1GRIA

Grb2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
211
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR BOUND PROTEIN 2
publication title Crystal structure of the mammalian Grb2 adaptor.
pubmed rcsb
source organism Homo sapiens
molecule tags Signal transduction adaptor
total genus 34
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA03
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1griA02
2BBUA 2A37A 4RTTA 2KBTA 2I0NA 2EYZA 2D8JA 2DRKA 3VS1A 5IHKA 2EKXA 2DA9A 1JXMA 3REBB 4J9CA 1W1FA 4JZ4A 4Z88A 4P9ZA 2YUOA 2MIOA 1WDXA 3EHRA 1U3OA 1CWEA 3PQZA 1AWJA 2D1XA 1GL5A 1D4TA 2PNIA 1NM7A 2LZ6B 2QDLA 1NLPC 3EHQA 5J3XA 3CBLA 3TL0A 3EG2A 5GJVB 1LCKA 1X6CA 1E6HA 1JEGA 5IBMA 4Z8AA 4LUEA 2PLDA 4JEGA 1N5ZA 2DBKA 1KA7A 4OHIA 3BKBA 1B47A 2LQNA 2EU0A 5AXIA 5DF6A 2J7IA 4DGXA 1O49A 4JJDA 1H92A 2B3OA 1O4IA 2K7AB 3MXCA 1FMKA 1UHFA 2EVRA 4WWQA 1NEBA 3VRRA 1ZFPE 3CWGA 1O41A 1Y57A 1NZLA 3VRQA 2SEMA 1AOUF 1ARKA 1O47A 1K76A 1H8KA 1QADA 1X2QA 2DX0A 1TUDA 1A1CA 1A1AA 4JE4A 2GTJA 2K9GA 4IIMA 1I0CA 2DCRA 4ESRA 5FW9A 4J9BA 2ED1A 4NWFA 2LNWA 1JWOA 2AZSA 5I11A 2J6FA 2YU7A 3PJPA 3FJ5A 5HKWA 3T04A 4A4BA 3WA4A 1PRLC 1PWTA 1VYTA 2DVJA 3M0TA 2YT6A 4IIOA 1TZEE 2DL5A 2X3WD 3RNJA 3QWYA 2BTTA 1YWPA 1RPYA 1YVHA 2FPFA 3I35A 1P13A 2HDAA 3EG0A 1AYDA 5GJWB 1ZSGA 2ED0A 1O45A 5GJIA 2KRSA 2DL4A 1W6XA 1E7OA 1GRIA 1PKSA 2DYBA 1PHTA 2GNCA 1WI7A 2KYBA 5IHNA 2CSQA 1HSQA 2O9VA 2CH4W 2JMCA 2JYQA 2XP1A 3PE0A 2MRJA 1UJYA 1R1PA 2K79B 1LUKA 2VIFA 3CXLA 4JJBA 4AFUC 1WFWA 2AZVA 1YNZA 3N8MA 1BLJA 4J9FA 5BO4A 2F2VA 5IH2A 1H9OA 1V1CA 1YCSB 3SHWA 4KRTA 2F2XA 2HDXA 4J9GA 2RQVA 4OMLA 5EC7A 1ZUKA 1ZUUA 2RMOA 3IN8A 5FWCA 2DRMA 5GJHA 1O4CA 4HVVA 2FCIA 3EAZA 1PNJA 1WLPB 2HDVA 4ZNXA 4E6RA 3S8LA 1NLOC 2RORA 4OHHA 1BHHB 5HKZA 2X3XD 3BUMB 1QKXA 1B3QA 1AZEA 1AWXA 4CC4B 1M30A 2NUZA 1U5SA 2CRHA 5IHIA 4U1PA 2V1RA 1O4HA 1UUSA 2BZXA 1M27A 4GBQA 3VS7A 2J05A 1KSWA 1M61A 1LKLA 4JZ3A 3S8OA 1O44A 2DLZA 2FO0A 3H0FA 1RLQC 1M3BA 4H1OA 2EYWA 4OMPA 3TSZA 1MV0B 1SHFA 2GQIA 1SPSA 4E93A 1WXTA 3QWXX 2MK2A 1E6GA 2AUGA 1O4RA 2KEAA 2L3SA 1O4GA 1ZUYA 1K9AA 1QCFA 2MCNA 4FBNA 2OI3A 3PS5A 2ESWA 4FSSA 1XOVA 4RUGA 2BZYA 1BG1A 1Z9QA 5HKYA 1SKJA 3IMJA 2LNHB 1NEGA 2HBWA 3MXYA 3US4A 4DEXA 1WXBA 5I22A 2FPDA 2C0IA 1CJ1A 1WQUA 4RTZA 2LJ3A 5L23A 2DNUA 1SHBA 4EIHA 2EKHA 4E68A 2EGAA 1YP5A 1M27C 1AYAA 2JT4A 4F59A 1T0JA 1AZGB 1LCJA 1Y0MA 2F2WA 2KNBB 2P4RA 1O4OA 4AFSC 1O4NA 1G83A 1WIEA 2FRYA 5IXBA 2RF0A 1A1EA 4OMQA 1FBVA 3BUNB 1FYRA 2MQIA 1AD5A 4D8DA 2PNAA 4K2RA 3U23A 1AOJA 4CC2A 1BHHA 4QT7A 3BUOB 4RTVA 2ECDA 5EHPA 2LCTA 1MUZA 2IIMA 1BU1A 2KXDA 4CC3A 4GPLB 2LP5A 3NPFA 2KRMA 1BLKA 1UURA 1TCEA 3NHNA 4LN2A 2V1QA 2RQRA 2RVFA 1SPRA 1A81A 1AVZC 4OMMA 3N84A 1HCTB 2W10A 4XZ0A 4HXJA 3VS2A 3OP0A 2SRCA 5EELA 3GXWA 1CKAA 2KT8A 1OV3A 2LX7A 2DL3A 2VVKA 1OPKA 5AULA 1ZX6A 3CQTA 2VWFA 2D8HA 3KFVA 1BHFA 4AG2C 2CDTA 2RNAA 1K0XA 2CS0A 1Y1UA 2SHPA 1BM2A 1WXUA 2OJ2A 5ECAA 1KA6A 4J9EA 2DLPA 5DC0B 1G2BA 3HIZB 2JM8A 1GBRA 1GFDA 1O4JA 1NRVA 3OV1A 1X2KA 4JPBW 2L3PA 1IJRA 1TG0A 4OMOA 1BMBA 2J6OA 2EBPA 1JYUA 5CDWA 3I5RA 1KC2A 3R6NA 2CBLA 1GBQA 3UATA 2EYYA 2JS0A 2W0ZA 1UJ0A 1GCQC 1QWFA 4RTUA 4A63B 1BFJA 2DM0A 2CT4A 2A08A 1UDLA 3A98A 1QKWA 2JTEA 4RTXA 2CUDA 2HEQA 2KE9A 2LMJA 2RQTA 3H0HA 3ZL7C 2K2MA 4D8KA 2CT3A 4ORZA 2QMSA 1O43A 1SRLA 4GL9E 1U06A 4CC7A 1K0SA 1A0NB 1O4QA 2A36A 2FG0A 1HJDA 4FL3A 2ABLA 3MAZA 1UECA 2C0TA 3M0RA 3HHMB 2DJQA 4M4ZA 1OPLA 3UA7A 2LJ1A 2O2OA 3I9QA 1NZVA 1I1JA 5DC4A 2M0YA 2DMOA 4U17A 2AKLA 3K2MA 1BF5A 1IO6A 3GBQA 1MW4A 1I3ZA 3N7YA 2AKKA 1CSYA 2M51A 4X1VA 1UHCA 2KYMA 2L6KA 2JM9A 2ENMA 1AOTF 4EIKA 4H34A 1F1WA 4K45A 2MOXA 2EYXA 1RLPC 3ULRB 1F2FA 2OQ1A 3VROA 1D1ZA 3RBBB 4LUDA 1LUIA 3EACA 4XZ1A 4DGPA 1A1BA 1R1QA 2CREA 2EO6A 1TUCA 1YVLA 2DM1A 1X27A 2RPNA 4AFQC 2DILA 2CI8A 2HUWA 1O46A 1GFCA 1LUMA 1O4KA 1O42A 1AB2A 3S8NA 2ROLA 2YSXA 2YDLA 4FL2A 1GHUA 1JXOA 1PICA 1R1SA 3IN7A 5IXFA 4Z89A 1HD3A 3BUXB 5D0JA 2KT1A 4OMNA 4AG1C 2H5KA 2D0NA 1K1ZA 1AWWA 1O4MA 2RSYA 4OHLA 2EOBA 2PLEA 1LUNA 1Z3KA 3S9KA 1RUWA 2K3BA 3VRNA 1A09A 1RQQC 4TZIA 1VA7A 1W70A 3VS0A 1X6GA 2EYVA 3IQLA 2Y1MA 1AWOA 1X69A 3THKA 4F14A 2CI9A 1QLYA 1B07A 1A08A 2IZVA 5EG3B 2DF6A 1MILA 2RMXA 3VRYA 4HVWA 5FWBA 2MC1A 2O31A 2PTKA 2JS2A 4P9VA 3HCKA 2LQWA 3C0CA 2L0AA 2GSBA 3TKZA 4J9DA 2IUHA 1VYUA 2K6DA 4F5BA 1OOTA 2HCKA 4J9HA 1X0NA 1UUEA 1JQQA 1T3SA 2L4KA 1J3TA 2KRNA 1WX6A 1FU5A 1BBZA 2LJ0A 2OAWA 2AOAA 2IUGA 2RN8A 4LNPA 2L3TA 3OB2B 3O5ZA 1YN8A 3VRZA 4JJCA 2YSQA 1JU5A 4AFZC 2H46E 2LCSA 3PVLA 3KFJA 1ZLMA 1GCQA 3PVQA 2LNXA 2CR4A 1SSHA 4GWFA 1O4FA 1M3AA 1UGVA 2FPEA 1O48A 1AYCA 1O4DA 3M7FA 2HSPA 2CH4A 2B86A 2DX1A 1LKKA 1SHDA 3SEMA 1S1NA 2JXBA 1YWOA 2GBQA 2YUQA 3EGUA 1GCPA 2EPDA 1SHAA 2AOBA 2FEIA 2O88A 1KFZA 1MV3A 2KR3A 3VS4A 1AEYA 1FU6A 5KAZA 1UTIA 1BKLA 2J6KA 3VGOA 2EQIA 4ROJA 1O4PA 2MRKA 1XA6A 2CIAA 1BK2A 3M0SA 3VS6A 1A07A 1JYRA 2DBMA 2PZ1A 3PFVA 2J06A 3VS5A 1SEMA 3OVEA 2CSIA 3GXXA 1FHSA 1JU5C 5EHRA 2EO3A 2KK6A 1UE9A 1WA7A 2EGCA 2VKNA 3PSJA 4OHEA 1KJWA 1OO4A 2YUNA 2DE0X 4J9IA 3PSKA 3VRPA 4Y92A 1NG2A 1PKTA 2DL8A 2ETZA 4EY0A 1NYFA 3TSWA 3EG1A 4F5AA 2C9WA 3M0PA 2KXCA 1KIKA 2RQWA 1OO3A 1O4EA 1ABOA 1QWEA 1X6BA 2ROTA 2G6FX 1SRMA 2IUIA 2BZ8A 5HCKA 2E5KA 4QSYA 2GGRA 1D4WA 1HCSB 5DC9A 1WYXA 2C0OA 4X6SA 1FYNA 2YUPA 1SHGA 1O4LA 5EEQA 3NGPA 2FRWA 1BFIA 1I07A 2DL7A 1M8MA 2A28A 1CSZA 2EW3A 4K11A 1ABQA 1JYQA 2CUBA 3UYOA 2K7AA 2GE9A 2HMHA 3TVTA 1H3HA 4DEYA 1T0HA 2GTOA 2RQUA 2XMFA 2JW4A 1K4US 1CWDL 1O4BA 1VYVA 2PNBA 1T3LA 3VS3A 1ZBJA 4L1BB 1Z9ZA 3ZNIA 1UG1A 3REAB 3NMZC 4K44A 2L3QA 1CKBA 1UFFA 3H0IA 1PRMC 2O9SA 2H8HA 2ECZA 3JV3A 4GLMA 4RTWA 4HCKA 4RTYA 3IMDA 3CD3A 2AK5A 3GQIB 2Y1NA 1O4AA 3PLFB 3OB1B 2KGTA 4WCIA 1NYGA 1SPKA 2NWMA 3EG3A 4F17A 3BUWB 2EGEA 2JMAA 1JO8A 1X43A 3C7IA 4OHDA 1QG1E 1BKMA 1RI9A 4JGHA 2Y3AB 2EL8A 3I5SA 2DLYA 3M0QA 1FBZA 4LE9A 1AYBA 4NWGA 2L2PA 5IBSA 3H41A 2KROA 3M0UA 2OZOA 1EFNA 4A4CA 1RJAA 5I6VA 4F16A 1IS0A 3LH5A 4R0KA 1CSKA 1BB9A 1M3CA 3UA6A 2KNOA 3UF4A 4HVUA 1OEBA 2K79A
chains in the Genus database with same CATH superfamily
2F1LA 2CZ7B 3CMET 3M56A 3CCRT 2DRKA 3VS1A 5IHKA 1M1FA 2EJGA 4EMHA 1BCMA 3REBB 1U1TA 4EPCA 2YUOA 1TXQA 3PQZA 2ZAEA 2PNIA 1MGQA 4EMKA 5J3XA 4QQGA 2BUDA 4J6XA 1VUBA 1K73R 2V8JA 4N0AC 2PLDA 1ZHIA 2DBKA 2K3YA 3MP8A 3M58A 3QBYA 4C92F 1PSFA 1UGQB 1H92A 2B3OA 4LD6A 3MEUA 4DOVA 3CMEA 1UHFA 3CCRA 4M7AD 3CWGA 2E5QA 2ZGWA 3VJPA 2HL3A 1X2QA 1A1CA 1A1AA 4ESRA 5LJ5e 1JWOA 3EFOA 3PJPA 3T04A 4A4BA 3WA4A 2B8AA 1VYTA 1RAFB 1TZEE 2YT6A 5GAN8 3RNJA 1YWPA 1N9SA 1BYMA 4M75F 5LJ5d 1K8AR 1AYDA 4M7AB 2WSCE 1E7OA 1GRIA 1PHTA 2KDSA 3TQ7P 4C0FA 3G1JA 2CSQA 3OS1A 2O9VA 2CH4W 4IUPA 4N4HA 2AIRB 4KUDK 1K9MC 4IUQA 4JJBA 1WFWA 2ZPHB 2F2VA 2CP7A 5IH2A 1V1CA 3SHWA 4KRTA 2F2XA 4J9GA 5EC7A 4UC4A 3CPWA 3CCEQ 2RK1A 2RMOA 4F04B 5FWCA 4X9CA 4HT9A 4DA4A 2FCIA 3EAZA 2HDVA 1WHJA 4JLIA 1BI1A 1D0ZA 5HKZA 4PK4A 1AZEA 1M30A 2F69A 2NUZA 2CRHA 4C5HA 2V1RA 1O4HA 1X6OA 4IUVA 4OGCA 5CQYA 3VS7A 4C0ZA 2J05A 4PJOB 1M61A 3GNFB 2FO0A 1RLQC 2RD1A 2IVWA 1M3BA 4H1OA 3TSZA 1SHFA 1N6AA 1E6GA 2AUGA 2K5IA 1O4RA 5DM7R 2MCNA 2OI3A 3PS5A 2ESWA 1N8RC 1BG1A 5GAOq 4OMFB 5HKYA 1LPLA 2VUBA 3IMJA 2JUFA 1NEGA 2HBWA 2DNUA 1SHBA 4BY6C 2QEXQ 1VQ5T 2JTFA 1T0JA 3CCJT 1M2VA 2M1HA 2EYQA 4MMKA 2LNVA 1G83A 1RABB 4OMQA 1QVGP 5CIUA 1U8RA 4BE0A 1JBMA 4BB7A 4OB3B 5LJ5f 3JCMQ 1BHHA 5KCHA 4FW2A 1G3WA 3JCMc 5EHPA 1V29B 2LCTA 1MUZA 2IIMA 2LTOA 2KXDA 2EQJA 3RIRA 1QVFA 1W2BS 1BLKA 1VQ5A 3CCUT 4LXCA 3L2QA 4A54A 3OYHA 3CCJA 3CPFA 1KG1A 2RHUA 2W10A 2SRCA 3GIBA 1FX7A 1QMCA 2DPPB 2KT8A 3CC4T 2VVKA 1MMAA 3G4ST 1VQOQ 1UGSB 1ZX6A 2LT4A 2VWFA 2DJZA 2RM4A 4M77B 3OYIA 1Y1UA 5ECAA 1N27A 2MI6A 2DLPA 5DC0B 1JJ2P 4LDXA 1GBRA 4KGXB 1O4JA 4M7DE 2YHTA 3CCUA 3T9NA 4JPBW 1RAGB 3META 4B6MA 2L5QA 2D9TA 4OMOA 2J6OA 2EBPA 2XICA 2CBLA 5FRNA 1GXIE 3UATA 4N4GA 4RTUA 5GAMg 2A08A 1UDLA 2VV5A 3C94A 3CC4A 3G4SA 1YITQ 2KE9A 3A8LB 3S3NA 4E7SA 4M7DF 3ZL7C 2OTLT 1SRLA 2HD0A 3S3MA 4E7JA 4FL3A 2ABLA 2VB6A 2C0TA 3HHMB 5GAMh 4BUGA 1OPLA 3I9QA 2KK4A 1NZVA 2M0YA 1FMVA 1I5OB 2DMOA 4U17A 1BF5A 3I55Q 1IO6A 1MW4A 1VQ9T 2DKGA 4X1VA 2ZPFB 3CCLQ 2L6KA 1M2OA 2QQBA 3EGDB 1AOTF 4JS4A 2DTOA 3ULRB 1H3ZA 4DOWA 3VROA 3RBBB 4LUDA 2E3HA 3JCMd 1A1BA 3KBGA 4FW1A 1TUCA 2OTLA 5GANg 2LDMA 2FYKA 1M90R 2DM1A 4XQ3A 4AFQC 1LUMA 1O42A 3GP8A 2ROLA 2YSXA 1GHUA 5IXFA 1HD3A 4HCCA 2XD0A 5D0JA 3E1SA 2BIVA 4ATOA 4D6WA 1VQ9A 3MP6A 3VU3C 5GANj 1Z3KA 3QJYA 3VRNA 1RQQC 3VS0A 5CO7A 3OSSC 1FMWA 5GMKe 1O9SA 3CPWS 5FWBA 1YJ9A 2PTKA 5LJ3e 3HCKA 1KD1C 4F7UE 1KQSA 4J9DA 4ELYC 2RI5A 2QGGA 1OOTA 4KH1B 1BKBA 5HY6A 1M1GA 2KRNA 1WX6A 1J3TA 1BBZA 2LJ0A 2AOAA 2L3TA 1WPYA 2RN8A 1P92A 3O5ZA 1VIFA 3CMEQ 3CCRQ 2YSQA 3QSUA 2V26A 1NJIC 1D1AA 1GCQA 2D6FA 3DB4A 2LNXA 4M7AC 3LW5E 1AYCA 2LVMA 5LJ5j 4AT1B 1KHCA 3CMAT 1Y71A 2GBQA 2YUQA 3UWNA 2IG0A 2AOBA 2EPDA 2O88A 3OS2A 2KR3A 1AEYA 2O4XA 3OYJA 3PTAA 3CXCA 1BKLA 3C12A 2J6KA 4BE2A 2EQIA 2CP2A 1MMDA 1Q81C 2J06A 4KUIA 1B34B 3GXXA 1K9MU 2H3EB 2P0QA 4M78G 1WA7A 2PUOB 2MYSA 3JCMf 3CCQT 3L2WA 4HCBA 1OO4A 2VASA 3CMAA 4J9IA 2PU9B 3PSKA 3VRPA 2MK5A 3H9NA 2ETZA 3OA6A 3EG1A 4F5AA 2C9WA 2FZCB 3M0PA 1WHLA 4MMLA 1O4EA 1QW1A 2BKDN 3HTRA 2E5KA 5CKEA 2RH2A 2GGRA 4JRIA 1WYXA 2C0OA 2YRDA 1VQKT 3QZ5B 1KQ1A 3D7SB 2FRWA 1BFIA 2A28A 4RKUE 3KUFA 3QPHA 4DBFA 4M7AF 2MAMA 3UYOA 3TVTA 2DIQA 1F1BB 3SWNB 2GTOA 2RQUA 2ZCFB 1CWDL 5DLOA 1N8RU 3NTHA 1NE8A 3SFMA 4OB2B 1UFFA 2GF7A 3H0IA 1PRMC 2O9SA 2Y4YA 2ECZA 4GLMA 4RTWA 4HCKA 3IMDA 3CD3A 1O4AA 3HPWA 3G7ZA 4PJOE 1JO8A 1X43A 5DY9A 1RI9A 2HBPA 2Y3AB 3M0QA 3M54A 3FDRA 3M0UA 1EFNA 4J7IA 3RMQA 4KGVB 4F16A 3OYYA 2A3LA 2KNOA 3VYHB 4HVUA 2BBUA 3MHXA 4RTTA 2I0NA 4M7DD 3LGFA 4J9CA 1W1FA 4P9ZA 2NUTA 2MIOA 2WSFE 3EHRA 1U3OA 3CC2T 1AWJA 3TL0A 2QDLA 1NM7A 3QDFA 1NLPC 3EHQA 4JJNK 2NLUA 3OBWA 1Q7YR 1VQ5Q 1PG5B 1E6HA 4JRPA 4J7FA 5D7UA 4Z8AA 5IBMA 4JEGA 1N5ZA 3M59A 3G6ET 3HL8A 3CCJQ 2JN0A 3S6WA 1B47A 2EU0A 3GPLA 3RERA 2FB7A 4FT2A 3EAEA 1Y57A 3FIFA 3EG9B 2X4WA 4QVCA 1ARKA 2QI2A 3TU4K 1H8KA 4XTZA 3CC2A 1ACMB 1QADA 2E41A 1UGPB 2EKOA 2FL7A 4IIMA 2ED1A 1YITT 1K9MR 1Q82C 3CCUQ 2YU7A 5HKWA 3FJ5A 2DYIA 3G6EA 2E70A 3OYGA 4XTWA 4Z02A 3OYCA 3QHSA 1YVHA 1M5Q1 4DQ2A 3I35A 1P13A 3EG0A 3OMGA 3CC4Q 3G4SQ 1O45A 2VC8A 2KRSA 2DL4A 1W6XA 3JCMW 1KQSS 1VQ7T 4M77E 1Y96A 2RB6A 1ZA1B 5IHNA 2XP1A 4QVDA 4E47A 1LUKA 2JVVA 4C0DC 3CXLA 2AZVA 1YITA 1YNZA 3MPUB 1LNXA 1YCSB 3SB2A 2HDXA 4FYVB 1RI0A 3RKWA 2Y90A 4L6V5 1D1CA 3PMIA 5KYUB 1G3YA 4M75A 3RKXA 2DIGA 3V8LA 3S8LA 2X35A 4OHHA 1BHHB 1ZSZB 1VQ7A 2X3XD 1QKXA 1B3QA 1FWZA 4M77G 2EQUA 2BE7D 3CXCS 2OTLQ 1UUSA 1M27A 1M4ZA 2MWPA 4GBQA 2RA2A 5KYXB 3S8OA 3H0FA 3MP1A 5LJ3h 3E9FA 3TCJA 2EYWA 4OMPA 4E93A 2GQIA 5GAMe 1VQ9Q 2KEAA 3ASKA 1O4GA 4FSXA 4C8QG 5CCAA 1TH7A 1XOVA 1ZQ1A 2BZYA 2LRQA 2RK2A 1G3SA 3PIPA 1TUGB 2P0KA 1KD1U 1Q95G 1CJ1A 4YTLA 1WQUA 2EKHA 2CZ0B 4E68A 4BI3A 2KSSA 1M27C 4PFPA 1OULA 2JT4A 4M78B 1AZGB 5CR2A 4MDWA 1B7TA 3JB9I 4FCYA 1YHQT 4AFSC 1O4NA 4L59A 1NJIU 3HRUA 5IXBA 5HKCA 1A1EA 1QVGA 5I2MA 1QQJA 3NTIA 4D8DA 2XKOC 3A1PA 2VXFA 4JDSA 4RTVA 4C5IA 2QA4T 4J5YA 5C6SA 2Z0WA 3JAME 2CYZB 3NPFA 5D6XA 2KRMA 2VYTA 2RO0A 4MZPA 2ZZDA 2EJFA 2R5AA 2RVFA 2RJEA 4HT8A 2QQRA 4OMMA 5I2SA 4KT0E 1Q81U 3EGXA 3N5BB 5KYWA 4HXJA 1YHQA 2E6ZA 2XIDA 3OP0A 3EH1A 2EQKA 2DL3A 2COWA 2DEQA 2LQ8A 4FYYB 4BI4A 1Q86C 2D8HA 1BHFA 4PJMA 8AT1B 2R58A 4AG2C 2QA4A 1K0XA 1VQMQ 3JCMX 2SHPA 1WXUA 1KA6A 2COZA 3HIZB 1MNEA 1JJ2A 4NOYA 3CMAQ 1NRVA 1X2KA 3ZEHA 4TVRA 4XTYA 3JSCA 1TG0A 3H8ZA 5CDWA 3I5RA 3R6NA 2E3IA 2XK0A 2JS0A 2V8KA 3AT1B 4A63B 4BDYA 2R57A 3SWNC 4PJOD 1KQ2A 2CUDA 4ME7A 2LMJA 1WHMA 3H0HA 1WZOA 3OW2S 2QMSA 1O43A 3M55A 2EFIA 3CCQQ 4CC7A 2X51A 2A36A 2XU8A 2FG0A 1HJDA 2XDDA 2GFUA 3ZFJA 1QCOA 4OP0A 3M0RA 4LDWA 2A0FB 1M8VA 1I1JA 5DC4A 2HL5C 3K2MA 1I3ZA 2NUPA 7AT1B 1UHCA 1RL2A 5GAN7 4H34A 2CP3A 4K45A 3CEYA 1KC8C 4V2SA 1D1ZA 1VQKQ 1LUIA 4M7DA 3HKSA 1D1BA 2P84A 3OYMA 2DILA 2E10A 2CI8A 2HUWA 1O46A 1W2BP 1AB2A 4FL2A 5CKDA 1PICA 3HP9A 2D0QB 2IPOB 2QQSA 2CS7A 2RJDA 4OMNA 5FROA 4Y91A 1K1ZA 1AWWA 1O4MA 4OHLA 2EOBA 2DZ9A 1VA7A 1X6GA 1AWOA 1X69A 1EX4A 4F14A 2CI9A 1B07A 2LCCA 4M7DC 1OYXA 3PGGA 2HQXA 2JNGA 3INZA 2GSBA 2ZPEB 3TKZA 5GAN2 4J8OA 2AT1B 4MZTA 4M77D 4Y28E 5KYYB 5LL6S 1UUEA 4BDZA 3CCVT 1AOUF 2OAWA 3KXTA 2LRAA 3VRZA 4JJCA 2LX9A 4XTVA 5AYFA 1D09B 3KFJA 3PVQA 1TU0B 1Q82U 3CC2Q 1O48A 2M02A 2YLCA 5GMKi 2M0OA 2PVOB 2B86A 2BE9B 2DX1A 3DB3A 1LKKA 1YWOA 5IAYA 2GQVA 3G6EQ 3F70A 3DKMA 2EJ9A 2LT1A 3CCVA 1WJSA 1XA6A 1BK2A 2FHDA 1JYRA 2DBMA 2PZ1A 1K73C 3VS5A 3OVEA 2CSIA 3HRTA 1FHSA 5EHRA 4F7UA 1UE9A 4XTUA 2EGCA 4ZTJA 2HKQB 1VQPT 4C8QB 3LWHA 4OHEA 4R55A 3OB9A 2YUNA 3PFSA 1QVGS 1NG2A 1I5LA 4KBMB 3RMSA 4IUUA 3CC7T 1NZ9A 3QYHB 2KXCA 3A5ZB 1Y07A 1QWEA 1YBYA 3AHUA 2ROTA 4WF2A 3L42A 2PQWA 1QCNA 3VUBA 1C6VX 1XQHA 1SRMA 4C0GA 4QSYA 5DC9A 4KGZB 1VQ7Q 1BI3A 1FYNA 1OU9A 4NL3A 2FZKB 1SHGA 5EEQA 1I8FA 3NGPA 3QUIA 2DXCA 1YJWT 4OF1A 1VQPA 5IN1A 2KY9A 2E4HA 2EW3A 1XTDA 1K8AC 1IZ6A 4PNOA 8ATCB 4GY5A 1UGRB 2HMHA 3DLLA 2JW4A 2L3RA 3I56T 3CC7A 3VS3A 1D3BB 4A4EA 1ZBJA 2YRCA 1PCXA 4QW2A 3LWIA 3L2UA 2L3QA 1D0XA 2AK5A 2HSEB 5D6WA 3GQIB 3EG3A 4F17A 4PFOA 5C0MA 1YJWA 2QASA 2JMAA 3V7RA 4WTOB 1QG1E 1IHVA 3JCMb 5GANh 3GNGA 4JGHA 2EL8A 1IGUA 1OZ3A 1AYBA 1RACB 4M7AA 3H41A 3HSBA 2KROA 3OYBA 3VV0A 4A4CA 3I56A 5I6VA 3R6OA 3K2TA 3LH5A 4C92B 1BB9A 1NPRA 3EFSA 1NPPA 1OEBA 3JB9J 2EKXA 1JXMA 4JZ4A 4Z88A 5LJ5g 5LJ3d 3O8VA 1CWEA 2RHYA 1D4TA 1BLJA 3US4A 5BO4A 5IT9E 3EG2A 1LCKA 4DBHA 4ZGEB 1JEGA 1WJRA 4M78E 3JCMJ 4F7UF 1VQMT 1KA7A 2LQNA 1YHQQ 4RCBA 5AXIA 1Q86U 2ZPBB 2J7IA 5CKBA 4M75B 2K7AB 1FMKA 2EVRA 4PJOA 4WWQA 1NEBA 1ZFPE 1O41A 4ZGDB 1NZLA 4ZTFA 4Q5WA 2QA4Q 2SEMA 2CP5A 1O47A 1K76A 2DX0A 5HK3A 1TUDA 3OYEA 1MMGA 3LYIA 2K9GA 1U1SA 1VQ4T 4NWFA 2AZSA 4L5GA 5I11A 4OVAA 1PRLC 3M0TA 1VQMA 1N9RA 2COYA 9ATCB 2A7YA 2K2VA 3V8KA 5CKFA 2L89A 2PVDB 2DO3A 1ZSGA 3OYDA 1S72T 4PJOC 2KYBA 3FB9A 1Y7XA 2JMCA 2JYQA 1PM3A 1RAAB 2K79B 1QVFS 2K3XA 2VIFA 1VQ4A 4A53A 3N8MA 4J9FA 1DJ7B 3QO3A 5GAOm 3NFCA 5GMKl 2DZCA 2RQVA 4OMLA 4AMCA 4EMKB 3CCQA 5FU6B 1KC8U 2KQWA 1LVKA 1WHHA 1MHNA 1D0YA 1X01A 1O4CA 5GAN5 4FYWB 1PNJA 4ZNXA 3PT9A 2RORA 3BUMB 2VGNA 3MJXA 4CC4B 1SSFA 1U5SA 2OX7A 5GMKm 5LJ3f 2WACA 1KSWA 2R5MA 3FJPA 4RMOA 1LKLA 1VQKA 1RAIB 2DLZA 2HQEA 2JJ9A 1M1KC 2JTMA 2O01E 5CVIA 4DBQA 1MV0B 3FRNA 1SPSA 2X4YA 2X9HA 4PL6A 2L3SA 1VQ8T 1WQWA 4JRKA 3EFOB 4E7ZA 4FBNA 3E19A 2WSEE 2HZYA 2XDBA 2RI3A 3LX7A 4DEXA 1WXBA 5I22A 2K4YA 4PJOF 4RTZA 5L23A 2QQAA 5KH6A 3QZ9B 3X26B 1HXDA 2RHIA 1AYAA 4F59A 2AHJB 4X9DA 3BFMA 4FT4A 3CCST 2F2WA 2VGMA 5CK9A 2MMPA 1OQKA 3OYFA 1WIEA 1M90C 1VQ8A 3A8MB 4M77C 5A0DA 3QDRB 2KI7A 3BUNB 2FVUA 1AD5A 2MQIA 2KVQG 4CC2A 4QT7A 4HA8A 3L2RA 3VKIA 4MDXA 1BU1A 4OB0B 2YLBA 2MF2A 2ZPIB 4GPLB 5GAOp 1UURA 2QTXA 1TCEA 4DBRA 3EGDA 2VXEA 3GOXA 1SPRA 1JB0E 2HQHA 1A81A 3Q1JA 1AVZC 3N84A 1HCTB 3CCSA 4XZ0A 1K73U 4X34A 3VS2A 3CCVQ 3CBOA 1R77A 2DTHA 3UT1A 2LX7A 4A4HA 5AULA 3CQTA 4EDUA 3DLMA 4J6YA 3OMCA 1G2BA 2V8IA 3P8DA 2ATCB 1VQNT 2CP6A 3JCMg 1GFDA 3OV1A 2PVGB 1IJRA 1BMBA 4KH0B 2CZ6B 2OTJT 1KC2A 2LCLA 1WHGA 1UJ0A 1QWFA 2JOYA 4XTXA 1VQLT 2DD5A 1BFJA 2DM0A 3A98A 2JTEA 4RTXA 3FC3A 2HEQA 4VUBA 4XU3A 4ZN1A 2RQTA 1M2VB 3OS0A 4M77F 2K2MA 4XAXB 1K8AU 4ORZA 4C8QE 3CCMT 4GL9E 1VQPQ 1U06A 3SD4A 1K0SA 1A0NB 1VQNA 1IB8A 3JCMV 1N8RR 4JRQA 1UECA 5FU7B 2DJQA 2LJ1A 2O2OA 4C5GA 3CC7Q 2OTJA 2AKLA 3GBQA 3N7YA 4A4FA 2M51A 1VQLA 3JB9H 2KYMA 4QKUA 4QQDA 2JM9A 1F1WA 2MOXA 1RLPC 4E7KA 1F2FA 4II1A 4ANJA 3MEWA 3EACA 4M78D 5A0GA 1R1QA 2CREA 1YJWQ 1YVLA 1JRIA 4A4KA 1X27A 4C5EA 3OYAA 1O4KA 1GFCA 2QGFB 1W2BA 5GMKj 4XU1A 2DK3A 1R1SA 4J6WA 3IN7A 1W4SA 1B34A 4Z89A 5GAMd 2E65A 5LJ3j 3X25B 5M9OA 3I56Q 3RKYA 4AG1C 2H5KA 2D0NA 1SG5A 1VQ6T 5GAN3 2RSYA 2PLEA 2XDPA 1LUNA 3BY7A 2GCXA 1A09A 3JB9G 4TZIA 1IRXA 1R0BG 1IHWA 3IQLA 1SF9A 1R8OB 1OX9A 2QXFA 4BI8B 4BE1A 1A08A 2DF6A 1MILA 2RMXA 2DD4A 2O31A 2LQWA 2L0AA 4QQ6A 5GANe 1RAEB 4JS5A 2IUHA 3LH0A 3M4GA 4C92E 2K6DA 4F5BA 1VQ6A 4FM4B 3OYLA 5A2QE 3OB2B 4LNPA 4E7HA 5GANd 3JCMP 1XNIA 4AFZC 4LDYA 3PVLA 3V8JA 1TSFA 1ZLMA 4OB1B 1SSHA 3SWNA 3OW2P 2DXTA 1M3AA 1UGVA 2FPEA 3M7FA 2CH4A 4OGEA 3H6ZA 5GAN6 4RG8A 2QYZA 1S1NA 2JXBA 3L2VA 4LDVA 3TREA 2FEIA 1KFZA 2KGYA 3GLXA 2RJFA 2DVEA 5KAZA 4C92G 4M75E 4ROJA 1O4PA 2H3JA 3M0SA 3VS6A 1Q7YC 1A07A 3PFVA 4EMKC 5FU6C 2DXUA 2KK6A 2VKNA 3CD6T 1KJWA 1VQ4Q 2DE0X 5GAOn 1TTHB 4XU2A 4Y92A 2LC4A 2ZPGB 3M9QA 4EY0A 4HKEA 2E1HA 3V7SA 5GAMf 1O75A 1OO3A 2QDYB 3MCAB 4M75G 2IUIA 5HCKA 2CKKA 1S72Q 3TEEA 1O4LA 3QXEB 3ER0A 1I07A 2DL7A 1M8MA 2PUKB 1M1KU 3CD6A 5L8RE 2E6NA 1YJNT 2M9UA 1UB4A 2K5LA 1T0HA 2XMFA 1YI2T 1O4BA 2PNBA 1K4US 4NS5A 3EG9A 3FEOA 4JLGA 1Z9ZA 3CBPA 3J81E 3REAB 3NMZC 4K44A 1KD1R 1WNLA 2H8HA 3BE3A 3JV3A 4RTYA 2O4XB 5GANf 2Y1NA 2DXBA 3OB1B 4O5VA 4WCIA 3BUWB 2EGEA 3C7IA 3QJ6A 3URGA 1BKMA 5GAN4 5KE3A 1R0CB 3J80E 3I5SA 2P0PA 3NTKA 3G71T 1YJNA 2L2PA 4NWGA 1NJIR 3C4SA 1M90U 2HKNA 2OZOA 1YI2A 2E12A 1IS0A 1ZA2B 1CSKA 1VQ8Q 3E2UA 5CAIA 2A37A 2YRVA 2KBTA 2EYZA 2D8JA 6AT1B 2DA9A 2M16A 1BI2A 3A8HB 1WDXA 2QG9B 3MO8A 4CRIA 3OYNA 2D1XA 1GL5A 2LZ6B 2MWOA 3CBLA 5GJVB 1OU8A 3OBYA 5KYUA 1UEBA 1X6CA 1Q81R 3G71A 4IKFA 4LUEA 1BCOA 1ZSZA 4OHIA 2P4TA 2DFUA 3BKBA 3CCSQ 5DF6A 4C8QD 4DGXA 1O49A 4JJDA 2EAYA 1O4IA 3MXCA 4XU0A 4E7LA 5KYXA 2DETA 4PJJA 3VRRA 3X24B 3EFRA 4KULA 3M4YA 3VRQA 1PD1A 4CI0C 5I21A 3RR6A 4JE4A 4ELZC 2GTJA 1I0CA 2DCRA 4GLKA 4J9BA 5FW9A 3JB9D 2LNWA 2J6FA 4BACA 1WHKA 1I4K1 4IUTA 1IREB 1OX8A 1PWTA 2DVJA 4IIOA 2EWNA 2DAQA 2DL5A 2X3WD 3J7AF 1AHJB 4PKCC 3QWYA 2BTTA 1ZSZC 1RPYA 2FPFA 1EZZB 5FU7C 2HDAA 3MKDA 5GJWB 2ED0A 5GJIA 1PKSA 2XHCA 2NYSA 2DYBA 4E2FB 4ZGJB 3P8BB 2GNCA 1WI7A 4M78A 5J39A 1HSQA 3PE0A 2MRJA 1UJYA 1C0MA 1R1PA 5J3BA 3OY9A 4AFUC 1VQNQ 1YIJT 1QVPA 3HRSA 1H9OA 3RDVA 2Y4XA 5FRMA 2NUTB 5DLQE 1OI1A 3CPWP 1M1KR 2OTJQ 5A0LA 3HHTB 1ZUKA 1ZUUA 3IN8A 1VQLQ 2DRMA 4IURA 5KYNA 5GJHA 4HVVA 4P5NA 1WLPB 2MPXC 4E6RA 1NLOC 5GAMj 4M7DG 1AWXA 3BW1A 2QTVA 2CZ1B 4C92D 3CCMQ 3JCMe 4M78C 5IHIA 4B9WA 4LD9K 4U1PA 1JJ2S 1PC0A 2BZXA 4NL2A 2K5FA 1YIJA 2EQMA 4JZ3A 1O44A 4E7IA 1TOVA 3BDUA 4C0DB 2KMTA 1WXTA 3RUXA 3QWXX 2MK2A 1YJ9T 1ZUYA 3LGLA 1RAHB 1K9AA 1QCFA 1TWBA 5AT1B 1YCYA 4FSSA 4PFZA 4RUGA 2DERA 1Z9QA 1SKJA 2G3RA 2LNHB 3MXYA 2FPDA 2C0IA 1QP3A 1OZ2A 2KAFA 2LJ3A 4EIHA 4M75D 2EGAA 1YP5A 1Y96B 2F5KA 1LCJA 2QK0A 1BI0A 1Y0MA 2P4RA 2KNBB 3S3OA 1O4OA 1VQ6Q 3M57A 2FRYA 1EIFA 2RF0A 4QVZA 1FBVA 1FYRA 1Q82R 2PNAA 2RHZA 4K2RA 3U23A 1AOJA 2E64A 1WQ7A 3BUOB 2ECDA 4R56A 4BD3A 3L1AA 2K57A 5LJ5h 4CC3A 2LP5A 1QVFP 1WGSA 3NHNA 4LN2A 2V1QA 2RQRA 4M78F 1Q7YU 5EELA 3GXWA 1CKAA 1OV3A 1OPKA 2HNIA 1V76A 3M5AA 3QKJA 4LDUA 3KFVA 3MEAA 2CDTA 2RNAA 2CS0A 3E9GA 2HAXA 2XG8D 4F7UG 1BM2A 2OJ2A 5GAOl 4J9EA 2JM8A 3GF5A 1I81A 5J26A 2QAZA 2L3PA 5EG2A 3A8OB 1JYUA 4FIBA 3CCET 1GBQA 2EYYA 2W0ZA 1GCQC 2CT4A 1QKWA 2I2LA 4FL6A 3C95A 4D8KA 2CT3A 3VUZA 5KYYA 3CD6Q 1IXDA 1O4QA 3ZBDA 4M7AE 5D6YA 3WVDB 3OYKA 1S72A 2XI9A 3MAZA 1AT1B 1H641 3UA7A 4M4ZA 1QP2A 3CCEA 1WJQA 1BIAA 2AKKA 1CSYA 3LLRA 2ENMA 3SDZA 4EIKA 2EYXA 2DTIA 1VIEA 2OQ1A 4XZ1A 3EGXB 5KYWB 4DGPA 4M77A 1BIBA 2EO6A 4XK8E 4RCCA 2RPNA 3MEVA 2QEXT 3S8NA 2YDLA 1C1AA 1YJNQ 1JXOA 4M7AG 1LOJA 3BUXB 2EIFA 1YI2Q 2KT1A 3OS5A 4O6JA 3M53A 1PSEA 3UDCA 3X28B 3WVEB 3S9KA 1RUWA 2CGHA 2K3BA 3HFNA 4C8QA 1W70A 4N4IA 2FZGB 2EYVA 2Y1MA 2YXYA 2X4JA 3THKA 1QLYA 1HK9A 2IZVA 5EG3B 3VRYA 4HVWA 2MC1A 1G3TA 2JS2A 4P9VA 3C0CA 2QEXA 3G71Q 1KQSP 1Q86R 3UPUA 3LYVA 2RHXA 1VYUA 4JUVA 1X0NA 2HCKA 4J9HA 4FU6A 3HFOA 1JQQA 1T3SA 2L4KA 1FU5A 2IUGA 3JRZA 2GFAA 1YN8A 4PJOG 5HK0A 3WXMB 1VQOT 2C06A 1JU5A 4C8QC 2H46E 2LCSA 4BY6B 2CR4A 4GWFA 2NUPB 1O4FA 1G5VA 3OW2A 2OAUA 1O4DA 2HSPA 4PJNA 1D3BA 1IGQA 1SHDA 3SEMA 3EGUA 2LQKA 1GCPA 1SHAA 4M7DB 2YWWA 4PLIA 4A4GA 2F5TX 3FLGA 1MV3A 1SKUB 3VS4A 3V7CA 1MNDA 3CXCP 1VOMA 4J83A 1FU6A 1RADB 1UTIA 5KCOA 3VGOA 1G8XA 2L8DA 3VYGA 2MRKA 2CIAA 3QIIA 2JZ2A 1VQOA 1SEMA 3L2ZA 1LJOA 2X4XA 1JU5C 2EO3A 5KE2A 2RI2A 4PJLA 3PSJA 4C92A 4HCZA 1MMNA 4PLLA 1KC8R 3X20B 1PKTA 2DL8A 3JCMh 3ME9A 1NYFA 3BDLA 3TSWA 1KIKA 2RQWA 2HMAA 2QQ9A 3I55T 3RESA 4MZMA 1ABOA 1X6BA 1HYOA 3CCLT 2G6FX 1ZBXA 2BZ8A 1TS9A 4ZN3A 1D4WA 1HCSB 4RG2A 4X6SA 1PD0A 2RJCA 2YUPA 1NBEB 3QG1A 4C8QF 4B9XA 1CSZA 1KHIA 4K11A 3A8GB 5CKHA 4EMGA 1YIJQ 4C92C 5LJ3g 3P8HA 1ABQA 1JYQA 2CUBA 3PNWC 2K7AA 2DEUA 2GE9A 1X75C 1H3HA 4DEYA 1VYVA 4FYXB 1T3LA 3CCMA 3I55A 4L1BB 3QYGB 3ZNIA 3PMTA 1UG1A 3CCLA 1FXXA 3JB9F 3OQ5A 1CKBA 5GAOr 1KK7A 3PIOA 5GMKh 3CBMA 3PLFB 2KGTA 1NYGA 1SPKA 2NWMA 3EH2A 4OHDA 2DLYA 4N0AA 3OSVA 1FBZA 4LE9A 5IBSA 1M9SA 2CP0A 4M75C 4F7UB 1YFNA 5CQXA 1RJAA 5FLXE 4R0KA 1M3CA 3UA6A 3UF4A 1XJWB 1YJ9Q 2K79A
chains in the Genus database with same CATH topology
2BBUA 2A37A 4RTTA 2KBTA 2I0NA 2EYZA 2D8JA 2DRKA 3VS1A 5IHKA 2EKXA 2DA9A 1JXMA 3REBB 4J9CA 1W1FA 4JZ4A 4Z88A 4P9ZA 2YUOA 2MIOA 1WDXA 3EHRA 1U3OA 1CWEA 3PQZA 1AWJA 2D1XA 1GL5A 1D4TA 2PNIA 1NM7A 2LZ6B 2QDLA 1NLPC 3EHQA 5J3XA 3CBLA 3TL0A 3EG2A 5GJVB 1LCKA 1X6CA 1E6HA 1JEGA 5IBMA 4Z8AA 4LUEA 2PLDA 4JEGA 1N5ZA 2DBKA 1KA7A 4OHIA 3BKBA 1B47A 2LQNA 2EU0A 5AXIA 5DF6A 2J7IA 4DGXA 1O49A 4JJDA 1H92A 2B3OA 1O4IA 2K7AB 3MXCA 1FMKA 1UHFA 2EVRA 4WWQA 1NEBA 3VRRA 1ZFPE 3CWGA 1O41A 1Y57A 1NZLA 3VRQA 2SEMA 1AOUF 1ARKA 1O47A 1K76A 1H8KA 1QADA 1X2QA 2DX0A 1TUDA 1A1CA 1A1AA 4JE4A 2GTJA 2K9GA 4IIMA 1I0CA 2DCRA 4ESRA 5FW9A 4J9BA 2ED1A 4NWFA 2LNWA 1JWOA 2AZSA 5I11A 2J6FA 2YU7A 3PJPA 3FJ5A 5HKWA 3T04A 4A4BA 3WA4A 1PRLC 1PWTA 1VYTA 2DVJA 3M0TA 2YT6A 4IIOA 1TZEE 2DL5A 2X3WD 3RNJA 3QWYA 2BTTA 1YWPA 1RPYA 1YVHA 2FPFA 3I35A 1P13A 2HDAA 3EG0A 1AYDA 5GJWB 1ZSGA 2ED0A 1O45A 5GJIA 2KRSA 2DL4A 1W6XA 1E7OA 1GRIA 1PKSA 2DYBA 1PHTA 2GNCA 1WI7A 2KYBA 5IHNA 2CSQA 1HSQA 2O9VA 2CH4W 2JMCA 2JYQA 2XP1A 3PE0A 2MRJA 1UJYA 1R1PA 2K79B 1LUKA 2VIFA 3CXLA 4JJBA 4AFUC 1WFWA 2AZVA 1YNZA 3N8MA 1BLJA 4J9FA 5BO4A 2F2VA 5IH2A 1H9OA 1V1CA 1YCSB 3SHWA 4KRTA 2F2XA 2HDXA 4J9GA 2RQVA 4OMLA 5EC7A 1ZUKA 1ZUUA 2RMOA 3IN8A 5FWCA 2DRMA 5GJHA 1O4CA 4HVVA 2FCIA 3EAZA 1PNJA 1WLPB 2HDVA 4ZNXA 4E6RA 3S8LA 1NLOC 2RORA 4OHHA 1BHHB 5HKZA 2X3XD 3BUMB 1QKXA 1B3QA 1AZEA 1AWXA 4CC4B 1M30A 2NUZA 1U5SA 2CRHA 5IHIA 4U1PA 2V1RA 1O4HA 1UUSA 2BZXA 1M27A 4GBQA 3VS7A 2J05A 1KSWA 1M61A 1LKLA 4JZ3A 3S8OA 1O44A 2DLZA 2FO0A 3H0FA 1RLQC 1M3BA 4H1OA 2EYWA 4OMPA 3TSZA 1MV0B 1SHFA 2GQIA 1SPSA 4E93A 1WXTA 3QWXX 2MK2A 1E6GA 2AUGA 1O4RA 2KEAA 2L3SA 1O4GA 1ZUYA 1K9AA 1QCFA 2MCNA 4FBNA 2OI3A 3PS5A 2ESWA 4FSSA 1XOVA 4RUGA 2BZYA 1BG1A 1Z9QA 5HKYA 1SKJA 3IMJA 2LNHB 1NEGA 2HBWA 3MXYA 3US4A 4DEXA 1WXBA 5I22A 2FPDA 2C0IA 1CJ1A 1WQUA 4RTZA 2LJ3A 5L23A 2DNUA 1SHBA 4EIHA 2EKHA 4E68A 2EGAA 1YP5A 1M27C 1AYAA 2JT4A 4F59A 1T0JA 1AZGB 1LCJA 1Y0MA 2F2WA 2KNBB 2P4RA 1O4OA 4AFSC 1O4NA 1G83A 1WIEA 2FRYA 5IXBA 2RF0A 1A1EA 4OMQA 1FBVA 3BUNB 1FYRA 2MQIA 1AD5A 4D8DA 2PNAA 4K2RA 3U23A 1AOJA 4CC2A 1BHHA 4QT7A 3BUOB 4RTVA 2ECDA 5EHPA 2LCTA 1MUZA 2IIMA 1BU1A 2KXDA 4CC3A 4GPLB 2LP5A 3NPFA 2KRMA 1BLKA 1UURA 1TCEA 3NHNA 4LN2A 2V1QA 2RQRA 2RVFA 1SPRA 1A81A 1AVZC 4OMMA 3N84A 1HCTB 2W10A 4XZ0A 4HXJA 3VS2A 3OP0A 2SRCA 5EELA 3GXWA 1CKAA 2KT8A 1OV3A 2LX7A 2DL3A 2VVKA 1OPKA 5AULA 1ZX6A 3CQTA 2VWFA 2D8HA 3KFVA 1BHFA 4AG2C 2CDTA 2RNAA 1K0XA 2CS0A 1Y1UA 2SHPA 1BM2A 1WXUA 2OJ2A 5ECAA 1KA6A 4J9EA 2DLPA 5DC0B 1G2BA 3HIZB 2JM8A 1GBRA 1GFDA 1O4JA 1NRVA 3OV1A 1X2KA 4JPBW 2L3PA 1IJRA 1TG0A 4OMOA 1BMBA 2J6OA 2EBPA 1JYUA 5CDWA 3I5RA 1KC2A 3R6NA 2CBLA 1GBQA 3UATA 2EYYA 2JS0A 2W0ZA 1UJ0A 1GCQC 1QWFA 4RTUA 4A63B 1BFJA 2DM0A 2CT4A 2A08A 1UDLA 3A98A 1QKWA 2JTEA 4RTXA 2CUDA 2HEQA 2KE9A 2LMJA 2RQTA 3H0HA 3ZL7C 2K2MA 4D8KA 2CT3A 4ORZA 2QMSA 1O43A 1SRLA 4GL9E 1U06A 4CC7A 1K0SA 1A0NB 1O4QA 2A36A 2FG0A 1HJDA 4FL3A 2ABLA 3MAZA 1UECA 2C0TA 3M0RA 3HHMB 2DJQA 4M4ZA 1OPLA 3UA7A 2LJ1A 2O2OA 3I9QA 1NZVA 1I1JA 5DC4A 2M0YA 2DMOA 4U17A 2AKLA 3K2MA 1BF5A 1IO6A 3GBQA 1MW4A 1I3ZA 3N7YA 2AKKA 1CSYA 2M51A 4X1VA 1UHCA 2KYMA 2L6KA 2JM9A 2ENMA 1AOTF 4EIKA 4H34A 1F1WA 4K45A 2MOXA 2EYXA 1RLPC 3ULRB 1F2FA 2OQ1A 3VROA 1D1ZA 3RBBB 4LUDA 1LUIA 3EACA 4XZ1A 4DGPA 1A1BA 1R1QA 2CREA 2EO6A 1TUCA 1YVLA 2DM1A 1X27A 2RPNA 4AFQC 2DILA 2CI8A 2HUWA 1O46A 1GFCA 1LUMA 1O4KA 1O42A 1AB2A 3S8NA 2ROLA 2YSXA 2YDLA 4FL2A 1GHUA 1JXOA 1PICA 1R1SA 3IN7A 5IXFA 4Z89A 1HD3A 3BUXB 5D0JA 2KT1A 4OMNA 4AG1C 2H5KA 2D0NA 1K1ZA 1AWWA 1O4MA 2RSYA 4OHLA 2EOBA 2PLEA 1LUNA 1Z3KA 3S9KA 1RUWA 2K3BA 3VRNA 1A09A 1RQQC 4TZIA 1VA7A 1W70A 3VS0A 1X6GA 2EYVA 3IQLA 2Y1MA 1AWOA 1X69A 3THKA 4F14A 2CI9A 1QLYA 1B07A 1A08A 2IZVA 5EG3B 2DF6A 1MILA 2RMXA 3VRYA 4HVWA 5FWBA 2MC1A 2O31A 2PTKA 2JS2A 4P9VA 3HCKA 2LQWA 3C0CA 2L0AA 2GSBA 3TKZA 4J9DA 2IUHA 1VYUA 2K6DA 4F5BA 1OOTA 2HCKA 4J9HA 1X0NA 1UUEA 1JQQA 1T3SA 2L4KA 1J3TA 2KRNA 1WX6A 1FU5A 1BBZA 2LJ0A 2OAWA 2AOAA 2IUGA 2RN8A 4LNPA 2L3TA 3OB2B 3O5ZA 1YN8A 3VRZA 4JJCA 2YSQA 1JU5A 4AFZC 2H46E 2LCSA 3PVLA 3KFJA 1ZLMA 1GCQA 3PVQA 2LNXA 2CR4A 1SSHA 4GWFA 1O4FA 1M3AA 1UGVA 2FPEA 1O48A 1AYCA 1O4DA 3M7FA 2HSPA 2CH4A 2B86A 2DX1A 1LKKA 1SHDA 3SEMA 1S1NA 2JXBA 1YWOA 2GBQA 2YUQA 3EGUA 1GCPA 2EPDA 1SHAA 2AOBA 2FEIA 2O88A 1KFZA 1MV3A 2KR3A 3VS4A 1AEYA 1FU6A 5KAZA 1UTIA 1BKLA 2J6KA 3VGOA 2EQIA 4ROJA 1O4PA 2MRKA 1XA6A 2CIAA 1BK2A 3M0SA 3VS6A 1A07A 1JYRA 2DBMA 2PZ1A 3PFVA 2J06A 3VS5A 1SEMA 3OVEA 2CSIA 3GXXA 1FHSA 1JU5C 5EHRA 2EO3A 2KK6A 1UE9A 1WA7A 2EGCA 2VKNA 3PSJA 4OHEA 1KJWA 1OO4A 2YUNA 2DE0X 4J9IA 3PSKA 3VRPA 4Y92A 1NG2A 1PKTA 2DL8A 2ETZA 4EY0A 1NYFA 3TSWA 3EG1A 4F5AA 2C9WA 3M0PA 2KXCA 1KIKA 2RQWA 1OO3A 1O4EA 1ABOA 1QWEA 1X6BA 2ROTA 2G6FX 1SRMA 2IUIA 2BZ8A 5HCKA 2E5KA 4QSYA 2GGRA 1D4WA 1HCSB 5DC9A 1WYXA 2C0OA 4X6SA 1FYNA 2YUPA 1SHGA 1O4LA 5EEQA 3NGPA 2FRWA 1BFIA 1I07A 2DL7A 1M8MA 2A28A 1CSZA 2EW3A 4K11A 1ABQA 1JYQA 2CUBA 3UYOA 2K7AA 2GE9A 2HMHA 3TVTA 1H3HA 4DEYA 1T0HA 2GTOA 2RQUA 2XMFA 2JW4A 1K4US 1CWDL 1O4BA 1VYVA 2PNBA 1T3LA 3VS3A 1ZBJA 4L1BB 1Z9ZA 3ZNIA 1UG1A 3REAB 3NMZC 4K44A 2L3QA 1CKBA 1UFFA 3H0IA 1PRMC 2O9SA 2H8HA 2ECZA 3JV3A 4GLMA 4RTWA 4HCKA 4RTYA 3IMDA 3CD3A 2AK5A 3GQIB 2Y1NA 1O4AA 3PLFB 3OB1B 2KGTA 4WCIA 1NYGA 1SPKA 2NWMA 3EG3A 4F17A 3BUWB 2EGEA 2JMAA 1JO8A 1X43A 3C7IA 4OHDA 1QG1E 1BKMA 1RI9A 4JGHA 2Y3AB 2EL8A 3I5SA 2DLYA 3M0QA 1FBZA 4LE9A 1AYBA 4NWGA 2L2PA 5IBSA 3H41A 2KROA 3M0UA 2OZOA 1EFNA 4A4CA 1RJAA 5I6VA 4F16A 1IS0A 3LH5A 4R0KA 1CSKA 1BB9A 1M3CA 3UA6A 2KNOA 3UF4A 4HVUA 1OEBA 2K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBU A;  2A37 A;  4RTT A;  2KBT A;  2I0N A;  2EYZ A;  2D8J A;  2DRK A;  3VS1 A;  5IHK A;  2EKX A;  2DA9 A;  1JXM A;  3REB B;  4J9C A;  1W1F A;  4JZ4 A;  4Z88 A;  4P9Z A;  2YUO A;  2MIO A;  1WDX A;  3EHR A;  1U3O A;  1CWE A;  3PQZ A;  1AWJ A;  2D1X A;  1GL5 A;  1D4T A;  2PNI A;  1NM7 A;  2LZ6 B;  2QDL A;  1NLP C;  3EHQ A;  5J3X A;  3CBL A;  3TL0 A;  3EG2 A;  5GJV B;  1LCK A;  1X6C A;  1E6H A;  1JEG A;  5IBM A;  4Z8A A;  4LUE A;  2PLD A;  4JEG A;  1N5Z A;  2DBK A;  1KA7 A;  4OHI A;  3BKB A;  1B47 A;  2LQN A;  2EU0 A;  5AXI A;  5DF6 A;  2J7I A;  4DGX A;  1O49 A;  4JJD A;  1H92 A;  2B3O A;  1O4I A;  2K7A B;  3MXC A;  1FMK A;  1UHF A;  2EVR A;  4WWQ A;  1NEB A;  3VRR A;  1ZFP E;  3CWG A;  1O41 A;  1Y57 A;  1NZL A;  3VRQ A;  2SEM A;  1AOU F;  1ARK A;  1O47 A;  1K76 A;  1H8K A;  1QAD A;  1X2Q A;  2DX0 A;  1TUD A;  1A1C A;  1A1A A;  4JE4 A;  2GTJ A;  2K9G A;  4IIM A;  1I0C A;  2DCR A;  4ESR A;  5FW9 A;  4J9B A;  2ED1 A;  4NWF A;  2LNW A;  1JWO A;  2AZS A;  5I11 A;  2J6F A;  2YU7 A;  3PJP A;  3FJ5 A;  5HKW A;  3T04 A;  4A4B A;  3WA4 A;  1PRL C;  1PWT A;  1VYT A;  2DVJ A;  3M0T A;  2YT6 A;  4IIO A;  1TZE E;  2DL5 A;  2X3W D;  3RNJ A;  3QWY A;  2BTT A;  1YWP A;  1RPY A;  1YVH A;  2FPF A;  3I35 A;  1P13 A;  2HDA A;  3EG0 A;  1AYD A;  5GJW B;  1ZSG A;  2ED0 A;  1O45 A;  5GJI A;  2KRS A;  2DL4 A;  1W6X A;  1E7O A;  1GRI A;  1PKS A;  2DYB A;  1PHT A;  2GNC A;  1WI7 A;  2KYB A;  5IHN A;  2CSQ A;  1HSQ A;  2O9V A;  2CH4 W;  2JMC A;  2JYQ A;  2XP1 A;  3PE0 A;  2MRJ A;  1UJY A;  1R1P A;  2K79 B;  1LUK A;  2VIF A;  3CXL A;  4JJB A;  4AFU C;  1WFW A;  2AZV A;  1YNZ A;  3N8M A;  1BLJ A;  4J9F A;  5BO4 A;  2F2V A;  5IH2 A;  1H9O A;  1V1C A;  1YCS B;  3SHW A;  4KRT A;  2F2X A;  2HDX A;  4J9G A;  2RQV A;  4OML A;  5EC7 A;  1ZUK A;  1ZUU A;  2RMO A;  3IN8 A;  5FWC A;  2DRM A;  5GJH A;  1O4C A;  4HVV A;  2FCI A;  3EAZ A;  1PNJ A;  1WLP B;  2HDV A;  4ZNX A;  4E6R A;  3S8L A;  1NLO C;  2ROR A;  4OHH A;  1BHH B;  5HKZ A;  2X3X D;  3BUM B;  1QKX A;  1B3Q A;  1AZE A;  1AWX A;  4CC4 B;  1M30 A;  2NUZ A;  1U5S A;  2CRH A;  5IHI A;  4U1P A;  2V1R A;  1O4H A;  1UUS A;  2BZX A;  1M27 A;  4GBQ A;  3VS7 A;  2J05 A;  1KSW A;  1M61 A;  1LKL A;  4JZ3 A;  3S8O A;  1O44 A;  2DLZ A;  2FO0 A;  3H0F A;  1RLQ C;  1M3B A;  4H1O A;  2EYW A;  4OMP A;  3TSZ A;  1MV0 B;  1SHF A;  2GQI A;  1SPS A;  4E93 A;  1WXT A;  3QWX X;  2MK2 A;  1E6G A;  2AUG A;  1O4R A;  2KEA A;  2L3S A;  1O4G A;  1ZUY A;  1K9A A;  1QCF A;  2MCN A;  4FBN A;  2OI3 A;  3PS5 A;  2ESW A;  4FSS A;  1XOV A;  4RUG A;  2BZY A;  1BG1 A;  1Z9Q A;  5HKY A;  1SKJ A;  3IMJ A;  2LNH B;  1NEG A;  2HBW A;  3MXY A;  3US4 A;  4DEX A;  1WXB A;  5I22 A;  2FPD A;  2C0I A;  1CJ1 A;  1WQU A;  4RTZ A;  2LJ3 A;  5L23 A;  2DNU A;  1SHB A;  4EIH A;  2EKH A;  4E68 A;  2EGA A;  1YP5 A;  1M27 C;  1AYA A;  2JT4 A;  4F59 A;  1T0J A;  1AZG B;  1LCJ A;  1Y0M A;  2F2W A;  2KNB B;  2P4R A;  1O4O A;  4AFS C;  1O4N A;  1G83 A;  1WIE A;  2FRY A;  5IXB A;  2RF0 A;  1A1E A;  4OMQ A;  1FBV A;  3BUN B;  1FYR A;  2MQI A;  1AD5 A;  4D8D A;  2PNA A;  4K2R A;  3U23 A;  1AOJ A;  4CC2 A;  1BHH A;  4QT7 A;  3BUO B;  4RTV A;  2ECD A;  5EHP A;  2LCT A;  1MUZ A;  2IIM A;  1BU1 A;  2KXD A;  4CC3 A;  4GPL B;  2LP5 A;  3NPF A;  2KRM A;  1BLK A;  1UUR A;  1TCE A;  3NHN A;  4LN2 A;  2V1Q A;  2RQR A;  2RVF A;  1SPR A;  1A81 A;  1AVZ C;  4OMM A;  3N84 A;  1HCT B;  2W10 A;  4XZ0 A;  4HXJ A;  3VS2 A;  3OP0 A;  2SRC A;  5EEL A;  3GXW A;  1CKA A;  2KT8 A;  1OV3 A;  2LX7 A;  2DL3 A;  2VVK A;  1OPK A;  5AUL A;  1ZX6 A;  3CQT A;  2VWF A;  2D8H A;  3KFV A;  1BHF A;  4AG2 C;  2CDT A;  2RNA A;  1K0X A;  2CS0 A;  1Y1U A;  2SHP A;  1BM2 A;  1WXU A;  2OJ2 A;  5ECA A;  1KA6 A;  4J9E A;  2DLP A;  5DC0 B;  1G2B A;  3HIZ B;  2JM8 A;  1GBR A;  1GFD A;  1O4J A;  1NRV A;  3OV1 A;  1X2K A;  4JPB W;  2L3P A;  1IJR A;  1TG0 A;  4OMO A;  1BMB A;  2J6O A;  2EBP A;  1JYU A;  5CDW A;  3I5R A;  1KC2 A;  3R6N A;  2CBL A;  1GBQ A;  3UAT A;  2EYY A;  2JS0 A;  2W0Z A;  1UJ0 A;  1GCQ C;  1QWF A;  4RTU A;  4A63 B;  1BFJ A;  2DM0 A;  2CT4 A;  2A08 A;  1UDL A;  3A98 A;  1QKW A;  2JTE A;  4RTX A;  2CUD A;  2HEQ A;  2KE9 A;  2LMJ A;  2RQT A;  3H0H A;  3ZL7 C;  2K2M A;  4D8K A;  2CT3 A;  4ORZ A;  2QMS A;  1O43 A;  1SRL A;  4GL9 E;  1U06 A;  4CC7 A;  1K0S A;  1A0N B;  1O4Q A;  2A36 A;  2FG0 A;  1HJD A;  4FL3 A;  2ABL A;  3MAZ A;  1UEC A;  2C0T A;  3M0R A;  3HHM B;  2DJQ A;  4M4Z A;  1OPL A;  3UA7 A;  2LJ1 A;  2O2O A;  3I9Q A;  1NZV A;  1I1J A;  5DC4 A;  2M0Y A;  2DMO A;  4U17 A;  2AKL A;  3K2M A;  1BF5 A;  1IO6 A;  3GBQ A;  1MW4 A;  1I3Z A;  3N7Y A;  2AKK A;  1CSY A;  2M51 A;  4X1V A;  1UHC A;  2KYM A;  2L6K A;  2JM9 A;  2ENM A;  1AOT F;  4EIK A;  4H34 A;  1F1W A;  4K45 A;  2MOX A;  2EYX A;  1RLP C;  3ULR B;  1F2F A;  2OQ1 A;  3VRO A;  1D1Z A;  3RBB B;  4LUD A;  1LUI A;  3EAC A;  4XZ1 A;  4DGP A;  1A1B A;  1R1Q A;  2CRE A;  2EO6 A;  1TUC A;  1YVL A;  2DM1 A;  1X27 A;  2RPN A;  4AFQ C;  2DIL A;  2CI8 A;  2HUW A;  1O46 A;  1GFC A;  1LUM A;  1O4K A;  1O42 A;  1AB2 A;  3S8N A;  2ROL A;  2YSX A;  2YDL A;  4FL2 A;  1GHU A;  1JXO A;  1PIC A;  1R1S A;  3IN7 A;  5IXF A;  4Z89 A;  1HD3 A;  3BUX B;  5D0J A;  2KT1 A;  4OMN A;  4AG1 C;  2H5K A;  2D0N A;  1K1Z A;  1AWW A;  1O4M A;  2RSY A;  4OHL A;  2EOB A;  2PLE A;  1LUN A;  1Z3K A;  3S9K A;  1RUW A;  2K3B A;  3VRN A;  1A09 A;  1RQQ C;  4TZI A;  1VA7 A;  1W70 A;  3VS0 A;  1X6G A;  2EYV A;  3IQL A;  2Y1M A;  1AWO A;  1X69 A;  3THK A;  4F14 A;  2CI9 A;  1QLY A;  1B07 A;  1A08 A;  2IZV A;  5EG3 B;  2DF6 A;  1MIL A;  2RMX A;  3VRY A;  4HVW A;  5FWB A;  2MC1 A;  2O31 A;  2PTK A;  2JS2 A;  4P9V A;  3HCK A;  2LQW A;  3C0C A;  2L0A A;  2GSB A;  3TKZ A;  4J9D A;  2IUH A;  1VYU A;  2K6D A;  4F5B A;  1OOT A;  2HCK A;  4J9H A;  1X0N A;  1UUE A;  1JQQ A;  1T3S A;  2L4K A;  1J3T A;  2KRN A;  1WX6 A;  1FU5 A;  1BBZ A;  2LJ0 A;  2OAW A;  2AOA A;  2IUG A;  2RN8 A;  4LNP A;  2L3T A;  3OB2 B;  3O5Z A;  1YN8 A;  3VRZ A;  4JJC A;  2YSQ A;  1JU5 A;  4AFZ C;  2H46 E;  2LCS A;  3PVL A;  3KFJ A;  1ZLM A;  1GCQ A;  3PVQ A;  2LNX A;  2CR4 A;  1SSH A;  4GWF A;  1O4F A;  1M3A A;  1UGV A;  2FPE A;  1O48 A;  1AYC A;  1O4D A;  3M7F A;  2HSP A;  2CH4 A;  2B86 A;  2DX1 A;  1LKK A;  1SHD A;  3SEM A;  1S1N A;  2JXB A;  1YWO A;  2GBQ A;  2YUQ A;  3EGU A;  1GCP A;  2EPD A;  1SHA A;  2AOB A;  2FEI A;  2O88 A;  1KFZ A;  1MV3 A;  2KR3 A;  3VS4 A;  1AEY A;  1FU6 A;  5KAZ A;  1UTI A;  1BKL A;  2J6K A;  3VGO A;  2EQI A;  4ROJ A;  1O4P A;  2MRK A;  1XA6 A;  2CIA A;  1BK2 A;  3M0S A;  3VS6 A;  1A07 A;  1JYR A;  2DBM A;  2PZ1 A;  3PFV A;  2J06 A;  3VS5 A;  1SEM A;  3OVE A;  2CSI A;  3GXX A;  1FHS A;  1JU5 C;  5EHR A;  2EO3 A;  2KK6 A;  1UE9 A;  1WA7 A;  2EGC A;  2VKN A;  3PSJ A;  4OHE A;  1KJW A;  1OO4 A;  2YUN A;  2DE0 X;  4J9I A;  3PSK A;  3VRP A;  4Y92 A;  1NG2 A;  1PKT A;  2DL8 A;  2ETZ A;  4EY0 A;  1NYF A;  3TSW A;  3EG1 A;  4F5A A;  2C9W A;  3M0P A;  2KXC A;  1KIK A;  2RQW A;  1OO3 A;  1O4E A;  1ABO A;  1QWE A;  1X6B A;  2ROT A;  2G6F X;  1SRM A;  2IUI A;  2BZ8 A;  5HCK A;  2E5K A;  4QSY A;  2GGR A;  1D4W A;  1HCS B;  5DC9 A;  1WYX A;  2C0O A;  4X6S A;  1FYN A;  2YUP A;  1SHG A;  1O4L A;  5EEQ A;  3NGP A;  2FRW A;  1BFI A;  1I07 A;  2DL7 A;  1M8M A;  2A28 A;  1CSZ A;  2EW3 A;  4K11 A;  1ABQ A;  1JYQ A;  2CUB A;  3UYO A;  2K7A A;  2GE9 A;  2HMH A;  3TVT A;  1H3H A;  4DEY A;  1T0H A;  2GTO A;  2RQU A;  2XMF A;  2JW4 A;  1K4U S;  1CWD L;  1O4B A;  1VYV A;  2PNB A;  1T3L A;  3VS3 A;  1ZBJ A;  4L1B B;  1Z9Z A;  3ZNI A;  1UG1 A;  3REA B;  3NMZ C;  4K44 A;  2L3Q A;  1CKB A;  1UFF A;  3H0I A;  1PRM C;  2O9S A;  2H8H A;  2ECZ A;  3JV3 A;  4GLM A;  4RTW A;  4HCK A;  4RTY A;  3IMD A;  3CD3 A;  2AK5 A;  3GQI B;  2Y1N A;  1O4A A;  3PLF B;  3OB1 B;  2KGT A;  4WCI A;  1NYG A;  1SPK A;  2NWM A;  3EG3 A;  4F17 A;  3BUW B;  2EGE A;  2JMA A;  1JO8 A;  1X43 A;  3C7I A;  4OHD A;  1QG1 E;  1BKM A;  1RI9 A;  4JGH A;  2Y3A B;  2EL8 A;  3I5S A;  2DLY A;  3M0Q A;  1FBZ A;  4LE9 A;  1AYB A;  4NWG A;  2L2P A;  5IBS A;  3H41 A;  2KRO A;  3M0U A;  2OZO A;  1EFN A;  4A4C A;  1RJA A;  5I6V A;  4F16 A;  1IS0 A;  3LH5 A;  4R0K A;  1CSK A;  1BB9 A;  1M3C A;  3UA6 A;  2KNO A;  3UF4 A;  4HVU A;  1OEB A;  2K79 A; 
#chains in the Genus database with same CATH topology
 2F1L A;  2CZ7 B;  3CME T;  3M56 A;  3CCR T;  2DRK A;  3VS1 A;  5IHK A;  1M1F A;  2EJG A;  4EMH A;  1BCM A;  3REB B;  1U1T A;  4EPC A;  2YUO A;  1TXQ A;  3PQZ A;  2ZAE A;  2PNI A;  1MGQ A;  4EMK A;  5J3X A;  4QQG A;  2BUD A;  4J6X A;  1VUB A;  1K73 R;  2V8J A;  4N0A C;  2PLD A;  1ZHI A;  2DBK A;  2K3Y A;  3MP8 A;  3M58 A;  3QBY A;  4C92 F;  1PSF A;  1UGQ B;  1H92 A;  2B3O A;  4LD6 A;  3MEU A;  4DOV A;  3CME A;  1UHF A;  3CCR A;  4M7A D;  3CWG A;  2E5Q A;  2ZGW A;  3VJP A;  2HL3 A;  1X2Q A;  1A1C A;  1A1A A;  4ESR A;  5LJ5 e;  1JWO A;  3EFO A;  3PJP A;  3T04 A;  4A4B A;  3WA4 A;  2B8A A;  1VYT A;  1RAF B;  1TZE E;  2YT6 A;  5GAN 8;  3RNJ A;  1YWP A;  1N9S A;  1BYM A;  4M75 F;  5LJ5 d;  1K8A R;  1AYD A;  4M7A B;  2WSC E;  1E7O A;  1GRI A;  1PHT A;  2KDS A;  3TQ7 P;  4C0F A;  3G1J A;  2CSQ A;  3OS1 A;  2O9V A;  2CH4 W;  4IUP A;  4N4H A;  2AIR B;  4KUD K;  1K9M C;  4IUQ A;  4JJB A;  1WFW A;  2ZPH B;  2F2V A;  2CP7 A;  5IH2 A;  1V1C A;  3SHW A;  4KRT A;  2F2X A;  4J9G A;  5EC7 A;  4UC4 A;  3CPW A;  3CCE Q;  2RK1 A;  2RMO A;  4F04 B;  5FWC A;  4X9C A;  4HT9 A;  4DA4 A;  2FCI A;  3EAZ A;  2HDV A;  1WHJ A;  4JLI A;  1BI1 A;  1D0Z A;  5HKZ A;  4PK4 A;  1AZE A;  1M30 A;  2F69 A;  2NUZ A;  2CRH A;  4C5H A;  2V1R A;  1O4H A;  1X6O A;  4IUV A;  4OGC A;  5CQY A;  3VS7 A;  4C0Z A;  2J05 A;  4PJO B;  1M61 A;  3GNF B;  2FO0 A;  1RLQ C;  2RD1 A;  2IVW A;  1M3B A;  4H1O A;  3TSZ A;  1SHF A;  1N6A A;  1E6G A;  2AUG A;  2K5I A;  1O4R A;  5DM7 R;  2MCN A;  2OI3 A;  3PS5 A;  2ESW A;  1N8R C;  1BG1 A;  5GAO q;  4OMF B;  5HKY A;  1LPL A;  2VUB A;  3IMJ A;  2JUF A;  1NEG A;  2HBW A;  2DNU A;  1SHB A;  4BY6 C;  2QEX Q;  1VQ5 T;  2JTF A;  1T0J A;  3CCJ T;  1M2V A;  2M1H A;  2EYQ A;  4MMK A;  2LNV A;  1G83 A;  1RAB B;  4OMQ A;  1QVG P;  5CIU A;  1U8R A;  4BE0 A;  1JBM A;  4BB7 A;  4OB3 B;  5LJ5 f;  3JCM Q;  1BHH A;  5KCH A;  4FW2 A;  1G3W A;  3JCM c;  5EHP A;  1V29 B;  2LCT A;  1MUZ A;  2IIM A;  2LTO A;  2KXD A;  2EQJ A;  3RIR A;  1QVF A;  1W2B S;  1BLK A;  1VQ5 A;  3CCU T;  4LXC A;  3L2Q A;  4A54 A;  3OYH A;  3CCJ A;  3CPF A;  1KG1 A;  2RHU A;  2W10 A;  2SRC A;  3GIB A;  1FX7 A;  1QMC A;  2DPP B;  2KT8 A;  3CC4 T;  2VVK A;  1MMA A;  3G4S T;  1VQO Q;  1UGS B;  1ZX6 A;  2LT4 A;  2VWF A;  2DJZ A;  2RM4 A;  4M77 B;  3OYI A;  1Y1U A;  5ECA A;  1N27 A;  2MI6 A;  2DLP A;  5DC0 B;  1JJ2 P;  4LDX A;  1GBR A;  4KGX B;  1O4J A;  4M7D E;  2YHT A;  3CCU A;  3T9N A;  4JPB W;  1RAG B;  3MET A;  4B6M A;  2L5Q A;  2D9T A;  4OMO A;  2J6O A;  2EBP A;  2XIC A;  2CBL A;  5FRN A;  1GXI E;  3UAT A;  4N4G A;  4RTU A;  5GAM g;  2A08 A;  1UDL A;  2VV5 A;  3C94 A;  3CC4 A;  3G4S A;  1YIT Q;  2KE9 A;  3A8L B;  3S3N A;  4E7S A;  4M7D F;  3ZL7 C;  2OTL T;  1SRL A;  2HD0 A;  3S3M A;  4E7J A;  4FL3 A;  2ABL A;  2VB6 A;  2C0T A;  3HHM B;  5GAM h;  4BUG A;  1OPL A;  3I9Q A;  2KK4 A;  1NZV A;  2M0Y A;  1FMV A;  1I5O B;  2DMO A;  4U17 A;  1BF5 A;  3I55 Q;  1IO6 A;  1MW4 A;  1VQ9 T;  2DKG A;  4X1V A;  2ZPF B;  3CCL Q;  2L6K A;  1M2O A;  2QQB A;  3EGD B;  1AOT F;  4JS4 A;  2DTO A;  3ULR B;  1H3Z A;  4DOW A;  3VRO A;  3RBB B;  4LUD A;  2E3H A;  3JCM d;  1A1B A;  3KBG A;  4FW1 A;  1TUC A;  2OTL A;  5GAN g;  2LDM A;  2FYK A;  1M90 R;  2DM1 A;  4XQ3 A;  4AFQ C;  1LUM A;  1O42 A;  3GP8 A;  2ROL A;  2YSX A;  1GHU A;  5IXF A;  1HD3 A;  4HCC A;  2XD0 A;  5D0J A;  3E1S A;  2BIV A;  4ATO A;  4D6W A;  1VQ9 A;  3MP6 A;  3VU3 C;  5GAN j;  1Z3K A;  3QJY A;  3VRN A;  1RQQ C;  3VS0 A;  5CO7 A;  3OSS C;  1FMW A;  5GMK e;  1O9S A;  3CPW S;  5FWB A;  1YJ9 A;  2PTK A;  5LJ3 e;  3HCK A;  1KD1 C;  4F7U E;  1KQS A;  4J9D A;  4ELY C;  2RI5 A;  2QGG A;  1OOT A;  4KH1 B;  1BKB A;  5HY6 A;  1M1G A;  2KRN A;  1WX6 A;  1J3T A;  1BBZ A;  2LJ0 A;  2AOA A;  2L3T A;  1WPY A;  2RN8 A;  1P92 A;  3O5Z A;  1VIF A;  3CME Q;  3CCR Q;  2YSQ A;  3QSU A;  2V26 A;  1NJI C;  1D1A A;  1GCQ A;  2D6F A;  3DB4 A;  2LNX A;  4M7A C;  3LW5 E;  1AYC A;  2LVM A;  5LJ5 j;  4AT1 B;  1KHC A;  3CMA T;  1Y71 A;  2GBQ A;  2YUQ A;  3UWN A;  2IG0 A;  2AOB A;  2EPD A;  2O88 A;  3OS2 A;  2KR3 A;  1AEY A;  2O4X A;  3OYJ A;  3PTA A;  3CXC A;  1BKL A;  3C12 A;  2J6K A;  4BE2 A;  2EQI A;  2CP2 A;  1MMD A;  1Q81 C;  2J06 A;  4KUI A;  1B34 B;  3GXX A;  1K9M U;  2H3E B;  2P0Q A;  4M78 G;  1WA7 A;  2PUO B;  2MYS A;  3JCM f;  3CCQ T;  3L2W A;  4HCB A;  1OO4 A;  2VAS A;  3CMA A;  4J9I A;  2PU9 B;  3PSK A;  3VRP A;  2MK5 A;  3H9N A;  2ETZ A;  3OA6 A;  3EG1 A;  4F5A A;  2C9W A;  2FZC B;  3M0P A;  1WHL A;  4MML A;  1O4E A;  1QW1 A;  2BKD N;  3HTR A;  2E5K A;  5CKE A;  2RH2 A;  2GGR A;  4JRI A;  1WYX A;  2C0O A;  2YRD A;  1VQK T;  3QZ5 B;  1KQ1 A;  3D7S B;  2FRW A;  1BFI A;  2A28 A;  4RKU E;  3KUF A;  3QPH A;  4DBF A;  4M7A F;  2MAM A;  3UYO A;  3TVT A;  2DIQ A;  1F1B B;  3SWN B;  2GTO A;  2RQU A;  2ZCF B;  1CWD L;  5DLO A;  1N8R U;  3NTH A;  1NE8 A;  3SFM A;  4OB2 B;  1UFF A;  2GF7 A;  3H0I A;  1PRM C;  2O9S A;  2Y4Y A;  2ECZ A;  4GLM A;  4RTW A;  4HCK A;  3IMD A;  3CD3 A;  1O4A A;  3HPW A;  3G7Z A;  4PJO E;  1JO8 A;  1X43 A;  5DY9 A;  1RI9 A;  2HBP A;  2Y3A B;  3M0Q A;  3M54 A;  3FDR A;  3M0U A;  1EFN A;  4J7I A;  3RMQ A;  4KGV B;  4F16 A;  3OYY A;  2A3L A;  2KNO A;  3VYH B;  4HVU A;  2BBU A;  3MHX A;  4RTT A;  2I0N A;  4M7D D;  3LGF A;  4J9C A;  1W1F A;  4P9Z A;  2NUT A;  2MIO A;  2WSF E;  3EHR A;  1U3O A;  3CC2 T;  1AWJ A;  3TL0 A;  2QDL A;  1NM7 A;  3QDF A;  1NLP C;  3EHQ A;  4JJN K;  2NLU A;  3OBW A;  1Q7Y R;  1VQ5 Q;  1PG5 B;  1E6H A;  4JRP A;  4J7F A;  5D7U A;  4Z8A A;  5IBM A;  4JEG A;  1N5Z A;  3M59 A;  3G6E T;  3HL8 A;  3CCJ Q;  2JN0 A;  3S6W A;  1B47 A;  2EU0 A;  3GPL A;  3RER A;  2FB7 A;  4FT2 A;  3EAE A;  1Y57 A;  3FIF A;  3EG9 B;  2X4W A;  4QVC A;  1ARK A;  2QI2 A;  3TU4 K;  1H8K A;  4XTZ A;  3CC2 A;  1ACM B;  1QAD A;  2E41 A;  1UGP B;  2EKO A;  2FL7 A;  4IIM A;  2ED1 A;  1YIT T;  1K9M R;  1Q82 C;  3CCU Q;  2YU7 A;  5HKW A;  3FJ5 A;  2DYI A;  3G6E A;  2E70 A;  3OYG A;  4XTW A;  4Z02 A;  3OYC A;  3QHS A;  1YVH A;  1M5Q 1;  4DQ2 A;  3I35 A;  1P13 A;  3EG0 A;  3OMG A;  3CC4 Q;  3G4S Q;  1O45 A;  2VC8 A;  2KRS A;  2DL4 A;  1W6X A;  3JCM W;  1KQS S;  1VQ7 T;  4M77 E;  1Y96 A;  2RB6 A;  1ZA1 B;  5IHN A;  2XP1 A;  4QVD A;  4E47 A;  1LUK A;  2JVV A;  4C0D C;  3CXL A;  2AZV A;  1YIT A;  1YNZ A;  3MPU B;  1LNX A;  1YCS B;  3SB2 A;  2HDX A;  4FYV B;  1RI0 A;  3RKW A;  2Y90 A;  4L6V 5;  1D1C A;  3PMI A;  5KYU B;  1G3Y A;  4M75 A;  3RKX A;  2DIG A;  3V8L A;  3S8L A;  2X35 A;  4OHH A;  1BHH B;  1ZSZ B;  1VQ7 A;  2X3X D;  1QKX A;  1B3Q A;  1FWZ A;  4M77 G;  2EQU A;  2BE7 D;  3CXC S;  2OTL Q;  1UUS A;  1M27 A;  1M4Z A;  2MWP A;  4GBQ A;  2RA2 A;  5KYX B;  3S8O A;  3H0F A;  3MP1 A;  5LJ3 h;  3E9F A;  3TCJ A;  2EYW A;  4OMP A;  4E93 A;  2GQI A;  5GAM e;  1VQ9 Q;  2KEA A;  3ASK A;  1O4G A;  4FSX A;  4C8Q G;  5CCA A;  1TH7 A;  1XOV A;  1ZQ1 A;  2BZY A;  2LRQ A;  2RK2 A;  1G3S A;  3PIP A;  1TUG B;  2P0K A;  1KD1 U;  1Q95 G;  1CJ1 A;  4YTL A;  1WQU A;  2EKH A;  2CZ0 B;  4E68 A;  4BI3 A;  2KSS A;  1M27 C;  4PFP A;  1OUL A;  2JT4 A;  4M78 B;  1AZG B;  5CR2 A;  4MDW A;  1B7T A;  3JB9 I;  4FCY A;  1YHQ T;  4AFS C;  1O4N A;  4L59 A;  1NJI U;  3HRU A;  5IXB A;  5HKC A;  1A1E A;  1QVG A;  5I2M A;  1QQJ A;  3NTI A;  4D8D A;  2XKO C;  3A1P A;  2VXF A;  4JDS A;  4RTV A;  4C5I A;  2QA4 T;  4J5Y A;  5C6S A;  2Z0W A;  3JAM E;  2CYZ B;  3NPF A;  5D6X A;  2KRM A;  2VYT A;  2RO0 A;  4MZP A;  2ZZD A;  2EJF A;  2R5A A;  2RVF A;  2RJE A;  4HT8 A;  2QQR A;  4OMM A;  5I2S A;  4KT0 E;  1Q81 U;  3EGX A;  3N5B B;  5KYW A;  4HXJ A;  1YHQ A;  2E6Z A;  2XID A;  3OP0 A;  3EH1 A;  2EQK A;  2DL3 A;  2COW A;  2DEQ A;  2LQ8 A;  4FYY B;  4BI4 A;  1Q86 C;  2D8H A;  1BHF A;  4PJM A;  8AT1 B;  2R58 A;  4AG2 C;  2QA4 A;  1K0X A;  1VQM Q;  3JCM X;  2SHP A;  1WXU A;  1KA6 A;  2COZ A;  3HIZ B;  1MNE A;  1JJ2 A;  4NOY A;  3CMA Q;  1NRV A;  1X2K A;  3ZEH A;  4TVR A;  4XTY A;  3JSC A;  1TG0 A;  3H8Z A;  5CDW A;  3I5R A;  3R6N A;  2E3I A;  2XK0 A;  2JS0 A;  2V8K A;  3AT1 B;  4A63 B;  4BDY A;  2R57 A;  3SWN C;  4PJO D;  1KQ2 A;  2CUD A;  4ME7 A;  2LMJ A;  1WHM A;  3H0H A;  1WZO A;  3OW2 S;  2QMS A;  1O43 A;  3M55 A;  2EFI A;  3CCQ Q;  4CC7 A;  2X51 A;  2A36 A;  2XU8 A;  2FG0 A;  1HJD A;  2XDD A;  2GFU A;  3ZFJ A;  1QCO A;  4OP0 A;  3M0R A;  4LDW A;  2A0F B;  1M8V A;  1I1J A;  5DC4 A;  2HL5 C;  3K2M A;  1I3Z A;  2NUP A;  7AT1 B;  1UHC A;  1RL2 A;  5GAN 7;  4H34 A;  2CP3 A;  4K45 A;  3CEY A;  1KC8 C;  4V2S A;  1D1Z A;  1VQK Q;  1LUI A;  4M7D A;  3HKS A;  1D1B A;  2P84 A;  3OYM A;  2DIL A;  2E10 A;  2CI8 A;  2HUW A;  1O46 A;  1W2B P;  1AB2 A;  4FL2 A;  5CKD A;  1PIC A;  3HP9 A;  2D0Q B;  2IPO B;  2QQS A;  2CS7 A;  2RJD A;  4OMN A;  5FRO A;  4Y91 A;  1K1Z A;  1AWW A;  1O4M A;  4OHL A;  2EOB A;  2DZ9 A;  1VA7 A;  1X6G A;  1AWO A;  1X69 A;  1EX4 A;  4F14 A;  2CI9 A;  1B07 A;  2LCC A;  4M7D C;  1OYX A;  3PGG A;  2HQX A;  2JNG A;  3INZ A;  2GSB A;  2ZPE B;  3TKZ A;  5GAN 2;  4J8O A;  2AT1 B;  4MZT A;  4M77 D;  4Y28 E;  5KYY B;  5LL6 S;  1UUE A;  4BDZ A;  3CCV T;  1AOU F;  2OAW A;  3KXT A;  2LRA A;  3VRZ A;  4JJC A;  2LX9 A;  4XTV A;  5AYF A;  1D09 B;  3KFJ A;  3PVQ A;  1TU0 B;  1Q82 U;  3CC2 Q;  1O48 A;  2M02 A;  2YLC A;  5GMK i;  2M0O A;  2PVO B;  2B86 A;  2BE9 B;  2DX1 A;  3DB3 A;  1LKK A;  1YWO A;  5IAY A;  2GQV A;  3G6E Q;  3F70 A;  3DKM A;  2EJ9 A;  2LT1 A;  3CCV A;  1WJS A;  1XA6 A;  1BK2 A;  2FHD A;  1JYR A;  2DBM A;  2PZ1 A;  1K73 C;  3VS5 A;  3OVE A;  2CSI A;  3HRT A;  1FHS A;  5EHR A;  4F7U A;  1UE9 A;  4XTU A;  2EGC A;  4ZTJ A;  2HKQ B;  1VQP T;  4C8Q B;  3LWH A;  4OHE A;  4R55 A;  3OB9 A;  2YUN A;  3PFS A;  1QVG S;  1NG2 A;  1I5L A;  4KBM B;  3RMS A;  4IUU A;  3CC7 T;  1NZ9 A;  3QYH B;  2KXC A;  3A5Z B;  1Y07 A;  1QWE A;  1YBY A;  3AHU A;  2ROT A;  4WF2 A;  3L42 A;  2PQW A;  1QCN A;  3VUB A;  1C6V X;  1XQH A;  1SRM A;  4C0G A;  4QSY A;  5DC9 A;  4KGZ B;  1VQ7 Q;  1BI3 A;  1FYN A;  1OU9 A;  4NL3 A;  2FZK B;  1SHG A;  5EEQ A;  1I8F A;  3NGP A;  3QUI A;  2DXC A;  1YJW T;  4OF1 A;  1VQP A;  5IN1 A;  2KY9 A;  2E4H A;  2EW3 A;  1XTD A;  1K8A C;  1IZ6 A;  4PNO A;  8ATC B;  4GY5 A;  1UGR B;  2HMH A;  3DLL A;  2JW4 A;  2L3R A;  3I56 T;  3CC7 A;  3VS3 A;  1D3B B;  4A4E A;  1ZBJ A;  2YRC A;  1PCX A;  4QW2 A;  3LWI A;  3L2U A;  2L3Q A;  1D0X A;  2AK5 A;  2HSE B;  5D6W A;  3GQI B;  3EG3 A;  4F17 A;  4PFO A;  5C0M A;  1YJW A;  2QAS A;  2JMA A;  3V7R A;  4WTO B;  1QG1 E;  1IHV A;  3JCM b;  5GAN h;  3GNG A;  4JGH A;  2EL8 A;  1IGU A;  1OZ3 A;  1AYB A;  1RAC B;  4M7A A;  3H41 A;  3HSB A;  2KRO A;  3OYB A;  3VV0 A;  4A4C A;  3I56 A;  5I6V A;  3R6O A;  3K2T A;  3LH5 A;  4C92 B;  1BB9 A;  1NPR A;  3EFS A;  1NPP A;  1OEB A;  3JB9 J;  2EKX A;  1JXM A;  4JZ4 A;  4Z88 A;  5LJ5 g;  5LJ3 d;  3O8V A;  1CWE A;  2RHY A;  1D4T A;  1BLJ A;  3US4 A;  5BO4 A;  5IT9 E;  3EG2 A;  1LCK A;  4DBH A;  4ZGE B;  1JEG A;  1WJR A;  4M78 E;  3JCM J;  4F7U F;  1VQM T;  1KA7 A;  2LQN A;  1YHQ Q;  4RCB A;  5AXI A;  1Q86 U;  2ZPB B;  2J7I A;  5CKB A;  4M75 B;  2K7A B;  1FMK A;  2EVR A;  4PJO A;  4WWQ A;  1NEB A;  1ZFP E;  1O41 A;  4ZGD B;  1NZL A;  4ZTF A;  4Q5W A;  2QA4 Q;  2SEM A;  2CP5 A;  1O47 A;  1K76 A;  2DX0 A;  5HK3 A;  1TUD A;  3OYE A;  1MMG A;  3LYI A;  2K9G A;  1U1S A;  1VQ4 T;  4NWF A;  2AZS A;  4L5G A;  5I11 A;  4OVA A;  1PRL C;  3M0T A;  1VQM A;  1N9R A;  2COY A;  9ATC B;  2A7Y A;  2K2V A;  3V8K A;  5CKF A;  2L89 A;  2PVD B;  2DO3 A;  1ZSG A;  3OYD A;  1S72 T;  4PJO C;  2KYB A;  3FB9 A;  1Y7X A;  2JMC A;  2JYQ A;  1PM3 A;  1RAA B;  2K79 B;  1QVF S;  2K3X A;  2VIF A;  1VQ4 A;  4A53 A;  3N8M A;  4J9F A;  1DJ7 B;  3QO3 A;  5GAO m;  3NFC A;  5GMK l;  2DZC A;  2RQV A;  4OML A;  4AMC A;  4EMK B;  3CCQ A;  5FU6 B;  1KC8 U;  2KQW A;  1LVK A;  1WHH A;  1MHN A;  1D0Y A;  1X01 A;  1O4C A;  5GAN 5;  4FYW B;  1PNJ A;  4ZNX A;  3PT9 A;  2ROR A;  3BUM B;  2VGN A;  3MJX A;  4CC4 B;  1SSF A;  1U5S A;  2OX7 A;  5GMK m;  5LJ3 f;  2WAC A;  1KSW A;  2R5M A;  3FJP A;  4RMO A;  1LKL A;  1VQK A;  1RAI B;  2DLZ A;  2HQE A;  2JJ9 A;  1M1K C;  2JTM A;  2O01 E;  5CVI A;  4DBQ A;  1MV0 B;  3FRN A;  1SPS A;  2X4Y A;  2X9H A;  4PL6 A;  2L3S A;  1VQ8 T;  1WQW A;  4JRK A;  3EFO B;  4E7Z A;  4FBN A;  3E19 A;  2WSE E;  2HZY A;  2XDB A;  2RI3 A;  3LX7 A;  4DEX A;  1WXB A;  5I22 A;  2K4Y A;  4PJO F;  4RTZ A;  5L23 A;  2QQA A;  5KH6 A;  3QZ9 B;  3X26 B;  1HXD A;  2RHI A;  1AYA A;  4F59 A;  2AHJ B;  4X9D A;  3BFM A;  4FT4 A;  3CCS T;  2F2W A;  2VGM A;  5CK9 A;  2MMP A;  1OQK A;  3OYF A;  1WIE A;  1M90 C;  1VQ8 A;  3A8M B;  4M77 C;  5A0D A;  3QDR B;  2KI7 A;  3BUN B;  2FVU A;  1AD5 A;  2MQI A;  2KVQ G;  4CC2 A;  4QT7 A;  4HA8 A;  3L2R A;  3VKI A;  4MDX A;  1BU1 A;  4OB0 B;  2YLB A;  2MF2 A;  2ZPI B;  4GPL B;  5GAO p;  1UUR A;  2QTX A;  1TCE A;  4DBR A;  3EGD A;  2VXE A;  3GOX A;  1SPR A;  1JB0 E;  2HQH A;  1A81 A;  3Q1J A;  1AVZ C;  3N84 A;  1HCT B;  3CCS A;  4XZ0 A;  1K73 U;  4X34 A;  3VS2 A;  3CCV Q;  3CBO A;  1R77 A;  2DTH A;  3UT1 A;  2LX7 A;  4A4H A;  5AUL A;  3CQT A;  4EDU A;  3DLM A;  4J6Y A;  3OMC A;  1G2B A;  2V8I A;  3P8D A;  2ATC B;  1VQN T;  2CP6 A;  3JCM g;  1GFD A;  3OV1 A;  2PVG B;  1IJR A;  1BMB A;  4KH0 B;  2CZ6 B;  2OTJ T;  1KC2 A;  2LCL A;  1WHG A;  1UJ0 A;  1QWF A;  2JOY A;  4XTX A;  1VQL T;  2DD5 A;  1BFJ A;  2DM0 A;  3A98 A;  2JTE A;  4RTX A;  3FC3 A;  2HEQ A;  4VUB A;  4XU3 A;  4ZN1 A;  2RQT A;  1M2V B;  3OS0 A;  4M77 F;  2K2M A;  4XAX B;  1K8A U;  4ORZ A;  4C8Q E;  3CCM T;  4GL9 E;  1VQP Q;  1U06 A;  3SD4 A;  1K0S A;  1A0N B;  1VQN A;  1IB8 A;  3JCM V;  1N8R R;  4JRQ A;  1UEC A;  5FU7 B;  2DJQ A;  2LJ1 A;  2O2O A;  4C5G A;  3CC7 Q;  2OTJ A;  2AKL A;  3GBQ A;  3N7Y A;  4A4F A;  2M51 A;  1VQL A;  3JB9 H;  2KYM A;  4QKU A;  4QQD A;  2JM9 A;  1F1W A;  2MOX A;  1RLP C;  4E7K A;  1F2F A;  4II1 A;  4ANJ A;  3MEW A;  3EAC A;  4M78 D;  5A0G A;  1R1Q A;  2CRE A;  1YJW Q;  1YVL A;  1JRI A;  4A4K A;  1X27 A;  4C5E A;  3OYA A;  1O4K A;  1GFC A;  2QGF B;  1W2B A;  5GMK j;  4XU1 A;  2DK3 A;  1R1S A;  4J6W A;  3IN7 A;  1W4S A;  1B34 A;  4Z89 A;  5GAM d;  2E65 A;  5LJ3 j;  3X25 B;  5M9O A;  3I56 Q;  3RKY A;  4AG1 C;  2H5K A;  2D0N A;  1SG5 A;  1VQ6 T;  5GAN 3;  2RSY A;  2PLE A;  2XDP A;  1LUN A;  3BY7 A;  2GCX A;  1A09 A;  3JB9 G;  4TZI A;  1IRX A;  1R0B G;  1IHW A;  3IQL A;  1SF9 A;  1R8O B;  1OX9 A;  2QXF A;  4BI8 B;  4BE1 A;  1A08 A;  2DF6 A;  1MIL A;  2RMX A;  2DD4 A;  2O31 A;  2LQW A;  2L0A A;  4QQ6 A;  5GAN e;  1RAE B;  4JS5 A;  2IUH A;  3LH0 A;  3M4G A;  4C92 E;  2K6D A;  4F5B A;  1VQ6 A;  4FM4 B;  3OYL A;  5A2Q E;  3OB2 B;  4LNP A;  4E7H A;  5GAN d;  3JCM P;  1XNI A;  4AFZ C;  4LDY A;  3PVL A;  3V8J A;  1TSF A;  1ZLM A;  4OB1 B;  1SSH A;  3SWN A;  3OW2 P;  2DXT A;  1M3A A;  1UGV A;  2FPE A;  3M7F A;  2CH4 A;  4OGE A;  3H6Z A;  5GAN 6;  4RG8 A;  2QYZ A;  1S1N A;  2JXB A;  3L2V A;  4LDV A;  3TRE A;  2FEI A;  1KFZ A;  2KGY A;  3GLX A;  2RJF A;  2DVE A;  5KAZ A;  4C92 G;  4M75 E;  4ROJ A;  1O4P A;  2H3J A;  3M0S A;  3VS6 A;  1Q7Y C;  1A07 A;  3PFV A;  4EMK C;  5FU6 C;  2DXU A;  2KK6 A;  2VKN A;  3CD6 T;  1KJW A;  1VQ4 Q;  2DE0 X;  5GAO n;  1TTH B;  4XU2 A;  4Y92 A;  2LC4 A;  2ZPG B;  3M9Q A;  4EY0 A;  4HKE A;  2E1H A;  3V7S A;  5GAM f;  1O75 A;  1OO3 A;  2QDY B;  3MCA B;  4M75 G;  2IUI A;  5HCK A;  2CKK A;  1S72 Q;  3TEE A;  1O4L A;  3QXE B;  3ER0 A;  1I07 A;  2DL7 A;  1M8M A;  2PUK B;  1M1K U;  3CD6 A;  5L8R E;  2E6N A;  1YJN T;  2M9U A;  1UB4 A;  2K5L A;  1T0H A;  2XMF A;  1YI2 T;  1O4B A;  2PNB A;  1K4U S;  4NS5 A;  3EG9 A;  3FEO A;  4JLG A;  1Z9Z A;  3CBP A;  3J81 E;  3REA B;  3NMZ C;  4K44 A;  1KD1 R;  1WNL A;  2H8H A;  3BE3 A;  3JV3 A;  4RTY A;  2O4X B;  5GAN f;  2Y1N A;  2DXB A;  3OB1 B;  4O5V A;  4WCI A;  3BUW B;  2EGE A;  3C7I A;  3QJ6 A;  3URG A;  1BKM A;  5GAN 4;  5KE3 A;  1R0C B;  3J80 E;  3I5S A;  2P0P A;  3NTK A;  3G71 T;  1YJN A;  2L2P A;  4NWG A;  1NJI R;  3C4S A;  1M90 U;  2HKN A;  2OZO A;  1YI2 A;  2E12 A;  1IS0 A;  1ZA2 B;  1CSK A;  1VQ8 Q;  3E2U A;  5CAI A;  2A37 A;  2YRV A;  2KBT A;  2EYZ A;  2D8J A;  6AT1 B;  2DA9 A;  2M16 A;  1BI2 A;  3A8H B;  1WDX A;  2QG9 B;  3MO8 A;  4CRI A;  3OYN A;  2D1X A;  1GL5 A;  2LZ6 B;  2MWO A;  3CBL A;  5GJV B;  1OU8 A;  3OBY A;  5KYU A;  1UEB A;  1X6C A;  1Q81 R;  3G71 A;  4IKF A;  4LUE A;  1BCO A;  1ZSZ A;  4OHI A;  2P4T A;  2DFU A;  3BKB A;  3CCS Q;  5DF6 A;  4C8Q D;  4DGX A;  1O49 A;  4JJD A;  2EAY A;  1O4I A;  3MXC A;  4XU0 A;  4E7L A;  5KYX A;  2DET A;  4PJJ A;  3VRR A;  3X24 B;  3EFR A;  4KUL A;  3M4Y A;  3VRQ A;  1PD1 A;  4CI0 C;  5I21 A;  3RR6 A;  4JE4 A;  4ELZ C;  2GTJ A;  1I0C A;  2DCR A;  4GLK A;  4J9B A;  5FW9 A;  3JB9 D;  2LNW A;  2J6F A;  4BAC A;  1WHK A;  1I4K 1;  4IUT A;  1IRE B;  1OX8 A;  1PWT A;  2DVJ A;  4IIO A;  2EWN A;  2DAQ A;  2DL5 A;  2X3W D;  3J7A F;  1AHJ B;  4PKC C;  3QWY A;  2BTT A;  1ZSZ C;  1RPY A;  2FPF A;  1EZZ B;  5FU7 C;  2HDA A;  3MKD A;  5GJW B;  2ED0 A;  5GJI A;  1PKS A;  2XHC A;  2NYS A;  2DYB A;  4E2F B;  4ZGJ B;  3P8B B;  2GNC A;  1WI7 A;  4M78 A;  5J39 A;  1HSQ A;  3PE0 A;  2MRJ A;  1UJY A;  1C0M A;  1R1P A;  5J3B A;  3OY9 A;  4AFU C;  1VQN Q;  1YIJ T;  1QVP A;  3HRS A;  1H9O A;  3RDV A;  2Y4X A;  5FRM A;  2NUT B;  5DLQ E;  1OI1 A;  3CPW P;  1M1K R;  2OTJ Q;  5A0L A;  3HHT B;  1ZUK A;  1ZUU A;  3IN8 A;  1VQL Q;  2DRM A;  4IUR A;  5KYN A;  5GJH A;  4HVV A;  4P5N A;  1WLP B;  2MPX C;  4E6R A;  1NLO C;  5GAM j;  4M7D G;  1AWX A;  3BW1 A;  2QTV A;  2CZ1 B;  4C92 D;  3CCM Q;  3JCM e;  4M78 C;  5IHI A;  4B9W A;  4LD9 K;  4U1P A;  1JJ2 S;  1PC0 A;  2BZX A;  4NL2 A;  2K5F A;  1YIJ A;  2EQM A;  4JZ3 A;  1O44 A;  4E7I A;  1TOV A;  3BDU A;  4C0D B;  2KMT A;  1WXT A;  3RUX A;  3QWX X;  2MK2 A;  1YJ9 T;  1ZUY A;  3LGL A;  1RAH B;  1K9A A;  1QCF A;  1TWB A;  5AT1 B;  1YCY A;  4FSS A;  4PFZ A;  4RUG A;  2DER A;  1Z9Q A;  1SKJ A;  2G3R A;  2LNH B;  3MXY A;  2FPD A;  2C0I A;  1QP3 A;  1OZ2 A;  2KAF A;  2LJ3 A;  4EIH A;  4M75 D;  2EGA A;  1YP5 A;  1Y96 B;  2F5K A;  1LCJ A;  2QK0 A;  1BI0 A;  1Y0M A;  2P4R A;  2KNB B;  3S3O A;  1O4O A;  1VQ6 Q;  3M57 A;  2FRY A;  1EIF A;  2RF0 A;  4QVZ A;  1FBV A;  1FYR A;  1Q82 R;  2PNA A;  2RHZ A;  4K2R A;  3U23 A;  1AOJ A;  2E64 A;  1WQ7 A;  3BUO B;  2ECD A;  4R56 A;  4BD3 A;  3L1A A;  2K57 A;  5LJ5 h;  4CC3 A;  2LP5 A;  1QVF P;  1WGS A;  3NHN A;  4LN2 A;  2V1Q A;  2RQR A;  4M78 F;  1Q7Y U;  5EEL A;  3GXW A;  1CKA A;  1OV3 A;  1OPK A;  2HNI A;  1V76 A;  3M5A A;  3QKJ A;  4LDU A;  3KFV A;  3MEA A;  2CDT A;  2RNA A;  2CS0 A;  3E9G A;  2HAX A;  2XG8 D;  4F7U G;  1BM2 A;  2OJ2 A;  5GAO l;  4J9E A;  2JM8 A;  3GF5 A;  1I81 A;  5J26 A;  2QAZ A;  2L3P A;  5EG2 A;  3A8O B;  1JYU A;  4FIB A;  3CCE T;  1GBQ A;  2EYY A;  2W0Z A;  1GCQ C;  2CT4 A;  1QKW A;  2I2L A;  4FL6 A;  3C95 A;  4D8K A;  2CT3 A;  3VUZ A;  5KYY A;  3CD6 Q;  1IXD A;  1O4Q A;  3ZBD A;  4M7A E;  5D6Y A;  3WVD B;  3OYK A;  1S72 A;  2XI9 A;  3MAZ A;  1AT1 B;  1H64 1;  3UA7 A;  4M4Z A;  1QP2 A;  3CCE A;  1WJQ A;  1BIA A;  2AKK A;  1CSY A;  3LLR A;  2ENM A;  3SDZ A;  4EIK A;  2EYX A;  2DTI A;  1VIE A;  2OQ1 A;  4XZ1 A;  3EGX B;  5KYW B;  4DGP A;  4M77 A;  1BIB A;  2EO6 A;  4XK8 E;  4RCC A;  2RPN A;  3MEV A;  2QEX T;  3S8N A;  2YDL A;  1C1A A;  1YJN Q;  1JXO A;  4M7A G;  1LOJ A;  3BUX B;  2EIF A;  1YI2 Q;  2KT1 A;  3OS5 A;  4O6J A;  3M53 A;  1PSE A;  3UDC A;  3X28 B;  3WVE B;  3S9K A;  1RUW A;  2CGH A;  2K3B A;  3HFN A;  4C8Q A;  1W70 A;  4N4I A;  2FZG B;  2EYV A;  2Y1M A;  2YXY A;  2X4J A;  3THK A;  1QLY A;  1HK9 A;  2IZV A;  5EG3 B;  3VRY A;  4HVW A;  2MC1 A;  1G3T A;  2JS2 A;  4P9V A;  3C0C A;  2QEX A;  3G71 Q;  1KQS P;  1Q86 R;  3UPU A;  3LYV A;  2RHX A;  1VYU A;  4JUV A;  1X0N A;  2HCK A;  4J9H A;  4FU6 A;  3HFO A;  1JQQ A;  1T3S A;  2L4K A;  1FU5 A;  2IUG A;  3JRZ A;  2GFA A;  1YN8 A;  4PJO G;  5HK0 A;  3WXM B;  1VQO T;  2C06 A;  1JU5 A;  4C8Q C;  2H46 E;  2LCS A;  4BY6 B;  2CR4 A;  4GWF A;  2NUP B;  1O4F A;  1G5V A;  3OW2 A;  2OAU A;  1O4D A;  2HSP A;  4PJN A;  1D3B A;  1IGQ A;  1SHD A;  3SEM A;  3EGU A;  2LQK A;  1GCP A;  1SHA A;  4M7D B;  2YWW A;  4PLI A;  4A4G A;  2F5T X;  3FLG A;  1MV3 A;  1SKU B;  3VS4 A;  3V7C A;  1MND A;  3CXC P;  1VOM A;  4J83 A;  1FU6 A;  1RAD B;  1UTI A;  5KCO A;  3VGO A;  1G8X A;  2L8D A;  3VYG A;  2MRK A;  2CIA A;  3QII A;  2JZ2 A;  1VQO A;  1SEM A;  3L2Z A;  1LJO A;  2X4X A;  1JU5 C;  2EO3 A;  5KE2 A;  2RI2 A;  4PJL A;  3PSJ A;  4C92 A;  4HCZ A;  1MMN A;  4PLL A;  1KC8 R;  3X20 B;  1PKT A;  2DL8 A;  3JCM h;  3ME9 A;  1NYF A;  3BDL A;  3TSW A;  1KIK A;  2RQW A;  2HMA A;  2QQ9 A;  3I55 T;  3RES A;  4MZM A;  1ABO A;  1X6B A;  1HYO A;  3CCL T;  2G6F X;  1ZBX A;  2BZ8 A;  1TS9 A;  4ZN3 A;  1D4W A;  1HCS B;  4RG2 A;  4X6S A;  1PD0 A;  2RJC A;  2YUP A;  1NBE B;  3QG1 A;  4C8Q F;  4B9X A;  1CSZ A;  1KHI A;  4K11 A;  3A8G B;  5CKH A;  4EMG A;  1YIJ Q;  4C92 C;  5LJ3 g;  3P8H A;  1ABQ A;  1JYQ A;  2CUB A;  3PNW C;  2K7A A;  2DEU A;  2GE9 A;  1X75 C;  1H3H A;  4DEY A;  1VYV A;  4FYX B;  1T3L A;  3CCM A;  3I55 A;  4L1B B;  3QYG B;  3ZNI A;  3PMT A;  1UG1 A;  3CCL A;  1FXX A;  3JB9 F;  3OQ5 A;  1CKB A;  5GAO r;  1KK7 A;  3PIO A;  5GMK h;  3CBM A;  3PLF B;  2KGT A;  1NYG A;  1SPK A;  2NWM A;  3EH2 A;  4OHD A;  2DLY A;  4N0A A;  3OSV A;  1FBZ A;  4LE9 A;  5IBS A;  1M9S A;  2CP0 A;  4M75 C;  4F7U B;  1YFN A;  5CQX A;  1RJA A;  5FLX E;  4R0K A;  1M3C A;  3UA6 A;  3UF4 A;  1XJW B;  1YJ9 Q;  2K79 A; 
#chains in the Genus database with same CATH homology
 2BBU A;  2A37 A;  4RTT A;  2KBT A;  2I0N A;  2EYZ A;  2D8J A;  2DRK A;  3VS1 A;  5IHK A;  2EKX A;  2DA9 A;  1JXM A;  3REB B;  4J9C A;  1W1F A;  4JZ4 A;  4Z88 A;  4P9Z A;  2YUO A;  2MIO A;  1WDX A;  3EHR A;  1U3O A;  1CWE A;  3PQZ A;  1AWJ A;  2D1X A;  1GL5 A;  1D4T A;  2PNI A;  1NM7 A;  2LZ6 B;  2QDL A;  1NLP C;  3EHQ A;  5J3X A;  3CBL A;  3TL0 A;  3EG2 A;  5GJV B;  1LCK A;  1X6C A;  1E6H A;  1JEG A;  5IBM A;  4Z8A A;  4LUE A;  2PLD A;  4JEG A;  1N5Z A;  2DBK A;  1KA7 A;  4OHI A;  3BKB A;  1B47 A;  2LQN A;  2EU0 A;  5AXI A;  5DF6 A;  2J7I A;  4DGX A;  1O49 A;  4JJD A;  1H92 A;  2B3O A;  1O4I A;  2K7A B;  3MXC A;  1FMK A;  1UHF A;  2EVR A;  4WWQ A;  1NEB A;  3VRR A;  1ZFP E;  3CWG A;  1O41 A;  1Y57 A;  1NZL A;  3VRQ A;  2SEM A;  1AOU F;  1ARK A;  1O47 A;  1K76 A;  1H8K A;  1QAD A;  1X2Q A;  2DX0 A;  1TUD A;  1A1C A;  1A1A A;  4JE4 A;  2GTJ A;  2K9G A;  4IIM A;  1I0C A;  2DCR A;  4ESR A;  5FW9 A;  4J9B A;  2ED1 A;  4NWF A;  2LNW A;  1JWO A;  2AZS A;  5I11 A;  2J6F A;  2YU7 A;  3PJP A;  3FJ5 A;  5HKW A;  3T04 A;  4A4B A;  3WA4 A;  1PRL C;  1PWT A;  1VYT A;  2DVJ A;  3M0T A;  2YT6 A;  4IIO A;  1TZE E;  2DL5 A;  2X3W D;  3RNJ A;  3QWY A;  2BTT A;  1YWP A;  1RPY A;  1YVH A;  2FPF A;  3I35 A;  1P13 A;  2HDA A;  3EG0 A;  1AYD A;  5GJW B;  1ZSG A;  2ED0 A;  1O45 A;  5GJI A;  2KRS A;  2DL4 A;  1W6X A;  1E7O A;  1GRI A;  1PKS A;  2DYB A;  1PHT A;  2GNC A;  1WI7 A;  2KYB A;  5IHN A;  2CSQ A;  1HSQ A;  2O9V A;  2CH4 W;  2JMC A;  2JYQ A;  2XP1 A;  3PE0 A;  2MRJ A;  1UJY A;  1R1P A;  2K79 B;  1LUK A;  2VIF A;  3CXL A;  4JJB A;  4AFU C;  1WFW A;  2AZV A;  1YNZ A;  3N8M A;  1BLJ A;  4J9F A;  5BO4 A;  2F2V A;  5IH2 A;  1H9O A;  1V1C A;  1YCS B;  3SHW A;  4KRT A;  2F2X A;  2HDX A;  4J9G A;  2RQV A;  4OML A;  5EC7 A;  1ZUK A;  1ZUU A;  2RMO A;  3IN8 A;  5FWC A;  2DRM A;  5GJH A;  1O4C A;  4HVV A;  2FCI A;  3EAZ A;  1PNJ A;  1WLP B;  2HDV A;  4ZNX A;  4E6R A;  3S8L A;  1NLO C;  2ROR A;  4OHH A;  1BHH B;  5HKZ A;  2X3X D;  3BUM B;  1QKX A;  1B3Q A;  1AZE A;  1AWX A;  4CC4 B;  1M30 A;  2NUZ A;  1U5S A;  2CRH A;  5IHI A;  4U1P A;  2V1R A;  1O4H A;  1UUS A;  2BZX A;  1M27 A;  4GBQ A;  3VS7 A;  2J05 A;  1KSW A;  1M61 A;  1LKL A;  4JZ3 A;  3S8O A;  1O44 A;  2DLZ A;  2FO0 A;  3H0F A;  1RLQ C;  1M3B A;  4H1O A;  2EYW A;  4OMP A;  3TSZ A;  1MV0 B;  1SHF A;  2GQI A;  1SPS A;  4E93 A;  1WXT A;  3QWX X;  2MK2 A;  1E6G A;  2AUG A;  1O4R A;  2KEA A;  2L3S A;  1O4G A;  1ZUY A;  1K9A A;  1QCF A;  2MCN A;  4FBN A;  2OI3 A;  3PS5 A;  2ESW A;  4FSS A;  1XOV A;  4RUG A;  2BZY A;  1BG1 A;  1Z9Q A;  5HKY A;  1SKJ A;  3IMJ A;  2LNH B;  1NEG A;  2HBW A;  3MXY A;  3US4 A;  4DEX A;  1WXB A;  5I22 A;  2FPD A;  2C0I A;  1CJ1 A;  1WQU A;  4RTZ A;  2LJ3 A;  5L23 A;  2DNU A;  1SHB A;  4EIH A;  2EKH A;  4E68 A;  2EGA A;  1YP5 A;  1M27 C;  1AYA A;  2JT4 A;  4F59 A;  1T0J A;  1AZG B;  1LCJ A;  1Y0M A;  2F2W A;  2KNB B;  2P4R A;  1O4O A;  4AFS C;  1O4N A;  1G83 A;  1WIE A;  2FRY A;  5IXB A;  2RF0 A;  1A1E A;  4OMQ A;  1FBV A;  3BUN B;  1FYR A;  2MQI A;  1AD5 A;  4D8D A;  2PNA A;  4K2R A;  3U23 A;  1AOJ A;  4CC2 A;  1BHH A;  4QT7 A;  3BUO B;  4RTV A;  2ECD A;  5EHP A;  2LCT A;  1MUZ A;  2IIM A;  1BU1 A;  2KXD A;  4CC3 A;  4GPL B;  2LP5 A;  3NPF A;  2KRM A;  1BLK A;  1UUR A;  1TCE A;  3NHN A;  4LN2 A;  2V1Q A;  2RQR A;  2RVF A;  1SPR A;  1A81 A;  1AVZ C;  4OMM A;  3N84 A;  1HCT B;  2W10 A;  4XZ0 A;  4HXJ A;  3VS2 A;  3OP0 A;  2SRC A;  5EEL A;  3GXW A;  1CKA A;  2KT8 A;  1OV3 A;  2LX7 A;  2DL3 A;  2VVK A;  1OPK A;  5AUL A;  1ZX6 A;  3CQT A;  2VWF A;  2D8H A;  3KFV A;  1BHF A;  4AG2 C;  2CDT A;  2RNA A;  1K0X A;  2CS0 A;  1Y1U A;  2SHP A;  1BM2 A;  1WXU A;  2OJ2 A;  5ECA A;  1KA6 A;  4J9E A;  2DLP A;  5DC0 B;  1G2B A;  3HIZ B;  2JM8 A;  1GBR A;  1GFD A;  1O4J A;  1NRV A;  3OV1 A;  1X2K A;  4JPB W;  2L3P A;  1IJR A;  1TG0 A;  4OMO A;  1BMB A;  2J6O A;  2EBP A;  1JYU A;  5CDW A;  3I5R A;  1KC2 A;  3R6N A;  2CBL A;  1GBQ A;  3UAT A;  2EYY A;  2JS0 A;  2W0Z A;  1UJ0 A;  1GCQ C;  1QWF A;  4RTU A;  4A63 B;  1BFJ A;  2DM0 A;  2CT4 A;  2A08 A;  1UDL A;  3A98 A;  1QKW A;  2JTE A;  4RTX A;  2CUD A;  2HEQ A;  2KE9 A;  2LMJ A;  2RQT A;  3H0H A;  3ZL7 C;  2K2M A;  4D8K A;  2CT3 A;  4ORZ A;  2QMS A;  1O43 A;  1SRL A;  4GL9 E;  1U06 A;  4CC7 A;  1K0S A;  1A0N B;  1O4Q A;  2A36 A;  2FG0 A;  1HJD A;  4FL3 A;  2ABL A;  3MAZ A;  1UEC A;  2C0T A;  3M0R A;  3HHM B;  2DJQ A;  4M4Z A;  1OPL A;  3UA7 A;  2LJ1 A;  2O2O A;  3I9Q A;  1NZV A;  1I1J A;  5DC4 A;  2M0Y A;  2DMO A;  4U17 A;  2AKL A;  3K2M A;  1BF5 A;  1IO6 A;  3GBQ A;  1MW4 A;  1I3Z A;  3N7Y A;  2AKK A;  1CSY A;  2M51 A;  4X1V A;  1UHC A;  2KYM A;  2L6K A;  2JM9 A;  2ENM A;  1AOT F;  4EIK A;  4H34 A;  1F1W A;  4K45 A;  2MOX A;  2EYX A;  1RLP C;  3ULR B;  1F2F A;  2OQ1 A;  3VRO A;  1D1Z A;  3RBB B;  4LUD A;  1LUI A;  3EAC A;  4XZ1 A;  4DGP A;  1A1B A;  1R1Q A;  2CRE A;  2EO6 A;  1TUC A;  1YVL A;  2DM1 A;  1X27 A;  2RPN A;  4AFQ C;  2DIL A;  2CI8 A;  2HUW A;  1O46 A;  1GFC A;  1LUM A;  1O4K A;  1O42 A;  1AB2 A;  3S8N A;  2ROL A;  2YSX A;  2YDL A;  4FL2 A;  1GHU A;  1JXO A;  1PIC A;  1R1S A;  3IN7 A;  5IXF A;  4Z89 A;  1HD3 A;  3BUX B;  5D0J A;  2KT1 A;  4OMN A;  4AG1 C;  2H5K A;  2D0N A;  1K1Z A;  1AWW A;  1O4M A;  2RSY A;  4OHL A;  2EOB A;  2PLE A;  1LUN A;  1Z3K A;  3S9K A;  1RUW A;  2K3B A;  3VRN A;  1A09 A;  1RQQ C;  4TZI A;  1VA7 A;  1W70 A;  3VS0 A;  1X6G A;  2EYV A;  3IQL A;  2Y1M A;  1AWO A;  1X69 A;  3THK A;  4F14 A;  2CI9 A;  1QLY A;  1B07 A;  1A08 A;  2IZV A;  5EG3 B;  2DF6 A;  1MIL A;  2RMX A;  3VRY A;  4HVW A;  5FWB A;  2MC1 A;  2O31 A;  2PTK A;  2JS2 A;  4P9V A;  3HCK A;  2LQW A;  3C0C A;  2L0A A;  2GSB A;  3TKZ A;  4J9D A;  2IUH A;  1VYU A;  2K6D A;  4F5B A;  1OOT A;  2HCK A;  4J9H A;  1X0N A;  1UUE A;  1JQQ A;  1T3S A;  2L4K A;  1J3T A;  2KRN A;  1WX6 A;  1FU5 A;  1BBZ A;  2LJ0 A;  2OAW A;  2AOA A;  2IUG A;  2RN8 A;  4LNP A;  2L3T A;  3OB2 B;  3O5Z A;  1YN8 A;  3VRZ A;  4JJC A;  2YSQ A;  1JU5 A;  4AFZ C;  2H46 E;  2LCS A;  3PVL A;  3KFJ A;  1ZLM A;  1GCQ A;  3PVQ A;  2LNX A;  2CR4 A;  1SSH A;  4GWF A;  1O4F A;  1M3A A;  1UGV A;  2FPE A;  1O48 A;  1AYC A;  1O4D A;  3M7F A;  2HSP A;  2CH4 A;  2B86 A;  2DX1 A;  1LKK A;  1SHD A;  3SEM A;  1S1N A;  2JXB A;  1YWO A;  2GBQ A;  2YUQ A;  3EGU A;  1GCP A;  2EPD A;  1SHA A;  2AOB A;  2FEI A;  2O88 A;  1KFZ A;  1MV3 A;  2KR3 A;  3VS4 A;  1AEY A;  1FU6 A;  5KAZ A;  1UTI A;  1BKL A;  2J6K A;  3VGO A;  2EQI A;  4ROJ A;  1O4P A;  2MRK A;  1XA6 A;  2CIA A;  1BK2 A;  3M0S A;  3VS6 A;  1A07 A;  1JYR A;  2DBM A;  2PZ1 A;  3PFV A;  2J06 A;  3VS5 A;  1SEM A;  3OVE A;  2CSI A;  3GXX A;  1FHS A;  1JU5 C;  5EHR A;  2EO3 A;  2KK6 A;  1UE9 A;  1WA7 A;  2EGC A;  2VKN A;  3PSJ A;  4OHE A;  1KJW A;  1OO4 A;  2YUN A;  2DE0 X;  4J9I A;  3PSK A;  3VRP A;  4Y92 A;  1NG2 A;  1PKT A;  2DL8 A;  2ETZ A;  4EY0 A;  1NYF A;  3TSW A;  3EG1 A;  4F5A A;  2C9W A;  3M0P A;  2KXC A;  1KIK A;  2RQW A;  1OO3 A;  1O4E A;  1ABO A;  1QWE A;  1X6B A;  2ROT A;  2G6F X;  1SRM A;  2IUI A;  2BZ8 A;  5HCK A;  2E5K A;  4QSY A;  2GGR A;  1D4W A;  1HCS B;  5DC9 A;  1WYX A;  2C0O A;  4X6S A;  1FYN A;  2YUP A;  1SHG A;  1O4L A;  5EEQ A;  3NGP A;  2FRW A;  1BFI A;  1I07 A;  2DL7 A;  1M8M A;  2A28 A;  1CSZ A;  2EW3 A;  4K11 A;  1ABQ A;  1JYQ A;  2CUB A;  3UYO A;  2K7A A;  2GE9 A;  2HMH A;  3TVT A;  1H3H A;  4DEY A;  1T0H A;  2GTO A;  2RQU A;  2XMF A;  2JW4 A;  1K4U S;  1CWD L;  1O4B A;  1VYV A;  2PNB A;  1T3L A;  3VS3 A;  1ZBJ A;  4L1B B;  1Z9Z A;  3ZNI A;  1UG1 A;  3REA B;  3NMZ C;  4K44 A;  2L3Q A;  1CKB A;  1UFF A;  3H0I A;  1PRM C;  2O9S A;  2H8H A;  2ECZ A;  3JV3 A;  4GLM A;  4RTW A;  4HCK A;  4RTY A;  3IMD A;  3CD3 A;  2AK5 A;  3GQI B;  2Y1N A;  1O4A A;  3PLF B;  3OB1 B;  2KGT A;  4WCI A;  1NYG A;  1SPK A;  2NWM A;  3EG3 A;  4F17 A;  3BUW B;  2EGE A;  2JMA A;  1JO8 A;  1X43 A;  3C7I A;  4OHD A;  1QG1 E;  1BKM A;  1RI9 A;  4JGH A;  2Y3A B;  2EL8 A;  3I5S A;  2DLY A;  3M0Q A;  1FBZ A;  4LE9 A;  1AYB A;  4NWG A;  2L2P A;  5IBS A;  3H41 A;  2KRO A;  3M0U A;  2OZO A;  1EFN A;  4A4C A;  1RJA A;  5I6V A;  4F16 A;  1IS0 A;  3LH5 A;  4R0K A;  1CSK A;  1BB9 A;  1M3C A;  3UA6 A;  2KNO A;  3UF4 A;  4HVU A;  1OEB A;  2K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...