1GQPA

Apc10/doc1 subunit of s. cerevisiae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
194
structure length
180
Chain Sequence
SVLVLDDRIVDAATKDLYVNGFQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications for the Ubiquitination Reaction of the Anaphase-Promoting Complex from the Crystal Structure of the Doc1/Apc10 Subunit.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOC1/APC10
total genus 48
structure length 180
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1gqpA00
3FHQA 3K4AA 1K42A 1XNTA 3A7QA 2Y64A 3ACHA 3FL7A 3HEIA 1CX1A 3MO4A 1UY1A 3P6BA 3I97A 2ZXQA 3WNKA 3HNBM 5LCWL 2V5DA 1XPWA 2WO1A 1UY0A 4ZY9A 1UYYA 4CUCA 3MUZ1 3J7HA 5JXIA 3LEGA 3T2OA 4XUNA 5LA0A 4DXSA 1O8PA 3HNYM 4DEQA 2E32A 1F4HA 3LPFA 3DECA 4RYDA 2Y6HA 3E1F1 4MGSA 3WNMA 3HN3A 3OB8A 5I0DA 3VD3A 2VZ3A 4Z2AA 4QDSA 4CU8A 4JKKA 3LEIA 5IFTA 3ACGA 2W1UA 4PT6A 4A44A 4CU7A 3HOBA 1W9SA 3MV11 2ZEXA 1RYYA 4A6OA 2W91A 1KEXA 3WNOA 4CU9A 4DUVA 4MO3M 2WYSA 1GOGA 2EIEA 2QQMA 2VZUA 2OKXA 1JZ2A 2RV9A 1CIYA 3A23A 2C9KA 3CQOA 3D3AA 3IIIA 4A4AA 2RJ2A 4ZXEA 2C4XA 3VD4A 1W9WA 4P02B 2X09A 2DCKA 1W0NA 3WF4A 3C7OA 1UMHA 3LEKA 3EB7A 4GWIA 2QBXA 1KGYA 4LQRA 4DUWA 1JZ4A 4QX3A 2JE8A 2CDPA 4OMCA 4JKLA 3T0DA 1H6XA 4D0QA 2EICA 4OYUA 2J1EA 4DXRA 1MPXA 1EUTA 3LQCA 5C7GA 1W99A 4XZUG 5DMYA 3CMGA 1JYWA 4QX0A 1DYOA 1PX3A 3DYMA 3GM8A 3UESA 2BBAA 3F2ZA 2X05A 5DPNA 3W5NA 5G05L 4E8DA 4UOJA 2VCCA 2BGOA 3I2HA 1GOHA 1UMIA 5EIYB 2VC9A 3T08A 3VD5A 3VDAA 1J84A 2VOTA 4XUQA 5JXHA 2JD9A 2XOMA 2WO2A 3I3DA 5HXMA 2VM9A 1UY3A 2JDAA 3ZM8A 3GDBA 1UXXX 1H6YA 2VTFA 3A21A 3WNPA 5IJRA 2LS6A 1OT5A 2CDOA 3PUHA 2VMDA 3LPGA 3WNNA 1US2A 4OMDA 1DP0A 2QQIA 4QB6A 3ACIA 2J1RA 3WF2A 5G04L 2J1AA 3SEPA 1JZ5A 3VD9A 3WF1A 4LKSA 1K3IA 2VMFA 4BJ0A 2WQ8A 1CZTA 4M4RA 3I2IA 5IHRA 1L7RA 1R64A 2YC2A 3ACFA 2VZTA 2Y6KA 3IB3A 5F7UA 3BGAA 1YQ2A 4LPLA 1DLCA 5LA1A 4UAPA 1CZVA 1W8OA 1D7PM 1I5PA 2VJXA 4GWJA 5JUVA 1P8JA 3NRUA 2W47A 2QQKA 4OZOA 1PMJX 3WF3A 4QPWA 4A42A 3K46A 2VR4A 1PX4A 2VO5A 3NJXA 1JU4A 3I2GA 1SG3A 2VCAA 4TTGA 3K4ZA 2W1QA 5IYYA 1T2XA 5IFPA 1K12A 3OGRA 1UY4A 2W95A 3VDBA 5C70A 4BDVB 1NAEA 1GNYA 3ETPA 3OEBA 4QB2A 3GGLA 4OUEA 3IDAA 1IQDC 4PF1A 1OD3A 5CZKA 1GQPA 2W1SA 4A3ZA 5CYYA 4CUAA 5JXGA 2ID4A 1PMHX 3AC0A 4AG4A 1UYZA 3FHAA 1UYXA 1ULPA 2ORZA 2WZEA 4UI9L 4MOAA 3MV01 1HN1A 4XURA 2DCJA 2VMCA 5DN2A 2QQLA 3OG2A 4GZ9A 4P5YA 2QQOA 3I2JA 2Y8KA 5LA2A 2BGPA 1O8SA 3UNPA 2PQSA 4KMQA 1K45A 4E8CA 3NNGA 4BK5A 2HYXA 1TG7A 4DXTA 1GUIA 3WF0A 1F4AA 2VZVA 2EIDA 4QB1A 2YFUA 3I3EA 4MGQA 2V4VA 5C71A 1WCQA 3BN6A 1XNAA 4ARYA 1O59A 4DEVA 1JI6A 2JKXA 3ECQA 2W5FA 1JHJA 3ABZA 4ET7A 3WQBA 4QDRA 4IUGA 3C8XA 3K4DA 1XC6A 4JX0A 4DUXA 2J7MA 2YFZA 2E31A 3CKHA 3UETA 3MBWA 4CU6A 2VZ1A 2YG0A 1JYNA 4LHSA 4RN5A 4KWUA 2WZ8A 2QQNA 3NJVA 1ULOA 2VZRA 2B9VA 2V72A 2VQTA 1W9TA 1NUKA 1US3A 4ZZ8A 2QQJA 4TXWA 2RVAA 2XONA 5FUIA 2VZOA 2ZEWA 3I3BA 2YC4A 5EJZB 3HNMA 3NQHA 3VD7A 3HPNA 4XUTA 3EYPA 4ZZ5A 2B4KA 5DQ0A 2J1TA 3IAQA 2R7EB 1OF3A 1L7QA 2J22A 4W4ZA 3WSOA 2WBKA 3VDCA 1OF4A 3I2FA 3W5MA 2Y6LA 1TVGA 3C7EA 1JYVA 2W92A 4A45A 2VQUA 1CZSA 1JZ6A 4W50A 3K77A 3WEZA 2E33A 5JR2A 1UX7A 4YPJA 1W8NA 1JZ7A 3SKVA 2BZDA 1OH4A 2HLEA 1UY2A 2C26A 2XHNA 3DYOA 2W46A 3K75B 1NKGA 1GMMA 2W87A 2VL4A 1JU3A 4QX1A 1UZ0A 3SEEA 4ARXA 2LW8A 3JXSA 4AAXA 5J1XA 5EJ1B 3T0BA 2J1VA 4PQQA 5B4NA 4BXSV 3IAPA 2W9XA 3P1IA 2VMEA 4MADA 2W3JA 3OEAA 4P08A 4P00B 5A1AA 4D8MA 4W8JA 4A41A 1NX9A 3PUIA 2BERA 3T2QA 3OBAA 4XUPA 3MUY1 3A22A 4CVUA 2WO3A 1GOFA 5JMOA 2VZPA 2VZSA 1WKYA 4QDQA 3THCA 2WN3A 3THDA 3T2PA 1UWWA 4L0PA 3C7FA 1JZ8A 1SDDB 3CIHA 2ORXA 2W1WA 4XUOA 1J83A 5B4XA 4JKMA 1JYXA 1JZ3A 2W94A 2XQXA 1SHWB 2L9LA 4QAWA 4HG6B 2EIBA 2ZEYA 4M4PA 2X10A 2J1UA 2WAOA 4BK4A 2DDUA 2E26A 3OGVA 4XVHA 2Y6GA 2WUHA 4QX2A 3LE0A 3WNLA 2Y6JA 2WAAA 4KI5M 3OGSA 2YB7A 1EUUA 2KD7A 2WABA 1LNSA 3HJRA 3C7GA 2J1SA 3T0AA 2VCBA 5HPOA 1GU3A 3T09A 3DYPA 2ZEZA 3CZJA 3GXUA 3CDZB 2WDBA 4JHZA 1UXZA 3I2KA 5JXJA 2VZQA 3FN9A 2WN2A 3C7HA 2Z4FA 3CZUA 4FI9A 3U37A 1BHGA 3SKJE 4CUBA
chains in the Genus database with same CATH superfamily
1GBGA 5SV5A 4D6SA 3RZHA 3D8CA 2VD7A 3RPQA 4OULA 1OA4A 4GMP3 3V0BB 1WMFA 2QJVA 3KF3A 3OY8A 2WNVC 3POEA 3CF6E 4LO8A 1SZBA 4Q5OA 1X33A 5EYXA 3AM2A 1FXZA 1DZTA 4LJHA 1C8M3 3PLQA 2Y38A 3HQUA 1IHMA 2KA3A 3WNKA 1HB4A 1LCLA 4CP9A 2BJSA 3HNBM 5GJ6A 4NIGA 5JZGA 1SLLA 1ULDA 5L9BA 4LE3A 2PHLA 5FJKA 4ZY9A 1SPPA 1ZZ6A 1UYYA 3ZVXA 5IVFA 3MUZ1 4EQVA 1XYOA 4OI4A 4E9KA 1OMIA 2E63A 3PVNA 3POJA 1FOD2 2IZWA 4XJ8A 2GDFA 3LEGA 4PDWC 5A3NA 4YW5A 1YFWA 3M8LA 2CAVA 5A3WA 2A6XA 2RE9A 3V64A 4XUNA 3WZ1A 2ZX2A 5LA0A 2C0ZA 3RI9A 3NV3A 4JGZC 3KCCA 3D82A 3LOIA 3SITA 4NE9A 1CGPA 4LBNA 1WW5A 4XIKA 3NKTA 4RYDA 1AYN1 3E1F1 5C9AA 5DUUA 1GP5A 3WNMA 5A6ZA 1I6XA 3HN3A 5BPXA 3W21A 3WVJA 1C8NA 1LB2A 5AVPA 3KMHA 3N7JA 3VKMA 2DUOA 5I0DA 3VD3A 5KBFA 4A2UA 3ILNA 3ITQA 4QDSA 3KT1A 1UZWA 2YHJA 4LITA 4BQ4A 5C3QA 1DQ6A 4K20A 3AFKA 2DTWA 4RD7A 4D7SA 4PT6A 3RDIA 1BBT1 4Y5Z0 2WA3A 1V00A 1GLHA 3LA7A 1RUG2 4LKDA 4UT5A 1RYYA 1PO12 1YO8A 1ZVFA 1X8MA 1YQ8A 2MEV3 4Y20B 1ZZBA 4AF9A 4COUA 4NIAA 1W28A 4WVWA 2DUPA 4MO3M 4LOTA 4IEXA 4FFFA 4EZHA 2WNVB 3HIFA 2OUJA 5HV0A 1TMF2 3A23A 3LA3A 3H8RA 1DYPA 2RR13 3D3AA 4N8MA 1ULGA 4IV3C 4ZXKA 3KVBA 3WV6A 4R4ZA 3H7YA 2RJ2A 3LAGA 4XF0A 1YNAA 3OGJA 5CIRA 4I01A 1AX2A 1V6MA 1RGSA 4I0AA 4L11A 1W0NA 3CLPA 3C7OA 3NVCA 5T54A 4R9CA 2VG9A 3ZFGA 3USSA 1OLME 1KFUL 2MHFA 4CPBA 2HH9A 4GWIA 1AHSA 2QBXA 2DVAA 5EYYA 4LQRA 1YEWA 3ELNA 4DUWA 5ABJB 2BOJA 5A7NA 1OUSA 1R081 1DU3D 3O0WA 3X29B 4JKLA 2FCVA 2I2SA 2VOXA 1RIRA 2CTVA 4QU2A 5F6KA 2VXJA 3MIGA 1N3PA 1S0BA 2VULA 4FP2A 2DVDA 4OYUA 2J1EA 3W20A 5C7GA 2Q1FA 3KS7A 3CMGA 2Q8CA 4QX0A 1JYWA 2EXIA 3ZYFA 5HCFA 3ZSLA 4YGDA 2ZMLA 1QNWA 5LRRA 1QJX3 3N9NA 1PX3A 3V0AB 3O1RA 5I0SA 2ZS6B 4XAAA 5I8SA 1UX6A 1GOHA 3BI3A 2ZGRA 1BVVA 5KHJA 1H8TA 2PAKA 2RS33 3T08A 3VD5A 4B4PA 4DS0A 5ACA2 3RZGA 1GICA 2BDRA 2VOTA 2QQVA 1ND3A 2DBIA 2X29A 3KV6A 4IETA 2BGCA 4XUQA 4Y1UA 5BNNB 5JXHA 1QQP1 3RJ2X 2Y33A 1NLQA 1G86A 1QY4A 1W6PA 3NNMA 3WD5A 2XJQA 3IN9A 2D6MA 1S2KA 2WZR1 1JYTA 1D4M2 2VM9A 1AXYA 1UY3A 4Q1PA 4QPYA 3ZM8A 3KHCA 3VDDB 4JTNA 5IJRA 5FZGA 1HXS1 1OT5A 4FXKB 4G4FA 3J7LA 5LK5A 1VR3A 1AR81 2DVGA 3LPGA 2W39A 1N3OA 1S0JA 2VVEA 4OMDA 4OFGA 3FWEA 2HWB2 1W6OA 4YFZA 4CEWC 4QB6A 3ACIA 4BQWA 4IEWA 3VKLA 1VAMA 1JZ5A 3WF1A 3B69A 4C90A 2NPIA 2VMFA 1GQHA 2HWE2 4Z2WA 5IVVA 5L9VA 5FK8A 5T5LA 2ENRA 4AVSA 4M3CB 1L7RA 2VNVA 4Q4V3 1V6OA 2ET7A 2PHRA 2WWUA 2YC2A 2Y6KA 1CAVA 1H30A 3RYKA 1QWRA 4OQ9A 4WVVA 3ZN5A 2ILMA 4UAPA 4JHTA 1NCQA 5DUVA 1W8OA 4ES9A 2JG8A 2WYFA 1S2EA 4GWJA 1VE0A 3B02A 5JUVA 1I1EA 4FOYA 4LLFA 1VMFA 3NAPC 3NRUA 2W47A 3BIEA 1EPZA 1IOAA 1RUJ1 2TEPA 3IDCB 3WF3A 1E5RA 1OQEA 1NY72 4QPWA 1ZX5A 2DVFA 4E4SA 3EJKA 1SLIA 1S0DA 3K46A 4B7EA 1ZBE1 3NJXA 4PIXA 1ULFA 5FPLA 3S5AA 1WD4A 4EN9B 1XE7A 4XFGA 4YNIA 1CAWB 3K4ZA 1UQXA 4WM8C 1MS5A 3A0NA 1LGNA 1POV1 5H9PA 3VBUB 2W1QA 4CCLA 5IYYA 1K12A 3OGRA 2W95A 4FOQA 2FDKA 1S0EA 3OGGA 5LEKA 1NE6A 3ZPOA 2ERFA 3EBRA 5T52A 3K3NA 5K9YA 3BOPA 4QQHA 4OUEA 4MGYE 1OA3A 1W06A 1FATA 5FCCA 3DXUA 1ZZ7A 3KCYA 4A3ZA 3PMSA 3WXPA 2HJIA 1JYCA 2JEMA 2O8OA 2UURA 2GH8A 3WP5A 1MZEA 1ULPA 3NJYA 5A32A 3S5QA 2E6VA 4AK3A 2ARCA 3ST7A 1YJKA 3I3MA 1XRUA 2QFEA 2PHDA 2YPJA 4MOAA 1B35B 1B09A 3ZXLA 4YM0A 5A3PA 4H55A 3BKZA 4KH9A 2A1XA 4P5YA 2QQOA 2VU9A 1LOGA 1DQ1A 3I2JA 1WCDJ 3KT4A 5D2AA 4KGGA 2BWAA 4QU1A 3UNPA 1CPMA 1EV13 2XWBB 3KT7A 3MDPA 3NKGA 4YGCA 5F2SA 4CEWB 2WFPA 1DGRA 4AL9A 1VBA1 1UW8A 1HW5A 1W04A 3NNGA 1RVF1 1H0BA 4Y5TA 4K8FA 4ES8A 5FBZA 1YCIA 5FR3A 2V73A 4XFCA 4HVRA 4IDZA 4ZHNA 5FYIA 2VZVA 3LDBA 3USUB 2NM1A 5FIXA 4OI2A 2H0BA 4HN0A 1U12A 2A71A 3ENRA 1MQTA 5FJHA 5FWEA 4FPKA 5C71A 4H2AA 1WCQA 1HB1A 2ZGSA 3OD0A 1RUG1 2ZGMA 2LTNA 3A4UA 2ZA9A 4GJYA 4BWOA 3RSJA 1OLRA 3KD4A 2W5FA 2Q1MA 5BNPA 2W52A 3DKQA 1EP0A 3EXUA 4XE9A 5GLVA 1BK0A 1CAWA 1RUI2 4AHZA 4GWNA 5KXCA 3K4DA 2WNEA 3INAA 4S2DA 3AP7A 4ZPIA 1XC6A 3ZYJB 4AFCA 1COV2 1SLCA 1ZA4A 1WMXA 2YFZA 2ZMKA 4O9EA 5HXVA 4G3YC 3VBRC 1WUVA 2LRPA 3OBZA 4YG0A 3M3IA 4N43A 2YG0A 4TLFA 5H9RA 5FPUA 4COZA 4LHSA 3OJBA 1CX4A 1IG0A 1JN2P 2DURA 2QQNA 3IMMA 3N7LA 3NJVA 2IC1A 5F6LB 1ULOA 5DG2A 5F32A 2JG8B 1LEDA 3NAPA 2HKXA 4HVQA 1PZ7A 2Y6FA 4DY3A 1D4M3 4BXFA 5JSPA 4FPYA 1US3A 2ZX0A 4ZZ8A 5FZBA 4Z07A 3VBSB 2R063 2BVVA 1UIJA 2H6CA 3FLTA 4QD2A 1RJ8A 5DDJ3 3FLPA 1NCRC 1OVPA 2NZ9A 1RITA 1X9TA 2B4KA 3EYPA 1UPIA 4XXPA 5DQ0A 1VBB3 1YIPA 3WHUA 3GYDA 4XC9A 4YG6A 3IT8A 4CUGA 1GZTA 5KR7A 2ZX1A 2R7EB 2J22A 1HQNA 4XFHA 5FYTA 1Z0HA 4M3CF 3WSOA 4UYBA 5FYHA 3DF0A 4KBZA 4S2FA 1QXRA 5FK7A 1BQPA 5CISA 2XLGA 1FV2A 3CJIC 5FDBA 2SBAA 4M00A 3ZIWA 2HEVF 1CQ9A 3LKJA 5EPAA 5JOZA 1JYVA 3PUAA 4A45A 3B9IA 4DB5A 2VQUA 3LWCA 4HKOA 2JD4A 5APAA 5A3LA 1D2SA 1DF0A 5EV7A 3W58A 3O5SA 5CFDA 2AENA 2D3RA 3DKWA 1NYWA 2PLV1 2Q0AA 1W8NA 4QPGC 1WMDA 3AMHA 1PO22 3VHRA 2LROA 1H2KA 1Q8QA 1OH4A 2ARAA 2HLEA 4WBBA 1RMU3 2ZGUA 2C26A 2YU2A 4HZFA 3LD8A 1QKQA 3AJYA 4HL0A 4R8HA 4CZSA 2W87A 4QX7A 2CGOA 1H8TC 3SEEA 3VHPA 1NCRA 2LW8A 3JXSA 5EJ1B 4COYA 1FMD3 5CFDC 1K5JA 2GAUA 4UFIA 5FXVA 1GKBA 1AYM1 2HWC1 4QPIB 2HWB1 4WM7C 4BXSV 2QTWB 1PGL1 3BYWA 3ZSJA 3AB0A 4EWEA 1OKQA 1NG0A 1Y9QA 4P08A 2BPA2 3CJIA 4JGZB 1M4WA 4NVPA 4NMIA 4W8JA 5A1AA 1NX9A 1H2MA 3PUIA 4LKEA 5KXDA 1QJX1 3ILRA 4LIUA 4P9JA 2CU5A 4I3GA 3WG4A 1GR3A 1WA6X 2QUOA 1DQ5A 2XMLA 1IZ3A 4QQOA 4UBHA 1TNRA 2NLRA 2ZX3A 4CDQB 2XJTA 4CVUA 3AK0A 2C9AA 4W65A 5K0UC 4KU7A 1UN1A 4KQ7A 1JOPA 4XQ4A 4UFJA 1LJ7A 1HRV3 1VAVA 5DXDA 3THCA 1UYPA 4ITCA 1BKZA 1U0AA 2TUNA 5FOJB 1OURA 4JQTA 2KR2A 3H8XA 2GMPA 2SLIA 5FY5A 3THDA 5KXBA 2CYFA 1UWWA 3HQXA 3AYAA 3BPSA 5JI7A 1LULA 5C33A 3AYEA 4WZCA 4M0HA 3BTZA 2PA7A 4LBJA 2ORXA 4UW6A 3SXWA 2W1WA 3N4MA 1QEXA 1LR5A 3CJIB 5IVEA 4XUOA 5B4XA 1SBDA 1JYXA 1NOVA 5FZOB 1JZ3A 1VB2A 1HRI3 2W94A 3H8UA 2PHFA 4GJZA 2K9ZA 3QLQA 5I8YA 3ETQA 1AX1A 3LDKA 3MPPG 2PQQA 4HG6B 4XBLA 2YXSA 4FO9A 4B1LA 2A70A 4M4PA 2P3JA 1ND2B 2CSGA 2EA7A 2WWJA 3JB8A 3RQ0A 1K5MA 4F7ZA 2FD8A 3B94A 1BCXA 1JBCA 2B7YA 2QE3A 1WMEA 2VMIA 4NHYA 2HWC3 3WUCA 4P9LA 2Y6GA 4RHV1 5BXXA 2OW4A 1W2NA 1J1TA 3ZXFA 5EJ3A 2MEV1 3WNLA 1RB8G 3P3PA 4TSVA 4BQXA 2RS53 2Y6JA 4GKYA 3OGSA 4UF0B 1AJKA 1B35C 4AVAA 3AVSA 1EUUA 5FO9B 1ASJ1 3R6SA 1HDKA 3VBHB 1F35A 2GMMA 2Z42A 2D97A 2VBBA 5HPOA 1HXS2 4XCBA 3VKOA 3KV4A 1JYIA 1CWPA 2Y34A 2KXLA 3OPZA 1WA4A 2XJPA 3OUIA 1A8MA 2ZEZA 2XVLA 2FBEA 1JH5A 4IGOA 4MXWA 4O9GA 4UW5A 4Y22A 3WDUA 1LU2A 5C8WA 3ZO0B 1G9BA 1O4ZA 3VHNA 1SPPB 1V70A 4BE3A 4N7IA 1O4YA 1Q43A 3WT3A 5JXJA 3AL5A 2D93A 2HWE1 1MEC1 2Z4FA 4N9HA 1BMV2 2PMWB 3VUOA 4A3XA 5KHHA 1VBD2 4F3JA 2HWD1 3VLBB 3RWKX 5K0UB 2UY8A 1AR62 3LEMA 1TME3 4P9XA 2ZGKA 1YFYA 4CUBA 3UL2A 4K1ZA 3JU9A 3VBFA 1O5LA 1OLQA 2ETEA 1VBB2 3K4AA 2PAMA 1RUD2 1S0IA 3TRSB 2P1BA 2QQWA 1QJU3 4OHVA 2DFCA 3A7QA 3E5UA 1U5IA 2Y64A 3MFAA 3WR0A 3FL7A 5A33A 4AAPA 3MO4A 4YZ4A 2GP5A 1COV1 1IPKA 1QJEA 3H3UA 4I3PA 2ZKNA 2VECA 5CA6A 5LCWL 2QQPA 4AR2A 1XU2A 3JUUA 3ZN6A 3DV8A 2B45X 2AUYA 2P34A 4IV3A 4LUMA 4N53C 5ANNA 1GWMA 4Y22B 4BPZA 5FY1A 2WNUB 1OBNA 4K9SA 1WW7A 4Y3OA 3E6DA 1SLTA 2JB8A 2XBO2 4DPNA 1EAH2 5T3NA 2XR4A 4NRQA 3USUA 4NUBA 4YVWA 5A6QA 3WQ0A 5CKQA 4QGLA 2E32A 3LSEA 4ZKTB 2G9GA 2XVGA 2ZKLA 3AP6A 5M0TA 2Y6HA 5IUQA 3T2TA 3Q8FA 5FLHA 3H1WA 5F5CA 2BRTA 1BLZA 5IVJA 1JTZX 4Z2AA 3MW4A 1W6PB 3ZMOA 1X8EA 1LOAA 1PM7A 1R093 1W2OA 5EHDA 3WQ7A 5BNNA 1GZWB 2W1UA 1QU0A 1XYNA 5JR7B 4CU7A 1LOFA 1LHUA 3NNFA 4XF9A 3MV11 3WCSA 5JDBA 5LK7B 4KU8A 4C1XA 4CE8A 4HFSA 3WNOA 4Z1VA 1REEA 1OQ1A 4ZONA 1NQJA 3VN4A 5BYNA 1WW4A 4COWA 3TAYA 2DVBA 1AL22 2WYSA 4FFGA 4FVVA 1X9PA 1N3QA 2PLV2 4FPFA 2VZUA 4XILA 5FZIA 2OKXA 4AOCA 1NT0A 4TYSA 3GBFA 3TB0A 2C9KA 5I0UA 3IIIA 4A4AA 3RMXA 5JPMB 4GA9A 4Q27A 1W2UA 5FZ3A 4AEDA 2WSVA 1W3XA 4ZXEA 2WFF2 3KVAA 3M70A 3VD4A 2IXKA 2GC2A 3H3ZA 1IPJA 4IV3B 2JE9A 4AQSA 3VGIA 4LK6A 1D2QA 1CAUB 2BQPA 1RUC3 4LO6B 4L8QA 3WF4A 3VZLA 5BV6A 1OD5A 4IW3A 2G9ZA 4PDWA 3LEKA 3RYRA 3EB7A 5GM0A 5FP8A 2OPWA 2VE1A 3J9SA 5A3OA 5DZEA 2Y26A 4L92A 1VBE2 1AYN2 1XQNA 2P37A 4PIZA 5K8SA 1ND2A 1RUOA 1G9DA 4HETA 4MVTA 4YGEA 4QKNA 1RUF3 3PURA 2ZAHA 2GALA 1H6XA 2GU9A 4AHWA 4NIIA 4D0QA 2EICA 1PGSA 4AI0A 5HI0A 4PI2A 2GN7A 4RFRB 2V09A 1W0PA 4N90A 4NIHA 4Q4W2 3MGUA 4HKLA 3WP6A 3Q8CA 2QQUA 1DYOA 1PGW2 5FMOL 2RS52 4OUSA 2DWRA 1HIXA 5BNNC 2GNBA 3W5NA 4BZ4A 1QXJA 2G1MA 2Y60A 3H8OA 4YW3A 2VCCA 5FZLA 4CXXA 2BGOA 1UZVA 3LF7A 5C6CA 5EIYB 5GZGA 2EF6A 2UU8A 1WW6A 4PI0A 3VDAA 3GF6A 5KHGA 3BOWA 3RZLA 2DUQA 1W3VA 4UW3A 1CR7A 2VBPA 3MIBA 2JD9A 1LESA 2ZGQA 2ZHMA 1MS9A 4GALA 5CKMA 2WO2A 4C91A 4EROA 3VV1A 2IWGB 2AGSA 4MH0E 4NHXA 3JD72 3R05A 2BNMA 2JDAA 1QXPA 3GDBA 4K1YA 5FMCA 1H6YA 1XOYA 1QDOA 1RMU1 1OOPA 3WY6A 5FMOS 1RXFA 4UF0A 2IUWA 2ZHLA 2Q8OA 1DP0A 3GZAA 1OKOA 1YI7A 4NPLA 2K2SA 2J1RA 3WF2A 1ENRA 2J1AA 2MPFA 2IXHA 1RUG3 2WT2A 1K3IA 1PO13 3PTYA 4BJ0A 4JCKA 5IATA 1CZTA 1J3QA 2ZHNA 3OPWA 1PHMA 3I2IA 2E53A 5FZ0A 4S2HA 4KWJA 4QXCA 4AQTA 1K5MB 3ZSEA 1GANA 3ACFA 5JSRA 3D5OA 4RQPA 1KITA 1GZ9A 2VZTA 4P9YA 4X8PA 4OLLA 5FYCA 3UKTA 1YQ2A 4LPLA 1E5SA 1UOGA 2FCTA 2P6CA 1W6NA 3MF9A 3WDWA 4BQ1A 5LA1A 3ON7A 1QIQA 1CZVA 3OY8B 1UNBA 1POQA 1CJPA 2WQZC 3LGRA 5FXWA 5C8CA 1FX5A 1AYM2 3MF6A 1OHFA 1QJY2 3RI8A 2AEYA 2A7AA 4GB31 3ZOIA 2BEOA 4LNVA 4A42A 3T1MA 1UU6A 3VZJA 1VP6A 1MVQA 4LO7A 4GB33 3KM5A 5HBAA 5J96B 2VO5A 4OVEA 3VL9A 4H3WA 1CJDA 4NR1A 4X6RB 1MR5A 1Q8PA 2HWD2 3DPRC 4R9DA 1YUDA 2JKBA 3PVOA 4MHRA 1KJLA 3VZNA 1CD3G 2EAAA 2FMDA 2UYBA 1W9FA 3EQEA 5C3SA 5JIAA 2VQ0A 3VDBA 2VW2A 3LSDA 2R062 2NQYA 1O3RA 5FOBB 3APBA 2GNMA 1GNYA 1AR82 4KG0A 3Q8AA 1W8UA 5J7MA 1LTEA 1MQTC 3AZXA 4FFIA 1U5ZA 1DQ0A 4DIQA 3IPVB 4CDWC 1YC61 4P9GA 5E1RA 3D0JA 5CZKA 4RGAA 1NXD1 2W1SA 2BYVE 3FC0A 2ID4A 1NA1A 1PMHX 3D6EA 2W68A 1UYZA 3RVHA 4LA3A 2CL2A 1WLDA 1YHFA 1PIV3 5JOWA 3WCRA 4C1WA 1WD3A 3TBDA 3ZXJA 5FYYA 1IPSA 3TN92 1LU1A 3I54A 1SLAA 1HN0A 4HXCA 4CDXC 3BCWA 2CGPA 1HN1A 2VMCA 1SFYA 1RUD3 3K3OA 4LMFA 4Y33A 5I0RA 4GMP1 5CG9A 2WS93 4QQPA 1QGLA 3PDQA 4FPHA 2BGPA 3ACLA 3WHTA 4XTMA 5EWSA 2ZTNA 4DRRA 1DCSA 1FPN3 4GULA 1W9YA 3CL1A 1RVF3 1A8DA 5CFDB 1GNHA 3ZIXA 4IE5A 1VBA3 3RJRA 1H9PA 1FPN1 1TG7A 5C3PA 1GUIA 3BUCA 5LY1A 3WF0A 1DLLA 2YC0A 2CHHA 1AR71 4GH4B 4RHV3 1UKGA 4Y5SA 4XF1A 2QZ3A 3RS6A 4OHXA 5HCAA 3MYXA 5CBLA 5JVVA 1SQ4A 5IT6A 3WUDA 4DEVA 1O59A 5FV3A 4W6WA 5FZHA 4D94A 1JI6A 4Q4X3 5FXXA 3FZ3A 1FNZA 2OVUA 4XZPA 2XUMA 4ET7A 4W6XA 3WQBA 5ABJC 5JZGB 3C8XA 1PK6B 4QGNA 4NHKA 3TEYA 1ZBA3 1B35A 1W90A 1ZBE2 3A0KA 5EZWA 4AVTA 3POBA 2J7MA 4UBGA 4DUXA 4FTBA 1Q8SA 2E31A 3UETA 3MBWA 3HR9A 2E7QA 2VZ1A 3PJYA 1W2TA 2NMOA 1KDKA 3N9MA 4V2WA 1BYHA 4ISQA 2R071 3V0BA 4RN5A 3SCGA 4CCMA 3JD71 4KWUA 5GZFA 1KRIA 3UK9A 1J58A 4COVA 3ZYHA 3OBTA 2FDIA 3WQ1A 4MZUA 2G19A 2VOWA 3BB6A 4LHLA 1OA2A 1O4TA 4YW7A 5LATA 1RUD1 3DXTA 1NUKA 4FPLA 4FTEA 4ZU4A 2B39A 1A3KA 2QQJA 2X5IC 3I2DA 1L7LA 4Q0UA 4TXWA 4J1WA 2GNTA 3PIJA 5FUIA 1APNA 5CEHA 2FQPA 1YXWA 2A6WA 2VZOA 2ZEWA 4JTOA 2YC4A 4YG3A 5EJZB 3TOJA 4CPBD 5L7OA 3HPNA 1XSQA 4XUTA 1BEV2 2A6ZA 2ZGPA 3ZXAC 5JAXA 4RSUA 1MS4A 2GC3A 4XMAA 5FLJA 1R1A2 4HT1T 4KWKA 4UW4A 3IAQA 1QOOA 4UFKA 5IK5A 1OF3A 1L7QA 1MVEA 1PZ8A 1BJQA 3MIHA 4MXWB 4Q4W1 1CPNA 2WBKA 1Q3EA 4JDMA 3NSTA 4RGGA 5F3IA 3VDCA 4A7KA 1WCUA 1PGW1 5A7WA 4M0NA 4N9IA 4XHXA 2XJSA 3I2FA 2Y6LA 4IQPA 1KS5A 3VHOA 2W92A 1XNKA 4I30A 5FREA 1UD1A 1CESA 1CZSA 1M06G 4L2NA 3WEZA 3J8F2 2ZAAA 5KHKA 5HCBA 1GYKA 1UX7A 2RDNA 4YPJA 2ARXA 3ZKUA 3UYJA 4CEYC 3BPZA 4QQLA 3H1MA 1EY2A 5GZEA 1PK6A 1NLRA 3AMPA 4CCJA 1W39A 1HXS3 4NWVA 3KF5A 4GAZA 1X82A 3E6CC 3K75B 2XL9A 1VRH3 2E51A 4LBOA 1HB3A 1PNGA 1OH3A 3NV2A 4BYYA 4BQ3A 4CDXB 1ZYBA 5CNAA 2XKPA 4RGKA 2HYKA 1CN1A 2O8QA 1TME2 4WVMB 4AAXA 5J1XA 4XJ9A 3MW3A 4N7UA 3T0BA 2N7GA 4E27A 4FAGA 3FLRA 1G9AA 3AYCA 3ZFFB 4NIDA 1W6OB 4SLIA 2OYZA 4LK7A 1GQGA 4TN7A 3WW2A 4BH9A 2AREA 2P3KA 4TWTA 4Q4V1 4MADA 1RUJ2 3OEAA 3CHXA 3LA2A 1NY71 4P00B 4JDNA 5T5OA 4BLJA 1V6LA 2FZ1A 2XB6C 1J3RA 3TNPB 4CCNA 4EZ4A 1OSGA 3VDDC 5JWPA 5F1RA 1MZ6A 1AF9A 1T6GC 3PUSA 2VY0A 5A6YA 4GH4C 4LBMA 1A78A 4QKBA 3SNMA 1WWYA 1H4HA 2R042 3VL8A 5LA9A 3VBUA 1NQDA 4JQRA 3H42B 2VZPA 2VZSA 3ZFGB 3M2MA 1LECA 4QDQA 4CRQA 2AACA 2DYCA 2PAEA 2WC2A 2ADEA 2VPVA 4LLOA 1LOFC 5GLZA 3NJZA 2YMZA 3T2PA 3UT0A 3SLIA 5FYSA 2FDGA 1YRZA 3MHZA 4CP0A 3IWZA 5BNOC 2CGNA 2PFWA 4QX5A 1MZFA 3KLSA 4GKXA 3ZFFC 4FAHA 1Q5OA 1SEFA 2IVIB 1WBLA 1HRV1 2RHPA 1DFQA 2MNGA 5A7QA 5A7PA 3RZZA 5FAXA 4NRPA 4WM8B 3VBUC 2XQXA 4DXZA 5CG8A 4QPIA 2L9LA 2FZ2A 2R061 1VLNA 2ZEYA 3IMNA 4QQ2A 1DIWA 4RQPB 5AFEA 2X10A 2RMU3 3ZXEA 2YROA 5KC5A 3N9PA 1O3TA 3AKSA 4OCTA 4QXBA 2E26A 1SACA 2D40A 3OGVA 3U4XA 1W6QB 3OSDA 3HD8B 5FP4A 4C0BA 3ASIA 2WKKA 1FNYA 1GNZA 3FX3A 3KV5A 4XJAA 3C3VA 3DPRA 1RUNA 4YZ5A 4NWWA 3LE0A 1C8M2 1HQWA 1QJX2 1L3JA 4ISRA 4IGQA 3KGZA 2WAAA 1VJ2A 1GP4A 1Y7BA 2B9UA 3IZOA 1BBT3 3M3QA 2YUEA 4JGZA 3VDDA 1UOJA 2C24A 1N1VA 2WABA 3AJZA 5E8AA 2J1SA 2VCBA 1OXCA 2NYYA 2PLV3 1RMU2 1GU3A 1XE8A 4HMZA 1U5YA 1KS4A 3DYPA 1URXA 2EALA 1WGPA 4LTAA 2VTXA 2F4LA 2R6QA 1ND3B 4XHBA 1XSRA 3NW4A 4RHV2 2XLFA 5DAPA 1AR93 1YFXA 1UXZA 4YWAA 4LORA 3GJBA 2VZQA 3FN9A 2FHRA 2XQRA 2R0HA 4CP2A 3IDEA 4LE4A 3VBSA 2QKDA 1AR72 4HBNA 1GWKA 4DMIA 1W8TA 5FO7B 1HLCA 2JJ6A 1NXMA 3OOXA 4OZXA 2GC0A 5ERLA 2OIIA 1HRI2 1GFF2 1BHGA 3SKJE 2JDYA 4CEYA 4Q4W3 3FHQA 4FBFA 2DCZA 4JVAA 4DNYA 1AR92 3WNXA 2RMU1 4BA6A 1H9WA 5FZ1A 1STMA 2JENA 2OQ6A 1K42A 1XNTA 2VVDA 5FRAA 3AKPA 4I2OA 5A7WB 2RDRA 4HVOA 3ACHA 3HEIA 1UL9A 2R0FA 1CX1A 1KDMA 2CAUA 1UY1A 3P6BA 3RGBA 3I97A 2ZXQA 1OI6A 3I2OA 2OXBA 2H0VA 2AH2A 4PDWB 5IK8A 5F5AA 5FYVA 1MEC2 2V5YA 3LOBA 1CAUA 2V5DA 1UY0A 5LRSA 2DU0A 2DTYA 2PXJA 5FPBA 4CUCA 3S7EA 4JGYA 3S0MA 4Q4Y3 2P17A 3JD73 4YVSB 5JXIA 2GC1A 4H14A 1BZWA 3T2OA 3M1HA 4YGBA 4BIFA 5GLWA 2XH6A 1LRHA 3AKTA 5FZAA 2YGLA 3T3YA 4DXSA 1O8PA 4DEQA 1QOTA 2ZZQA 4ZU7A 1ZNPA 4B4RA 1F4HA 4Q2FA 4AE2A 3ES4A 4JV4A 3DECA 5BUVA 4ORFA 4L9BA 2X53S 4I0BA 1QHDA 4AHYA 1V6JA 3OBRA 5K0UA 3S6PA 3HN1A 2VZ3A 4LOSA 4CU8A 3LEIA 4K21A 3RWNA 4XYXA 3PMEA 3U10A 5IAXA 5IFTA 4ONUA 3E6BA 2A75A 4HK9A 4AQ2A 1H1MA 5BNOA 1FMD1 4A44A 3HOBA 5KC6A 2ZEXA 1RHI2 5E6HA 2Q1ZB 1WLWA 3I8TA 4A6OA 3H9AA 4QM9A 1JXNA 1DGRN 1H2NA 1ND3C 3N7MA 2WIIB 3ZDSA 3UJQA 4CU9A 3OD4A 1TZOA 2YYOA 4PBOA 3SQOA 1RUH3 2EIEA 1VB4A 5DDJ1 2QQMA 2VOKA 1JZ2A 1XE0A 2RV9A 3IM0A 4LT5A 1CIYA 1HQLA 3NNJA 1MEC3 3D0SA 3ZFEC 2I07B 3CQOA 3V65A 3VBHA 4Z8BA 5CFCA 4YVWB 1F15A 3FJSA 1FYUA 1VIWB 1Y4WA 4CDUC 1ST8A 1IS6A 1D4M1 2CV6A 5AVAA 3D4KA 1A6CA 2WNUA 4E2QA 4WVMA 3P5BA 1EV12 2FMYA 4RR3C 4B8EA 1W9WA 5E16A 4CEWA 1LEMA 4P02B 2ES3A 1MACA 2VUCA 1DYKA 4MGKE 1EPWA 4QKDA 4AYUA 4D7YA 1UMHA 1ZRCA 3MZHA 4BB3A 4AFAA 2R073 5EFUA 5JOYA 3JB4C 5LB6A 1W8FA 3MFCA 2JIJA 2Z2SB 4IEQA 5LBBA 5DUXA 4I09A 4HN1A 5JMCA 1N1YA 1AZDA 4AFDA 4QXKA 2JE8A 3NWKA 1W05A 5FY9A 4OMCA 5A32B 1QJU2 2D6KA 2KM2A 4LULA 5FY4A 4U2AA 5LZ6A 1RUC1 2RDQA 1VRH2 3JZVA 2JECA 2RS32 1CAXB 3T4VA 4RA0A 1W99A 4V1PA 4XZUG 1NA1B 2R072 3SCFA 4CDQC 2BU9A 2WLQA 5A6XA 1RXGA 4XABA 1R092 5FLIA 3ZLIA 5LWBA 1JODA 3UESA 4D7TA 5BNQA 5T50A 2P3IA 2XL7A 1EAH1 1O6UA 3UKVA 2NMNA 1DGWA 4UOJA 4JGYB 1G9FA 4E4DX 1UMIA 2QDRA 4YM2A 3UGFA 3AP5A 3U75A 1J84A 2H6BA 3AX4A 2OZJA 3RYPA 1VALA 1W2AX 2HWD3 2XOMA 1PVC1 3I3DA 3VBOA 3QBQA 1HV1A 5LEJA 2GMEA 3VBHC 2BFUL 5F3GA 4LBKA 1ZM1A 1UIKA 3QD6A 2C1FA 4IERA 4CDUB 3A21A 3WNPA 4M3CE 3U0ZA 4TZDA 3AL6A 2LS6A 2A73B 2JDPA 1DBNA 2CDOA 4MX3A 1LOCA 1D0HA 4YRDA 1UOFA 3ZFEB 1LHNA 5FWJA 2VMDA 2K46A 2JDNA 2OZ6A 2XLAA 4HPKA 3WNNA 3VBFC 2IFRA 1IS3A 3H50A 5JZGC 2QQIA 5J3UA 5FZ6A 3SEPA 1DZRA 4A6SA 3VD9A 1ASJ3 3MW2A 4LKSA 2CNAA 4XQDA 2EAKA 4BM8A 4B29A 1DZQA 1R082 2WWSA 4FTSA 4JRLA 4M4RA 1LHVA 2WR9A 3POIA 5IHRA 2FDFA 4L99A 2VUDA 2WZR3 5C3RA 1E5HA 4DY5A 1PMIA 1U5XA 3IB3A 1JUHA 4LKFA 2HWB3 5F7UA 1W6MB 5F9TA 2D43A 1QQP3 1NLSA 5DAWA 4YYOA 3KZ4C 5FBJA 3N9QA 1ALYA 5LY2A 1ZBA2 5A3TA 2VJXA 1TE1B 4Y1ZA 4BQ2A 3BU7A 3MIDA 4PLNA 5CADA 4OHYA 4J1XA 2QQKA 4XAEA 1VBA2 2BWCA 4MGZE 1H8VA 3SHRA 2ZGLA 2A3YA 1LAJA 1QQP2 3POSA 5FTTC 3OF1A 2EXHA 1JU4A 1VMJA 4LBQA 4BMBA 4EYUA 1GV9A 4NN0A 2R49A 1SG3A 2VCAA 4NHMA 5E89A 3BTYA 3WG3A 3N3HA 5C9AC 1T2XA 1F9KA 4QT6A 5IFPA 2VGDA 2R041 2O0OA 1D4VB 2WRAA 4CTEA 3AVRA 4XDPA 5FYUA 3J7MA 4BDVB 1F5FA 3CBNA 4QPGB 3OEBA 2BNNA 1RUF1 2Y0OA 1VBE3 4R9BA 1W8HA 4IE0A 2OQ7A 1QJY1 5FZOA 1GQPA 2PN5A 4CUAA 2TNFA 3AMQA 3NAPB 5ANQA 3AC0A 3J26N 4Q4X1 3BALA 1ZA7A 4CCCA 1XNDA 5FPXA 2ZGNA 3DGTA 1UYXA 3IPVA 1FI2A 3B3QE 2I45A 1IKPA 2WZEA 3FBMA 4X6QB 3OTFA 2XXZA 5A7OA 3DPRB 3H3LA 3MV01 3PU8A 4XURA 2DCJA 1ZREA 2RM22 3LFIA 4HKWA 2QQLA 4KBBA 3OG2A 4NROA 5EQUA 1S0FA 2D6PA 2Z79A 4P9WA 5FZEA 3VZOA 4ASMB 5F3CA 1O3QA 4OHZA 4XBNA 4FPGA 3WP4A 2ZGOA 1JHNA 5LA2A 5LBEA 4LBQB 5J37A 1OFNA 3HT2A 4FCAA 4LEJA 2PQSA 4RS5C 1K45A 4QX8A 5FUPA 4IEUA 4E8CA 1ZRRA 2RJKA 3GZTB 4NPRA 4BIOA 3BU0A 1MQTB 1G9CA 1C4RA 2HYXA 3HBZA 4BQYA 4AEMA 1I5ZA 1F4AA 1AJOA 1PVXA 2ADDA 1OVSA 4EE2A 4QB1A 1OOPC 1WCSA 3RMYA 3TNQA 2YFUA 3J4UH 3I3EA 4MGQA 3R4SA 1IKQA 3FE5A 2VW1A 4IE7A 2ARBA 5JI9A 3HVDA 4XBQA 1OLMA 3ORJA 2BNOA 4ARYA 1NCRB 4XF3A 4O61A 4XQWA 4AGGA 3R4DB 4MLOA 1JHJA 4C8DA 4CDXA 3ZYIB 1ODNA 1Q8OA 1LKNA 1SFPA 4NHLA 4QDRA 4XXAA 1ODMA 3VBOC 5CKNA 3PIGA 3I59B 1VPHA 1C5IA 3SH5A 2JB4A 5FUNA 1VBE1 2AC1A 5H9QA 1MS1A 2R32A 3AZVA 4JX0A 5LW9A 4RQPC 2VW0A 3WW3A 3BODA 5I91A 4EWAA 2PYTA 3RNSA 1QOSA 1E5IA 5DABA 1JYNA 1VBC2 4MV2A 4CXWA 5C9AB 4XEZA 2WZ8A 1OPMA 1XNBA 2Q4SA 3C2UA 4OI1A 4EN7B 5L9RA 2VZRA 2B9VA 2V72A 4HONA 2RS12 2YGMA 3NMBA 4LHNA 2WO7A 3AZZA 3ZX7A 2VQTA 1YQ6A 3SH3A 2RMU2 1W9TA 4EN0A 1MS8A 1COV3 1E57A 3ZYGA 2FCUA 1W6MA 1IS5A 1V9U1 4L97A 4RR3A 4CDWB 2RVAA 2WQ4A 2XONA 3H0OA 3OCPA 2RR12 3QH7A 1HJFA 3NQHA 3VD7A 5FZDA 1W03A 2O1QA 5FXZA 2EVXA 1RUE1 3HQRA 5F5QA 4NAMA 3MLLA 4ZZ5A 4PHZA 2VUJA 4I02A 3TN91 3POWA 2WNOA 3DL3A 4FPEA 4IEOA 3EHKA 1V6IA 3ZSKA 1V0AA 4W4ZA 5C8CC 1R1ZA 4MYEA 3ZXDA 2PHUA 2XDVA 3PVEA 2WT0A 4IESA 1OF4A 2D98A 3BTAA 1IG3A 4ASLA 4BCUA 3W5MA 4Y1XA 3C7EA 3WOGA 4D69A 2IXCA 3K51A 3LZZA 1ZBA1 3L2HA 4DZGA 3O1UA 3VKNA 1POV3 4CDUA 4W50A 1S1AA 3AZWA 5KHIA 2ATFA 2E33A 4N43B 3KQRA 5JLVA 4ASKA 4YW4A 1RUI1 4AXOA 1AYN3 5FKCA 3E5XA 4FSJA 1UU4A 1JZ7A 3ZKYA 2BZDA 3O7OA 1BEV1 4META 4KL1A 2F17A 2JDKA 2Q30A 2WT1A 1SDWA 4YZ2A 2GP3A 3DYOA 3ZR6A 4YW2A 2W46A 4XACA 3O1PA 2NP0A 1GMMA 2GN3A 3B5LB 2VL4A 2A3XA 2ZHKA 2ZJCA 1WZXA 1JU3A 3G6JB 3N36A 3DUIA 1UZ0A 2PHXA 2YDEA 2BW8A 1XB9A 4FQ4A 4QX1A 2VNOA 3WDTA 1UF2C 4ARXA 1CONA 1ACCA 1UO9A 3R0RA 2J1VA 3ILFA 1DHKB 4QXHA 4XW3A 1KFXL 1UKRA 5B4NA 3NV4A 4AI9A 3PU3A 3CEWA 1LHOA 2W9XA 2FDHA 2CWMA 5CFCB 5HCHA 1ZZ9A 4AFMA 1XBFA 2XJUA 4IV1B 5DDJ2 4YSFA 1A34A 4UXAA 2YBPA 1HX6A 4Q4X2 3GBWA 4Z92B 3ZR5A 2JG9A 3GBGA 3IDBB 3GALA 2D3SA 5L73A 3UV9A 2BERA 5ISLA 1HB2A 4KGQA 3WW1A 2V4AA 1SMVA 3T2QA 3VZMA 5KXEA 5FZ7A 3MUY1 1H4GA 3B93A 2A5ZA 3NL1A 5F39A 1BK1A 2JDMA 4DRVA 5L7OB 1GOFA 5JMOA 1PZ9A 2CY6A 2RM21 2D6NA 4XF4A 1TME1 2JDHA 4GD4A 1PIV1 2WN3A 2ZCWA 1NZCA 1UAIA 2HWF1 2B42B 2EXKA 2X5IB 3C7FA 4IEYA 1Z7S2 1SDDB 4I0WB 1HV0A 3CIHA 3P3NA 1XYPA 4Y1VA 4BQ5A 4JAAA 1BXHA 4IV1A 1HJGA 4PLMA 3QCWA 4IEZA 4CCKA 3OYWB 2XVKA 1RUC2 1JMUB 1D0GA 1RUE3 2RJLA 4PIYA 5FPVA 2RS31 5FFOC 4ATFA 4CA9A 2ZMNA 4EV0A 4BMEA 3UKNA 4B4QA 5ABJA 5LBCA 1MS3A 3FFQA 2WAOA 1DG6A 2ZPXA 4GWMA 4PLOA 3ZN6B 4BK4A 4XVHA 2PELA 1JW6A 3VBSC 1LGCA 5SV8A 5C4WB 2HBTA 4GMP0 2WUHA 4S2GA 2BTVC 1ZRDA 1JS9A 2D6LX 4QX2A 4EN8B 5K7PA 2WL1A 4NAOA 2I74A 5FYMA 2ZX4A 4UFHA 4WVZA 1GSLA 2EIGA 4Q4Y2 2XWJB 4DOUA 3HBKA 2JWPA 4YW1A 1VBC1 5A80A 5C8CB 1DDLA 2KD7A 5DUWA 1LNSA 2JE7A 3JBG2 4MGTA 1BVP1 3AMMA 3C7GA 5F3EA 1RUH2 2JIGA 3JQWA 3SISA 1FOD1 4A7YA 3GNEA 2WNVA 3E97A 3I7DA 3T09A 3ME2A 1W6NB 1KXGA 1DQ2A 1PO11 4IEPA 1AR83 3N9LA 4LO4B 3GXUA 3J8F3 4QPGA 3CDZB 4CU6A 3ZSMA 4QPIC 3RFRA 1ENSA 4JGYC 1WLCA 2BV4A 4LBLA 4H7MA 5FYZA 3C7HA 5FP7A 3AYDA 4AFBA 1Q8VA 2B8MA 4RR3B 5AC91 3CZUA 3TYJA 4V2VA 4FI9A 3U37A 4QMAA 3TN93 3B00A 1NA1C 4AQ6A 4XJZA 4BOWA 3L9JT 4QHOA 2IXLA 4AGVA 3KCXA 1SFNA 4F83A 4AI2A 3PL0A 4R9AA 1KD7A 2ZABA 4XFIA 4D6QA 1LODA 1VRBA 4INDA 4QHZA 5EXOA 1AUYA 1VBD3 3TEWA 3GZEA 3SCHA 3O1OA 1O7FA 3ZYPA 2WLPA 3LIHA 2VOVA 3GZUC 4HLTA 1QNYA 3URFA 1C8M1 2FDJA 4JRAA 1Q56A 4XTPA 3ATGA 1IS4A 1REFA 1W6QA 2WNUC 4B1MA 4IXLA 2XPJA 2LUWA 3RRDA 1ZRIA 3O0XA 2WO1A 1XPWA 1H8TB 3MIFA 2ZBJA 3CNAA 2XUEA 4Y26A 3J7HA 1BBT2 1PM4A 3MI8A 4W6YA 2A6VA 1CVNA 2RS11 2VAUA 2R1BA 1I9RA 4K7JA 3U1XA 4AEJA 1AR91 4PQ9A 4Q26A 3HNYM 4HOOA 1IQAA 1Y3TA 1AX0A 5C3OA 3LPFA 4D3WA 3J8F1 4KWLA 4Q0VA 5LBFA 3PJQA 5C5TA 2OA2A 2RDSA 4MGSA 2E9QA 4FOWA 5IW0A 1S2BA 4AHXA 1O5UA 4Y20A 2DCYA 3CO2A 4YM3A 4NOTA 3OB8A 1W0OA 1S55A 2JDZA 5D8AC 1QF3A 1VBD1 2XHKA 1G6NA 4JKKA 4XJUA 4ZU5A 4AI1A 2WZR2 3ACGA 4J6GA 5FY0A 2D5HA 4LR4A 1REDA 1UPSA 1H2LA 4CDQA 1SCRA 4CYDA 4Y4RA 1X7NA 4PJYA 1W9SA 3LCPA 1LHWA 5FMDA 3WG2A 5FZ4A 1RJ7A 3EO6A 3LDRA 2W91A 3N7KA 5FQ0A 1KEXA 2VMHA 3M3OA 4DUVA 4OI0A 4D6RA 3E5QA 1GOGA 3PNAA 4Q4V2 1Y9GA 3KB5A 5LASA 3W9AA 4URTA 3Q8EA 5IAVA 3WDXA 3WW4A 3AZYA 3NV1A 2YU1A 3BIWE 2XJVA 2AZ5A 1CAXA 3DN7A 4HSJA 5L7OC 3ZFFA 2NN8A 4QGMA 3M3CA 2AEZA 3HMYA 2C4XA 4M01A 1HRI1 1UCXA 3M4FA 3IKWA 3TEZA 4OUMA 2X5IA 4YM1A 3THTA 4LA2A 3W59A 2X09A 2DCKA 5EP9A 3VBRB 1ULCA 4JDOA 1ENQA 2JXAA 5I0TA 5C4WA 2QZ2A 3PUQA 3I3QA 2ZZJA 4Q0QA 4U36A 5K4LA 4CP9B 3K48A 4ZS2A 5CFCC 2OX0A 2OS2A 3FBYA 4LUKA 4YW6A 1KGYA 2G4IA 1JZ4A 3S7IA 4AI3A 2WFF3 4QX3A 4CCEA 4FT8A 5D1IA 4KG8A 2CDPA 1OPOA 4PCRA 3T0DA 2IFWA 3O1VA 2WA4A 1QH7A 1HRV2 4HK8A 4DXRA 4PBPA 1MPXA 1EUTA 3LQCA 4Q4Y1 4ZS3A 4UFMA 4B3NA 5DMYA 5FPZA 2XJRA 1I3HA 1FMD2 3U11A 3DYMA 4K40A 3GM8A 5FMBA 2BBAA 3F2ZA 1RHI1 2X05A 5DPNA 5G05L 2VXRA 4E8DA 5J36A 1ZBE3 5D8AA 3HWJA 4P5HA 1RHI3 2IXJA 3I2HA 4OHWA 1KJRA 2VCMA 2WSUA 4Q0SA 1J1LA 2VC9A 3JQXA 1AYM3 4LXLA 4XDQA 3O14A 3VZKA 4NPMA 1POV0 2JG8C 4HANA 4R52A 3ZXKA 1ND2C 2AYHA 5HXMA 1O3SA 5IVBA 1VRH1 3FHIB 3IIAA 3QACA 4WM7A 3T1LA 3OPTA 1UXXX 2WFF1 4RFT0 3ZFEA 2JG9B 2VTFA 2DFBA 2BBVA 2OUHA 1R091 1W8ZA 3T4HB 3NO8A 3B7MA 4DFSA 3PUHA 1FT9A 3NNLA 4XMIA 4IV1C 5FYBA 1US2A 2YV8A 4H7LA 1AR63 4LO5B 2Q8EA 3VBOB 4Q1RA 5DG1A 1R1A3 1LGBA 5CVRA 3ES1A 3FUOA 5DAXA 5DZFA 2YBSA 4YVSA 1C5HA 5G04L 3ZN4A 3RZJA 1RUI3 4MUVA 4M3CA 3ALQA 2WQ8A 2BVBA 1GWLA 5FZFA 2XKOA 1ZRFA 2Y0IA 1TQ5A 1T6BX 1VAKA 1R64A 4EN6B 3CU7A 3HAGA 5D8AB 5H9SA 1EV11 4R4XA 3JBG1 4CDWA 1PVC3 3BGAA 5IWFA 1DLCA 1LOEA 1RUH1 3JCIA 4CCOA 5A1FA 5A33B 2QCSB 4LIVA 2RS51 1MZ5A 1FV3A 1D7PM 1I5PA 3FFZA 3TEXA 2RS13 2HWC2 2GH2A 4O65A 1PGL2 3R4UA 4RS5B 2D5FA 1P8JA 2QNKA 5FZKA 3WX5A 4ATEA 4XFBA 2O14A 1GP6A 1PMJX 4OZOA 3UGGA 1SBEA 3VBFB 1RL3A 4J25A 2A6YA 4WM7B 1F31A 5T55A 1FPN2 2DBNA 3AFGA 1PVC2 1QJU1 2YBKA 1RVF2 2VR4A 1PX4A 3I49A 5AC92 3LFMA 4FOVA 4FPCA 4XDOA 3I2GA 5A7SA 5GLTA 3LIGA 4N53B 3O12A 2ZGTA 4TTGA 4AW7A 5D21A 2E7TA 1DQ4A 3SMHA 4Y4YA 1UY4A 3OUJA 1F5JA 1JOBA 2GSYA 5C70A 1NAEA 4F8AA 2C5DA 3ETPA 3MLJA 5E88A 3B9CA 4BU2A 1LOBA 1AXZA 4KNCA 4QB2A 3GGLA 3IDAA 2B46X 4E2GA 1IQDC 2CWSA 4PF1A 1OD3A 4BLIA 4N43C 3DCQA 2UY9A 4FFHA 1UOBA 2UWBA 2P5BA 2DV9A 1Z7S1 4GH4A 4XOGA 5CYYA 5GZDA 4AG4A 4AWDA 5JXGA 2WS92 3N35A 3FHAA 1MS0A 2R043 2VH9A 2ZACA 4Y24A 4Q8LA 2IXIA 4K6BA 2P6HA 2P3YA 2PHWA 4YVSC 3WLUA 2ORZA 3UGHA 4AVVA 1XU1A 1AL0G 1NCQC 1RINA 4K3UA 1AR73 5FQ0B 5BNPC 1V9U3 4UI9L 5C5UA 4FP3A 5DN2A 3GCXA 5JIUA 2P4EA 4QWNA 4GZ9A 4C0HA 5A1LA 4YARA 1XXNA 2Y8KA 4QKFA 2PTMA 2VVFA 1LENA 1O8SA 5CU1A 5J48A 2LALA 4FPOB 3QH6A 4KMQA 4Q29A 3GJAA 1G7YA 4GB32 3SC7X 1VMHA 2JDUA 1TMF1 3MPBA 4BK5A 2WJSA 1N1TA 2J42A 4E2SA 4WM8A 4DXTA 1YIFA 3PHMA 4XIOA 4AVBA 1F8VA 1BEV3 2QDNA 2D6OX 1YLLA 4IGPA 2EIDA 1ASJ2 3WDVA 4O7XA 2GZWA 3POFA 1GZCA 1NCQB 3ZYRA 2V4VA 3POYA 4AZZA 1EYBA 2RG4A 3BN6A 5B2GB 5FY8A 1CAVB 1XNAA 4IE6A 3L2YA 2UWAA 5IVYA 1UU5A 4AGRA 3KHBA 2JKXA 3ECQA 4AEKA 4JC1A 5GZCA 1J59A 1N47A 3ABZA 4YFWA 4IUGA 3BTXA 5IVCA 5JCTA 2D44A 1R083 1PO23 3DEMA 3Q8BA 4MXVA 1Z7S3 4BHPA 2D7FA 3CKHA 1PO21 1V6NA 3AXDA 4FXGB 1YI9A 4B7KA 1Y43B 3MLKA 2BP6A 4SBVA 2DCTA 5DZGA 1OOPB 3M7AA 1ONAA 4URAA 1VBB1 5GALA 4CEYB 4JZRA 2RM23 3H7JA 1NE4A 4Z82A 3V56A 1QDCA 4OQ8A 1JOJA 1RUF2 1PK6C 4E4ZA 3ZMNA 1Y9MA 5I93A 1H1IA 1SCSA 5ACA1 3O1MA 2VBDA 4WZFA 2YY1A 4P14A 5JPNB 1RTVA 1ZZCA 3KQ4B 3I59A 3I3BA 3RZMA 3HNMA 3PVBB 4MG2A 2ET1A 5T5JA 3ZXGA 3MIEA 5F2WA 1O91A 1OFSA 3AP4A 1TMF3 2J1TA 2Z5WA 4CP1A 5HV4A 1NZIA 4XETA 1OUXA 1CIWA 2XG3A 3TWIA 3V0AA 1OQDA 4IE4A 4QHBA 5A3MA 2R16A 4NO4A 3JBG3 1TVGA 2P2KA 2AR6A 4GIQA 5J09A 3ZDVA 2VTXJ 4AEDC 5FO8B 2X8KA 5DAVA 3O0VA 2W2IA 1DGWX 2D3PA 2VQAA 1ZZ8A 3KGLA 3LB9A 4Q8KA 5GLUA 1JZ6A 3K77A 5JR2A 1XNCA 2A3WA 4E4HA 2PHTA 3B01A 4YZ1A 2RR11 1X36A 1TNFA 2MEV2 2E7AA 4MHUA 5FY7A 5GKAC 3SKVA 3ZFGC 1RUE2 3WINE 2YZ4A 4NRMA 3WP3A 1C3HA 1UY2A 2XHNA 1IGOA 2JG9C 3GHMA 3HT1A 2YPDA 1NKGA 2XGXA 5F5IA 5BNPB 2G9FA 3GHNA 2DU1A 2BUKA 1UMZA 1VBC3 3OUHA 3AKRA 1Z78A 2Q8DA 4YVWC 5FPAA 1YWKA 5L19A 4XFFA 1YYNA 2VMGA 4PF5A 2VNGA 5TSWA 1S0GA 4PQQA 4XPVA 1FAYA 5I8TA 4X8NA 5J98B 3G7DA 4DO0A 5IK4A 4GXLA 4HPKB 1AL21 3IAPA 1SBFA 3OYWA 3P1IA 2UWCA 2VMEA 3Q9OA 4YLZA 4DQAA 4EWDA 1J3PA 2W3JA 2Z69A 3K2OA 4K8RB 4CXYA 2ZOEB 1F2NA 3M3EA 5ACA3 4YZ3A 3T30A 4D8MA 4IL7A 1C28A 2WS91 4A41A 1QJZA 2W0XA 5T5PA 1ULEA 1BMV1 2R30A 3PTRB 3U78A 1R1A1 3AXEA 3OBAA 4XFAA 4XUPA 3RG0A 3ROUA 1WBFA 4A7ZA 3BVCA 2DF7A 3A22A 3I4IA 5BY5A 3GCWA 3IBMA 1QJY3 2VUAA 2WO3A 1RC6A 2TBVA 5FP3A 1S0CA 5F37A 2OPKA 1WKYA 4N53A 2WZPP 4GQ7A 5FZMA 5FZ8A 1YFUA 4UFLA 5CB7A 1OC1A 1QH6A 1C57A 1V9U2 5DAQA 3THPA 5AC93 2HWF3 2QVSB 4L0PA 3U07A 4FPJA 5A3UA 1YQ5A 1JZ8A 1QMJA 4AEDB 3F95A 4TLGA 3S57A 1JUIA 4CSWA 3POGA 4RS5A 1J83A 4IEVA 3KSCA 3S30A 4WV8A 3FMGA 4JKMA 1TEIA 4XCAA 2WINB 5FKBA 1QJFA 1SHWB 4RL7A 3U4SA 5IK7A 4LBQD 4P9IA 4QAWA 1AXKA 1AR61 2EIBA 2F4PA 4G9SB 1N1SA 4CCDA 5JSOA 1C1FA 2J1UA 2DDUA 3CJXA 5BNOB 1PIV2 3RZKA 1RUJ3 1DGLA 1WCKA 3QOPA 1GZWA 3FUQA 2W08A 2HEWF 4HSLA 2IVJA 2Q5TA 3VBRA 2HBUA 1AL23 5F8PA 1SLBA 3ZYBA 2BOIA 4QM8A 5JOXA 1H1AA 1HKDA 3WG1A 3AKQA 2F6BA 3J7NA 3WDYA 2K0GA 4KI5M 1V6KA 2YB7A 4LHKA 4MSVA 4UWDA 3VB9A 5FZCA 4AI8A 5KWRA 2VNRA 2LM3A 1XJAA 2HWE3 3HJRA 2EXJA 4Q0PA 3T0AA 2XBO3 3H1YA 2R1DA 3O1TA 1EAH3 2JX9A 3KV9A 3MEPA 3MICA 4MGIE 4DINB 4EJRA 1FOD3 1G8WA 2UYAA 5AFBA 2XBO1 2OT7A 2HWF2 4XJWA 5FZ9A 3O1SA 3CZJA 5L36A 4BISA 2C6SA 2WDBA 1X50A 2HEYF 3SH4A 4JHZA 1C1LA 3ZPYA 1PNFA 5C4WC 1KQRA 1WLTA 3AMNA 5CAZA 1UZZA 2BFUS 3I2KA 4FQZA 3UJOA 2JICA 5FP9A 1S4CA 3N9OA 2GNDA 2WN2A 1YJLA 3VKFC 4Y1YA 3KWVA 4NJ4A 4AVCA 3EMRA 3AP9A 5A70A 1YQCA 1K5MC 1ENXA 1AVBA 1W8WA 1UZYA 3U14A 2B5HA
chains in the Genus database with same CATH topology
3FHQA 3K4AA 1K42A 1XNTA 3A7QA 2Y64A 3ACHA 3FL7A 3HEIA 1CX1A 3MO4A 1UY1A 3P6BA 3I97A 2ZXQA 3WNKA 3HNBM 5LCWL 2V5DA 1XPWA 2WO1A 1UY0A 4ZY9A 1UYYA 4CUCA 3MUZ1 3J7HA 5JXIA 3LEGA 3T2OA 4XUNA 5LA0A 4DXSA 1O8PA 3HNYM 4DEQA 2E32A 1F4HA 3LPFA 3DECA 4RYDA 2Y6HA 3E1F1 4MGSA 3WNMA 3HN3A 3OB8A 5I0DA 3VD3A 2VZ3A 4Z2AA 4QDSA 4CU8A 4JKKA 3LEIA 5IFTA 3ACGA 2W1UA 4PT6A 4A44A 4CU7A 3HOBA 1W9SA 3MV11 2ZEXA 1RYYA 4A6OA 2W91A 1KEXA 3WNOA 4CU9A 4DUVA 4MO3M 2WYSA 1GOGA 2EIEA 2QQMA 2VZUA 2OKXA 1JZ2A 2RV9A 1CIYA 3A23A 2C9KA 3CQOA 3D3AA 3IIIA 4A4AA 2RJ2A 4ZXEA 2C4XA 3VD4A 1W9WA 4P02B 2X09A 2DCKA 1W0NA 3WF4A 3C7OA 1UMHA 3LEKA 3EB7A 4GWIA 2QBXA 1KGYA 4LQRA 4DUWA 1JZ4A 4QX3A 2JE8A 2CDPA 4OMCA 4JKLA 3T0DA 1H6XA 4D0QA 2EICA 4OYUA 2J1EA 4DXRA 1MPXA 1EUTA 3LQCA 5C7GA 1W99A 4XZUG 5DMYA 3CMGA 1JYWA 4QX0A 1DYOA 1PX3A 3DYMA 3GM8A 3UESA 2BBAA 3F2ZA 2X05A 5DPNA 3W5NA 5G05L 4E8DA 4UOJA 2VCCA 2BGOA 3I2HA 1GOHA 1UMIA 5EIYB 2VC9A 3T08A 3VD5A 3VDAA 1J84A 2VOTA 4XUQA 5JXHA 2JD9A 2XOMA 2WO2A 3I3DA 5HXMA 2VM9A 1UY3A 2JDAA 3ZM8A 3GDBA 1UXXX 1H6YA 2VTFA 3A21A 3WNPA 5IJRA 2LS6A 1OT5A 2CDOA 3PUHA 2VMDA 3LPGA 3WNNA 1US2A 4OMDA 1DP0A 2QQIA 4QB6A 3ACIA 2J1RA 3WF2A 5G04L 2J1AA 3SEPA 1JZ5A 3VD9A 3WF1A 4LKSA 1K3IA 2VMFA 4BJ0A 2WQ8A 1CZTA 4M4RA 3I2IA 5IHRA 1L7RA 1R64A 2YC2A 3ACFA 2VZTA 2Y6KA 3IB3A 5F7UA 3BGAA 1YQ2A 4LPLA 1DLCA 5LA1A 4UAPA 1CZVA 1W8OA 1D7PM 1I5PA 2VJXA 4GWJA 5JUVA 1P8JA 3NRUA 2W47A 2QQKA 4OZOA 1PMJX 3WF3A 4QPWA 4A42A 3K46A 2VR4A 1PX4A 2VO5A 3NJXA 1JU4A 3I2GA 1SG3A 2VCAA 4TTGA 3K4ZA 2W1QA 5IYYA 1T2XA 5IFPA 1K12A 3OGRA 1UY4A 2W95A 3VDBA 5C70A 4BDVB 1NAEA 1GNYA 3ETPA 3OEBA 4QB2A 3GGLA 4OUEA 3IDAA 1IQDC 4PF1A 1OD3A 5CZKA 1GQPA 2W1SA 4A3ZA 5CYYA 4CUAA 5JXGA 2ID4A 1PMHX 3AC0A 4AG4A 1UYZA 3FHAA 1UYXA 1ULPA 2ORZA 2WZEA 4UI9L 4MOAA 3MV01 1HN1A 4XURA 2DCJA 2VMCA 5DN2A 2QQLA 3OG2A 4GZ9A 4P5YA 2QQOA 3I2JA 2Y8KA 5LA2A 2BGPA 1O8SA 3UNPA 2PQSA 4KMQA 1K45A 4E8CA 3NNGA 4BK5A 2HYXA 1TG7A 4DXTA 1GUIA 3WF0A 1F4AA 2VZVA 2EIDA 4QB1A 2YFUA 3I3EA 4MGQA 2V4VA 5C71A 1WCQA 3BN6A 1XNAA 4ARYA 1O59A 4DEVA 1JI6A 2JKXA 3ECQA 2W5FA 1JHJA 3ABZA 4ET7A 3WQBA 4QDRA 4IUGA 3C8XA 3K4DA 1XC6A 4JX0A 4DUXA 2J7MA 2YFZA 2E31A 3CKHA 3UETA 3MBWA 4CU6A 2VZ1A 2YG0A 1JYNA 4LHSA 4RN5A 4KWUA 2WZ8A 2QQNA 3NJVA 1ULOA 2VZRA 2B9VA 2V72A 2VQTA 1W9TA 1NUKA 1US3A 4ZZ8A 2QQJA 4TXWA 2RVAA 2XONA 5FUIA 2VZOA 2ZEWA 3I3BA 2YC4A 5EJZB 3HNMA 3NQHA 3VD7A 3HPNA 4XUTA 3EYPA 4ZZ5A 2B4KA 5DQ0A 2J1TA 3IAQA 2R7EB 1OF3A 1L7QA 2J22A 4W4ZA 3WSOA 2WBKA 3VDCA 1OF4A 3I2FA 3W5MA 2Y6LA 1TVGA 3C7EA 1JYVA 2W92A 4A45A 2VQUA 1CZSA 1JZ6A 4W50A 3K77A 3WEZA 2E33A 5JR2A 1UX7A 4YPJA 1W8NA 1JZ7A 3SKVA 2BZDA 1OH4A 2HLEA 1UY2A 2C26A 2XHNA 3DYOA 2W46A 3K75B 1NKGA 1GMMA 2W87A 2VL4A 1JU3A 4QX1A 1UZ0A 3SEEA 4ARXA 2LW8A 3JXSA 4AAXA 5J1XA 5EJ1B 3T0BA 2J1VA 4PQQA 5B4NA 4BXSV 3IAPA 2W9XA 3P1IA 2VMEA 4MADA 2W3JA 3OEAA 4P08A 4P00B 5A1AA 4D8MA 4W8JA 4A41A 1NX9A 3PUIA 2BERA 3T2QA 3OBAA 4XUPA 3MUY1 3A22A 4CVUA 2WO3A 1GOFA 5JMOA 2VZPA 2VZSA 1WKYA 4QDQA 3THCA 2WN3A 3THDA 3T2PA 1UWWA 4L0PA 3C7FA 1JZ8A 1SDDB 3CIHA 2ORXA 2W1WA 4XUOA 1J83A 5B4XA 4JKMA 1JYXA 1JZ3A 2W94A 2XQXA 1SHWB 2L9LA 4QAWA 4HG6B 2EIBA 2ZEYA 4M4PA 2X10A 2J1UA 2WAOA 4BK4A 2DDUA 2E26A 3OGVA 4XVHA 2Y6GA 2WUHA 4QX2A 3LE0A 3WNLA 2Y6JA 2WAAA 4KI5M 3OGSA 2YB7A 1EUUA 2KD7A 2WABA 1LNSA 3HJRA 3C7GA 2J1SA 3T0AA 2VCBA 5HPOA 1GU3A 3T09A 3DYPA 2ZEZA 3CZJA 3GXUA 3CDZB 2WDBA 4JHZA 1UXZA 3I2KA 5JXJA 2VZQA 3FN9A 2WN2A 3C7HA 2Z4FA 3CZUA 4FI9A 3U37A 1BHGA 3SKJE 4CUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHQ A;  3K4A A;  1K42 A;  1XNT A;  3A7Q A;  2Y64 A;  3ACH A;  3FL7 A;  3HEI A;  1CX1 A;  3MO4 A;  1UY1 A;  3P6B A;  3I97 A;  2ZXQ A;  3WNK A;  3HNB M;  5LCW L;  2V5D A;  1XPW A;  2WO1 A;  1UY0 A;  4ZY9 A;  1UYY A;  4CUC A;  3MUZ 1;  3J7H A;  5JXI A;  3LEG A;  3T2O A;  4XUN A;  5LA0 A;  4DXS A;  1O8P A;  3HNY M;  4DEQ A;  2E32 A;  1F4H A;  3LPF A;  3DEC A;  4RYD A;  2Y6H A;  3E1F 1;  4MGS A;  3WNM A;  3HN3 A;  3OB8 A;  5I0D A;  3VD3 A;  2VZ3 A;  4Z2A A;  4QDS A;  4CU8 A;  4JKK A;  3LEI A;  5IFT A;  3ACG A;  2W1U A;  4PT6 A;  4A44 A;  4CU7 A;  3HOB A;  1W9S A;  3MV1 1;  2ZEX A;  1RYY A;  4A6O A;  2W91 A;  1KEX A;  3WNO A;  4CU9 A;  4DUV A;  4MO3 M;  2WYS A;  1GOG A;  2EIE A;  2QQM A;  2VZU A;  2OKX A;  1JZ2 A;  2RV9 A;  1CIY A;  3A23 A;  2C9K A;  3CQO A;  3D3A A;  3III A;  4A4A A;  2RJ2 A;  4ZXE A;  2C4X A;  3VD4 A;  1W9W A;  4P02 B;  2X09 A;  2DCK A;  1W0N A;  3WF4 A;  3C7O A;  1UMH A;  3LEK A;  3EB7 A;  4GWI A;  2QBX A;  1KGY A;  4LQR A;  4DUW A;  1JZ4 A;  4QX3 A;  2JE8 A;  2CDP A;  4OMC A;  4JKL A;  3T0D A;  1H6X A;  4D0Q A;  2EIC A;  4OYU A;  2J1E A;  4DXR A;  1MPX A;  1EUT A;  3LQC A;  5C7G A;  1W99 A;  4XZU G;  5DMY A;  3CMG A;  1JYW A;  4QX0 A;  1DYO A;  1PX3 A;  3DYM A;  3GM8 A;  3UES A;  2BBA A;  3F2Z A;  2X05 A;  5DPN A;  3W5N A;  5G05 L;  4E8D A;  4UOJ A;  2VCC A;  2BGO A;  3I2H A;  1GOH A;  1UMI A;  5EIY B;  2VC9 A;  3T08 A;  3VD5 A;  3VDA A;  1J84 A;  2VOT A;  4XUQ A;  5JXH A;  2JD9 A;  2XOM A;  2WO2 A;  3I3D A;  5HXM A;  2VM9 A;  1UY3 A;  2JDA A;  3ZM8 A;  3GDB A;  1UXX X;  1H6Y A;  2VTF A;  3A21 A;  3WNP A;  5IJR A;  2LS6 A;  1OT5 A;  2CDO A;  3PUH A;  2VMD A;  3LPG A;  3WNN A;  1US2 A;  4OMD A;  1DP0 A;  2QQI A;  4QB6 A;  3ACI A;  2J1R A;  3WF2 A;  5G04 L;  2J1A A;  3SEP A;  1JZ5 A;  3VD9 A;  3WF1 A;  4LKS A;  1K3I A;  2VMF A;  4BJ0 A;  2WQ8 A;  1CZT A;  4M4R A;  3I2I A;  5IHR A;  1L7R A;  1R64 A;  2YC2 A;  3ACF A;  2VZT A;  2Y6K A;  3IB3 A;  5F7U A;  3BGA A;  1YQ2 A;  4LPL A;  1DLC A;  5LA1 A;  4UAP A;  1CZV A;  1W8O A;  1D7P M;  1I5P A;  2VJX A;  4GWJ A;  5JUV A;  1P8J A;  3NRU A;  2W47 A;  2QQK A;  4OZO A;  1PMJ X;  3WF3 A;  4QPW A;  4A42 A;  3K46 A;  2VR4 A;  1PX4 A;  2VO5 A;  3NJX A;  1JU4 A;  3I2G A;  1SG3 A;  2VCA A;  4TTG A;  3K4Z A;  2W1Q A;  5IYY A;  1T2X A;  5IFP A;  1K12 A;  3OGR A;  1UY4 A;  2W95 A;  3VDB A;  5C70 A;  4BDV B;  1NAE A;  1GNY A;  3ETP A;  3OEB A;  4QB2 A;  3GGL A;  4OUE A;  3IDA A;  1IQD C;  4PF1 A;  1OD3 A;  5CZK A;  1GQP A;  2W1S A;  4A3Z A;  5CYY A;  4CUA A;  5JXG A;  2ID4 A;  1PMH X;  3AC0 A;  4AG4 A;  1UYZ A;  3FHA A;  1UYX A;  1ULP A;  2ORZ A;  2WZE A;  4UI9 L;  4MOA A;  3MV0 1;  1HN1 A;  4XUR A;  2DCJ A;  2VMC A;  5DN2 A;  2QQL A;  3OG2 A;  4GZ9 A;  4P5Y A;  2QQO A;  3I2J A;  2Y8K A;  5LA2 A;  2BGP A;  1O8S A;  3UNP A;  2PQS A;  4KMQ A;  1K45 A;  4E8C A;  3NNG A;  4BK5 A;  2HYX A;  1TG7 A;  4DXT A;  1GUI A;  3WF0 A;  1F4A A;  2VZV A;  2EID A;  4QB1 A;  2YFU A;  3I3E A;  4MGQ A;  2V4V A;  5C71 A;  1WCQ A;  3BN6 A;  1XNA A;  4ARY A;  1O59 A;  4DEV A;  1JI6 A;  2JKX A;  3ECQ A;  2W5F A;  1JHJ A;  3ABZ A;  4ET7 A;  3WQB A;  4QDR A;  4IUG A;  3C8X A;  3K4D A;  1XC6 A;  4JX0 A;  4DUX A;  2J7M A;  2YFZ A;  2E31 A;  3CKH A;  3UET A;  3MBW A;  4CU6 A;  2VZ1 A;  2YG0 A;  1JYN A;  4LHS A;  4RN5 A;  4KWU A;  2WZ8 A;  2QQN A;  3NJV A;  1ULO A;  2VZR A;  2B9V A;  2V72 A;  2VQT A;  1W9T A;  1NUK A;  1US3 A;  4ZZ8 A;  2QQJ A;  4TXW A;  2RVA A;  2XON A;  5FUI A;  2VZO A;  2ZEW A;  3I3B A;  2YC4 A;  5EJZ B;  3HNM A;  3NQH A;  3VD7 A;  3HPN A;  4XUT A;  3EYP A;  4ZZ5 A;  2B4K A;  5DQ0 A;  2J1T A;  3IAQ A;  2R7E B;  1OF3 A;  1L7Q A;  2J22 A;  4W4Z A;  3WSO A;  2WBK A;  3VDC A;  1OF4 A;  3I2F A;  3W5M A;  2Y6L A;  1TVG A;  3C7E A;  1JYV A;  2W92 A;  4A45 A;  2VQU A;  1CZS A;  1JZ6 A;  4W50 A;  3K77 A;  3WEZ A;  2E33 A;  5JR2 A;  1UX7 A;  4YPJ A;  1W8N A;  1JZ7 A;  3SKV A;  2BZD A;  1OH4 A;  2HLE A;  1UY2 A;  2C26 A;  2XHN A;  3DYO A;  2W46 A;  3K75 B;  1NKG A;  1GMM A;  2W87 A;  2VL4 A;  1JU3 A;  4QX1 A;  1UZ0 A;  3SEE A;  4ARX A;  2LW8 A;  3JXS A;  4AAX A;  5J1X A;  5EJ1 B;  3T0B A;  2J1V A;  4PQQ A;  5B4N A;  4BXS V;  3IAP A;  2W9X A;  3P1I A;  2VME A;  4MAD A;  2W3J A;  3OEA A;  4P08 A;  4P00 B;  5A1A A;  4D8M A;  4W8J A;  4A41 A;  1NX9 A;  3PUI A;  2BER A;  3T2Q A;  3OBA A;  4XUP A;  3MUY 1;  3A22 A;  4CVU A;  2WO3 A;  1GOF A;  5JMO A;  2VZP A;  2VZS A;  1WKY A;  4QDQ A;  3THC A;  2WN3 A;  3THD A;  3T2P A;  1UWW A;  4L0P A;  3C7F A;  1JZ8 A;  1SDD B;  3CIH A;  2ORX A;  2W1W A;  4XUO A;  1J83 A;  5B4X A;  4JKM A;  1JYX A;  1JZ3 A;  2W94 A;  2XQX A;  1SHW B;  2L9L A;  4QAW A;  4HG6 B;  2EIB A;  2ZEY A;  4M4P A;  2X10 A;  2J1U A;  2WAO A;  4BK4 A;  2DDU A;  2E26 A;  3OGV A;  4XVH A;  2Y6G A;  2WUH A;  4QX2 A;  3LE0 A;  3WNL A;  2Y6J A;  2WAA A;  4KI5 M;  3OGS A;  2YB7 A;  1EUU A;  2KD7 A;  2WAB A;  1LNS A;  3HJR A;  3C7G A;  2J1S A;  3T0A A;  2VCB A;  5HPO A;  1GU3 A;  3T09 A;  3DYP A;  2ZEZ A;  3CZJ A;  3GXU A;  3CDZ B;  2WDB A;  4JHZ A;  1UXZ A;  3I2K A;  5JXJ A;  2VZQ A;  3FN9 A;  2WN2 A;  3C7H A;  2Z4F A;  3CZU A;  4FI9 A;  3U37 A;  1BHG A;  3SKJ E;  4CUB A; 
#chains in the Genus database with same CATH topology
 1GBG A;  5SV5 A;  4D6S A;  3RZH A;  3D8C A;  2VD7 A;  3RPQ A;  4OUL A;  1OA4 A;  4GMP 3;  3V0B B;  1WMF A;  2QJV A;  3KF3 A;  3OY8 A;  2WNV C;  3POE A;  3CF6 E;  4LO8 A;  1SZB A;  4Q5O A;  1X33 A;  5EYX A;  3AM2 A;  1FXZ A;  1DZT A;  4LJH A;  1C8M 3;  3PLQ A;  2Y38 A;  3HQU A;  1IHM A;  2KA3 A;  3WNK A;  1HB4 A;  1LCL A;  4CP9 A;  2BJS A;  3HNB M;  5GJ6 A;  4NIG A;  5JZG A;  1SLL A;  1ULD A;  5L9B A;  4LE3 A;  2PHL A;  5FJK A;  4ZY9 A;  1SPP A;  1ZZ6 A;  1UYY A;  3ZVX A;  5IVF A;  3MUZ 1;  4EQV A;  1XYO A;  4OI4 A;  4E9K A;  1OMI A;  2E63 A;  3PVN A;  3POJ A;  1FOD 2;  2IZW A;  4XJ8 A;  2GDF A;  3LEG A;  4PDW C;  5A3N A;  4YW5 A;  1YFW A;  3M8L A;  2CAV A;  5A3W A;  2A6X A;  2RE9 A;  3V64 A;  4XUN A;  3WZ1 A;  2ZX2 A;  5LA0 A;  2C0Z A;  3RI9 A;  3NV3 A;  4JGZ C;  3KCC A;  3D82 A;  3LOI A;  3SIT A;  4NE9 A;  1CGP A;  4LBN A;  1WW5 A;  4XIK A;  3NKT A;  4RYD A;  1AYN 1;  3E1F 1;  5C9A A;  5DUU A;  1GP5 A;  3WNM A;  5A6Z A;  1I6X A;  3HN3 A;  5BPX A;  3W21 A;  3WVJ A;  1C8N A;  1LB2 A;  5AVP A;  3KMH A;  3N7J A;  3VKM A;  2DUO A;  5I0D A;  3VD3 A;  5KBF A;  4A2U A;  3ILN A;  3ITQ A;  4QDS A;  3KT1 A;  1UZW A;  2YHJ A;  4LIT A;  4BQ4 A;  5C3Q A;  1DQ6 A;  4K20 A;  3AFK A;  2DTW A;  4RD7 A;  4D7S A;  4PT6 A;  3RDI A;  1BBT 1;  4Y5Z 0;  2WA3 A;  1V00 A;  1GLH A;  3LA7 A;  1RUG 2;  4LKD A;  4UT5 A;  1RYY A;  1PO1 2;  1YO8 A;  1ZVF A;  1X8M A;  1YQ8 A;  2MEV 3;  4Y20 B;  1ZZB A;  4AF9 A;  4COU A;  4NIA A;  1W28 A;  4WVW A;  2DUP A;  4MO3 M;  4LOT A;  4IEX A;  4FFF A;  4EZH A;  2WNV B;  3HIF A;  2OUJ A;  5HV0 A;  1TMF 2;  3A23 A;  3LA3 A;  3H8R A;  1DYP A;  2RR1 3;  3D3A A;  4N8M A;  1ULG A;  4IV3 C;  4ZXK A;  3KVB A;  3WV6 A;  4R4Z A;  3H7Y A;  2RJ2 A;  3LAG A;  4XF0 A;  1YNA A;  3OGJ A;  5CIR A;  4I01 A;  1AX2 A;  1V6M A;  1RGS A;  4I0A A;  4L11 A;  1W0N A;  3CLP A;  3C7O A;  3NVC A;  5T54 A;  4R9C A;  2VG9 A;  3ZFG A;  3USS A;  1OLM E;  1KFU L;  2MHF A;  4CPB A;  2HH9 A;  4GWI A;  1AHS A;  2QBX A;  2DVA A;  5EYY A;  4LQR A;  1YEW A;  3ELN A;  4DUW A;  5ABJ B;  2BOJ A;  5A7N A;  1OUS A;  1R08 1;  1DU3 D;  3O0W A;  3X29 B;  4JKL A;  2FCV A;  2I2S A;  2VOX A;  1RIR A;  2CTV A;  4QU2 A;  5F6K A;  2VXJ A;  3MIG A;  1N3P A;  1S0B A;  2VUL A;  4FP2 A;  2DVD A;  4OYU A;  2J1E A;  3W20 A;  5C7G A;  2Q1F A;  3KS7 A;  3CMG A;  2Q8C A;  4QX0 A;  1JYW A;  2EXI A;  3ZYF A;  5HCF A;  3ZSL A;  4YGD A;  2ZML A;  1QNW A;  5LRR A;  1QJX 3;  3N9N A;  1PX3 A;  3V0A B;  3O1R A;  5I0S A;  2ZS6 B;  4XAA A;  5I8S A;  1UX6 A;  1GOH A;  3BI3 A;  2ZGR A;  1BVV A;  5KHJ A;  1H8T A;  2PAK A;  2RS3 3;  3T08 A;  3VD5 A;  4B4P A;  4DS0 A;  5ACA 2;  3RZG A;  1GIC A;  2BDR A;  2VOT A;  2QQV A;  1ND3 A;  2DBI A;  2X29 A;  3KV6 A;  4IET A;  2BGC A;  4XUQ A;  4Y1U A;  5BNN B;  5JXH A;  1QQP 1;  3RJ2 X;  2Y33 A;  1NLQ A;  1G86 A;  1QY4 A;  1W6P A;  3NNM A;  3WD5 A;  2XJQ A;  3IN9 A;  2D6M A;  1S2K A;  2WZR 1;  1JYT A;  1D4M 2;  2VM9 A;  1AXY A;  1UY3 A;  4Q1P A;  4QPY A;  3ZM8 A;  3KHC A;  3VDD B;  4JTN A;  5IJR A;  5FZG A;  1HXS 1;  1OT5 A;  4FXK B;  4G4F A;  3J7L A;  5LK5 A;  1VR3 A;  1AR8 1;  2DVG A;  3LPG A;  2W39 A;  1N3O A;  1S0J A;  2VVE A;  4OMD A;  4OFG A;  3FWE A;  2HWB 2;  1W6O A;  4YFZ A;  4CEW C;  4QB6 A;  3ACI A;  4BQW A;  4IEW A;  3VKL A;  1VAM A;  1JZ5 A;  3WF1 A;  3B69 A;  4C90 A;  2NPI A;  2VMF A;  1GQH A;  2HWE 2;  4Z2W A;  5IVV A;  5L9V A;  5FK8 A;  5T5L A;  2ENR A;  4AVS A;  4M3C B;  1L7R A;  2VNV A;  4Q4V 3;  1V6O A;  2ET7 A;  2PHR A;  2WWU A;  2YC2 A;  2Y6K A;  1CAV A;  1H30 A;  3RYK A;  1QWR A;  4OQ9 A;  4WVV A;  3ZN5 A;  2ILM A;  4UAP A;  4JHT A;  1NCQ A;  5DUV A;  1W8O A;  4ES9 A;  2JG8 A;  2WYF A;  1S2E A;  4GWJ A;  1VE0 A;  3B02 A;  5JUV A;  1I1E A;  4FOY A;  4LLF A;  1VMF A;  3NAP C;  3NRU A;  2W47 A;  3BIE A;  1EPZ A;  1IOA A;  1RUJ 1;  2TEP A;  3IDC B;  3WF3 A;  1E5R A;  1OQE A;  1NY7 2;  4QPW A;  1ZX5 A;  2DVF A;  4E4S A;  3EJK A;  1SLI A;  1S0D A;  3K46 A;  4B7E A;  1ZBE 1;  3NJX A;  4PIX A;  1ULF A;  5FPL A;  3S5A A;  1WD4 A;  4EN9 B;  1XE7 A;  4XFG A;  4YNI A;  1CAW B;  3K4Z A;  1UQX A;  4WM8 C;  1MS5 A;  3A0N A;  1LGN A;  1POV 1;  5H9P A;  3VBU B;  2W1Q A;  4CCL A;  5IYY A;  1K12 A;  3OGR A;  2W95 A;  4FOQ A;  2FDK A;  1S0E A;  3OGG A;  5LEK A;  1NE6 A;  3ZPO A;  2ERF A;  3EBR A;  5T52 A;  3K3N A;  5K9Y A;  3BOP A;  4QQH A;  4OUE A;  4MGY E;  1OA3 A;  1W06 A;  1FAT A;  5FCC A;  3DXU A;  1ZZ7 A;  3KCY A;  4A3Z A;  3PMS A;  3WXP A;  2HJI A;  1JYC A;  2JEM A;  2O8O A;  2UUR A;  2GH8 A;  3WP5 A;  1MZE A;  1ULP A;  3NJY A;  5A32 A;  3S5Q A;  2E6V A;  4AK3 A;  2ARC A;  3ST7 A;  1YJK A;  3I3M A;  1XRU A;  2QFE A;  2PHD A;  2YPJ A;  4MOA A;  1B35 B;  1B09 A;  3ZXL A;  4YM0 A;  5A3P A;  4H55 A;  3BKZ A;  4KH9 A;  2A1X A;  4P5Y A;  2QQO A;  2VU9 A;  1LOG A;  1DQ1 A;  3I2J A;  1WCD J;  3KT4 A;  5D2A A;  4KGG A;  2BWA A;  4QU1 A;  3UNP A;  1CPM A;  1EV1 3;  2XWB B;  3KT7 A;  3MDP A;  3NKG A;  4YGC A;  5F2S A;  4CEW B;  2WFP A;  1DGR A;  4AL9 A;  1VBA 1;  1UW8 A;  1HW5 A;  1W04 A;  3NNG A;  1RVF 1;  1H0B A;  4Y5T A;  4K8F A;  4ES8 A;  5FBZ A;  1YCI A;  5FR3 A;  2V73 A;  4XFC A;  4HVR A;  4IDZ A;  4ZHN A;  5FYI A;  2VZV A;  3LDB A;  3USU B;  2NM1 A;  5FIX A;  4OI2 A;  2H0B A;  4HN0 A;  1U12 A;  2A71 A;  3ENR A;  1MQT A;  5FJH A;  5FWE A;  4FPK A;  5C71 A;  4H2A A;  1WCQ A;  1HB1 A;  2ZGS A;  3OD0 A;  1RUG 1;  2ZGM A;  2LTN A;  3A4U A;  2ZA9 A;  4GJY A;  4BWO A;  3RSJ A;  1OLR A;  3KD4 A;  2W5F A;  2Q1M A;  5BNP A;  2W52 A;  3DKQ A;  1EP0 A;  3EXU A;  4XE9 A;  5GLV A;  1BK0 A;  1CAW A;  1RUI 2;  4AHZ A;  4GWN A;  5KXC A;  3K4D A;  2WNE A;  3INA A;  4S2D A;  3AP7 A;  4ZPI A;  1XC6 A;  3ZYJ B;  4AFC A;  1COV 2;  1SLC A;  1ZA4 A;  1WMX A;  2YFZ A;  2ZMK A;  4O9E A;  5HXV A;  4G3Y C;  3VBR C;  1WUV A;  2LRP A;  3OBZ A;  4YG0 A;  3M3I A;  4N43 A;  2YG0 A;  4TLF A;  5H9R A;  5FPU A;  4COZ A;  4LHS A;  3OJB A;  1CX4 A;  1IG0 A;  1JN2 P;  2DUR A;  2QQN A;  3IMM A;  3N7L A;  3NJV A;  2IC1 A;  5F6L B;  1ULO A;  5DG2 A;  5F32 A;  2JG8 B;  1LED A;  3NAP A;  2HKX A;  4HVQ A;  1PZ7 A;  2Y6F A;  4DY3 A;  1D4M 3;  4BXF A;  5JSP A;  4FPY A;  1US3 A;  2ZX0 A;  4ZZ8 A;  5FZB A;  4Z07 A;  3VBS B;  2R06 3;  2BVV A;  1UIJ A;  2H6C A;  3FLT A;  4QD2 A;  1RJ8 A;  5DDJ 3;  3FLP A;  1NCR C;  1OVP A;  2NZ9 A;  1RIT A;  1X9T A;  2B4K A;  3EYP A;  1UPI A;  4XXP A;  5DQ0 A;  1VBB 3;  1YIP A;  3WHU A;  3GYD A;  4XC9 A;  4YG6 A;  3IT8 A;  4CUG A;  1GZT A;  5KR7 A;  2ZX1 A;  2R7E B;  2J22 A;  1HQN A;  4XFH A;  5FYT A;  1Z0H A;  4M3C F;  3WSO A;  4UYB A;  5FYH A;  3DF0 A;  4KBZ A;  4S2F A;  1QXR A;  5FK7 A;  1BQP A;  5CIS A;  2XLG A;  1FV2 A;  3CJI C;  5FDB A;  2SBA A;  4M00 A;  3ZIW A;  2HEV F;  1CQ9 A;  3LKJ A;  5EPA A;  5JOZ A;  1JYV A;  3PUA A;  4A45 A;  3B9I A;  4DB5 A;  2VQU A;  3LWC A;  4HKO A;  2JD4 A;  5APA A;  5A3L A;  1D2S A;  1DF0 A;  5EV7 A;  3W58 A;  3O5S A;  5CFD A;  2AEN A;  2D3R A;  3DKW A;  1NYW A;  2PLV 1;  2Q0A A;  1W8N A;  4QPG C;  1WMD A;  3AMH A;  1PO2 2;  3VHR A;  2LRO A;  1H2K A;  1Q8Q A;  1OH4 A;  2ARA A;  2HLE A;  4WBB A;  1RMU 3;  2ZGU A;  2C26 A;  2YU2 A;  4HZF A;  3LD8 A;  1QKQ A;  3AJY A;  4HL0 A;  4R8H A;  4CZS A;  2W87 A;  4QX7 A;  2CGO A;  1H8T C;  3SEE A;  3VHP A;  1NCR A;  2LW8 A;  3JXS A;  5EJ1 B;  4COY A;  1FMD 3;  5CFD C;  1K5J A;  2GAU A;  4UFI A;  5FXV A;  1GKB A;  1AYM 1;  2HWC 1;  4QPI B;  2HWB 1;  4WM7 C;  4BXS V;  2QTW B;  1PGL 1;  3BYW A;  3ZSJ A;  3AB0 A;  4EWE A;  1OKQ A;  1NG0 A;  1Y9Q A;  4P08 A;  2BPA 2;  3CJI A;  4JGZ B;  1M4W A;  4NVP A;  4NMI A;  4W8J A;  5A1A A;  1NX9 A;  1H2M A;  3PUI A;  4LKE A;  5KXD A;  1QJX 1;  3ILR A;  4LIU A;  4P9J A;  2CU5 A;  4I3G A;  3WG4 A;  1GR3 A;  1WA6 X;  2QUO A;  1DQ5 A;  2XML A;  1IZ3 A;  4QQO A;  4UBH A;  1TNR A;  2NLR A;  2ZX3 A;  4CDQ B;  2XJT A;  4CVU A;  3AK0 A;  2C9A A;  4W65 A;  5K0U C;  4KU7 A;  1UN1 A;  4KQ7 A;  1JOP A;  4XQ4 A;  4UFJ A;  1LJ7 A;  1HRV 3;  1VAV A;  5DXD A;  3THC A;  1UYP A;  4ITC A;  1BKZ A;  1U0A A;  2TUN A;  5FOJ B;  1OUR A;  4JQT A;  2KR2 A;  3H8X A;  2GMP A;  2SLI A;  5FY5 A;  3THD A;  5KXB A;  2CYF A;  1UWW A;  3HQX A;  3AYA A;  3BPS A;  5JI7 A;  1LUL A;  5C33 A;  3AYE A;  4WZC A;  4M0H A;  3BTZ A;  2PA7 A;  4LBJ A;  2ORX A;  4UW6 A;  3SXW A;  2W1W A;  3N4M A;  1QEX A;  1LR5 A;  3CJI B;  5IVE A;  4XUO A;  5B4X A;  1SBD A;  1JYX A;  1NOV A;  5FZO B;  1JZ3 A;  1VB2 A;  1HRI 3;  2W94 A;  3H8U A;  2PHF A;  4GJZ A;  2K9Z A;  3QLQ A;  5I8Y A;  3ETQ A;  1AX1 A;  3LDK A;  3MPP G;  2PQQ A;  4HG6 B;  4XBL A;  2YXS A;  4FO9 A;  4B1L A;  2A70 A;  4M4P A;  2P3J A;  1ND2 B;  2CSG A;  2EA7 A;  2WWJ A;  3JB8 A;  3RQ0 A;  1K5M A;  4F7Z A;  2FD8 A;  3B94 A;  1BCX A;  1JBC A;  2B7Y A;  2QE3 A;  1WME A;  2VMI A;  4NHY A;  2HWC 3;  3WUC A;  4P9L A;  2Y6G A;  4RHV 1;  5BXX A;  2OW4 A;  1W2N A;  1J1T A;  3ZXF A;  5EJ3 A;  2MEV 1;  3WNL A;  1RB8 G;  3P3P A;  4TSV A;  4BQX A;  2RS5 3;  2Y6J A;  4GKY A;  3OGS A;  4UF0 B;  1AJK A;  1B35 C;  4AVA A;  3AVS A;  1EUU A;  5FO9 B;  1ASJ 1;  3R6S A;  1HDK A;  3VBH B;  1F35 A;  2GMM A;  2Z42 A;  2D97 A;  2VBB A;  5HPO A;  1HXS 2;  4XCB A;  3VKO A;  3KV4 A;  1JYI A;  1CWP A;  2Y34 A;  2KXL A;  3OPZ A;  1WA4 A;  2XJP A;  3OUI A;  1A8M A;  2ZEZ A;  2XVL A;  2FBE A;  1JH5 A;  4IGO A;  4MXW A;  4O9G A;  4UW5 A;  4Y22 A;  3WDU A;  1LU2 A;  5C8W A;  3ZO0 B;  1G9B A;  1O4Z A;  3VHN A;  1SPP B;  1V70 A;  4BE3 A;  4N7I A;  1O4Y A;  1Q43 A;  3WT3 A;  5JXJ A;  3AL5 A;  2D93 A;  2HWE 1;  1MEC 1;  2Z4F A;  4N9H A;  1BMV 2;  2PMW B;  3VUO A;  4A3X A;  5KHH A;  1VBD 2;  4F3J A;  2HWD 1;  3VLB B;  3RWK X;  5K0U B;  2UY8 A;  1AR6 2;  3LEM A;  1TME 3;  4P9X A;  2ZGK A;  1YFY A;  4CUB A;  3UL2 A;  4K1Z A;  3JU9 A;  3VBF A;  1O5L A;  1OLQ A;  2ETE A;  1VBB 2;  3K4A A;  2PAM A;  1RUD 2;  1S0I A;  3TRS B;  2P1B A;  2QQW A;  1QJU 3;  4OHV A;  2DFC A;  3A7Q A;  3E5U A;  1U5I A;  2Y64 A;  3MFA A;  3WR0 A;  3FL7 A;  5A33 A;  4AAP A;  3MO4 A;  4YZ4 A;  2GP5 A;  1COV 1;  1IPK A;  1QJE A;  3H3U A;  4I3P A;  2ZKN A;  2VEC A;  5CA6 A;  5LCW L;  2QQP A;  4AR2 A;  1XU2 A;  3JUU A;  3ZN6 A;  3DV8 A;  2B45 X;  2AUY A;  2P34 A;  4IV3 A;  4LUM A;  4N53 C;  5ANN A;  1GWM A;  4Y22 B;  4BPZ A;  5FY1 A;  2WNU B;  1OBN A;  4K9S A;  1WW7 A;  4Y3O A;  3E6D A;  1SLT A;  2JB8 A;  2XBO 2;  4DPN A;  1EAH 2;  5T3N A;  2XR4 A;  4NRQ A;  3USU A;  4NUB A;  4YVW A;  5A6Q A;  3WQ0 A;  5CKQ A;  4QGL A;  2E32 A;  3LSE A;  4ZKT B;  2G9G A;  2XVG A;  2ZKL A;  3AP6 A;  5M0T A;  2Y6H A;  5IUQ A;  3T2T A;  3Q8F A;  5FLH A;  3H1W A;  5F5C A;  2BRT A;  1BLZ A;  5IVJ A;  1JTZ X;  4Z2A A;  3MW4 A;  1W6P B;  3ZMO A;  1X8E A;  1LOA A;  1PM7 A;  1R09 3;  1W2O A;  5EHD A;  3WQ7 A;  5BNN A;  1GZW B;  2W1U A;  1QU0 A;  1XYN A;  5JR7 B;  4CU7 A;  1LOF A;  1LHU A;  3NNF A;  4XF9 A;  3MV1 1;  3WCS A;  5JDB A;  5LK7 B;  4KU8 A;  4C1X A;  4CE8 A;  4HFS A;  3WNO A;  4Z1V A;  1REE A;  1OQ1 A;  4ZON A;  1NQJ A;  3VN4 A;  5BYN A;  1WW4 A;  4COW A;  3TAY A;  2DVB A;  1AL2 2;  2WYS A;  4FFG A;  4FVV A;  1X9P A;  1N3Q A;  2PLV 2;  4FPF A;  2VZU A;  4XIL A;  5FZI A;  2OKX A;  4AOC A;  1NT0 A;  4TYS A;  3GBF A;  3TB0 A;  2C9K A;  5I0U A;  3III A;  4A4A A;  3RMX A;  5JPM B;  4GA9 A;  4Q27 A;  1W2U A;  5FZ3 A;  4AED A;  2WSV A;  1W3X A;  4ZXE A;  2WFF 2;  3KVA A;  3M70 A;  3VD4 A;  2IXK A;  2GC2 A;  3H3Z A;  1IPJ A;  4IV3 B;  2JE9 A;  4AQS A;  3VGI A;  4LK6 A;  1D2Q A;  1CAU B;  2BQP A;  1RUC 3;  4LO6 B;  4L8Q A;  3WF4 A;  3VZL A;  5BV6 A;  1OD5 A;  4IW3 A;  2G9Z A;  4PDW A;  3LEK A;  3RYR A;  3EB7 A;  5GM0 A;  5FP8 A;  2OPW A;  2VE1 A;  3J9S A;  5A3O A;  5DZE A;  2Y26 A;  4L92 A;  1VBE 2;  1AYN 2;  1XQN A;  2P37 A;  4PIZ A;  5K8S A;  1ND2 A;  1RUO A;  1G9D A;  4HET A;  4MVT A;  4YGE A;  4QKN A;  1RUF 3;  3PUR A;  2ZAH A;  2GAL A;  1H6X A;  2GU9 A;  4AHW A;  4NII A;  4D0Q A;  2EIC A;  1PGS A;  4AI0 A;  5HI0 A;  4PI2 A;  2GN7 A;  4RFR B;  2V09 A;  1W0P A;  4N90 A;  4NIH A;  4Q4W 2;  3MGU A;  4HKL A;  3WP6 A;  3Q8C A;  2QQU A;  1DYO A;  1PGW 2;  5FMO L;  2RS5 2;  4OUS A;  2DWR A;  1HIX A;  5BNN C;  2GNB A;  3W5N A;  4BZ4 A;  1QXJ A;  2G1M A;  2Y60 A;  3H8O A;  4YW3 A;  2VCC A;  5FZL A;  4CXX A;  2BGO A;  1UZV A;  3LF7 A;  5C6C A;  5EIY B;  5GZG A;  2EF6 A;  2UU8 A;  1WW6 A;  4PI0 A;  3VDA A;  3GF6 A;  5KHG A;  3BOW A;  3RZL A;  2DUQ A;  1W3V A;  4UW3 A;  1CR7 A;  2VBP A;  3MIB A;  2JD9 A;  1LES A;  2ZGQ A;  2ZHM A;  1MS9 A;  4GAL A;  5CKM A;  2WO2 A;  4C91 A;  4ERO A;  3VV1 A;  2IWG B;  2AGS A;  4MH0 E;  4NHX A;  3JD7 2;  3R05 A;  2BNM A;  2JDA A;  1QXP A;  3GDB A;  4K1Y A;  5FMC A;  1H6Y A;  1XOY A;  1QDO A;  1RMU 1;  1OOP A;  3WY6 A;  5FMO S;  1RXF A;  4UF0 A;  2IUW A;  2ZHL A;  2Q8O A;  1DP0 A;  3GZA A;  1OKO A;  1YI7 A;  4NPL A;  2K2S A;  2J1R A;  3WF2 A;  1ENR A;  2J1A A;  2MPF A;  2IXH A;  1RUG 3;  2WT2 A;  1K3I A;  1PO1 3;  3PTY A;  4BJ0 A;  4JCK A;  5IAT A;  1CZT A;  1J3Q A;  2ZHN A;  3OPW A;  1PHM A;  3I2I A;  2E53 A;  5FZ0 A;  4S2H A;  4KWJ A;  4QXC A;  4AQT A;  1K5M B;  3ZSE A;  1GAN A;  3ACF A;  5JSR A;  3D5O A;  4RQP A;  1KIT A;  1GZ9 A;  2VZT A;  4P9Y A;  4X8P A;  4OLL A;  5FYC A;  3UKT A;  1YQ2 A;  4LPL A;  1E5S A;  1UOG A;  2FCT A;  2P6C A;  1W6N A;  3MF9 A;  3WDW A;  4BQ1 A;  5LA1 A;  3ON7 A;  1QIQ A;  1CZV A;  3OY8 B;  1UNB A;  1POQ A;  1CJP A;  2WQZ C;  3LGR A;  5FXW A;  5C8C A;  1FX5 A;  1AYM 2;  3MF6 A;  1OHF A;  1QJY 2;  3RI8 A;  2AEY A;  2A7A A;  4GB3 1;  3ZOI A;  2BEO A;  4LNV A;  4A42 A;  3T1M A;  1UU6 A;  3VZJ A;  1VP6 A;  1MVQ A;  4LO7 A;  4GB3 3;  3KM5 A;  5HBA A;  5J96 B;  2VO5 A;  4OVE A;  3VL9 A;  4H3W A;  1CJD A;  4NR1 A;  4X6R B;  1MR5 A;  1Q8P A;  2HWD 2;  3DPR C;  4R9D A;  1YUD A;  2JKB A;  3PVO A;  4MHR A;  1KJL A;  3VZN A;  1CD3 G;  2EAA A;  2FMD A;  2UYB A;  1W9F A;  3EQE A;  5C3S A;  5JIA A;  2VQ0 A;  3VDB A;  2VW2 A;  3LSD A;  2R06 2;  2NQY A;  1O3R A;  5FOB B;  3APB A;  2GNM A;  1GNY A;  1AR8 2;  4KG0 A;  3Q8A A;  1W8U A;  5J7M A;  1LTE A;  1MQT C;  3AZX A;  4FFI A;  1U5Z A;  1DQ0 A;  4DIQ A;  3IPV B;  4CDW C;  1YC6 1;  4P9G A;  5E1R A;  3D0J A;  5CZK A;  4RGA A;  1NXD 1;  2W1S A;  2BYV E;  3FC0 A;  2ID4 A;  1NA1 A;  1PMH X;  3D6E A;  2W68 A;  1UYZ A;  3RVH A;  4LA3 A;  2CL2 A;  1WLD A;  1YHF A;  1PIV 3;  5JOW A;  3WCR A;  4C1W A;  1WD3 A;  3TBD A;  3ZXJ A;  5FYY A;  1IPS A;  3TN9 2;  1LU1 A;  3I54 A;  1SLA A;  1HN0 A;  4HXC A;  4CDX C;  3BCW A;  2CGP A;  1HN1 A;  2VMC A;  1SFY A;  1RUD 3;  3K3O A;  4LMF A;  4Y33 A;  5I0R A;  4GMP 1;  5CG9 A;  2WS9 3;  4QQP A;  1QGL A;  3PDQ A;  4FPH A;  2BGP A;  3ACL A;  3WHT A;  4XTM A;  5EWS A;  2ZTN A;  4DRR A;  1DCS A;  1FPN 3;  4GUL A;  1W9Y A;  3CL1 A;  1RVF 3;  1A8D A;  5CFD B;  1GNH A;  3ZIX A;  4IE5 A;  1VBA 3;  3RJR A;  1H9P A;  1FPN 1;  1TG7 A;  5C3P A;  1GUI A;  3BUC A;  5LY1 A;  3WF0 A;  1DLL A;  2YC0 A;  2CHH A;  1AR7 1;  4GH4 B;  4RHV 3;  1UKG A;  4Y5S A;  4XF1 A;  2QZ3 A;  3RS6 A;  4OHX A;  5HCA A;  3MYX A;  5CBL A;  5JVV A;  1SQ4 A;  5IT6 A;  3WUD A;  4DEV A;  1O59 A;  5FV3 A;  4W6W A;  5FZH A;  4D94 A;  1JI6 A;  4Q4X 3;  5FXX A;  3FZ3 A;  1FNZ A;  2OVU A;  4XZP A;  2XUM A;  4ET7 A;  4W6X A;  3WQB A;  5ABJ C;  5JZG B;  3C8X A;  1PK6 B;  4QGN A;  4NHK A;  3TEY A;  1ZBA 3;  1B35 A;  1W90 A;  1ZBE 2;  3A0K A;  5EZW A;  4AVT A;  3POB A;  2J7M A;  4UBG A;  4DUX A;  4FTB A;  1Q8S A;  2E31 A;  3UET A;  3MBW A;  3HR9 A;  2E7Q A;  2VZ1 A;  3PJY A;  1W2T A;  2NMO A;  1KDK A;  3N9M A;  4V2W A;  1BYH A;  4ISQ A;  2R07 1;  3V0B A;  4RN5 A;  3SCG A;  4CCM A;  3JD7 1;  4KWU A;  5GZF A;  1KRI A;  3UK9 A;  1J58 A;  4COV A;  3ZYH A;  3OBT A;  2FDI A;  3WQ1 A;  4MZU A;  2G19 A;  2VOW A;  3BB6 A;  4LHL A;  1OA2 A;  1O4T A;  4YW7 A;  5LAT A;  1RUD 1;  3DXT A;  1NUK A;  4FPL A;  4FTE A;  4ZU4 A;  2B39 A;  1A3K A;  2QQJ A;  2X5I C;  3I2D A;  1L7L A;  4Q0U A;  4TXW A;  4J1W A;  2GNT A;  3PIJ A;  5FUI A;  1APN A;  5CEH A;  2FQP A;  1YXW A;  2A6W A;  2VZO A;  2ZEW A;  4JTO A;  2YC4 A;  4YG3 A;  5EJZ B;  3TOJ A;  4CPB D;  5L7O A;  3HPN A;  1XSQ A;  4XUT A;  1BEV 2;  2A6Z A;  2ZGP A;  3ZXA C;  5JAX A;  4RSU A;  1MS4 A;  2GC3 A;  4XMA A;  5FLJ A;  1R1A 2;  4HT1 T;  4KWK A;  4UW4 A;  3IAQ A;  1QOO A;  4UFK A;  5IK5 A;  1OF3 A;  1L7Q A;  1MVE A;  1PZ8 A;  1BJQ A;  3MIH A;  4MXW B;  4Q4W 1;  1CPN A;  2WBK A;  1Q3E A;  4JDM A;  3NST A;  4RGG A;  5F3I A;  3VDC A;  4A7K A;  1WCU A;  1PGW 1;  5A7W A;  4M0N A;  4N9I A;  4XHX A;  2XJS A;  3I2F A;  2Y6L A;  4IQP A;  1KS5 A;  3VHO A;  2W92 A;  1XNK A;  4I30 A;  5FRE A;  1UD1 A;  1CES A;  1CZS A;  1M06 G;  4L2N A;  3WEZ A;  3J8F 2;  2ZAA A;  5KHK A;  5HCB A;  1GYK A;  1UX7 A;  2RDN A;  4YPJ A;  2ARX A;  3ZKU A;  3UYJ A;  4CEY C;  3BPZ A;  4QQL A;  3H1M A;  1EY2 A;  5GZE A;  1PK6 A;  1NLR A;  3AMP A;  4CCJ A;  1W39 A;  1HXS 3;  4NWV A;  3KF5 A;  4GAZ A;  1X82 A;  3E6C C;  3K75 B;  2XL9 A;  1VRH 3;  2E51 A;  4LBO A;  1HB3 A;  1PNG A;  1OH3 A;  3NV2 A;  4BYY A;  4BQ3 A;  4CDX B;  1ZYB A;  5CNA A;  2XKP A;  4RGK A;  2HYK A;  1CN1 A;  2O8Q A;  1TME 2;  4WVM B;  4AAX A;  5J1X A;  4XJ9 A;  3MW3 A;  4N7U A;  3T0B A;  2N7G A;  4E27 A;  4FAG A;  3FLR A;  1G9A A;  3AYC A;  3ZFF B;  4NID A;  1W6O B;  4SLI A;  2OYZ A;  4LK7 A;  1GQG A;  4TN7 A;  3WW2 A;  4BH9 A;  2ARE A;  2P3K A;  4TWT A;  4Q4V 1;  4MAD A;  1RUJ 2;  3OEA A;  3CHX A;  3LA2 A;  1NY7 1;  4P00 B;  4JDN A;  5T5O A;  4BLJ A;  1V6L A;  2FZ1 A;  2XB6 C;  1J3R A;  3TNP B;  4CCN A;  4EZ4 A;  1OSG A;  3VDD C;  5JWP A;  5F1R A;  1MZ6 A;  1AF9 A;  1T6G C;  3PUS A;  2VY0 A;  5A6Y A;  4GH4 C;  4LBM A;  1A78 A;  4QKB A;  3SNM A;  1WWY A;  1H4H A;  2R04 2;  3VL8 A;  5LA9 A;  3VBU A;  1NQD A;  4JQR A;  3H42 B;  2VZP A;  2VZS A;  3ZFG B;  3M2M A;  1LEC A;  4QDQ A;  4CRQ A;  2AAC A;  2DYC A;  2PAE A;  2WC2 A;  2ADE A;  2VPV A;  4LLO A;  1LOF C;  5GLZ A;  3NJZ A;  2YMZ A;  3T2P A;  3UT0 A;  3SLI A;  5FYS A;  2FDG A;  1YRZ A;  3MHZ A;  4CP0 A;  3IWZ A;  5BNO C;  2CGN A;  2PFW A;  4QX5 A;  1MZF A;  3KLS A;  4GKX A;  3ZFF C;  4FAH A;  1Q5O A;  1SEF A;  2IVI B;  1WBL A;  1HRV 1;  2RHP A;  1DFQ A;  2MNG A;  5A7Q A;  5A7P A;  3RZZ A;  5FAX A;  4NRP A;  4WM8 B;  3VBU C;  2XQX A;  4DXZ A;  5CG8 A;  4QPI A;  2L9L A;  2FZ2 A;  2R06 1;  1VLN A;  2ZEY A;  3IMN A;  4QQ2 A;  1DIW A;  4RQP B;  5AFE A;  2X10 A;  2RMU 3;  3ZXE A;  2YRO A;  5KC5 A;  3N9P A;  1O3T A;  3AKS A;  4OCT A;  4QXB A;  2E26 A;  1SAC A;  2D40 A;  3OGV A;  3U4X A;  1W6Q B;  3OSD A;  3HD8 B;  5FP4 A;  4C0B A;  3ASI A;  2WKK A;  1FNY A;  1GNZ A;  3FX3 A;  3KV5 A;  4XJA A;  3C3V A;  3DPR A;  1RUN A;  4YZ5 A;  4NWW A;  3LE0 A;  1C8M 2;  1HQW A;  1QJX 2;  1L3J A;  4ISR A;  4IGQ A;  3KGZ A;  2WAA A;  1VJ2 A;  1GP4 A;  1Y7B A;  2B9U A;  3IZO A;  1BBT 3;  3M3Q A;  2YUE A;  4JGZ A;  3VDD A;  1UOJ A;  2C24 A;  1N1V A;  2WAB A;  3AJZ A;  5E8A A;  2J1S A;  2VCB A;  1OXC A;  2NYY A;  2PLV 3;  1RMU 2;  1GU3 A;  1XE8 A;  4HMZ A;  1U5Y A;  1KS4 A;  3DYP A;  1URX A;  2EAL A;  1WGP A;  4LTA A;  2VTX A;  2F4L A;  2R6Q A;  1ND3 B;  4XHB A;  1XSR A;  3NW4 A;  4RHV 2;  2XLF A;  5DAP A;  1AR9 3;  1YFX A;  1UXZ A;  4YWA A;  4LOR A;  3GJB A;  2VZQ A;  3FN9 A;  2FHR A;  2XQR A;  2R0H A;  4CP2 A;  3IDE A;  4LE4 A;  3VBS A;  2QKD A;  1AR7 2;  4HBN A;  1GWK A;  4DMI A;  1W8T A;  5FO7 B;  1HLC A;  2JJ6 A;  1NXM A;  3OOX A;  4OZX A;  2GC0 A;  5ERL A;  2OII A;  1HRI 2;  1GFF 2;  1BHG A;  3SKJ E;  2JDY A;  4CEY A;  4Q4W 3;  3FHQ A;  4FBF A;  2DCZ A;  4JVA A;  4DNY A;  1AR9 2;  3WNX A;  2RMU 1;  4BA6 A;  1H9W A;  5FZ1 A;  1STM A;  2JEN A;  2OQ6 A;  1K42 A;  1XNT A;  2VVD A;  5FRA A;  3AKP A;  4I2O A;  5A7W B;  2RDR A;  4HVO A;  3ACH A;  3HEI A;  1UL9 A;  2R0F A;  1CX1 A;  1KDM A;  2CAU A;  1UY1 A;  3P6B A;  3RGB A;  3I97 A;  2ZXQ A;  1OI6 A;  3I2O A;  2OXB A;  2H0V A;  2AH2 A;  4PDW B;  5IK8 A;  5F5A A;  5FYV A;  1MEC 2;  2V5Y A;  3LOB A;  1CAU A;  2V5D A;  1UY0 A;  5LRS A;  2DU0 A;  2DTY A;  2PXJ A;  5FPB A;  4CUC A;  3S7E A;  4JGY A;  3S0M A;  4Q4Y 3;  2P17 A;  3JD7 3;  4YVS B;  5JXI A;  2GC1 A;  4H14 A;  1BZW A;  3T2O A;  3M1H A;  4YGB A;  4BIF A;  5GLW A;  2XH6 A;  1LRH A;  3AKT A;  5FZA A;  2YGL A;  3T3Y A;  4DXS A;  1O8P A;  4DEQ A;  1QOT A;  2ZZQ A;  4ZU7 A;  1ZNP A;  4B4R A;  1F4H A;  4Q2F A;  4AE2 A;  3ES4 A;  4JV4 A;  3DEC A;  5BUV A;  4ORF A;  4L9B A;  2X53 S;  4I0B A;  1QHD A;  4AHY A;  1V6J A;  3OBR A;  5K0U A;  3S6P A;  3HN1 A;  2VZ3 A;  4LOS A;  4CU8 A;  3LEI A;  4K21 A;  3RWN A;  4XYX A;  3PME A;  3U10 A;  5IAX A;  5IFT A;  4ONU A;  3E6B A;  2A75 A;  4HK9 A;  4AQ2 A;  1H1M A;  5BNO A;  1FMD 1;  4A44 A;  3HOB A;  5KC6 A;  2ZEX A;  1RHI 2;  5E6H A;  2Q1Z B;  1WLW A;  3I8T A;  4A6O A;  3H9A A;  4QM9 A;  1JXN A;  1DGR N;  1H2N A;  1ND3 C;  3N7M A;  2WII B;  3ZDS A;  3UJQ A;  4CU9 A;  3OD4 A;  1TZO A;  2YYO A;  4PBO A;  3SQO A;  1RUH 3;  2EIE A;  1VB4 A;  5DDJ 1;  2QQM A;  2VOK A;  1JZ2 A;  1XE0 A;  2RV9 A;  3IM0 A;  4LT5 A;  1CIY A;  1HQL A;  3NNJ A;  1MEC 3;  3D0S A;  3ZFE C;  2I07 B;  3CQO A;  3V65 A;  3VBH A;  4Z8B A;  5CFC A;  4YVW B;  1F15 A;  3FJS A;  1FYU A;  1VIW B;  1Y4W A;  4CDU C;  1ST8 A;  1IS6 A;  1D4M 1;  2CV6 A;  5AVA A;  3D4K A;  1A6C A;  2WNU A;  4E2Q A;  4WVM A;  3P5B A;  1EV1 2;  2FMY A;  4RR3 C;  4B8E A;  1W9W A;  5E16 A;  4CEW A;  1LEM A;  4P02 B;  2ES3 A;  1MAC A;  2VUC A;  1DYK A;  4MGK E;  1EPW A;  4QKD A;  4AYU A;  4D7Y A;  1UMH A;  1ZRC A;  3MZH A;  4BB3 A;  4AFA A;  2R07 3;  5EFU A;  5JOY A;  3JB4 C;  5LB6 A;  1W8F A;  3MFC A;  2JIJ A;  2Z2S B;  4IEQ A;  5LBB A;  5DUX A;  4I09 A;  4HN1 A;  5JMC A;  1N1Y A;  1AZD A;  4AFD A;  4QXK A;  2JE8 A;  3NWK A;  1W05 A;  5FY9 A;  4OMC A;  5A32 B;  1QJU 2;  2D6K A;  2KM2 A;  4LUL A;  5FY4 A;  4U2A A;  5LZ6 A;  1RUC 1;  2RDQ A;  1VRH 2;  3JZV A;  2JEC A;  2RS3 2;  1CAX B;  3T4V A;  4RA0 A;  1W99 A;  4V1P A;  4XZU G;  1NA1 B;  2R07 2;  3SCF A;  4CDQ C;  2BU9 A;  2WLQ A;  5A6X A;  1RXG A;  4XAB A;  1R09 2;  5FLI A;  3ZLI A;  5LWB A;  1JOD A;  3UES A;  4D7T A;  5BNQ A;  5T50 A;  2P3I A;  2XL7 A;  1EAH 1;  1O6U A;  3UKV A;  2NMN A;  1DGW A;  4UOJ A;  4JGY B;  1G9F A;  4E4D X;  1UMI A;  2QDR A;  4YM2 A;  3UGF A;  3AP5 A;  3U75 A;  1J84 A;  2H6B A;  3AX4 A;  2OZJ A;  3RYP A;  1VAL A;  1W2A X;  2HWD 3;  2XOM A;  1PVC 1;  3I3D A;  3VBO A;  3QBQ A;  1HV1 A;  5LEJ A;  2GME A;  3VBH C;  2BFU L;  5F3G A;  4LBK A;  1ZM1 A;  1UIK A;  3QD6 A;  2C1F A;  4IER A;  4CDU B;  3A21 A;  3WNP A;  4M3C E;  3U0Z A;  4TZD A;  3AL6 A;  2LS6 A;  2A73 B;  2JDP A;  1DBN A;  2CDO A;  4MX3 A;  1LOC A;  1D0H A;  4YRD A;  1UOF A;  3ZFE B;  1LHN A;  5FWJ A;  2VMD A;  2K46 A;  2JDN A;  2OZ6 A;  2XLA A;  4HPK A;  3WNN A;  3VBF C;  2IFR A;  1IS3 A;  3H50 A;  5JZG C;  2QQI A;  5J3U A;  5FZ6 A;  3SEP A;  1DZR A;  4A6S A;  3VD9 A;  1ASJ 3;  3MW2 A;  4LKS A;  2CNA A;  4XQD A;  2EAK A;  4BM8 A;  4B29 A;  1DZQ A;  1R08 2;  2WWS A;  4FTS A;  4JRL A;  4M4R A;  1LHV A;  2WR9 A;  3POI A;  5IHR A;  2FDF A;  4L99 A;  2VUD A;  2WZR 3;  5C3R A;  1E5H A;  4DY5 A;  1PMI A;  1U5X A;  3IB3 A;  1JUH A;  4LKF A;  2HWB 3;  5F7U A;  1W6M B;  5F9T A;  2D43 A;  1QQP 3;  1NLS A;  5DAW A;  4YYO A;  3KZ4 C;  5FBJ A;  3N9Q A;  1ALY A;  5LY2 A;  1ZBA 2;  5A3T A;  2VJX A;  1TE1 B;  4Y1Z A;  4BQ2 A;  3BU7 A;  3MID A;  4PLN A;  5CAD A;  4OHY A;  4J1X A;  2QQK A;  4XAE A;  1VBA 2;  2BWC A;  4MGZ E;  1H8V A;  3SHR A;  2ZGL A;  2A3Y A;  1LAJ A;  1QQP 2;  3POS A;  5FTT C;  3OF1 A;  2EXH A;  1JU4 A;  1VMJ A;  4LBQ A;  4BMB A;  4EYU A;  1GV9 A;  4NN0 A;  2R49 A;  1SG3 A;  2VCA A;  4NHM A;  5E89 A;  3BTY A;  3WG3 A;  3N3H A;  5C9A C;  1T2X A;  1F9K A;  4QT6 A;  5IFP A;  2VGD A;  2R04 1;  2O0O A;  1D4V B;  2WRA A;  4CTE A;  3AVR A;  4XDP A;  5FYU A;  3J7M A;  4BDV B;  1F5F A;  3CBN A;  4QPG B;  3OEB A;  2BNN A;  1RUF 1;  2Y0O A;  1VBE 3;  4R9B A;  1W8H A;  4IE0 A;  2OQ7 A;  1QJY 1;  5FZO A;  1GQP A;  2PN5 A;  4CUA A;  2TNF A;  3AMQ A;  3NAP B;  5ANQ A;  3AC0 A;  3J26 N;  4Q4X 1;  3BAL A;  1ZA7 A;  4CCC A;  1XND A;  5FPX A;  2ZGN A;  3DGT A;  1UYX A;  3IPV A;  1FI2 A;  3B3Q E;  2I45 A;  1IKP A;  2WZE A;  3FBM A;  4X6Q B;  3OTF A;  2XXZ A;  5A7O A;  3DPR B;  3H3L A;  3MV0 1;  3PU8 A;  4XUR A;  2DCJ A;  1ZRE A;  2RM2 2;  3LFI A;  4HKW A;  2QQL A;  4KBB A;  3OG2 A;  4NRO A;  5EQU A;  1S0F A;  2D6P A;  2Z79 A;  4P9W A;  5FZE A;  3VZO A;  4ASM B;  5F3C A;  1O3Q A;  4OHZ A;  4XBN A;  4FPG A;  3WP4 A;  2ZGO A;  1JHN A;  5LA2 A;  5LBE A;  4LBQ B;  5J37 A;  1OFN A;  3HT2 A;  4FCA A;  4LEJ A;  2PQS A;  4RS5 C;  1K45 A;  4QX8 A;  5FUP A;  4IEU A;  4E8C A;  1ZRR A;  2RJK A;  3GZT B;  4NPR A;  4BIO A;  3BU0 A;  1MQT B;  1G9C A;  1C4R A;  2HYX A;  3HBZ A;  4BQY A;  4AEM A;  1I5Z A;  1F4A A;  1AJO A;  1PVX A;  2ADD A;  1OVS A;  4EE2 A;  4QB1 A;  1OOP C;  1WCS A;  3RMY A;  3TNQ A;  2YFU A;  3J4U H;  3I3E A;  4MGQ A;  3R4S A;  1IKQ A;  3FE5 A;  2VW1 A;  4IE7 A;  2ARB A;  5JI9 A;  3HVD A;  4XBQ A;  1OLM A;  3ORJ A;  2BNO A;  4ARY A;  1NCR B;  4XF3 A;  4O61 A;  4XQW A;  4AGG A;  3R4D B;  4MLO A;  1JHJ A;  4C8D A;  4CDX A;  3ZYI B;  1ODN A;  1Q8O A;  1LKN A;  1SFP A;  4NHL A;  4QDR A;  4XXA A;  1ODM A;  3VBO C;  5CKN A;  3PIG A;  3I59 B;  1VPH A;  1C5I A;  3SH5 A;  2JB4 A;  5FUN A;  1VBE 1;  2AC1 A;  5H9Q A;  1MS1 A;  2R32 A;  3AZV A;  4JX0 A;  5LW9 A;  4RQP C;  2VW0 A;  3WW3 A;  3BOD A;  5I91 A;  4EWA A;  2PYT A;  3RNS A;  1QOS A;  1E5I A;  5DAB A;  1JYN A;  1VBC 2;  4MV2 A;  4CXW A;  5C9A B;  4XEZ A;  2WZ8 A;  1OPM A;  1XNB A;  2Q4S A;  3C2U A;  4OI1 A;  4EN7 B;  5L9R A;  2VZR A;  2B9V A;  2V72 A;  4HON A;  2RS1 2;  2YGM A;  3NMB A;  4LHN A;  2WO7 A;  3AZZ A;  3ZX7 A;  2VQT A;  1YQ6 A;  3SH3 A;  2RMU 2;  1W9T A;  4EN0 A;  1MS8 A;  1COV 3;  1E57 A;  3ZYG A;  2FCU A;  1W6M A;  1IS5 A;  1V9U 1;  4L97 A;  4RR3 A;  4CDW B;  2RVA A;  2WQ4 A;  2XON A;  3H0O A;  3OCP A;  2RR1 2;  3QH7 A;  1HJF A;  3NQH A;  3VD7 A;  5FZD A;  1W03 A;  2O1Q A;  5FXZ A;  2EVX A;  1RUE 1;  3HQR A;  5F5Q A;  4NAM A;  3MLL A;  4ZZ5 A;  4PHZ A;  2VUJ A;  4I02 A;  3TN9 1;  3POW A;  2WNO A;  3DL3 A;  4FPE A;  4IEO A;  3EHK A;  1V6I A;  3ZSK A;  1V0A A;  4W4Z A;  5C8C C;  1R1Z A;  4MYE A;  3ZXD A;  2PHU A;  2XDV A;  3PVE A;  2WT0 A;  4IES A;  1OF4 A;  2D98 A;  3BTA A;  1IG3 A;  4ASL A;  4BCU A;  3W5M A;  4Y1X A;  3C7E A;  3WOG A;  4D69 A;  2IXC A;  3K51 A;  3LZZ A;  1ZBA 1;  3L2H A;  4DZG A;  3O1U A;  3VKN A;  1POV 3;  4CDU A;  4W50 A;  1S1A A;  3AZW A;  5KHI A;  2ATF A;  2E33 A;  4N43 B;  3KQR A;  5JLV A;  4ASK A;  4YW4 A;  1RUI 1;  4AXO A;  1AYN 3;  5FKC A;  3E5X A;  4FSJ A;  1UU4 A;  1JZ7 A;  3ZKY A;  2BZD A;  3O7O A;  1BEV 1;  4MET A;  4KL1 A;  2F17 A;  2JDK A;  2Q30 A;  2WT1 A;  1SDW A;  4YZ2 A;  2GP3 A;  3DYO A;  3ZR6 A;  4YW2 A;  2W46 A;  4XAC A;  3O1P A;  2NP0 A;  1GMM A;  2GN3 A;  3B5L B;  2VL4 A;  2A3X A;  2ZHK A;  2ZJC A;  1WZX A;  1JU3 A;  3G6J B;  3N36 A;  3DUI A;  1UZ0 A;  2PHX A;  2YDE A;  2BW8 A;  1XB9 A;  4FQ4 A;  4QX1 A;  2VNO A;  3WDT A;  1UF2 C;  4ARX A;  1CON A;  1ACC A;  1UO9 A;  3R0R A;  2J1V A;  3ILF A;  1DHK B;  4QXH A;  4XW3 A;  1KFX L;  1UKR A;  5B4N A;  3NV4 A;  4AI9 A;  3PU3 A;  3CEW A;  1LHO A;  2W9X A;  2FDH A;  2CWM A;  5CFC B;  5HCH A;  1ZZ9 A;  4AFM A;  1XBF A;  2XJU A;  4IV1 B;  5DDJ 2;  4YSF A;  1A34 A;  4UXA A;  2YBP A;  1HX6 A;  4Q4X 2;  3GBW A;  4Z92 B;  3ZR5 A;  2JG9 A;  3GBG A;  3IDB B;  3GAL A;  2D3S A;  5L73 A;  3UV9 A;  2BER A;  5ISL A;  1HB2 A;  4KGQ A;  3WW1 A;  2V4A A;  1SMV A;  3T2Q A;  3VZM A;  5KXE A;  5FZ7 A;  3MUY 1;  1H4G A;  3B93 A;  2A5Z A;  3NL1 A;  5F39 A;  1BK1 A;  2JDM A;  4DRV A;  5L7O B;  1GOF A;  5JMO A;  1PZ9 A;  2CY6 A;  2RM2 1;  2D6N A;  4XF4 A;  1TME 1;  2JDH A;  4GD4 A;  1PIV 1;  2WN3 A;  2ZCW A;  1NZC A;  1UAI A;  2HWF 1;  2B42 B;  2EXK A;  2X5I B;  3C7F A;  4IEY A;  1Z7S 2;  1SDD B;  4I0W B;  1HV0 A;  3CIH A;  3P3N A;  1XYP A;  4Y1V A;  4BQ5 A;  4JAA A;  1BXH A;  4IV1 A;  1HJG A;  4PLM A;  3QCW A;  4IEZ A;  4CCK A;  3OYW B;  2XVK A;  1RUC 2;  1JMU B;  1D0G A;  1RUE 3;  2RJL A;  4PIY A;  5FPV A;  2RS3 1;  5FFO C;  4ATF A;  4CA9 A;  2ZMN A;  4EV0 A;  4BME A;  3UKN A;  4B4Q A;  5ABJ A;  5LBC A;  1MS3 A;  3FFQ A;  2WAO A;  1DG6 A;  2ZPX A;  4GWM A;  4PLO A;  3ZN6 B;  4BK4 A;  4XVH A;  2PEL A;  1JW6 A;  3VBS C;  1LGC A;  5SV8 A;  5C4W B;  2HBT A;  4GMP 0;  2WUH A;  4S2G A;  2BTV C;  1ZRD A;  1JS9 A;  2D6L X;  4QX2 A;  4EN8 B;  5K7P A;  2WL1 A;  4NAO A;  2I74 A;  5FYM A;  2ZX4 A;  4UFH A;  4WVZ A;  1GSL A;  2EIG A;  4Q4Y 2;  2XWJ B;  4DOU A;  3HBK A;  2JWP A;  4YW1 A;  1VBC 1;  5A80 A;  5C8C B;  1DDL A;  2KD7 A;  5DUW A;  1LNS A;  2JE7 A;  3JBG 2;  4MGT A;  1BVP 1;  3AMM A;  3C7G A;  5F3E A;  1RUH 2;  2JIG A;  3JQW A;  3SIS A;  1FOD 1;  4A7Y A;  3GNE A;  2WNV A;  3E97 A;  3I7D A;  3T09 A;  3ME2 A;  1W6N B;  1KXG A;  1DQ2 A;  1PO1 1;  4IEP A;  1AR8 3;  3N9L A;  4LO4 B;  3GXU A;  3J8F 3;  4QPG A;  3CDZ B;  4CU6 A;  3ZSM A;  4QPI C;  3RFR A;  1ENS A;  4JGY C;  1WLC A;  2BV4 A;  4LBL A;  4H7M A;  5FYZ A;  3C7H A;  5FP7 A;  3AYD A;  4AFB A;  1Q8V A;  2B8M A;  4RR3 B;  5AC9 1;  3CZU A;  3TYJ A;  4V2V A;  4FI9 A;  3U37 A;  4QMA A;  3TN9 3;  3B00 A;  1NA1 C;  4AQ6 A;  4XJZ A;  4BOW A;  3L9J T;  4QHO A;  2IXL A;  4AGV A;  3KCX A;  1SFN A;  4F83 A;  4AI2 A;  3PL0 A;  4R9A A;  1KD7 A;  2ZAB A;  4XFI A;  4D6Q A;  1LOD A;  1VRB A;  4IND A;  4QHZ A;  5EXO A;  1AUY A;  1VBD 3;  3TEW A;  3GZE A;  3SCH A;  3O1O A;  1O7F A;  3ZYP A;  2WLP A;  3LIH A;  2VOV A;  3GZU C;  4HLT A;  1QNY A;  3URF A;  1C8M 1;  2FDJ A;  4JRA A;  1Q56 A;  4XTP A;  3ATG A;  1IS4 A;  1REF A;  1W6Q A;  2WNU C;  4B1M A;  4IXL A;  2XPJ A;  2LUW A;  3RRD A;  1ZRI A;  3O0X A;  2WO1 A;  1XPW A;  1H8T B;  3MIF A;  2ZBJ A;  3CNA A;  2XUE A;  4Y26 A;  3J7H A;  1BBT 2;  1PM4 A;  3MI8 A;  4W6Y A;  2A6V A;  1CVN A;  2RS1 1;  2VAU A;  2R1B A;  1I9R A;  4K7J A;  3U1X A;  4AEJ A;  1AR9 1;  4PQ9 A;  4Q26 A;  3HNY M;  4HOO A;  1IQA A;  1Y3T A;  1AX0 A;  5C3O A;  3LPF A;  4D3W A;  3J8F 1;  4KWL A;  4Q0V A;  5LBF A;  3PJQ A;  5C5T A;  2OA2 A;  2RDS A;  4MGS A;  2E9Q A;  4FOW A;  5IW0 A;  1S2B A;  4AHX A;  1O5U A;  4Y20 A;  2DCY A;  3CO2 A;  4YM3 A;  4NOT A;  3OB8 A;  1W0O A;  1S55 A;  2JDZ A;  5D8A C;  1QF3 A;  1VBD 1;  2XHK A;  1G6N A;  4JKK A;  4XJU A;  4ZU5 A;  4AI1 A;  2WZR 2;  3ACG A;  4J6G A;  5FY0 A;  2D5H A;  4LR4 A;  1RED A;  1UPS A;  1H2L A;  4CDQ A;  1SCR A;  4CYD A;  4Y4R A;  1X7N A;  4PJY A;  1W9S A;  3LCP A;  1LHW A;  5FMD A;  3WG2 A;  5FZ4 A;  1RJ7 A;  3EO6 A;  3LDR A;  2W91 A;  3N7K A;  5FQ0 A;  1KEX A;  2VMH A;  3M3O A;  4DUV A;  4OI0 A;  4D6R A;  3E5Q A;  1GOG A;  3PNA A;  4Q4V 2;  1Y9G A;  3KB5 A;  5LAS A;  3W9A A;  4URT A;  3Q8E A;  5IAV A;  3WDX A;  3WW4 A;  3AZY A;  3NV1 A;  2YU1 A;  3BIW E;  2XJV A;  2AZ5 A;  1CAX A;  3DN7 A;  4HSJ A;  5L7O C;  3ZFF A;  2NN8 A;  4QGM A;  3M3C A;  2AEZ A;  3HMY A;  2C4X A;  4M01 A;  1HRI 1;  1UCX A;  3M4F A;  3IKW A;  3TEZ A;  4OUM A;  2X5I A;  4YM1 A;  3THT A;  4LA2 A;  3W59 A;  2X09 A;  2DCK A;  5EP9 A;  3VBR B;  1ULC A;  4JDO A;  1ENQ A;  2JXA A;  5I0T A;  5C4W A;  2QZ2 A;  3PUQ A;  3I3Q A;  2ZZJ A;  4Q0Q A;  4U36 A;  5K4L A;  4CP9 B;  3K48 A;  4ZS2 A;  5CFC C;  2OX0 A;  2OS2 A;  3FBY A;  4LUK A;  4YW6 A;  1KGY A;  2G4I A;  1JZ4 A;  3S7I A;  4AI3 A;  2WFF 3;  4QX3 A;  4CCE A;  4FT8 A;  5D1I A;  4KG8 A;  2CDP A;  1OPO A;  4PCR A;  3T0D A;  2IFW A;  3O1V A;  2WA4 A;  1QH7 A;  1HRV 2;  4HK8 A;  4DXR A;  4PBP A;  1MPX A;  1EUT A;  3LQC A;  4Q4Y 1;  4ZS3 A;  4UFM A;  4B3N A;  5DMY A;  5FPZ A;  2XJR A;  1I3H A;  1FMD 2;  3U11 A;  3DYM A;  4K40 A;  3GM8 A;  5FMB A;  2BBA A;  3F2Z A;  1RHI 1;  2X05 A;  5DPN A;  5G05 L;  2VXR A;  4E8D A;  5J36 A;  1ZBE 3;  5D8A A;  3HWJ A;  4P5H A;  1RHI 3;  2IXJ A;  3I2H A;  4OHW A;  1KJR A;  2VCM A;  2WSU A;  4Q0S A;  1J1L A;  2VC9 A;  3JQX A;  1AYM 3;  4LXL A;  4XDQ A;  3O14 A;  3VZK A;  4NPM A;  1POV 0;  2JG8 C;  4HAN A;  4R52 A;  3ZXK A;  1ND2 C;  2AYH A;  5HXM A;  1O3S A;  5IVB A;  1VRH 1;  3FHI B;  3IIA A;  3QAC A;  4WM7 A;  3T1L A;  3OPT A;  1UXX X;  2WFF 1;  4RFT 0;  3ZFE A;  2JG9 B;  2VTF A;  2DFB A;  2BBV A;  2OUH A;  1R09 1;  1W8Z A;  3T4H B;  3NO8 A;  3B7M A;  4DFS A;  3PUH A;  1FT9 A;  3NNL A;  4XMI A;  4IV1 C;  5FYB A;  1US2 A;  2YV8 A;  4H7L A;  1AR6 3;  4LO5 B;  2Q8E A;  3VBO B;  4Q1R A;  5DG1 A;  1R1A 3;  1LGB A;  5CVR A;  3ES1 A;  3FUO A;  5DAX A;  5DZF A;  2YBS A;  4YVS A;  1C5H A;  5G04 L;  3ZN4 A;  3RZJ A;  1RUI 3;  4MUV A;  4M3C A;  3ALQ A;  2WQ8 A;  2BVB A;  1GWL A;  5FZF A;  2XKO A;  1ZRF A;  2Y0I A;  1TQ5 A;  1T6B X;  1VAK A;  1R64 A;  4EN6 B;  3CU7 A;  3HAG A;  5D8A B;  5H9S A;  1EV1 1;  4R4X A;  3JBG 1;  4CDW A;  1PVC 3;  3BGA A;  5IWF A;  1DLC A;  1LOE A;  1RUH 1;  3JCI A;  4CCO A;  5A1F A;  5A33 B;  2QCS B;  4LIV A;  2RS5 1;  1MZ5 A;  1FV3 A;  1D7P M;  1I5P A;  3FFZ A;  3TEX A;  2RS1 3;  2HWC 2;  2GH2 A;  4O65 A;  1PGL 2;  3R4U A;  4RS5 B;  2D5F A;  1P8J A;  2QNK A;  5FZK A;  3WX5 A;  4ATE A;  4XFB A;  2O14 A;  1GP6 A;  1PMJ X;  4OZO A;  3UGG A;  1SBE A;  3VBF B;  1RL3 A;  4J25 A;  2A6Y A;  4WM7 B;  1F31 A;  5T55 A;  1FPN 2;  2DBN A;  3AFG A;  1PVC 2;  1QJU 1;  2YBK A;  1RVF 2;  2VR4 A;  1PX4 A;  3I49 A;  5AC9 2;  3LFM A;  4FOV A;  4FPC A;  4XDO A;  3I2G A;  5A7S A;  5GLT A;  3LIG A;  4N53 B;  3O12 A;  2ZGT A;  4TTG A;  4AW7 A;  5D21 A;  2E7T A;  1DQ4 A;  3SMH A;  4Y4Y A;  1UY4 A;  3OUJ A;  1F5J A;  1JOB A;  2GSY A;  5C70 A;  1NAE A;  4F8A A;  2C5D A;  3ETP A;  3MLJ A;  5E88 A;  3B9C A;  4BU2 A;  1LOB A;  1AXZ A;  4KNC A;  4QB2 A;  3GGL A;  3IDA A;  2B46 X;  4E2G A;  1IQD C;  2CWS A;  4PF1 A;  1OD3 A;  4BLI A;  4N43 C;  3DCQ A;  2UY9 A;  4FFH A;  1UOB A;  2UWB A;  2P5B A;  2DV9 A;  1Z7S 1;  4GH4 A;  4XOG A;  5CYY A;  5GZD A;  4AG4 A;  4AWD A;  5JXG A;  2WS9 2;  3N35 A;  3FHA A;  1MS0 A;  2R04 3;  2VH9 A;  2ZAC A;  4Y24 A;  4Q8L A;  2IXI A;  4K6B A;  2P6H A;  2P3Y A;  2PHW A;  4YVS C;  3WLU A;  2ORZ A;  3UGH A;  4AVV A;  1XU1 A;  1AL0 G;  1NCQ C;  1RIN A;  4K3U A;  1AR7 3;  5FQ0 B;  5BNP C;  1V9U 3;  4UI9 L;  5C5U A;  4FP3 A;  5DN2 A;  3GCX A;  5JIU A;  2P4E A;  4QWN A;  4GZ9 A;  4C0H A;  5A1L A;  4YAR A;  1XXN A;  2Y8K A;  4QKF A;  2PTM A;  2VVF A;  1LEN A;  1O8S A;  5CU1 A;  5J48 A;  2LAL A;  4FPO B;  3QH6 A;  4KMQ A;  4Q29 A;  3GJA A;  1G7Y A;  4GB3 2;  3SC7 X;  1VMH A;  2JDU A;  1TMF 1;  3MPB A;  4BK5 A;  2WJS A;  1N1T A;  2J42 A;  4E2S A;  4WM8 A;  4DXT A;  1YIF A;  3PHM A;  4XIO A;  4AVB A;  1F8V A;  1BEV 3;  2QDN A;  2D6O X;  1YLL A;  4IGP A;  2EID A;  1ASJ 2;  3WDV A;  4O7X A;  2GZW A;  3POF A;  1GZC A;  1NCQ B;  3ZYR A;  2V4V A;  3POY A;  4AZZ A;  1EYB A;  2RG4 A;  3BN6 A;  5B2G B;  5FY8 A;  1CAV B;  1XNA A;  4IE6 A;  3L2Y A;  2UWA A;  5IVY A;  1UU5 A;  4AGR A;  3KHB A;  2JKX A;  3ECQ A;  4AEK A;  4JC1 A;  5GZC A;  1J59 A;  1N47 A;  3ABZ A;  4YFW A;  4IUG A;  3BTX A;  5IVC A;  5JCT A;  2D44 A;  1R08 3;  1PO2 3;  3DEM A;  3Q8B A;  4MXV A;  1Z7S 3;  4BHP A;  2D7F A;  3CKH A;  1PO2 1;  1V6N A;  3AXD A;  4FXG B;  1YI9 A;  4B7K A;  1Y43 B;  3MLK A;  2BP6 A;  4SBV A;  2DCT A;  5DZG A;  1OOP B;  3M7A A;  1ONA A;  4URA A;  1VBB 1;  5GAL A;  4CEY B;  4JZR A;  2RM2 3;  3H7J A;  1NE4 A;  4Z82 A;  3V56 A;  1QDC A;  4OQ8 A;  1JOJ A;  1RUF 2;  1PK6 C;  4E4Z A;  3ZMN A;  1Y9M A;  5I93 A;  1H1I A;  1SCS A;  5ACA 1;  3O1M A;  2VBD A;  4WZF A;  2YY1 A;  4P14 A;  5JPN B;  1RTV A;  1ZZC A;  3KQ4 B;  3I59 A;  3I3B A;  3RZM A;  3HNM A;  3PVB B;  4MG2 A;  2ET1 A;  5T5J A;  3ZXG A;  3MIE A;  5F2W A;  1O91 A;  1OFS A;  3AP4 A;  1TMF 3;  2J1T A;  2Z5W A;  4CP1 A;  5HV4 A;  1NZI A;  4XET A;  1OUX A;  1CIW A;  2XG3 A;  3TWI A;  3V0A A;  1OQD A;  4IE4 A;  4QHB A;  5A3M A;  2R16 A;  4NO4 A;  3JBG 3;  1TVG A;  2P2K A;  2AR6 A;  4GIQ A;  5J09 A;  3ZDV A;  2VTX J;  4AED C;  5FO8 B;  2X8K A;  5DAV A;  3O0V A;  2W2I A;  1DGW X;  2D3P A;  2VQA A;  1ZZ8 A;  3KGL A;  3LB9 A;  4Q8K A;  5GLU A;  1JZ6 A;  3K77 A;  5JR2 A;  1XNC A;  2A3W A;  4E4H A;  2PHT A;  3B01 A;  4YZ1 A;  2RR1 1;  1X36 A;  1TNF A;  2MEV 2;  2E7A A;  4MHU A;  5FY7 A;  5GKA C;  3SKV A;  3ZFG C;  1RUE 2;  3WIN E;  2YZ4 A;  4NRM A;  3WP3 A;  1C3H A;  1UY2 A;  2XHN A;  1IGO A;  2JG9 C;  3GHM A;  3HT1 A;  2YPD A;  1NKG A;  2XGX A;  5F5I A;  5BNP B;  2G9F A;  3GHN A;  2DU1 A;  2BUK A;  1UMZ A;  1VBC 3;  3OUH A;  3AKR A;  1Z78 A;  2Q8D A;  4YVW C;  5FPA A;  1YWK A;  5L19 A;  4XFF A;  1YYN A;  2VMG A;  4PF5 A;  2VNG A;  5TSW A;  1S0G A;  4PQQ A;  4XPV A;  1FAY A;  5I8T A;  4X8N A;  5J98 B;  3G7D A;  4DO0 A;  5IK4 A;  4GXL A;  4HPK B;  1AL2 1;  3IAP A;  1SBF A;  3OYW A;  3P1I A;  2UWC A;  2VME A;  3Q9O A;  4YLZ A;  4DQA A;  4EWD A;  1J3P A;  2W3J A;  2Z69 A;  3K2O A;  4K8R B;  4CXY A;  2ZOE B;  1F2N A;  3M3E A;  5ACA 3;  4YZ3 A;  3T30 A;  4D8M A;  4IL7 A;  1C28 A;  2WS9 1;  4A41 A;  1QJZ A;  2W0X A;  5T5P A;  1ULE A;  1BMV 1;  2R30 A;  3PTR B;  3U78 A;  1R1A 1;  3AXE A;  3OBA A;  4XFA A;  4XUP A;  3RG0 A;  3ROU A;  1WBF A;  4A7Z A;  3BVC A;  2DF7 A;  3A22 A;  3I4I A;  5BY5 A;  3GCW A;  3IBM A;  1QJY 3;  2VUA A;  2WO3 A;  1RC6 A;  2TBV A;  5FP3 A;  1S0C A;  5F37 A;  2OPK A;  1WKY A;  4N53 A;  2WZP P;  4GQ7 A;  5FZM A;  5FZ8 A;  1YFU A;  4UFL A;  5CB7 A;  1OC1 A;  1QH6 A;  1C57 A;  1V9U 2;  5DAQ A;  3THP A;  5AC9 3;  2HWF 3;  2QVS B;  4L0P A;  3U07 A;  4FPJ A;  5A3U A;  1YQ5 A;  1JZ8 A;  1QMJ A;  4AED B;  3F95 A;  4TLG A;  3S57 A;  1JUI A;  4CSW A;  3POG A;  4RS5 A;  1J83 A;  4IEV A;  3KSC A;  3S30 A;  4WV8 A;  3FMG A;  4JKM A;  1TEI A;  4XCA A;  2WIN B;  5FKB A;  1QJF A;  1SHW B;  4RL7 A;  3U4S A;  5IK7 A;  4LBQ D;  4P9I A;  4QAW A;  1AXK A;  1AR6 1;  2EIB A;  2F4P A;  4G9S B;  1N1S A;  4CCD A;  5JSO A;  1C1F A;  2J1U A;  2DDU A;  3CJX A;  5BNO B;  1PIV 2;  3RZK A;  1RUJ 3;  1DGL A;  1WCK A;  3QOP A;  1GZW A;  3FUQ A;  2W08 A;  2HEW F;  4HSL A;  2IVJ A;  2Q5T A;  3VBR A;  2HBU A;  1AL2 3;  5F8P A;  1SLB A;  3ZYB A;  2BOI A;  4QM8 A;  5JOX A;  1H1A A;  1HKD A;  3WG1 A;  3AKQ A;  2F6B A;  3J7N A;  3WDY A;  2K0G A;  4KI5 M;  1V6K A;  2YB7 A;  4LHK A;  4MSV A;  4UWD A;  3VB9 A;  5FZC A;  4AI8 A;  5KWR A;  2VNR A;  2LM3 A;  1XJA A;  2HWE 3;  3HJR A;  2EXJ A;  4Q0P A;  3T0A A;  2XBO 3;  3H1Y A;  2R1D A;  3O1T A;  1EAH 3;  2JX9 A;  3KV9 A;  3MEP A;  3MIC A;  4MGI E;  4DIN B;  4EJR A;  1FOD 3;  1G8W A;  2UYA A;  5AFB A;  2XBO 1;  2OT7 A;  2HWF 2;  4XJW A;  5FZ9 A;  3O1S A;  3CZJ A;  5L36 A;  4BIS A;  2C6S A;  2WDB A;  1X50 A;  2HEY F;  3SH4 A;  4JHZ A;  1C1L A;  3ZPY A;  1PNF A;  5C4W C;  1KQR A;  1WLT A;  3AMN A;  5CAZ A;  1UZZ A;  2BFU S;  3I2K A;  4FQZ A;  3UJO A;  2JIC A;  5FP9 A;  1S4C A;  3N9O A;  2GND A;  2WN2 A;  1YJL A;  3VKF C;  4Y1Y A;  3KWV A;  4NJ4 A;  4AVC A;  3EMR A;  3AP9 A;  5A70 A;  1YQC A;  1K5M C;  1ENX A;  1AVB A;  1W8W A;  1UZY A;  3U14 A;  2B5H A; 
#chains in the Genus database with same CATH homology
 3FHQ A;  3K4A A;  1K42 A;  1XNT A;  3A7Q A;  2Y64 A;  3ACH A;  3FL7 A;  3HEI A;  1CX1 A;  3MO4 A;  1UY1 A;  3P6B A;  3I97 A;  2ZXQ A;  3WNK A;  3HNB M;  5LCW L;  2V5D A;  1XPW A;  2WO1 A;  1UY0 A;  4ZY9 A;  1UYY A;  4CUC A;  3MUZ 1;  3J7H A;  5JXI A;  3LEG A;  3T2O A;  4XUN A;  5LA0 A;  4DXS A;  1O8P A;  3HNY M;  4DEQ A;  2E32 A;  1F4H A;  3LPF A;  3DEC A;  4RYD A;  2Y6H A;  3E1F 1;  4MGS A;  3WNM A;  3HN3 A;  3OB8 A;  5I0D A;  3VD3 A;  2VZ3 A;  4Z2A A;  4QDS A;  4CU8 A;  4JKK A;  3LEI A;  5IFT A;  3ACG A;  2W1U A;  4PT6 A;  4A44 A;  4CU7 A;  3HOB A;  1W9S A;  3MV1 1;  2ZEX A;  1RYY A;  4A6O A;  2W91 A;  1KEX A;  3WNO A;  4CU9 A;  4DUV A;  4MO3 M;  2WYS A;  1GOG A;  2EIE A;  2QQM A;  2VZU A;  2OKX A;  1JZ2 A;  2RV9 A;  1CIY A;  3A23 A;  2C9K A;  3CQO A;  3D3A A;  3III A;  4A4A A;  2RJ2 A;  4ZXE A;  2C4X A;  3VD4 A;  1W9W A;  4P02 B;  2X09 A;  2DCK A;  1W0N A;  3WF4 A;  3C7O A;  1UMH A;  3LEK A;  3EB7 A;  4GWI A;  2QBX A;  1KGY A;  4LQR A;  4DUW A;  1JZ4 A;  4QX3 A;  2JE8 A;  2CDP A;  4OMC A;  4JKL A;  3T0D A;  1H6X A;  4D0Q A;  2EIC A;  4OYU A;  2J1E A;  4DXR A;  1MPX A;  1EUT A;  3LQC A;  5C7G A;  1W99 A;  4XZU G;  5DMY A;  3CMG A;  1JYW A;  4QX0 A;  1DYO A;  1PX3 A;  3DYM A;  3GM8 A;  3UES A;  2BBA A;  3F2Z A;  2X05 A;  5DPN A;  3W5N A;  5G05 L;  4E8D A;  4UOJ A;  2VCC A;  2BGO A;  3I2H A;  1GOH A;  1UMI A;  5EIY B;  2VC9 A;  3T08 A;  3VD5 A;  3VDA A;  1J84 A;  2VOT A;  4XUQ A;  5JXH A;  2JD9 A;  2XOM A;  2WO2 A;  3I3D A;  5HXM A;  2VM9 A;  1UY3 A;  2JDA A;  3ZM8 A;  3GDB A;  1UXX X;  1H6Y A;  2VTF A;  3A21 A;  3WNP A;  5IJR A;  2LS6 A;  1OT5 A;  2CDO A;  3PUH A;  2VMD A;  3LPG A;  3WNN A;  1US2 A;  4OMD A;  1DP0 A;  2QQI A;  4QB6 A;  3ACI A;  2J1R A;  3WF2 A;  5G04 L;  2J1A A;  3SEP A;  1JZ5 A;  3VD9 A;  3WF1 A;  4LKS A;  1K3I A;  2VMF A;  4BJ0 A;  2WQ8 A;  1CZT A;  4M4R A;  3I2I A;  5IHR A;  1L7R A;  1R64 A;  2YC2 A;  3ACF A;  2VZT A;  2Y6K A;  3IB3 A;  5F7U A;  3BGA A;  1YQ2 A;  4LPL A;  1DLC A;  5LA1 A;  4UAP A;  1CZV A;  1W8O A;  1D7P M;  1I5P A;  2VJX A;  4GWJ A;  5JUV A;  1P8J A;  3NRU A;  2W47 A;  2QQK A;  4OZO A;  1PMJ X;  3WF3 A;  4QPW A;  4A42 A;  3K46 A;  2VR4 A;  1PX4 A;  2VO5 A;  3NJX A;  1JU4 A;  3I2G A;  1SG3 A;  2VCA A;  4TTG A;  3K4Z A;  2W1Q A;  5IYY A;  1T2X A;  5IFP A;  1K12 A;  3OGR A;  1UY4 A;  2W95 A;  3VDB A;  5C70 A;  4BDV B;  1NAE A;  1GNY A;  3ETP A;  3OEB A;  4QB2 A;  3GGL A;  4OUE A;  3IDA A;  1IQD C;  4PF1 A;  1OD3 A;  5CZK A;  1GQP A;  2W1S A;  4A3Z A;  5CYY A;  4CUA A;  5JXG A;  2ID4 A;  1PMH X;  3AC0 A;  4AG4 A;  1UYZ A;  3FHA A;  1UYX A;  1ULP A;  2ORZ A;  2WZE A;  4UI9 L;  4MOA A;  3MV0 1;  1HN1 A;  4XUR A;  2DCJ A;  2VMC A;  5DN2 A;  2QQL A;  3OG2 A;  4GZ9 A;  4P5Y A;  2QQO A;  3I2J A;  2Y8K A;  5LA2 A;  2BGP A;  1O8S A;  3UNP A;  2PQS A;  4KMQ A;  1K45 A;  4E8C A;  3NNG A;  4BK5 A;  2HYX A;  1TG7 A;  4DXT A;  1GUI A;  3WF0 A;  1F4A A;  2VZV A;  2EID A;  4QB1 A;  2YFU A;  3I3E A;  4MGQ A;  2V4V A;  5C71 A;  1WCQ A;  3BN6 A;  1XNA A;  4ARY A;  1O59 A;  4DEV A;  1JI6 A;  2JKX A;  3ECQ A;  2W5F A;  1JHJ A;  3ABZ A;  4ET7 A;  3WQB A;  4QDR A;  4IUG A;  3C8X A;  3K4D A;  1XC6 A;  4JX0 A;  4DUX A;  2J7M A;  2YFZ A;  2E31 A;  3CKH A;  3UET A;  3MBW A;  4CU6 A;  2VZ1 A;  2YG0 A;  1JYN A;  4LHS A;  4RN5 A;  4KWU A;  2WZ8 A;  2QQN A;  3NJV A;  1ULO A;  2VZR A;  2B9V A;  2V72 A;  2VQT A;  1W9T A;  1NUK A;  1US3 A;  4ZZ8 A;  2QQJ A;  4TXW A;  2RVA A;  2XON A;  5FUI A;  2VZO A;  2ZEW A;  3I3B A;  2YC4 A;  5EJZ B;  3HNM A;  3NQH A;  3VD7 A;  3HPN A;  4XUT A;  3EYP A;  4ZZ5 A;  2B4K A;  5DQ0 A;  2J1T A;  3IAQ A;  2R7E B;  1OF3 A;  1L7Q A;  2J22 A;  4W4Z A;  3WSO A;  2WBK A;  3VDC A;  1OF4 A;  3I2F A;  3W5M A;  2Y6L A;  1TVG A;  3C7E A;  1JYV A;  2W92 A;  4A45 A;  2VQU A;  1CZS A;  1JZ6 A;  4W50 A;  3K77 A;  3WEZ A;  2E33 A;  5JR2 A;  1UX7 A;  4YPJ A;  1W8N A;  1JZ7 A;  3SKV A;  2BZD A;  1OH4 A;  2HLE A;  1UY2 A;  2C26 A;  2XHN A;  3DYO A;  2W46 A;  3K75 B;  1NKG A;  1GMM A;  2W87 A;  2VL4 A;  1JU3 A;  4QX1 A;  1UZ0 A;  3SEE A;  4ARX A;  2LW8 A;  3JXS A;  4AAX A;  5J1X A;  5EJ1 B;  3T0B A;  2J1V A;  4PQQ A;  5B4N A;  4BXS V;  3IAP A;  2W9X A;  3P1I A;  2VME A;  4MAD A;  2W3J A;  3OEA A;  4P08 A;  4P00 B;  5A1A A;  4D8M A;  4W8J A;  4A41 A;  1NX9 A;  3PUI A;  2BER A;  3T2Q A;  3OBA A;  4XUP A;  3MUY 1;  3A22 A;  4CVU A;  2WO3 A;  1GOF A;  5JMO A;  2VZP A;  2VZS A;  1WKY A;  4QDQ A;  3THC A;  2WN3 A;  3THD A;  3T2P A;  1UWW A;  4L0P A;  3C7F A;  1JZ8 A;  1SDD B;  3CIH A;  2ORX A;  2W1W A;  4XUO A;  1J83 A;  5B4X A;  4JKM A;  1JYX A;  1JZ3 A;  2W94 A;  2XQX A;  1SHW B;  2L9L A;  4QAW A;  4HG6 B;  2EIB A;  2ZEY A;  4M4P A;  2X10 A;  2J1U A;  2WAO A;  4BK4 A;  2DDU A;  2E26 A;  3OGV A;  4XVH A;  2Y6G A;  2WUH A;  4QX2 A;  3LE0 A;  3WNL A;  2Y6J A;  2WAA A;  4KI5 M;  3OGS A;  2YB7 A;  1EUU A;  2KD7 A;  2WAB A;  1LNS A;  3HJR A;  3C7G A;  2J1S A;  3T0A A;  2VCB A;  5HPO A;  1GU3 A;  3T09 A;  3DYP A;  2ZEZ A;  3CZJ A;  3GXU A;  3CDZ B;  2WDB A;  4JHZ A;  1UXZ A;  3I2K A;  5JXJ A;  2VZQ A;  3FN9 A;  2WN2 A;  3C7H A;  2Z4F A;  3CZU A;  4FI9 A;  3U37 A;  1BHG A;  3SKJ E;  4CUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...