1GRIA

Grb2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
211
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR BOUND PROTEIN 2
publication title Crystal structure of the mammalian Grb2 adaptor.
pubmed rcsb
source organism Homo sapiens
molecule tags Signal transduction adaptor
total genus 34
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA03
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1griA02
1X69A 1BHHA 5L23A 3M0QA 4X1VA 4OMOA 1A81A 1AYDA 2KE9A 2CSQA 4LE9A 2HDXA 2DLYA 1K0SA 1N5ZA 1G83A 4M4ZA 2HBWA 2EYYA 2D8JA 2QDLA 1BHFA 2PZ1A 1H9OA 5GJWB 3PJPA 1CWDL 5HKZA 3R6NA 2PLEA 1GRIA 1GBRA 2RVFA 1BG1A 2CUDA 2DBMA 2OJ2A 2CT3A 1OOTA 2AZSA 1O41A 4RUGA 3IN8A 2YDLA 4WWQA 4HXJA 1LUIA 3BUMB 2OZOA 1AOUF 3EAZA 5AXIA 2DRKA 3NMZC 1O47A 1CKBA 1GCQC 2PNIA 2L0AA 1M61A 2P4RA 1RUWA 2FO0A 1O49A 2C9WA 2K2MA 1R1SA 2J05A 5I6VA 3EG2A 2EKXA 2VVKA 3I9QA 1FU6A 1X27A 5DC9A 1SHDA 4EIHA 3N84A 1PRMC 4Z89A 2GE9A 4QT7A 2MQIA 3VS4A 1JYQA 5J3XA 5IBMA 1QCFA 1QWEA 5DC0B 1AWXA 3PVLA 4Z8AA 5D0JA 1W1FA 3CWGA 4JPBW 1KIKA 1O4QA 1O4EA 2FRYA 1O4MA 1GFDA 4QSYA 2YUOA 1TUDA 1NZLA 2AZVA 1K76A 2LMJA 4HVVA 1QKXA 1WFWA 2ECZA 2CSIA 3M0PA 2J6FA 1KA7A 3VRPA 2D0NA 1X2QA 3N8MA 2D8HA 2HMHA 3K2MA 3BUXB 1D4TA 1W70A 3I35A 3REAB 1SRMA 3VS5A 3MAZA 3VS6A 2EGEA 1BLJA 2DE0X 1SHBA 1IO6A 2DL8A 2A28A 2X3WD 1O4GA 1BHHB 4AG1C 2B3OA 5EC7A 4RTVA 2K6DA 2YU7A 1NLOC 1A1CA 4A63B 2F2WA 1AWWA 2H46E 2GBQA 3GXXA 3KFJA 3ZNIA 4E68A 4JZ3A 2A08A 5BO4A 1BFJA 1O42A 2HUWA 2YUQA 5HKYA 3TSZA 2LJ3A 4AFSC 3VS1A 3M7FA 5I22A 1BU1A 1ZFPE 1UUEA 1Z9QA 2NUZA 1UGVA 2EL8A 2LP5A 3I5SA 2KRSA 4XZ1A 1HJDA 1SHGA 3VRYA 1AWOA 1WQUA 2PNAA 4GL9E 2GTOA 2H8HA 1TCEA 1FHSA 4FL3A 1CKAA 1TUCA 1FU5A 5IBSA 5IHKA 2LJ1A 1O4FA 2EYWA 1LKKA 1B3QA 1QKWA 4JJDA 1UTIA 1PHTA 2W10A 3C0CA 1RLPC 3CQTA 1F2FA 2KYMA 4OMMA 1OV3A 2JS0A 4WCIA 1K4US 1O4PA 2EYXA 1JXOA 1ZUUA 3KFVA 1ZUYA 4FL2A 4U1PA 1LCKA 3EGUA 2QMSA 1BLKA 1PICA 2BBUA 1W6XA 1GFCA 3EG3A 2V1QA 1AWJA 2DLPA 1O4OA 3BUNB 4GLMA 1AZEA 1TG0A 2AKLA 3QWYA 1RQQC 2ABLA 5HCKA 1FMKA 3H41A 3QWXX 4F17A 1O43A 4P9ZA 2EYVA 2ENMA 5IHIA 1IJRA 4E93A 2KR3A 1M3BA 4LNPA 3S8NA 1M30A 2AUGA 2O9SA 1AZGB 1XOVA 2DX0A 2FCIA 3TKZA 4HVUA 2KYBA 1D1ZA 2RORA 5GJVB 1YVLA 2IZVA 2EVRA 3VRRA 3EHQA 1FBZA 2DVJA 1JYUA 2E5KA 1UECA 2RQRA 1MILA 1O46A 3TVTA 2VIFA 1NEGA 2EO3A 2FEIA 2GTJA 5EHRA 1O4CA 1LKLA 1FBVA 1KSWA 1ZUKA 2LCTA 2FPEA 1A07A 2I0NA 2LCSA 4Z88A 1SPSA 2YUNA 1SHFA 4DEXA 1ARKA 4LN2A 1BMBA 1A1BA 2RMXA 2D1XA 1G2BA 2C0TA 3OP0A 3BUWB 1GBQA 1R1QA 2JM8A 3THKA 1KFZA 2DNUA 2F2VA 1BKMA 1M27C 2DCRA 4K2RA 1U3OA 1AOJA 1O4LA 2CH4A 1OO3A 1SRLA 4RTTA 2EU0A 4LUDA 3T04A 2W0ZA 2CRHA 1WIEA 1X0NA 2EO6A 2JYQA 3IN7A 5DC4A 1B07A 1YN8A 4EY0A 2DMOA 2DL3A 2X3XD 1AYAA 1GL5A 1JEGA 2CI8A 3UATA 3PSKA 3IMJA 2KRMA 2CS0A 1H3HA 2Y1MA 3EG1A 2B86A 1J3TA 2MK2A 2BTTA 5EEQA 4ESRA 2YSQA 4J9DA 2HDVA 1P13A 3M0SA 1UE9A 2O31A 4K45A 3S9KA 2G6FX 2AOBA 2H5KA 3S8LA 1AD5A 1PRLC 2JW4A 2HEQA 1LUKA 1WI7A 2GGRA 2KRNA 4FSSA 1NYFA 1GCPA 4K11A 2DBKA 3H0FA 1UG1A 2IUGA 1PKSA 2DM1A 2O2OA 2KK6A 4OMLA 1YNZA 4JGHA 3VGOA 1QG1E 3OV1A 2HDAA 3VRZA 2DM0A 2DJQA 1M27A 1AYCA 4E6RA 1ZBJA 2DA9A 5I11A 4K44A 3UA6A 5IXBA 2PNBA 2JMCA 2RNAA 2BZ8A 1PKTA 1JU5C 1SPKA 1UUSA 2MRKA 2CUBA 2VKNA 2AOAA 4HVWA 4LUEA 3BKBA 2EGAA 4H34A 2L2PA 2FRWA 1O48A 2KXCA 3GBQA 1O4BA 5IXFA 3EHRA 4RTXA 4D8DA 4JEGA 1QADA 4F5BA 3GQIB 1VA7A 1AEYA 4ORZA 2RN8A 2DILA 1AYBA 3RBBB 1BBZA 1NYGA 1X6BA 5FWBA 1T3LA 2KROA 1SKJA 3M0UA 3PE0A 2ECDA 1MW4A 2EYZA 2LNWA 1IS0A 4GPLB 1CWEA 4OMNA 3VS0A 2ETZA 4FBNA 3SHWA 1RLQC 4J9IA 3TL0A 1K9AA 2RSYA 2SHPA 2CH4W 2O9VA 3HCKA 2XP1A 1Y57A 4EIKA 1M8MA 1PWTA 4CC4B 5ECAA 4NWGA 4A4CA 1MV0B 2DL5A 4IIOA 1H92A 2RMOA 2RQWA 2EBPA 3EG0A 1BB9A 1E6HA 1WA7A 2LQNA 1CSYA 2DX1A 4RTZA 3H0HA 1X6CA 4F59A 1OO4A 1WLPB 1F1WA 2DF6A 3I5RA 1RJAA 1Z9ZA 2F2XA 1OEBA 2K3BA 1WXUA 1O4JA 1WXBA 1JU5A 2C0OA 5HKWA 2IIMA 3ULRB 1SHAA 1CSZA 2K79A 2GQIA 2J06A 4OHHA 1JXMA 1NRVA 1KA6A 1M3CA 4OMQA 2ED0A 2PTKA 2RPNA 4Y92A 2A36A 2RQTA 3PSJA 2J7IA 4JE4A 1AVZC 3IMDA 3N7YA 3UF4A 2JXBA 4JJBA 1WYXA 1E6GA 1SEMA 1YP5A 4DEYA 1V1CA 1JYRA 2AK5A 4X6SA 1RPYA 1LUMA 4J9FA 1ZLMA 1T3SA 2KEAA 4GWFA 3C7IA 2GSBA 2MIOA 3PS5A 3PQZA 1UHCA 4AG2C 2FPDA 5EG3B 1YWOA 2L3PA 5DF6A 2FG0A 2DYBA 3O5ZA 2L3SA 2FPFA 1O4KA 1NLPC 3US4A 1BK2A 1GHUA 1RI9A 3H0IA 1I0CA 1O4IA 2YT6A 4RTYA 4XZ0A 1I1JA 2GNCA 2KT1A 4A4BA 1LUNA 2EQIA 1A1AA 1KC2A 2L3TA 2M51A 2KXDA 3FJ5A 4GBQA 2NWMA 5FWCA 1AOTF 2SRCA 3WA4A 2BZXA 1HSQA 2JM9A 1K1ZA 1O4RA 2L6KA 2OQ1A 4ZNXA 3NPFA 2MC1A 2LNHB 2RQUA 4R0KA 1K0XA 1ABQA 1R1PA 2EGCA 1VYVA 4HCKA 2SEMA 4AFZC 2HSPA 2J6OA 1NG2A 4J9BA 4F5AA 3U23A 2K7AA 1HCTB 1O4DA 4U17A 1S1NA 3HHMB 4F14A 2ROLA 1HD3A 4DGXA 1PNJA 1QWFA 1WX6A 2KNBB 3VS2A 1FYNA 2K79B 3UYOA 3MXCA 2KT8A 2CIAA 1KJWA 2JT4A 1O44A 2EKHA 2CR4A 4AFQC 4CC7A 1M3AA 3M0RA 2AKKA 4OHIA 1X6GA 3M0TA 1TZEE 1YVHA 1O4AA 1YCSB 2L3QA 3ZL7C 1JWOA 1T0JA 2EW3A 2MOXA 3PLFB 4ROJA 1BKLA 1Y0MA 2LNXA 3HIZB 5CDWA 4H1OA 4JZ4A 2OI3A 3S8OA 4RTWA 5FW9A 5GJIA 2DLZA 4OMPA 4J9GA 4CC3A 1FYRA 1Z3KA 1NM7A 2EOBA 1XA6A 1T0HA 5EELA 4TZIA 1ZX6A 1D4WA 5EHPA 4OHDA 1BF5A 2DL7A 4J9CA 3NGPA 2RF0A 2A37A 1U5SA 3VS3A 2CREA 3PFVA 5GJHA 4F16A 4DGPA 1EFNA 1AB2A 2IUIA 1E7OA 1VYUA 1ZSGA 2OAWA 4AFUC 3VRQA 1OPKA 4J9HA 3A98A 1JO8A 4JJCA 2CBLA 1BFIA 1GCQA 2HCKA 3CBLA 1BM2A 4D8KA 1MUZA 3RNJA 3REBB 1UJ0A 3OB2B 3IQLA 4KRTA 2MRJA 1ABOA 1NEBA 4CC2A 1NZVA 1O4HA 3BUOB 5IHNA 5IH2A 1SPRA 2VWFA 2KNOA 1I3ZA 2Y1NA 1A09A 2EPDA 3EACA 1B47A 2RQVA 1UURA 3PVQA 3MXYA 1YWPA 2BZYA 5AULA 3SEMA 2DL4A 2YSXA 2J6KA 1MV3A 1UHFA 2ROTA 1WXTA 3VROA 3CXLA 3UA7A 1CSKA 2LZ6B 3OVEA 2LJ0A 1U06A 2ED1A 1X2KA 3LH5A 4OHLA 2ESWA 2DRMA 2K7AB 1X43A 4RTUA 1H8KA 4NWFA 2XMFA 4P9VA 2CI9A 1SSHA 2MCNA 1UJYA 1A08A 1I07A 4IIMA 2JS2A 2KGTA 2L4KA 2PLDA 2Y3AB 2M0YA 4OHEA 1HCSB 3CD3A 3OB1B 3NHNA 2KBTA 1WDXA 1Y1UA 2O88A 1O4NA 1OPLA 3GXWA 2JTEA 2CT4A 1CJ1A 1JQQA 1A0NB 1QLYA 5KAZA 3JV3A 2V1RA 2LQWA 1UFFA 3VRNA 2YUPA 3VS7A 1UDLA 1A1EA 4L1BB 2JMAA 1VYTA 4J9EA 3TSWA 2LX7A 1LCJA 1O45A 2K9GA 2C0IA 2IUHA 2CDTA
chains in the Genus database with same CATH superfamily
4F7UF 4QVCA 4OMOA 4F7UB 1A81A 2RI5A 2QG9B 1KD1U 4CRIA 2E65A 1AYDA 2JZ2A 4LE9A 2DERA 3CBOA 3CXCP 1UGSB 1M1KC 5GAMe 2D8JA 3HRSA 2RHXA 4RMOA 5IT9E 4X9DA 1BG1A 3CPFA 1GBRA 2CUDA 2OJ2A 2LNVA 5KYWB 2AZSA 2R57A 2YDLA 4M7DB 2DKGA 3BUMB 4E7KA 3BE3A 4M77G 5AXIA 2DRKA 2L0AA 4FCYA 1M61A 5KYUA 3HFNA 2J05A 3D7SB 2COZA 4C8QA 1S72Q 4EIHA 2YRCA 4Z89A 2AIRB 3M4YA 3QZ9B 2V8JA 4QT7A 2MQIA 3VS4A 1QCFA 5DC0B 4Z8AA 1BI1A 5D0JA 3EAEA 4JPBW 1O4EA 4QSYA 1M4ZA 4C5IA 3I56A 4M7AC 3ER0A 1K73U 2LMJA 4HVVA 1WFWA 2ECZA 1KA7A 1WNLA 3RKYA 1X2QA 1VQPA 5HKCA 1PSEA 4KUDK 3VYGA 1SRMA 1VQLA 2EGEA 1I4K1 2D0QB 2E70A 2VV5A 2X3WD 2A28A 4HCCA 4M7AE 4KH1B 4QW2A 2K6DA 5GAMd 1NLOC 3GNGA 2EJGA 3C95A 1QP3A 4OGEA 1A1CA 4E47A 4FYVB 1RAHB 2DEQA 1AWWA 1TSFA 3ZNIA 1M9SA 4JZ3A 5KYYA 2A3LA 2KDSA 1Q81R 1N8RR 3Q1JA 3VS1A 5I22A 2RD1A 1ZFPE 1Z9QA 5LJ5j 2M1HA 2ZZDA 2MWOA 1SHGA 3VRYA 1YHQT 4XU1A 3CCVT 2RO0A 2E64A 1SSFA 4GL9E 1K9MR 3JCMP 1FU5A 1FMVA 2RI2A 3QZ5B 1WQWA 3EGDA 3MCAB 3PGGA 4M7AD 2EYWA 1LKKA 1QKWA 4LDUA 5GAMf 1Q86U 1G3WA 1PHTA 3C0CA 3P8DA 4B9XA 4OB3B 4OMMA 1OV3A 2L3RA 4WCIA 3FLGA 5GMKj 2X51A 4DQ2A 3KFVA 1ZUUA 2DJZA 4ANJA 4VUBA 1BLKA 2QMSA 1GFCA 3G6EA 1AWJA 1NJIC 4BI3A 4GLMA 4KGZB 3QWYA 1RQQC 2ABLA 1O43A 1FMKA 3H41A 3CCQQ 3S3OA 3JB9H 2KR3A 1M3BA 4C8QC 2DX0A 5GAMj 2FCIA 3A8HB 3CMEA 4HVUA 3E9GA 5GJVB 1YVLA 2EVRA 1UECA 3CXCA 1Q82U 1V29B 1NEGA 1R77A 2EO3A 2FEIA 3G71Q 2GTJA 4ELZC 4C8QE 2Y4YA 2QYZA 2I0NA 5FU6B 1AHJB 3MJXA 4DEXA 2JUFA 4LN2A 2OTJA 1BI3A 1VQ4T 3CMAQ 2QQRA 5FU7C 1YJ9A 3OP0A 4M75G 2HL3A 2XIDA 4GLKA 1KFZA 3OS1A 1M27C 3PIOA 4OMFB 2LRQA 4QQ6A 4PJMA 1KHIA 2O4XA 4EMGA 4LUDA 4M77B 2JYQA 1WIEA 4DBHA 2R5MA 1B07A 3GOXA 5GANe 1FXXA 2CI8A 3UATA 3PSKA 3QYHB 3LLRA 2KRMA 2CS0A 4FM4B 3CCMA 1P13A 2O31A 3G4SA 4EPCA 1IGUA 1AD5A 1PRLC 2HEQA 3OYMA 1LUKA 4KH0B 2KRNA 4FSSA 1NYFA 2NYSA 1YI2T 4IURA 2DBKA 2NUPB 4C92A 3VRZA 2DJQA 4E6RA 1XTDA 4K44A 2KI7A 5IXBA 2RNAA 5I2SA 1UUSA 2MRKA 2AOAA 1Q7YR 3V7RA 2L2PA 3SWNA 8ATCB 4O5VA 1B34B 3V8KA 3GQIB 1AEYA 1BBZA 5LJ3g 5FWBA 1T3LA 2CP6A 5FLXE 1MW4A 2EYZA 2DXTA 3TL0A 1K9AA 2EQJA 4LXCA 2RSYA 1WZOA 2O9VA 4RCBA 1Y57A 4CC4B 5ECAA 1QP2A 3CCLT 2RMOA 2RQWA 1WA7A 5J3BA 3OMCA 4RTZA 3H0HA 5GAN2 1WLPB 4X9CA 1F1WA 1Z9ZA 2EJ9A 2CP3A 4HT9A 3GLXA 2NUTA 1WXUA 4E7SA 4OB0B 1JU5A 2IIMA 3QJYA 3ULRB 3MPUB 1M2VA 3CCSQ 3CCRQ 1VUBA 5HY6A 1VQMA 1VQ6Q 3M5AA 2PTKA 2VGNA 1N8RC 2RQTA 4BDYA 4KGVB 5FRMA 2JXBA 4N4IA 1I5LA 2JVVA 2E6ZA 2LX9A 1V1CA 1JYRA 4RCCA 4R56A 1K9MC 1QVPA 3CXCS 2KEAA 4GWFA 3C7IA 1VQ5T 2GSBA 1RAAB 3PS5A 2QTVA 5KYXA 3EFSA 5GMKl 3JAME 3JB9G 2L3PA 2CZ1B 4DBFA 2DYBA 3O5ZA 2L3SA 4Z02A 3JCMW 1O4KA 1PD1A 1G3SA 2DTOA 5GAOl 1O4IA 4RKUE 2LC4A 1OZ2A 4RTYA 2GNCA 5CKBA 1YJNT 1PG5B 5GANj 4A4BA 1KC2A 2L3TA 4M78C 2XDDA 2EAYA 3G7ZA 1W2BP 2FHDA 5GAOp 2BZXA 2JM9A 3S3MA 1K1ZA 3LWHA 1SG5A 1O4RA 1I5OB 3MP1A 3FIFA 4PJNA 3SWNC 2RK1A 2RQUA 4R0KA 2OTLA 1ABQA 3X28B 5HK0A 2EGCA 1VYVA 4M78E 5M9OA 4J9BA 3CC4T 1TU0B 2ZGWA 2DXBA 3U23A 5A2QE 3HHMB 3PMTA 1G8XA 2HL5C 3L2RA 4DGXA 1PNJA 1QWFA 1WX6A 3UYOA 3MXCA 2KT8A 3OB9A 1OX9A 2EKHA 4DOVA 3E2UA 2LTOA 2MF2A 2AKKA 4OHIA 1ZHIA 2K5LA 5CKDA 1O4AA 3ZL7C 3L2WA 5GAOq 2EW3A 4ROJA 2LNXA 4NL2A 4JZ4A 2OI3A 4OGCA 2V26A 3LGFA 1FYRA 1Z3KA 4EMKB 1NM7A 2VC8A 4E2FB 4M78D 1D4WA 3EFOA 1JB0E 2FVUA 4KGXB 1WHKA 3NGPA 1U5SA 2QASA 1AB2A 1LNXA 2OAWA 4AFUC 1NBEB 1OPKA 4F7UA 1UEBA 4J9HA 3CCUT 1JO8A 2CBLA 1BFIA 2P84A 3PMIA 4C0FA 1BM2A 4D8KA 3CBLA 3ME9A 4FSXA 1NEBA 3FB9A 2QA4A 5IHNA 1SPRA 2VGMA 2VWFA 4N4HA 2KNOA 1W4SA 2EPDA 5KYWA 2LQKA 4UC4A 3PIPA 1YWPA 2QEXT 4M7DA 5AULA 2FZCB 3SEMA 1UHFA 3MEUA 2LZ6B 1U06A 3CCET 1QMCA 1X43A 1B7TA 2CI9A 2RHYA 8AT1B 1Q7YC 1VQOA 2Y3AB 2M0YA 5IAYA 1TS9A 3CD3A 3OB1B 1YJWT 1Y1UA 3GXWA 2JTEA 2MPXC 1CJ1A 2EQMA 4M78F 1JQQA 5C0MA 1A0NB 2V1RA 1BIBA 1F1BB 3CD6T 5CQYA 3RMQA 3A8OB 2GCXA 3CCSA 3OW2P 1VQKA 4J9EA 3CCRA 2K9GA 2C0IA 2EQKA 2IUHA 3JCMg 3M0QA 4X1VA 1YITQ 2F69A 1W2BA 3DB3A 1D0XA 1RAGB 1TWBA 3OYFA 1K0SA 1N5ZA 1G83A 4XTWA 1BHFA 3PJPA 1CWDL 2WSFE 3CCJA 1GRIA 3AHUA 1O41A 1OOTA 4WWQA 2M16A 2QAZA 4HXJA 4PJLA 1LUIA 4PJOC 1AOUF 3I56Q 5GAN7 3M57A 1VQ9A 3CEYA 3QDRB 4FU6A 1O49A 1WJQA 1VQPQ 5I6VA 4B9WA 4DOWA 5KH6A 1MHNA 3I9QA 3FEOA 4XAXB 1X27A 1K8AR 1VQLQ 4PJOE 5LJ3h 1PRMC 3S3NA 2GE9A 4M7DC 5J3XA 4FIBA 2L8DA 3EFRA 3PVLA 4Y28E 2FRYA 2RH2A 4PKCC 3QG1A 1LJOA 2COYA 1K76A 3M0PA 3VRPA 2D0NA 3N8MA 4KUIA 4M7DE 2D8HA 3BUXB 2ZPHB 3I35A 3VS5A 1BLJA 2XKOC 2DE0X 1SHBA 1O4GA 1OZ3A 1BHHB 2PVOB 4MMLA 1M90U 4PJOD 4ELYC 3HRTA 4A63B 5LL6S 2F2WA 4EDUA 2H46E 1MNDA 1BIAA 1BKBA 2LJ3A 2P0KA 2QQBA 1WJSA 3CBMA 2VB6A 1UUEA 1UGVA 2EL8A 3G6EQ 4XZ1A 1AWOA 4M7DD 2DVEA 2GTOA 5C6SA 1TCEA 2XI9A 1FHSA 4FL3A 3SD4A 5IHKA 2WACA 2LJ1A 2DZ9A 2X4XA 3CBPA 3CMEQ 4JJDA 2FL7A 1C6VX 1U1TA 2LT1A 4E93A 1F2FA 2KYMA 4QKUA 1O4PA 3OSSC 4ZGEB 3X24B 1JXOA 4FL2A 1ZUYA 3OMGA 4U1PA 3EGUA 2BBUA 1W6XA 3EG3A 2V1QA 4FYYB 1ACMB 2DLPA 1AZEA 3OW2A 1LOJA 2AKLA 4FYXB 2YLCA 2ENMA 1IJRA 3JB9J 3VKIA 4LNPA 2OTJQ 2EYQA 4KT0E 1M8VA 3A1PA 4FYWB 2KYBA 4OB2B 1D1ZA 2RORA 1K9MU 2BUDA 3EHQA 1FBZA 1JYUA 2DETA 4PK4A 1MILA 4PJOF 4PJOB 3OA6A 2VUBA 5EHRA 1O4CA 2X4YA 1LKLA 1FBVA 2P4TA 2P0PA 1TUGB 3OYAA 1KQ2A 3JRZA 2LCSA 4J6WA 1W2BS 4Z88A 3VYHB 1MMDA 1ARKA 2IVWA 1BMBA 4MZPA 1G2BA 4M7DF 4NS5A 1TH7A 3CCMQ 2QQSA 3THKA 1YITA 2GFAA 2DIGA 2DXCA 1YHQA 3CCVA 3G4SQ 5FU6C 3CC7T 3NTKA 1AOJA 3NTHA 4M7AG 2EO6A 2E10A 3JSCA 2MI6A 1TXQA 1VQ8T 3SFMA 3IN7A 2E1HA 4DA4A 2BE9B 2DMOA 2DL3A 2X3XD 1U1SA 2E4HA 1JEGA 2H3EB 1WHJA 1H3HA 3EG1A 2B86A 1J3TA 2MK2A 4ESRA 4NL3A 1N9RA 1GXIE 2EIFA 2AOBA 2H5KA 3JCMQ 4M77C 1WI7A 2FZKB 2GGRA 1GCPA 4K11A 1KC8R 1PKSA 3FC3A 2KK6A 4JGHA 1YNZA 2CP7A 2X4JA 2DM0A 1M27A 5I11A 3UA6A 2ZPFB 2PNBA 4M77E 2BZ8A 1PKTA 3G1JA 2RJCA 3RKXA 1IXDA 3BKBA 4H34A 4HVWA 2JN0A 2EGAA 3LYVA 2KXCA 1O4BA 1K8AC 1OX8A 1QADA 3BW1A 1VA7A 2DILA 3RBBB 1X6BA 1SKJA 1VQ4A 2ECDA 3J7AF 4J83A 2CP2A 5LJ5g 5J26A 4OMNA 3VS0A 2ETZA 1RLQC 3OYHA 1VQMQ 3TU4K 2MK5A 1PWTA 4A4CA 1YFNA 2DL5A 2YHTA 4IIOA 1H92A 2E3HA 3JCMh 2EBPA 1YIJT 2Y4XA 2LQNA 3H6ZA 2DX1A 4M77D 4C8QG 1QVGS 1CSYA 3OBWA 2HQHA 4JS5A 2F2XA 1Q7YU 3QYGB 3MO8A 3OS2A 2C0OA 4A4FA 1G3YA 1NRVA 3GIBA 3ZEHA 3GF5A 1KA6A 1M3CA 2RB6A 4ZTFA 3OW2S 3SB2A 4L5GA 2A36A 2J7IA 1AVZC 1BYMA 5GAMg 4BDZA 4C0GA 2AK5A 2MWPA 1LUMA 1JRIA 4J9FA 4ATOA 4EMKA 4N4GA 2KSSA 5DF6A 1D0ZA 1P92A 2OTLQ 3MKDA 5IN1A 1NLPC 4MZTA 1TOVA 1RI9A 3H0IA 1I0CA 2KMTA 2YT6A 4XZ0A 1I1JA 1D1BA 4LDVA 2KT1A 5GMKm 1A1AA 2HNIA 2M51A 4Q5WA 3CC2T 4GBQA 5FWCA 3OYJA 2SRCA 3M56A 4OP0A 3O8VA 4M77F 5GAOm 2OQ1A 1OYXA 3NPFA 1K73R 1K0XA 1R1PA 3CCLA 4XTXA 3LGLA 1M1FA 1RADB 4AFZC 3RR6A 3P8HA 1NG2A 1KG1A 5LJ3d 4KBMB 1HCTB 3L2QA 4PFOA 4U17A 4J6XA 1S1NA 3I55T 2YXYA 2ROLA 2JTMA 3VS2A 1D0YA 2K79B 2CIAA 1KJWA 2QGFB 1PCXA 1M3AA 3T9NA 4N0AC 3M0TA 4LDXA 2EKOA 2MOXA 3PLFB 2MYSA 1Y0MA 1BKLA 5CDWA 4H1OA 2QGGA 3BDLA 4RTWA 4M78A 2ZCFB 3QKJA 5DLOA 5GJIA 2QA4Q 2DLZA 4Y91A 1OU8A 5CVIA 1VQ7T 2AT1B 2XICA 5LJ3f 4OHDA 1VQ5A 2RF0A 2A37A 5A0GA 2CREA 1VQNQ 2IUIA 1Q86R 4JJCA 4J7FA 1GCQA 5AT1B 5GMKi 2DTIA 1YJNA 1UJ0A 3OB2B 4KRTA 4EMKC 1ABOA 3OYLA 1VQOQ 2MRJA 1D1CA 4E7LA 5IH2A 1MMAA 1YJ9T 1B47A 2KAFA 3MXYA 2DL4A 1KC8C 1R8OB 2ROTA 1IZ6A 1HYOA 2WSEE 2KY9A 3UA7A 3PTAA 3OVEA 2KQWA 1X2KA 2EJFA 2ESWA 2K7AB 4NWFA 1X01A 4BY6B 1Q82R 1SSHA 2AHJB 2MCNA 3CC4A 1I07A 1VQKQ 2BIVA 2Y90A 2L4KA 2PLDA 1H3ZA 2VASA 1Q81C 3PNWC 1QQJA 2JJ9A 3AT1B 4BE0A 1OPLA 2YRVA 2CT4A 4PL6A 4PNOA 1QLYA 1S72T 3VRNA 3CCJQ 2YUPA 1UDLA 4C92G 1A1EA 4L1BB 1BCOA 4J5YA 4PJJA 1R0BG 4JJNK 3RKWA 2PUKB 1M1KU 1JJ2P 2CDTA 1X69A 1BHHA 1I81A 1VQ9Q 3TEEA 3FRNA 5CK9A 2KE9A 2CSQA 5CAIA 2XD0A 2HDXA 4BE1A 5A0DA 3CCUA 4X34A 3MEAA 3RESA 5GANg 2QDLA 2PZ1A 1PM3A 5HKZA 4M75F 2PLEA 4M75B 2RVFA 2E41A 1NPRA 2DBMA 2CT3A 1LPLA 1ZQ1A 3OQ5A 3EAZA 3DB4A 2QEXA 2OAUA 3NMZC 1O47A 1CKBA 1GCQC 2PNIA 1BI0A 2P4RA 4RG2A 2C9WA 3JCMe 1R1SA 2HZYA 3EG2A 3CCEA 2EKXA 4C0DC 2DAQA 3M4GA 5DC9A 1SHDA 4PLLA 2M02A 3N84A 1JYQA 4JRKA 4PLIA 5LJ5h 5IBMA 3LW5E 3V8JA 1AWXA 1W1FA 2GFUA 1O4QA 1O4MA 1YJWA 2YUOA 1TUDA 1IHVA 1NZLA 4QVDA 3GNFB 2CSIA 4XU3A 2LT4A 2QQ9A 1KQ1A 3CD6A 1D4TA 1W70A 3REAB 1K73C 3HHTB 3VS6A 5GMKh 4PJOA 1IO6A 2DYIA 4CI0C 3QSUA 2B3OA 5EC7A 1IB8A 3CCQT 4C5EA 3JB9D 2GBQA 3KFJA 2RA2A 2A08A 1MMNA 3CC7Q 1EX4A 2HUWA 2YUQA 5HKYA 2E5QA 5GAMh 1PC0A 2HQXA 1BU1A 3G71T 1VQNA 2LP5A 1HJDA 1ZSZC 3JCMd 4O6JA 2H8HA 2HAXA 1XJWB 1YBYA 1CKAA 5FRNA 4AMCA 1C1AA 1O4FA 1B3QA 1UTIA 2W10A 1NJIU 1RLPC 3CMAT 1K4US 5KCHA 2EYXA 3J81E 1QVGP 1LCKA 3JB9I 3HPWA 1PICA 3M58A 1Q86C 2CS7A 3BUNB 5HCKA 3QWXX 4P9ZA 1RL2A 1MGQA 2EYVA 5IHIA 4A4KA 1X6OA 1JJ2A 3S8NA 1M30A 2BKDN 2O9SA 2X4WA 3JCMf 1UGPB 3TKZA 2IZVA 2HKQB 4ZTJA 1O46A 2E5KA 2VIFA 3L2VA 3E19A 3JB9F 1RABB 1XQHA 1YHQQ 4JUVA 3CCVQ 1KSWA 1ZUKA 2LCTA 2FPEA 4IKFA 3X25B 1Q82C 2JOYA 4F7UG 1M2OA 2RJEA 4C0DB 2YUNA 4LD6A 1SHFA 4L6V5 1NPPA 1BCMA 3OYDA 2GF7A 3MHXA 2RMXA 2HSEB 3M9QA 2C0TA 7AT1B 3BUWB 1GBQA 1R1QA 2JM8A 4ZN1A 2LDMA 4M7DG 2DCRA 4L59A 3P8BB 3T04A 2HMAA 1MNEA 1AYAA 3J80E 2MAMA 4HKEA 2QTXA 2XK0A 2DO3A 1Y71A 3OYKA 2YSQA 2A7YA 2K5FA 3INZA 3M0SA 4K45A 4IUVA 1PSFA 5CQXA 2JW4A 1Y96B 2COWA 1SKUB 4P5NA 3DLMA 3E9FA 3M53A 1VQ4Q 3H0FA 2IUGA 4A4EA 1OU9A 1ZSZB 4OMLA 4QQDA 3VGOA 3OV1A 4IUTA 1AYCA 1G3TA 1ZBJA 2DA9A 2VXEA 3E1SA 3CCST 4BI4A 3L2UA 2DD5A 2R5AA 2VKNA 1VQ6T 5KE3A 4LUEA 2FRWA 1O48A 2R58A 5CR2A 5IXFA 3EHRA 4RTXA 3UDCA 4D8DA 4JEGA 3QJ6A 4F5BA 4ORZA 2RN8A 2ATCB 1NYGA 4GY5A 2P0QA 2LNWA 3M0UA 2RHIA 1UGQB 3ZFJA 1IS0A 4GPLB 2IG0A 3A8MB 3SHWA 1TTHB 4QQGA 4J9IA 4TVRA 3JCMV 2ZPBB 1WQ7A 2CZ0B 1ZBXA 2XP1A 3QXEB 1QVGA 4EIKA 1M8MA 1QW1A 4M77A 1MV0B 2RHUA 3CC7A 4F59A 1YI2Q 1RAIB 1OO4A 3L42A 1VQ8A 1RJAA 3I5RA 4BE2A 5L8RE 1Q81U 1OEBA 1WHGA 5GANh 1N8RU 5HKWA 1CSZA 2K79A 1JXMA 3C12A 3A5ZB 4OMQA 1WGSA 1N9SA 4Y92A 3PSJA 3VUZA 1JJ2S 2NUPA 4MMKA 2CKKA 3UF4A 1WYXA 4DEYA 1YP5A 4NOYA 3JCMJ 1RAEB 1ZLMA 1T3SA 2F5KA 3ZBDA 3PQZA 2FPDA 2HQEA 1MMGA 2XU8A 2DEUA 1B34A 2FPFA 4R55A 3CCLQ 4BI8B 1KQSP 2EWNA 1GHUA 3EGXB 3LYIA 3BDUA 1D09B 1I8FA 1OQKA 3WA4A 4YTLA 4ZNXA 3HTRA 2LNHB 1RAFB 1D3BB 1M5Q1 3M59A 1UGRB 4XU2A 2CYZB 1X75C 4HCKA 3WVDB 2HSPA 2J6OA 1YIJA 4F5AA 4IUUA 5I2MA 2K7AA 5J39A 3V8LA 4LDWA 4F14A 5LJ5d 3NTIA 2LVMA 1HD3A 2PUOB 1FYNA 4BACA 3DKMA 1VQ5Q 1M90R 3RDVA 1O44A 4IUQA 2CR4A 5KE2A 4JDSA 3MP6A 2HKNA 1YVHA 1YCSB 2L3QA 4JRQA 1T0JA 3HIZB 3S8OA 1YJNQ 3UWNA 4OMPA 4J9GA 4OB1B 1T0HA 4DBRA 1RACB 4HT8A 1ZX6A 5GAOr 5EHPA 1BF5A 3HKSA 2DL7A 4J9CA 4JLIA 5DM7R 1QVFP 5GAN3 4OF1A 2XDBA 2QI2A 3PFVA 1EFNA 5LJ5f 2YLBA 1VYUA 3A98A 3JCMX 5KCOA 5I21A 1U8RA 3OS5A 2RJDA 1MUZA 5D6WA 3CC4Q 2NLUA 1DJ7B 3IQLA 4C0ZA 4CC2A 1NZVA 3BUOB 2K5IA 1I3ZA 4M75A 2Y1NA 4ZGJB 3CC2A 4FW2A 4QVZA 2RQVA 1UURA 4N0AA 2BZYA 2V8IA 1YITT 1KHCA 2YSXA 3OYCA 1MV3A 3VROA 1HXDA 1WXTA 3EH1A 3V7CA 3OYEA 2D9TA 2LJ0A 2DRMA 1H8KA 1PD0A 2XMFA 3LX7A 4OVAA 5LJ3e 4P9VA 3RIRA 2K3YA 2K2VA 3H8ZA 1A08A 1KD1R 2JS2A 3EH2A 3I55A 5D6YA 4OHEA 3TREA 3C4SA 4ME7A 3WXMB 2PU9B 2KBTA 3DLLA 1WDXA 3I56T 3GPLA 1O4NA 3SDZA 3QDFA 3LH0A 1YI2A 3CCUQ 1WHLA 4ZGDB 2M9UA 1VQPT 5KAZA 4BY6C 1UFFA 1KQSA 1BI2A 1OI1A 1VQLT 2B8AA 2JMAA 2KK4A 4AT1B 1WJRA 1VQ7A 1VYTA 2O01E 4JLGA 1N6AA 3QBYA 3HSBA 1LCJA 2K3XA 2QEXQ 5L23A 2QQAA 2DLYA 3VV0A 3CCEQ 3KBGA 4XQ3A 4M4ZA 2HBWA 2EYYA 2YRDA 1H9OA 5GJWB 3EG9B 3FJPA 3R6NA 5EG2A 4XTUA 4JRIA 2HD0A 4RUGA 3IN8A 4J7IA 2OZOA 1YJWQ 1VIFA 3OBYA 2RM4A 3OSVA 4M7AF 4M7AB 1RUWA 2FO0A 3HL8A 2K2MA 1IRXA 9ATCB 2VVKA 3CD6Q 2K4YA 2F5TX 1FU6A 2PVGB 4M75C 4C8QD 2XHCA 4A53A 3BFMA 3G6ET 2E6NA 4BB7A 1FX7A 1QWEA 3CWGA 2PQWA 1KIKA 4RG8A 1GFDA 4JS4A 1D1AA 2RI3A 1QVFA 3K2TA 2CGHA 3LWIA 3X20B 2AZVA 2L5QA 4M75E 5CKFA 2L89A 4MZMA 3CMET 1QKXA 4BD3A 2J6FA 5CIUA 4KULA 2HMHA 3VU3C 1S72A 3K2MA 4J8OA 2V8KA 1M1GA 3MAZA 1NZ9A 4V2SA 3HP9A 2DL8A 4AG1C 2XG8D 3V7SA 4RTVA 2YU7A 3R6OA 2KGYA 2FYKA 2OTJT 1AT1B 3GXXA 4E68A 2E3IA 2D6FA 5BO4A 1BFJA 1O42A 3UPUA 1M90C 3BY7A 3TSZA 4D6WA 4B6MA 5LJ3j 4EMHA 1C0MA 4AFSC 3M7FA 1IGQA 2MMPA 2NUZA 4M75D 3I5SA 2KRSA 1WQUA 3VJPA 2PNAA 3CPWP 3MEWA 2ZPEB 2LCCA 1TUCA 5IBSA 5KYUB 4C8QF 4C8QB 1VIEA 4WF2A 2M0OA 5GANd 3CQTA 3OYYA 1H641 2JS0A 5CO7A 3CCMT 2LRAA 3L1AA 2JTFA 4FW1A 4LDYA 1O4OA 2G3RA 1TG0A 3G4ST 4F17A 3META 2VYTA 1O75A 2AUGA 1AZGB 1XOVA 1Y96A 3TQ7P 4M78G 5GAN8 1KQSS 1JBMA 3VRRA 2DVJA 2RQRA 5FU7B 3TVTA 1ZSZA 3QPHA 5GANf 4DBQA 3X26B 1V76A 3QUIA 1R0CB 4C5HA 5GAOn 1A07A 6AT1B 3CCQA 1SPSA 5KYYB 1KD1C 3OY9A 3FDRA 5GAN5 1A1BA 2D1XA 4XTVA 4HA8A 4F04B 2GQVA 5D7UA 5DLQE 4C92C 5HK3A 1ZA2B 2DNUA 2F2VA 3G71A 1BKMA 2LQ8A 4K2RA 1U3OA 3EGDB 1O4LA 2CH4A 1OO3A 3F70A 1SRLA 2DXUA 4RTTA 2EU0A 4MDWA 2QXFA 2W0ZA 2CRHA 2X9HA 1X0NA 2DZCA 5DC4A 1YN8A 4C92E 4EY0A 5GAN4 3HFOA 1GL5A 3CMAA 2H3JA 2HBPA 4XK8E 3IMJA 5EEQA 2Y1MA 2ZPGB 2BTTA 4J9DA 1VQMT 5DY9A 2HDVA 4A54A 1UE9A 3S9KA 2G6FX 1YCYA 2DPPB 3S8LA 1QVFS 3MP8A 2DFUA 1UG1A 2DM1A 2O2OA 1QG1E 2HDAA 3L2ZA 1K8AU 4HCBA 1XNIA 3JCMc 2JMCA 4C92D 1JU5C 1EIFA 1SPKA 2CUBA 4E7ZA 4FL6A 3GBQA 3CPWA 4XTYA 4A4HA 1AYBA 2WSCE 1VQ8Q 3EGXA 3NFCA 1G5VA 4E7JA 2KROA 3PE0A 4FT2A 2QK0A 1CWEA 4FBNA 2PVDB 3A8GB 2ZAEA 2EQUA 2K57A 2SHPA 2CH4W 4E7IA 3HCKA 4HCZA 1Y7XA 2OTLT 4NWGA 2OX7A 2O4XB 4IUPA 1D3BA 3EG0A 1BB9A 1E6HA 3TCJA 1FMWA 2E12A 1X6CA 2RJFA 2X35A 2DF6A 4WTOB 3OYIA 2K3BA 1O4JA 1WXBA 3PFSA 1M1KR 1SHAA 2GQIA 2J06A 4OHHA 3OYGA 1ZA1B 3URGA 2ED0A 2RPNA 2Z0WA 4JE4A 1OULA 3IMDA 3N7YA 4XU0A 1FWZA 4JJBA 1E6GA 2A0FB 4C92F 1SEMA 2DK3A 1Q95G 4C92B 2KVQG 2RK2A 3OYBA 1RPYA 4X6SA 5FROA 4M78B 3MEVA 4PJOG 1EZZB 1LVKA 3C94A 3JCMb 2MIOA 1UHCA 4AG2C 5EG3B 1YWOA 2FG0A 3SWNB 1UB4A 1VQ6A 3US4A 2QDYB 5CKHA 1BK2A 5AYFA 2ZPIB 1YIJQ 4E7HA 4C5GA 2QA4T 1LUNA 2EQIA 2CP5A 4XTZA 3RUXA 4J6YA 1SF9A 3QHSA 2KXDA 3FJ5A 4JRPA 1WHMA 2NWMA 2VXFA 1AOTF 4A4GA 1HSQA 4LD9K 1VQNT 2FB7A 5A0LA 4PFPA 2L6KA 2MC1A 3GP8A 2FZGB 3OYNA 1WHHA 2SEMA 1O4DA 1RI0A 2NUTB 1VQOT 3H9NA 2DIQA 3RMSA 2I2LA 2KNBB 1M2VB 2JT4A 2XDPA 1QCNA 1VOMA 4AFQC 4F7UE 4CC7A 3M0RA 4FT4A 1QCOA 1X6GA 1TZEE 3HRUA 1JWOA 1IHWA 3WVEB 4MDXA 2DTHA 5FW9A 3RERA 4CC3A 1VQKT 2EOBA 3PT9A 1XA6A 1Y07A 3CCRT 5EELA 4TZIA 1IREB 5KYXB 3CC2Q 5CCAA 3VS3A 4PFZA 4DGPA 5GJHA 4F16A 1NE8A 1E7OA 1WPYA 1ZSGA 3VRQA 2LCLA 3ASKA 4BUGA 3CPWS 1NJIR 2HCKA 3UT1A 2CZ6B 1N27A 3M54A 3CCJT 3RNJA 3REBB 3I55Q 3EG9A 1O4HA 1KC8U 1A09A 3M55A 2IPOB 3EACA 3OS0A 1HK9A 3PVQA 3KXTA 1VQ9T 2J6KA 3CXLA 1O9SA 5GAN6 1CSKA 3LH5A 2ED1A 4ZN3A 4OHLA 4M7AA 2BE7D 4RTUA 2CZ7B 3KUFA 1UJYA 1VQ7Q 3A8LB 2YWWA 4IIMA 2RHZA 2KGTA 5LJ5e 5CKEA 5KYNA 1HCSB 2CP0A 3NHNA 1KK7A 2O88A 2JNGA 3QIIA 3JV3A 2DD4A 2C06A 2LQWA 3VS7A 3N5BB 5GMKe 3VUBA 4II1A 3QO3A 3EFOB 1YJ9Q 3S6WA 3TSWA 5D6XA 2EFIA 2LX7A 2F1LA 1O45A
chains in the Genus database with same CATH topology
1X69A 1BHHA 5L23A 3M0QA 4X1VA 4OMOA 1A81A 1AYDA 2KE9A 2CSQA 4LE9A 2HDXA 2DLYA 1K0SA 1N5ZA 1G83A 4M4ZA 2HBWA 2EYYA 2D8JA 2QDLA 1BHFA 2PZ1A 1H9OA 5GJWB 3PJPA 1CWDL 5HKZA 3R6NA 2PLEA 1GRIA 1GBRA 2RVFA 1BG1A 2CUDA 2DBMA 2OJ2A 2CT3A 1OOTA 2AZSA 1O41A 4RUGA 3IN8A 2YDLA 4WWQA 4HXJA 1LUIA 3BUMB 2OZOA 1AOUF 3EAZA 5AXIA 2DRKA 3NMZC 1O47A 1CKBA 1GCQC 2PNIA 2L0AA 1M61A 2P4RA 1RUWA 2FO0A 1O49A 2C9WA 2K2MA 1R1SA 2J05A 5I6VA 3EG2A 2EKXA 2VVKA 3I9QA 1FU6A 1X27A 5DC9A 1SHDA 4EIHA 3N84A 1PRMC 4Z89A 2GE9A 4QT7A 2MQIA 3VS4A 1JYQA 5J3XA 5IBMA 1QCFA 1QWEA 5DC0B 1AWXA 3PVLA 4Z8AA 5D0JA 1W1FA 3CWGA 4JPBW 1KIKA 1O4QA 1O4EA 2FRYA 1O4MA 1GFDA 4QSYA 2YUOA 1TUDA 1NZLA 2AZVA 1K76A 2LMJA 4HVVA 1QKXA 1WFWA 2ECZA 2CSIA 3M0PA 2J6FA 1KA7A 3VRPA 2D0NA 1X2QA 3N8MA 2D8HA 2HMHA 3K2MA 3BUXB 1D4TA 1W70A 3I35A 3REAB 1SRMA 3VS5A 3MAZA 3VS6A 2EGEA 1BLJA 2DE0X 1SHBA 1IO6A 2DL8A 2A28A 2X3WD 1O4GA 1BHHB 4AG1C 2B3OA 5EC7A 4RTVA 2K6DA 2YU7A 1NLOC 1A1CA 4A63B 2F2WA 1AWWA 2H46E 2GBQA 3GXXA 3KFJA 3ZNIA 4E68A 4JZ3A 2A08A 5BO4A 1BFJA 1O42A 2HUWA 2YUQA 5HKYA 3TSZA 2LJ3A 4AFSC 3VS1A 3M7FA 5I22A 1BU1A 1ZFPE 1UUEA 1Z9QA 2NUZA 1UGVA 2EL8A 2LP5A 3I5SA 2KRSA 4XZ1A 1HJDA 1SHGA 3VRYA 1AWOA 1WQUA 2PNAA 4GL9E 2GTOA 2H8HA 1TCEA 1FHSA 4FL3A 1CKAA 1TUCA 1FU5A 5IBSA 5IHKA 2LJ1A 1O4FA 2EYWA 1LKKA 1B3QA 1QKWA 4JJDA 1UTIA 1PHTA 2W10A 3C0CA 1RLPC 3CQTA 1F2FA 2KYMA 4OMMA 1OV3A 2JS0A 4WCIA 1K4US 1O4PA 2EYXA 1JXOA 1ZUUA 3KFVA 1ZUYA 4FL2A 4U1PA 1LCKA 3EGUA 2QMSA 1BLKA 1PICA 2BBUA 1W6XA 1GFCA 3EG3A 2V1QA 1AWJA 2DLPA 1O4OA 3BUNB 4GLMA 1AZEA 1TG0A 2AKLA 3QWYA 1RQQC 2ABLA 5HCKA 1FMKA 3H41A 3QWXX 4F17A 1O43A 4P9ZA 2EYVA 2ENMA 5IHIA 1IJRA 4E93A 2KR3A 1M3BA 4LNPA 3S8NA 1M30A 2AUGA 2O9SA 1AZGB 1XOVA 2DX0A 2FCIA 3TKZA 4HVUA 2KYBA 1D1ZA 2RORA 5GJVB 1YVLA 2IZVA 2EVRA 3VRRA 3EHQA 1FBZA 2DVJA 1JYUA 2E5KA 1UECA 2RQRA 1MILA 1O46A 3TVTA 2VIFA 1NEGA 2EO3A 2FEIA 2GTJA 5EHRA 1O4CA 1LKLA 1FBVA 1KSWA 1ZUKA 2LCTA 2FPEA 1A07A 2I0NA 2LCSA 4Z88A 1SPSA 2YUNA 1SHFA 4DEXA 1ARKA 4LN2A 1BMBA 1A1BA 2RMXA 2D1XA 1G2BA 2C0TA 3OP0A 3BUWB 1GBQA 1R1QA 2JM8A 3THKA 1KFZA 2DNUA 2F2VA 1BKMA 1M27C 2DCRA 4K2RA 1U3OA 1AOJA 1O4LA 2CH4A 1OO3A 1SRLA 4RTTA 2EU0A 4LUDA 3T04A 2W0ZA 2CRHA 1WIEA 1X0NA 2EO6A 2JYQA 3IN7A 5DC4A 1B07A 1YN8A 4EY0A 2DMOA 2DL3A 2X3XD 1AYAA 1GL5A 1JEGA 2CI8A 3UATA 3PSKA 3IMJA 2KRMA 2CS0A 1H3HA 2Y1MA 3EG1A 2B86A 1J3TA 2MK2A 2BTTA 5EEQA 4ESRA 2YSQA 4J9DA 2HDVA 1P13A 3M0SA 1UE9A 2O31A 4K45A 3S9KA 2G6FX 2AOBA 2H5KA 3S8LA 1AD5A 1PRLC 2JW4A 2HEQA 1LUKA 1WI7A 2GGRA 2KRNA 4FSSA 1NYFA 1GCPA 4K11A 2DBKA 3H0FA 1UG1A 2IUGA 1PKSA 2DM1A 2O2OA 2KK6A 4OMLA 1YNZA 4JGHA 3VGOA 1QG1E 3OV1A 2HDAA 3VRZA 2DM0A 2DJQA 1M27A 1AYCA 4E6RA 1ZBJA 2DA9A 5I11A 4K44A 3UA6A 5IXBA 2PNBA 2JMCA 2RNAA 2BZ8A 1PKTA 1JU5C 1SPKA 1UUSA 2MRKA 2CUBA 2VKNA 2AOAA 4HVWA 4LUEA 3BKBA 2EGAA 4H34A 2L2PA 2FRWA 1O48A 2KXCA 3GBQA 1O4BA 5IXFA 3EHRA 4RTXA 4D8DA 4JEGA 1QADA 4F5BA 3GQIB 1VA7A 1AEYA 4ORZA 2RN8A 2DILA 1AYBA 3RBBB 1BBZA 1NYGA 1X6BA 5FWBA 1T3LA 2KROA 1SKJA 3M0UA 3PE0A 2ECDA 1MW4A 2EYZA 2LNWA 1IS0A 4GPLB 1CWEA 4OMNA 3VS0A 2ETZA 4FBNA 3SHWA 1RLQC 4J9IA 3TL0A 1K9AA 2RSYA 2SHPA 2CH4W 2O9VA 3HCKA 2XP1A 1Y57A 4EIKA 1M8MA 1PWTA 4CC4B 5ECAA 4NWGA 4A4CA 1MV0B 2DL5A 4IIOA 1H92A 2RMOA 2RQWA 2EBPA 3EG0A 1BB9A 1E6HA 1WA7A 2LQNA 1CSYA 2DX1A 4RTZA 3H0HA 1X6CA 4F59A 1OO4A 1WLPB 1F1WA 2DF6A 3I5RA 1RJAA 1Z9ZA 2F2XA 1OEBA 2K3BA 1WXUA 1O4JA 1WXBA 1JU5A 2C0OA 5HKWA 2IIMA 3ULRB 1SHAA 1CSZA 2K79A 2GQIA 2J06A 4OHHA 1JXMA 1NRVA 1KA6A 1M3CA 4OMQA 2ED0A 2PTKA 2RPNA 4Y92A 2A36A 2RQTA 3PSJA 2J7IA 4JE4A 1AVZC 3IMDA 3N7YA 3UF4A 2JXBA 4JJBA 1WYXA 1E6GA 1SEMA 1YP5A 4DEYA 1V1CA 1JYRA 2AK5A 4X6SA 1RPYA 1LUMA 4J9FA 1ZLMA 1T3SA 2KEAA 4GWFA 3C7IA 2GSBA 2MIOA 3PS5A 3PQZA 1UHCA 4AG2C 2FPDA 5EG3B 1YWOA 2L3PA 5DF6A 2FG0A 2DYBA 3O5ZA 2L3SA 2FPFA 1O4KA 1NLPC 3US4A 1BK2A 1GHUA 1RI9A 3H0IA 1I0CA 1O4IA 2YT6A 4RTYA 4XZ0A 1I1JA 2GNCA 2KT1A 4A4BA 1LUNA 2EQIA 1A1AA 1KC2A 2L3TA 2M51A 2KXDA 3FJ5A 4GBQA 2NWMA 5FWCA 1AOTF 2SRCA 3WA4A 2BZXA 1HSQA 2JM9A 1K1ZA 1O4RA 2L6KA 2OQ1A 4ZNXA 3NPFA 2MC1A 2LNHB 2RQUA 4R0KA 1K0XA 1ABQA 1R1PA 2EGCA 1VYVA 4HCKA 2SEMA 4AFZC 2HSPA 2J6OA 1NG2A 4J9BA 4F5AA 3U23A 2K7AA 1HCTB 1O4DA 4U17A 1S1NA 3HHMB 4F14A 2ROLA 1HD3A 4DGXA 1PNJA 1QWFA 1WX6A 2KNBB 3VS2A 1FYNA 2K79B 3UYOA 3MXCA 2KT8A 2CIAA 1KJWA 2JT4A 1O44A 2EKHA 2CR4A 4AFQC 4CC7A 1M3AA 3M0RA 2AKKA 4OHIA 1X6GA 3M0TA 1TZEE 1YVHA 1O4AA 1YCSB 2L3QA 3ZL7C 1JWOA 1T0JA 2EW3A 2MOXA 3PLFB 4ROJA 1BKLA 1Y0MA 2LNXA 3HIZB 5CDWA 4H1OA 4JZ4A 2OI3A 3S8OA 4RTWA 5FW9A 5GJIA 2DLZA 4OMPA 4J9GA 4CC3A 1FYRA 1Z3KA 1NM7A 2EOBA 1XA6A 1T0HA 5EELA 4TZIA 1ZX6A 1D4WA 5EHPA 4OHDA 1BF5A 2DL7A 4J9CA 3NGPA 2RF0A 2A37A 1U5SA 3VS3A 2CREA 3PFVA 5GJHA 4F16A 4DGPA 1EFNA 1AB2A 2IUIA 1E7OA 1VYUA 1ZSGA 2OAWA 4AFUC 3VRQA 1OPKA 4J9HA 3A98A 1JO8A 4JJCA 2CBLA 1BFIA 1GCQA 2HCKA 3CBLA 1BM2A 4D8KA 1MUZA 3RNJA 3REBB 1UJ0A 3OB2B 3IQLA 4KRTA 2MRJA 1ABOA 1NEBA 4CC2A 1NZVA 1O4HA 3BUOB 5IHNA 5IH2A 1SPRA 2VWFA 2KNOA 1I3ZA 2Y1NA 1A09A 2EPDA 3EACA 1B47A 2RQVA 1UURA 3PVQA 3MXYA 1YWPA 2BZYA 5AULA 3SEMA 2DL4A 2YSXA 2J6KA 1MV3A 1UHFA 2ROTA 1WXTA 3VROA 3CXLA 3UA7A 1CSKA 2LZ6B 3OVEA 2LJ0A 1U06A 2ED1A 1X2KA 3LH5A 4OHLA 2ESWA 2DRMA 2K7AB 1X43A 4RTUA 1H8KA 4NWFA 2XMFA 4P9VA 2CI9A 1SSHA 2MCNA 1UJYA 1A08A 1I07A 4IIMA 2JS2A 2KGTA 2L4KA 2PLDA 2Y3AB 2M0YA 4OHEA 1HCSB 3CD3A 3OB1B 3NHNA 2KBTA 1WDXA 1Y1UA 2O88A 1O4NA 1OPLA 3GXWA 2JTEA 2CT4A 1CJ1A 1JQQA 1A0NB 1QLYA 5KAZA 3JV3A 2V1RA 2LQWA 1UFFA 3VRNA 2YUPA 3VS7A 1UDLA 1A1EA 4L1BB 2JMAA 1VYTA 4J9EA 3TSWA 2LX7A 1LCJA 1O45A 2K9GA 2C0IA 2IUHA 2CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X69 A;  1BHH A;  5L23 A;  3M0Q A;  4X1V A;  4OMO A;  1A81 A;  1AYD A;  2KE9 A;  2CSQ A;  4LE9 A;  2HDX A;  2DLY A;  1K0S A;  1N5Z A;  1G83 A;  4M4Z A;  2HBW A;  2EYY A;  2D8J A;  2QDL A;  1BHF A;  2PZ1 A;  1H9O A;  5GJW B;  3PJP A;  1CWD L;  5HKZ A;  3R6N A;  2PLE A;  1GRI A;  1GBR A;  2RVF A;  1BG1 A;  2CUD A;  2DBM A;  2OJ2 A;  2CT3 A;  1OOT A;  2AZS A;  1O41 A;  4RUG A;  3IN8 A;  2YDL A;  4WWQ A;  4HXJ A;  1LUI A;  3BUM B;  2OZO A;  1AOU F;  3EAZ A;  5AXI A;  2DRK A;  3NMZ C;  1O47 A;  1CKB A;  1GCQ C;  2PNI A;  2L0A A;  1M61 A;  2P4R A;  1RUW A;  2FO0 A;  1O49 A;  2C9W A;  2K2M A;  1R1S A;  2J05 A;  5I6V A;  3EG2 A;  2EKX A;  2VVK A;  3I9Q A;  1FU6 A;  1X27 A;  5DC9 A;  1SHD A;  4EIH A;  3N84 A;  1PRM C;  4Z89 A;  2GE9 A;  4QT7 A;  2MQI A;  3VS4 A;  1JYQ A;  5J3X A;  5IBM A;  1QCF A;  1QWE A;  5DC0 B;  1AWX A;  3PVL A;  4Z8A A;  5D0J A;  1W1F A;  3CWG A;  4JPB W;  1KIK A;  1O4Q A;  1O4E A;  2FRY A;  1O4M A;  1GFD A;  4QSY A;  2YUO A;  1TUD A;  1NZL A;  2AZV A;  1K76 A;  2LMJ A;  4HVV A;  1QKX A;  1WFW A;  2ECZ A;  2CSI A;  3M0P A;  2J6F A;  1KA7 A;  3VRP A;  2D0N A;  1X2Q A;  3N8M A;  2D8H A;  2HMH A;  3K2M A;  3BUX B;  1D4T A;  1W70 A;  3I35 A;  3REA B;  1SRM A;  3VS5 A;  3MAZ A;  3VS6 A;  2EGE A;  1BLJ A;  2DE0 X;  1SHB A;  1IO6 A;  2DL8 A;  2A28 A;  2X3W D;  1O4G A;  1BHH B;  4AG1 C;  2B3O A;  5EC7 A;  4RTV A;  2K6D A;  2YU7 A;  1NLO C;  1A1C A;  4A63 B;  2F2W A;  1AWW A;  2H46 E;  2GBQ A;  3GXX A;  3KFJ A;  3ZNI A;  4E68 A;  4JZ3 A;  2A08 A;  5BO4 A;  1BFJ A;  1O42 A;  2HUW A;  2YUQ A;  5HKY A;  3TSZ A;  2LJ3 A;  4AFS C;  3VS1 A;  3M7F A;  5I22 A;  1BU1 A;  1ZFP E;  1UUE A;  1Z9Q A;  2NUZ A;  1UGV A;  2EL8 A;  2LP5 A;  3I5S A;  2KRS A;  4XZ1 A;  1HJD A;  1SHG A;  3VRY A;  1AWO A;  1WQU A;  2PNA A;  4GL9 E;  2GTO A;  2H8H A;  1TCE A;  1FHS A;  4FL3 A;  1CKA A;  1TUC A;  1FU5 A;  5IBS A;  5IHK A;  2LJ1 A;  1O4F A;  2EYW A;  1LKK A;  1B3Q A;  1QKW A;  4JJD A;  1UTI A;  1PHT A;  2W10 A;  3C0C A;  1RLP C;  3CQT A;  1F2F A;  2KYM A;  4OMM A;  1OV3 A;  2JS0 A;  4WCI A;  1K4U S;  1O4P A;  2EYX A;  1JXO A;  1ZUU A;  3KFV A;  1ZUY A;  4FL2 A;  4U1P A;  1LCK A;  3EGU A;  2QMS A;  1BLK A;  1PIC A;  2BBU A;  1W6X A;  1GFC A;  3EG3 A;  2V1Q A;  1AWJ A;  2DLP A;  1O4O A;  3BUN B;  4GLM A;  1AZE A;  1TG0 A;  2AKL A;  3QWY A;  1RQQ C;  2ABL A;  5HCK A;  1FMK A;  3H41 A;  3QWX X;  4F17 A;  1O43 A;  4P9Z A;  2EYV A;  2ENM A;  5IHI A;  1IJR A;  4E93 A;  2KR3 A;  1M3B A;  4LNP A;  3S8N A;  1M30 A;  2AUG A;  2O9S A;  1AZG B;  1XOV A;  2DX0 A;  2FCI A;  3TKZ A;  4HVU A;  2KYB A;  1D1Z A;  2ROR A;  5GJV B;  1YVL A;  2IZV A;  2EVR A;  3VRR A;  3EHQ A;  1FBZ A;  2DVJ A;  1JYU A;  2E5K A;  1UEC A;  2RQR A;  1MIL A;  1O46 A;  3TVT A;  2VIF A;  1NEG A;  2EO3 A;  2FEI A;  2GTJ A;  5EHR A;  1O4C A;  1LKL A;  1FBV A;  1KSW A;  1ZUK A;  2LCT A;  2FPE A;  1A07 A;  2I0N A;  2LCS A;  4Z88 A;  1SPS A;  2YUN A;  1SHF A;  4DEX A;  1ARK A;  4LN2 A;  1BMB A;  1A1B A;  2RMX A;  2D1X A;  1G2B A;  2C0T A;  3OP0 A;  3BUW B;  1GBQ A;  1R1Q A;  2JM8 A;  3THK A;  1KFZ A;  2DNU A;  2F2V A;  1BKM A;  1M27 C;  2DCR A;  4K2R A;  1U3O A;  1AOJ A;  1O4L A;  2CH4 A;  1OO3 A;  1SRL A;  4RTT A;  2EU0 A;  4LUD A;  3T04 A;  2W0Z A;  2CRH A;  1WIE A;  1X0N A;  2EO6 A;  2JYQ A;  3IN7 A;  5DC4 A;  1B07 A;  1YN8 A;  4EY0 A;  2DMO A;  2DL3 A;  2X3X D;  1AYA A;  1GL5 A;  1JEG A;  2CI8 A;  3UAT A;  3PSK A;  3IMJ A;  2KRM A;  2CS0 A;  1H3H A;  2Y1M A;  3EG1 A;  2B86 A;  1J3T A;  2MK2 A;  2BTT A;  5EEQ A;  4ESR A;  2YSQ A;  4J9D A;  2HDV A;  1P13 A;  3M0S A;  1UE9 A;  2O31 A;  4K45 A;  3S9K A;  2G6F X;  2AOB A;  2H5K A;  3S8L A;  1AD5 A;  1PRL C;  2JW4 A;  2HEQ A;  1LUK A;  1WI7 A;  2GGR A;  2KRN A;  4FSS A;  1NYF A;  1GCP A;  4K11 A;  2DBK A;  3H0F A;  1UG1 A;  2IUG A;  1PKS A;  2DM1 A;  2O2O A;  2KK6 A;  4OML A;  1YNZ A;  4JGH A;  3VGO A;  1QG1 E;  3OV1 A;  2HDA A;  3VRZ A;  2DM0 A;  2DJQ A;  1M27 A;  1AYC A;  4E6R A;  1ZBJ A;  2DA9 A;  5I11 A;  4K44 A;  3UA6 A;  5IXB A;  2PNB A;  2JMC A;  2RNA A;  2BZ8 A;  1PKT A;  1JU5 C;  1SPK A;  1UUS A;  2MRK A;  2CUB A;  2VKN A;  2AOA A;  4HVW A;  4LUE A;  3BKB A;  2EGA A;  4H34 A;  2L2P A;  2FRW A;  1O48 A;  2KXC A;  3GBQ A;  1O4B A;  5IXF A;  3EHR A;  4RTX A;  4D8D A;  4JEG A;  1QAD A;  4F5B A;  3GQI B;  1VA7 A;  1AEY A;  4ORZ A;  2RN8 A;  2DIL A;  1AYB A;  3RBB B;  1BBZ A;  1NYG A;  1X6B A;  5FWB A;  1T3L A;  2KRO A;  1SKJ A;  3M0U A;  3PE0 A;  2ECD A;  1MW4 A;  2EYZ A;  2LNW A;  1IS0 A;  4GPL B;  1CWE A;  4OMN A;  3VS0 A;  2ETZ A;  4FBN A;  3SHW A;  1RLQ C;  4J9I A;  3TL0 A;  1K9A A;  2RSY A;  2SHP A;  2CH4 W;  2O9V A;  3HCK A;  2XP1 A;  1Y57 A;  4EIK A;  1M8M A;  1PWT A;  4CC4 B;  5ECA A;  4NWG A;  4A4C A;  1MV0 B;  2DL5 A;  4IIO A;  1H92 A;  2RMO A;  2RQW A;  2EBP A;  3EG0 A;  1BB9 A;  1E6H A;  1WA7 A;  2LQN A;  1CSY A;  2DX1 A;  4RTZ A;  3H0H A;  1X6C A;  4F59 A;  1OO4 A;  1WLP B;  1F1W A;  2DF6 A;  3I5R A;  1RJA A;  1Z9Z A;  2F2X A;  1OEB A;  2K3B A;  1WXU A;  1O4J A;  1WXB A;  1JU5 A;  2C0O A;  5HKW A;  2IIM A;  3ULR B;  1SHA A;  1CSZ A;  2K79 A;  2GQI A;  2J06 A;  4OHH A;  1JXM A;  1NRV A;  1KA6 A;  1M3C A;  4OMQ A;  2ED0 A;  2PTK A;  2RPN A;  4Y92 A;  2A36 A;  2RQT A;  3PSJ A;  2J7I A;  4JE4 A;  1AVZ C;  3IMD A;  3N7Y A;  3UF4 A;  2JXB A;  4JJB A;  1WYX A;  1E6G A;  1SEM A;  1YP5 A;  4DEY A;  1V1C A;  1JYR A;  2AK5 A;  4X6S A;  1RPY A;  1LUM A;  4J9F A;  1ZLM A;  1T3S A;  2KEA A;  4GWF A;  3C7I A;  2GSB A;  2MIO A;  3PS5 A;  3PQZ A;  1UHC A;  4AG2 C;  2FPD A;  5EG3 B;  1YWO A;  2L3P A;  5DF6 A;  2FG0 A;  2DYB A;  3O5Z A;  2L3S A;  2FPF A;  1O4K A;  1NLP C;  3US4 A;  1BK2 A;  1GHU A;  1RI9 A;  3H0I A;  1I0C A;  1O4I A;  2YT6 A;  4RTY A;  4XZ0 A;  1I1J A;  2GNC A;  2KT1 A;  4A4B A;  1LUN A;  2EQI A;  1A1A A;  1KC2 A;  2L3T A;  2M51 A;  2KXD A;  3FJ5 A;  4GBQ A;  2NWM A;  5FWC A;  1AOT F;  2SRC A;  3WA4 A;  2BZX A;  1HSQ A;  2JM9 A;  1K1Z A;  1O4R A;  2L6K A;  2OQ1 A;  4ZNX A;  3NPF A;  2MC1 A;  2LNH B;  2RQU A;  4R0K A;  1K0X A;  1ABQ A;  1R1P A;  2EGC A;  1VYV A;  4HCK A;  2SEM A;  4AFZ C;  2HSP A;  2J6O A;  1NG2 A;  4J9B A;  4F5A A;  3U23 A;  2K7A A;  1HCT B;  1O4D A;  4U17 A;  1S1N A;  3HHM B;  4F14 A;  2ROL A;  1HD3 A;  4DGX A;  1PNJ A;  1QWF A;  1WX6 A;  2KNB B;  3VS2 A;  1FYN A;  2K79 B;  3UYO A;  3MXC A;  2KT8 A;  2CIA A;  1KJW A;  2JT4 A;  1O44 A;  2EKH A;  2CR4 A;  4AFQ C;  4CC7 A;  1M3A A;  3M0R A;  2AKK A;  4OHI A;  1X6G A;  3M0T A;  1TZE E;  1YVH A;  1O4A A;  1YCS B;  2L3Q A;  3ZL7 C;  1JWO A;  1T0J A;  2EW3 A;  2MOX A;  3PLF B;  4ROJ A;  1BKL A;  1Y0M A;  2LNX A;  3HIZ B;  5CDW A;  4H1O A;  4JZ4 A;  2OI3 A;  3S8O A;  4RTW A;  5FW9 A;  5GJI A;  2DLZ A;  4OMP A;  4J9G A;  4CC3 A;  1FYR A;  1Z3K A;  1NM7 A;  2EOB A;  1XA6 A;  1T0H A;  5EEL A;  4TZI A;  1ZX6 A;  1D4W A;  5EHP A;  4OHD A;  1BF5 A;  2DL7 A;  4J9C A;  3NGP A;  2RF0 A;  2A37 A;  1U5S A;  3VS3 A;  2CRE A;  3PFV A;  5GJH A;  4F16 A;  4DGP A;  1EFN A;  1AB2 A;  2IUI A;  1E7O A;  1VYU A;  1ZSG A;  2OAW A;  4AFU C;  3VRQ A;  1OPK A;  4J9H A;  3A98 A;  1JO8 A;  4JJC A;  2CBL A;  1BFI A;  1GCQ A;  2HCK A;  3CBL A;  1BM2 A;  4D8K A;  1MUZ A;  3RNJ A;  3REB B;  1UJ0 A;  3OB2 B;  3IQL A;  4KRT A;  2MRJ A;  1ABO A;  1NEB A;  4CC2 A;  1NZV A;  1O4H A;  3BUO B;  5IHN A;  5IH2 A;  1SPR A;  2VWF A;  2KNO A;  1I3Z A;  2Y1N A;  1A09 A;  2EPD A;  3EAC A;  1B47 A;  2RQV A;  1UUR A;  3PVQ A;  3MXY A;  1YWP A;  2BZY A;  5AUL A;  3SEM A;  2DL4 A;  2YSX A;  2J6K A;  1MV3 A;  1UHF A;  2ROT A;  1WXT A;  3VRO A;  3CXL A;  3UA7 A;  1CSK A;  2LZ6 B;  3OVE A;  2LJ0 A;  1U06 A;  2ED1 A;  1X2K A;  3LH5 A;  4OHL A;  2ESW A;  2DRM A;  2K7A B;  1X43 A;  4RTU A;  1H8K A;  4NWF A;  2XMF A;  4P9V A;  2CI9 A;  1SSH A;  2MCN A;  1UJY A;  1A08 A;  1I07 A;  4IIM A;  2JS2 A;  2KGT A;  2L4K A;  2PLD A;  2Y3A B;  2M0Y A;  4OHE A;  1HCS B;  3CD3 A;  3OB1 B;  3NHN A;  2KBT A;  1WDX A;  1Y1U A;  2O88 A;  1O4N A;  1OPL A;  3GXW A;  2JTE A;  2CT4 A;  1CJ1 A;  1JQQ A;  1A0N B;  1QLY A;  5KAZ A;  3JV3 A;  2V1R A;  2LQW A;  1UFF A;  3VRN A;  2YUP A;  3VS7 A;  1UDL A;  1A1E A;  4L1B B;  2JMA A;  1VYT A;  4J9E A;  3TSW A;  2LX7 A;  1LCJ A;  1O45 A;  2K9G A;  2C0I A;  2IUH A;  2CDT A; 
#chains in the Genus database with same CATH topology
 4F7U F;  4QVC A;  4OMO A;  4F7U B;  1A81 A;  2RI5 A;  2QG9 B;  1KD1 U;  4CRI A;  2E65 A;  1AYD A;  2JZ2 A;  4LE9 A;  2DER A;  3CBO A;  3CXC P;  1UGS B;  1M1K C;  5GAM e;  2D8J A;  3HRS A;  2RHX A;  4RMO A;  5IT9 E;  4X9D A;  1BG1 A;  3CPF A;  1GBR A;  2CUD A;  2OJ2 A;  2LNV A;  5KYW B;  2AZS A;  2R57 A;  2YDL A;  4M7D B;  2DKG A;  3BUM B;  4E7K A;  3BE3 A;  4M77 G;  5AXI A;  2DRK A;  2L0A A;  4FCY A;  1M61 A;  5KYU A;  3HFN A;  2J05 A;  3D7S B;  2COZ A;  4C8Q A;  1S72 Q;  4EIH A;  2YRC A;  4Z89 A;  2AIR B;  3M4Y A;  3QZ9 B;  2V8J A;  4QT7 A;  2MQI A;  3VS4 A;  1QCF A;  5DC0 B;  4Z8A A;  1BI1 A;  5D0J A;  3EAE A;  4JPB W;  1O4E A;  4QSY A;  1M4Z A;  4C5I A;  3I56 A;  4M7A C;  3ER0 A;  1K73 U;  2LMJ A;  4HVV A;  1WFW A;  2ECZ A;  1KA7 A;  1WNL A;  3RKY A;  1X2Q A;  1VQP A;  5HKC A;  1PSE A;  4KUD K;  3VYG A;  1SRM A;  1VQL A;  2EGE A;  1I4K 1;  2D0Q B;  2E70 A;  2VV5 A;  2X3W D;  2A28 A;  4HCC A;  4M7A E;  4KH1 B;  4QW2 A;  2K6D A;  5GAM d;  1NLO C;  3GNG A;  2EJG A;  3C95 A;  1QP3 A;  4OGE A;  1A1C A;  4E47 A;  4FYV B;  1RAH B;  2DEQ A;  1AWW A;  1TSF A;  3ZNI A;  1M9S A;  4JZ3 A;  5KYY A;  2A3L A;  2KDS A;  1Q81 R;  1N8R R;  3Q1J A;  3VS1 A;  5I22 A;  2RD1 A;  1ZFP E;  1Z9Q A;  5LJ5 j;  2M1H A;  2ZZD A;  2MWO A;  1SHG A;  3VRY A;  1YHQ T;  4XU1 A;  3CCV T;  2RO0 A;  2E64 A;  1SSF A;  4GL9 E;  1K9M R;  3JCM P;  1FU5 A;  1FMV A;  2RI2 A;  3QZ5 B;  1WQW A;  3EGD A;  3MCA B;  3PGG A;  4M7A D;  2EYW A;  1LKK A;  1QKW A;  4LDU A;  5GAM f;  1Q86 U;  1G3W A;  1PHT A;  3C0C A;  3P8D A;  4B9X A;  4OB3 B;  4OMM A;  1OV3 A;  2L3R A;  4WCI A;  3FLG A;  5GMK j;  2X51 A;  4DQ2 A;  3KFV A;  1ZUU A;  2DJZ A;  4ANJ A;  4VUB A;  1BLK A;  2QMS A;  1GFC A;  3G6E A;  1AWJ A;  1NJI C;  4BI3 A;  4GLM A;  4KGZ B;  3QWY A;  1RQQ C;  2ABL A;  1O43 A;  1FMK A;  3H41 A;  3CCQ Q;  3S3O A;  3JB9 H;  2KR3 A;  1M3B A;  4C8Q C;  2DX0 A;  5GAM j;  2FCI A;  3A8H B;  3CME A;  4HVU A;  3E9G A;  5GJV B;  1YVL A;  2EVR A;  1UEC A;  3CXC A;  1Q82 U;  1V29 B;  1NEG A;  1R77 A;  2EO3 A;  2FEI A;  3G71 Q;  2GTJ A;  4ELZ C;  4C8Q E;  2Y4Y A;  2QYZ A;  2I0N A;  5FU6 B;  1AHJ B;  3MJX A;  4DEX A;  2JUF A;  4LN2 A;  2OTJ A;  1BI3 A;  1VQ4 T;  3CMA Q;  2QQR A;  5FU7 C;  1YJ9 A;  3OP0 A;  4M75 G;  2HL3 A;  2XID A;  4GLK A;  1KFZ A;  3OS1 A;  1M27 C;  3PIO A;  4OMF B;  2LRQ A;  4QQ6 A;  4PJM A;  1KHI A;  2O4X A;  4EMG A;  4LUD A;  4M77 B;  2JYQ A;  1WIE A;  4DBH A;  2R5M A;  1B07 A;  3GOX A;  5GAN e;  1FXX A;  2CI8 A;  3UAT A;  3PSK A;  3QYH B;  3LLR A;  2KRM A;  2CS0 A;  4FM4 B;  3CCM A;  1P13 A;  2O31 A;  3G4S A;  4EPC A;  1IGU A;  1AD5 A;  1PRL C;  2HEQ A;  3OYM A;  1LUK A;  4KH0 B;  2KRN A;  4FSS A;  1NYF A;  2NYS A;  1YI2 T;  4IUR A;  2DBK A;  2NUP B;  4C92 A;  3VRZ A;  2DJQ A;  4E6R A;  1XTD A;  4K44 A;  2KI7 A;  5IXB A;  2RNA A;  5I2S A;  1UUS A;  2MRK A;  2AOA A;  1Q7Y R;  3V7R A;  2L2P A;  3SWN A;  8ATC B;  4O5V A;  1B34 B;  3V8K A;  3GQI B;  1AEY A;  1BBZ A;  5LJ3 g;  5FWB A;  1T3L A;  2CP6 A;  5FLX E;  1MW4 A;  2EYZ A;  2DXT A;  3TL0 A;  1K9A A;  2EQJ A;  4LXC A;  2RSY A;  1WZO A;  2O9V A;  4RCB A;  1Y57 A;  4CC4 B;  5ECA A;  1QP2 A;  3CCL T;  2RMO A;  2RQW A;  1WA7 A;  5J3B A;  3OMC A;  4RTZ A;  3H0H A;  5GAN 2;  1WLP B;  4X9C A;  1F1W A;  1Z9Z A;  2EJ9 A;  2CP3 A;  4HT9 A;  3GLX A;  2NUT A;  1WXU A;  4E7S A;  4OB0 B;  1JU5 A;  2IIM A;  3QJY A;  3ULR B;  3MPU B;  1M2V A;  3CCS Q;  3CCR Q;  1VUB A;  5HY6 A;  1VQM A;  1VQ6 Q;  3M5A A;  2PTK A;  2VGN A;  1N8R C;  2RQT A;  4BDY A;  4KGV B;  5FRM A;  2JXB A;  4N4I A;  1I5L A;  2JVV A;  2E6Z A;  2LX9 A;  1V1C A;  1JYR A;  4RCC A;  4R56 A;  1K9M C;  1QVP A;  3CXC S;  2KEA A;  4GWF A;  3C7I A;  1VQ5 T;  2GSB A;  1RAA B;  3PS5 A;  2QTV A;  5KYX A;  3EFS A;  5GMK l;  3JAM E;  3JB9 G;  2L3P A;  2CZ1 B;  4DBF A;  2DYB A;  3O5Z A;  2L3S A;  4Z02 A;  3JCM W;  1O4K A;  1PD1 A;  1G3S A;  2DTO A;  5GAO l;  1O4I A;  4RKU E;  2LC4 A;  1OZ2 A;  4RTY A;  2GNC A;  5CKB A;  1YJN T;  1PG5 B;  5GAN j;  4A4B A;  1KC2 A;  2L3T A;  4M78 C;  2XDD A;  2EAY A;  3G7Z A;  1W2B P;  2FHD A;  5GAO p;  2BZX A;  2JM9 A;  3S3M A;  1K1Z A;  3LWH A;  1SG5 A;  1O4R A;  1I5O B;  3MP1 A;  3FIF A;  4PJN A;  3SWN C;  2RK1 A;  2RQU A;  4R0K A;  2OTL A;  1ABQ A;  3X28 B;  5HK0 A;  2EGC A;  1VYV A;  4M78 E;  5M9O A;  4J9B A;  3CC4 T;  1TU0 B;  2ZGW A;  2DXB A;  3U23 A;  5A2Q E;  3HHM B;  3PMT A;  1G8X A;  2HL5 C;  3L2R A;  4DGX A;  1PNJ A;  1QWF A;  1WX6 A;  3UYO A;  3MXC A;  2KT8 A;  3OB9 A;  1OX9 A;  2EKH A;  4DOV A;  3E2U A;  2LTO A;  2MF2 A;  2AKK A;  4OHI A;  1ZHI A;  2K5L A;  5CKD A;  1O4A A;  3ZL7 C;  3L2W A;  5GAO q;  2EW3 A;  4ROJ A;  2LNX A;  4NL2 A;  4JZ4 A;  2OI3 A;  4OGC A;  2V26 A;  3LGF A;  1FYR A;  1Z3K A;  4EMK B;  1NM7 A;  2VC8 A;  4E2F B;  4M78 D;  1D4W A;  3EFO A;  1JB0 E;  2FVU A;  4KGX B;  1WHK A;  3NGP A;  1U5S A;  2QAS A;  1AB2 A;  1LNX A;  2OAW A;  4AFU C;  1NBE B;  1OPK A;  4F7U A;  1UEB A;  4J9H A;  3CCU T;  1JO8 A;  2CBL A;  1BFI A;  2P84 A;  3PMI A;  4C0F A;  1BM2 A;  4D8K A;  3CBL A;  3ME9 A;  4FSX A;  1NEB A;  3FB9 A;  2QA4 A;  5IHN A;  1SPR A;  2VGM A;  2VWF A;  4N4H A;  2KNO A;  1W4S A;  2EPD A;  5KYW A;  2LQK A;  4UC4 A;  3PIP A;  1YWP A;  2QEX T;  4M7D A;  5AUL A;  2FZC B;  3SEM A;  1UHF A;  3MEU A;  2LZ6 B;  1U06 A;  3CCE T;  1QMC A;  1X43 A;  1B7T A;  2CI9 A;  2RHY A;  8AT1 B;  1Q7Y C;  1VQO A;  2Y3A B;  2M0Y A;  5IAY A;  1TS9 A;  3CD3 A;  3OB1 B;  1YJW T;  1Y1U A;  3GXW A;  2JTE A;  2MPX C;  1CJ1 A;  2EQM A;  4M78 F;  1JQQ A;  5C0M A;  1A0N B;  2V1R A;  1BIB A;  1F1B B;  3CD6 T;  5CQY A;  3RMQ A;  3A8O B;  2GCX A;  3CCS A;  3OW2 P;  1VQK A;  4J9E A;  3CCR A;  2K9G A;  2C0I A;  2EQK A;  2IUH A;  3JCM g;  3M0Q A;  4X1V A;  1YIT Q;  2F69 A;  1W2B A;  3DB3 A;  1D0X A;  1RAG B;  1TWB A;  3OYF A;  1K0S A;  1N5Z A;  1G83 A;  4XTW A;  1BHF A;  3PJP A;  1CWD L;  2WSF E;  3CCJ A;  1GRI A;  3AHU A;  1O41 A;  1OOT A;  4WWQ A;  2M16 A;  2QAZ A;  4HXJ A;  4PJL A;  1LUI A;  4PJO C;  1AOU F;  3I56 Q;  5GAN 7;  3M57 A;  1VQ9 A;  3CEY A;  3QDR B;  4FU6 A;  1O49 A;  1WJQ A;  1VQP Q;  5I6V A;  4B9W A;  4DOW A;  5KH6 A;  1MHN A;  3I9Q A;  3FEO A;  4XAX B;  1X27 A;  1K8A R;  1VQL Q;  4PJO E;  5LJ3 h;  1PRM C;  3S3N A;  2GE9 A;  4M7D C;  5J3X A;  4FIB A;  2L8D A;  3EFR A;  3PVL A;  4Y28 E;  2FRY A;  2RH2 A;  4PKC C;  3QG1 A;  1LJO A;  2COY A;  1K76 A;  3M0P A;  3VRP A;  2D0N A;  3N8M A;  4KUI A;  4M7D E;  2D8H A;  3BUX B;  2ZPH B;  3I35 A;  3VS5 A;  1BLJ A;  2XKO C;  2DE0 X;  1SHB A;  1O4G A;  1OZ3 A;  1BHH B;  2PVO B;  4MML A;  1M90 U;  4PJO D;  4ELY C;  3HRT A;  4A63 B;  5LL6 S;  2F2W A;  4EDU A;  2H46 E;  1MND A;  1BIA A;  1BKB A;  2LJ3 A;  2P0K A;  2QQB A;  1WJS A;  3CBM A;  2VB6 A;  1UUE A;  1UGV A;  2EL8 A;  3G6E Q;  4XZ1 A;  1AWO A;  4M7D D;  2DVE A;  2GTO A;  5C6S A;  1TCE A;  2XI9 A;  1FHS A;  4FL3 A;  3SD4 A;  5IHK A;  2WAC A;  2LJ1 A;  2DZ9 A;  2X4X A;  3CBP A;  3CME Q;  4JJD A;  2FL7 A;  1C6V X;  1U1T A;  2LT1 A;  4E93 A;  1F2F A;  2KYM A;  4QKU A;  1O4P A;  3OSS C;  4ZGE B;  3X24 B;  1JXO A;  4FL2 A;  1ZUY A;  3OMG A;  4U1P A;  3EGU A;  2BBU A;  1W6X A;  3EG3 A;  2V1Q A;  4FYY B;  1ACM B;  2DLP A;  1AZE A;  3OW2 A;  1LOJ A;  2AKL A;  4FYX B;  2YLC A;  2ENM A;  1IJR A;  3JB9 J;  3VKI A;  4LNP A;  2OTJ Q;  2EYQ A;  4KT0 E;  1M8V A;  3A1P A;  4FYW B;  2KYB A;  4OB2 B;  1D1Z A;  2ROR A;  1K9M U;  2BUD A;  3EHQ A;  1FBZ A;  1JYU A;  2DET A;  4PK4 A;  1MIL A;  4PJO F;  4PJO B;  3OA6 A;  2VUB A;  5EHR A;  1O4C A;  2X4Y A;  1LKL A;  1FBV A;  2P4T A;  2P0P A;  1TUG B;  3OYA A;  1KQ2 A;  3JRZ A;  2LCS A;  4J6W A;  1W2B S;  4Z88 A;  3VYH B;  1MMD A;  1ARK A;  2IVW A;  1BMB A;  4MZP A;  1G2B A;  4M7D F;  4NS5 A;  1TH7 A;  3CCM Q;  2QQS A;  3THK A;  1YIT A;  2GFA A;  2DIG A;  2DXC A;  1YHQ A;  3CCV A;  3G4S Q;  5FU6 C;  3CC7 T;  3NTK A;  1AOJ A;  3NTH A;  4M7A G;  2EO6 A;  2E10 A;  3JSC A;  2MI6 A;  1TXQ A;  1VQ8 T;  3SFM A;  3IN7 A;  2E1H A;  4DA4 A;  2BE9 B;  2DMO A;  2DL3 A;  2X3X D;  1U1S A;  2E4H A;  1JEG A;  2H3E B;  1WHJ A;  1H3H A;  3EG1 A;  2B86 A;  1J3T A;  2MK2 A;  4ESR A;  4NL3 A;  1N9R A;  1GXI E;  2EIF A;  2AOB A;  2H5K A;  3JCM Q;  4M77 C;  1WI7 A;  2FZK B;  2GGR A;  1GCP A;  4K11 A;  1KC8 R;  1PKS A;  3FC3 A;  2KK6 A;  4JGH A;  1YNZ A;  2CP7 A;  2X4J A;  2DM0 A;  1M27 A;  5I11 A;  3UA6 A;  2ZPF B;  2PNB A;  4M77 E;  2BZ8 A;  1PKT A;  3G1J A;  2RJC A;  3RKX A;  1IXD A;  3BKB A;  4H34 A;  4HVW A;  2JN0 A;  2EGA A;  3LYV A;  2KXC A;  1O4B A;  1K8A C;  1OX8 A;  1QAD A;  3BW1 A;  1VA7 A;  2DIL A;  3RBB B;  1X6B A;  1SKJ A;  1VQ4 A;  2ECD A;  3J7A F;  4J83 A;  2CP2 A;  5LJ5 g;  5J26 A;  4OMN A;  3VS0 A;  2ETZ A;  1RLQ C;  3OYH A;  1VQM Q;  3TU4 K;  2MK5 A;  1PWT A;  4A4C A;  1YFN A;  2DL5 A;  2YHT A;  4IIO A;  1H92 A;  2E3H A;  3JCM h;  2EBP A;  1YIJ T;  2Y4X A;  2LQN A;  3H6Z A;  2DX1 A;  4M77 D;  4C8Q G;  1QVG S;  1CSY A;  3OBW A;  2HQH A;  4JS5 A;  2F2X A;  1Q7Y U;  3QYG B;  3MO8 A;  3OS2 A;  2C0O A;  4A4F A;  1G3Y A;  1NRV A;  3GIB A;  3ZEH A;  3GF5 A;  1KA6 A;  1M3C A;  2RB6 A;  4ZTF A;  3OW2 S;  3SB2 A;  4L5G A;  2A36 A;  2J7I A;  1AVZ C;  1BYM A;  5GAM g;  4BDZ A;  4C0G A;  2AK5 A;  2MWP A;  1LUM A;  1JRI A;  4J9F A;  4ATO A;  4EMK A;  4N4G A;  2KSS A;  5DF6 A;  1D0Z A;  1P92 A;  2OTL Q;  3MKD A;  5IN1 A;  1NLP C;  4MZT A;  1TOV A;  1RI9 A;  3H0I A;  1I0C A;  2KMT A;  2YT6 A;  4XZ0 A;  1I1J A;  1D1B A;  4LDV A;  2KT1 A;  5GMK m;  1A1A A;  2HNI A;  2M51 A;  4Q5W A;  3CC2 T;  4GBQ A;  5FWC A;  3OYJ A;  2SRC A;  3M56 A;  4OP0 A;  3O8V A;  4M77 F;  5GAO m;  2OQ1 A;  1OYX A;  3NPF A;  1K73 R;  1K0X A;  1R1P A;  3CCL A;  4XTX A;  3LGL A;  1M1F A;  1RAD B;  4AFZ C;  3RR6 A;  3P8H A;  1NG2 A;  1KG1 A;  5LJ3 d;  4KBM B;  1HCT B;  3L2Q A;  4PFO A;  4U17 A;  4J6X A;  1S1N A;  3I55 T;  2YXY A;  2ROL A;  2JTM A;  3VS2 A;  1D0Y A;  2K79 B;  2CIA A;  1KJW A;  2QGF B;  1PCX A;  1M3A A;  3T9N A;  4N0A C;  3M0T A;  4LDX A;  2EKO A;  2MOX A;  3PLF B;  2MYS A;  1Y0M A;  1BKL A;  5CDW A;  4H1O A;  2QGG A;  3BDL A;  4RTW A;  4M78 A;  2ZCF B;  3QKJ A;  5DLO A;  5GJI A;  2QA4 Q;  2DLZ A;  4Y91 A;  1OU8 A;  5CVI A;  1VQ7 T;  2AT1 B;  2XIC A;  5LJ3 f;  4OHD A;  1VQ5 A;  2RF0 A;  2A37 A;  5A0G A;  2CRE A;  1VQN Q;  2IUI A;  1Q86 R;  4JJC A;  4J7F A;  1GCQ A;  5AT1 B;  5GMK i;  2DTI A;  1YJN A;  1UJ0 A;  3OB2 B;  4KRT A;  4EMK C;  1ABO A;  3OYL A;  1VQO Q;  2MRJ A;  1D1C A;  4E7L A;  5IH2 A;  1MMA A;  1YJ9 T;  1B47 A;  2KAF A;  3MXY A;  2DL4 A;  1KC8 C;  1R8O B;  2ROT A;  1IZ6 A;  1HYO A;  2WSE E;  2KY9 A;  3UA7 A;  3PTA A;  3OVE A;  2KQW A;  1X2K A;  2EJF A;  2ESW A;  2K7A B;  4NWF A;  1X01 A;  4BY6 B;  1Q82 R;  1SSH A;  2AHJ B;  2MCN A;  3CC4 A;  1I07 A;  1VQK Q;  2BIV A;  2Y90 A;  2L4K A;  2PLD A;  1H3Z A;  2VAS A;  1Q81 C;  3PNW C;  1QQJ A;  2JJ9 A;  3AT1 B;  4BE0 A;  1OPL A;  2YRV A;  2CT4 A;  4PL6 A;  4PNO A;  1QLY A;  1S72 T;  3VRN A;  3CCJ Q;  2YUP A;  1UDL A;  4C92 G;  1A1E A;  4L1B B;  1BCO A;  4J5Y A;  4PJJ A;  1R0B G;  4JJN K;  3RKW A;  2PUK B;  1M1K U;  1JJ2 P;  2CDT A;  1X69 A;  1BHH A;  1I81 A;  1VQ9 Q;  3TEE A;  3FRN A;  5CK9 A;  2KE9 A;  2CSQ A;  5CAI A;  2XD0 A;  2HDX A;  4BE1 A;  5A0D A;  3CCU A;  4X34 A;  3MEA A;  3RES A;  5GAN g;  2QDL A;  2PZ1 A;  1PM3 A;  5HKZ A;  4M75 F;  2PLE A;  4M75 B;  2RVF A;  2E41 A;  1NPR A;  2DBM A;  2CT3 A;  1LPL A;  1ZQ1 A;  3OQ5 A;  3EAZ A;  3DB4 A;  2QEX A;  2OAU A;  3NMZ C;  1O47 A;  1CKB A;  1GCQ C;  2PNI A;  1BI0 A;  2P4R A;  4RG2 A;  2C9W A;  3JCM e;  1R1S A;  2HZY A;  3EG2 A;  3CCE A;  2EKX A;  4C0D C;  2DAQ A;  3M4G A;  5DC9 A;  1SHD A;  4PLL A;  2M02 A;  3N84 A;  1JYQ A;  4JRK A;  4PLI A;  5LJ5 h;  5IBM A;  3LW5 E;  3V8J A;  1AWX A;  1W1F A;  2GFU A;  1O4Q A;  1O4M A;  1YJW A;  2YUO A;  1TUD A;  1IHV A;  1NZL A;  4QVD A;  3GNF B;  2CSI A;  4XU3 A;  2LT4 A;  2QQ9 A;  1KQ1 A;  3CD6 A;  1D4T A;  1W70 A;  3REA B;  1K73 C;  3HHT B;  3VS6 A;  5GMK h;  4PJO A;  1IO6 A;  2DYI A;  4CI0 C;  3QSU A;  2B3O A;  5EC7 A;  1IB8 A;  3CCQ T;  4C5E A;  3JB9 D;  2GBQ A;  3KFJ A;  2RA2 A;  2A08 A;  1MMN A;  3CC7 Q;  1EX4 A;  2HUW A;  2YUQ A;  5HKY A;  2E5Q A;  5GAM h;  1PC0 A;  2HQX A;  1BU1 A;  3G71 T;  1VQN A;  2LP5 A;  1HJD A;  1ZSZ C;  3JCM d;  4O6J A;  2H8H A;  2HAX A;  1XJW B;  1YBY A;  1CKA A;  5FRN A;  4AMC A;  1C1A A;  1O4F A;  1B3Q A;  1UTI A;  2W10 A;  1NJI U;  1RLP C;  3CMA T;  1K4U S;  5KCH A;  2EYX A;  3J81 E;  1QVG P;  1LCK A;  3JB9 I;  3HPW A;  1PIC A;  3M58 A;  1Q86 C;  2CS7 A;  3BUN B;  5HCK A;  3QWX X;  4P9Z A;  1RL2 A;  1MGQ A;  2EYV A;  5IHI A;  4A4K A;  1X6O A;  1JJ2 A;  3S8N A;  1M30 A;  2BKD N;  2O9S A;  2X4W A;  3JCM f;  1UGP B;  3TKZ A;  2IZV A;  2HKQ B;  4ZTJ A;  1O46 A;  2E5K A;  2VIF A;  3L2V A;  3E19 A;  3JB9 F;  1RAB B;  1XQH A;  1YHQ Q;  4JUV A;  3CCV Q;  1KSW A;  1ZUK A;  2LCT A;  2FPE A;  4IKF A;  3X25 B;  1Q82 C;  2JOY A;  4F7U G;  1M2O A;  2RJE A;  4C0D B;  2YUN A;  4LD6 A;  1SHF A;  4L6V 5;  1NPP A;  1BCM A;  3OYD A;  2GF7 A;  3MHX A;  2RMX A;  2HSE B;  3M9Q A;  2C0T A;  7AT1 B;  3BUW B;  1GBQ A;  1R1Q A;  2JM8 A;  4ZN1 A;  2LDM A;  4M7D G;  2DCR A;  4L59 A;  3P8B B;  3T04 A;  2HMA A;  1MNE A;  1AYA A;  3J80 E;  2MAM A;  4HKE A;  2QTX A;  2XK0 A;  2DO3 A;  1Y71 A;  3OYK A;  2YSQ A;  2A7Y A;  2K5F A;  3INZ A;  3M0S A;  4K45 A;  4IUV A;  1PSF A;  5CQX A;  2JW4 A;  1Y96 B;  2COW A;  1SKU B;  4P5N A;  3DLM A;  3E9F A;  3M53 A;  1VQ4 Q;  3H0F A;  2IUG A;  4A4E A;  1OU9 A;  1ZSZ B;  4OML A;  4QQD A;  3VGO A;  3OV1 A;  4IUT A;  1AYC A;  1G3T A;  1ZBJ A;  2DA9 A;  2VXE A;  3E1S A;  3CCS T;  4BI4 A;  3L2U A;  2DD5 A;  2R5A A;  2VKN A;  1VQ6 T;  5KE3 A;  4LUE A;  2FRW A;  1O48 A;  2R58 A;  5CR2 A;  5IXF A;  3EHR A;  4RTX A;  3UDC A;  4D8D A;  4JEG A;  3QJ6 A;  4F5B A;  4ORZ A;  2RN8 A;  2ATC B;  1NYG A;  4GY5 A;  2P0Q A;  2LNW A;  3M0U A;  2RHI A;  1UGQ B;  3ZFJ A;  1IS0 A;  4GPL B;  2IG0 A;  3A8M B;  3SHW A;  1TTH B;  4QQG A;  4J9I A;  4TVR A;  3JCM V;  2ZPB B;  1WQ7 A;  2CZ0 B;  1ZBX A;  2XP1 A;  3QXE B;  1QVG A;  4EIK A;  1M8M A;  1QW1 A;  4M77 A;  1MV0 B;  2RHU A;  3CC7 A;  4F59 A;  1YI2 Q;  1RAI B;  1OO4 A;  3L42 A;  1VQ8 A;  1RJA A;  3I5R A;  4BE2 A;  5L8R E;  1Q81 U;  1OEB A;  1WHG A;  5GAN h;  1N8R U;  5HKW A;  1CSZ A;  2K79 A;  1JXM A;  3C12 A;  3A5Z B;  4OMQ A;  1WGS A;  1N9S A;  4Y92 A;  3PSJ A;  3VUZ A;  1JJ2 S;  2NUP A;  4MMK A;  2CKK A;  3UF4 A;  1WYX A;  4DEY A;  1YP5 A;  4NOY A;  3JCM J;  1RAE B;  1ZLM A;  1T3S A;  2F5K A;  3ZBD A;  3PQZ A;  2FPD A;  2HQE A;  1MMG A;  2XU8 A;  2DEU A;  1B34 A;  2FPF A;  4R55 A;  3CCL Q;  4BI8 B;  1KQS P;  2EWN A;  1GHU A;  3EGX B;  3LYI A;  3BDU A;  1D09 B;  1I8F A;  1OQK A;  3WA4 A;  4YTL A;  4ZNX A;  3HTR A;  2LNH B;  1RAF B;  1D3B B;  1M5Q 1;  3M59 A;  1UGR B;  4XU2 A;  2CYZ B;  1X75 C;  4HCK A;  3WVD B;  2HSP A;  2J6O A;  1YIJ A;  4F5A A;  4IUU A;  5I2M A;  2K7A A;  5J39 A;  3V8L A;  4LDW A;  4F14 A;  5LJ5 d;  3NTI A;  2LVM A;  1HD3 A;  2PUO B;  1FYN A;  4BAC A;  3DKM A;  1VQ5 Q;  1M90 R;  3RDV A;  1O44 A;  4IUQ A;  2CR4 A;  5KE2 A;  4JDS A;  3MP6 A;  2HKN A;  1YVH A;  1YCS B;  2L3Q A;  4JRQ A;  1T0J A;  3HIZ B;  3S8O A;  1YJN Q;  3UWN A;  4OMP A;  4J9G A;  4OB1 B;  1T0H A;  4DBR A;  1RAC B;  4HT8 A;  1ZX6 A;  5GAO r;  5EHP A;  1BF5 A;  3HKS A;  2DL7 A;  4J9C A;  4JLI A;  5DM7 R;  1QVF P;  5GAN 3;  4OF1 A;  2XDB A;  2QI2 A;  3PFV A;  1EFN A;  5LJ5 f;  2YLB A;  1VYU A;  3A98 A;  3JCM X;  5KCO A;  5I21 A;  1U8R A;  3OS5 A;  2RJD A;  1MUZ A;  5D6W A;  3CC4 Q;  2NLU A;  1DJ7 B;  3IQL A;  4C0Z A;  4CC2 A;  1NZV A;  3BUO B;  2K5I A;  1I3Z A;  4M75 A;  2Y1N A;  4ZGJ B;  3CC2 A;  4FW2 A;  4QVZ A;  2RQV A;  1UUR A;  4N0A A;  2BZY A;  2V8I A;  1YIT T;  1KHC A;  2YSX A;  3OYC A;  1MV3 A;  3VRO A;  1HXD A;  1WXT A;  3EH1 A;  3V7C A;  3OYE A;  2D9T A;  2LJ0 A;  2DRM A;  1H8K A;  1PD0 A;  2XMF A;  3LX7 A;  4OVA A;  5LJ3 e;  4P9V A;  3RIR A;  2K3Y A;  2K2V A;  3H8Z A;  1A08 A;  1KD1 R;  2JS2 A;  3EH2 A;  3I55 A;  5D6Y A;  4OHE A;  3TRE A;  3C4S A;  4ME7 A;  3WXM B;  2PU9 B;  2KBT A;  3DLL A;  1WDX A;  3I56 T;  3GPL A;  1O4N A;  3SDZ A;  3QDF A;  3LH0 A;  1YI2 A;  3CCU Q;  1WHL A;  4ZGD B;  2M9U A;  1VQP T;  5KAZ A;  4BY6 C;  1UFF A;  1KQS A;  1BI2 A;  1OI1 A;  1VQL T;  2B8A A;  2JMA A;  2KK4 A;  4AT1 B;  1WJR A;  1VQ7 A;  1VYT A;  2O01 E;  4JLG A;  1N6A A;  3QBY A;  3HSB A;  1LCJ A;  2K3X A;  2QEX Q;  5L23 A;  2QQA A;  2DLY A;  3VV0 A;  3CCE Q;  3KBG A;  4XQ3 A;  4M4Z A;  2HBW A;  2EYY A;  2YRD A;  1H9O A;  5GJW B;  3EG9 B;  3FJP A;  3R6N A;  5EG2 A;  4XTU A;  4JRI A;  2HD0 A;  4RUG A;  3IN8 A;  4J7I A;  2OZO A;  1YJW Q;  1VIF A;  3OBY A;  2RM4 A;  3OSV A;  4M7A F;  4M7A B;  1RUW A;  2FO0 A;  3HL8 A;  2K2M A;  1IRX A;  9ATC B;  2VVK A;  3CD6 Q;  2K4Y A;  2F5T X;  1FU6 A;  2PVG B;  4M75 C;  4C8Q D;  2XHC A;  4A53 A;  3BFM A;  3G6E T;  2E6N A;  4BB7 A;  1FX7 A;  1QWE A;  3CWG A;  2PQW A;  1KIK A;  4RG8 A;  1GFD A;  4JS4 A;  1D1A A;  2RI3 A;  1QVF A;  3K2T A;  2CGH A;  3LWI A;  3X20 B;  2AZV A;  2L5Q A;  4M75 E;  5CKF A;  2L89 A;  4MZM A;  3CME T;  1QKX A;  4BD3 A;  2J6F A;  5CIU A;  4KUL A;  2HMH A;  3VU3 C;  1S72 A;  3K2M A;  4J8O A;  2V8K A;  1M1G A;  3MAZ A;  1NZ9 A;  4V2S A;  3HP9 A;  2DL8 A;  4AG1 C;  2XG8 D;  3V7S A;  4RTV A;  2YU7 A;  3R6O A;  2KGY A;  2FYK A;  2OTJ T;  1AT1 B;  3GXX A;  4E68 A;  2E3I A;  2D6F A;  5BO4 A;  1BFJ A;  1O42 A;  3UPU A;  1M90 C;  3BY7 A;  3TSZ A;  4D6W A;  4B6M A;  5LJ3 j;  4EMH A;  1C0M A;  4AFS C;  3M7F A;  1IGQ A;  2MMP A;  2NUZ A;  4M75 D;  3I5S A;  2KRS A;  1WQU A;  3VJP A;  2PNA A;  3CPW P;  3MEW A;  2ZPE B;  2LCC A;  1TUC A;  5IBS A;  5KYU B;  4C8Q F;  4C8Q B;  1VIE A;  4WF2 A;  2M0O A;  5GAN d;  3CQT A;  3OYY A;  1H64 1;  2JS0 A;  5CO7 A;  3CCM T;  2LRA A;  3L1A A;  2JTF A;  4FW1 A;  4LDY A;  1O4O A;  2G3R A;  1TG0 A;  3G4S T;  4F17 A;  3MET A;  2VYT A;  1O75 A;  2AUG A;  1AZG B;  1XOV A;  1Y96 A;  3TQ7 P;  4M78 G;  5GAN 8;  1KQS S;  1JBM A;  3VRR A;  2DVJ A;  2RQR A;  5FU7 B;  3TVT A;  1ZSZ A;  3QPH A;  5GAN f;  4DBQ A;  3X26 B;  1V76 A;  3QUI A;  1R0C B;  4C5H A;  5GAO n;  1A07 A;  6AT1 B;  3CCQ A;  1SPS A;  5KYY B;  1KD1 C;  3OY9 A;  3FDR A;  5GAN 5;  1A1B A;  2D1X A;  4XTV A;  4HA8 A;  4F04 B;  2GQV A;  5D7U A;  5DLQ E;  4C92 C;  5HK3 A;  1ZA2 B;  2DNU A;  2F2V A;  3G71 A;  1BKM A;  2LQ8 A;  4K2R A;  1U3O A;  3EGD B;  1O4L A;  2CH4 A;  1OO3 A;  3F70 A;  1SRL A;  2DXU A;  4RTT A;  2EU0 A;  4MDW A;  2QXF A;  2W0Z A;  2CRH A;  2X9H A;  1X0N A;  2DZC A;  5DC4 A;  1YN8 A;  4C92 E;  4EY0 A;  5GAN 4;  3HFO A;  1GL5 A;  3CMA A;  2H3J A;  2HBP A;  4XK8 E;  3IMJ A;  5EEQ A;  2Y1M A;  2ZPG B;  2BTT A;  4J9D A;  1VQM T;  5DY9 A;  2HDV A;  4A54 A;  1UE9 A;  3S9K A;  2G6F X;  1YCY A;  2DPP B;  3S8L A;  1QVF S;  3MP8 A;  2DFU A;  1UG1 A;  2DM1 A;  2O2O A;  1QG1 E;  2HDA A;  3L2Z A;  1K8A U;  4HCB A;  1XNI A;  3JCM c;  2JMC A;  4C92 D;  1JU5 C;  1EIF A;  1SPK A;  2CUB A;  4E7Z A;  4FL6 A;  3GBQ A;  3CPW A;  4XTY A;  4A4H A;  1AYB A;  2WSC E;  1VQ8 Q;  3EGX A;  3NFC A;  1G5V A;  4E7J A;  2KRO A;  3PE0 A;  4FT2 A;  2QK0 A;  1CWE A;  4FBN A;  2PVD B;  3A8G B;  2ZAE A;  2EQU A;  2K57 A;  2SHP A;  2CH4 W;  4E7I A;  3HCK A;  4HCZ A;  1Y7X A;  2OTL T;  4NWG A;  2OX7 A;  2O4X B;  4IUP A;  1D3B A;  3EG0 A;  1BB9 A;  1E6H A;  3TCJ A;  1FMW A;  2E12 A;  1X6C A;  2RJF A;  2X35 A;  2DF6 A;  4WTO B;  3OYI A;  2K3B A;  1O4J A;  1WXB A;  3PFS A;  1M1K R;  1SHA A;  2GQI A;  2J06 A;  4OHH A;  3OYG A;  1ZA1 B;  3URG A;  2ED0 A;  2RPN A;  2Z0W A;  4JE4 A;  1OUL A;  3IMD A;  3N7Y A;  4XU0 A;  1FWZ A;  4JJB A;  1E6G A;  2A0F B;  4C92 F;  1SEM A;  2DK3 A;  1Q95 G;  4C92 B;  2KVQ G;  2RK2 A;  3OYB A;  1RPY A;  4X6S A;  5FRO A;  4M78 B;  3MEV A;  4PJO G;  1EZZ B;  1LVK A;  3C94 A;  3JCM b;  2MIO A;  1UHC A;  4AG2 C;  5EG3 B;  1YWO A;  2FG0 A;  3SWN B;  1UB4 A;  1VQ6 A;  3US4 A;  2QDY B;  5CKH A;  1BK2 A;  5AYF A;  2ZPI B;  1YIJ Q;  4E7H A;  4C5G A;  2QA4 T;  1LUN A;  2EQI A;  2CP5 A;  4XTZ A;  3RUX A;  4J6Y A;  1SF9 A;  3QHS A;  2KXD A;  3FJ5 A;  4JRP A;  1WHM A;  2NWM A;  2VXF A;  1AOT F;  4A4G A;  1HSQ A;  4LD9 K;  1VQN T;  2FB7 A;  5A0L A;  4PFP A;  2L6K A;  2MC1 A;  3GP8 A;  2FZG B;  3OYN A;  1WHH A;  2SEM A;  1O4D A;  1RI0 A;  2NUT B;  1VQO T;  3H9N A;  2DIQ A;  3RMS A;  2I2L A;  2KNB B;  1M2V B;  2JT4 A;  2XDP A;  1QCN A;  1VOM A;  4AFQ C;  4F7U E;  4CC7 A;  3M0R A;  4FT4 A;  1QCO A;  1X6G A;  1TZE E;  3HRU A;  1JWO A;  1IHW A;  3WVE B;  4MDX A;  2DTH A;  5FW9 A;  3RER A;  4CC3 A;  1VQK T;  2EOB A;  3PT9 A;  1XA6 A;  1Y07 A;  3CCR T;  5EEL A;  4TZI A;  1IRE B;  5KYX B;  3CC2 Q;  5CCA A;  3VS3 A;  4PFZ A;  4DGP A;  5GJH A;  4F16 A;  1NE8 A;  1E7O A;  1WPY A;  1ZSG A;  3VRQ A;  2LCL A;  3ASK A;  4BUG A;  3CPW S;  1NJI R;  2HCK A;  3UT1 A;  2CZ6 B;  1N27 A;  3M54 A;  3CCJ T;  3RNJ A;  3REB B;  3I55 Q;  3EG9 A;  1O4H A;  1KC8 U;  1A09 A;  3M55 A;  2IPO B;  3EAC A;  3OS0 A;  1HK9 A;  3PVQ A;  3KXT A;  1VQ9 T;  2J6K A;  3CXL A;  1O9S A;  5GAN 6;  1CSK A;  3LH5 A;  2ED1 A;  4ZN3 A;  4OHL A;  4M7A A;  2BE7 D;  4RTU A;  2CZ7 B;  3KUF A;  1UJY A;  1VQ7 Q;  3A8L B;  2YWW A;  4IIM A;  2RHZ A;  2KGT A;  5LJ5 e;  5CKE A;  5KYN A;  1HCS B;  2CP0 A;  3NHN A;  1KK7 A;  2O88 A;  2JNG A;  3QII A;  3JV3 A;  2DD4 A;  2C06 A;  2LQW A;  3VS7 A;  3N5B B;  5GMK e;  3VUB A;  4II1 A;  3QO3 A;  3EFO B;  1YJ9 Q;  3S6W A;  3TSW A;  5D6X A;  2EFI A;  2LX7 A;  2F1L A;  1O45 A; 
#chains in the Genus database with same CATH homology
 1X69 A;  1BHH A;  5L23 A;  3M0Q A;  4X1V A;  4OMO A;  1A81 A;  1AYD A;  2KE9 A;  2CSQ A;  4LE9 A;  2HDX A;  2DLY A;  1K0S A;  1N5Z A;  1G83 A;  4M4Z A;  2HBW A;  2EYY A;  2D8J A;  2QDL A;  1BHF A;  2PZ1 A;  1H9O A;  5GJW B;  3PJP A;  1CWD L;  5HKZ A;  3R6N A;  2PLE A;  1GRI A;  1GBR A;  2RVF A;  1BG1 A;  2CUD A;  2DBM A;  2OJ2 A;  2CT3 A;  1OOT A;  2AZS A;  1O41 A;  4RUG A;  3IN8 A;  2YDL A;  4WWQ A;  4HXJ A;  1LUI A;  3BUM B;  2OZO A;  1AOU F;  3EAZ A;  5AXI A;  2DRK A;  3NMZ C;  1O47 A;  1CKB A;  1GCQ C;  2PNI A;  2L0A A;  1M61 A;  2P4R A;  1RUW A;  2FO0 A;  1O49 A;  2C9W A;  2K2M A;  1R1S A;  2J05 A;  5I6V A;  3EG2 A;  2EKX A;  2VVK A;  3I9Q A;  1FU6 A;  1X27 A;  5DC9 A;  1SHD A;  4EIH A;  3N84 A;  1PRM C;  4Z89 A;  2GE9 A;  4QT7 A;  2MQI A;  3VS4 A;  1JYQ A;  5J3X A;  5IBM A;  1QCF A;  1QWE A;  5DC0 B;  1AWX A;  3PVL A;  4Z8A A;  5D0J A;  1W1F A;  3CWG A;  4JPB W;  1KIK A;  1O4Q A;  1O4E A;  2FRY A;  1O4M A;  1GFD A;  4QSY A;  2YUO A;  1TUD A;  1NZL A;  2AZV A;  1K76 A;  2LMJ A;  4HVV A;  1QKX A;  1WFW A;  2ECZ A;  2CSI A;  3M0P A;  2J6F A;  1KA7 A;  3VRP A;  2D0N A;  1X2Q A;  3N8M A;  2D8H A;  2HMH A;  3K2M A;  3BUX B;  1D4T A;  1W70 A;  3I35 A;  3REA B;  1SRM A;  3VS5 A;  3MAZ A;  3VS6 A;  2EGE A;  1BLJ A;  2DE0 X;  1SHB A;  1IO6 A;  2DL8 A;  2A28 A;  2X3W D;  1O4G A;  1BHH B;  4AG1 C;  2B3O A;  5EC7 A;  4RTV A;  2K6D A;  2YU7 A;  1NLO C;  1A1C A;  4A63 B;  2F2W A;  1AWW A;  2H46 E;  2GBQ A;  3GXX A;  3KFJ A;  3ZNI A;  4E68 A;  4JZ3 A;  2A08 A;  5BO4 A;  1BFJ A;  1O42 A;  2HUW A;  2YUQ A;  5HKY A;  3TSZ A;  2LJ3 A;  4AFS C;  3VS1 A;  3M7F A;  5I22 A;  1BU1 A;  1ZFP E;  1UUE A;  1Z9Q A;  2NUZ A;  1UGV A;  2EL8 A;  2LP5 A;  3I5S A;  2KRS A;  4XZ1 A;  1HJD A;  1SHG A;  3VRY A;  1AWO A;  1WQU A;  2PNA A;  4GL9 E;  2GTO A;  2H8H A;  1TCE A;  1FHS A;  4FL3 A;  1CKA A;  1TUC A;  1FU5 A;  5IBS A;  5IHK A;  2LJ1 A;  1O4F A;  2EYW A;  1LKK A;  1B3Q A;  1QKW A;  4JJD A;  1UTI A;  1PHT A;  2W10 A;  3C0C A;  1RLP C;  3CQT A;  1F2F A;  2KYM A;  4OMM A;  1OV3 A;  2JS0 A;  4WCI A;  1K4U S;  1O4P A;  2EYX A;  1JXO A;  1ZUU A;  3KFV A;  1ZUY A;  4FL2 A;  4U1P A;  1LCK A;  3EGU A;  2QMS A;  1BLK A;  1PIC A;  2BBU A;  1W6X A;  1GFC A;  3EG3 A;  2V1Q A;  1AWJ A;  2DLP A;  1O4O A;  3BUN B;  4GLM A;  1AZE A;  1TG0 A;  2AKL A;  3QWY A;  1RQQ C;  2ABL A;  5HCK A;  1FMK A;  3H41 A;  3QWX X;  4F17 A;  1O43 A;  4P9Z A;  2EYV A;  2ENM A;  5IHI A;  1IJR A;  4E93 A;  2KR3 A;  1M3B A;  4LNP A;  3S8N A;  1M30 A;  2AUG A;  2O9S A;  1AZG B;  1XOV A;  2DX0 A;  2FCI A;  3TKZ A;  4HVU A;  2KYB A;  1D1Z A;  2ROR A;  5GJV B;  1YVL A;  2IZV A;  2EVR A;  3VRR A;  3EHQ A;  1FBZ A;  2DVJ A;  1JYU A;  2E5K A;  1UEC A;  2RQR A;  1MIL A;  1O46 A;  3TVT A;  2VIF A;  1NEG A;  2EO3 A;  2FEI A;  2GTJ A;  5EHR A;  1O4C A;  1LKL A;  1FBV A;  1KSW A;  1ZUK A;  2LCT A;  2FPE A;  1A07 A;  2I0N A;  2LCS A;  4Z88 A;  1SPS A;  2YUN A;  1SHF A;  4DEX A;  1ARK A;  4LN2 A;  1BMB A;  1A1B A;  2RMX A;  2D1X A;  1G2B A;  2C0T A;  3OP0 A;  3BUW B;  1GBQ A;  1R1Q A;  2JM8 A;  3THK A;  1KFZ A;  2DNU A;  2F2V A;  1BKM A;  1M27 C;  2DCR A;  4K2R A;  1U3O A;  1AOJ A;  1O4L A;  2CH4 A;  1OO3 A;  1SRL A;  4RTT A;  2EU0 A;  4LUD A;  3T04 A;  2W0Z A;  2CRH A;  1WIE A;  1X0N A;  2EO6 A;  2JYQ A;  3IN7 A;  5DC4 A;  1B07 A;  1YN8 A;  4EY0 A;  2DMO A;  2DL3 A;  2X3X D;  1AYA A;  1GL5 A;  1JEG A;  2CI8 A;  3UAT A;  3PSK A;  3IMJ A;  2KRM A;  2CS0 A;  1H3H A;  2Y1M A;  3EG1 A;  2B86 A;  1J3T A;  2MK2 A;  2BTT A;  5EEQ A;  4ESR A;  2YSQ A;  4J9D A;  2HDV A;  1P13 A;  3M0S A;  1UE9 A;  2O31 A;  4K45 A;  3S9K A;  2G6F X;  2AOB A;  2H5K A;  3S8L A;  1AD5 A;  1PRL C;  2JW4 A;  2HEQ A;  1LUK A;  1WI7 A;  2GGR A;  2KRN A;  4FSS A;  1NYF A;  1GCP A;  4K11 A;  2DBK A;  3H0F A;  1UG1 A;  2IUG A;  1PKS A;  2DM1 A;  2O2O A;  2KK6 A;  4OML A;  1YNZ A;  4JGH A;  3VGO A;  1QG1 E;  3OV1 A;  2HDA A;  3VRZ A;  2DM0 A;  2DJQ A;  1M27 A;  1AYC A;  4E6R A;  1ZBJ A;  2DA9 A;  5I11 A;  4K44 A;  3UA6 A;  5IXB A;  2PNB A;  2JMC A;  2RNA A;  2BZ8 A;  1PKT A;  1JU5 C;  1SPK A;  1UUS A;  2MRK A;  2CUB A;  2VKN A;  2AOA A;  4HVW A;  4LUE A;  3BKB A;  2EGA A;  4H34 A;  2L2P A;  2FRW A;  1O48 A;  2KXC A;  3GBQ A;  1O4B A;  5IXF A;  3EHR A;  4RTX A;  4D8D A;  4JEG A;  1QAD A;  4F5B A;  3GQI B;  1VA7 A;  1AEY A;  4ORZ A;  2RN8 A;  2DIL A;  1AYB A;  3RBB B;  1BBZ A;  1NYG A;  1X6B A;  5FWB A;  1T3L A;  2KRO A;  1SKJ A;  3M0U A;  3PE0 A;  2ECD A;  1MW4 A;  2EYZ A;  2LNW A;  1IS0 A;  4GPL B;  1CWE A;  4OMN A;  3VS0 A;  2ETZ A;  4FBN A;  3SHW A;  1RLQ C;  4J9I A;  3TL0 A;  1K9A A;  2RSY A;  2SHP A;  2CH4 W;  2O9V A;  3HCK A;  2XP1 A;  1Y57 A;  4EIK A;  1M8M A;  1PWT A;  4CC4 B;  5ECA A;  4NWG A;  4A4C A;  1MV0 B;  2DL5 A;  4IIO A;  1H92 A;  2RMO A;  2RQW A;  2EBP A;  3EG0 A;  1BB9 A;  1E6H A;  1WA7 A;  2LQN A;  1CSY A;  2DX1 A;  4RTZ A;  3H0H A;  1X6C A;  4F59 A;  1OO4 A;  1WLP B;  1F1W A;  2DF6 A;  3I5R A;  1RJA A;  1Z9Z A;  2F2X A;  1OEB A;  2K3B A;  1WXU A;  1O4J A;  1WXB A;  1JU5 A;  2C0O A;  5HKW A;  2IIM A;  3ULR B;  1SHA A;  1CSZ A;  2K79 A;  2GQI A;  2J06 A;  4OHH A;  1JXM A;  1NRV A;  1KA6 A;  1M3C A;  4OMQ A;  2ED0 A;  2PTK A;  2RPN A;  4Y92 A;  2A36 A;  2RQT A;  3PSJ A;  2J7I A;  4JE4 A;  1AVZ C;  3IMD A;  3N7Y A;  3UF4 A;  2JXB A;  4JJB A;  1WYX A;  1E6G A;  1SEM A;  1YP5 A;  4DEY A;  1V1C A;  1JYR A;  2AK5 A;  4X6S A;  1RPY A;  1LUM A;  4J9F A;  1ZLM A;  1T3S A;  2KEA A;  4GWF A;  3C7I A;  2GSB A;  2MIO A;  3PS5 A;  3PQZ A;  1UHC A;  4AG2 C;  2FPD A;  5EG3 B;  1YWO A;  2L3P A;  5DF6 A;  2FG0 A;  2DYB A;  3O5Z A;  2L3S A;  2FPF A;  1O4K A;  1NLP C;  3US4 A;  1BK2 A;  1GHU A;  1RI9 A;  3H0I A;  1I0C A;  1O4I A;  2YT6 A;  4RTY A;  4XZ0 A;  1I1J A;  2GNC A;  2KT1 A;  4A4B A;  1LUN A;  2EQI A;  1A1A A;  1KC2 A;  2L3T A;  2M51 A;  2KXD A;  3FJ5 A;  4GBQ A;  2NWM A;  5FWC A;  1AOT F;  2SRC A;  3WA4 A;  2BZX A;  1HSQ A;  2JM9 A;  1K1Z A;  1O4R A;  2L6K A;  2OQ1 A;  4ZNX A;  3NPF A;  2MC1 A;  2LNH B;  2RQU A;  4R0K A;  1K0X A;  1ABQ A;  1R1P A;  2EGC A;  1VYV A;  4HCK A;  2SEM A;  4AFZ C;  2HSP A;  2J6O A;  1NG2 A;  4J9B A;  4F5A A;  3U23 A;  2K7A A;  1HCT B;  1O4D A;  4U17 A;  1S1N A;  3HHM B;  4F14 A;  2ROL A;  1HD3 A;  4DGX A;  1PNJ A;  1QWF A;  1WX6 A;  2KNB B;  3VS2 A;  1FYN A;  2K79 B;  3UYO A;  3MXC A;  2KT8 A;  2CIA A;  1KJW A;  2JT4 A;  1O44 A;  2EKH A;  2CR4 A;  4AFQ C;  4CC7 A;  1M3A A;  3M0R A;  2AKK A;  4OHI A;  1X6G A;  3M0T A;  1TZE E;  1YVH A;  1O4A A;  1YCS B;  2L3Q A;  3ZL7 C;  1JWO A;  1T0J A;  2EW3 A;  2MOX A;  3PLF B;  4ROJ A;  1BKL A;  1Y0M A;  2LNX A;  3HIZ B;  5CDW A;  4H1O A;  4JZ4 A;  2OI3 A;  3S8O A;  4RTW A;  5FW9 A;  5GJI A;  2DLZ A;  4OMP A;  4J9G A;  4CC3 A;  1FYR A;  1Z3K A;  1NM7 A;  2EOB A;  1XA6 A;  1T0H A;  5EEL A;  4TZI A;  1ZX6 A;  1D4W A;  5EHP A;  4OHD A;  1BF5 A;  2DL7 A;  4J9C A;  3NGP A;  2RF0 A;  2A37 A;  1U5S A;  3VS3 A;  2CRE A;  3PFV A;  5GJH A;  4F16 A;  4DGP A;  1EFN A;  1AB2 A;  2IUI A;  1E7O A;  1VYU A;  1ZSG A;  2OAW A;  4AFU C;  3VRQ A;  1OPK A;  4J9H A;  3A98 A;  1JO8 A;  4JJC A;  2CBL A;  1BFI A;  1GCQ A;  2HCK A;  3CBL A;  1BM2 A;  4D8K A;  1MUZ A;  3RNJ A;  3REB B;  1UJ0 A;  3OB2 B;  3IQL A;  4KRT A;  2MRJ A;  1ABO A;  1NEB A;  4CC2 A;  1NZV A;  1O4H A;  3BUO B;  5IHN A;  5IH2 A;  1SPR A;  2VWF A;  2KNO A;  1I3Z A;  2Y1N A;  1A09 A;  2EPD A;  3EAC A;  1B47 A;  2RQV A;  1UUR A;  3PVQ A;  3MXY A;  1YWP A;  2BZY A;  5AUL A;  3SEM A;  2DL4 A;  2YSX A;  2J6K A;  1MV3 A;  1UHF A;  2ROT A;  1WXT A;  3VRO A;  3CXL A;  3UA7 A;  1CSK A;  2LZ6 B;  3OVE A;  2LJ0 A;  1U06 A;  2ED1 A;  1X2K A;  3LH5 A;  4OHL A;  2ESW A;  2DRM A;  2K7A B;  1X43 A;  4RTU A;  1H8K A;  4NWF A;  2XMF A;  4P9V A;  2CI9 A;  1SSH A;  2MCN A;  1UJY A;  1A08 A;  1I07 A;  4IIM A;  2JS2 A;  2KGT A;  2L4K A;  2PLD A;  2Y3A B;  2M0Y A;  4OHE A;  1HCS B;  3CD3 A;  3OB1 B;  3NHN A;  2KBT A;  1WDX A;  1Y1U A;  2O88 A;  1O4N A;  1OPL A;  3GXW A;  2JTE A;  2CT4 A;  1CJ1 A;  1JQQ A;  1A0N B;  1QLY A;  5KAZ A;  3JV3 A;  2V1R A;  2LQW A;  1UFF A;  3VRN A;  2YUP A;  3VS7 A;  1UDL A;  1A1E A;  4L1B B;  2JMA A;  1VYT A;  4J9E A;  3TSW A;  2LX7 A;  1LCJ A;  1O45 A;  2K9G A;  2C0I A;  2IUH A;  2CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...