3GJB A;  4UT5 A;  1WMX A;  2VJX A;  4WV8 A;  5FZB A;  1LGB A;  3NWK A;  5J98 B;  3KF3 A;  3JU9 A;  5FLI A;  3UJO A;  1J1L A;  1HB2 A;  4LR4 A;  1PNG A;  2H6B A;  3FWE A;  3RPQ A;  1SFN A;  4Q4X 1;  4MGZ E;  3S5A A;  4DQA A;  4HON A;  2CAV A;  5EXO A;  3FC0 A;  3SHR A;  2RMU 1;  4EWA A;  5A3P A;  4A7K A;  2IVJ A;  2ZKN A;  3DPR B;  4ZS2 A;  4BME A;  3FMG A;  4Q4W 1;  4IV1 C;  2BQP A;  4WVV A;  4CCJ A;  2XJQ A;  4QB2 A;  4XTM A;  1HQN A;  5EYX A;  2FDH A;  4HPK B;  3MI8 A;  5K8S A;  2DF7 A;  4ISQ A;  1LED A;  1JZ2 A;  2EXI A;  1HB4 A;  5C5U A;  1EPZ A;  5L7O A;  1LOC A;  2WLP A;  1FNY A;  3ILF A;  1HKD A;  3OUH A;  4U36 A;  3DXU A;  1UOB A;  5EWS A;  3MF9 A;  3WDT A;  1BMV 1;  3PUI A;  4WZC A;  4PQ9 A;  3GZU C;  3U4S A;  3VN4 A;  4YW3 A;  3S6P A;  1LOG A;  4AOC A;  4WM7 C;  2JG9 A;  2Q1F A;  2WSU A;  3ZFE C;  1KD7 A;  5L7O C;  1ASJ 1;  2GDF A;  3D0S A;  3I97 A;  4PQQ A;  5C33 A;  3DUI A;  4XXA A;  4CUC A;  2NPI A;  1RGS A;  3A22 A;  1DYK A;  1JOP A;  1ALY A;  2A3X A;  2QE3 A;  1BEV 3;  3SH5 A;  4AF9 A;  4BJ0 A;  2JWP A;  4URT A;  2O0O A;  3ZDS A;  3OYW B;  1W04 A;  4UW6 A;  4M3C A;  1CAX B;  1AR9 2;  5FLJ A;  1ZRR A;  2GMP A;  3WP3 A;  4IE5 A;  4YRD A;  2CU5 A;  2UYB A;  1W2U A;  1UXZ A;  2B9U A;  1OQ1 A; 
#chains in the Genus database with same CATH homology
 2W47 A;  4LKS A;  4QX2 A;  3I2I A;  5IHR A;  3ACH A;  3OGV A;  4L0P A;  1US3 A;  3T0B A;  2VZO A;  3WF1 A;  2L9L A;  4OMD A;  3T2O A;  2VZU A;  1GQP A;  4PF1 A;  3HNY M;  4QDR A;  1MPX A;  4LQR A;  3HN3 A;  4RYD A;  1UMH A;  4GZ9 A;  2W5F A;  1JZ6 A;  2VCC A;  3E1F 1;  4W50 A;  3SKV A;  4E8C A;  2YFZ A;  3T09 A;  2CDO A;  2WN3 A;  3MO4 A;  2BGP A;  5IFP A;  1JZ7 A;  5IYY A;  2BZD A;  5CZK A;  2YB7 A;  4XUR A;  2BER A;  1TG7 A;  2Y6K A;  2DDU A;  1JU4 A;  2BBA A;  4OMC A;  2VZ1 A;  3NRU A;  2YC2 A;  4AAX A;  4QDS A;  1JZ3 A;  3GGL A;  4CU9 A;  3WQB A;  1J84 A;  5CYY A;  3LEK A;  4Z2A A;  3OGR A;  3K4D A;  4TTG A;  3OBA A;  4CU6 A;  1JHJ A;  1WKY A;  4RN5 A;  1O8P A;  2BGO A;  4BXS V;  1CIY A;  2XHN A;  2W3J A;  3CDZ B;  3J7H A;  5HXM A;  3ETP A;  2C26 A;  2Y6H A;  2QQL A;  1PMJ X;  2YC4 A;  3I3D A;  1UZ0 A;  5B4X A;  2X09 A;  3WNK A;  2W1U A;  1I5P A;  3I2H A;  2ZEX A;  1UY1 A;  1KGY A;  4JX0 A;  3HNB M;  2W1W A;  4MOA A;  1W99 A;  2VZR A;  1PMH X;  3K4Z A;  3OEB A;  4KWU A;  4XVH A;  2WAA A;  3T08 A;  1JYN A;  2JE8 A;  3SKJ E;  2J1T A;  2QBX A;  4CU7 A;  3D3A A;  4QX1 A;  1US2 A;  3WF4 A;  1JZ4 A;  1GU3 A;  1ULP A;  4DUW A;  4CU8 A;  3VDC A;  1NAE A;  3C7O A;  4OYU A;  1CX1 A;  3EB7 A;  2V4V A;  2YFU A;  1EUT A;  3ACF A;  1JYV A;  5JXJ A;  1T2X A;  1OF4 A;  1WCQ A;  3LPF A;  1DLC A;  5DPN A;  3U37 A;  2WBK A;  1JI6 A;  3MBW A;  4BK4 A;  4ET7 A;  2VOT A;  5C7G A;  5G04 L;  1H6Y A;  2W91 A;  2J1R A;  1CZS A;  4DXT A;  3HEI A;  4A41 A;  1H6X A;  2E26 A;  2J7M A;  1K45 A;  2QQJ A;  2VCA A;  3F2Z A;  1PX4 A;  4MAD A;  1K3I A;  4W4Z A;  3WF0 A;  5I0D A;  4CUA A;  3DYM A;  3CZJ A;  1W9S A;  3JXS A;  3VDB A;  2C9K A;  3CZU A;  5FUI A;  3WSO A;  2ORX A;  3UET A;  3HPN A;  3T0D A;  3CMG A;  1J83 A;  1XC6 A;  2WAB A;  4M4P A;  4DXS A;  5JXH A;  2E31 A;  2XQX A;  3OG2 A;  2WUH A;  1UYY A;  3SEP A;  2Y6L A;  3P6B A;  2WO1 A;  2HYX A;  2X05 A;  4KI5 M;  5HPO A;  4W8J A;  2RVA A;  5G05 L;  2R7E B;  3C8X A;  2V72 A;  4OUE A;  3A21 A;  3THC A;  1CZT A;  1GOG A;  1K12 A;  2VZT A;  4HG6 B;  2C4X A;  4A44 A;  4ZXE A;  2VC9 A;  2RJ2 A;  3I2J A;  4TXW A;  1GOH A;  4ARX A;  2Y6G A;  2JKX A;  2VTF A;  1JZ5 A;  4XUP A;  5C70 A;  2E33 A;  2ORZ A;  1W0N A;  5JMO A;  3VD9 A;  1W8N A;  2ID4 A;  3LE0 A;  4XUQ A;  3HOB A;  1UYX A;  5JUV A;  1HN1 A;  2ZXQ A;  1XNA A;  3CQO A;  4P08 A;  1EUU A;  3W5M A;  2QQI A;  4XUO A;  3BN6 A;  2VL4 A;  3I3B A;  3VD3 A;  4ZZ8 A;  2X10 A;  3FL7 A;  1OT5 A;  3NJV A;  2V5D A;  3ABZ A;  3GM8 A;  3I3E A;  3FHA A;  3MV0 1;  3K75 B;  5J1X A;  3III A;  2JDA A;  5JR2 A;  2LS6 A;  5LA0 A;  3MUZ 1;  4A45 A;  2W1S A;  5DN2 A;  2Y6J A;  4LHS A;  1NX9 A;  3VDA A;  2VO5 A;  4P02 B;  3W5N A;  2VZQ A;  2J1A A;  2WQ8 A;  3C7G A;  3HNM A;  4LPL A;  2CDP A;  1CZV A;  3BGA A;  3ACG A;  3DYP A;  1JYW A;  3GDB A;  1TVG A;  5IJR A;  2QQK A;  3P1I A;  5B4N A;  1F4H A;  2ZEZ A;  3WNO A;  3IAQ A;  4PT6 A;  3K77 A;  4P00 B;  3ECQ A;  4DXR A;  1D7P M;  1JYX A;  1SG3 A;  4A3Z A;  2E32 A;  4AG4 A;  1W8O A;  1KEX A;  5LA1 A;  3ACI A;  1GMM A;  3T2P A;  2WAO A;  3DYO A;  1K42 A;  3CIH A;  4UAP A;  1NKG A;  2B4K A;  1W9W A;  3DEC A;  4A4A A;  4JKK A;  4QDQ A;  1O8S A;  2WO3 A;  1UY3 A;  2W1Q A;  1SHW B;  2WZE A;  3WEZ A;  4QB6 A;  3OB8 A;  3GXU A;  2J1V A;  2VQU A;  4D8M A;  3C7E A;  3VD7 A;  3T2Q A;  5DQ0 A;  4ARY A;  4GWI A;  4XZU G;  3C7F A;  4DUX A;  4DUV A;  4CVU A;  4ZY9 A;  1YQ2 A;  4UOJ A;  2J1U A;  2WDB A;  2VQT A;  3A23 A;  3LEI A;  3T0A A;  1GUI A;  1UX7 A;  5EJZ B;  3LEG A;  1UY2 A;  2YG0 A;  4DEV A;  2RV9 A;  1XPW A;  4YPJ A;  5EIY B;  5JXG A;  2EIB A;  2QQO A;  1RYY A;  2VM9 A;  2XON A;  4IUG A;  2VCB A;  2LW8 A;  2W87 A;  5DMY A;  2W94 A;  2B9V A;  2WZ8 A;  3ZM8 A;  2VMC A;  4M4R A;  2QQM A;  1NUK A;  4A6O A;  5LA2 A;  5JXI A;  4XUN A;  2Y8K A;  3VD4 A;  3I2F A;  2WYS A;  4QX3 A;  1UXX X;  1L7R A;  2W46 A;  2DCJ A;  4BK5 A;  2VMD A;  3AC0 A;  1GNY A;  3C7H A;  2WO2 A;  5C71 A;  3FHQ A;  3I2K A;  3MUY 1;  3WNN A;  1XNT A;  1IQD C;  1ULO A;  4D0Q A;  1R64 A;  5IFT A;  4P5Y A;  1BHG A;  2OKX A;  3SEE A;  1O59 A;  2W92 A;  2XOM A;  3LPG A;  4QAW A;  2EIE A;  3EYP A;  2Z4F A;  1L7Q A;  3WNM A;  2VZV A;  3A7Q A;  1GOF A;  1OH4 A;  3WNP A;  4DEQ A;  4ZZ5 A;  2EID A;  2J1S A;  3I2G A;  3MV1 1;  1DP0 A;  1UYZ A;  2DCK A;  4OZO A;  2VMF A;  3IB3 A;  4MGQ A;  3WF3 A;  4BDV B;  1PX3 A;  4QB1 A;  4CUB A;  3WF2 A;  3IDA A;  2VZP A;  3THD A;  1JZ8 A;  4JKL A;  1JU3 A;  3VD5 A;  2ZEW A;  3NQH A;  4A42 A;  2VJX A;  1SDD B;  4QPW A;  1UWW A;  1P8J A;  2VZS A;  3OGS A;  4KMQ A;  2W95 A;  3OEA A;  5F7U A;  5EJ1 B;  4QX0 A;  3NJX A;  4UI9 L;  1W9T A;  3FN9 A;  5LCW L;  4E8D A;  4QB2 A;  1DYO A;  4XUT A;  3UES A;  4MGS A;  1OD3 A;  2WN2 A;  3HJR A;  1JZ2 A;  3IAP A;  2J1E A;  2VME A;  2W9X A;  1UY0 A;  2PQS A;  3PUI A;  2VZ3 A;  3UNP A;  3LQC A;  3K4A A;  1UMI A;  2JD9 A;  1OF3 A;  3K46 A;  2QQN A;  4JKM A;  4JHZ A;  2EIC A;  3I97 A;  4FI9 A;  4PQQ A;  4CUC A;  3A22 A;  4GWJ A;  4MO3 M;  4BJ0 A;  1LNS A;  3PUH A;  2KD7 A;  3NNG A;  1F4A A;  2J22 A;  2ZEY A;  1UY4 A;  2HLE A;  5A1A A;  2Y64 A;  2VR4 A;  1UXZ A;  3CKH A;  3WNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...