1GRIA

Grb2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
211
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mammalian Grb2 adaptor.
pubmed rcsb
source organism Homo sapiens
molecule tags Signal transduction adaptor
molecule keywords GROWTH FACTOR BOUND PROTEIN 2
total genus 34
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA03
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1griA02
1AWOA 4WCIA 4M4ZA 4J9HA 1F2FA 1AYBA 1PRLC 1WI7A 1AOUF 5HKZA 5FW9A 1W6XA 1K1ZA 4JGHA 2XP1A 3GBQA 1O4MA 2CI8A 3REBB 1GBRA 3CBLA 4CC7A 1A1CA 2XMFA 3M0SA 5AULA 2LX7A 4GL9E 3VRNA 3EGUA 2RQWA 2MCNA 1B07A 1NLPC 5CDWA 4OHHA 1FYRA 2CR4A 1LUKA 1WDXA 3EG3A 1BK2A 2FG0A 4J9IA 1O4BA 1AWXA 1KJWA 1O4NA 1R1SA 1U5SA 1F1WA 3IN7A 4X6SA 3US4A 1W70A 5FWCA 2YSQA 4F14A 1RI9A 1WA7A 2D8HA 1WLPB 4RTZA 1AWJA 3ZNIA 2AKLA 2DCRA 1O4KA 4RUGA 1WFWA 4FL2A 1GBQA 2L0AA 2NUZA 1SPSA 5I6VA 5BO4A 2KRNA 1PRMC 2ROLA 1HJDA 4OMNA 1CWEA 1O47A 1BMBA 2RVFA 1CJ1A 1V1CA 2OZOA 2DLPA 2DL3A 2SHPA 2CIAA 3CQTA 2E5KA 1BB9A 1ZUKA 1IJRA 3M0PA 1SHAA 2CSQA 3PE0A 4JZ3A 2EOBA 2BZYA 2L6KA 2MQIA 2DNUA 5EHRA 4ZNXA 2PNIA 4L1BB 3SHWA 4OMPA 1RJAA 1UG1A 3I5SA 1UGVA 4X1VA 2DL8A 3NMZC 1UUSA 2C0TA 4NWFA 3N84A 1RQQC 2ESWA 2JS2A 1AZGB 2EKHA 2Y1NA 5GJHA 2KE9A 1O4CA 5DF6A 4OMMA 4NWGA 2ECDA 2OQ1A 1H92A 1BG1A 3S8LA 2V1RA 1BF5A 4CC4B 2FPEA 3N8MA 3H0IA 2BZ8A 5I11A 5ECAA 1GHUA 1BU1A 1M27C 1VYVA 2YUNA 3EHQA 4WWQA 1CKBA 2IZVA 2L3TA 1SEMA 1GFDA 1AOTF 2F2WA 2CUBA 2BTTA 1O4LA 1G83A 4J9CA 4OHEA 1UTIA 3VS5A 4Z8AA 4HVUA 1O49A 2HEQA 1I3ZA 1FYNA 2ABLA 2G6FX 3MAZA 1T3SA 4E93A 3R6NA 3MXCA 1YVLA 1UHCA 3EG0A 4JJBA 2GE9A 1O4QA 1W1FA 1PKSA 3GXXA 1UECA 1LKLA 2PZ1A 2EGCA 3VS0A 4Y92A 1A08A 1JU5C 2AK5A 2CDTA 2JMCA 1BHHB 1FHSA 1K0SA 1MV0B 2KNOA 4LUEA 3BUWB 2DLZA 3N7YA 1ZUYA 2IIMA 2A28A 2FCIA 4AFZC 2AZSA 2DE0X 3C7IA 3M0UA 1ABOA 2CT4A 1M27A 1VA7A 1XOVA 1CKAA 2O9VA 4D8KA 3BUNB 2K6DA 1HCTB 3OB1B 3FJ5A 4JE4A 1NZLA 5L23A 5IBMA 1WQUA 2K79A 1CSKA 2KK6A 1N5ZA 1ZSGA 1WIEA 2EW3A 2ENMA 2QMSA 1O4EA 2PTKA 1Y0MA 1J3TA 1AYDA 4RTWA 2LMJA 2BZXA 2KYBA 1JQQA 1K9AA 2KT8A 1MV3A 1MILA 1BLKA 3VS4A 1RLQC 1IO6A 5AXIA 1O44A 3VS7A 1HCSB 4J9GA 2EL8A 1AEYA 4H34A 1E6HA 1H8KA 1LKKA 2KXDA 4ESRA 3OB2B 1JO8A 2KR3A 1JWOA 3SEMA 1HSQA 1H9OA 3EG2A 2PNBA 1M30A 3KFVA 2YUOA 3OV1A 5HKWA 1NLOC 4QSYA 2FRWA 1UE9A 2DVJA 1R1QA 3QWYA 1Z3KA 3TKZA 1MW4A 3UYOA 2MIOA 2OAWA 1O4FA 3CD3A 1M3CA 2CUDA 4KRTA 4R0KA 1SRLA 2DL4A 1SHGA 1OO4A 2VWFA 2NWMA 2PLEA 2L3PA 4XZ0A 1BM2A 2RN8A 3T04A 4OHIA 1QLYA 2DA9A 2L2PA 1AYAA 1GL5A 1O4AA 2RORA 3UF4A 1O4OA 1FBZA 1ARKA 4F59A 1A81A 4TZIA 2IUHA 3REAB 1B47A 1K76A 2IUGA 1AD5A 1ZUUA 3LH5A 2CH4A 2ROTA 3IN8A 5EEQA 2K79B 1PHTA 1I1JA 5IHNA 2MK2A 1M8MA 1SPRA 1I07A 1FU5A 1A1AA 2HMHA 1UJ0A 1NYFA 3BUMB 2J7IA 2JW4A 2KROA 3PVQA 2CI9A 1LUIA 3M0QA 4RTVA 1O4GA 1YN8A 2DMOA 3UA7A 3CXLA 2VIFA 1JEGA 5HKYA 2DBKA 1UHFA 2KXCA 2B86A 2B3OA 2YUQA 3TL0A 2DLYA 2BBUA 3TSZA 2RF0A 2YDLA 4DGPA 2LNWA 3I5RA 3EHRA 2V1QA 1YWPA 2D1XA 1QWEA 3S8OA 2JXBA 1GCQA 3MXYA 2LJ0A 1YVHA 4LNPA 1TZEE 1QCFA 1UJYA 2DF6A 1NG2A 2AZVA 2EBPA 1XA6A 4DEXA 3UA6A 3CWGA 1Y57A 1YWOA 1T0JA 2A08A 3IMJA 3PSJA 2QDLA 1WXBA 1RLPC 2EYZA 4P9ZA 1PKTA 1OPKA 4JPBW 1B3QA 4HCKA 1VYUA 2M0YA 2OI3A 2CREA 3BKBA 1SKJA 2P4RA 2JYQA 1UURA 4OHDA 2HBWA 2RMOA 1X6BA 2DYBA 1IS0A 4OMLA 1NZVA 2YT6A 3TVTA 5D0JA 4J9FA 2JT4A 3S9KA 1TG0A 2C0OA 2EYVA 5IH2A 1NRVA 2YU7A 2Y3AB 5IHKA 1BHFA 2O2OA 2RSYA 2LCTA 2RPNA 1FBVA 4E68A 2EU0A 2MC1A 2AUGA 4U17A 1NEBA 2ED1A 3VROA 4ORZA 1WYXA 1Z9QA 3VS2A 5GJVB 2HUWA 5IXBA 1ZLMA 2C9WA 3H41A 2DX0A 2RMXA 3S8NA 1ZX6A 2A37A 3O5ZA 1BFJA 1E6GA 2LJ1A 2YUPA 3GXWA 3NHNA 1X6GA 3TSWA 1M61A 1O4JA 5DC0B 1O41A 5GJIA 1A1BA 2SRCA 4XZ1A 1OEBA 5IHIA 1AZEA 1S1NA 1AYCA 2K3BA 3WA4A 2RQTA 2DL5A 2K7AA 3QWXX 1HD3A 2W0ZA 4Z89A 1ABQA 2EYYA 3EG1A 3VRYA 1LUNA 3PJPA 2X3WD 1CSYA 2SEMA 4A4CA 1OO3A 1GFCA 1QKWA 2O31A 3I35A 2AOBA 3HHMB 1GRIA 2DRMA 4AFUC 4LN2A 4OMQA 2DM0A 3RNJA 2HDVA 4DGXA 4F5AA 2J6FA 2HDXA 4FBNA 1TUDA 3GQIB 2DRKA 1AWWA 4A4BA 1NEGA 1A07A 5KAZA 1Y1UA 1WXUA 1AVZC 1O48A 1JYRA 1O4RA 1LCJA 1SRMA 3THKA 1MUZA 1BKMA 5IBSA 2EPDA 1R1PA 4A63B 1QKXA 4CC2A 2DILA 2KNBB 1D1ZA 1VYTA 3OP0A 5FWBA 5EHPA 4GPLB 1O45A 2JMAA 1OPLA 2I0NA 2EVRA 1PNJA 2F2XA 3IMDA 4K44A 4JJDA 3BUOB 2OJ2A 4IIOA 1QWFA 2RQUA 1QG1E 3RBBB 2K7AB 1SHDA 5HCKA 2CH4W 2AOAA 1PWTA 3PVLA 1JYUA 2IUIA 4JEGA 2W10A 2J6KA 1ZBJA 2K2MA 3M0TA 2CSIA 2PLDA 2RQRA 2KEAA 2D0NA 2FRYA 4JZ4A 4HXJA 1D4WA 4K2RA 2O88A 1T0HA 1U3OA 2GBQA 3VRZA 4EY0A 2VVKA 4QT7A 1OV3A 1X43A 1G2BA 1X6CA 3PLFB 5J3XA 1KSWA 2EQIA 2EYXA 1X27A 4HVVA 2HDAA 4LUDA 4AFSC 1JXMA 4AFQC 1NM7A 1A1EA 3VRPA 2L3QA 3H0FA 2JS0A 3NGPA 2K9GA 1TUCA 4OMOA 1P13A 1WXTA 5DC9A 1UFFA 4RTUA 2FPDA 1BKLA 1LCKA 1RPYA 2EYWA 4H1OA 2RNAA 4LE9A 2FO0A 1AB2A 2LNXA 3UATA 4HVWA 4F17A 3H0HA 1SHBA 3OVEA 3EAZA 1OOTA 3IQLA 1QADA 3ZL7C 3PSKA 4FL3A 4GWFA 5I22A 2AKKA 2JM8A 4DEYA 3VGOA 2GTOA 1M3AA 2EGAA 5GJWB 2KRMA 2J05A 4K11A 4EIHA 1NYGA 3M7FA 4FSSA 3K2MA 3BUXB 2ECZA 1YNZA 1BLJA 1I0CA 4EIKA 2JTEA 2LQWA 1ZFPE 1AOJA 4RTTA 1EFNA 3HIZB 1TCEA 4F5BA 2KYMA 5IXFA 4D8DA 2EO6A 1O4PA 5EG3B 2D8JA 2CBLA 2ED0A 1WX6A 3NPFA 3PQZA 2HCKA 2FEIA 1KA7A 2LJ3A 4E6RA 3VRQA 4GLMA 2C0IA 2MOXA 4JJCA 2M51A 2H46E 3VS3A 3PS5A 1K0XA 2FPFA 1O4HA 2KBTA 2LCSA 3EACA 1X2QA 2KT1A 2O9SA 4F16A 2MRKA 1A0NB 1SHFA 2CRHA 2DX1A 2Y1MA 4U1PA 2L3SA 4RTXA 3U23A 1E7OA 4AG1C 1PICA 1FU6A 2H5KA 2EO3A 4J9DA 4ROJA 2JM9A 2MRJA 2EGEA 1CSZA 1RUWA 3VRRA 1M3BA 2DM1A 1H3HA 4OHLA 1O4DA 4J9BA 5DC4A 1YP5A 1X2KA 5EC7A 1O43A 1KFZA 3A98A 2L4KA 1U06A 1GCQC 1BBZA 2GSBA 4Z88A 3ULRB 1BFIA 1YCSB 1O46A 4J9EA 2EKXA 3PFVA 1FMKA 2YSXA 2J06A 4IIMA 4GBQA 1JXOA 3VS1A 3JV3A 3HCKA 2GTJA 2LQNA 2PNAA 1CWDL 2H8HA 2VKNA 2LNHB 4CC3A 1D4TA 2A36A 1Z9ZA 1T3LA 3KFJA 1O42A 2LP5A 2GNCA 1KA6A 1SPKA 4K45A 2DJQA 2GGRA 3VS6A 1UDLA 2HSPA 2F2VA 5EELA 1JU5A 1UUEA 1O4IA 2DBMA 1A09A 3M0RA 1K4US 2GQIA 1BHHA 4P9VA 1JYQA 2DL7A 2CT3A 1GCPA 2X3XD 3C0CA 2J6OA 3I9QA 4RTYA 1KC2A 2RQVA 1LUMA 1X0NA 1SSHA 2KGTA 2KRSA 4AG2C 2ETZA 2CS0A 2LZ6B 1X69A 1KIKA
chains in the Genus database with same CATH superfamily
4WCIA 5DLOA 3CEYA 1RACB 1W4SA 1F2FA 3PGGA 7AT1B 2MWOA 5FRMA 3GBQA 3REBB 2XIDA 2XMFA 1YJWT 4KULA 4DBHA 2KI7A 5AT1B 1VQOA 3EGUA 1NLPC 2Y90A 1JRIA 3J7AF 1XNIA 2QGGA 1BK2A 5LJ5h 1O4NA 1R1SA 2V8KA 3LWIA 3DKMA 4LDUA 4RUGA 1WFWA 2VXFA 5I6VA 2EFIA 4DBRA 1KD1U 1PRMC 1QP2A 2RVFA 5LJ3j 3QYGB 2DLPA 3URGA 3Q1JA 3CQTA 3EGDB 4E47A 2DXCA 1SHAA 3PE0A 2PVOB 4JZ3A 2BZYA 2DNUA 4C8QD 3GLXA 3SHWA 4KT0E 1RJAA 1UG1A 3I5SA 3NMZC 4C92A 4XK8E 4NWFA 4QKUA 4ELYC 5GAN7 1RQQC 2ESWA 3CCSA 2EKHA 4PJOC 1VQNA 2KE9A 3OQ5A 4AMCA 2NUTA 4OMMA 5CAIA 3CXCA 4QQ6A 3FLGA 2V1RA 3BY7A 1BCOA 3N8MA 4FIBA 1WZOA 1M27C 4FU6A 2YUNA 4WWQA 4EDUA 3E9FA 2IZVA 2H3EB 4E7SA 1G5VA 2F2WA 1QP3A 2BTTA 1MMAA 4IKFA 1G83A 4J9CA 2XG8D 3QO3A 3VYHB 1K9MC 1O49A 2F69A 2L3RA 2HL5C 3G4SQ 3MAZA 3EG0A 2GE9A 4Z02A 4V2SA 3M58A 1O4QA 2KDSA 5GAOn 3RMSA 2EGCA 2IG0A 2AK5A 1YI2Q 3CXCP 1R77A 2P84A 1WQWA 5I2SA 1TUGB 3PIOA 1VQ7A 3RMQA 2VASA 4AFZC 1S72Q 3AHUA 3V7CA 1Q7YU 4F04B 4N0AC 4OP0A 1HCTB 4JRIA 2HMAA 1OYXA 3V8LA 3GF5A 3QZ5B 3O8VA 1CSKA 1N5ZA 1ZSGA 1WIEA 2KQWA 5CR2A 2ENMA 1O4EA 5DM7R 1J3TA 4RTWA 2BZXA 2KT8A 4RG8A 1MV3A 1MILA 5KYNA 1BLKA 3QZ9B 1IO6A 3KUFA 5J3BA 4M77F 5CK9A 3L2RA 2LRQA 1H8KA 5GAMf 1HSQA 2COWA 4QSYA 3FC3A 5GAN4 1N8RR 3JSCA 2OAWA 2CUDA 3AT1B 2DL4A 1SHGA 2PLEA 4N4GA 1D3BA 2ZPGB 1B7TA 1O9SA 3VKIA 4ATOA 1O4AA 4O6JA 2FZCB 3UF4A 3OYJA 4JS5A 1FBZA 2Y4XA 1MMDA 2LC4A 1A81A 4M77B 2IUGA 4C92C 3L2QA 4BE2A 1K8AC 1PHTA 2Y4YA 4DOWA 4X9CA 4X34A 3I55Q 4M7DA 1VQMQ 3PVQA 1FXXA 3MP6A 4RTVA 1RAGB 2DMOA 3CC7T 1UHFA 2B86A 2B3OA 3M56A 4P5NA 2BBUA 3CC4A 3I5RA 4RG2A 1B34A 1D0ZA 3L2UA 2LJ0A 3M5AA 1NG2A 2EBPA 3CPWA 1NZ9A 4KGXB 2VB6A 3BDUA 3CC7A 1VQ8T 5M9OA 1YWOA 3CBOA 3PSJA 4MDWA 5DY9A 3H8ZA 2DZ9A 1D09B 1PKTA 2LT1A 3WVDB 1B3QA 4HCKA 1IZ6A 3MJXA 1I81A 2BE7D 2HQXA 1VQ6T 4XQ3A 4PLIA 1R0BG 3OYIA 2P4TA 2RMOA 2LNVA 2YT6A 3TVTA 5D0JA 1NJIC 3LGLA 2DTOA 2YU7A 2RSYA 4E68A 2EU0A 3BFMA 3L42A 3F70A 2DVEA 3VROA 4PJLA 2HUWA 2Z0WA 2C9WA 3V7SA 4M7DD 3C4SA 1BFJA 1E6GA 1M61A 5GJIA 1NE8A 1KC8R 3X24B 2NUTB 3QWXX 5KYXA 1HD3A 3PJPA 1LUNA 2RJDA 2X3WD 2KGYA 2O4XB 2L5QA 1BI2A 2DRMA 4JUVA 4AFUC 4LN2A 1FX7A 4DGXA 1WQ7A 2JOYA 4FBNA 3GQIB 4OB2B 1VQ8A 3FIFA 5KAZA 1JYRA 1O4RA 5KE2A 4XU3A 4PFOA 1YJ9Q 2KNBB 2EQMA 5FWBA 5CQYA 5EHPA 3TU4K 2C06A 4M7AF 2JMAA 4K44A 4OVAA 4LD6A 5DLQE 2RB6A 2CH4W 4M78E 2AOAA 3PVLA 2IUIA 2DPPB 1ZBJA 2K2MA 5A0DA 1KQSA 3CC2A 3LW5E 2YRCA 1ZQ1A 2DXTA 1IHVA 4IUQA 1WNLA 4N4IA 3JCMb 1U3OA 1X01A 3VRZA 2JZ2A 2FYKA 1G2BA 1M90U 2EQIA 1VQ5A 1YJ9T 1X27A 1K73U 1VQLT 4R55A 5J26A 4OMOA 1IGQA 5DC9A 1RPYA 2EYWA 5CKEA 2FO0A 1QVFP 3H0HA 2OX7A 3PSKA 4C92D 1SKUB 5GAMj 2RJCA 3CCMT 3FB9A 4FM4B 4LDVA 3VGOA 4Y28E 3G4ST 2D0QB 5LJ3h 2KAFA 3EGXA 1YNZA 4EIKA 2E6NA 2LQWA 1ZFPE 4RTTA 1BI3A 3J80E 2CS7A 3MP1A 4D8DA 2XDPA 4E7ZA 4XTUA 5EG3B 3NPFA 2HNIA 3M9QA 2LDMA 3PQZA 5LJ3g 1FMWA 2LJ3A 4E6RA 1WHGA 3VRQA 5GAOr 4IUUA 1C6VX 1WHJA 4GLMA 3MEWA 2H46E 1TSFA 2FPFA 4J83A 1X2QA 2CZ7B 4L5GA 4JJNK 4MMLA 4F16A 4EMKC 1A0NB 2R57A 2DX1A 4XU0A 2L3SA 2AT1B 3GNFB 3QXEB 1E7OA 4AG1C 4EMKB 2K5IA 1B34B 2BIVA 1RUWA 1CSZA 2DM1A 3HSBA 4VUBA 1YJNQ 3BE3A 5DC4A 1X2KA 5EC7A 1KFZA 4JLGA 1VQLA 2GSBA 3CCVT 2DD5A 3PFVA 1JXOA 4AT1B 2GTJA 2LQNA 4HCBA 2PNAA 1CWDL 1FMVA 2VKNA 3CC2Q 2A36A 2LCLA 1D1AA 2LP5A 1SPKA 2QG9B 1G3YA 1UDLA 2F2VA 4JLIA 3OYLA 1Y96B 4P9VA 2DL7A 3L2ZA 2X3XD 3C0CA 3LGFA 3X25B 2CP7A 3JCMe 4C0GA 1WJSA 1MGQA 2EJFA 4M4ZA 4J9HA 4YTLA 1AYBA 1PRLC 1WI7A 1D1CA 5HKZA 3I55T 2DZCA 4JGHA 1VQNQ 1O4MA 2E3IA 3E1SA 1A1CA 3OS5A 3QJ6A 3VRNA 4E7HA 5CDWA 1M1KU 1FYRA 4BE0A 3EG3A 2DEUA 4A4EA 2FG0A 3T9NA 4J9IA 3HPWA 1VQLQ 4F7UF 1O4BA 4J8OA 3V8JA 1U5SA 3A8GB 4M77G 2QAZA 1Q82R 4MMKA 4FL6A 3MEAA 4F14A 1RI9A 3JCMg 3OS1A 2DETA 2D8HA 1WLPB 1OU8A 2DCRA 1V29B 2K3XA 1O4KA 1Q86R 1W2BS 1BIBA 2L0AA 3A5ZB 5KYYA 4XU1A 4OMNA 1BMBA 4DQ2A 1V1CA 2SHPA 1YI2A 1P92A 1BB9A 1ZUKA 2X35A 3JCMV 3M0PA 2CSQA 5LJ5g 2GQVA 1R8OB 1M8VA 4PJOA 1YHQQ 4L1BB 1UGVA 2DL8A 5GAMg 3L2WA 1WGSA 1I4K1 4NS5A 2Y1NA 3GP8A 3A8HB 4M77D 1YI2T 4FYYB 3CCLQ 1ZA2B 4M75B 2ZCFB 2CP3A 2NYSA 3UPUA 2GF7A 3G4SA 1BG1A 1H92A 3S8LA 3QJYA 3CCJA 4N4HA 5D6YA 1ZBXA 5D6WA 3MCAB 5C0MA 2QI2A 3PNWC 1Q82U 1GHUA 3RR6A 2CUBA 1VQ9A 3C94A 2E65A 4C5GA 4OHEA 4M7AG 2HEQA 3TQ7P 5HK3A 2ABLA 3KBGA 2G6FX 3CCJQ 4JJBA 2QEXA 2OTJT 1W1FA 1PKSA 1LKLA 4KH1B 3CCRQ 4C92B 2JMCA 2GCXA 2HAXA 9ATCB 3OW2S 2LQ8A 2DLZA 1RAIB 2R58A 2V26A 2AZSA 2DE0X 3C7IA 2EWNA 1ABOA 3M0UA 2CT4A 3EH2A 2O9VA 1XOVA 4D8KA 5LJ5d 2DFUA 2XHCA 3NFCA 2EQJA 1NZLA 5L23A 4XTVA 2K79A 2CP6A 4HT9A 1PCXA 3M53A 4OB1B 2PTKA 3NTHA 2KYBA 1JJ2S 1EZZB 3LWHA 3PMTA 5GANg 4J9GA 2EL8A 1G3TA 4BI8B 1LKKA 2KXDA 1YCYA 1JO8A 1N27A 4RCCA 4XTWA 2KR3A 1Q95G 1H9OA 2PNBA 1M1KC 2QDYB 3OV1A 5CIUA 2CZ6B 5J39A 1R1QA 3QWYA 3UYOA 1VQNT 4KRTA 3CD6T 3CD3A 4R0KA 5GANf 3CMEA 4XZ0A 4OHIA 2L2PA 5GAMe 1ZHIA 5HY6A 1AYAA 1WHLA 3SDZA 1O4OA 1WJQA 1I5LA 5GANd 1IXDA 2CH4A 1KQSS 1H3ZA 3WXMB 4E7KA 5GMKe 5EEQA 3MPUB 1M8MA 2RI3A 3HRSA 1I07A 3M57A 2HMHA 4ZN3A 1NYFA 3BUMB 2JW4A 2KROA 2CI9A 4KUIA 1LUIA 1BI1A 1MNDA 3UA7A 2R5AA 3JAME 2DBKA 1BYMA 1LNXA 1KD1R 3CCUT 2RF0A 2YDLA 4DGPA 1F1BB 3EHRA 2V1QA 4FSXA 1YWPA 3FJPA 3JB9F 3MP8A 3OYYA 2QQRA 2JXBA 1GCQA 1V76A 5AYFA 2D6FA 4E2FB 4PK4A 1N9SA 4M78D 2L89A 3M59A 3CWGA 1T0JA 3IMJA 4L59A 3QSUA 2QDLA 4OB0B 1Y07A 2BUDA 1RLPC 1KG1A 4P9ZA 1VQ7Q 4JPBW 3TEEA 2CREA 4ZTFA 3BKBA 1M2VB 2JTFA 4BD3A 1C0MA 2JYQA 4M7DB 5CKFA 4OHDA 1NZVA 1IRXA 1X6BA 2DYBA 4M7AC 4J9FA 2EYVA 2ZPEB 4HT8A 2Y3AB 5IHKA 2LCTA 4OGEA 1FWZA 4C8QB 2AUGA 1KHIA 5CVIA 1NJIR 4IUTA 2B8AA 5GJVB 1X6OA 2RI5A 1VQPT 1ZLMA 3INZA 2RMXA 3S8NA 3G71A 3E9GA 5LJ3f 3JB9I 3GXWA 3HRUA 3NHNA 1O4JA 4M7DF 1A1BA 3UT1A 2MMPA 1AYCA 2X4WA 2QXFA 4HKEA 2RQTA 1VQ5Q 5LJ3d 3EG1A 2QQ9A 1QKWA 3I35A 4FYWB 3DLMA 2ZPIB 1D1BA 4OMQA 4M75A 2HDVA 3X28B 2ZPHB 3OB9A 1TUDA 2OAUA 2DJZA 1A07A 4L6V5 2OTLQ 5FROA 1Y1UA 1WXUA 1AVZC 5A0LA 4LDXA 2VGNA 2K2VA 4A63B 1QKXA 4CC2A 3E2UA 1D1ZA 4M7DC 3OP0A 2HL3A 1YFNA 1PNJA 4JJDA 4JS4A 2OJ2A 4IURA 1QWFA 2RD1A 2RQUA 5KYXB 1SHDA 2HKQB 4J6YA 3CD6A 2JVVA 1PWTA 1JYUA 3CCEQ 2J6KA 4NL3A 1UGPB 4C5HA 4B6MA 3OYGA 5FU7B 1BI0A 2RHUA 2OTJQ 3M4YA 3CCMA 1D4WA 1IREB 4K2RA 2O88A 4NOYA 3I56A 3CCST 4TVRA 2VVKA 4RMOA 1K9MU 3P8BB 1X6CA 5J3XA 1D3BB 2YRVA 2XD0A 2HDAA 1A1EA 1JXMA 2LTOA 3H0FA 5GAOm 1UGQB 3UWNA 4C0ZA 1VUBA 4RCBA 4FW2A 4C0DC 4PJOD 4HA8A 2E41A 1SHBA 3OVEA 3EAZA 1OOTA 2O01E 2QK0A 1QCNA 4GWFA 2CP0A 3CCLT 2JM8A 4DEYA 5GAN8 2EGAA 4PNOA 5GJWB 1U8RA 2KRMA 3CC2T 4EIHA 3M7FA 3K2MA 3BUXB 1BLJA 1ZSZC 4EPCA 2EIFA 1YIJT 5IXFA 2ED0A 1WX6A 3K2TA 5FU6B 3RIRA 2K5LA 1OZ3A 1KA7A 5LJ5e 1NBEB 3X26B 4QQGA 3CXCS 5FU7C 2DK3A 2MOXA 2QTVA 2M51A 3PS5A 1K0XA 3EACA 2KT1A 3I56T 5KE3A 3RDVA 4XAXB 2LX9A 1TXQA 4GLKA 4RTXA 3U23A 4J9DA 2JM9A 5CKBA 3SFMA 1YP5A 1O43A 1VQ6A 1M1GA 4J6XA 4M78F 3ULRB 1BFIA 1YCSB 3HTRA 3OS2A 4M75E 3EGXB 3QYHB 3L1AA 2EKXA 2YSXA 3JB9D 2WSCE 2GFUA 4GBQA 5GANj 2VV5A 1JJ2A 4PFZA 4FCYA 3CPWP 1T3LA 3CC7Q 4QW2A 5KYUB 2E6ZA 4BI3A 5EELA 3M54A 1K4US 2GQIA 3ASKA 1MMGA 2CT3A 3RERA 1GCPA 4DOVA 5HKCA 4RTYA 2DYIA 1KC2A 4PJNA 3QIIA 2WACA 2KGTA 4AG2C 3JB9G 2O4XA 1KIKA 3HRTA 1AWOA 2X4YA 3C12A 2QQAA 2AHJB 3S3OA 2XP1A 1D0XA 2FL7A 2CI8A 3CBLA 2X4XA 1UGSB 4CC7A 1BKBA 1TTHB 3M0SA 4QVZA 2XI9A 5GAMh 2P0KA 1B07A 3EG9B 3HL8A 1KC8C 2CR4A 2K3YA 1LUKA 1WDXA 3SWNB 1M1KR 5GAOp 4J5YA 1NJIU 2RHYA 1KJWA 1ZSZB 2CGHA 2QASA 1F1WA 4J7IA 3RKYA 2BE9B 2DXUA 1W70A 2YSQA 1Y96A 4IUVA 4RTZA 1AWJA 1LVKA 4PJJA 3ZNIA 2CKKA 3CPWS 4C8QG 1SPSA 1RAHB 1O47A 1HJDA 4C8QF 2RK2A 3OYKA 1CJ1A 1VQOQ 5GMKh 2MWPA 2FZGB 2DL3A 4WTOB 2CIAA 2E5KA 3LYIA 2RHZA 3CPFA 2EOBA 1YITA 5EHRA 4ZNXA 4OMPA 3RUXA 3FEOA 3JRZA 4DBQA 5LJ5j 2HZYA 1YJ9A 3EH1A 3N84A 2KY9A 4M75C 3CCMQ 4DA4A 1VQ4A 3R6OA 5LJ5f 1I8FA 5DF6A 4OF1A 4NWGA 2VGMA 2ECDA 3CCSQ 3KXTA 2FPEA 2MK5A 2BZ8A 3CCET 5I11A 5ECAA 1JB0E 1VYVA 3EHQA 3WVEB 2RI2A 1CKBA 8ATCB 2AIRB 4C5IA 1VQ4T 1RI0A 1O4LA 2HD0A 4BDZA 1UTIA 1OZ2A 4Z8AA 1I3ZA 1FYNA 1T3SA 4LDWA 3R6NA 1YVLA 2RO0A 3OYEA 4PJOB 4A4HA 3CMAA 1UECA 2HQHA 2H3JA 2NUPA 4M77C 1RAEB 3VS0A 4Y92A 1YBYA 3SD4A 1BHHB 1FHSA 1K0SA 1MV0B 1QW1A 3EFOB 4KGZB 2X9HA 3BUWB 2E1HA 3N7YA 1ZUYA 3QPHA 1QVGS 2FCIA 1K73C 2PUKB 1PG5B 1WPYA 1M27A 2G3RA 1CKAA 3OA6A 3BUNB 2IPOB 5C6SA 3OB1B 1PD1A 4MZMA 1WQUA 1OQKA 2FZKB 2EW3A 3LYVA 2QMSA 1Y0MA 4C92F 1AYDA 2LMJA 1I5OB 3VS4A 1RLQC 3VUBA 1HCSB 1E6HA 4ESRA 2V8IA 2QA4A 1KC8U 3KFVA 2YUOA 1QVPA 5HKWA 3OYCA 2IVWA 2FRWA 2DVJA 2E3HA 3TKZA 2MIOA 1O4FA 4ELZC 1M3CA 5CO7A 2M1HA 1BM2A 2RN8A 2MYSA 1QLYA 2EJ9A 2DA9A 1WJRA 2I2LA 4LXCA 3CMAQ 4ZTJA 2RORA 2QA4Q 4PFPA 1ARKA 3ER0A 4TZIA 4ZGEB 1B47A 1AD5A 3BW1A 3IN8A 2K79B 1I1JA 1VQ9T 1VQKA 2MK2A 4A4KA 2E4HA 3CMEQ 1FU5A 1A1AA 2J7IA 1VOMA 3M0QA 3OYDA 1O4GA 1YN8A 3CXLA 2VIFA 5HKYA 3QBYA 4XTXA 1OX8A 1RABB 2YUQA 2LVMA 2DLYA 4M78G 3TSZA 2LNWA 4CRIA 2D1XA 1M2OA 3S8OA 4LDYA 3MXYA 1YVHA 4LNPA 3CCQT 1UJYA 2K57A 5KYYB 2AZVA 3QKJA 2GFAA 3UA6A 3NTKA 1YITT 2RK1A 3CCUQ 2YHTA 1Y57A 3JB9H 1X75C 4BACA 1VIEA 5L8RE 2DEQA 2VC8A 3CCVA 1VYUA 2M0YA 1SG5A 2YLCA 4JRPA 1O75A 4UC4A 2K5FA 3SWNA 4XTYA 1OULA 1UURA 3CCUA 2DKGA 4BUGA 1IS0A 5GMKi 2ZAEA 1VQMT 1NRVA 5IH2A 3VU3C 4OB3B 4M7AE 4LD9K 2YXYA 4U17A 1NEBA 2ED1A 3NTIA 4NL2A 4ORZA 3VS2A 1QVFA 4BY6B 5IXBA 1KHCA 3H41A 3EFSA 2DX0A 1ZX6A 5EG2A 3JCMP 2LJ1A 3EFRA 1X6GA 3TSWA 3MHXA 3HHTB 2QTXA 4M7DE 2SRCA 4XZ1A 1N6AA 3WA4A 1JBMA 2KMTA 2M9UA 1N9RA 2K7AA 2ZPBB 2EYYA 3VRYA 1CSYA 3OSVA 2SEMA 3OYHA 2FVUA 1KQ2A 1NPRA 5IAYA 2O31A 2AOBA 3HHMB 1GRIA 1M2VA 2DM0A 3RNJA 2HBPA 4C0DB 3OYNA 1YJNT 4F5AA 1YJWA 2HDXA 3OMCA 2DRKA 1AWWA 4PL6A 1NEGA 3ZBDA 1O48A 2COYA 3CCJT 1LCJA 1SRMA 1BKMA 3MKDA 2EPDA 1R1PA 4EMHA 1TU0B 1PD0A 1MHNA 2DILA 1VYTA 4M7AB 5A0GA 4GPLB 1VQ9Q 1O45A 2I0NA 2EVRA 3IMDA 3N5BB 1VQMA 4BB7A 1TWBA 2EYQA 3S3MA 1LJOA 2ZPFB 2PQWA 3CCRA 1Q82C 3M0TA 3G6ET 2CSIA 2V8JA 1UB4A 1W2BP 2PLDA 3CCLA 2D0NA 2FRYA 2ZZDA 4M75G 3CCEA 5FLXE 1T0HA 2XDBA 1OV3A 1X43A 2RHIA 5GANe 4DBFA 1KSWA 4HVVA 4LUDA 1NM7A 2JNGA 2L3QA 4E7IA 1Q7YC 2JS0A 3X20B 4PJMA 1WXTA 1LCKA 2NLUA 4CI0C 1K8AR 5IN1A 2L8DA 3HFNA 4OGCA 4LE9A 1RL2A 1QMCA 3TCJA 2LQKA 3UATA 4FYVB 1EX4A 2PVGB 3ZL7C 3FDRA 2A3LA 2EKOA 1Q7YR 1PSEA 1VQ7T 2XKOC 3HP9A 5KCHA 3J81E 2J05A 4D6WA 4FSSA 2ECZA 1I0CA 1G3WA 1AOJA 3RKXA 4F5BA 2K4YA 2KYMA 3OMGA 2EO6A 1O4PA 2CBLA 4PJOG 1Y71A 3H6ZA 2HCKA 4M7AA 2P0QA 4M7DG 5FU6C 3V8KA 2C0IA 2KVQG 1O4HA 2KBTA 4C92E 2LCSA 1MNEA 3OW2P 2MRKA 1SHFA 1K8AU 2CRHA 4BI4A 4F7UA 1FU6A 2MRJA 1QVGP 2EGEA 5GAN3 1M3BA 3PMIA 8AT1B 4F7UE 3QDFA 4EMKA 4J9BA 2PVDB 1U06A 1GCQC 3ZEHA 3OYBA 5IT9E 1O46A 3JCMJ 4J9EA 3MEVA 2E5QA 1R0CB 4M78A 2XU8A 1VQOT 3QHSA 4IIMA 3HCKA 3JV3A 1W2BA 2M02A 1KK7A 2H8HA 2LNHB 3PIPA 4O5VA 3KFJA 2M16A 3D7SB 1XQHA 1KA6A 4K45A 2GGRA 3CCVQ 5HK0A 4HCCA 2RJFA 2QGFB 4N0AA 5CKHA 4ZN1A 5GAN5 2LRAA 2DAQA 1YITQ 1HYOA 3LX7A 2ZGWA 3P8HA 1LOJA 1LUMA 1VIFA 2ETZA 2CS0A 2LZ6B 2EJGA 3FRNA 1PSFA 1AOUF 5FW9A 1W6XA 5CQXA 1K1ZA 4M77E 4MZPA 2PU9B 1GBRA 2JTMA 4II1A 1U1TA 5AULA 2LX7A 3CMAT 2E10A 4GL9E 1IGUA 1HXDA 4PKCC 2RQWA 2MCNA 3HFOA 3OYFA 1AT1B 2MF2A 1VQPA 1MMNA 4OHHA 2XICA 1AWXA 1VQKQ 3CCRT 5KYUA 3JCMQ 3IN7A 4X6SA 5I2MA 3US4A 3G7ZA 5FWCA 5GAMd 2KK4A 1WA7A 3P8DA 2AKLA 4FL2A 1GBQA 2NUZA 5BO4A 2KRNA 3OW2A 4XU2A 2ROLA 1CWEA 3VJPA 2YRDA 1M90R 5LL6S 2EQKA 4J6WA 2DTIA 4PJOE 2OZOA 2X51A 3JCMf 1IJRA 1SSFA 3MO8A 3OSSC 2MQIA 2L6KA 3OS0A 3A1PA 2PNIA 1RAFB 1RADB 1M4ZA 4X1VA 3S3NA 1Q81C 1ZSZA 2E64A 3QUIA 1UUSA 2C0TA 3JCMd 6AT1B 2JS2A 3EG9A 1AZGB 5GJHA 3CC4T 3G71T 3UDCA 1O4CA 4OMFB 2E12A 5GMKm 5GAOq 2OQ1A 2RH2A 1BF5A 2DIGA 5KCOA 4CC4B 5GAN2 1Q81R 3H0IA 1BU1A 2LCCA 1M5Q1 3QG1A 2L3TA 4Y91A 3SWNC 2OTJA 1SEMA 3JCMh 1GFDA 1S72A 1AOTF 3CCQA 2DIQA 3I56Q 4FT2A 5FRNA 3S6WA 3VS5A 1SF9A 4HVUA 1M90C 5LJ3e 4FW1A 4E93A 1D0YA 3MXCA 1UHCA 3GXXA 4M75D 1WHHA 2PZ1A 3JCMX 1A08A 3BDLA 1QVFS 1JU5C 4M7AD 2CDTA 2JN0A 1TS9A 1YIJQ 1EIFA 2YWWA 2KNOA 4LUEA 2MAMA 2IIMA 2A28A 4C8QA 5GMKj 2QYZA 2HKNA 2QEXT 1VA7A 1BIAA 2K6DA 3FJ5A 3TREA 4JE4A 3ME9A 5IBMA 4QQDA 4PJOF 2KK6A 4PLLA 2HQEA 2VXEA 4QVCA 2RJEA 3HKSA 5CCAA 4M77A 1JQQA 1Q86U 1K9AA 5AXIA 1VQKT 1O44A 3VS7A 3GIBA 1AEYA 1G8XA 4H34A 3OB2B 4Q5WA 3CCQQ 1JWOA 3SEMA 3EG2A 1M30A 3I55A 1UEBA 1NLOC 1K9MR 1IB8A 1UE9A 1ACMB 4F7UB 1Z3KA 1MW4A 2MPXC 4A4FA 4HCZA 1OO4A 1SRLA 1LPLA 2VWFA 2NWMA 4M78B 2L3PA 1BCMA 2WSEE 3T04A 2HSEB 4M78C 1GL5A 4KBMB 3VV0A 4F59A 2F1LA 2IUHA 3REAB 3CMET 1K76A 3VUZA 2P0PA 1ZUUA 3LH5A 2ROTA 5IHNA 4A53A 4C8QC 1SPRA 1UJ0A 2QA4T 1ZA1B 2F5TX 3A8OB 1QVGA 3CC4Q 1YJNA 2QQBA 4B9XA 3C95A 1Q81U 3E19A 1JEGA 1GXIE 2KXCA 3META 3TL0A 4ME7A 4BDYA 3CBPA 2CP2A 5GANh 2R5MA 4M75F 1QWEA 3A8MB 2A0FB 2BKDN 4KUDK 1TZEE 1QCFA 2DF6A 1XA6A 4DEXA 2CZ1B 4JRKA 1VQ5T 2VYTA 3JCMc 3RESA 3OBWA 5D6XA 2EAYA 2A08A 2EQUA 2DXBA 3GOXA 2X4JA 1WXBA 2EYZA 1UGRB 1OPKA 2FB7A 3A8LB 2OI3A 2DTHA 4ZGJB 1SKJA 2P4RA 1QQJA 1M1FA 2A7YA 2HBWA 4ANJA 4OMLA 4MDXA 2JT4A 3S9KA 1TG0A 2C0OA 2E70A 4IUPA 1KQSP 1BHFA 2O2OA 2RPNA 2RM4A 1FBVA 3OBYA 3PT9A 2MC1A 2FHDA 1WYXA 1Z9QA 2CP5A 5CKDA 4QVDA 3JB9J 1N8RC 3CBMA 4BY6C 2A37A 2RHXA 4GY5A 1PC0A 3O5ZA 2YUPA 4FT4A 4BE1A 5DC0B 1O41A 2PUOB 2COZA 1OEBA 5IHIA 2VUBA 1AZEA 3G71Q 3JCMW 1S1NA 3L2VA 1VQ4Q 2K3BA 2DL5A 4Z89A 2W0ZA 1QCOA 4E7LA 1ABQA 1Q86C 1S72T 4A4CA 2NUPB 4C0FA 1OO3A 1GFCA 4E7JA 3DLLA 5GAOl 5GAN6 2J6FA 4EMGA 4MZTA 3MEUA 4A4BA 1TH7A 2DD4A 2RA2A 3LH0A 3THKA 1MUZA 5IBSA 5KYWA 1KQ1A 4C8QE 2KSSA 3CD6Q 1YHQA 4C5EA 3EGDA 1OPLA 3DB3A 2QEXQ 1WHKA 2F2XA 4RKUE 4KH0B 4A4GA 3BUOB 2XDDA 1YIJA 1G3SA 2XK0A 4IIOA 1QG1E 3RBBB 2K7AB 5HCKA 3M55A 1IHWA 4JEGA 3OY9A 2W10A 1AHJB 2QQSA 1TOVA 2RQRA 2KEAA 1JJ2P 2LT4A 4JZ4A 4HXJA 2ATCB 2GBQA 4EY0A 3M4GA 4QT7A 3PFSA 2DO3A 3PLFB 1VQ6Q 1C1AA 2EYXA 1K73R 5GMKl 4AFSC 4AFQC 3LLRA 1WHMA 3VRPA 3NGPA 2K9GA 1TUCA 4JRQA 1P13A 1NPPA 1UFFA 4RTUA 2FPDA 1BKLA 2OTLT 4H1OA 2RNAA 3QDRB 3RKWA 1AB2A 4R56A 2LNXA 3VYGA 1RAAB 1VQ8Q 4HVWA 4F17A 3GPLA 2DERA 4X9DA 4B9WA 4FL3A 3IQLA 1QADA 5I22A 2AKKA 4F7UG 4FYXB 3OYAA 1KD1C 2GTOA 1M3AA 4ZGDB 3ZFJA 1XJWB 4K11A 1NYGA 3OYMA 3G6EA 2JTEA 4C92G 3EAEA 2MI6A 1EFNA 5A2QE 3PTAA 1TCEA 3HIZB 5KYWB 2D8JA 2CYZB 2FEIA 1OX9A 1OI1A 3SB2A 3V7RA 3DB4A 1DJ7B 1N8RU 4JJCA 3VS3A 3G6EQ 4KGVB 2O9SA 5KH6A 2Y1MA 4U1PA 2YLBA 2H5KA 1PICA 2EO3A 4ROJA 1VQPQ 3VRRA 2M0OA 4J7FA 1YJWQ 1U1SA 1H3HA 4OHLA 2JUFA 1O4DA 1YHQT 1XTDA 2OTLA 3A98A 2L4KA 1BBZA 2F5KA 1PM3A 4Z88A 1FMKA 4A54A 2J06A 3VS1A 2JJ9A 1HK9A 2CZ0B 4CC3A 1D4TA 1Z9ZA 3H9NA 1O42A 2GNCA 2DJQA 3VS6A 2HSPA 1M9SA 1JU5A 5D7UA 1UUEA 2WSFE 2DBMA 3G1JA 4WF2A 1O4IA 1A09A 3M0RA 1BHHA 1JYQA 2J6OA 4JDSA 3EFOA 3I9QA 4XTZA 1H641 2RQVA 1X0NA 1SSHA 2KRSA 3GNGA 1Y7XA 2D9TA 1OU9A 1X69A 5I21A
chains in the Genus database with same CATH topology
1AWOA 4WCIA 4M4ZA 4J9HA 1F2FA 1AYBA 1PRLC 1WI7A 1AOUF 5HKZA 5FW9A 1W6XA 1K1ZA 4JGHA 2XP1A 3GBQA 1O4MA 2CI8A 3REBB 1GBRA 3CBLA 4CC7A 1A1CA 2XMFA 3M0SA 5AULA 2LX7A 4GL9E 3VRNA 3EGUA 2RQWA 2MCNA 1B07A 1NLPC 5CDWA 4OHHA 1FYRA 2CR4A 1LUKA 1WDXA 3EG3A 1BK2A 2FG0A 4J9IA 1O4BA 1AWXA 1KJWA 1O4NA 1R1SA 1U5SA 1F1WA 3IN7A 4X6SA 3US4A 1W70A 5FWCA 2YSQA 4F14A 1RI9A 1WA7A 2D8HA 1WLPB 4RTZA 1AWJA 3ZNIA 2AKLA 2DCRA 1O4KA 4RUGA 1WFWA 4FL2A 1GBQA 2L0AA 2NUZA 1SPSA 5I6VA 5BO4A 2KRNA 1PRMC 2ROLA 1HJDA 4OMNA 1CWEA 1O47A 1BMBA 2RVFA 1CJ1A 1V1CA 2OZOA 2DLPA 2DL3A 2SHPA 2CIAA 3CQTA 2E5KA 1BB9A 1ZUKA 1IJRA 3M0PA 1SHAA 2CSQA 3PE0A 4JZ3A 2EOBA 2BZYA 2L6KA 2MQIA 2DNUA 5EHRA 4ZNXA 2PNIA 4L1BB 3SHWA 4OMPA 1RJAA 1UG1A 3I5SA 1UGVA 4X1VA 2DL8A 3NMZC 1UUSA 2C0TA 4NWFA 3N84A 1RQQC 2ESWA 2JS2A 1AZGB 2EKHA 2Y1NA 5GJHA 2KE9A 1O4CA 5DF6A 4OMMA 4NWGA 2ECDA 2OQ1A 1H92A 1BG1A 3S8LA 2V1RA 1BF5A 4CC4B 2FPEA 3N8MA 3H0IA 2BZ8A 5I11A 5ECAA 1GHUA 1BU1A 1M27C 1VYVA 2YUNA 3EHQA 4WWQA 1CKBA 2IZVA 2L3TA 1SEMA 1GFDA 1AOTF 2F2WA 2CUBA 2BTTA 1O4LA 1G83A 4J9CA 4OHEA 1UTIA 3VS5A 4Z8AA 4HVUA 1O49A 2HEQA 1I3ZA 1FYNA 2ABLA 2G6FX 3MAZA 1T3SA 4E93A 3R6NA 3MXCA 1YVLA 1UHCA 3EG0A 4JJBA 2GE9A 1O4QA 1W1FA 1PKSA 3GXXA 1UECA 1LKLA 2PZ1A 2EGCA 3VS0A 4Y92A 1A08A 1JU5C 2AK5A 2CDTA 2JMCA 1BHHB 1FHSA 1K0SA 1MV0B 2KNOA 4LUEA 3BUWB 2DLZA 3N7YA 1ZUYA 2IIMA 2A28A 2FCIA 4AFZC 2AZSA 2DE0X 3C7IA 3M0UA 1ABOA 2CT4A 1M27A 1VA7A 1XOVA 1CKAA 2O9VA 4D8KA 3BUNB 2K6DA 1HCTB 3OB1B 3FJ5A 4JE4A 1NZLA 5L23A 5IBMA 1WQUA 2K79A 1CSKA 2KK6A 1N5ZA 1ZSGA 1WIEA 2EW3A 2ENMA 2QMSA 1O4EA 2PTKA 1Y0MA 1J3TA 1AYDA 4RTWA 2LMJA 2BZXA 2KYBA 1JQQA 1K9AA 2KT8A 1MV3A 1MILA 1BLKA 3VS4A 1RLQC 1IO6A 5AXIA 1O44A 3VS7A 1HCSB 4J9GA 2EL8A 1AEYA 4H34A 1E6HA 1H8KA 1LKKA 2KXDA 4ESRA 3OB2B 1JO8A 2KR3A 1JWOA 3SEMA 1HSQA 1H9OA 3EG2A 2PNBA 1M30A 3KFVA 2YUOA 3OV1A 5HKWA 1NLOC 4QSYA 2FRWA 1UE9A 2DVJA 1R1QA 3QWYA 1Z3KA 3TKZA 1MW4A 3UYOA 2MIOA 2OAWA 1O4FA 3CD3A 1M3CA 2CUDA 4KRTA 4R0KA 1SRLA 2DL4A 1SHGA 1OO4A 2VWFA 2NWMA 2PLEA 2L3PA 4XZ0A 1BM2A 2RN8A 3T04A 4OHIA 1QLYA 2DA9A 2L2PA 1AYAA 1GL5A 1O4AA 2RORA 3UF4A 1O4OA 1FBZA 1ARKA 4F59A 1A81A 4TZIA 2IUHA 3REAB 1B47A 1K76A 2IUGA 1AD5A 1ZUUA 3LH5A 2CH4A 2ROTA 3IN8A 5EEQA 2K79B 1PHTA 1I1JA 5IHNA 2MK2A 1M8MA 1SPRA 1I07A 1FU5A 1A1AA 2HMHA 1UJ0A 1NYFA 3BUMB 2J7IA 2JW4A 2KROA 3PVQA 2CI9A 1LUIA 3M0QA 4RTVA 1O4GA 1YN8A 2DMOA 3UA7A 3CXLA 2VIFA 1JEGA 5HKYA 2DBKA 1UHFA 2KXCA 2B86A 2B3OA 2YUQA 3TL0A 2DLYA 2BBUA 3TSZA 2RF0A 2YDLA 4DGPA 2LNWA 3I5RA 3EHRA 2V1QA 1YWPA 2D1XA 1QWEA 3S8OA 2JXBA 1GCQA 3MXYA 2LJ0A 1YVHA 4LNPA 1TZEE 1QCFA 1UJYA 2DF6A 1NG2A 2AZVA 2EBPA 1XA6A 4DEXA 3UA6A 3CWGA 1Y57A 1YWOA 1T0JA 2A08A 3IMJA 3PSJA 2QDLA 1WXBA 1RLPC 2EYZA 4P9ZA 1PKTA 1OPKA 4JPBW 1B3QA 4HCKA 1VYUA 2M0YA 2OI3A 2CREA 3BKBA 1SKJA 2P4RA 2JYQA 1UURA 4OHDA 2HBWA 2RMOA 1X6BA 2DYBA 1IS0A 4OMLA 1NZVA 2YT6A 3TVTA 5D0JA 4J9FA 2JT4A 3S9KA 1TG0A 2C0OA 2EYVA 5IH2A 1NRVA 2YU7A 2Y3AB 5IHKA 1BHFA 2O2OA 2RSYA 2LCTA 2RPNA 1FBVA 4E68A 2EU0A 2MC1A 2AUGA 4U17A 1NEBA 2ED1A 3VROA 4ORZA 1WYXA 1Z9QA 3VS2A 5GJVB 2HUWA 5IXBA 1ZLMA 2C9WA 3H41A 2DX0A 2RMXA 3S8NA 1ZX6A 2A37A 3O5ZA 1BFJA 1E6GA 2LJ1A 2YUPA 3GXWA 3NHNA 1X6GA 3TSWA 1M61A 1O4JA 5DC0B 1O41A 5GJIA 1A1BA 2SRCA 4XZ1A 1OEBA 5IHIA 1AZEA 1S1NA 1AYCA 2K3BA 3WA4A 2RQTA 2DL5A 2K7AA 3QWXX 1HD3A 2W0ZA 4Z89A 1ABQA 2EYYA 3EG1A 3VRYA 1LUNA 3PJPA 2X3WD 1CSYA 2SEMA 4A4CA 1OO3A 1GFCA 1QKWA 2O31A 3I35A 2AOBA 3HHMB 1GRIA 2DRMA 4AFUC 4LN2A 4OMQA 2DM0A 3RNJA 2HDVA 4DGXA 4F5AA 2J6FA 2HDXA 4FBNA 1TUDA 3GQIB 2DRKA 1AWWA 4A4BA 1NEGA 1A07A 5KAZA 1Y1UA 1WXUA 1AVZC 1O48A 1JYRA 1O4RA 1LCJA 1SRMA 3THKA 1MUZA 1BKMA 5IBSA 2EPDA 1R1PA 4A63B 1QKXA 4CC2A 2DILA 2KNBB 1D1ZA 1VYTA 3OP0A 5FWBA 5EHPA 4GPLB 1O45A 2JMAA 1OPLA 2I0NA 2EVRA 1PNJA 2F2XA 3IMDA 4K44A 4JJDA 3BUOB 2OJ2A 4IIOA 1QWFA 2RQUA 1QG1E 3RBBB 2K7AB 1SHDA 5HCKA 2CH4W 2AOAA 1PWTA 3PVLA 1JYUA 2IUIA 4JEGA 2W10A 2J6KA 1ZBJA 2K2MA 3M0TA 2CSIA 2PLDA 2RQRA 2KEAA 2D0NA 2FRYA 4JZ4A 4HXJA 1D4WA 4K2RA 2O88A 1T0HA 1U3OA 2GBQA 3VRZA 4EY0A 2VVKA 4QT7A 1OV3A 1X43A 1G2BA 1X6CA 3PLFB 5J3XA 1KSWA 2EQIA 2EYXA 1X27A 4HVVA 2HDAA 4LUDA 4AFSC 1JXMA 4AFQC 1NM7A 1A1EA 3VRPA 2L3QA 3H0FA 2JS0A 3NGPA 2K9GA 1TUCA 4OMOA 1P13A 1WXTA 5DC9A 1UFFA 4RTUA 2FPDA 1BKLA 1LCKA 1RPYA 2EYWA 4H1OA 2RNAA 4LE9A 2FO0A 1AB2A 2LNXA 3UATA 4HVWA 4F17A 3H0HA 1SHBA 3OVEA 3EAZA 1OOTA 3IQLA 1QADA 3ZL7C 3PSKA 4FL3A 4GWFA 5I22A 2AKKA 2JM8A 4DEYA 3VGOA 2GTOA 1M3AA 2EGAA 5GJWB 2KRMA 2J05A 4K11A 4EIHA 1NYGA 3M7FA 4FSSA 3K2MA 3BUXB 2ECZA 1YNZA 1BLJA 1I0CA 4EIKA 2JTEA 2LQWA 1ZFPE 1AOJA 4RTTA 1EFNA 3HIZB 1TCEA 4F5BA 2KYMA 5IXFA 4D8DA 2EO6A 1O4PA 5EG3B 2D8JA 2CBLA 2ED0A 1WX6A 3NPFA 3PQZA 2HCKA 2FEIA 1KA7A 2LJ3A 4E6RA 3VRQA 4GLMA 2C0IA 2MOXA 4JJCA 2M51A 2H46E 3VS3A 3PS5A 1K0XA 2FPFA 1O4HA 2KBTA 2LCSA 3EACA 1X2QA 2KT1A 2O9SA 4F16A 2MRKA 1A0NB 1SHFA 2CRHA 2DX1A 2Y1MA 4U1PA 2L3SA 4RTXA 3U23A 1E7OA 4AG1C 1PICA 1FU6A 2H5KA 2EO3A 4J9DA 4ROJA 2JM9A 2MRJA 2EGEA 1CSZA 1RUWA 3VRRA 1M3BA 2DM1A 1H3HA 4OHLA 1O4DA 4J9BA 5DC4A 1YP5A 1X2KA 5EC7A 1O43A 1KFZA 3A98A 2L4KA 1U06A 1GCQC 1BBZA 2GSBA 4Z88A 3ULRB 1BFIA 1YCSB 1O46A 4J9EA 2EKXA 3PFVA 1FMKA 2YSXA 2J06A 4IIMA 4GBQA 1JXOA 3VS1A 3JV3A 3HCKA 2GTJA 2LQNA 2PNAA 1CWDL 2H8HA 2VKNA 2LNHB 4CC3A 1D4TA 2A36A 1Z9ZA 1T3LA 3KFJA 1O42A 2LP5A 2GNCA 1KA6A 1SPKA 4K45A 2DJQA 2GGRA 3VS6A 1UDLA 2HSPA 2F2VA 5EELA 1JU5A 1UUEA 1O4IA 2DBMA 1A09A 3M0RA 1K4US 2GQIA 1BHHA 4P9VA 1JYQA 2DL7A 2CT3A 1GCPA 2X3XD 3C0CA 2J6OA 3I9QA 4RTYA 1KC2A 2RQVA 1LUMA 1X0NA 1SSHA 2KGTA 2KRSA 4AG2C 2ETZA 2CS0A 2LZ6B 1X69A 1KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWO A;  4WCI A;  4M4Z A;  4J9H A;  1F2F A;  1AYB A;  1PRL C;  1WI7 A;  1AOU F;  5HKZ A;  5FW9 A;  1W6X A;  1K1Z A;  4JGH A;  2XP1 A;  3GBQ A;  1O4M A;  2CI8 A;  3REB B;  1GBR A;  3CBL A;  4CC7 A;  1A1C A;  2XMF A;  3M0S A;  5AUL A;  2LX7 A;  4GL9 E;  3VRN A;  3EGU A;  2RQW A;  2MCN A;  1B07 A;  1NLP C;  5CDW A;  4OHH A;  1FYR A;  2CR4 A;  1LUK A;  1WDX A;  3EG3 A;  1BK2 A;  2FG0 A;  4J9I A;  1O4B A;  1AWX A;  1KJW A;  1O4N A;  1R1S A;  1U5S A;  1F1W A;  3IN7 A;  4X6S A;  3US4 A;  1W70 A;  5FWC A;  2YSQ A;  4F14 A;  1RI9 A;  1WA7 A;  2D8H A;  1WLP B;  4RTZ A;  1AWJ A;  3ZNI A;  2AKL A;  2DCR A;  1O4K A;  4RUG A;  1WFW A;  4FL2 A;  1GBQ A;  2L0A A;  2NUZ A;  1SPS A;  5I6V A;  5BO4 A;  2KRN A;  1PRM C;  2ROL A;  1HJD A;  4OMN A;  1CWE A;  1O47 A;  1BMB A;  2RVF A;  1CJ1 A;  1V1C A;  2OZO A;  2DLP A;  2DL3 A;  2SHP A;  2CIA A;  3CQT A;  2E5K A;  1BB9 A;  1ZUK A;  1IJR A;  3M0P A;  1SHA A;  2CSQ A;  3PE0 A;  4JZ3 A;  2EOB A;  2BZY A;  2L6K A;  2MQI A;  2DNU A;  5EHR A;  4ZNX A;  2PNI A;  4L1B B;  3SHW A;  4OMP A;  1RJA A;  1UG1 A;  3I5S A;  1UGV A;  4X1V A;  2DL8 A;  3NMZ C;  1UUS A;  2C0T A;  4NWF A;  3N84 A;  1RQQ C;  2ESW A;  2JS2 A;  1AZG B;  2EKH A;  2Y1N A;  5GJH A;  2KE9 A;  1O4C A;  5DF6 A;  4OMM A;  4NWG A;  2ECD A;  2OQ1 A;  1H92 A;  1BG1 A;  3S8L A;  2V1R A;  1BF5 A;  4CC4 B;  2FPE A;  3N8M A;  3H0I A;  2BZ8 A;  5I11 A;  5ECA A;  1GHU A;  1BU1 A;  1M27 C;  1VYV A;  2YUN A;  3EHQ A;  4WWQ A;  1CKB A;  2IZV A;  2L3T A;  1SEM A;  1GFD A;  1AOT F;  2F2W A;  2CUB A;  2BTT A;  1O4L A;  1G83 A;  4J9C A;  4OHE A;  1UTI A;  3VS5 A;  4Z8A A;  4HVU A;  1O49 A;  2HEQ A;  1I3Z A;  1FYN A;  2ABL A;  2G6F X;  3MAZ A;  1T3S A;  4E93 A;  3R6N A;  3MXC A;  1YVL A;  1UHC A;  3EG0 A;  4JJB A;  2GE9 A;  1O4Q A;  1W1F A;  1PKS A;  3GXX A;  1UEC A;  1LKL A;  2PZ1 A;  2EGC A;  3VS0 A;  4Y92 A;  1A08 A;  1JU5 C;  2AK5 A;  2CDT A;  2JMC A;  1BHH B;  1FHS A;  1K0S A;  1MV0 B;  2KNO A;  4LUE A;  3BUW B;  2DLZ A;  3N7Y A;  1ZUY A;  2IIM A;  2A28 A;  2FCI A;  4AFZ C;  2AZS A;  2DE0 X;  3C7I A;  3M0U A;  1ABO A;  2CT4 A;  1M27 A;  1VA7 A;  1XOV A;  1CKA A;  2O9V A;  4D8K A;  3BUN B;  2K6D A;  1HCT B;  3OB1 B;  3FJ5 A;  4JE4 A;  1NZL A;  5L23 A;  5IBM A;  1WQU A;  2K79 A;  1CSK A;  2KK6 A;  1N5Z A;  1ZSG A;  1WIE A;  2EW3 A;  2ENM A;  2QMS A;  1O4E A;  2PTK A;  1Y0M A;  1J3T A;  1AYD A;  4RTW A;  2LMJ A;  2BZX A;  2KYB A;  1JQQ A;  1K9A A;  2KT8 A;  1MV3 A;  1MIL A;  1BLK A;  3VS4 A;  1RLQ C;  1IO6 A;  5AXI A;  1O44 A;  3VS7 A;  1HCS B;  4J9G A;  2EL8 A;  1AEY A;  4H34 A;  1E6H A;  1H8K A;  1LKK A;  2KXD A;  4ESR A;  3OB2 B;  1JO8 A;  2KR3 A;  1JWO A;  3SEM A;  1HSQ A;  1H9O A;  3EG2 A;  2PNB A;  1M30 A;  3KFV A;  2YUO A;  3OV1 A;  5HKW A;  1NLO C;  4QSY A;  2FRW A;  1UE9 A;  2DVJ A;  1R1Q A;  3QWY A;  1Z3K A;  3TKZ A;  1MW4 A;  3UYO A;  2MIO A;  2OAW A;  1O4F A;  3CD3 A;  1M3C A;  2CUD A;  4KRT A;  4R0K A;  1SRL A;  2DL4 A;  1SHG A;  1OO4 A;  2VWF A;  2NWM A;  2PLE A;  2L3P A;  4XZ0 A;  1BM2 A;  2RN8 A;  3T04 A;  4OHI A;  1QLY A;  2DA9 A;  2L2P A;  1AYA A;  1GL5 A;  1O4A A;  2ROR A;  3UF4 A;  1O4O A;  1FBZ A;  1ARK A;  4F59 A;  1A81 A;  4TZI A;  2IUH A;  3REA B;  1B47 A;  1K76 A;  2IUG A;  1AD5 A;  1ZUU A;  3LH5 A;  2CH4 A;  2ROT A;  3IN8 A;  5EEQ A;  2K79 B;  1PHT A;  1I1J A;  5IHN A;  2MK2 A;  1M8M A;  1SPR A;  1I07 A;  1FU5 A;  1A1A A;  2HMH A;  1UJ0 A;  1NYF A;  3BUM B;  2J7I A;  2JW4 A;  2KRO A;  3PVQ A;  2CI9 A;  1LUI A;  3M0Q A;  4RTV A;  1O4G A;  1YN8 A;  2DMO A;  3UA7 A;  3CXL A;  2VIF A;  1JEG A;  5HKY A;  2DBK A;  1UHF A;  2KXC A;  2B86 A;  2B3O A;  2YUQ A;  3TL0 A;  2DLY A;  2BBU A;  3TSZ A;  2RF0 A;  2YDL A;  4DGP A;  2LNW A;  3I5R A;  3EHR A;  2V1Q A;  1YWP A;  2D1X A;  1QWE A;  3S8O A;  2JXB A;  1GCQ A;  3MXY A;  2LJ0 A;  1YVH A;  4LNP A;  1TZE E;  1QCF A;  1UJY A;  2DF6 A;  1NG2 A;  2AZV A;  2EBP A;  1XA6 A;  4DEX A;  3UA6 A;  3CWG A;  1Y57 A;  1YWO A;  1T0J A;  2A08 A;  3IMJ A;  3PSJ A;  2QDL A;  1WXB A;  1RLP C;  2EYZ A;  4P9Z A;  1PKT A;  1OPK A;  4JPB W;  1B3Q A;  4HCK A;  1VYU A;  2M0Y A;  2OI3 A;  2CRE A;  3BKB A;  1SKJ A;  2P4R A;  2JYQ A;  1UUR A;  4OHD A;  2HBW A;  2RMO A;  1X6B A;  2DYB A;  1IS0 A;  4OML A;  1NZV A;  2YT6 A;  3TVT A;  5D0J A;  4J9F A;  2JT4 A;  3S9K A;  1TG0 A;  2C0O A;  2EYV A;  5IH2 A;  1NRV A;  2YU7 A;  2Y3A B;  5IHK A;  1BHF A;  2O2O A;  2RSY A;  2LCT A;  2RPN A;  1FBV A;  4E68 A;  2EU0 A;  2MC1 A;  2AUG A;  4U17 A;  1NEB A;  2ED1 A;  3VRO A;  4ORZ A;  1WYX A;  1Z9Q A;  3VS2 A;  5GJV B;  2HUW A;  5IXB A;  1ZLM A;  2C9W A;  3H41 A;  2DX0 A;  2RMX A;  3S8N A;  1ZX6 A;  2A37 A;  3O5Z A;  1BFJ A;  1E6G A;  2LJ1 A;  2YUP A;  3GXW A;  3NHN A;  1X6G A;  3TSW A;  1M61 A;  1O4J A;  5DC0 B;  1O41 A;  5GJI A;  1A1B A;  2SRC A;  4XZ1 A;  1OEB A;  5IHI A;  1AZE A;  1S1N A;  1AYC A;  2K3B A;  3WA4 A;  2RQT A;  2DL5 A;  2K7A A;  3QWX X;  1HD3 A;  2W0Z A;  4Z89 A;  1ABQ A;  2EYY A;  3EG1 A;  3VRY A;  1LUN A;  3PJP A;  2X3W D;  1CSY A;  2SEM A;  4A4C A;  1OO3 A;  1GFC A;  1QKW A;  2O31 A;  3I35 A;  2AOB A;  3HHM B;  1GRI A;  2DRM A;  4AFU C;  4LN2 A;  4OMQ A;  2DM0 A;  3RNJ A;  2HDV A;  4DGX A;  4F5A A;  2J6F A;  2HDX A;  4FBN A;  1TUD A;  3GQI B;  2DRK A;  1AWW A;  4A4B A;  1NEG A;  1A07 A;  5KAZ A;  1Y1U A;  1WXU A;  1AVZ C;  1O48 A;  1JYR A;  1O4R A;  1LCJ A;  1SRM A;  3THK A;  1MUZ A;  1BKM A;  5IBS A;  2EPD A;  1R1P A;  4A63 B;  1QKX A;  4CC2 A;  2DIL A;  2KNB B;  1D1Z A;  1VYT A;  3OP0 A;  5FWB A;  5EHP A;  4GPL B;  1O45 A;  2JMA A;  1OPL A;  2I0N A;  2EVR A;  1PNJ A;  2F2X A;  3IMD A;  4K44 A;  4JJD A;  3BUO B;  2OJ2 A;  4IIO A;  1QWF A;  2RQU A;  1QG1 E;  3RBB B;  2K7A B;  1SHD A;  5HCK A;  2CH4 W;  2AOA A;  1PWT A;  3PVL A;  1JYU A;  2IUI A;  4JEG A;  2W10 A;  2J6K A;  1ZBJ A;  2K2M A;  3M0T A;  2CSI A;  2PLD A;  2RQR A;  2KEA A;  2D0N A;  2FRY A;  4JZ4 A;  4HXJ A;  1D4W A;  4K2R A;  2O88 A;  1T0H A;  1U3O A;  2GBQ A;  3VRZ A;  4EY0 A;  2VVK A;  4QT7 A;  1OV3 A;  1X43 A;  1G2B A;  1X6C A;  3PLF B;  5J3X A;  1KSW A;  2EQI A;  2EYX A;  1X27 A;  4HVV A;  2HDA A;  4LUD A;  4AFS C;  1JXM A;  4AFQ C;  1NM7 A;  1A1E A;  3VRP A;  2L3Q A;  3H0F A;  2JS0 A;  3NGP A;  2K9G A;  1TUC A;  4OMO A;  1P13 A;  1WXT A;  5DC9 A;  1UFF A;  4RTU A;  2FPD A;  1BKL A;  1LCK A;  1RPY A;  2EYW A;  4H1O A;  2RNA A;  4LE9 A;  2FO0 A;  1AB2 A;  2LNX A;  3UAT A;  4HVW A;  4F17 A;  3H0H A;  1SHB A;  3OVE A;  3EAZ A;  1OOT A;  3IQL A;  1QAD A;  3ZL7 C;  3PSK A;  4FL3 A;  4GWF A;  5I22 A;  2AKK A;  2JM8 A;  4DEY A;  3VGO A;  2GTO A;  1M3A A;  2EGA A;  5GJW B;  2KRM A;  2J05 A;  4K11 A;  4EIH A;  1NYG A;  3M7F A;  4FSS A;  3K2M A;  3BUX B;  2ECZ A;  1YNZ A;  1BLJ A;  1I0C A;  4EIK A;  2JTE A;  2LQW A;  1ZFP E;  1AOJ A;  4RTT A;  1EFN A;  3HIZ B;  1TCE A;  4F5B A;  2KYM A;  5IXF A;  4D8D A;  2EO6 A;  1O4P A;  5EG3 B;  2D8J A;  2CBL A;  2ED0 A;  1WX6 A;  3NPF A;  3PQZ A;  2HCK A;  2FEI A;  1KA7 A;  2LJ3 A;  4E6R A;  3VRQ A;  4GLM A;  2C0I A;  2MOX A;  4JJC A;  2M51 A;  2H46 E;  3VS3 A;  3PS5 A;  1K0X A;  2FPF A;  1O4H A;  2KBT A;  2LCS A;  3EAC A;  1X2Q A;  2KT1 A;  2O9S A;  4F16 A;  2MRK A;  1A0N B;  1SHF A;  2CRH A;  2DX1 A;  2Y1M A;  4U1P A;  2L3S A;  4RTX A;  3U23 A;  1E7O A;  4AG1 C;  1PIC A;  1FU6 A;  2H5K A;  2EO3 A;  4J9D A;  4ROJ A;  2JM9 A;  2MRJ A;  2EGE A;  1CSZ A;  1RUW A;  3VRR A;  1M3B A;  2DM1 A;  1H3H A;  4OHL A;  1O4D A;  4J9B A;  5DC4 A;  1YP5 A;  1X2K A;  5EC7 A;  1O43 A;  1KFZ A;  3A98 A;  2L4K A;  1U06 A;  1GCQ C;  1BBZ A;  2GSB A;  4Z88 A;  3ULR B;  1BFI A;  1YCS B;  1O46 A;  4J9E A;  2EKX A;  3PFV A;  1FMK A;  2YSX A;  2J06 A;  4IIM A;  4GBQ A;  1JXO A;  3VS1 A;  3JV3 A;  3HCK A;  2GTJ A;  2LQN A;  2PNA A;  1CWD L;  2H8H A;  2VKN A;  2LNH B;  4CC3 A;  1D4T A;  2A36 A;  1Z9Z A;  1T3L A;  3KFJ A;  1O42 A;  2LP5 A;  2GNC A;  1KA6 A;  1SPK A;  4K45 A;  2DJQ A;  2GGR A;  3VS6 A;  1UDL A;  2HSP A;  2F2V A;  5EEL A;  1JU5 A;  1UUE A;  1O4I A;  2DBM A;  1A09 A;  3M0R A;  1K4U S;  2GQI A;  1BHH A;  4P9V A;  1JYQ A;  2DL7 A;  2CT3 A;  1GCP A;  2X3X D;  3C0C A;  2J6O A;  3I9Q A;  4RTY A;  1KC2 A;  2RQV A;  1LUM A;  1X0N A;  1SSH A;  2KGT A;  2KRS A;  4AG2 C;  2ETZ A;  2CS0 A;  2LZ6 B;  1X69 A;  1KIK A; 
#chains in the Genus database with same CATH topology
 4WCI A;  5DLO A;  3CEY A;  1RAC B;  1W4S A;  1F2F A;  3PGG A;  7AT1 B;  2MWO A;  5FRM A;  3GBQ A;  3REB B;  2XID A;  2XMF A;  1YJW T;  4KUL A;  4DBH A;  2KI7 A;  5AT1 B;  1VQO A;  3EGU A;  1NLP C;  2Y90 A;  1JRI A;  3J7A F;  1XNI A;  2QGG A;  1BK2 A;  5LJ5 h;  1O4N A;  1R1S A;  2V8K A;  3LWI A;  3DKM A;  4LDU A;  4RUG A;  1WFW A;  2VXF A;  5I6V A;  2EFI A;  4DBR A;  1KD1 U;  1PRM C;  1QP2 A;  2RVF A;  5LJ3 j;  3QYG B;  2DLP A;  3URG A;  3Q1J A;  3CQT A;  3EGD B;  4E47 A;  2DXC A;  1SHA A;  3PE0 A;  2PVO B;  4JZ3 A;  2BZY A;  2DNU A;  4C8Q D;  3GLX A;  3SHW A;  4KT0 E;  1RJA A;  1UG1 A;  3I5S A;  3NMZ C;  4C92 A;  4XK8 E;  4NWF A;  4QKU A;  4ELY C;  5GAN 7;  1RQQ C;  2ESW A;  3CCS A;  2EKH A;  4PJO C;  1VQN A;  2KE9 A;  3OQ5 A;  4AMC A;  2NUT A;  4OMM A;  5CAI A;  3CXC A;  4QQ6 A;  3FLG A;  2V1R A;  3BY7 A;  1BCO A;  3N8M A;  4FIB A;  1WZO A;  1M27 C;  4FU6 A;  2YUN A;  4WWQ A;  4EDU A;  3E9F A;  2IZV A;  2H3E B;  4E7S A;  1G5V A;  2F2W A;  1QP3 A;  2BTT A;  1MMA A;  4IKF A;  1G83 A;  4J9C A;  2XG8 D;  3QO3 A;  3VYH B;  1K9M C;  1O49 A;  2F69 A;  2L3R A;  2HL5 C;  3G4S Q;  3MAZ A;  3EG0 A;  2GE9 A;  4Z02 A;  4V2S A;  3M58 A;  1O4Q A;  2KDS A;  5GAO n;  3RMS A;  2EGC A;  2IG0 A;  2AK5 A;  1YI2 Q;  3CXC P;  1R77 A;  2P84 A;  1WQW A;  5I2S A;  1TUG B;  3PIO A;  1VQ7 A;  3RMQ A;  2VAS A;  4AFZ C;  1S72 Q;  3AHU A;  3V7C A;  1Q7Y U;  4F04 B;  4N0A C;  4OP0 A;  1HCT B;  4JRI A;  2HMA A;  1OYX A;  3V8L A;  3GF5 A;  3QZ5 B;  3O8V A;  1CSK A;  1N5Z A;  1ZSG A;  1WIE A;  2KQW A;  5CR2 A;  2ENM A;  1O4E A;  5DM7 R;  1J3T A;  4RTW A;  2BZX A;  2KT8 A;  4RG8 A;  1MV3 A;  1MIL A;  5KYN A;  1BLK A;  3QZ9 B;  1IO6 A;  3KUF A;  5J3B A;  4M77 F;  5CK9 A;  3L2R A;  2LRQ A;  1H8K A;  5GAM f;  1HSQ A;  2COW A;  4QSY A;  3FC3 A;  5GAN 4;  1N8R R;  3JSC A;  2OAW A;  2CUD A;  3AT1 B;  2DL4 A;  1SHG A;  2PLE A;  4N4G A;  1D3B A;  2ZPG B;  1B7T A;  1O9S A;  3VKI A;  4ATO A;  1O4A A;  4O6J A;  2FZC B;  3UF4 A;  3OYJ A;  4JS5 A;  1FBZ A;  2Y4X A;  1MMD A;  2LC4 A;  1A81 A;  4M77 B;  2IUG A;  4C92 C;  3L2Q A;  4BE2 A;  1K8A C;  1PHT A;  2Y4Y A;  4DOW A;  4X9C A;  4X34 A;  3I55 Q;  4M7D A;  1VQM Q;  3PVQ A;  1FXX A;  3MP6 A;  4RTV A;  1RAG B;  2DMO A;  3CC7 T;  1UHF A;  2B86 A;  2B3O A;  3M56 A;  4P5N A;  2BBU A;  3CC4 A;  3I5R A;  4RG2 A;  1B34 A;  1D0Z A;  3L2U A;  2LJ0 A;  3M5A A;  1NG2 A;  2EBP A;  3CPW A;  1NZ9 A;  4KGX B;  2VB6 A;  3BDU A;  3CC7 A;  1VQ8 T;  5M9O A;  1YWO A;  3CBO A;  3PSJ A;  4MDW A;  5DY9 A;  3H8Z A;  2DZ9 A;  1D09 B;  1PKT A;  2LT1 A;  3WVD B;  1B3Q A;  4HCK A;  1IZ6 A;  3MJX A;  1I81 A;  2BE7 D;  2HQX A;  1VQ6 T;  4XQ3 A;  4PLI A;  1R0B G;  3OYI A;  2P4T A;  2RMO A;  2LNV A;  2YT6 A;  3TVT A;  5D0J A;  1NJI C;  3LGL A;  2DTO A;  2YU7 A;  2RSY A;  4E68 A;  2EU0 A;  3BFM A;  3L42 A;  3F70 A;  2DVE A;  3VRO A;  4PJL A;  2HUW A;  2Z0W A;  2C9W A;  3V7S A;  4M7D D;  3C4S A;  1BFJ A;  1E6G A;  1M61 A;  5GJI A;  1NE8 A;  1KC8 R;  3X24 B;  2NUT B;  3QWX X;  5KYX A;  1HD3 A;  3PJP A;  1LUN A;  2RJD A;  2X3W D;  2KGY A;  2O4X B;  2L5Q A;  1BI2 A;  2DRM A;  4JUV A;  4AFU C;  4LN2 A;  1FX7 A;  4DGX A;  1WQ7 A;  2JOY A;  4FBN A;  3GQI B;  4OB2 B;  1VQ8 A;  3FIF A;  5KAZ A;  1JYR A;  1O4R A;  5KE2 A;  4XU3 A;  4PFO A;  1YJ9 Q;  2KNB B;  2EQM A;  5FWB A;  5CQY A;  5EHP A;  3TU4 K;  2C06 A;  4M7A F;  2JMA A;  4K44 A;  4OVA A;  4LD6 A;  5DLQ E;  2RB6 A;  2CH4 W;  4M78 E;  2AOA A;  3PVL A;  2IUI A;  2DPP B;  1ZBJ A;  2K2M A;  5A0D A;  1KQS A;  3CC2 A;  3LW5 E;  2YRC A;  1ZQ1 A;  2DXT A;  1IHV A;  4IUQ A;  1WNL A;  4N4I A;  3JCM b;  1U3O A;  1X01 A;  3VRZ A;  2JZ2 A;  2FYK A;  1G2B A;  1M90 U;  2EQI A;  1VQ5 A;  1YJ9 T;  1X27 A;  1K73 U;  1VQL T;  4R55 A;  5J26 A;  4OMO A;  1IGQ A;  5DC9 A;  1RPY A;  2EYW A;  5CKE A;  2FO0 A;  1QVF P;  3H0H A;  2OX7 A;  3PSK A;  4C92 D;  1SKU B;  5GAM j;  2RJC A;  3CCM T;  3FB9 A;  4FM4 B;  4LDV A;  3VGO A;  4Y28 E;  3G4S T;  2D0Q B;  5LJ3 h;  2KAF A;  3EGX A;  1YNZ A;  4EIK A;  2E6N A;  2LQW A;  1ZFP E;  4RTT A;  1BI3 A;  3J80 E;  2CS7 A;  3MP1 A;  4D8D A;  2XDP A;  4E7Z A;  4XTU A;  5EG3 B;  3NPF A;  2HNI A;  3M9Q A;  2LDM A;  3PQZ A;  5LJ3 g;  1FMW A;  2LJ3 A;  4E6R A;  1WHG A;  3VRQ A;  5GAO r;  4IUU A;  1C6V X;  1WHJ A;  4GLM A;  3MEW A;  2H46 E;  1TSF A;  2FPF A;  4J83 A;  1X2Q A;  2CZ7 B;  4L5G A;  4JJN K;  4MML A;  4F16 A;  4EMK C;  1A0N B;  2R57 A;  2DX1 A;  4XU0 A;  2L3S A;  2AT1 B;  3GNF B;  3QXE B;  1E7O A;  4AG1 C;  4EMK B;  2K5I A;  1B34 B;  2BIV A;  1RUW A;  1CSZ A;  2DM1 A;  3HSB A;  4VUB A;  1YJN Q;  3BE3 A;  5DC4 A;  1X2K A;  5EC7 A;  1KFZ A;  4JLG A;  1VQL A;  2GSB A;  3CCV T;  2DD5 A;  3PFV A;  1JXO A;  4AT1 B;  2GTJ A;  2LQN A;  4HCB A;  2PNA A;  1CWD L;  1FMV A;  2VKN A;  3CC2 Q;  2A36 A;  2LCL A;  1D1A A;  2LP5 A;  1SPK A;  2QG9 B;  1G3Y A;  1UDL A;  2F2V A;  4JLI A;  3OYL A;  1Y96 B;  4P9V A;  2DL7 A;  3L2Z A;  2X3X D;  3C0C A;  3LGF A;  3X25 B;  2CP7 A;  3JCM e;  4C0G A;  1WJS A;  1MGQ A;  2EJF A;  4M4Z A;  4J9H A;  4YTL A;  1AYB A;  1PRL C;  1WI7 A;  1D1C A;  5HKZ A;  3I55 T;  2DZC A;  4JGH A;  1VQN Q;  1O4M A;  2E3I A;  3E1S A;  1A1C A;  3OS5 A;  3QJ6 A;  3VRN A;  4E7H A;  5CDW A;  1M1K U;  1FYR A;  4BE0 A;  3EG3 A;  2DEU A;  4A4E A;  2FG0 A;  3T9N A;  4J9I A;  3HPW A;  1VQL Q;  4F7U F;  1O4B A;  4J8O A;  3V8J A;  1U5S A;  3A8G B;  4M77 G;  2QAZ A;  1Q82 R;  4MMK A;  4FL6 A;  3MEA A;  4F14 A;  1RI9 A;  3JCM g;  3OS1 A;  2DET A;  2D8H A;  1WLP B;  1OU8 A;  2DCR A;  1V29 B;  2K3X A;  1O4K A;  1Q86 R;  1W2B S;  1BIB A;  2L0A A;  3A5Z B;  5KYY A;  4XU1 A;  4OMN A;  1BMB A;  4DQ2 A;  1V1C A;  2SHP A;  1YI2 A;  1P92 A;  1BB9 A;  1ZUK A;  2X35 A;  3JCM V;  3M0P A;  2CSQ A;  5LJ5 g;  2GQV A;  1R8O B;  1M8V A;  4PJO A;  1YHQ Q;  4L1B B;  1UGV A;  2DL8 A;  5GAM g;  3L2W A;  1WGS A;  1I4K 1;  4NS5 A;  2Y1N A;  3GP8 A;  3A8H B;  4M77 D;  1YI2 T;  4FYY B;  3CCL Q;  1ZA2 B;  4M75 B;  2ZCF B;  2CP3 A;  2NYS A;  3UPU A;  2GF7 A;  3G4S A;  1BG1 A;  1H92 A;  3S8L A;  3QJY A;  3CCJ A;  4N4H A;  5D6Y A;  1ZBX A;  5D6W A;  3MCA B;  5C0M A;  2QI2 A;  3PNW C;  1Q82 U;  1GHU A;  3RR6 A;  2CUB A;  1VQ9 A;  3C94 A;  2E65 A;  4C5G A;  4OHE A;  4M7A G;  2HEQ A;  3TQ7 P;  5HK3 A;  2ABL A;  3KBG A;  2G6F X;  3CCJ Q;  4JJB A;  2QEX A;  2OTJ T;  1W1F A;  1PKS A;  1LKL A;  4KH1 B;  3CCR Q;  4C92 B;  2JMC A;  2GCX A;  2HAX A;  9ATC B;  3OW2 S;  2LQ8 A;  2DLZ A;  1RAI B;  2R58 A;  2V26 A;  2AZS A;  2DE0 X;  3C7I A;  2EWN A;  1ABO A;  3M0U A;  2CT4 A;  3EH2 A;  2O9V A;  1XOV A;  4D8K A;  5LJ5 d;  2DFU A;  2XHC A;  3NFC A;  2EQJ A;  1NZL A;  5L23 A;  4XTV A;  2K79 A;  2CP6 A;  4HT9 A;  1PCX A;  3M53 A;  4OB1 B;  2PTK A;  3NTH A;  2KYB A;  1JJ2 S;  1EZZ B;  3LWH A;  3PMT A;  5GAN g;  4J9G A;  2EL8 A;  1G3T A;  4BI8 B;  1LKK A;  2KXD A;  1YCY A;  1JO8 A;  1N27 A;  4RCC A;  4XTW A;  2KR3 A;  1Q95 G;  1H9O A;  2PNB A;  1M1K C;  2QDY B;  3OV1 A;  5CIU A;  2CZ6 B;  5J39 A;  1R1Q A;  3QWY A;  3UYO A;  1VQN T;  4KRT A;  3CD6 T;  3CD3 A;  4R0K A;  5GAN f;  3CME A;  4XZ0 A;  4OHI A;  2L2P A;  5GAM e;  1ZHI A;  5HY6 A;  1AYA A;  1WHL A;  3SDZ A;  1O4O A;  1WJQ A;  1I5L A;  5GAN d;  1IXD A;  2CH4 A;  1KQS S;  1H3Z A;  3WXM B;  4E7K A;  5GMK e;  5EEQ A;  3MPU B;  1M8M A;  2RI3 A;  3HRS A;  1I07 A;  3M57 A;  2HMH A;  4ZN3 A;  1NYF A;  3BUM B;  2JW4 A;  2KRO A;  2CI9 A;  4KUI A;  1LUI A;  1BI1 A;  1MND A;  3UA7 A;  2R5A A;  3JAM E;  2DBK A;  1BYM A;  1LNX A;  1KD1 R;  3CCU T;  2RF0 A;  2YDL A;  4DGP A;  1F1B B;  3EHR A;  2V1Q A;  4FSX A;  1YWP A;  3FJP A;  3JB9 F;  3MP8 A;  3OYY A;  2QQR A;  2JXB A;  1GCQ A;  1V76 A;  5AYF A;  2D6F A;  4E2F B;  4PK4 A;  1N9S A;  4M78 D;  2L89 A;  3M59 A;  3CWG A;  1T0J A;  3IMJ A;  4L59 A;  3QSU A;  2QDL A;  4OB0 B;  1Y07 A;  2BUD A;  1RLP C;  1KG1 A;  4P9Z A;  1VQ7 Q;  4JPB W;  3TEE A;  2CRE A;  4ZTF A;  3BKB A;  1M2V B;  2JTF A;  4BD3 A;  1C0M A;  2JYQ A;  4M7D B;  5CKF A;  4OHD A;  1NZV A;  1IRX A;  1X6B A;  2DYB A;  4M7A C;  4J9F A;  2EYV A;  2ZPE B;  4HT8 A;  2Y3A B;  5IHK A;  2LCT A;  4OGE A;  1FWZ A;  4C8Q B;  2AUG A;  1KHI A;  5CVI A;  1NJI R;  4IUT A;  2B8A A;  5GJV B;  1X6O A;  2RI5 A;  1VQP T;  1ZLM A;  3INZ A;  2RMX A;  3S8N A;  3G71 A;  3E9G A;  5LJ3 f;  3JB9 I;  3GXW A;  3HRU A;  3NHN A;  1O4J A;  4M7D F;  1A1B A;  3UT1 A;  2MMP A;  1AYC A;  2X4W A;  2QXF A;  4HKE A;  2RQT A;  1VQ5 Q;  5LJ3 d;  3EG1 A;  2QQ9 A;  1QKW A;  3I35 A;  4FYW B;  3DLM A;  2ZPI B;  1D1B A;  4OMQ A;  4M75 A;  2HDV A;  3X28 B;  2ZPH B;  3OB9 A;  1TUD A;  2OAU A;  2DJZ A;  1A07 A;  4L6V 5;  2OTL Q;  5FRO A;  1Y1U A;  1WXU A;  1AVZ C;  5A0L A;  4LDX A;  2VGN A;  2K2V A;  4A63 B;  1QKX A;  4CC2 A;  3E2U A;  1D1Z A;  4M7D C;  3OP0 A;  2HL3 A;  1YFN A;  1PNJ A;  4JJD A;  4JS4 A;  2OJ2 A;  4IUR A;  1QWF A;  2RD1 A;  2RQU A;  5KYX B;  1SHD A;  2HKQ B;  4J6Y A;  3CD6 A;  2JVV A;  1PWT A;  1JYU A;  3CCE Q;  2J6K A;  4NL3 A;  1UGP B;  4C5H A;  4B6M A;  3OYG A;  5FU7 B;  1BI0 A;  2RHU A;  2OTJ Q;  3M4Y A;  3CCM A;  1D4W A;  1IRE B;  4K2R A;  2O88 A;  4NOY A;  3I56 A;  3CCS T;  4TVR A;  2VVK A;  4RMO A;  1K9M U;  3P8B B;  1X6C A;  5J3X A;  1D3B B;  2YRV A;  2XD0 A;  2HDA A;  1A1E A;  1JXM A;  2LTO A;  3H0F A;  5GAO m;  1UGQ B;  3UWN A;  4C0Z A;  1VUB A;  4RCB A;  4FW2 A;  4C0D C;  4PJO D;  4HA8 A;  2E41 A;  1SHB A;  3OVE A;  3EAZ A;  1OOT A;  2O01 E;  2QK0 A;  1QCN A;  4GWF A;  2CP0 A;  3CCL T;  2JM8 A;  4DEY A;  5GAN 8;  2EGA A;  4PNO A;  5GJW B;  1U8R A;  2KRM A;  3CC2 T;  4EIH A;  3M7F A;  3K2M A;  3BUX B;  1BLJ A;  1ZSZ C;  4EPC A;  2EIF A;  1YIJ T;  5IXF A;  2ED0 A;  1WX6 A;  3K2T A;  5FU6 B;  3RIR A;  2K5L A;  1OZ3 A;  1KA7 A;  5LJ5 e;  1NBE B;  3X26 B;  4QQG A;  3CXC S;  5FU7 C;  2DK3 A;  2MOX A;  2QTV A;  2M51 A;  3PS5 A;  1K0X A;  3EAC A;  2KT1 A;  3I56 T;  5KE3 A;  3RDV A;  4XAX B;  2LX9 A;  1TXQ A;  4GLK A;  4RTX A;  3U23 A;  4J9D A;  2JM9 A;  5CKB A;  3SFM A;  1YP5 A;  1O43 A;  1VQ6 A;  1M1G A;  4J6X A;  4M78 F;  3ULR B;  1BFI A;  1YCS B;  3HTR A;  3OS2 A;  4M75 E;  3EGX B;  3QYH B;  3L1A A;  2EKX A;  2YSX A;  3JB9 D;  2WSC E;  2GFU A;  4GBQ A;  5GAN j;  2VV5 A;  1JJ2 A;  4PFZ A;  4FCY A;  3CPW P;  1T3L A;  3CC7 Q;  4QW2 A;  5KYU B;  2E6Z A;  4BI3 A;  5EEL A;  3M54 A;  1K4U S;  2GQI A;  3ASK A;  1MMG A;  2CT3 A;  3RER A;  1GCP A;  4DOV A;  5HKC A;  4RTY A;  2DYI A;  1KC2 A;  4PJN A;  3QII A;  2WAC A;  2KGT A;  4AG2 C;  3JB9 G;  2O4X A;  1KIK A;  3HRT A;  1AWO A;  2X4Y A;  3C12 A;  2QQA A;  2AHJ B;  3S3O A;  2XP1 A;  1D0X A;  2FL7 A;  2CI8 A;  3CBL A;  2X4X A;  1UGS B;  4CC7 A;  1BKB A;  1TTH B;  3M0S A;  4QVZ A;  2XI9 A;  5GAM h;  2P0K A;  1B07 A;  3EG9 B;  3HL8 A;  1KC8 C;  2CR4 A;  2K3Y A;  1LUK A;  1WDX A;  3SWN B;  1M1K R;  5GAO p;  4J5Y A;  1NJI U;  2RHY A;  1KJW A;  1ZSZ B;  2CGH A;  2QAS A;  1F1W A;  4J7I A;  3RKY A;  2BE9 B;  2DXU A;  1W70 A;  2YSQ A;  1Y96 A;  4IUV A;  4RTZ A;  1AWJ A;  1LVK A;  4PJJ A;  3ZNI A;  2CKK A;  3CPW S;  4C8Q G;  1SPS A;  1RAH B;  1O47 A;  1HJD A;  4C8Q F;  2RK2 A;  3OYK A;  1CJ1 A;  1VQO Q;  5GMK h;  2MWP A;  2FZG B;  2DL3 A;  4WTO B;  2CIA A;  2E5K A;  3LYI A;  2RHZ A;  3CPF A;  2EOB A;  1YIT A;  5EHR A;  4ZNX A;  4OMP A;  3RUX A;  3FEO A;  3JRZ A;  4DBQ A;  5LJ5 j;  2HZY A;  1YJ9 A;  3EH1 A;  3N84 A;  2KY9 A;  4M75 C;  3CCM Q;  4DA4 A;  1VQ4 A;  3R6O A;  5LJ5 f;  1I8F A;  5DF6 A;  4OF1 A;  4NWG A;  2VGM A;  2ECD A;  3CCS Q;  3KXT A;  2FPE A;  2MK5 A;  2BZ8 A;  3CCE T;  5I11 A;  5ECA A;  1JB0 E;  1VYV A;  3EHQ A;  3WVE B;  2RI2 A;  1CKB A;  8ATC B;  2AIR B;  4C5I A;  1VQ4 T;  1RI0 A;  1O4L A;  2HD0 A;  4BDZ A;  1UTI A;  1OZ2 A;  4Z8A A;  1I3Z A;  1FYN A;  1T3S A;  4LDW A;  3R6N A;  1YVL A;  2RO0 A;  3OYE A;  4PJO B;  4A4H A;  3CMA A;  1UEC A;  2HQH A;  2H3J A;  2NUP A;  4M77 C;  1RAE B;  3VS0 A;  4Y92 A;  1YBY A;  3SD4 A;  1BHH B;  1FHS A;  1K0S A;  1MV0 B;  1QW1 A;  3EFO B;  4KGZ B;  2X9H A;  3BUW B;  2E1H A;  3N7Y A;  1ZUY A;  3QPH A;  1QVG S;  2FCI A;  1K73 C;  2PUK B;  1PG5 B;  1WPY A;  1M27 A;  2G3R A;  1CKA A;  3OA6 A;  3BUN B;  2IPO B;  5C6S A;  3OB1 B;  1PD1 A;  4MZM A;  1WQU A;  1OQK A;  2FZK B;  2EW3 A;  3LYV A;  2QMS A;  1Y0M A;  4C92 F;  1AYD A;  2LMJ A;  1I5O B;  3VS4 A;  1RLQ C;  3VUB A;  1HCS B;  1E6H A;  4ESR A;  2V8I A;  2QA4 A;  1KC8 U;  3KFV A;  2YUO A;  1QVP A;  5HKW A;  3OYC A;  2IVW A;  2FRW A;  2DVJ A;  2E3H A;  3TKZ A;  2MIO A;  1O4F A;  4ELZ C;  1M3C A;  5CO7 A;  2M1H A;  1BM2 A;  2RN8 A;  2MYS A;  1QLY A;  2EJ9 A;  2DA9 A;  1WJR A;  2I2L A;  4LXC A;  3CMA Q;  4ZTJ A;  2ROR A;  2QA4 Q;  4PFP A;  1ARK A;  3ER0 A;  4TZI A;  4ZGE B;  1B47 A;  1AD5 A;  3BW1 A;  3IN8 A;  2K79 B;  1I1J A;  1VQ9 T;  1VQK A;  2MK2 A;  4A4K A;  2E4H A;  3CME Q;  1FU5 A;  1A1A A;  2J7I A;  1VOM A;  3M0Q A;  3OYD A;  1O4G A;  1YN8 A;  3CXL A;  2VIF A;  5HKY A;  3QBY A;  4XTX A;  1OX8 A;  1RAB B;  2YUQ A;  2LVM A;  2DLY A;  4M78 G;  3TSZ A;  2LNW A;  4CRI A;  2D1X A;  1M2O A;  3S8O A;  4LDY A;  3MXY A;  1YVH A;  4LNP A;  3CCQ T;  1UJY A;  2K57 A;  5KYY B;  2AZV A;  3QKJ A;  2GFA A;  3UA6 A;  3NTK A;  1YIT T;  2RK1 A;  3CCU Q;  2YHT A;  1Y57 A;  3JB9 H;  1X75 C;  4BAC A;  1VIE A;  5L8R E;  2DEQ A;  2VC8 A;  3CCV A;  1VYU A;  2M0Y A;  1SG5 A;  2YLC A;  4JRP A;  1O75 A;  4UC4 A;  2K5F A;  3SWN A;  4XTY A;  1OUL A;  1UUR A;  3CCU A;  2DKG A;  4BUG A;  1IS0 A;  5GMK i;  2ZAE A;  1VQM T;  1NRV A;  5IH2 A;  3VU3 C;  4OB3 B;  4M7A E;  4LD9 K;  2YXY A;  4U17 A;  1NEB A;  2ED1 A;  3NTI A;  4NL2 A;  4ORZ A;  3VS2 A;  1QVF A;  4BY6 B;  5IXB A;  1KHC A;  3H41 A;  3EFS A;  2DX0 A;  1ZX6 A;  5EG2 A;  3JCM P;  2LJ1 A;  3EFR A;  1X6G A;  3TSW A;  3MHX A;  3HHT B;  2QTX A;  4M7D E;  2SRC A;  4XZ1 A;  1N6A A;  3WA4 A;  1JBM A;  2KMT A;  2M9U A;  1N9R A;  2K7A A;  2ZPB B;  2EYY A;  3VRY A;  1CSY A;  3OSV A;  2SEM A;  3OYH A;  2FVU A;  1KQ2 A;  1NPR A;  5IAY A;  2O31 A;  2AOB A;  3HHM B;  1GRI A;  1M2V A;  2DM0 A;  3RNJ A;  2HBP A;  4C0D B;  3OYN A;  1YJN T;  4F5A A;  1YJW A;  2HDX A;  3OMC A;  2DRK A;  1AWW A;  4PL6 A;  1NEG A;  3ZBD A;  1O48 A;  2COY A;  3CCJ T;  1LCJ A;  1SRM A;  1BKM A;  3MKD A;  2EPD A;  1R1P A;  4EMH A;  1TU0 B;  1PD0 A;  1MHN A;  2DIL A;  1VYT A;  4M7A B;  5A0G A;  4GPL B;  1VQ9 Q;  1O45 A;  2I0N A;  2EVR A;  3IMD A;  3N5B B;  1VQM A;  4BB7 A;  1TWB A;  2EYQ A;  3S3M A;  1LJO A;  2ZPF B;  2PQW A;  3CCR A;  1Q82 C;  3M0T A;  3G6E T;  2CSI A;  2V8J A;  1UB4 A;  1W2B P;  2PLD A;  3CCL A;  2D0N A;  2FRY A;  2ZZD A;  4M75 G;  3CCE A;  5FLX E;  1T0H A;  2XDB A;  1OV3 A;  1X43 A;  2RHI A;  5GAN e;  4DBF A;  1KSW A;  4HVV A;  4LUD A;  1NM7 A;  2JNG A;  2L3Q A;  4E7I A;  1Q7Y C;  2JS0 A;  3X20 B;  4PJM A;  1WXT A;  1LCK A;  2NLU A;  4CI0 C;  1K8A R;  5IN1 A;  2L8D A;  3HFN A;  4OGC A;  4LE9 A;  1RL2 A;  1QMC A;  3TCJ A;  2LQK A;  3UAT A;  4FYV B;  1EX4 A;  2PVG B;  3ZL7 C;  3FDR A;  2A3L A;  2EKO A;  1Q7Y R;  1PSE A;  1VQ7 T;  2XKO C;  3HP9 A;  5KCH A;  3J81 E;  2J05 A;  4D6W A;  4FSS A;  2ECZ A;  1I0C A;  1G3W A;  1AOJ A;  3RKX A;  4F5B A;  2K4Y A;  2KYM A;  3OMG A;  2EO6 A;  1O4P A;  2CBL A;  4PJO G;  1Y71 A;  3H6Z A;  2HCK A;  4M7A A;  2P0Q A;  4M7D G;  5FU6 C;  3V8K A;  2C0I A;  2KVQ G;  1O4H A;  2KBT A;  4C92 E;  2LCS A;  1MNE A;  3OW2 P;  2MRK A;  1SHF A;  1K8A U;  2CRH A;  4BI4 A;  4F7U A;  1FU6 A;  2MRJ A;  1QVG P;  2EGE A;  5GAN 3;  1M3B A;  3PMI A;  8AT1 B;  4F7U E;  3QDF A;  4EMK A;  4J9B A;  2PVD B;  1U06 A;  1GCQ C;  3ZEH A;  3OYB A;  5IT9 E;  1O46 A;  3JCM J;  4J9E A;  3MEV A;  2E5Q A;  1R0C B;  4M78 A;  2XU8 A;  1VQO T;  3QHS A;  4IIM A;  3HCK A;  3JV3 A;  1W2B A;  2M02 A;  1KK7 A;  2H8H A;  2LNH B;  3PIP A;  4O5V A;  3KFJ A;  2M16 A;  3D7S B;  1XQH A;  1KA6 A;  4K45 A;  2GGR A;  3CCV Q;  5HK0 A;  4HCC A;  2RJF A;  2QGF B;  4N0A A;  5CKH A;  4ZN1 A;  5GAN 5;  2LRA A;  2DAQ A;  1YIT Q;  1HYO A;  3LX7 A;  2ZGW A;  3P8H A;  1LOJ A;  1LUM A;  1VIF A;  2ETZ A;  2CS0 A;  2LZ6 B;  2EJG A;  3FRN A;  1PSF A;  1AOU F;  5FW9 A;  1W6X A;  5CQX A;  1K1Z A;  4M77 E;  4MZP A;  2PU9 B;  1GBR A;  2JTM A;  4II1 A;  1U1T A;  5AUL A;  2LX7 A;  3CMA T;  2E10 A;  4GL9 E;  1IGU A;  1HXD A;  4PKC C;  2RQW A;  2MCN A;  3HFO A;  3OYF A;  1AT1 B;  2MF2 A;  1VQP A;  1MMN A;  4OHH A;  2XIC A;  1AWX A;  1VQK Q;  3CCR T;  5KYU A;  3JCM Q;  3IN7 A;  4X6S A;  5I2M A;  3US4 A;  3G7Z A;  5FWC A;  5GAM d;  2KK4 A;  1WA7 A;  3P8D A;  2AKL A;  4FL2 A;  1GBQ A;  2NUZ A;  5BO4 A;  2KRN A;  3OW2 A;  4XU2 A;  2ROL A;  1CWE A;  3VJP A;  2YRD A;  1M90 R;  5LL6 S;  2EQK A;  4J6W A;  2DTI A;  4PJO E;  2OZO A;  2X51 A;  3JCM f;  1IJR A;  1SSF A;  3MO8 A;  3OSS C;  2MQI A;  2L6K A;  3OS0 A;  3A1P A;  2PNI A;  1RAF B;  1RAD B;  1M4Z A;  4X1V A;  3S3N A;  1Q81 C;  1ZSZ A;  2E64 A;  3QUI A;  1UUS A;  2C0T A;  3JCM d;  6AT1 B;  2JS2 A;  3EG9 A;  1AZG B;  5GJH A;  3CC4 T;  3G71 T;  3UDC A;  1O4C A;  4OMF B;  2E12 A;  5GMK m;  5GAO q;  2OQ1 A;  2RH2 A;  1BF5 A;  2DIG A;  5KCO A;  4CC4 B;  5GAN 2;  1Q81 R;  3H0I A;  1BU1 A;  2LCC A;  1M5Q 1;  3QG1 A;  2L3T A;  4Y91 A;  3SWN C;  2OTJ A;  1SEM A;  3JCM h;  1GFD A;  1S72 A;  1AOT F;  3CCQ A;  2DIQ A;  3I56 Q;  4FT2 A;  5FRN A;  3S6W A;  3VS5 A;  1SF9 A;  4HVU A;  1M90 C;  5LJ3 e;  4FW1 A;  4E93 A;  1D0Y A;  3MXC A;  1UHC A;  3GXX A;  4M75 D;  1WHH A;  2PZ1 A;  3JCM X;  1A08 A;  3BDL A;  1QVF S;  1JU5 C;  4M7A D;  2CDT A;  2JN0 A;  1TS9 A;  1YIJ Q;  1EIF A;  2YWW A;  2KNO A;  4LUE A;  2MAM A;  2IIM A;  2A28 A;  4C8Q A;  5GMK j;  2QYZ A;  2HKN A;  2QEX T;  1VA7 A;  1BIA A;  2K6D A;  3FJ5 A;  3TRE A;  4JE4 A;  3ME9 A;  5IBM A;  4QQD A;  4PJO F;  2KK6 A;  4PLL A;  2HQE A;  2VXE A;  4QVC A;  2RJE A;  3HKS A;  5CCA A;  4M77 A;  1JQQ A;  1Q86 U;  1K9A A;  5AXI A;  1VQK T;  1O44 A;  3VS7 A;  3GIB A;  1AEY A;  1G8X A;  4H34 A;  3OB2 B;  4Q5W A;  3CCQ Q;  1JWO A;  3SEM A;  3EG2 A;  1M30 A;  3I55 A;  1UEB A;  1NLO C;  1K9M R;  1IB8 A;  1UE9 A;  1ACM B;  4F7U B;  1Z3K A;  1MW4 A;  2MPX C;  4A4F A;  4HCZ A;  1OO4 A;  1SRL A;  1LPL A;  2VWF A;  2NWM A;  4M78 B;  2L3P A;  1BCM A;  2WSE E;  3T04 A;  2HSE B;  4M78 C;  1GL5 A;  4KBM B;  3VV0 A;  4F59 A;  2F1L A;  2IUH A;  3REA B;  3CME T;  1K76 A;  3VUZ A;  2P0P A;  1ZUU A;  3LH5 A;  2ROT A;  5IHN A;  4A53 A;  4C8Q C;  1SPR A;  1UJ0 A;  2QA4 T;  1ZA1 B;  2F5T X;  3A8O B;  1QVG A;  3CC4 Q;  1YJN A;  2QQB A;  4B9X A;  3C95 A;  1Q81 U;  3E19 A;  1JEG A;  1GXI E;  2KXC A;  3MET A;  3TL0 A;  4ME7 A;  4BDY A;  3CBP A;  2CP2 A;  5GAN h;  2R5M A;  4M75 F;  1QWE A;  3A8M B;  2A0F B;  2BKD N;  4KUD K;  1TZE E;  1QCF A;  2DF6 A;  1XA6 A;  4DEX A;  2CZ1 B;  4JRK A;  1VQ5 T;  2VYT A;  3JCM c;  3RES A;  3OBW A;  5D6X A;  2EAY A;  2A08 A;  2EQU A;  2DXB A;  3GOX A;  2X4J A;  1WXB A;  2EYZ A;  1UGR B;  1OPK A;  2FB7 A;  3A8L B;  2OI3 A;  2DTH A;  4ZGJ B;  1SKJ A;  2P4R A;  1QQJ A;  1M1F A;  2A7Y A;  2HBW A;  4ANJ A;  4OML A;  4MDX A;  2JT4 A;  3S9K A;  1TG0 A;  2C0O A;  2E70 A;  4IUP A;  1KQS P;  1BHF A;  2O2O A;  2RPN A;  2RM4 A;  1FBV A;  3OBY A;  3PT9 A;  2MC1 A;  2FHD A;  1WYX A;  1Z9Q A;  2CP5 A;  5CKD A;  4QVD A;  3JB9 J;  1N8R C;  3CBM A;  4BY6 C;  2A37 A;  2RHX A;  4GY5 A;  1PC0 A;  3O5Z A;  2YUP A;  4FT4 A;  4BE1 A;  5DC0 B;  1O41 A;  2PUO B;  2COZ A;  1OEB A;  5IHI A;  2VUB A;  1AZE A;  3G71 Q;  3JCM W;  1S1N A;  3L2V A;  1VQ4 Q;  2K3B A;  2DL5 A;  4Z89 A;  2W0Z A;  1QCO A;  4E7L A;  1ABQ A;  1Q86 C;  1S72 T;  4A4C A;  2NUP B;  4C0F A;  1OO3 A;  1GFC A;  4E7J A;  3DLL A;  5GAO l;  5GAN 6;  2J6F A;  4EMG A;  4MZT A;  3MEU A;  4A4B A;  1TH7 A;  2DD4 A;  2RA2 A;  3LH0 A;  3THK A;  1MUZ A;  5IBS A;  5KYW A;  1KQ1 A;  4C8Q E;  2KSS A;  3CD6 Q;  1YHQ A;  4C5E A;  3EGD A;  1OPL A;  3DB3 A;  2QEX Q;  1WHK A;  2F2X A;  4RKU E;  4KH0 B;  4A4G A;  3BUO B;  2XDD A;  1YIJ A;  1G3S A;  2XK0 A;  4IIO A;  1QG1 E;  3RBB B;  2K7A B;  5HCK A;  3M55 A;  1IHW A;  4JEG A;  3OY9 A;  2W10 A;  1AHJ B;  2QQS A;  1TOV A;  2RQR A;  2KEA A;  1JJ2 P;  2LT4 A;  4JZ4 A;  4HXJ A;  2ATC B;  2GBQ A;  4EY0 A;  3M4G A;  4QT7 A;  3PFS A;  2DO3 A;  3PLF B;  1VQ6 Q;  1C1A A;  2EYX A;  1K73 R;  5GMK l;  4AFS C;  4AFQ C;  3LLR A;  1WHM A;  3VRP A;  3NGP A;  2K9G A;  1TUC A;  4JRQ A;  1P13 A;  1NPP A;  1UFF A;  4RTU A;  2FPD A;  1BKL A;  2OTL T;  4H1O A;  2RNA A;  3QDR B;  3RKW A;  1AB2 A;  4R56 A;  2LNX A;  3VYG A;  1RAA B;  1VQ8 Q;  4HVW A;  4F17 A;  3GPL A;  2DER A;  4X9D A;  4B9W A;  4FL3 A;  3IQL A;  1QAD A;  5I22 A;  2AKK A;  4F7U G;  4FYX B;  3OYA A;  1KD1 C;  2GTO A;  1M3A A;  4ZGD B;  3ZFJ A;  1XJW B;  4K11 A;  1NYG A;  3OYM A;  3G6E A;  2JTE A;  4C92 G;  3EAE A;  2MI6 A;  1EFN A;  5A2Q E;  3PTA A;  1TCE A;  3HIZ B;  5KYW B;  2D8J A;  2CYZ B;  2FEI A;  1OX9 A;  1OI1 A;  3SB2 A;  3V7R A;  3DB4 A;  1DJ7 B;  1N8R U;  4JJC A;  3VS3 A;  3G6E Q;  4KGV B;  2O9S A;  5KH6 A;  2Y1M A;  4U1P A;  2YLB A;  2H5K A;  1PIC A;  2EO3 A;  4ROJ A;  1VQP Q;  3VRR A;  2M0O A;  4J7F A;  1YJW Q;  1U1S A;  1H3H A;  4OHL A;  2JUF A;  1O4D A;  1YHQ T;  1XTD A;  2OTL A;  3A98 A;  2L4K A;  1BBZ A;  2F5K A;  1PM3 A;  4Z88 A;  1FMK A;  4A54 A;  2J06 A;  3VS1 A;  2JJ9 A;  1HK9 A;  2CZ0 B;  4CC3 A;  1D4T A;  1Z9Z A;  3H9N A;  1O42 A;  2GNC A;  2DJQ A;  3VS6 A;  2HSP A;  1M9S A;  1JU5 A;  5D7U A;  1UUE A;  2WSF E;  2DBM A;  3G1J A;  4WF2 A;  1O4I A;  1A09 A;  3M0R A;  1BHH A;  1JYQ A;  2J6O A;  4JDS A;  3EFO A;  3I9Q A;  4XTZ A;  1H64 1;  2RQV A;  1X0N A;  1SSH A;  2KRS A;  3GNG A;  1Y7X A;  2D9T A;  1OU9 A;  1X69 A;  5I21 A; 
#chains in the Genus database with same CATH homology
 1AWO A;  4WCI A;  4M4Z A;  4J9H A;  1F2F A;  1AYB A;  1PRL C;  1WI7 A;  1AOU F;  5HKZ A;  5FW9 A;  1W6X A;  1K1Z A;  4JGH A;  2XP1 A;  3GBQ A;  1O4M A;  2CI8 A;  3REB B;  1GBR A;  3CBL A;  4CC7 A;  1A1C A;  2XMF A;  3M0S A;  5AUL A;  2LX7 A;  4GL9 E;  3VRN A;  3EGU A;  2RQW A;  2MCN A;  1B07 A;  1NLP C;  5CDW A;  4OHH A;  1FYR A;  2CR4 A;  1LUK A;  1WDX A;  3EG3 A;  1BK2 A;  2FG0 A;  4J9I A;  1O4B A;  1AWX A;  1KJW A;  1O4N A;  1R1S A;  1U5S A;  1F1W A;  3IN7 A;  4X6S A;  3US4 A;  1W70 A;  5FWC A;  2YSQ A;  4F14 A;  1RI9 A;  1WA7 A;  2D8H A;  1WLP B;  4RTZ A;  1AWJ A;  3ZNI A;  2AKL A;  2DCR A;  1O4K A;  4RUG A;  1WFW A;  4FL2 A;  1GBQ A;  2L0A A;  2NUZ A;  1SPS A;  5I6V A;  5BO4 A;  2KRN A;  1PRM C;  2ROL A;  1HJD A;  4OMN A;  1CWE A;  1O47 A;  1BMB A;  2RVF A;  1CJ1 A;  1V1C A;  2OZO A;  2DLP A;  2DL3 A;  2SHP A;  2CIA A;  3CQT A;  2E5K A;  1BB9 A;  1ZUK A;  1IJR A;  3M0P A;  1SHA A;  2CSQ A;  3PE0 A;  4JZ3 A;  2EOB A;  2BZY A;  2L6K A;  2MQI A;  2DNU A;  5EHR A;  4ZNX A;  2PNI A;  4L1B B;  3SHW A;  4OMP A;  1RJA A;  1UG1 A;  3I5S A;  1UGV A;  4X1V A;  2DL8 A;  3NMZ C;  1UUS A;  2C0T A;  4NWF A;  3N84 A;  1RQQ C;  2ESW A;  2JS2 A;  1AZG B;  2EKH A;  2Y1N A;  5GJH A;  2KE9 A;  1O4C A;  5DF6 A;  4OMM A;  4NWG A;  2ECD A;  2OQ1 A;  1H92 A;  1BG1 A;  3S8L A;  2V1R A;  1BF5 A;  4CC4 B;  2FPE A;  3N8M A;  3H0I A;  2BZ8 A;  5I11 A;  5ECA A;  1GHU A;  1BU1 A;  1M27 C;  1VYV A;  2YUN A;  3EHQ A;  4WWQ A;  1CKB A;  2IZV A;  2L3T A;  1SEM A;  1GFD A;  1AOT F;  2F2W A;  2CUB A;  2BTT A;  1O4L A;  1G83 A;  4J9C A;  4OHE A;  1UTI A;  3VS5 A;  4Z8A A;  4HVU A;  1O49 A;  2HEQ A;  1I3Z A;  1FYN A;  2ABL A;  2G6F X;  3MAZ A;  1T3S A;  4E93 A;  3R6N A;  3MXC A;  1YVL A;  1UHC A;  3EG0 A;  4JJB A;  2GE9 A;  1O4Q A;  1W1F A;  1PKS A;  3GXX A;  1UEC A;  1LKL A;  2PZ1 A;  2EGC A;  3VS0 A;  4Y92 A;  1A08 A;  1JU5 C;  2AK5 A;  2CDT A;  2JMC A;  1BHH B;  1FHS A;  1K0S A;  1MV0 B;  2KNO A;  4LUE A;  3BUW B;  2DLZ A;  3N7Y A;  1ZUY A;  2IIM A;  2A28 A;  2FCI A;  4AFZ C;  2AZS A;  2DE0 X;  3C7I A;  3M0U A;  1ABO A;  2CT4 A;  1M27 A;  1VA7 A;  1XOV A;  1CKA A;  2O9V A;  4D8K A;  3BUN B;  2K6D A;  1HCT B;  3OB1 B;  3FJ5 A;  4JE4 A;  1NZL A;  5L23 A;  5IBM A;  1WQU A;  2K79 A;  1CSK A;  2KK6 A;  1N5Z A;  1ZSG A;  1WIE A;  2EW3 A;  2ENM A;  2QMS A;  1O4E A;  2PTK A;  1Y0M A;  1J3T A;  1AYD A;  4RTW A;  2LMJ A;  2BZX A;  2KYB A;  1JQQ A;  1K9A A;  2KT8 A;  1MV3 A;  1MIL A;  1BLK A;  3VS4 A;  1RLQ C;  1IO6 A;  5AXI A;  1O44 A;  3VS7 A;  1HCS B;  4J9G A;  2EL8 A;  1AEY A;  4H34 A;  1E6H A;  1H8K A;  1LKK A;  2KXD A;  4ESR A;  3OB2 B;  1JO8 A;  2KR3 A;  1JWO A;  3SEM A;  1HSQ A;  1H9O A;  3EG2 A;  2PNB A;  1M30 A;  3KFV A;  2YUO A;  3OV1 A;  5HKW A;  1NLO C;  4QSY A;  2FRW A;  1UE9 A;  2DVJ A;  1R1Q A;  3QWY A;  1Z3K A;  3TKZ A;  1MW4 A;  3UYO A;  2MIO A;  2OAW A;  1O4F A;  3CD3 A;  1M3C A;  2CUD A;  4KRT A;  4R0K A;  1SRL A;  2DL4 A;  1SHG A;  1OO4 A;  2VWF A;  2NWM A;  2PLE A;  2L3P A;  4XZ0 A;  1BM2 A;  2RN8 A;  3T04 A;  4OHI A;  1QLY A;  2DA9 A;  2L2P A;  1AYA A;  1GL5 A;  1O4A A;  2ROR A;  3UF4 A;  1O4O A;  1FBZ A;  1ARK A;  4F59 A;  1A81 A;  4TZI A;  2IUH A;  3REA B;  1B47 A;  1K76 A;  2IUG A;  1AD5 A;  1ZUU A;  3LH5 A;  2CH4 A;  2ROT A;  3IN8 A;  5EEQ A;  2K79 B;  1PHT A;  1I1J A;  5IHN A;  2MK2 A;  1M8M A;  1SPR A;  1I07 A;  1FU5 A;  1A1A A;  2HMH A;  1UJ0 A;  1NYF A;  3BUM B;  2J7I A;  2JW4 A;  2KRO A;  3PVQ A;  2CI9 A;  1LUI A;  3M0Q A;  4RTV A;  1O4G A;  1YN8 A;  2DMO A;  3UA7 A;  3CXL A;  2VIF A;  1JEG A;  5HKY A;  2DBK A;  1UHF A;  2KXC A;  2B86 A;  2B3O A;  2YUQ A;  3TL0 A;  2DLY A;  2BBU A;  3TSZ A;  2RF0 A;  2YDL A;  4DGP A;  2LNW A;  3I5R A;  3EHR A;  2V1Q A;  1YWP A;  2D1X A;  1QWE A;  3S8O A;  2JXB A;  1GCQ A;  3MXY A;  2LJ0 A;  1YVH A;  4LNP A;  1TZE E;  1QCF A;  1UJY A;  2DF6 A;  1NG2 A;  2AZV A;  2EBP A;  1XA6 A;  4DEX A;  3UA6 A;  3CWG A;  1Y57 A;  1YWO A;  1T0J A;  2A08 A;  3IMJ A;  3PSJ A;  2QDL A;  1WXB A;  1RLP C;  2EYZ A;  4P9Z A;  1PKT A;  1OPK A;  4JPB W;  1B3Q A;  4HCK A;  1VYU A;  2M0Y A;  2OI3 A;  2CRE A;  3BKB A;  1SKJ A;  2P4R A;  2JYQ A;  1UUR A;  4OHD A;  2HBW A;  2RMO A;  1X6B A;  2DYB A;  1IS0 A;  4OML A;  1NZV A;  2YT6 A;  3TVT A;  5D0J A;  4J9F A;  2JT4 A;  3S9K A;  1TG0 A;  2C0O A;  2EYV A;  5IH2 A;  1NRV A;  2YU7 A;  2Y3A B;  5IHK A;  1BHF A;  2O2O A;  2RSY A;  2LCT A;  2RPN A;  1FBV A;  4E68 A;  2EU0 A;  2MC1 A;  2AUG A;  4U17 A;  1NEB A;  2ED1 A;  3VRO A;  4ORZ A;  1WYX A;  1Z9Q A;  3VS2 A;  5GJV B;  2HUW A;  5IXB A;  1ZLM A;  2C9W A;  3H41 A;  2DX0 A;  2RMX A;  3S8N A;  1ZX6 A;  2A37 A;  3O5Z A;  1BFJ A;  1E6G A;  2LJ1 A;  2YUP A;  3GXW A;  3NHN A;  1X6G A;  3TSW A;  1M61 A;  1O4J A;  5DC0 B;  1O41 A;  5GJI A;  1A1B A;  2SRC A;  4XZ1 A;  1OEB A;  5IHI A;  1AZE A;  1S1N A;  1AYC A;  2K3B A;  3WA4 A;  2RQT A;  2DL5 A;  2K7A A;  3QWX X;  1HD3 A;  2W0Z A;  4Z89 A;  1ABQ A;  2EYY A;  3EG1 A;  3VRY A;  1LUN A;  3PJP A;  2X3W D;  1CSY A;  2SEM A;  4A4C A;  1OO3 A;  1GFC A;  1QKW A;  2O31 A;  3I35 A;  2AOB A;  3HHM B;  1GRI A;  2DRM A;  4AFU C;  4LN2 A;  4OMQ A;  2DM0 A;  3RNJ A;  2HDV A;  4DGX A;  4F5A A;  2J6F A;  2HDX A;  4FBN A;  1TUD A;  3GQI B;  2DRK A;  1AWW A;  4A4B A;  1NEG A;  1A07 A;  5KAZ A;  1Y1U A;  1WXU A;  1AVZ C;  1O48 A;  1JYR A;  1O4R A;  1LCJ A;  1SRM A;  3THK A;  1MUZ A;  1BKM A;  5IBS A;  2EPD A;  1R1P A;  4A63 B;  1QKX A;  4CC2 A;  2DIL A;  2KNB B;  1D1Z A;  1VYT A;  3OP0 A;  5FWB A;  5EHP A;  4GPL B;  1O45 A;  2JMA A;  1OPL A;  2I0N A;  2EVR A;  1PNJ A;  2F2X A;  3IMD A;  4K44 A;  4JJD A;  3BUO B;  2OJ2 A;  4IIO A;  1QWF A;  2RQU A;  1QG1 E;  3RBB B;  2K7A B;  1SHD A;  5HCK A;  2CH4 W;  2AOA A;  1PWT A;  3PVL A;  1JYU A;  2IUI A;  4JEG A;  2W10 A;  2J6K A;  1ZBJ A;  2K2M A;  3M0T A;  2CSI A;  2PLD A;  2RQR A;  2KEA A;  2D0N A;  2FRY A;  4JZ4 A;  4HXJ A;  1D4W A;  4K2R A;  2O88 A;  1T0H A;  1U3O A;  2GBQ A;  3VRZ A;  4EY0 A;  2VVK A;  4QT7 A;  1OV3 A;  1X43 A;  1G2B A;  1X6C A;  3PLF B;  5J3X A;  1KSW A;  2EQI A;  2EYX A;  1X27 A;  4HVV A;  2HDA A;  4LUD A;  4AFS C;  1JXM A;  4AFQ C;  1NM7 A;  1A1E A;  3VRP A;  2L3Q A;  3H0F A;  2JS0 A;  3NGP A;  2K9G A;  1TUC A;  4OMO A;  1P13 A;  1WXT A;  5DC9 A;  1UFF A;  4RTU A;  2FPD A;  1BKL A;  1LCK A;  1RPY A;  2EYW A;  4H1O A;  2RNA A;  4LE9 A;  2FO0 A;  1AB2 A;  2LNX A;  3UAT A;  4HVW A;  4F17 A;  3H0H A;  1SHB A;  3OVE A;  3EAZ A;  1OOT A;  3IQL A;  1QAD A;  3ZL7 C;  3PSK A;  4FL3 A;  4GWF A;  5I22 A;  2AKK A;  2JM8 A;  4DEY A;  3VGO A;  2GTO A;  1M3A A;  2EGA A;  5GJW B;  2KRM A;  2J05 A;  4K11 A;  4EIH A;  1NYG A;  3M7F A;  4FSS A;  3K2M A;  3BUX B;  2ECZ A;  1YNZ A;  1BLJ A;  1I0C A;  4EIK A;  2JTE A;  2LQW A;  1ZFP E;  1AOJ A;  4RTT A;  1EFN A;  3HIZ B;  1TCE A;  4F5B A;  2KYM A;  5IXF A;  4D8D A;  2EO6 A;  1O4P A;  5EG3 B;  2D8J A;  2CBL A;  2ED0 A;  1WX6 A;  3NPF A;  3PQZ A;  2HCK A;  2FEI A;  1KA7 A;  2LJ3 A;  4E6R A;  3VRQ A;  4GLM A;  2C0I A;  2MOX A;  4JJC A;  2M51 A;  2H46 E;  3VS3 A;  3PS5 A;  1K0X A;  2FPF A;  1O4H A;  2KBT A;  2LCS A;  3EAC A;  1X2Q A;  2KT1 A;  2O9S A;  4F16 A;  2MRK A;  1A0N B;  1SHF A;  2CRH A;  2DX1 A;  2Y1M A;  4U1P A;  2L3S A;  4RTX A;  3U23 A;  1E7O A;  4AG1 C;  1PIC A;  1FU6 A;  2H5K A;  2EO3 A;  4J9D A;  4ROJ A;  2JM9 A;  2MRJ A;  2EGE A;  1CSZ A;  1RUW A;  3VRR A;  1M3B A;  2DM1 A;  1H3H A;  4OHL A;  1O4D A;  4J9B A;  5DC4 A;  1YP5 A;  1X2K A;  5EC7 A;  1O43 A;  1KFZ A;  3A98 A;  2L4K A;  1U06 A;  1GCQ C;  1BBZ A;  2GSB A;  4Z88 A;  3ULR B;  1BFI A;  1YCS B;  1O46 A;  4J9E A;  2EKX A;  3PFV A;  1FMK A;  2YSX A;  2J06 A;  4IIM A;  4GBQ A;  1JXO A;  3VS1 A;  3JV3 A;  3HCK A;  2GTJ A;  2LQN A;  2PNA A;  1CWD L;  2H8H A;  2VKN A;  2LNH B;  4CC3 A;  1D4T A;  2A36 A;  1Z9Z A;  1T3L A;  3KFJ A;  1O42 A;  2LP5 A;  2GNC A;  1KA6 A;  1SPK A;  4K45 A;  2DJQ A;  2GGR A;  3VS6 A;  1UDL A;  2HSP A;  2F2V A;  5EEL A;  1JU5 A;  1UUE A;  1O4I A;  2DBM A;  1A09 A;  3M0R A;  1K4U S;  2GQI A;  1BHH A;  4P9V A;  1JYQ A;  2DL7 A;  2CT3 A;  1GCP A;  2X3X D;  3C0C A;  2J6O A;  3I9Q A;  4RTY A;  1KC2 A;  2RQV A;  1LUM A;  1X0N A;  1SSH A;  2KGT A;  2KRS A;  4AG2 C;  2ETZ A;  2CS0 A;  2LZ6 B;  1X69 A;  1KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...