1GRIA

Grb2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
211
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mammalian Grb2 adaptor.
pubmed rcsb
molecule keywords GROWTH FACTOR BOUND PROTEIN 2
source organism Homo sapiens
molecule tags Signal transduction adaptor
total genus 34
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA03
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1griA02
2KBTA 2OJ2A 2FPDA 5L23A 3VS0A 1IO6A 2EYXA 2MIOA 3EG2A 1OOTA 1SSHA 3EACA 3BUMB 1M8MA 1RJAA 4U1PA 2J7IA 5EHPA 2Y3AB 2IZVA 1X6BA 2J06A 3VGOA 2BZ8A 3REBB 2G6FX 1JO8A 1AWWA 1NLPC 3TSZA 2X3WD 1SPRA 4L1BB 1BHFA 4OMMA 1I1JA 3EG0A 5ECAA 2RQUA 2FPEA 1BKMA 1Y57A 2Y1NA 2MCNA 3ULRB 1U5SA 3M7FA 1F1WA 5EELA 4K11A 1HCTB 1UGVA 2V1QA 1WI7A 1BFJA 1RQQC 1FHSA 4JJCA 1GCPA 4LUDA 2EL8A 1O4BA 2JT4A 1KIKA 1UDLA 2O88A 1O4KA 2LQNA 4OMOA 5IBSA 2EGEA 2HBWA 2DL8A 1MV3A 1A1CA 2FO0A 2LJ1A 1MW4A 4LN2A 3SEMA 3VS2A 4ESRA 1UUSA 1QLYA 2DX1A 2EYYA 3U23A 1O4RA 3PQZA 5HKYA 2ED0A 2DLZA 2EW3A 2EGCA 2JXBA 2KROA 1SRMA 3EGUA 3QWXX 1O4OA 3BUWB 1TZEE 4J9FA 1M3CA 5HKZA 5EG3B 5I22A 1P13A 2PTKA 2MRJA 2JMAA 1SHGA 1YN8A 2DE0X 1YWOA 3CXLA 1NLOC 2F2VA 1WYXA 1GBQA 4D8KA 3S8NA 2KEAA 1JYUA 1K76A 4H1OA 3SHWA 3VRYA 2C0OA 1O46A 3O5ZA 1YVLA 4JZ4A 1TUDA 1LUNA 2YT6A 2L6KA 2D1XA 2LQWA 1WQUA 2IUIA 3K2MA 5J3XA 3VS4A 1BLKA 2C9WA 1QWFA 1CKAA 1R1QA 2ETZA 1O44A 2JMCA 1XA6A 4QSYA 2RF0A 3M0SA 1Z3KA 4FL3A 2CDTA 1FU6A 3IMDA 1CKBA 1I3ZA 1GRIA 1YCSB 3UF4A 1X6CA 1G83A 1O4HA 2K9GA 4EY0A 1NZLA 4OMNA 2SRCA 2DL4A 4DEYA 3IMJA 3GBQA 1OPLA 2RN8A 5IHIA 1BBZA 1UFFA 1CWDL 4DEXA 1TCEA 2PZ1A 3N84A 1UE9A 4GBQA 1M3AA 2GNCA 4LE9A 1A1EA 1IS0A 3PFVA 3TVTA 4ZNXA 4K2RA 3HCKA 1O45A 2JM8A 3I9QA 1HSQA 4NWGA 1AWJA 4AG1C 1BLJA 5I11A 4RUGA 1H8KA 1N5ZA 1ZLMA 1MILA 2KXDA 1FBVA 2M51A 3JV3A 3H0HA 1SHAA 1BU1A 3CQTA 1JEGA 1B07A 2H8HA 3M0UA 1BHHB 1CSZA 3TSWA 1QADA 1GCQC 1X0NA 1VYTA 2BZXA 2AOAA 1LUIA 1PHTA 4P9VA 1O4QA 5BO4A 1QKXA 5GJVB 2LMJA 4TZIA 1A81A 2FPFA 2KT8A 4RTXA 1YP5A 2LX7A 3PLFB 1BFIA 2DRMA 1ZX6A 1M27A 2NWMA 1T0JA 4IIOA 1AOJA 1QKWA 1Z9ZA 3EG3A 4HVVA 1O4DA 1R1SA 1LCKA 4RTZA 4Z8AA 2AOBA 1RPYA 1H92A 4F14A 2J6KA 2JW4A 3WA4A 1ZFPE 2A28A 3R6NA 2KK6A 1HCSB 2QMSA 2ROLA 4J9HA 3ZNIA 2YSQA 1AVZC 1PRLC 4GWFA 2YDLA 1CJ1A 2DCRA 4A63B 2SHPA 1ZUYA 2DX0A 1KSWA 3IN7A 2KE9A 5HKWA 4F17A 2MOXA 5IHKA 5GJHA 3EAZA 4E6RA 1EFNA 2DJQA 2H5KA 3H0FA 2HMHA 2KXCA 3NPFA 1WLPB 2YUPA 2A36A 2RNAA 2MK2A 4X6SA 2IIMA 4AFZC 2L3SA 3VS7A 5KAZA 2YUNA 1AB2A 5GJWB 1WX6A 2W10A 5IBMA 2EKHA 1AZGB 2V1RA 1GL5A 2VIFA 2AK5A 2O31A 2HDXA 1I07A 3TKZA 2O9VA 3NMZC 1UJYA 1UHFA 3I35A 3H41A 2EVRA 2RVFA 2KR3A 4HXJA 4OHIA 2XP1A 2FRYA 2CS0A 1BMBA 1WDXA 2K79A 1QWEA 1O4JA 1YNZA 1LKKA 4DGPA 2CI8A 1G2BA 2RSYA 2LP5A 3RNJA 1AYBA 1LKLA 1E6HA 1OEBA 2F2WA 2RMOA 2DLPA 2KNOA 1B3QA 1A1BA 4XZ1A 3HHMB 1WXUA 1VYUA 2GGRA 1M3BA 1NZVA 4A4BA 5FWCA 1FYRA 4GL9E 1JYQA 2CSIA 3VRRA 3BUXB 1E7OA 2AUGA 5DC9A 2CT4A 2PLEA 5EC7A 2CT3A 1UHCA 1O4PA 4H34A 2KRMA 1YWPA 4IIMA 2CREA 2RORA 1MV0B 4ROJA 4J9IA 2F2XA 4HCKA 2J6FA 1UUEA 1X43A 4LNPA 2CUBA 4F16A 4AFUC 1F2FA 1Y0MA 2A37A 2DM1A 2DMOA 3CWGA 4J9EA 1RLPC 4GLMA 3VS6A 3S8LA 1JU5C 2JS2A 5I6VA 1O4AA 1W70A 2JS0A 2PNIA 4NWFA 2DM0A 2KGTA 2YU7A 3UA7A 2ESWA 1O4FA 2AZSA 3LH5A 5D0JA 4KRTA 1LUMA 1A09A 4RTUA 1WA7A 2KYMA 2YUQA 2K7AA 2PNAA 2SEMA 1UJ0A 4J9DA 1O49A 1AD5A 1D4TA 2XMFA 4OHEA 2KYBA 2H46E 5GJIA 1AOUF 3MXYA 5FWBA 3EG1A 2HDVA 1FBZA 2DVJA 2E5KA 1O4IA 2J05A 4OHDA 3S9KA 2GBQA 2RQWA 3VRQA 3FJ5A 1CSYA 1RI9A 2HCKA 3VS5A 4OHLA 1O4MA 2AKKA 4D8DA 1IJRA 1ARKA 2C0TA 5DC0B 2JTEA 1WIEA 4FSSA 1M30A 2K3BA 5FW9A 1LCJA 3C0CA 2DYBA 1LUKA 2OQ1A 2D0NA 1VA7A 2GE9A 4OMLA 2KT1A 4RTWA 1O41A 2DA9A 4RTTA 1A08A 4AFQC 1PKSA 4FBNA 4J9BA 4JGHA 2IUGA 3IQLA 2PNBA 1JU5A 1NM7A 2GQIA 1TG0A 4K45A 3NHNA 1O47A 3PS5A 3UYOA 1OV3A 2DL3A 1T3SA 1WXBA 1U06A 2CRHA 1NEBA 2L3PA 4WCIA 1O4GA 2CH4A 2CIAA 1BM2A 1NYFA 1XOVA 1E6GA 1KFZA 3VRPA 3VRNA 1D1ZA 4J9CA 1I0CA 2EYVA 1ZBJA 2ROTA 4OMPA 3N8MA 1J3TA 3T04A 1JXOA 1PKTA 2HDAA 1KA7A 2P4RA 4CC3A 2MC1A 2FEIA 2EYWA 2FG0A 1OO3A 2DLYA 1W6XA 2L3QA 1X6GA 3UATA 4F59A 2A08A 3PE0A 1O4EA 2GTJA 5AULA 4HVWA 2L2PA 4M4ZA 3KFJA 4E93A 1KJWA 2OAWA 2DL7A 4J9GA 4RTVA 1GCQA 1SPSA 3VS3A 5CDWA 1UURA 1V1CA 1YVHA 1GFDA 2EQIA 1PICA 2DILA 4AG2C 2BZYA 2RQVA 1JXMA 2D8HA 1CWEA 1UECA 4GPLB 2AKLA 2MRKA 2C0IA 2DNUA 3VROA 1QCFA 1AEYA 4RTYA 2ED1A 2Y1MA 3UA6A 1CSKA 1O48A 1K1ZA 1TUCA 4LUEA 1T3LA 1BHHA 2PLDA 2O2OA 3A98A 5DC4A 2I0NA 2L0AA 3REAB 2J6OA 1O43A 2LNWA 3MAZA 2EOBA 3S8OA 4U17A 3MXCA 1PWTA 1ZUUA 5IH2A 1K4US 3GXWA 5EEQA 3IN8A 1GHUA 3NGPA 4OHHA 1ZUKA 1HD3A 1A1AA 2RMXA 5IXBA 3HIZB 3I5SA 4K44A 1RLQC 3KFVA 1BG1A 4F5AA 2AZVA 4ORZA 5IHNA 1FMKA 4JPBW 3OP0A 4Y92A 1VYVA 2K7AB 1AOTF 2CUDA 2L3TA 2ENMA 3BUNB 3OV1A 2YSXA 4JZ3A 2QDLA 1BK2A 4CC4B 2O9SA 1MUZA 4P9ZA 2DBMA 2EO3A 1SHDA 1UG1A 2IUHA 2EGAA 3EHQA 2L4KA 1X2QA 4Z88A 2LNHB 4FL2A 3CD3A 1ZSGA 3VS1A 1FYNA 2GTOA 1AWXA 2NUZA 2RQTA 1AWOA 1RUWA 4JJDA 1WXTA 2CSQA 2DBKA 3OVEA 4JEGA 5AXIA 1AZEA 1R1PA 1SRLA 2FCIA 1WFWA 1O42A 1SHFA 3PVLA 1O4LA 2CBLA 1NEGA 1X69A 1GBRA 2MQIA 1HJDA 4R0KA 2HUWA 2BBUA 4A4CA 2K6DA 3H0IA 3ZL7C 1FU5A 2VVKA 3CBLA 2RQRA 1SHBA 4DGXA 2B3OA 2LJ3A 4E68A 2LCSA 1O4NA 1Z9QA 2FRWA 4F5BA 3THKA 2LNXA 1ABOA 2KRNA 2EYZA 3M0QA 2HSPA 2ECZA 1ABQA 3M0RA 1SEMA 1M27C 3RBBB 1PRMC 4HVUA 4XZ0A 1S1NA 1W1FA 1X27A 3BKBA 2VKNA 1JWOA 2CI9A 1T0HA 1K0XA 3BUOB 4JE4A 1U3OA 5EHRA 4Z89A 2EPDA 4OMQA 2YUOA 4AFSC 1OPKA 1BKLA 2EO6A 3I5RA 2M0YA 1SPKA 2LCTA 2EBPA 1PNJA 1K9AA 2KNBB 2W0ZA 1D4WA 2CR4A 2LJ0A 2B86A 2VWFA 3OB2B 2LZ6B 1NG2A 3US4A 1BF5A 1AYAA 1O4CA 3QWYA 5DF6A 1M61A 3PSKA 4X1VA 2JYQA 2D8JA 3GXXA 1A0NB 3TL0A 1H3HA 2OZOA 1UTIA 1NYGA 1H9OA 2ECDA 1Y1UA 2K79B 1KC2A 2EKXA 3GQIB 4JJBA 1AYDA 2DF6A 1GFCA 2DRKA 3VRZA 4WWQA 1B47A 1AYCA 2CH4W 1JYRA 1JQQA 3EHRA 2GSBA 3OB1B 3PVQA 2OI3A 2KRSA 1KA6A 3C7IA 2EU0A 4EIHA 2HEQA 1A07A 2DL5A 1SKJA 4CC2A 1K0SA 3PSJA 1NRVA 2X3XD 4EIKA 5IXFA 1X2KA 3N7YA 2K2MA 4CC7A 1OO4A 3PJPA 3M0PA 1BB9A 2ABLA 2JM9A 2BTTA 3M0TA 2RPNA 4QT7A 5HCKA 1QG1E
chains in the Genus database with same CATH superfamily
3GNGA 3VS0A 1M8VA 2MIOA 3EG2A 1M8MA 5GAN3 3OY9A 2J7IA 2Y3AB 1PSFA 1X6BA 2J06A 4OMFB 4IKFA 4C5HA 2G6FX 2ZZDA 2DIGA 5M9OA 1AWWA 3G4SQ 2HL3A 1BHFA 4OMMA 4JJNK 1NPPA 1Y57A 1G3SA 3MP1A 2QASA 3OQ5A 2V1QA 4EMKC 1BFJA 3JCMh 5GANj 5KCHA 1TUGB 2Y4YA 4LUDA 1KG1A 1K73U 1UDLA 3BW1A 4DBFA 5IBSA 2MK5A 5DLQE 3RESA 4XU2A 4LN2A 4XU1A 1QLYA 4E7SA 4LD9K 1O4RA 1R77A 3LX7A 4M7AA 2EW3A 4C0FA 5CKFA 1SRMA 2NUTB 2FZCB 1I5LA 3MHXA 2M0OA 4J8OA 2EKOA 4WTOB 3G6EA 4J9FA 1M3CA 1WQWA 1VQ6T 5I22A 1VQ9Q 2AIRB 1SHGA 3M4YA 1YWOA 2HZYA 3CCUT 3CXLA 2JNGA 2QEXA 4D8KA 3S8NA 2DD4A 2KEAA 4KH0B 4E7JA 1YI2Q 3VRYA 2X4WA 4JRIA 4JZ4A 3I56T 2YT6A 3QIIA 1WQUA 5J3XA 1MHNA 1BLKA 1XJWB 4IUUA 3G71T 1CKAA 3L2ZA 1G3TA 1G3WA 2RF0A 1QVGP 2OTLT 3M0SA 4ZN1A 4FL3A 2GF7A 1FU6A 1X6CA 5GMKl 2LQ8A 2EQKA 4XTVA 1WHGA 2DL4A 4DEYA 2CP0A 1OPLA 2QI2A 1UFFA 3CC7Q 3CC4T 2PZ1A 2RI5A 1IS0A 4A53A 1UGPB 4ZNXA 3NTIA 3QZ9B 2WACA 2LTOA 4D6WA 3I9QA 4RUGA 1MILA 1VQKA 1FBVA 4PJOA 1NE8A 3J80E 2XIDA 3H0HA 1X01A 3CQTA 1JEGA 1B07A 2H8HA 4RKUE 3JB9F 1CSZA 4J7IA 1QADA 4EMGA 4PFZA 1VQPA 2AOAA 3HHTB 5AYFA 4OGEA 1VQ8A 1QKXA 2F69A 2LMJA 1YP5A 5L8RE 2DRMA 1OI1A 4IIOA 3CCEQ 3HRTA 4Z8AA 3A1PA 1RPYA 4F14A 3WA4A 1ZFPE 2KK6A 3RKYA 3FDRA 3PFSA 2ROLA 3DLLA 3ZNIA 2YSQA 4HKEA 2HQEA 1MMAA 1KSWA 3IN7A 4E6RA 3MEUA 3S3NA 2BKDN 2KXCA 3NPFA 2YUPA 1TH7A 4AFZC 2L3SA 5GANf 1U8RA 2E6NA 3A8MB 4PJLA 2DXCA 2M9UA 1WX6A 2W10A 5FU7C 3HRUA 1VQ4A 3NMZC 1UHFA 3EG9B 2E64A 1Q82C 5GANe 4HT9A 2RVFA 4HXJA 4FT4A 4M75D 1Y07A 4E7KA 4O6JA 4KULA 2KNOA 3CCRQ 4XZ1A 4VUBA 5FU6B 1KD1C 1WXUA 2GGRA 1M3BA 5FWCA 4RCBA 5KYYB 3M54A 3PIOA 2O4XA 5A0DA 3VRRA 1R8OB 1WNLA 2F5TX 2AUGA 1LPLA 3OW2P 4A54A 2CT4A 1ACMB 5EC7A 1EZZB 4H34A 4E2FB 2KRMA 4A4GA 5CQXA 1LJOA 1VQOA 1OQKA 2RORA 2F2XA 4C92F 4NL2A 2J6FA 1VQLA 2MAMA 4AFUC 2DMOA 2ZPEB 4ZGDB 3CWGA 1RLPC 3C94A 1KHIA 1M2VA 2HSEB 2DAQA 2HQXA 1O4AA 1W70A 4NWFA 2LNVA 1QVGS 1KK7A 1I4K1 2AZSA 3X25B 1OULA 1H641 1LUMA 3JCMQ 1A09A 4N0AC 2KYMA 2YUQA 3MO8A 3EG1A 2HDVA 1FBZA 2DVJA 3CD6A 2RD1A 3LGLA 3FJ5A 3LGFA 4P5NA 5GMKh 3JB9D 1IJRA 1ARKA 3CCET 5FW9A 2DXUA 1UGRB 3C0CA 1VOMA 1VA7A 4OMLA 4FSXA 2KT1A 2K5LA 1A08A 5A0GA 4ZGJB 4FBNA 4J9BA 2IUGA 3IQLA 2NLUA 3OYYA 4M77E 1O47A 4M7AG 3RR6A 5GAMj 1WXBA 3QJ6A 5KYWA 2CIAA 1M90C 1ZSZC 4CRIA 4C8QG 2ZGWA 4BY6C 3MCAB 2RH2A 4M78F 3CPWP 5GAN5 2EYVA 4FCYA 1LOJA 4JRKA 2P4RA 3E9FA 3I55T 3CCQA 1X6GA 3SB2A 3UATA 1M1KC 4F59A 2A08A 3PE0A 4R56A 2KVQG 5FRNA 4M7AB 1V76A 4M4ZA 1WQ7A 1W2BP 1IXDA 3KFJA 3CPWA 1KJWA 2OAWA 2DL7A 4C8QB 2HAXA 1SPSA 3P8DA 1UURA 1YVHA 1SKJA 2DILA 1JXMA 4ZTJA 1UECA 3EFSA 1VUBA 2AKLA 5LJ3g 4C0DB 4OB3B 3JB9I 1M5Q1 4JS5A 1QCFA 2MWOA 5LJ5g 2RK2A 3CBOA 4XTXA 1W2BA 4M7DG 1K8AC 3UA6A 1O48A 1TUCA 1T3LA 4RG8A 1O43A 1RABB 1N9RA 3MEVA 3CBPA 4DOVA 1PWTA 1ZUUA 5IH2A 3CCLQ 3X20B 3IN8A 4PJOG 3NGPA 1ZUKA 1HD3A 5IXBA 3PMIA 3V8KA 4EPCA 3RERA 3JCMf 5GMKi 4C92D 1YITT 2L3TA 4M7DB 1FMVA 1YJNT 2XD0A 3OBWA 3OW2S 3OBYA 4PLLA 5C0MA 2DBMA 2EO3A 1W4SA 2VC8A 1VQMA 4EMHA 2LNHB 1D0XA 1FYNA 1FMWA 2NUZA 3K2TA 4JJDA 3OVEA 3OYCA 5D7UA 2HD0A 1SRLA 1R1PA 4J5YA 4BI3A 3PVLA 2CBLA 1X69A 1JJ2P 2QGFB 1HJDA 2DXTA 2BBUA 1QW1A 4R55A 3HFOA 2QK0A 2RQRA 4DGXA 2B3OA 2LCSA 2X35A 1Z9QA 2DEQA 5GAOl 1VQ7A 2HNIA 5FLXE 2HSPA 2NUTA 1SEMA 3M56A 4HVUA 4OP0A 4XZ0A 2CI9A 1U3OA 5EHRA 4Z89A 4OMQA 3JCMb 2DVEA 4PJOF 3JCMd 4M78D 2LCTA 2EBPA 3OS5A 4JS4A 2GCXA 2VWFA 5GAMe 2K5IA 3PSKA 1TSFA 1A0NB 5GAOn 4Y28E 1IRXA 5GMKj 4RMOA 1QCOA 1UTIA 2QA4Q 3CPWS 4PJJA 4J6XA 1C0MA 1KC2A 2ZCFB 4F7UA 1AYDA 2DRKA 2KSSA 3L2UA 4WWQA 3BDUA 1AYCA 2RA2A 2JN0A 3A5ZB 1VQ6A 3HRSA 2OI3A 2KRSA 3CCUA 2LRAA 3C7IA 4EIHA 3CCST 5HY6A 1MMNA 1W2BS 5CAIA 3OYBA 4CC2A 4LDVA 2CZ7B 3MP8A 5IXFA 5D6WA 3I56A 2ABLA 5HCKA 2BTTA 3M0TA 5BO4A 5IN1A 1Q86C 2E1HA 3VKIA 1Y71A 3Q1JA 4XU3A 2OTLA 4U1PA 3REBB 1JO8A 1WHJA 1SPRA 4L1BB 5GMKm 1M2VB 4M75C 4M7AD 2RQUA 2DO3A 2RHYA 1M1FA 2FB7A 4Q5WA 1Q82R 1F1WA 2FL7A 5EELA 1HCTB 4JLGA 1RQQC 1FHSA 2DD5A 1G3YA 2EL8A 4OF1A 2XDBA 1NJIC 2O88A 3MKDA 2LQNA 2Z0WA 5IAYA 3M55A 2DL8A 1MV3A 2RHZA 2DTIA 2LJ1A 2B8AA 1MW4A 3SEMA 1MNDA 4QVZA 3FEOA 2D9TA 5HKYA 2ED0A 3JCMV 1FX7A 2JTFA 1KD1R 2EGCA 2JXBA 2KROA 3EGUA 2K57A 3EGXB 4TVRA 3BUWB 4IUVA 2YRDA 3JCMc 5EG3B 3L2RA 1KC8C 1P13A 2MRJA 1JBMA 1YN8A 4PLIA 3QPHA 1NLOC 2F2VA 1WYXA 2RI3A 4H1OA 2E41A 1O46A 2VXEA 2XKOC 3O5ZA 1QP2A 1YVLA 4MMKA 1TUDA 3EG9A 5KYWB 2LQWA 1UGSB 2IUIA 3J81E 2WSFE 3K2MA 1JJ2S 2C9WA 2BIVA 2ETZA 1M9SA 2JMCA 4QSYA 3OA6A 1YCSB 2R5AA 2WSCE 4PJOD 4L59A 1O4HA 1VQ5T 3DKMA 1NZLA 3CBMA 2PVOB 5KYYA 3IMJA 3CCJT 2RN8A 1TCEA 3N84A 1D09B 1UE9A 2GNCA 3V7CA 4K2RA 2K3XA 3HCKA 3A8GB 1O45A 3CCVA 2JM8A 2M1HA 2RK1A 4AG1C 3NTKA 3RKXA 4LDXA 3JV3A 1SHAA 1BU1A 3HP9A 4MZTA 4X9CA 1XQHA 1GCQC 4FYVB 3JB9H 1VYTA 1LUIA 1BI3A 1WJRA 3QUIA 3JCMX 3E19A 1JB0E 1M90R 4TZIA 2LX7A 1FWZA 1YIJA 1C1AA 3L2QA 2NWMA 1QKWA 1Z9ZA 3EG3A 3WXMB 1R1SA 3JCMW 4QKUA 2R58A 4ELZC 2J6KA 4II1A 1M1KR 3G7ZA 2YDLA 2SHPA 4MZPA 2LQKA 4BD3A 4A4KA 2MOXA 3EAZA 2HMHA 3H0FA 1P92A 2KQWA 3CMEQ 1WLPB 2MK2A 2IIMA 3VS7A 1AB2A 2YRCA 3EAEA 5GJWB 1S72A 1GL5A 5FRMA 3NTHA 1D3BA 1I07A 2V26A 1K8AR 2O01E 1BI2A 2EVRA 2DFUA 3CMAT 4OHIA 2X9HA 1M1KU 4C92C 3NFCA 1O4JA 2QXFA 4CI0C 1Q81C 1LKKA 3CCEA 2P4TA 3RNJA 1BI1A 1AYBA 4KBMB 1LKLA 5GANg 3MPUB 2F2WA 1B3QA 1YJWA 4M75F 5DM7R 2L8DA 4C8QA 1NZVA 3OYKA 4F7UG 1E7OA 2E70A 2E65A 3R6OA 3O8VA 1YWPA 4IIMA 2CREA 1K8AU 4ROJA 4FIBA 4HCKA 5A2QE 4F16A 1VQNT 1F2FA 1Y0MA 3I55A 1M1GA 4GLMA 2HKQB 2JS2A 2PNIA 4F7UB 2KGTA 1O4FA 2ESWA 2OTJA 4XTUA 4KRTA 4RTUA 5GAMh 1Y7XA 1WA7A 5D6XA 2IG0A 1UJ0A 4J9DA 4OHEA 2KYBA 4M7DA 2H46E 5GJIA 2CP5A 5I2MA 4C92E 2E5KA 4MZMA 3M57A 1N8RC 2GBQA 2RQWA 3CXCP 4M77A 3JCMJ 4OHLA 1PC0A 3INZA 2AKKA 4D8DA 5KE3A 2RHXA 4M78C 4C0GA 2JTEA 1OZ3A 1WIEA 3MP6A 1LCJA 4FYXB 2DYBA 2OQ1A 4L6V5 4KH1B 1YHQQ 2DA9A 3OSSC 1HXDA 1PKSA 3OS2A 4JGHA 2PNBA 1NM7A 3CXCA 4K45A 3PS5A 2DL3A 4J7FA 1U06A 4ME7A 4QW2A 5HK3A 1VIEA 1E6GA 4N4GA 1YITA 3X26B 3VRNA 3G4ST 4J9CA 1I0CA 3UPUA 2P0QA 2KK4A 1YJNA 1JXOA 2HDAA 6AT1B 2MC1A 2EYWA 1NPRA 2FG0A 2LCLA 3ME9A 4BE0A 2Y90A 1PM3A 2DLYA 1W6XA 2L3QA 3A8LB 1SSFA 1IHVA 2Y4XA 4ATOA 2GTJA 4HVWA 4E93A 2L89A 2KMTA 3QHSA 3UDCA 2ZPBB 3VS3A 2NUPB 5CDWA 4B9XA 1RAGB 1GFDA 4AG2C 3RIRA 1Q86R 5I2SA 3G6EQ 2C0IA 4M78E 1SG5A 2MPXC 3VROA 4M7AC 1VQ9T 1ZSZA 1AEYA 1AHJB 2ED1A 2QEXQ 2QAZA 3HTRA 4EMKB 2LT1A 3A98A 1QVFP 3QSUA 2ZPGB 2I0NA 2L0AA 1YI2T 1TOVA 2X4YA 2EOBA 3S8OA 3L2WA 5EEQA 1TTHB 3C95A 3LYVA 2OAUA 4F5AA 1NJIR 4ORZA 1D0YA 3OP0A 1QVFA 2K7AB 4QVCA 4N4IA 1BK2A 1ZBXA 3BFMA 2E3IA 3OMGA 4FYYB 3GPLA 3HSBA 1MUZA 2EQUA 3SDZA 2VGNA 2L3RA 3CC7T 2IUHA 2EGAA 2DTHA 3EHQA 3HFNA 1KC8R 3PGGA 4FL2A 3TCJA 2GTOA 1AWXA 4BACA 3GNFB 1VQKQ 3JCMg 3LYIA 3QKJA 2FCIA 5GANd 2GFAA 1O42A 2YWWA 1WHMA 1SKUB 2XG8D 2C06A 1O4LA 1YHQT 2MQIA 1VQPQ 1NJIU 2V8KA 5J39A 4PJOC 3CCSA 2HUWA 4A4CA 2K6DA 1VQ8Q 2LDMA 1FU5A 2VVKA 3OMCA 1O4NA 3CPFA 4F5BA 2DEUA 3THKA 2ZPIB 2LNXA 1ABOA 2KDSA 2EYZA 2V8IA 1KC8U 2KGYA 3EGXA 1PRMC 4XTWA 1S1NA 1YJ9A 1X27A 2VKNA 2YHTA 1T0HA 1K0XA 2XICA 5KYXB 2EPDA 2PU9B 1PSEA 5CKDA 1BKLA 2EO6A 2W0ZA 1D4WA 2NYSA 4JUVA 1BI0A 2CR4A 2B86A 3GLXA 3OB2B 2QQAA 3J7AF 4O5VA 1D3BB 1V29B 2AT1B 4IURA 1O4CA 5DF6A 3WVDB 3EFOA 3PT9A 3WVEB 1VQ4Q 2OZOA 5GAMg 1F1BB 2ECDA 1Y1UA 2EKXA 3GQIB 4JJBA 4E7HA 2P0PA 2CH4W 3HKSA 4FW2A 1BIAA 3OB1B 1KA6A 1PD0A 4GY5A 2HEQA 2JZ2A 1X2KA 4CC7A 1OO4A 3V7SA 3CCRT 1BB9A 4QT7A 2RPNA 1U1TA 2LVMA 5FU7B 2KBTA 2OJ2A 2FPDA 4NOYA 5L23A 1IO6A 1OOTA 1SSHA 3M9QA 5CKBA 3BUMB 1RJAA 4ZGEB 5EHPA 1VQOQ 3VGOA 4X34A 2BZ8A 4M77G 2QGGA 1EX4A 5J3BA 1I1JA 5ECAA 1VQ5A 3OYJA 1VQLQ 2FPEA 2X4JA 4DA4A 5CR2A 2MCNA 3ULRB 3CCJA 4A4FA 1UGVA 1WI7A 4JJCA 4PFPA 1EIFA 5GAN6 3PMTA 4M7AF 1O4BA 2RJCA 2JT4A 1RACB 3ZEHA 1Q81R 1O4KA 3PNWC 4OMOA 2HBWA 3URGA 1A1CA 1QMCA 4C8QF 4ESRA 1VQPT 2DX1A 4M77B 3OB9A 2OX7A 1VQ8T 1D1AA 3AHUA 3CD6Q 4YTLA 1TZEE 5HKZA 3KXTA 2JMAA 2DE0X 2VGMA 1MGQA 3OYNA 1GBQA 4JRQA 2RM4A 5CQYA 4B9WA 2C0OA 3OSVA 2DPPB 1LUNA 1Q81U 1R1QA 1O44A 2G3RA 3DB4A 1Z3KA 1GXIE 2CZ1B 3IMDA 4M7DF 1GRIA 4FYWB 3UF4A 3V7RA 2LRQA 3D7SB 4EY0A 5GAMf 5KYNA 1UGQB 1RAHB 3CCQQ 3JB9J 1CWDL 1BBZA 3F70A 1N8RR 2HKNA 2QG9B 4NS5A 4GBQA 1HYOA 1M3AA 2EFIA 4LE9A 3TVTA 2FZKB 2JVVA 4NWGA 5FROA 1AWJA 5I11A 3SWNC 1ZLMA 2KXDA 3CMAA 1ZSZB 2ZPFB 3OYMA 2COYA 3M0UA 4BY6B 3QYHB 3L2VA 1X0NA 2BZXA 2VASA 2YLBA 3QZ5B 4P9VA 3MEWA 4BI8B 5GJVB 1UB4A 2KT8A 1M27A 1T0JA 1AOJA 3KBGA 1O4DA 2PVGB 1LCKA 1N8RU 2D0QB 4JLIA 1BYMA 3CCLT 2JW4A 1VQLT 2A28A 1HCSB 2QMSA 4J9HA 4GWFA 1CJ1A 2DCRA 2ATCB 3EGDB 1RAIB 2KE9A 3G71A 7AT1B 2E4HA 1VQNA 5IHKA 5GJHA 1EFNA 2H5KA 5GAN4 5LJ3e 2QDYB 2RJDA 4V2SA 5GAMd 2XI9A 1Q95G 5LJ5e 1NBEB 2R5MA 1QQJA 5IBMA 2V1RA 1BKBA 3QG1A 2VIFA 2AK5A 2MI6A 2BUDA 3TKZA 2O9VA 4C8QD 1UJYA 3CC4A 4LD6A 2X4XA 5LL6S 2FRYA 2CS0A 3M5AA 1QWEA 4DGPA 2LP5A 1TXQA 4DOWA 1E6HA 1OEBA 2DLPA 4ZN3A 1A1BA 3FLGA 1IZ6A 1VYUA 4A4BA 1G5VA 1VQ7Q 4GL9E 1XNIA 2NUPA 1JYQA 4RCCA 2IVWA 3BUXB 2VV5A 4PL6A 5DC9A 4MDWA 2CT3A 1UHCA 1Q82U 4J9IA 3CCQT 3G4SA 4EMKA 3BE3A 4M7DD 4LDWA 1UUEA 4LNPA 2CUBA 3EFOB 2A37A 2CS7A 2DM1A 4J9EA 3VS6A 4M77D 4C5EA 1JU5C 3RDVA 4C92A 1IHWA 4M75E 2DM0A 2YU7A 3UA7A 1KD1U 5D0JA 3KUFA 5DY9A 4E47A 1YCYA 3S6WA 5AT1B 2K7AA 2QA4T 2SEMA 5CIUA 1AOUF 4DBHA 3FRNA 4NL3A 4A4HA 1MNEA 4PJNA 3S9KA 1CSYA 1O4IA 2J05A 4OHDA 2HQHA 1VQ6Q 3CCUQ 5J26A 1VQ9A 2C0TA 2LT4A 1B34A 2K3BA 3QBYA 5KE2A 2D0NA 3HPWA 1PD1A 2HBPA 1YI2A 1QVPA 4RTTA 3I56Q 4AFQC 2COWA 2PUKB 5CVIA 3JSCA 1I81A 2EYQA 2GQIA 2F1LA 3NHNA 1N9SA 2OTLQ 2RSYA 2L3PA 3S3OA 1O4GA 2GFUA 3VRPA 4BE2A 4KT0E 1D1ZA 2DZ9A 1IB8A 4Y91A 1R0CB 1ZBJA 2ROTA 4OMPA 1KQ1A 2EWNA 2JJ9A 3T04A 4HCCA 1PKTA 3DB3A 3CC7A 2JUFA 4QQ6A 4PJMA 4BI4A 4RG2A 3TEEA 5C6SA 3CCMQ 4C5GA 1O4EA 3VYHB 2VXFA 4E7IA 1QP3A 5KYXA 1XTDA 2EJFA 4J9GA 4RTVA 2COZA 3HL8A 2QYZA 2EQIA 4GPLB 1M90U 1PCXA 1U1SA 4XU0A 3G1JA 4FW1A 5KCOA 1VQ7T 1Y96B 2EQJA 1WHHA 2DKGA 4RTYA 5KYUA 2Y1MA 1BHHA 3REAB 1QCNA 5CK9A 2LNWA 1IGQA 1R0BG 3MAZA 3QDRB 1WJSA 3FC3A 3MXCA 4U17A 1PG5B 3L42A 3N5BB 2QQ9A 1GHUA 2CP3A 4OHHA 3JRZA 2FZGB 5HK0A 1A1AA 3HIZB 1ZA1B 2M16A 5IHNA 3CC2Q 4JPBW 1BIBA 2QQSA 1VYVA 9ATCB 1G8XA 1AOTF 8AT1B 2CUDA 3BUNB 2AHJB 4XQ3A 3OV1A 2QDLA 2O9SA 2D6FA 3JB9G 4P9ZA 1LNXA 1UG1A 1RI0A 5FU6C 2L4KA 4OGCA 1X2QA 4JDSA 3CCVQ 4HT8A 4Z02A 2RJEA 2RQTA 1RUWA 2XDPA 3QO3A 2DBKA 2CP6A 4LDYA 4JEGA 5AXIA 2DYIA 1UEBA 1WFWA 3M59A 5CKHA 3ZBDA 1NEGA 2PQWA 3M58A 4LDUA 1GBRA 3OYDA 3ZL7C 2K2VA 1SHBA 1RAAB 8ATCB 1YIJQ 3CCRA 2YRVA 4MDXA 2EJ9A 2FYKA 2KRNA 2K4YA 3M0RA 1ABQA 4OB2B 4KGZB 4KGXB 4UC4A 3BKBA 1AT1B 2MYSA 4ANJA 3BUOB 4JE4A 4AFSC 3JCMP 2YUOA 2MF2A 1QVGA 4QVDA 3CCMT 1K9AA 2KNBB 2CGHA 5IT9E 2L5QA 2KY9A 3CMET 2LZ6B 1NG2A 4N0AA 4F7UF 3US4A 1BF5A 1AYAA 2P84A 1M61A 4X1VA 2JYQA 1WJQA 3LW5E 5LJ3h 3GXXA 1S72Q 4OB1B 2DTOA 3TL0A 4IUQA 4KGVB 1NYGA 5LJ5h 3VRZA 3A8OB 1B47A 4E7ZA 3A8HB 2DZCA 2GSBA 1N27A 3UT1A 2EU0A 4C92G 5EG2A 2DL5A 1YJWQ 1NRVA 2X3XD 3PJPA 2RJFA 4AT1B 2QTVA 2JM9A 1ZHIA 1QG1E 3H9NA 3CC2T 2EYXA 4XTYA 2RO0A 2VYTA 3EACA 3SD4A 4C8QC 2IZVA 5GAOm 4FU6A 1OU8A 2YLCA 1OYXA 1NLPC 3TSZA 2X3WD 5GAN2 3LLRA 4C92B 3EG0A 3H6ZA 4C0DC 1BKMA 4J6WA 2PUOB 2DIQA 2Y1NA 3I55Q 1TWBA 1U5SA 3CCVT 3M7FA 2ZPHB 4K11A 1NZ9A 3LWIA 1GCPA 3QDFA 2OTJQ 1KIKA 1Q86U 4MMLA 2XDDA 2EGEA 3OS0A 3LWHA 3VJPA 2FO0A 2VB6A 3VS2A 3EGDA 4OVAA 2EYYA 3U23A 1UUSA 3ER0A 4ZTFA 3PQZA 5GAOp 2DLZA 2RHUA 1B34B 3QWXX 1YIJT 1O4OA 2LC4A 4AMCA 1ZQ1A 2PTKA 4M7DC 2LCCA 2KAFA 3FIFA 4M78G 4ELYC 4M77C 1JYUA 1K76A 3SHWA 4M7AE 2DERA 2R57A 3X24B 2L6KA 2BE9B 2D1XA 2E12A 3VS4A 3OYGA 3CCLA 4C8QE 1QWFA 1OZ2A 1Q7YC 3DLMA 1XA6A 3PIPA 3OW2A 2BE7D 1I8FA 2CDTA 4J6YA 1YITQ 5A0LA 1CKBA 1I3ZA 3CXCS 1D0ZA 1G83A 1YFNA 2K9GA 4M78B 1YJNQ 4OMNA 2H3EB 1S72T 3CEYA 2SRCA 3GBQA 5IHIA 4DEXA 5HKCA 4BUGA 1A1EA 3S3MA 3PFVA 1RAFB 4XAXB 3UWNA 5CKEA 1HSQA 1BLJA 1H8KA 1N5ZA 1K9MC 2M51A 4GLKA 1KHCA 3LH0A 4BB7A 3GF5A 1YJWT 4C0ZA 5KYUB 3BY7A 4M7DE 1BHHB 3TSWA 3EH2A 3G6ET 1MMDA 1PHTA 1O4QA 1D1BA 1A81A 2FPFA 4RTXA 2QEXT 1BFIA 3PLFB 2DJZA 1ZX6A 5KH6A 4PJOE 1MMGA 4HVVA 2XU8A 3OYFA 1D1CA 1WHLA 4RTZA 3OYIA 1X75C 2AOBA 1H92A 2QQRA 3R6NA 4FT2A 1KQSP 2I2LA 1K73C 1AVZC 1PRLC 4KUIA 4PNOA 1I5OB 4A63B 1ZUYA 3SWNA 2DX0A 4QQGA 4B6MA 5LJ3j 3P8BB 5HKWA 4F17A 2OTJT 5GAN8 2QQBA 2DJQA 2V8JA 2HL5C 3MEAA 2A36A 2RNAA 4BE1A 5LJ5j 4X6SA 2MMPA 1QVFS 5KAZA 1KQSA 2CZ0B 2YUNA 3SFMA 4IUPA 3OS1A 2EIFA 1AZGB 2EKHA 3MJXA 4PK4A 2IPOB 2O31A 1M2OA 2QA4A 2HDXA 1WGSA 3I35A 3H41A 5DLOA 4A4EA 3OYAA 1VQKT 5GAN7 2KR3A 3VUZA 2XP1A 1BMBA 1N6AA 1WDXA 2K79A 2A0FB 1YNZA 3CCSQ 2CI8A 1G2BA 3ASKA 3AT1B 2QTXA 2RB6A 4L5GA 1RADB 2RMOA 3FB9A 4DBQA 4HA8A 2DXBA 3OYEA 3HHMB 5CCAA 1FYRA 1BCMA 2CSIA 1BCOA 4WF2A 2DETA 3C12A 5I21A 4OB0B 2PLEA 1O4PA 4M75A 1YJ9Q 1TS9A 2E10A 4C5IA 1MV0B 1Y96A 3EH1A 4DQ2A 3JCMe 3BDLA 3QXEB 1X43A 4PJOB 2E3HA 3VUBA 3S8LA 3OYHA 3RMQA 3L1AA 5I6VA 2JS0A 5D6YA 2MWPA 3LH5A 1TU0B 3P8HA 4M77F 1VQ4T 2PNAA 1O49A 1AD5A 1D4TA 2XMFA 2XHCA 3MXYA 5FWBA 2DK3A 2A3LA 3T9NA 1OX9A 2XK0A 3FJPA 2FVUA 2EJGA 3VRQA 1RI9A 2HCKA 3VS5A 1O4MA 5DC0B 4FSSA 1M30A 1JJ2A 1LUKA 3EFRA 2GE9A 4RTWA 1O41A 2CKKA 2X51A 3QJYA 2EAYA 4QQDA 3ZFJA 1OX8A 1JU5A 1TG0A 2CZ6B 3UYOA 1RAEB 1OV3A 4FL6A 1T3SA 2CRHA 1NEBA 4WCIA 1WZOA 2CH4A 1IREB 1BM2A 4J83A 4FM4B 1VQOT 1NYFA 1XOVA 1KFZA 2K5FA 1B7TA 4HCZA 2JOYA 1VQ5Q 3N8MA 5LJ3f 1J3TA 3E9GA 3GP8A 4CC3A 3CCJQ 1KA7A 1WPYA 2FEIA 2VUBA 1OO3A 3QYGB 5LJ5f 1H3ZA 1KQSS 2E6ZA 5AULA 2L2PA 2K3YA 1C6VX 2CYZB 5GANh 1GCQA 4HCBA 2CP2A 3V8JA 4KUDK 1V1CA 2H3JA 2O4XB 2P0KA 1PICA 5DC4A 2BZYA 2RQVA 1VQMQ 2D8HA 1CWEA 2CP7A 2MRKA 3CD6T 2DNUA 4JRPA 3VU3C 4X9DA 1DJ7B 1CSKA 1OU9A 1K1ZA 4LUEA 2PLDA 2O2OA 3VV0A 2J6OA 1YJ9T 3GOXA 5GAOr 2KI7A 1K4US 3GXWA 4K44A 2RMXA 3I5SA 1RLQC 4EDUA 3KFVA 3E1SA 1BG1A 2AZVA 1FMKA 2RI2A 3RMSA 4Y92A 1O75A 4XK8E 2ENMA 1IGUA 3CCMA 2YSXA 3RKWA 4JZ3A 4CC4B 5LJ3d 3CMEA 3X28B 1SHDA 2JTMA 5LJ5d 2RHIA 2GQVA 4Z88A 1ZA2B 2E5QA 1O9SA 3CD3A 5CO7A 1X6OA 1ZSGA 3VS1A 2LX9A 4BDZA 1AWOA 1RL2A 1WXTA 2CSQA 1KQ2A 4E7LA 3PTAA 3CMAQ 1AZEA 2ZAEA 1SHFA 1Q7YR 3GIBA 4R0KA 3H0IA 3CBLA 2LJ3A 4E68A 2FRWA 1FXXA 3CC2A 2FHDA 4XTZA 4BDYA 3M0QA 2ECZA 3VYGA 1M27C 3SWNB 3TREA 3RBBB 1WHKA 3E2UA 1W1FA 1VIFA 2WSEE 4IUTA 1JWOA 4F04B 3C4SA 3TU4K 1OPKA 3G71Q 5GAOq 3I5RA 4PKCC 2M0YA 1SPKA 1VQNQ 2HMAA 1PNJA 2M02A 3RUXA 1K9MR 1LVKA 2LJ0A 4PFOA 1Q7YU 3OYLA 3TQ7P 1HK9A 3QWYA 4LXCA 2D8JA 1SF9A 1JRIA 1VQMT 1H3HA 4M75G 3H8ZA 1H9OA 2K79B 3CC4Q 5GMKe 2DF6A 1GFCA 3M4GA 4M78A 3V8LA 3META 1JYRA 3JAME 4N4HA 1JQQA 3EHRA 4DBRA 3PVQA 1YBYA 1M4ZA 2PVDB 2EQMA 1K73R 1A07A 2A7YA 1K0SA 2YXYA 3PSJA 4F7UE 4EIKA 3N7YA 2K2MA 1YHQA 1K9MU 2F5KA 3M0PA 3M53A 4M75B
chains in the Genus database with same CATH topology
2KBTA 2OJ2A 2FPDA 5L23A 3VS0A 1IO6A 2EYXA 2MIOA 3EG2A 1OOTA 1SSHA 3EACA 3BUMB 1M8MA 1RJAA 4U1PA 2J7IA 5EHPA 2Y3AB 2IZVA 1X6BA 2J06A 3VGOA 2BZ8A 3REBB 2G6FX 1JO8A 1AWWA 1NLPC 3TSZA 2X3WD 1SPRA 4L1BB 1BHFA 4OMMA 1I1JA 3EG0A 5ECAA 2RQUA 2FPEA 1BKMA 1Y57A 2Y1NA 2MCNA 3ULRB 1U5SA 3M7FA 1F1WA 5EELA 4K11A 1HCTB 1UGVA 2V1QA 1WI7A 1BFJA 1RQQC 1FHSA 4JJCA 1GCPA 4LUDA 2EL8A 1O4BA 2JT4A 1KIKA 1UDLA 2O88A 1O4KA 2LQNA 4OMOA 5IBSA 2EGEA 2HBWA 2DL8A 1MV3A 1A1CA 2FO0A 2LJ1A 1MW4A 4LN2A 3SEMA 3VS2A 4ESRA 1UUSA 1QLYA 2DX1A 2EYYA 3U23A 1O4RA 3PQZA 5HKYA 2ED0A 2DLZA 2EW3A 2EGCA 2JXBA 2KROA 1SRMA 3EGUA 3QWXX 1O4OA 3BUWB 1TZEE 4J9FA 1M3CA 5HKZA 5EG3B 5I22A 1P13A 2PTKA 2MRJA 2JMAA 1SHGA 1YN8A 2DE0X 1YWOA 3CXLA 1NLOC 2F2VA 1WYXA 1GBQA 4D8KA 3S8NA 2KEAA 1JYUA 1K76A 4H1OA 3SHWA 3VRYA 2C0OA 1O46A 3O5ZA 1YVLA 4JZ4A 1TUDA 1LUNA 2YT6A 2L6KA 2D1XA 2LQWA 1WQUA 2IUIA 3K2MA 5J3XA 3VS4A 1BLKA 2C9WA 1QWFA 1CKAA 1R1QA 2ETZA 1O44A 2JMCA 1XA6A 4QSYA 2RF0A 3M0SA 1Z3KA 4FL3A 2CDTA 1FU6A 3IMDA 1CKBA 1I3ZA 1GRIA 1YCSB 3UF4A 1X6CA 1G83A 1O4HA 2K9GA 4EY0A 1NZLA 4OMNA 2SRCA 2DL4A 4DEYA 3IMJA 3GBQA 1OPLA 2RN8A 5IHIA 1BBZA 1UFFA 1CWDL 4DEXA 1TCEA 2PZ1A 3N84A 1UE9A 4GBQA 1M3AA 2GNCA 4LE9A 1A1EA 1IS0A 3PFVA 3TVTA 4ZNXA 4K2RA 3HCKA 1O45A 2JM8A 3I9QA 1HSQA 4NWGA 1AWJA 4AG1C 1BLJA 5I11A 4RUGA 1H8KA 1N5ZA 1ZLMA 1MILA 2KXDA 1FBVA 2M51A 3JV3A 3H0HA 1SHAA 1BU1A 3CQTA 1JEGA 1B07A 2H8HA 3M0UA 1BHHB 1CSZA 3TSWA 1QADA 1GCQC 1X0NA 1VYTA 2BZXA 2AOAA 1LUIA 1PHTA 4P9VA 1O4QA 5BO4A 1QKXA 5GJVB 2LMJA 4TZIA 1A81A 2FPFA 2KT8A 4RTXA 1YP5A 2LX7A 3PLFB 1BFIA 2DRMA 1ZX6A 1M27A 2NWMA 1T0JA 4IIOA 1AOJA 1QKWA 1Z9ZA 3EG3A 4HVVA 1O4DA 1R1SA 1LCKA 4RTZA 4Z8AA 2AOBA 1RPYA 1H92A 4F14A 2J6KA 2JW4A 3WA4A 1ZFPE 2A28A 3R6NA 2KK6A 1HCSB 2QMSA 2ROLA 4J9HA 3ZNIA 2YSQA 1AVZC 1PRLC 4GWFA 2YDLA 1CJ1A 2DCRA 4A63B 2SHPA 1ZUYA 2DX0A 1KSWA 3IN7A 2KE9A 5HKWA 4F17A 2MOXA 5IHKA 5GJHA 3EAZA 4E6RA 1EFNA 2DJQA 2H5KA 3H0FA 2HMHA 2KXCA 3NPFA 1WLPB 2YUPA 2A36A 2RNAA 2MK2A 4X6SA 2IIMA 4AFZC 2L3SA 3VS7A 5KAZA 2YUNA 1AB2A 5GJWB 1WX6A 2W10A 5IBMA 2EKHA 1AZGB 2V1RA 1GL5A 2VIFA 2AK5A 2O31A 2HDXA 1I07A 3TKZA 2O9VA 3NMZC 1UJYA 1UHFA 3I35A 3H41A 2EVRA 2RVFA 2KR3A 4HXJA 4OHIA 2XP1A 2FRYA 2CS0A 1BMBA 1WDXA 2K79A 1QWEA 1O4JA 1YNZA 1LKKA 4DGPA 2CI8A 1G2BA 2RSYA 2LP5A 3RNJA 1AYBA 1LKLA 1E6HA 1OEBA 2F2WA 2RMOA 2DLPA 2KNOA 1B3QA 1A1BA 4XZ1A 3HHMB 1WXUA 1VYUA 2GGRA 1M3BA 1NZVA 4A4BA 5FWCA 1FYRA 4GL9E 1JYQA 2CSIA 3VRRA 3BUXB 1E7OA 2AUGA 5DC9A 2CT4A 2PLEA 5EC7A 2CT3A 1UHCA 1O4PA 4H34A 2KRMA 1YWPA 4IIMA 2CREA 2RORA 1MV0B 4ROJA 4J9IA 2F2XA 4HCKA 2J6FA 1UUEA 1X43A 4LNPA 2CUBA 4F16A 4AFUC 1F2FA 1Y0MA 2A37A 2DM1A 2DMOA 3CWGA 4J9EA 1RLPC 4GLMA 3VS6A 3S8LA 1JU5C 2JS2A 5I6VA 1O4AA 1W70A 2JS0A 2PNIA 4NWFA 2DM0A 2KGTA 2YU7A 3UA7A 2ESWA 1O4FA 2AZSA 3LH5A 5D0JA 4KRTA 1LUMA 1A09A 4RTUA 1WA7A 2KYMA 2YUQA 2K7AA 2PNAA 2SEMA 1UJ0A 4J9DA 1O49A 1AD5A 1D4TA 2XMFA 4OHEA 2KYBA 2H46E 5GJIA 1AOUF 3MXYA 5FWBA 3EG1A 2HDVA 1FBZA 2DVJA 2E5KA 1O4IA 2J05A 4OHDA 3S9KA 2GBQA 2RQWA 3VRQA 3FJ5A 1CSYA 1RI9A 2HCKA 3VS5A 4OHLA 1O4MA 2AKKA 4D8DA 1IJRA 1ARKA 2C0TA 5DC0B 2JTEA 1WIEA 4FSSA 1M30A 2K3BA 5FW9A 1LCJA 3C0CA 2DYBA 1LUKA 2OQ1A 2D0NA 1VA7A 2GE9A 4OMLA 2KT1A 4RTWA 1O41A 2DA9A 4RTTA 1A08A 4AFQC 1PKSA 4FBNA 4J9BA 4JGHA 2IUGA 3IQLA 2PNBA 1JU5A 1NM7A 2GQIA 1TG0A 4K45A 3NHNA 1O47A 3PS5A 3UYOA 1OV3A 2DL3A 1T3SA 1WXBA 1U06A 2CRHA 1NEBA 2L3PA 4WCIA 1O4GA 2CH4A 2CIAA 1BM2A 1NYFA 1XOVA 1E6GA 1KFZA 3VRPA 3VRNA 1D1ZA 4J9CA 1I0CA 2EYVA 1ZBJA 2ROTA 4OMPA 3N8MA 1J3TA 3T04A 1JXOA 1PKTA 2HDAA 1KA7A 2P4RA 4CC3A 2MC1A 2FEIA 2EYWA 2FG0A 1OO3A 2DLYA 1W6XA 2L3QA 1X6GA 3UATA 4F59A 2A08A 3PE0A 1O4EA 2GTJA 5AULA 4HVWA 2L2PA 4M4ZA 3KFJA 4E93A 1KJWA 2OAWA 2DL7A 4J9GA 4RTVA 1GCQA 1SPSA 3VS3A 5CDWA 1UURA 1V1CA 1YVHA 1GFDA 2EQIA 1PICA 2DILA 4AG2C 2BZYA 2RQVA 1JXMA 2D8HA 1CWEA 1UECA 4GPLB 2AKLA 2MRKA 2C0IA 2DNUA 3VROA 1QCFA 1AEYA 4RTYA 2ED1A 2Y1MA 3UA6A 1CSKA 1O48A 1K1ZA 1TUCA 4LUEA 1T3LA 1BHHA 2PLDA 2O2OA 3A98A 5DC4A 2I0NA 2L0AA 3REAB 2J6OA 1O43A 2LNWA 3MAZA 2EOBA 3S8OA 4U17A 3MXCA 1PWTA 1ZUUA 5IH2A 1K4US 3GXWA 5EEQA 3IN8A 1GHUA 3NGPA 4OHHA 1ZUKA 1HD3A 1A1AA 2RMXA 5IXBA 3HIZB 3I5SA 4K44A 1RLQC 3KFVA 1BG1A 4F5AA 2AZVA 4ORZA 5IHNA 1FMKA 4JPBW 3OP0A 4Y92A 1VYVA 2K7AB 1AOTF 2CUDA 2L3TA 2ENMA 3BUNB 3OV1A 2YSXA 4JZ3A 2QDLA 1BK2A 4CC4B 2O9SA 1MUZA 4P9ZA 2DBMA 2EO3A 1SHDA 1UG1A 2IUHA 2EGAA 3EHQA 2L4KA 1X2QA 4Z88A 2LNHB 4FL2A 3CD3A 1ZSGA 3VS1A 1FYNA 2GTOA 1AWXA 2NUZA 2RQTA 1AWOA 1RUWA 4JJDA 1WXTA 2CSQA 2DBKA 3OVEA 4JEGA 5AXIA 1AZEA 1R1PA 1SRLA 2FCIA 1WFWA 1O42A 1SHFA 3PVLA 1O4LA 2CBLA 1NEGA 1X69A 1GBRA 2MQIA 1HJDA 4R0KA 2HUWA 2BBUA 4A4CA 2K6DA 3H0IA 3ZL7C 1FU5A 2VVKA 3CBLA 2RQRA 1SHBA 4DGXA 2B3OA 2LJ3A 4E68A 2LCSA 1O4NA 1Z9QA 2FRWA 4F5BA 3THKA 2LNXA 1ABOA 2KRNA 2EYZA 3M0QA 2HSPA 2ECZA 1ABQA 3M0RA 1SEMA 1M27C 3RBBB 1PRMC 4HVUA 4XZ0A 1S1NA 1W1FA 1X27A 3BKBA 2VKNA 1JWOA 2CI9A 1T0HA 1K0XA 3BUOB 4JE4A 1U3OA 5EHRA 4Z89A 2EPDA 4OMQA 2YUOA 4AFSC 1OPKA 1BKLA 2EO6A 3I5RA 2M0YA 1SPKA 2LCTA 2EBPA 1PNJA 1K9AA 2KNBB 2W0ZA 1D4WA 2CR4A 2LJ0A 2B86A 2VWFA 3OB2B 2LZ6B 1NG2A 3US4A 1BF5A 1AYAA 1O4CA 3QWYA 5DF6A 1M61A 3PSKA 4X1VA 2JYQA 2D8JA 3GXXA 1A0NB 3TL0A 1H3HA 2OZOA 1UTIA 1NYGA 1H9OA 2ECDA 1Y1UA 2K79B 1KC2A 2EKXA 3GQIB 4JJBA 1AYDA 2DF6A 1GFCA 2DRKA 3VRZA 4WWQA 1B47A 1AYCA 2CH4W 1JYRA 1JQQA 3EHRA 2GSBA 3OB1B 3PVQA 2OI3A 2KRSA 1KA6A 3C7IA 2EU0A 4EIHA 2HEQA 1A07A 2DL5A 1SKJA 4CC2A 1K0SA 3PSJA 1NRVA 2X3XD 4EIKA 5IXFA 1X2KA 3N7YA 2K2MA 4CC7A 1OO4A 3PJPA 3M0PA 1BB9A 2ABLA 2JM9A 2BTTA 3M0TA 2RPNA 4QT7A 5HCKA 1QG1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBT A;  2OJ2 A;  2FPD A;  5L23 A;  3VS0 A;  1IO6 A;  2EYX A;  2MIO A;  3EG2 A;  1OOT A;  1SSH A;  3EAC A;  3BUM B;  1M8M A;  1RJA A;  4U1P A;  2J7I A;  5EHP A;  2Y3A B;  2IZV A;  1X6B A;  2J06 A;  3VGO A;  2BZ8 A;  3REB B;  2G6F X;  1JO8 A;  1AWW A;  1NLP C;  3TSZ A;  2X3W D;  1SPR A;  4L1B B;  1BHF A;  4OMM A;  1I1J A;  3EG0 A;  5ECA A;  2RQU A;  2FPE A;  1BKM A;  1Y57 A;  2Y1N A;  2MCN A;  3ULR B;  1U5S A;  3M7F A;  1F1W A;  5EEL A;  4K11 A;  1HCT B;  1UGV A;  2V1Q A;  1WI7 A;  1BFJ A;  1RQQ C;  1FHS A;  4JJC A;  1GCP A;  4LUD A;  2EL8 A;  1O4B A;  2JT4 A;  1KIK A;  1UDL A;  2O88 A;  1O4K A;  2LQN A;  4OMO A;  5IBS A;  2EGE A;  2HBW A;  2DL8 A;  1MV3 A;  1A1C A;  2FO0 A;  2LJ1 A;  1MW4 A;  4LN2 A;  3SEM A;  3VS2 A;  4ESR A;  1UUS A;  1QLY A;  2DX1 A;  2EYY A;  3U23 A;  1O4R A;  3PQZ A;  5HKY A;  2ED0 A;  2DLZ A;  2EW3 A;  2EGC A;  2JXB A;  2KRO A;  1SRM A;  3EGU A;  3QWX X;  1O4O A;  3BUW B;  1TZE E;  4J9F A;  1M3C A;  5HKZ A;  5EG3 B;  5I22 A;  1P13 A;  2PTK A;  2MRJ A;  2JMA A;  1SHG A;  1YN8 A;  2DE0 X;  1YWO A;  3CXL A;  1NLO C;  2F2V A;  1WYX A;  1GBQ A;  4D8K A;  3S8N A;  2KEA A;  1JYU A;  1K76 A;  4H1O A;  3SHW A;  3VRY A;  2C0O A;  1O46 A;  3O5Z A;  1YVL A;  4JZ4 A;  1TUD A;  1LUN A;  2YT6 A;  2L6K A;  2D1X A;  2LQW A;  1WQU A;  2IUI A;  3K2M A;  5J3X A;  3VS4 A;  1BLK A;  2C9W A;  1QWF A;  1CKA A;  1R1Q A;  2ETZ A;  1O44 A;  2JMC A;  1XA6 A;  4QSY A;  2RF0 A;  3M0S A;  1Z3K A;  4FL3 A;  2CDT A;  1FU6 A;  3IMD A;  1CKB A;  1I3Z A;  1GRI A;  1YCS B;  3UF4 A;  1X6C A;  1G83 A;  1O4H A;  2K9G A;  4EY0 A;  1NZL A;  4OMN A;  2SRC A;  2DL4 A;  4DEY A;  3IMJ A;  3GBQ A;  1OPL A;  2RN8 A;  5IHI A;  1BBZ A;  1UFF A;  1CWD L;  4DEX A;  1TCE A;  2PZ1 A;  3N84 A;  1UE9 A;  4GBQ A;  1M3A A;  2GNC A;  4LE9 A;  1A1E A;  1IS0 A;  3PFV A;  3TVT A;  4ZNX A;  4K2R A;  3HCK A;  1O45 A;  2JM8 A;  3I9Q A;  1HSQ A;  4NWG A;  1AWJ A;  4AG1 C;  1BLJ A;  5I11 A;  4RUG A;  1H8K A;  1N5Z A;  1ZLM A;  1MIL A;  2KXD A;  1FBV A;  2M51 A;  3JV3 A;  3H0H A;  1SHA A;  1BU1 A;  3CQT A;  1JEG A;  1B07 A;  2H8H A;  3M0U A;  1BHH B;  1CSZ A;  3TSW A;  1QAD A;  1GCQ C;  1X0N A;  1VYT A;  2BZX A;  2AOA A;  1LUI A;  1PHT A;  4P9V A;  1O4Q A;  5BO4 A;  1QKX A;  5GJV B;  2LMJ A;  4TZI A;  1A81 A;  2FPF A;  2KT8 A;  4RTX A;  1YP5 A;  2LX7 A;  3PLF B;  1BFI A;  2DRM A;  1ZX6 A;  1M27 A;  2NWM A;  1T0J A;  4IIO A;  1AOJ A;  1QKW A;  1Z9Z A;  3EG3 A;  4HVV A;  1O4D A;  1R1S A;  1LCK A;  4RTZ A;  4Z8A A;  2AOB A;  1RPY A;  1H92 A;  4F14 A;  2J6K A;  2JW4 A;  3WA4 A;  1ZFP E;  2A28 A;  3R6N A;  2KK6 A;  1HCS B;  2QMS A;  2ROL A;  4J9H A;  3ZNI A;  2YSQ A;  1AVZ C;  1PRL C;  4GWF A;  2YDL A;  1CJ1 A;  2DCR A;  4A63 B;  2SHP A;  1ZUY A;  2DX0 A;  1KSW A;  3IN7 A;  2KE9 A;  5HKW A;  4F17 A;  2MOX A;  5IHK A;  5GJH A;  3EAZ A;  4E6R A;  1EFN A;  2DJQ A;  2H5K A;  3H0F A;  2HMH A;  2KXC A;  3NPF A;  1WLP B;  2YUP A;  2A36 A;  2RNA A;  2MK2 A;  4X6S A;  2IIM A;  4AFZ C;  2L3S A;  3VS7 A;  5KAZ A;  2YUN A;  1AB2 A;  5GJW B;  1WX6 A;  2W10 A;  5IBM A;  2EKH A;  1AZG B;  2V1R A;  1GL5 A;  2VIF A;  2AK5 A;  2O31 A;  2HDX A;  1I07 A;  3TKZ A;  2O9V A;  3NMZ C;  1UJY A;  1UHF A;  3I35 A;  3H41 A;  2EVR A;  2RVF A;  2KR3 A;  4HXJ A;  4OHI A;  2XP1 A;  2FRY A;  2CS0 A;  1BMB A;  1WDX A;  2K79 A;  1QWE A;  1O4J A;  1YNZ A;  1LKK A;  4DGP A;  2CI8 A;  1G2B A;  2RSY A;  2LP5 A;  3RNJ A;  1AYB A;  1LKL A;  1E6H A;  1OEB A;  2F2W A;  2RMO A;  2DLP A;  2KNO A;  1B3Q A;  1A1B A;  4XZ1 A;  3HHM B;  1WXU A;  1VYU A;  2GGR A;  1M3B A;  1NZV A;  4A4B A;  5FWC A;  1FYR A;  4GL9 E;  1JYQ A;  2CSI A;  3VRR A;  3BUX B;  1E7O A;  2AUG A;  5DC9 A;  2CT4 A;  2PLE A;  5EC7 A;  2CT3 A;  1UHC A;  1O4P A;  4H34 A;  2KRM A;  1YWP A;  4IIM A;  2CRE A;  2ROR A;  1MV0 B;  4ROJ A;  4J9I A;  2F2X A;  4HCK A;  2J6F A;  1UUE A;  1X43 A;  4LNP A;  2CUB A;  4F16 A;  4AFU C;  1F2F A;  1Y0M A;  2A37 A;  2DM1 A;  2DMO A;  3CWG A;  4J9E A;  1RLP C;  4GLM A;  3VS6 A;  3S8L A;  1JU5 C;  2JS2 A;  5I6V A;  1O4A A;  1W70 A;  2JS0 A;  2PNI A;  4NWF A;  2DM0 A;  2KGT A;  2YU7 A;  3UA7 A;  2ESW A;  1O4F A;  2AZS A;  3LH5 A;  5D0J A;  4KRT A;  1LUM A;  1A09 A;  4RTU A;  1WA7 A;  2KYM A;  2YUQ A;  2K7A A;  2PNA A;  2SEM A;  1UJ0 A;  4J9D A;  1O49 A;  1AD5 A;  1D4T A;  2XMF A;  4OHE A;  2KYB A;  2H46 E;  5GJI A;  1AOU F;  3MXY A;  5FWB A;  3EG1 A;  2HDV A;  1FBZ A;  2DVJ A;  2E5K A;  1O4I A;  2J05 A;  4OHD A;  3S9K A;  2GBQ A;  2RQW A;  3VRQ A;  3FJ5 A;  1CSY A;  1RI9 A;  2HCK A;  3VS5 A;  4OHL A;  1O4M A;  2AKK A;  4D8D A;  1IJR A;  1ARK A;  2C0T A;  5DC0 B;  2JTE A;  1WIE A;  4FSS A;  1M30 A;  2K3B A;  5FW9 A;  1LCJ A;  3C0C A;  2DYB A;  1LUK A;  2OQ1 A;  2D0N A;  1VA7 A;  2GE9 A;  4OML A;  2KT1 A;  4RTW A;  1O41 A;  2DA9 A;  4RTT A;  1A08 A;  4AFQ C;  1PKS A;  4FBN A;  4J9B A;  4JGH A;  2IUG A;  3IQL A;  2PNB A;  1JU5 A;  1NM7 A;  2GQI A;  1TG0 A;  4K45 A;  3NHN A;  1O47 A;  3PS5 A;  3UYO A;  1OV3 A;  2DL3 A;  1T3S A;  1WXB A;  1U06 A;  2CRH A;  1NEB A;  2L3P A;  4WCI A;  1O4G A;  2CH4 A;  2CIA A;  1BM2 A;  1NYF A;  1XOV A;  1E6G A;  1KFZ A;  3VRP A;  3VRN A;  1D1Z A;  4J9C A;  1I0C A;  2EYV A;  1ZBJ A;  2ROT A;  4OMP A;  3N8M A;  1J3T A;  3T04 A;  1JXO A;  1PKT A;  2HDA A;  1KA7 A;  2P4R A;  4CC3 A;  2MC1 A;  2FEI A;  2EYW A;  2FG0 A;  1OO3 A;  2DLY A;  1W6X A;  2L3Q A;  1X6G A;  3UAT A;  4F59 A;  2A08 A;  3PE0 A;  1O4E A;  2GTJ A;  5AUL A;  4HVW A;  2L2P A;  4M4Z A;  3KFJ A;  4E93 A;  1KJW A;  2OAW A;  2DL7 A;  4J9G A;  4RTV A;  1GCQ A;  1SPS A;  3VS3 A;  5CDW A;  1UUR A;  1V1C A;  1YVH A;  1GFD A;  2EQI A;  1PIC A;  2DIL A;  4AG2 C;  2BZY A;  2RQV A;  1JXM A;  2D8H A;  1CWE A;  1UEC A;  4GPL B;  2AKL A;  2MRK A;  2C0I A;  2DNU A;  3VRO A;  1QCF A;  1AEY A;  4RTY A;  2ED1 A;  2Y1M A;  3UA6 A;  1CSK A;  1O48 A;  1K1Z A;  1TUC A;  4LUE A;  1T3L A;  1BHH A;  2PLD A;  2O2O A;  3A98 A;  5DC4 A;  2I0N A;  2L0A A;  3REA B;  2J6O A;  1O43 A;  2LNW A;  3MAZ A;  2EOB A;  3S8O A;  4U17 A;  3MXC A;  1PWT A;  1ZUU A;  5IH2 A;  1K4U S;  3GXW A;  5EEQ A;  3IN8 A;  1GHU A;  3NGP A;  4OHH A;  1ZUK A;  1HD3 A;  1A1A A;  2RMX A;  5IXB A;  3HIZ B;  3I5S A;  4K44 A;  1RLQ C;  3KFV A;  1BG1 A;  4F5A A;  2AZV A;  4ORZ A;  5IHN A;  1FMK A;  4JPB W;  3OP0 A;  4Y92 A;  1VYV A;  2K7A B;  1AOT F;  2CUD A;  2L3T A;  2ENM A;  3BUN B;  3OV1 A;  2YSX A;  4JZ3 A;  2QDL A;  1BK2 A;  4CC4 B;  2O9S A;  1MUZ A;  4P9Z A;  2DBM A;  2EO3 A;  1SHD A;  1UG1 A;  2IUH A;  2EGA A;  3EHQ A;  2L4K A;  1X2Q A;  4Z88 A;  2LNH B;  4FL2 A;  3CD3 A;  1ZSG A;  3VS1 A;  1FYN A;  2GTO A;  1AWX A;  2NUZ A;  2RQT A;  1AWO A;  1RUW A;  4JJD A;  1WXT A;  2CSQ A;  2DBK A;  3OVE A;  4JEG A;  5AXI A;  1AZE A;  1R1P A;  1SRL A;  2FCI A;  1WFW A;  1O42 A;  1SHF A;  3PVL A;  1O4L A;  2CBL A;  1NEG A;  1X69 A;  1GBR A;  2MQI A;  1HJD A;  4R0K A;  2HUW A;  2BBU A;  4A4C A;  2K6D A;  3H0I A;  3ZL7 C;  1FU5 A;  2VVK A;  3CBL A;  2RQR A;  1SHB A;  4DGX A;  2B3O A;  2LJ3 A;  4E68 A;  2LCS A;  1O4N A;  1Z9Q A;  2FRW A;  4F5B A;  3THK A;  2LNX A;  1ABO A;  2KRN A;  2EYZ A;  3M0Q A;  2HSP A;  2ECZ A;  1ABQ A;  3M0R A;  1SEM A;  1M27 C;  3RBB B;  1PRM C;  4HVU A;  4XZ0 A;  1S1N A;  1W1F A;  1X27 A;  3BKB A;  2VKN A;  1JWO A;  2CI9 A;  1T0H A;  1K0X A;  3BUO B;  4JE4 A;  1U3O A;  5EHR A;  4Z89 A;  2EPD A;  4OMQ A;  2YUO A;  4AFS C;  1OPK A;  1BKL A;  2EO6 A;  3I5R A;  2M0Y A;  1SPK A;  2LCT A;  2EBP A;  1PNJ A;  1K9A A;  2KNB B;  2W0Z A;  1D4W A;  2CR4 A;  2LJ0 A;  2B86 A;  2VWF A;  3OB2 B;  2LZ6 B;  1NG2 A;  3US4 A;  1BF5 A;  1AYA A;  1O4C A;  3QWY A;  5DF6 A;  1M61 A;  3PSK A;  4X1V A;  2JYQ A;  2D8J A;  3GXX A;  1A0N B;  3TL0 A;  1H3H A;  2OZO A;  1UTI A;  1NYG A;  1H9O A;  2ECD A;  1Y1U A;  2K79 B;  1KC2 A;  2EKX A;  3GQI B;  4JJB A;  1AYD A;  2DF6 A;  1GFC A;  2DRK A;  3VRZ A;  4WWQ A;  1B47 A;  1AYC A;  2CH4 W;  1JYR A;  1JQQ A;  3EHR A;  2GSB A;  3OB1 B;  3PVQ A;  2OI3 A;  2KRS A;  1KA6 A;  3C7I A;  2EU0 A;  4EIH A;  2HEQ A;  1A07 A;  2DL5 A;  1SKJ A;  4CC2 A;  1K0S A;  3PSJ A;  1NRV A;  2X3X D;  4EIK A;  5IXF A;  1X2K A;  3N7Y A;  2K2M A;  4CC7 A;  1OO4 A;  3PJP A;  3M0P A;  1BB9 A;  2ABL A;  2JM9 A;  2BTT A;  3M0T A;  2RPN A;  4QT7 A;  5HCK A;  1QG1 E; 
#chains in the Genus database with same CATH topology
 3GNG A;  3VS0 A;  1M8V A;  2MIO A;  3EG2 A;  1M8M A;  5GAN 3;  3OY9 A;  2J7I A;  2Y3A B;  1PSF A;  1X6B A;  2J06 A;  4OMF B;  4IKF A;  4C5H A;  2G6F X;  2ZZD A;  2DIG A;  5M9O A;  1AWW A;  3G4S Q;  2HL3 A;  1BHF A;  4OMM A;  4JJN K;  1NPP A;  1Y57 A;  1G3S A;  3MP1 A;  2QAS A;  3OQ5 A;  2V1Q A;  4EMK C;  1BFJ A;  3JCM h;  5GAN j;  5KCH A;  1TUG B;  2Y4Y A;  4LUD A;  1KG1 A;  1K73 U;  1UDL A;  3BW1 A;  4DBF A;  5IBS A;  2MK5 A;  5DLQ E;  3RES A;  4XU2 A;  4LN2 A;  4XU1 A;  1QLY A;  4E7S A;  4LD9 K;  1O4R A;  1R77 A;  3LX7 A;  4M7A A;  2EW3 A;  4C0F A;  5CKF A;  1SRM A;  2NUT B;  2FZC B;  1I5L A;  3MHX A;  2M0O A;  4J8O A;  2EKO A;  4WTO B;  3G6E A;  4J9F A;  1M3C A;  1WQW A;  1VQ6 T;  5I22 A;  1VQ9 Q;  2AIR B;  1SHG A;  3M4Y A;  1YWO A;  2HZY A;  3CCU T;  3CXL A;  2JNG A;  2QEX A;  4D8K A;  3S8N A;  2DD4 A;  2KEA A;  4KH0 B;  4E7J A;  1YI2 Q;  3VRY A;  2X4W A;  4JRI A;  4JZ4 A;  3I56 T;  2YT6 A;  3QII A;  1WQU A;  5J3X A;  1MHN A;  1BLK A;  1XJW B;  4IUU A;  3G71 T;  1CKA A;  3L2Z A;  1G3T A;  1G3W A;  2RF0 A;  1QVG P;  2OTL T;  3M0S A;  4ZN1 A;  4FL3 A;  2GF7 A;  1FU6 A;  1X6C A;  5GMK l;  2LQ8 A;  2EQK A;  4XTV A;  1WHG A;  2DL4 A;  4DEY A;  2CP0 A;  1OPL A;  2QI2 A;  1UFF A;  3CC7 Q;  3CC4 T;  2PZ1 A;  2RI5 A;  1IS0 A;  4A53 A;  1UGP B;  4ZNX A;  3NTI A;  3QZ9 B;  2WAC A;  2LTO A;  4D6W A;  3I9Q A;  4RUG A;  1MIL A;  1VQK A;  1FBV A;  4PJO A;  1NE8 A;  3J80 E;  2XID A;  3H0H A;  1X01 A;  3CQT A;  1JEG A;  1B07 A;  2H8H A;  4RKU E;  3JB9 F;  1CSZ A;  4J7I A;  1QAD A;  4EMG A;  4PFZ A;  1VQP A;  2AOA A;  3HHT B;  5AYF A;  4OGE A;  1VQ8 A;  1QKX A;  2F69 A;  2LMJ A;  1YP5 A;  5L8R E;  2DRM A;  1OI1 A;  4IIO A;  3CCE Q;  3HRT A;  4Z8A A;  3A1P A;  1RPY A;  4F14 A;  3WA4 A;  1ZFP E;  2KK6 A;  3RKY A;  3FDR A;  3PFS A;  2ROL A;  3DLL A;  3ZNI A;  2YSQ A;  4HKE A;  2HQE A;  1MMA A;  1KSW A;  3IN7 A;  4E6R A;  3MEU A;  3S3N A;  2BKD N;  2KXC A;  3NPF A;  2YUP A;  1TH7 A;  4AFZ C;  2L3S A;  5GAN f;  1U8R A;  2E6N A;  3A8M B;  4PJL A;  2DXC A;  2M9U A;  1WX6 A;  2W10 A;  5FU7 C;  3HRU A;  1VQ4 A;  3NMZ C;  1UHF A;  3EG9 B;  2E64 A;  1Q82 C;  5GAN e;  4HT9 A;  2RVF A;  4HXJ A;  4FT4 A;  4M75 D;  1Y07 A;  4E7K A;  4O6J A;  4KUL A;  2KNO A;  3CCR Q;  4XZ1 A;  4VUB A;  5FU6 B;  1KD1 C;  1WXU A;  2GGR A;  1M3B A;  5FWC A;  4RCB A;  5KYY B;  3M54 A;  3PIO A;  2O4X A;  5A0D A;  3VRR A;  1R8O B;  1WNL A;  2F5T X;  2AUG A;  1LPL A;  3OW2 P;  4A54 A;  2CT4 A;  1ACM B;  5EC7 A;  1EZZ B;  4H34 A;  4E2F B;  2KRM A;  4A4G A;  5CQX A;  1LJO A;  1VQO A;  1OQK A;  2ROR A;  2F2X A;  4C92 F;  4NL2 A;  2J6F A;  1VQL A;  2MAM A;  4AFU C;  2DMO A;  2ZPE B;  4ZGD B;  3CWG A;  1RLP C;  3C94 A;  1KHI A;  1M2V A;  2HSE B;  2DAQ A;  2HQX A;  1O4A A;  1W70 A;  4NWF A;  2LNV A;  1QVG S;  1KK7 A;  1I4K 1;  2AZS A;  3X25 B;  1OUL A;  1H64 1;  1LUM A;  3JCM Q;  1A09 A;  4N0A C;  2KYM A;  2YUQ A;  3MO8 A;  3EG1 A;  2HDV A;  1FBZ A;  2DVJ A;  3CD6 A;  2RD1 A;  3LGL A;  3FJ5 A;  3LGF A;  4P5N A;  5GMK h;  3JB9 D;  1IJR A;  1ARK A;  3CCE T;  5FW9 A;  2DXU A;  1UGR B;  3C0C A;  1VOM A;  1VA7 A;  4OML A;  4FSX A;  2KT1 A;  2K5L A;  1A08 A;  5A0G A;  4ZGJ B;  4FBN A;  4J9B A;  2IUG A;  3IQL A;  2NLU A;  3OYY A;  4M77 E;  1O47 A;  4M7A G;  3RR6 A;  5GAM j;  1WXB A;  3QJ6 A;  5KYW A;  2CIA A;  1M90 C;  1ZSZ C;  4CRI A;  4C8Q G;  2ZGW A;  4BY6 C;  3MCA B;  2RH2 A;  4M78 F;  3CPW P;  5GAN 5;  2EYV A;  4FCY A;  1LOJ A;  4JRK A;  2P4R A;  3E9F A;  3I55 T;  3CCQ A;  1X6G A;  3SB2 A;  3UAT A;  1M1K C;  4F59 A;  2A08 A;  3PE0 A;  4R56 A;  2KVQ G;  5FRN A;  4M7A B;  1V76 A;  4M4Z A;  1WQ7 A;  1W2B P;  1IXD A;  3KFJ A;  3CPW A;  1KJW A;  2OAW A;  2DL7 A;  4C8Q B;  2HAX A;  1SPS A;  3P8D A;  1UUR A;  1YVH A;  1SKJ A;  2DIL A;  1JXM A;  4ZTJ A;  1UEC A;  3EFS A;  1VUB A;  2AKL A;  5LJ3 g;  4C0D B;  4OB3 B;  3JB9 I;  1M5Q 1;  4JS5 A;  1QCF A;  2MWO A;  5LJ5 g;  2RK2 A;  3CBO A;  4XTX A;  1W2B A;  4M7D G;  1K8A C;  3UA6 A;  1O48 A;  1TUC A;  1T3L A;  4RG8 A;  1O43 A;  1RAB B;  1N9R A;  3MEV A;  3CBP A;  4DOV A;  1PWT A;  1ZUU A;  5IH2 A;  3CCL Q;  3X20 B;  3IN8 A;  4PJO G;  3NGP A;  1ZUK A;  1HD3 A;  5IXB A;  3PMI A;  3V8K A;  4EPC A;  3RER A;  3JCM f;  5GMK i;  4C92 D;  1YIT T;  2L3T A;  4M7D B;  1FMV A;  1YJN T;  2XD0 A;  3OBW A;  3OW2 S;  3OBY A;  4PLL A;  5C0M A;  2DBM A;  2EO3 A;  1W4S A;  2VC8 A;  1VQM A;  4EMH A;  2LNH B;  1D0X A;  1FYN A;  1FMW A;  2NUZ A;  3K2T A;  4JJD A;  3OVE A;  3OYC A;  5D7U A;  2HD0 A;  1SRL A;  1R1P A;  4J5Y A;  4BI3 A;  3PVL A;  2CBL A;  1X69 A;  1JJ2 P;  2QGF B;  1HJD A;  2DXT A;  2BBU A;  1QW1 A;  4R55 A;  3HFO A;  2QK0 A;  2RQR A;  4DGX A;  2B3O A;  2LCS A;  2X35 A;  1Z9Q A;  2DEQ A;  5GAO l;  1VQ7 A;  2HNI A;  5FLX E;  2HSP A;  2NUT A;  1SEM A;  3M56 A;  4HVU A;  4OP0 A;  4XZ0 A;  2CI9 A;  1U3O A;  5EHR A;  4Z89 A;  4OMQ A;  3JCM b;  2DVE A;  4PJO F;  3JCM d;  4M78 D;  2LCT A;  2EBP A;  3OS5 A;  4JS4 A;  2GCX A;  2VWF A;  5GAM e;  2K5I A;  3PSK A;  1TSF A;  1A0N B;  5GAO n;  4Y28 E;  1IRX A;  5GMK j;  4RMO A;  1QCO A;  1UTI A;  2QA4 Q;  3CPW S;  4PJJ A;  4J6X A;  1C0M A;  1KC2 A;  2ZCF B;  4F7U A;  1AYD A;  2DRK A;  2KSS A;  3L2U A;  4WWQ A;  3BDU A;  1AYC A;  2RA2 A;  2JN0 A;  3A5Z B;  1VQ6 A;  3HRS A;  2OI3 A;  2KRS A;  3CCU A;  2LRA A;  3C7I A;  4EIH A;  3CCS T;  5HY6 A;  1MMN A;  1W2B S;  5CAI A;  3OYB A;  4CC2 A;  4LDV A;  2CZ7 B;  3MP8 A;  5IXF A;  5D6W A;  3I56 A;  2ABL A;  5HCK A;  2BTT A;  3M0T A;  5BO4 A;  5IN1 A;  1Q86 C;  2E1H A;  3VKI A;  1Y71 A;  3Q1J A;  4XU3 A;  2OTL A;  4U1P A;  3REB B;  1JO8 A;  1WHJ A;  1SPR A;  4L1B B;  5GMK m;  1M2V B;  4M75 C;  4M7A D;  2RQU A;  2DO3 A;  2RHY A;  1M1F A;  2FB7 A;  4Q5W A;  1Q82 R;  1F1W A;  2FL7 A;  5EEL A;  1HCT B;  4JLG A;  1RQQ C;  1FHS A;  2DD5 A;  1G3Y A;  2EL8 A;  4OF1 A;  2XDB A;  1NJI C;  2O88 A;  3MKD A;  2LQN A;  2Z0W A;  5IAY A;  3M55 A;  2DL8 A;  1MV3 A;  2RHZ A;  2DTI A;  2LJ1 A;  2B8A A;  1MW4 A;  3SEM A;  1MND A;  4QVZ A;  3FEO A;  2D9T A;  5HKY A;  2ED0 A;  3JCM V;  1FX7 A;  2JTF A;  1KD1 R;  2EGC A;  2JXB A;  2KRO A;  3EGU A;  2K57 A;  3EGX B;  4TVR A;  3BUW B;  4IUV A;  2YRD A;  3JCM c;  5EG3 B;  3L2R A;  1KC8 C;  1P13 A;  2MRJ A;  1JBM A;  1YN8 A;  4PLI A;  3QPH A;  1NLO C;  2F2V A;  1WYX A;  2RI3 A;  4H1O A;  2E41 A;  1O46 A;  2VXE A;  2XKO C;  3O5Z A;  1QP2 A;  1YVL A;  4MMK A;  1TUD A;  3EG9 A;  5KYW B;  2LQW A;  1UGS B;  2IUI A;  3J81 E;  2WSF E;  3K2M A;  1JJ2 S;  2C9W A;  2BIV A;  2ETZ A;  1M9S A;  2JMC A;  4QSY A;  3OA6 A;  1YCS B;  2R5A A;  2WSC E;  4PJO D;  4L59 A;  1O4H A;  1VQ5 T;  3DKM A;  1NZL A;  3CBM A;  2PVO B;  5KYY A;  3IMJ A;  3CCJ T;  2RN8 A;  1TCE A;  3N84 A;  1D09 B;  1UE9 A;  2GNC A;  3V7C A;  4K2R A;  2K3X A;  3HCK A;  3A8G B;  1O45 A;  3CCV A;  2JM8 A;  2M1H A;  2RK1 A;  4AG1 C;  3NTK A;  3RKX A;  4LDX A;  3JV3 A;  1SHA A;  1BU1 A;  3HP9 A;  4MZT A;  4X9C A;  1XQH A;  1GCQ C;  4FYV B;  3JB9 H;  1VYT A;  1LUI A;  1BI3 A;  1WJR A;  3QUI A;  3JCM X;  3E19 A;  1JB0 E;  1M90 R;  4TZI A;  2LX7 A;  1FWZ A;  1YIJ A;  1C1A A;  3L2Q A;  2NWM A;  1QKW A;  1Z9Z A;  3EG3 A;  3WXM B;  1R1S A;  3JCM W;  4QKU A;  2R58 A;  4ELZ C;  2J6K A;  4II1 A;  1M1K R;  3G7Z A;  2YDL A;  2SHP A;  4MZP A;  2LQK A;  4BD3 A;  4A4K A;  2MOX A;  3EAZ A;  2HMH A;  3H0F A;  1P92 A;  2KQW A;  3CME Q;  1WLP B;  2MK2 A;  2IIM A;  3VS7 A;  1AB2 A;  2YRC A;  3EAE A;  5GJW B;  1S72 A;  1GL5 A;  5FRM A;  3NTH A;  1D3B A;  1I07 A;  2V26 A;  1K8A R;  2O01 E;  1BI2 A;  2EVR A;  2DFU A;  3CMA T;  4OHI A;  2X9H A;  1M1K U;  4C92 C;  3NFC A;  1O4J A;  2QXF A;  4CI0 C;  1Q81 C;  1LKK A;  3CCE A;  2P4T A;  3RNJ A;  1BI1 A;  1AYB A;  4KBM B;  1LKL A;  5GAN g;  3MPU B;  2F2W A;  1B3Q A;  1YJW A;  4M75 F;  5DM7 R;  2L8D A;  4C8Q A;  1NZV A;  3OYK A;  4F7U G;  1E7O A;  2E70 A;  2E65 A;  3R6O A;  3O8V A;  1YWP A;  4IIM A;  2CRE A;  1K8A U;  4ROJ A;  4FIB A;  4HCK A;  5A2Q E;  4F16 A;  1VQN T;  1F2F A;  1Y0M A;  3I55 A;  1M1G A;  4GLM A;  2HKQ B;  2JS2 A;  2PNI A;  4F7U B;  2KGT A;  1O4F A;  2ESW A;  2OTJ A;  4XTU A;  4KRT A;  4RTU A;  5GAM h;  1Y7X A;  1WA7 A;  5D6X A;  2IG0 A;  1UJ0 A;  4J9D A;  4OHE A;  2KYB A;  4M7D A;  2H46 E;  5GJI A;  2CP5 A;  5I2M A;  4C92 E;  2E5K A;  4MZM A;  3M57 A;  1N8R C;  2GBQ A;  2RQW A;  3CXC P;  4M77 A;  3JCM J;  4OHL A;  1PC0 A;  3INZ A;  2AKK A;  4D8D A;  5KE3 A;  2RHX A;  4M78 C;  4C0G A;  2JTE A;  1OZ3 A;  1WIE A;  3MP6 A;  1LCJ A;  4FYX B;  2DYB A;  2OQ1 A;  4L6V 5;  4KH1 B;  1YHQ Q;  2DA9 A;  3OSS C;  1HXD A;  1PKS A;  3OS2 A;  4JGH A;  2PNB A;  1NM7 A;  3CXC A;  4K45 A;  3PS5 A;  2DL3 A;  4J7F A;  1U06 A;  4ME7 A;  4QW2 A;  5HK3 A;  1VIE A;  1E6G A;  4N4G A;  1YIT A;  3X26 B;  3VRN A;  3G4S T;  4J9C A;  1I0C A;  3UPU A;  2P0Q A;  2KK4 A;  1YJN A;  1JXO A;  2HDA A;  6AT1 B;  2MC1 A;  2EYW A;  1NPR A;  2FG0 A;  2LCL A;  3ME9 A;  4BE0 A;  2Y90 A;  1PM3 A;  2DLY A;  1W6X A;  2L3Q A;  3A8L B;  1SSF A;  1IHV A;  2Y4X A;  4ATO A;  2GTJ A;  4HVW A;  4E93 A;  2L89 A;  2KMT A;  3QHS A;  3UDC A;  2ZPB B;  3VS3 A;  2NUP B;  5CDW A;  4B9X A;  1RAG B;  1GFD A;  4AG2 C;  3RIR A;  1Q86 R;  5I2S A;  3G6E Q;  2C0I A;  4M78 E;  1SG5 A;  2MPX C;  3VRO A;  4M7A C;  1VQ9 T;  1ZSZ A;  1AEY A;  1AHJ B;  2ED1 A;  2QEX Q;  2QAZ A;  3HTR A;  4EMK B;  2LT1 A;  3A98 A;  1QVF P;  3QSU A;  2ZPG B;  2I0N A;  2L0A A;  1YI2 T;  1TOV A;  2X4Y A;  2EOB A;  3S8O A;  3L2W A;  5EEQ A;  1TTH B;  3C95 A;  3LYV A;  2OAU A;  4F5A A;  1NJI R;  4ORZ A;  1D0Y A;  3OP0 A;  1QVF A;  2K7A B;  4QVC A;  4N4I A;  1BK2 A;  1ZBX A;  3BFM A;  2E3I A;  3OMG A;  4FYY B;  3GPL A;  3HSB A;  1MUZ A;  2EQU A;  3SDZ A;  2VGN A;  2L3R A;  3CC7 T;  2IUH A;  2EGA A;  2DTH A;  3EHQ A;  3HFN A;  1KC8 R;  3PGG A;  4FL2 A;  3TCJ A;  2GTO A;  1AWX A;  4BAC A;  3GNF B;  1VQK Q;  3JCM g;  3LYI A;  3QKJ A;  2FCI A;  5GAN d;  2GFA A;  1O42 A;  2YWW A;  1WHM A;  1SKU B;  2XG8 D;  2C06 A;  1O4L A;  1YHQ T;  2MQI A;  1VQP Q;  1NJI U;  2V8K A;  5J39 A;  4PJO C;  3CCS A;  2HUW A;  4A4C A;  2K6D A;  1VQ8 Q;  2LDM A;  1FU5 A;  2VVK A;  3OMC A;  1O4N A;  3CPF A;  4F5B A;  2DEU A;  3THK A;  2ZPI B;  2LNX A;  1ABO A;  2KDS A;  2EYZ A;  2V8I A;  1KC8 U;  2KGY A;  3EGX A;  1PRM C;  4XTW A;  1S1N A;  1YJ9 A;  1X27 A;  2VKN A;  2YHT A;  1T0H A;  1K0X A;  2XIC A;  5KYX B;  2EPD A;  2PU9 B;  1PSE A;  5CKD A;  1BKL A;  2EO6 A;  2W0Z A;  1D4W A;  2NYS A;  4JUV A;  1BI0 A;  2CR4 A;  2B86 A;  3GLX A;  3OB2 B;  2QQA A;  3J7A F;  4O5V A;  1D3B B;  1V29 B;  2AT1 B;  4IUR A;  1O4C A;  5DF6 A;  3WVD B;  3EFO A;  3PT9 A;  3WVE B;  1VQ4 Q;  2OZO A;  5GAM g;  1F1B B;  2ECD A;  1Y1U A;  2EKX A;  3GQI B;  4JJB A;  4E7H A;  2P0P A;  2CH4 W;  3HKS A;  4FW2 A;  1BIA A;  3OB1 B;  1KA6 A;  1PD0 A;  4GY5 A;  2HEQ A;  2JZ2 A;  1X2K A;  4CC7 A;  1OO4 A;  3V7S A;  3CCR T;  1BB9 A;  4QT7 A;  2RPN A;  1U1T A;  2LVM A;  5FU7 B;  2KBT A;  2OJ2 A;  2FPD A;  4NOY A;  5L23 A;  1IO6 A;  1OOT A;  1SSH A;  3M9Q A;  5CKB A;  3BUM B;  1RJA A;  4ZGE B;  5EHP A;  1VQO Q;  3VGO A;  4X34 A;  2BZ8 A;  4M77 G;  2QGG A;  1EX4 A;  5J3B A;  1I1J A;  5ECA A;  1VQ5 A;  3OYJ A;  1VQL Q;  2FPE A;  2X4J A;  4DA4 A;  5CR2 A;  2MCN A;  3ULR B;  3CCJ A;  4A4F A;  1UGV A;  1WI7 A;  4JJC A;  4PFP A;  1EIF A;  5GAN 6;  3PMT A;  4M7A F;  1O4B A;  2RJC A;  2JT4 A;  1RAC B;  3ZEH A;  1Q81 R;  1O4K A;  3PNW C;  4OMO A;  2HBW A;  3URG A;  1A1C A;  1QMC A;  4C8Q F;  4ESR A;  1VQP T;  2DX1 A;  4M77 B;  3OB9 A;  2OX7 A;  1VQ8 T;  1D1A A;  3AHU A;  3CD6 Q;  4YTL A;  1TZE E;  5HKZ A;  3KXT A;  2JMA A;  2DE0 X;  2VGM A;  1MGQ A;  3OYN A;  1GBQ A;  4JRQ A;  2RM4 A;  5CQY A;  4B9W A;  2C0O A;  3OSV A;  2DPP B;  1LUN A;  1Q81 U;  1R1Q A;  1O44 A;  2G3R A;  3DB4 A;  1Z3K A;  1GXI E;  2CZ1 B;  3IMD A;  4M7D F;  1GRI A;  4FYW B;  3UF4 A;  3V7R A;  2LRQ A;  3D7S B;  4EY0 A;  5GAM f;  5KYN A;  1UGQ B;  1RAH B;  3CCQ Q;  3JB9 J;  1CWD L;  1BBZ A;  3F70 A;  1N8R R;  2HKN A;  2QG9 B;  4NS5 A;  4GBQ A;  1HYO A;  1M3A A;  2EFI A;  4LE9 A;  3TVT A;  2FZK B;  2JVV A;  4NWG A;  5FRO A;  1AWJ A;  5I11 A;  3SWN C;  1ZLM A;  2KXD A;  3CMA A;  1ZSZ B;  2ZPF B;  3OYM A;  2COY A;  3M0U A;  4BY6 B;  3QYH B;  3L2V A;  1X0N A;  2BZX A;  2VAS A;  2YLB A;  3QZ5 B;  4P9V A;  3MEW A;  4BI8 B;  5GJV B;  1UB4 A;  2KT8 A;  1M27 A;  1T0J A;  1AOJ A;  3KBG A;  1O4D A;  2PVG B;  1LCK A;  1N8R U;  2D0Q B;  4JLI A;  1BYM A;  3CCL T;  2JW4 A;  1VQL T;  2A28 A;  1HCS B;  2QMS A;  4J9H A;  4GWF A;  1CJ1 A;  2DCR A;  2ATC B;  3EGD B;  1RAI B;  2KE9 A;  3G71 A;  7AT1 B;  2E4H A;  1VQN A;  5IHK A;  5GJH A;  1EFN A;  2H5K A;  5GAN 4;  5LJ3 e;  2QDY B;  2RJD A;  4V2S A;  5GAM d;  2XI9 A;  1Q95 G;  5LJ5 e;  1NBE B;  2R5M A;  1QQJ A;  5IBM A;  2V1R A;  1BKB A;  3QG1 A;  2VIF A;  2AK5 A;  2MI6 A;  2BUD A;  3TKZ A;  2O9V A;  4C8Q D;  1UJY A;  3CC4 A;  4LD6 A;  2X4X A;  5LL6 S;  2FRY A;  2CS0 A;  3M5A A;  1QWE A;  4DGP A;  2LP5 A;  1TXQ A;  4DOW A;  1E6H A;  1OEB A;  2DLP A;  4ZN3 A;  1A1B A;  3FLG A;  1IZ6 A;  1VYU A;  4A4B A;  1G5V A;  1VQ7 Q;  4GL9 E;  1XNI A;  2NUP A;  1JYQ A;  4RCC A;  2IVW A;  3BUX B;  2VV5 A;  4PL6 A;  5DC9 A;  4MDW A;  2CT3 A;  1UHC A;  1Q82 U;  4J9I A;  3CCQ T;  3G4S A;  4EMK A;  3BE3 A;  4M7D D;  4LDW A;  1UUE A;  4LNP A;  2CUB A;  3EFO B;  2A37 A;  2CS7 A;  2DM1 A;  4J9E A;  3VS6 A;  4M77 D;  4C5E A;  1JU5 C;  3RDV A;  4C92 A;  1IHW A;  4M75 E;  2DM0 A;  2YU7 A;  3UA7 A;  1KD1 U;  5D0J A;  3KUF A;  5DY9 A;  4E47 A;  1YCY A;  3S6W A;  5AT1 B;  2K7A A;  2QA4 T;  2SEM A;  5CIU A;  1AOU F;  4DBH A;  3FRN A;  4NL3 A;  4A4H A;  1MNE A;  4PJN A;  3S9K A;  1CSY A;  1O4I A;  2J05 A;  4OHD A;  2HQH A;  1VQ6 Q;  3CCU Q;  5J26 A;  1VQ9 A;  2C0T A;  2LT4 A;  1B34 A;  2K3B A;  3QBY A;  5KE2 A;  2D0N A;  3HPW A;  1PD1 A;  2HBP A;  1YI2 A;  1QVP A;  4RTT A;  3I56 Q;  4AFQ C;  2COW A;  2PUK B;  5CVI A;  3JSC A;  1I81 A;  2EYQ A;  2GQI A;  2F1L A;  3NHN A;  1N9S A;  2OTL Q;  2RSY A;  2L3P A;  3S3O A;  1O4G A;  2GFU A;  3VRP A;  4BE2 A;  4KT0 E;  1D1Z A;  2DZ9 A;  1IB8 A;  4Y91 A;  1R0C B;  1ZBJ A;  2ROT A;  4OMP A;  1KQ1 A;  2EWN A;  2JJ9 A;  3T04 A;  4HCC A;  1PKT A;  3DB3 A;  3CC7 A;  2JUF A;  4QQ6 A;  4PJM A;  4BI4 A;  4RG2 A;  3TEE A;  5C6S A;  3CCM Q;  4C5G A;  1O4E A;  3VYH B;  2VXF A;  4E7I A;  1QP3 A;  5KYX A;  1XTD A;  2EJF A;  4J9G A;  4RTV A;  2COZ A;  3HL8 A;  2QYZ A;  2EQI A;  4GPL B;  1M90 U;  1PCX A;  1U1S A;  4XU0 A;  3G1J A;  4FW1 A;  5KCO A;  1VQ7 T;  1Y96 B;  2EQJ A;  1WHH A;  2DKG A;  4RTY A;  5KYU A;  2Y1M A;  1BHH A;  3REA B;  1QCN A;  5CK9 A;  2LNW A;  1IGQ A;  1R0B G;  3MAZ A;  3QDR B;  1WJS A;  3FC3 A;  3MXC A;  4U17 A;  1PG5 B;  3L42 A;  3N5B B;  2QQ9 A;  1GHU A;  2CP3 A;  4OHH A;  3JRZ A;  2FZG B;  5HK0 A;  1A1A A;  3HIZ B;  1ZA1 B;  2M16 A;  5IHN A;  3CC2 Q;  4JPB W;  1BIB A;  2QQS A;  1VYV A;  9ATC B;  1G8X A;  1AOT F;  8AT1 B;  2CUD A;  3BUN B;  2AHJ B;  4XQ3 A;  3OV1 A;  2QDL A;  2O9S A;  2D6F A;  3JB9 G;  4P9Z A;  1LNX A;  1UG1 A;  1RI0 A;  5FU6 C;  2L4K A;  4OGC A;  1X2Q A;  4JDS A;  3CCV Q;  4HT8 A;  4Z02 A;  2RJE A;  2RQT A;  1RUW A;  2XDP A;  3QO3 A;  2DBK A;  2CP6 A;  4LDY A;  4JEG A;  5AXI A;  2DYI A;  1UEB A;  1WFW A;  3M59 A;  5CKH A;  3ZBD A;  1NEG A;  2PQW A;  3M58 A;  4LDU A;  1GBR A;  3OYD A;  3ZL7 C;  2K2V A;  1SHB A;  1RAA B;  8ATC B;  1YIJ Q;  3CCR A;  2YRV A;  4MDX A;  2EJ9 A;  2FYK A;  2KRN A;  2K4Y A;  3M0R A;  1ABQ A;  4OB2 B;  4KGZ B;  4KGX B;  4UC4 A;  3BKB A;  1AT1 B;  2MYS A;  4ANJ A;  3BUO B;  4JE4 A;  4AFS C;  3JCM P;  2YUO A;  2MF2 A;  1QVG A;  4QVD A;  3CCM T;  1K9A A;  2KNB B;  2CGH A;  5IT9 E;  2L5Q A;  2KY9 A;  3CME T;  2LZ6 B;  1NG2 A;  4N0A A;  4F7U F;  3US4 A;  1BF5 A;  1AYA A;  2P84 A;  1M61 A;  4X1V A;  2JYQ A;  1WJQ A;  3LW5 E;  5LJ3 h;  3GXX A;  1S72 Q;  4OB1 B;  2DTO A;  3TL0 A;  4IUQ A;  4KGV B;  1NYG A;  5LJ5 h;  3VRZ A;  3A8O B;  1B47 A;  4E7Z A;  3A8H B;  2DZC A;  2GSB A;  1N27 A;  3UT1 A;  2EU0 A;  4C92 G;  5EG2 A;  2DL5 A;  1YJW Q;  1NRV A;  2X3X D;  3PJP A;  2RJF A;  4AT1 B;  2QTV A;  2JM9 A;  1ZHI A;  1QG1 E;  3H9N A;  3CC2 T;  2EYX A;  4XTY A;  2RO0 A;  2VYT A;  3EAC A;  3SD4 A;  4C8Q C;  2IZV A;  5GAO m;  4FU6 A;  1OU8 A;  2YLC A;  1OYX A;  1NLP C;  3TSZ A;  2X3W D;  5GAN 2;  3LLR A;  4C92 B;  3EG0 A;  3H6Z A;  4C0D C;  1BKM A;  4J6W A;  2PUO B;  2DIQ A;  2Y1N A;  3I55 Q;  1TWB A;  1U5S A;  3CCV T;  3M7F A;  2ZPH B;  4K11 A;  1NZ9 A;  3LWI A;  1GCP A;  3QDF A;  2OTJ Q;  1KIK A;  1Q86 U;  4MML A;  2XDD A;  2EGE A;  3OS0 A;  3LWH A;  3VJP A;  2FO0 A;  2VB6 A;  3VS2 A;  3EGD A;  4OVA A;  2EYY A;  3U23 A;  1UUS A;  3ER0 A;  4ZTF A;  3PQZ A;  5GAO p;  2DLZ A;  2RHU A;  1B34 B;  3QWX X;  1YIJ T;  1O4O A;  2LC4 A;  4AMC A;  1ZQ1 A;  2PTK A;  4M7D C;  2LCC A;  2KAF A;  3FIF A;  4M78 G;  4ELY C;  4M77 C;  1JYU A;  1K76 A;  3SHW A;  4M7A E;  2DER A;  2R57 A;  3X24 B;  2L6K A;  2BE9 B;  2D1X A;  2E12 A;  3VS4 A;  3OYG A;  3CCL A;  4C8Q E;  1QWF A;  1OZ2 A;  1Q7Y C;  3DLM A;  1XA6 A;  3PIP A;  3OW2 A;  2BE7 D;  1I8F A;  2CDT A;  4J6Y A;  1YIT Q;  5A0L A;  1CKB A;  1I3Z A;  3CXC S;  1D0Z A;  1G83 A;  1YFN A;  2K9G A;  4M78 B;  1YJN Q;  4OMN A;  2H3E B;  1S72 T;  3CEY A;  2SRC A;  3GBQ A;  5IHI A;  4DEX A;  5HKC A;  4BUG A;  1A1E A;  3S3M A;  3PFV A;  1RAF B;  4XAX B;  3UWN A;  5CKE A;  1HSQ A;  1BLJ A;  1H8K A;  1N5Z A;  1K9M C;  2M51 A;  4GLK A;  1KHC A;  3LH0 A;  4BB7 A;  3GF5 A;  1YJW T;  4C0Z A;  5KYU B;  3BY7 A;  4M7D E;  1BHH B;  3TSW A;  3EH2 A;  3G6E T;  1MMD A;  1PHT A;  1O4Q A;  1D1B A;  1A81 A;  2FPF A;  4RTX A;  2QEX T;  1BFI A;  3PLF B;  2DJZ A;  1ZX6 A;  5KH6 A;  4PJO E;  1MMG A;  4HVV A;  2XU8 A;  3OYF A;  1D1C A;  1WHL A;  4RTZ A;  3OYI A;  1X75 C;  2AOB A;  1H92 A;  2QQR A;  3R6N A;  4FT2 A;  1KQS P;  2I2L A;  1K73 C;  1AVZ C;  1PRL C;  4KUI A;  4PNO A;  1I5O B;  4A63 B;  1ZUY A;  3SWN A;  2DX0 A;  4QQG A;  4B6M A;  5LJ3 j;  3P8B B;  5HKW A;  4F17 A;  2OTJ T;  5GAN 8;  2QQB A;  2DJQ A;  2V8J A;  2HL5 C;  3MEA A;  2A36 A;  2RNA A;  4BE1 A;  5LJ5 j;  4X6S A;  2MMP A;  1QVF S;  5KAZ A;  1KQS A;  2CZ0 B;  2YUN A;  3SFM A;  4IUP A;  3OS1 A;  2EIF A;  1AZG B;  2EKH A;  3MJX A;  4PK4 A;  2IPO B;  2O31 A;  1M2O A;  2QA4 A;  2HDX A;  1WGS A;  3I35 A;  3H41 A;  5DLO A;  4A4E A;  3OYA A;  1VQK T;  5GAN 7;  2KR3 A;  3VUZ A;  2XP1 A;  1BMB A;  1N6A A;  1WDX A;  2K79 A;  2A0F B;  1YNZ A;  3CCS Q;  2CI8 A;  1G2B A;  3ASK A;  3AT1 B;  2QTX A;  2RB6 A;  4L5G A;  1RAD B;  2RMO A;  3FB9 A;  4DBQ A;  4HA8 A;  2DXB A;  3OYE A;  3HHM B;  5CCA A;  1FYR A;  1BCM A;  2CSI A;  1BCO A;  4WF2 A;  2DET A;  3C12 A;  5I21 A;  4OB0 B;  2PLE A;  1O4P A;  4M75 A;  1YJ9 Q;  1TS9 A;  2E10 A;  4C5I A;  1MV0 B;  1Y96 A;  3EH1 A;  4DQ2 A;  3JCM e;  3BDL A;  3QXE B;  1X43 A;  4PJO B;  2E3H A;  3VUB A;  3S8L A;  3OYH A;  3RMQ A;  3L1A A;  5I6V A;  2JS0 A;  5D6Y A;  2MWP A;  3LH5 A;  1TU0 B;  3P8H A;  4M77 F;  1VQ4 T;  2PNA A;  1O49 A;  1AD5 A;  1D4T A;  2XMF A;  2XHC A;  3MXY A;  5FWB A;  2DK3 A;  2A3L A;  3T9N A;  1OX9 A;  2XK0 A;  3FJP A;  2FVU A;  2EJG A;  3VRQ A;  1RI9 A;  2HCK A;  3VS5 A;  1O4M A;  5DC0 B;  4FSS A;  1M30 A;  1JJ2 A;  1LUK A;  3EFR A;  2GE9 A;  4RTW A;  1O41 A;  2CKK A;  2X51 A;  3QJY A;  2EAY A;  4QQD A;  3ZFJ A;  1OX8 A;  1JU5 A;  1TG0 A;  2CZ6 B;  3UYO A;  1RAE B;  1OV3 A;  4FL6 A;  1T3S A;  2CRH A;  1NEB A;  4WCI A;  1WZO A;  2CH4 A;  1IRE B;  1BM2 A;  4J83 A;  4FM4 B;  1VQO T;  1NYF A;  1XOV A;  1KFZ A;  2K5F A;  1B7T A;  4HCZ A;  2JOY A;  1VQ5 Q;  3N8M A;  5LJ3 f;  1J3T A;  3E9G A;  3GP8 A;  4CC3 A;  3CCJ Q;  1KA7 A;  1WPY A;  2FEI A;  2VUB A;  1OO3 A;  3QYG B;  5LJ5 f;  1H3Z A;  1KQS S;  2E6Z A;  5AUL A;  2L2P A;  2K3Y A;  1C6V X;  2CYZ B;  5GAN h;  1GCQ A;  4HCB A;  2CP2 A;  3V8J A;  4KUD K;  1V1C A;  2H3J A;  2O4X B;  2P0K A;  1PIC A;  5DC4 A;  2BZY A;  2RQV A;  1VQM Q;  2D8H A;  1CWE A;  2CP7 A;  2MRK A;  3CD6 T;  2DNU A;  4JRP A;  3VU3 C;  4X9D A;  1DJ7 B;  1CSK A;  1OU9 A;  1K1Z A;  4LUE A;  2PLD A;  2O2O A;  3VV0 A;  2J6O A;  1YJ9 T;  3GOX A;  5GAO r;  2KI7 A;  1K4U S;  3GXW A;  4K44 A;  2RMX A;  3I5S A;  1RLQ C;  4EDU A;  3KFV A;  3E1S A;  1BG1 A;  2AZV A;  1FMK A;  2RI2 A;  3RMS A;  4Y92 A;  1O75 A;  4XK8 E;  2ENM A;  1IGU A;  3CCM A;  2YSX A;  3RKW A;  4JZ3 A;  4CC4 B;  5LJ3 d;  3CME A;  3X28 B;  1SHD A;  2JTM A;  5LJ5 d;  2RHI A;  2GQV A;  4Z88 A;  1ZA2 B;  2E5Q A;  1O9S A;  3CD3 A;  5CO7 A;  1X6O A;  1ZSG A;  3VS1 A;  2LX9 A;  4BDZ A;  1AWO A;  1RL2 A;  1WXT A;  2CSQ A;  1KQ2 A;  4E7L A;  3PTA A;  3CMA Q;  1AZE A;  2ZAE A;  1SHF A;  1Q7Y R;  3GIB A;  4R0K A;  3H0I A;  3CBL A;  2LJ3 A;  4E68 A;  2FRW A;  1FXX A;  3CC2 A;  2FHD A;  4XTZ A;  4BDY A;  3M0Q A;  2ECZ A;  3VYG A;  1M27 C;  3SWN B;  3TRE A;  3RBB B;  1WHK A;  3E2U A;  1W1F A;  1VIF A;  2WSE E;  4IUT A;  1JWO A;  4F04 B;  3C4S A;  3TU4 K;  1OPK A;  3G71 Q;  5GAO q;  3I5R A;  4PKC C;  2M0Y A;  1SPK A;  1VQN Q;  2HMA A;  1PNJ A;  2M02 A;  3RUX A;  1K9M R;  1LVK A;  2LJ0 A;  4PFO A;  1Q7Y U;  3OYL A;  3TQ7 P;  1HK9 A;  3QWY A;  4LXC A;  2D8J A;  1SF9 A;  1JRI A;  1VQM T;  1H3H A;  4M75 G;  3H8Z A;  1H9O A;  2K79 B;  3CC4 Q;  5GMK e;  2DF6 A;  1GFC A;  3M4G A;  4M78 A;  3V8L A;  3MET A;  1JYR A;  3JAM E;  4N4H A;  1JQQ A;  3EHR A;  4DBR A;  3PVQ A;  1YBY A;  1M4Z A;  2PVD B;  2EQM A;  1K73 R;  1A07 A;  2A7Y A;  1K0S A;  2YXY A;  3PSJ A;  4F7U E;  4EIK A;  3N7Y A;  2K2M A;  1YHQ A;  1K9M U;  2F5K A;  3M0P A;  3M53 A;  4M75 B; 
#chains in the Genus database with same CATH homology
 2KBT A;  2OJ2 A;  2FPD A;  5L23 A;  3VS0 A;  1IO6 A;  2EYX A;  2MIO A;  3EG2 A;  1OOT A;  1SSH A;  3EAC A;  3BUM B;  1M8M A;  1RJA A;  4U1P A;  2J7I A;  5EHP A;  2Y3A B;  2IZV A;  1X6B A;  2J06 A;  3VGO A;  2BZ8 A;  3REB B;  2G6F X;  1JO8 A;  1AWW A;  1NLP C;  3TSZ A;  2X3W D;  1SPR A;  4L1B B;  1BHF A;  4OMM A;  1I1J A;  3EG0 A;  5ECA A;  2RQU A;  2FPE A;  1BKM A;  1Y57 A;  2Y1N A;  2MCN A;  3ULR B;  1U5S A;  3M7F A;  1F1W A;  5EEL A;  4K11 A;  1HCT B;  1UGV A;  2V1Q A;  1WI7 A;  1BFJ A;  1RQQ C;  1FHS A;  4JJC A;  1GCP A;  4LUD A;  2EL8 A;  1O4B A;  2JT4 A;  1KIK A;  1UDL A;  2O88 A;  1O4K A;  2LQN A;  4OMO A;  5IBS A;  2EGE A;  2HBW A;  2DL8 A;  1MV3 A;  1A1C A;  2FO0 A;  2LJ1 A;  1MW4 A;  4LN2 A;  3SEM A;  3VS2 A;  4ESR A;  1UUS A;  1QLY A;  2DX1 A;  2EYY A;  3U23 A;  1O4R A;  3PQZ A;  5HKY A;  2ED0 A;  2DLZ A;  2EW3 A;  2EGC A;  2JXB A;  2KRO A;  1SRM A;  3EGU A;  3QWX X;  1O4O A;  3BUW B;  1TZE E;  4J9F A;  1M3C A;  5HKZ A;  5EG3 B;  5I22 A;  1P13 A;  2PTK A;  2MRJ A;  2JMA A;  1SHG A;  1YN8 A;  2DE0 X;  1YWO A;  3CXL A;  1NLO C;  2F2V A;  1WYX A;  1GBQ A;  4D8K A;  3S8N A;  2KEA A;  1JYU A;  1K76 A;  4H1O A;  3SHW A;  3VRY A;  2C0O A;  1O46 A;  3O5Z A;  1YVL A;  4JZ4 A;  1TUD A;  1LUN A;  2YT6 A;  2L6K A;  2D1X A;  2LQW A;  1WQU A;  2IUI A;  3K2M A;  5J3X A;  3VS4 A;  1BLK A;  2C9W A;  1QWF A;  1CKA A;  1R1Q A;  2ETZ A;  1O44 A;  2JMC A;  1XA6 A;  4QSY A;  2RF0 A;  3M0S A;  1Z3K A;  4FL3 A;  2CDT A;  1FU6 A;  3IMD A;  1CKB A;  1I3Z A;  1GRI A;  1YCS B;  3UF4 A;  1X6C A;  1G83 A;  1O4H A;  2K9G A;  4EY0 A;  1NZL A;  4OMN A;  2SRC A;  2DL4 A;  4DEY A;  3IMJ A;  3GBQ A;  1OPL A;  2RN8 A;  5IHI A;  1BBZ A;  1UFF A;  1CWD L;  4DEX A;  1TCE A;  2PZ1 A;  3N84 A;  1UE9 A;  4GBQ A;  1M3A A;  2GNC A;  4LE9 A;  1A1E A;  1IS0 A;  3PFV A;  3TVT A;  4ZNX A;  4K2R A;  3HCK A;  1O45 A;  2JM8 A;  3I9Q A;  1HSQ A;  4NWG A;  1AWJ A;  4AG1 C;  1BLJ A;  5I11 A;  4RUG A;  1H8K A;  1N5Z A;  1ZLM A;  1MIL A;  2KXD A;  1FBV A;  2M51 A;  3JV3 A;  3H0H A;  1SHA A;  1BU1 A;  3CQT A;  1JEG A;  1B07 A;  2H8H A;  3M0U A;  1BHH B;  1CSZ A;  3TSW A;  1QAD A;  1GCQ C;  1X0N A;  1VYT A;  2BZX A;  2AOA A;  1LUI A;  1PHT A;  4P9V A;  1O4Q A;  5BO4 A;  1QKX A;  5GJV B;  2LMJ A;  4TZI A;  1A81 A;  2FPF A;  2KT8 A;  4RTX A;  1YP5 A;  2LX7 A;  3PLF B;  1BFI A;  2DRM A;  1ZX6 A;  1M27 A;  2NWM A;  1T0J A;  4IIO A;  1AOJ A;  1QKW A;  1Z9Z A;  3EG3 A;  4HVV A;  1O4D A;  1R1S A;  1LCK A;  4RTZ A;  4Z8A A;  2AOB A;  1RPY A;  1H92 A;  4F14 A;  2J6K A;  2JW4 A;  3WA4 A;  1ZFP E;  2A28 A;  3R6N A;  2KK6 A;  1HCS B;  2QMS A;  2ROL A;  4J9H A;  3ZNI A;  2YSQ A;  1AVZ C;  1PRL C;  4GWF A;  2YDL A;  1CJ1 A;  2DCR A;  4A63 B;  2SHP A;  1ZUY A;  2DX0 A;  1KSW A;  3IN7 A;  2KE9 A;  5HKW A;  4F17 A;  2MOX A;  5IHK A;  5GJH A;  3EAZ A;  4E6R A;  1EFN A;  2DJQ A;  2H5K A;  3H0F A;  2HMH A;  2KXC A;  3NPF A;  1WLP B;  2YUP A;  2A36 A;  2RNA A;  2MK2 A;  4X6S A;  2IIM A;  4AFZ C;  2L3S A;  3VS7 A;  5KAZ A;  2YUN A;  1AB2 A;  5GJW B;  1WX6 A;  2W10 A;  5IBM A;  2EKH A;  1AZG B;  2V1R A;  1GL5 A;  2VIF A;  2AK5 A;  2O31 A;  2HDX A;  1I07 A;  3TKZ A;  2O9V A;  3NMZ C;  1UJY A;  1UHF A;  3I35 A;  3H41 A;  2EVR A;  2RVF A;  2KR3 A;  4HXJ A;  4OHI A;  2XP1 A;  2FRY A;  2CS0 A;  1BMB A;  1WDX A;  2K79 A;  1QWE A;  1O4J A;  1YNZ A;  1LKK A;  4DGP A;  2CI8 A;  1G2B A;  2RSY A;  2LP5 A;  3RNJ A;  1AYB A;  1LKL A;  1E6H A;  1OEB A;  2F2W A;  2RMO A;  2DLP A;  2KNO A;  1B3Q A;  1A1B A;  4XZ1 A;  3HHM B;  1WXU A;  1VYU A;  2GGR A;  1M3B A;  1NZV A;  4A4B A;  5FWC A;  1FYR A;  4GL9 E;  1JYQ A;  2CSI A;  3VRR A;  3BUX B;  1E7O A;  2AUG A;  5DC9 A;  2CT4 A;  2PLE A;  5EC7 A;  2CT3 A;  1UHC A;  1O4P A;  4H34 A;  2KRM A;  1YWP A;  4IIM A;  2CRE A;  2ROR A;  1MV0 B;  4ROJ A;  4J9I A;  2F2X A;  4HCK A;  2J6F A;  1UUE A;  1X43 A;  4LNP A;  2CUB A;  4F16 A;  4AFU C;  1F2F A;  1Y0M A;  2A37 A;  2DM1 A;  2DMO A;  3CWG A;  4J9E A;  1RLP C;  4GLM A;  3VS6 A;  3S8L A;  1JU5 C;  2JS2 A;  5I6V A;  1O4A A;  1W70 A;  2JS0 A;  2PNI A;  4NWF A;  2DM0 A;  2KGT A;  2YU7 A;  3UA7 A;  2ESW A;  1O4F A;  2AZS A;  3LH5 A;  5D0J A;  4KRT A;  1LUM A;  1A09 A;  4RTU A;  1WA7 A;  2KYM A;  2YUQ A;  2K7A A;  2PNA A;  2SEM A;  1UJ0 A;  4J9D A;  1O49 A;  1AD5 A;  1D4T A;  2XMF A;  4OHE A;  2KYB A;  2H46 E;  5GJI A;  1AOU F;  3MXY A;  5FWB A;  3EG1 A;  2HDV A;  1FBZ A;  2DVJ A;  2E5K A;  1O4I A;  2J05 A;  4OHD A;  3S9K A;  2GBQ A;  2RQW A;  3VRQ A;  3FJ5 A;  1CSY A;  1RI9 A;  2HCK A;  3VS5 A;  4OHL A;  1O4M A;  2AKK A;  4D8D A;  1IJR A;  1ARK A;  2C0T A;  5DC0 B;  2JTE A;  1WIE A;  4FSS A;  1M30 A;  2K3B A;  5FW9 A;  1LCJ A;  3C0C A;  2DYB A;  1LUK A;  2OQ1 A;  2D0N A;  1VA7 A;  2GE9 A;  4OML A;  2KT1 A;  4RTW A;  1O41 A;  2DA9 A;  4RTT A;  1A08 A;  4AFQ C;  1PKS A;  4FBN A;  4J9B A;  4JGH A;  2IUG A;  3IQL A;  2PNB A;  1JU5 A;  1NM7 A;  2GQI A;  1TG0 A;  4K45 A;  3NHN A;  1O47 A;  3PS5 A;  3UYO A;  1OV3 A;  2DL3 A;  1T3S A;  1WXB A;  1U06 A;  2CRH A;  1NEB A;  2L3P A;  4WCI A;  1O4G A;  2CH4 A;  2CIA A;  1BM2 A;  1NYF A;  1XOV A;  1E6G A;  1KFZ A;  3VRP A;  3VRN A;  1D1Z A;  4J9C A;  1I0C A;  2EYV A;  1ZBJ A;  2ROT A;  4OMP A;  3N8M A;  1J3T A;  3T04 A;  1JXO A;  1PKT A;  2HDA A;  1KA7 A;  2P4R A;  4CC3 A;  2MC1 A;  2FEI A;  2EYW A;  2FG0 A;  1OO3 A;  2DLY A;  1W6X A;  2L3Q A;  1X6G A;  3UAT A;  4F59 A;  2A08 A;  3PE0 A;  1O4E A;  2GTJ A;  5AUL A;  4HVW A;  2L2P A;  4M4Z A;  3KFJ A;  4E93 A;  1KJW A;  2OAW A;  2DL7 A;  4J9G A;  4RTV A;  1GCQ A;  1SPS A;  3VS3 A;  5CDW A;  1UUR A;  1V1C A;  1YVH A;  1GFD A;  2EQI A;  1PIC A;  2DIL A;  4AG2 C;  2BZY A;  2RQV A;  1JXM A;  2D8H A;  1CWE A;  1UEC A;  4GPL B;  2AKL A;  2MRK A;  2C0I A;  2DNU A;  3VRO A;  1QCF A;  1AEY A;  4RTY A;  2ED1 A;  2Y1M A;  3UA6 A;  1CSK A;  1O48 A;  1K1Z A;  1TUC A;  4LUE A;  1T3L A;  1BHH A;  2PLD A;  2O2O A;  3A98 A;  5DC4 A;  2I0N A;  2L0A A;  3REA B;  2J6O A;  1O43 A;  2LNW A;  3MAZ A;  2EOB A;  3S8O A;  4U17 A;  3MXC A;  1PWT A;  1ZUU A;  5IH2 A;  1K4U S;  3GXW A;  5EEQ A;  3IN8 A;  1GHU A;  3NGP A;  4OHH A;  1ZUK A;  1HD3 A;  1A1A A;  2RMX A;  5IXB A;  3HIZ B;  3I5S A;  4K44 A;  1RLQ C;  3KFV A;  1BG1 A;  4F5A A;  2AZV A;  4ORZ A;  5IHN A;  1FMK A;  4JPB W;  3OP0 A;  4Y92 A;  1VYV A;  2K7A B;  1AOT F;  2CUD A;  2L3T A;  2ENM A;  3BUN B;  3OV1 A;  2YSX A;  4JZ3 A;  2QDL A;  1BK2 A;  4CC4 B;  2O9S A;  1MUZ A;  4P9Z A;  2DBM A;  2EO3 A;  1SHD A;  1UG1 A;  2IUH A;  2EGA A;  3EHQ A;  2L4K A;  1X2Q A;  4Z88 A;  2LNH B;  4FL2 A;  3CD3 A;  1ZSG A;  3VS1 A;  1FYN A;  2GTO A;  1AWX A;  2NUZ A;  2RQT A;  1AWO A;  1RUW A;  4JJD A;  1WXT A;  2CSQ A;  2DBK A;  3OVE A;  4JEG A;  5AXI A;  1AZE A;  1R1P A;  1SRL A;  2FCI A;  1WFW A;  1O42 A;  1SHF A;  3PVL A;  1O4L A;  2CBL A;  1NEG A;  1X69 A;  1GBR A;  2MQI A;  1HJD A;  4R0K A;  2HUW A;  2BBU A;  4A4C A;  2K6D A;  3H0I A;  3ZL7 C;  1FU5 A;  2VVK A;  3CBL A;  2RQR A;  1SHB A;  4DGX A;  2B3O A;  2LJ3 A;  4E68 A;  2LCS A;  1O4N A;  1Z9Q A;  2FRW A;  4F5B A;  3THK A;  2LNX A;  1ABO A;  2KRN A;  2EYZ A;  3M0Q A;  2HSP A;  2ECZ A;  1ABQ A;  3M0R A;  1SEM A;  1M27 C;  3RBB B;  1PRM C;  4HVU A;  4XZ0 A;  1S1N A;  1W1F A;  1X27 A;  3BKB A;  2VKN A;  1JWO A;  2CI9 A;  1T0H A;  1K0X A;  3BUO B;  4JE4 A;  1U3O A;  5EHR A;  4Z89 A;  2EPD A;  4OMQ A;  2YUO A;  4AFS C;  1OPK A;  1BKL A;  2EO6 A;  3I5R A;  2M0Y A;  1SPK A;  2LCT A;  2EBP A;  1PNJ A;  1K9A A;  2KNB B;  2W0Z A;  1D4W A;  2CR4 A;  2LJ0 A;  2B86 A;  2VWF A;  3OB2 B;  2LZ6 B;  1NG2 A;  3US4 A;  1BF5 A;  1AYA A;  1O4C A;  3QWY A;  5DF6 A;  1M61 A;  3PSK A;  4X1V A;  2JYQ A;  2D8J A;  3GXX A;  1A0N B;  3TL0 A;  1H3H A;  2OZO A;  1UTI A;  1NYG A;  1H9O A;  2ECD A;  1Y1U A;  2K79 B;  1KC2 A;  2EKX A;  3GQI B;  4JJB A;  1AYD A;  2DF6 A;  1GFC A;  2DRK A;  3VRZ A;  4WWQ A;  1B47 A;  1AYC A;  2CH4 W;  1JYR A;  1JQQ A;  3EHR A;  2GSB A;  3OB1 B;  3PVQ A;  2OI3 A;  2KRS A;  1KA6 A;  3C7I A;  2EU0 A;  4EIH A;  2HEQ A;  1A07 A;  2DL5 A;  1SKJ A;  4CC2 A;  1K0S A;  3PSJ A;  1NRV A;  2X3X D;  4EIK A;  5IXF A;  1X2K A;  3N7Y A;  2K2M A;  4CC7 A;  1OO4 A;  3PJP A;  3M0P A;  1BB9 A;  2ABL A;  2JM9 A;  2BTT A;  3M0T A;  2RPN A;  4QT7 A;  5HCK A;  1QG1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...