1GRIA

Grb2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
211
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR BOUND PROTEIN 2
publication title Crystal structure of the mammalian Grb2 adaptor.
pubmed rcsb
source organism Homo sapiens
molecule tags Signal transduction adaptor
total genus 34
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA03
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1griA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1griA02
2ED0A 1PICA 1MV0B 3VS1A 3S8LA 1I1JA 1SPRA 4TZIA 4QT7A 2EBPA 1K4US 2ETZA 3C7IA 2KBTA 2DL4A 2DX1A 4FL3A 5CDWA 1Z9ZA 1B07A 4JPBW 3TKZA 1GBQA 1O48A 4AFZC 5AULA 1HCTB 4L1BB 2DL3A 1WFWA 1O4KA 2QDLA 1I0CA 2L3TA 2B3OA 2F2XA 1O4PA 4WWQA 1X27A 1X43A 2HEQA 4J9EA 3EHQA 4GPLB 2ECZA 5EEQA 1R1PA 1BLJA 1A07A 1A1AA 1PRLC 1O4OA 2KR3A 3M0QA 3PSJA 1U3OA 4OHLA 1CSYA 2DL5A 3IQLA 2O31A 2YU7A 3CWGA 2ABLA 2GQIA 2YUQA 3TSWA 1YNZA 2KRNA 4OHIA 3S9KA 3IN8A 3ZL7C 1YCSB 4OHEA 5AXIA 1JU5A 2C0TA 2EGAA 1O4HA 1X2QA 3BUNB 1ZLMA 3CBLA 1O4DA 1O4QA 2GNCA 1CSZA 2ROLA 4AFUC 2DL7A 1JU5C 1SPKA 2CUDA 1OEBA 4H1OA 1P13A 2OI3A 4NWGA 4E68A 1QG1E 2L2PA 1WDXA 2AKKA 2KT1A 4CC2A 1O49A 2JMAA 1Y1UA 4J9FA 5EHPA 2D8HA 2BZYA 2JT4A 1BHHB 3N84A 4AFSC 1YVHA 1NLPC 2EKXA 3A98A 2EVRA 1NZLA 1ZX6A 2PLEA 2RPNA 3PS5A 1OPLA 2MK2A 2FEIA 1U06A 2YSQA 1RJAA 1FMKA 2EO6A 1QCFA 1WIEA 5DF6A 2CDTA 1UG1A 1O4EA 2AOBA 2L6KA 2M0YA 2YSXA 2C0IA 1T0JA 4GLMA 2MOXA 4AG1C 1O45A 2DLZA 3RNJA 2DM0A 5IXBA 2KT8A 2VIFA 1ZUKA 4F17A 1SRLA 4ORZA 1O4AA 2JM8A 5J3XA 1SKJA 1AYBA 2EGCA 3I5RA 4K11A 5EG3B 2O2OA 1RQQC 2YDLA 5EHRA 1TUCA 1Y57A 2KROA 2GSBA 1R1QA 2LZ6B 1RUWA 1AZEA 1FBVA 1YVLA 1BBZA 1WXBA 1UGVA 2KNOA 2JMCA 2FG0A 3KFJA 1WLPB 3GBQA 1YP5A 2JW4A 1X6BA 1O42A 2DRMA 3TL0A 3VROA 5D0JA 1PHTA 2HSPA 1UHCA 2RNAA 5FW9A 1JWOA 2FO0A 1W6XA 4OMOA 1M27C 2EYVA 2F2WA 2YUPA 3EHRA 2LMJA 2FPFA 1A81A 3OB1B 3US4A 1UJYA 1OPKA 2GTOA 2KXCA 3UF4A 1BHHA 1AWWA 1O4MA 2W10A 1QWFA 4RTVA 4E93A 1LUNA 3BUMB 1AB2A 2KNBB 1UJ0A 2LNWA 2AZVA 1O4FA 3QWXX 5BO4A 1B47A 1D4TA 3MAZA 1QKWA 1OOTA 1HD3A 2JS0A 4OMQA 2LQNA 4OMNA 5HKYA 1A08A 1UURA 5L23A 2LJ1A 2AZSA 1BMBA 3K2MA 3IN7A 3MXYA 3VRQA 2OJ2A 2LJ0A 2PNAA 2RQTA 1BM2A 1E6HA 1UE9A 1ARKA 1Z9QA 4GL9E 3VS3A 3H0IA 1LCJA 1RLQC 2RVFA 2AKLA 4J9IA 3I35A 3T04A 3EG3A 1SHDA 3PVQA 3VRNA 4IIOA 2MRJA 2V1RA 1UUSA 3H0HA 1X0NA 4JGHA 1NZVA 2O9SA 2EW3A 1VYVA 2EYXA 2HBWA 4RUGA 3VRZA 3ULRB 4LN2A 1H9OA 1MILA 1O4IA 2RSYA 1WI7A 2Y1NA 3S8OA 1MUZA 1SEMA 2V1QA 4J9GA 4AFQC 2LCTA 2CREA 2NUZA 2EL8A 4R0KA 2RQVA 5DC0B 5DC4A 2XMFA 3PJPA 3PVLA 2CSIA 4KRTA 2FRYA 2A28A 4OMPA 2D8JA 3OVEA 4F5AA 1SHBA 1NEBA 2KK6A 4K45A 2CH4W 1JYRA 3VS4A 2PNIA 1BKMA 1KJWA 3OP0A 1ZUYA 2RMXA 1TCEA 4HVVA 1IO6A 1ZBJA 4GBQA 1AVZC 2CSQA 3KFVA 1RPYA 1AD5A 3BKBA 4ZNXA 2O88A 4FBNA 3SHWA 2GBQA 3VRYA 2EKHA 1M3CA 1CWDL 1BB9A 1UHFA 2OQ1A 2DF6A 1ZUUA 1GHUA 2C0OA 3VS5A 3LH5A 1JYQA 4D8KA 4RTYA 1X2KA 1O43A 4JEGA 4F5BA 1F2FA 3O5ZA 5IHNA 2YUNA 3TVTA 1FU6A 2KE9A 2DE0X 1M30A 2G6FX 2NWMA 3BUXB 1T3LA 2HUWA 1CKAA 2IIMA 1ABQA 1QLYA 3QWYA 2Y3AB 2K7AA 1JEGA 1W70A 2MRKA 3VS6A 1UDLA 3H41A 1A09A 4OHDA 5IBMA 2PZ1A 4HCKA 4OMLA 1HJDA 1O4RA 1GCQA 2LCSA 2KRSA 2EQIA 3NMZC 3EG1A 5FWBA 4RTTA 2FPEA 2D1XA 1GCQC 2B86A 2GTJA 3EG0A 1D1ZA 3M0RA 1K76A 1G83A 5GJIA 2EGEA 3UATA 1RI9A 3IMDA 3NGPA 4CC3A 3M0UA 1OO4A 1JXOA 4XZ1A 1HCSB 2ESWA 2IUIA 1M8MA 3CQTA 1O4LA 1WQUA 3PFVA 2O9VA 4IIMA 2K6DA 3FJ5A 4J9CA 3M0PA 5GJWB 1NLOC 3TSZA 3MXCA 4RTZA 1M27A 1NEGA 1O44A 1ZFPE 3HIZB 1XA6A 1LKLA 1A1EA 2KYBA 4OHHA 1FHSA 2BBUA 1I07A 2JM9A 1PKSA 2J06A 2LP5A 1OV3A 1MW4A 5IBSA 2M51A 1GFDA 2FPDA 4X6SA 1KFZA 1UUEA 2CT3A 4Y92A 5IHIA 4DEYA 2ENMA 5FWCA 5ECAA 2DLYA 2FCIA 1W1FA 4A63B 2J05A 3VS7A 4CC7A 3H0FA 1X69A 1O4BA 1GCPA 2KRMA 3REAB 1QKXA 5I22A 1KA6A 2JYQA 1VYUA 1A0NB 2RMOA 4Z88A 4EY0A 2OZOA 4DGPA 4M4ZA 4K44A 4P9ZA 3WA4A 1O4JA 1CKBA 3REBB 3VS0A 1IS0A 1QWEA 2DLPA 2L4KA 2EYWA 1OO3A 1WXTA 3SEMA 1AYCA 3CD3A 2IZVA 2KXDA 1WYXA 3PE0A 2DYBA 2K3BA 1K9AA 2LNHB 1TUDA 1JXMA 2QMSA 1QADA 1WA7A 1WXUA 3VRPA 1AWXA 4E6RA 1F1WA 4DEXA 2ECDA 4EIKA 1RLPC 2EPDA 2JS2A 3CXLA 3UYOA 4F16A 1G2BA 4RTUA 4GWFA 2DX0A 1KIKA 5HKWA 2HMHA 3BUOB 4K2RA 1CSKA 1YN8A 1V1CA 4JJCA 1KA7A 3M7FA 1GL5A 3NHNA 1AZGB 1YWOA 2K7AB 1JO8A 1U5SA 1K0XA 5KAZA 2W0ZA 3R6NA 2RORA 4JZ4A 1O4GA 2K2MA 1K0SA 1BLKA 3M0TA 4U17A 2YT6A 4HVUA 2A08A 4D8DA 1ABOA 2YUOA 2MC1A 2MCNA 2P4RA 3M0SA 5EC7A 3N7YA 3JV3A 1H92A 1A1BA 5DC9A 2EO3A 1YWPA 1TG0A 1WX6A 2CH4A 2PLDA 2FRWA 2KYMA 2BTTA 1T0HA 1AOJA 1LCKA 2PNBA 2LQWA 3EAZA 4EIHA 1HSQA 2X3XD 1O41A 1S1NA 1JYUA 1M61A 2LX7A 3THKA 2AOAA 4LUEA 1VA7A 3RBBB 5IH2A 1M3BA 1A1CA 4A4CA 1B3QA 3EGUA 2GE9A 2D0NA 1EFNA 4RTXA 2Y1MA 3IMJA 3C0CA 2CT4A 1AOUF 2DNUA 2OAWA 1K1ZA 4WCIA 2J6KA 4FL2A 1I3ZA 2K79A 3HCKA 3PQZA 1BF5A 4OMMA 5EELA 2MQIA 3U23A 1MV3A 2J6FA 1GFCA 2HCKA 1R1SA 4HVWA 3EG2A 2HDVA 1E6GA 4F14A 1AEYA 2RQWA 1JQQA 1FU5A 1Z3KA 5GJVB 2DVJA 3I9QA 3PLFB 3S8NA 5I11A 2H8HA 2DBKA 4NWFA 2JTEA 3ZNIA 1BFIA 1BFJA 4RTWA 1X6GA 3OB2B 2RQUA 2XP1A 2F2VA 1AYDA 2DCRA 2J6OA 2DBMA 5HCKA 4A4BA 2LJ3A 2SRCA 2L3SA 2CBLA 1VYTA 4LE9A 2DM1A 2RF0A 2IUGA 1SHGA 1M3AA 1CJ1A 1AYAA 2SHPA 2CI9A 2HDAA 1KC2A 4P9VA 2VKNA 1D4WA 2DRKA 1AWJA 1NRVA 2CI8A 1BU1A 3I5SA 3UA6A 1SHFA 2A36A 1UECA 1SSHA 3EACA 3UA7A 1BHFA 4FSSA 3PSKA 2DL8A 5I6VA 2DJQA 1T3SA 2BZXA 1PRMC 4Z89A 1X6CA 1KSWA 2EOBA 2JXBA 2ROTA 3HHMB 1PKTA 1H8KA 2VVKA 2RN8A 1SPSA 3BUWB 2A37A 1FYRA 1LUIA 4U1PA 2H5KA 1O46A 4JJDA 2PTKA 2L3QA 2I0NA 2L0AA 2AUGA 2K9GA 1PWTA 5IXFA 1NM7A 3GXWA 1E7OA 1GRIA 1N5ZA 2EYZA 3GQIB 1Y0MA 1LKKA 4AG2C 1LUKA 4ROJA 2DA9A 1ZSGA 2KEAA 4JZ3A 1UFFA 2DILA 4LUDA 1O4CA 4J9HA 1TZEE 4ESRA 2SEMA 2E5KA 2MIOA 2CR4A 2CUBA 1H3HA 4HXJA 1AOTF 1FBZA 2J7IA 1XOVA 4LNPA 2LNXA 1NYGA 1J3TA 4Z8AA 1FYNA 3NPFA 3VS2A 2L3PA 2RQRA 4X1VA 1AWOA 1BG1A 2ED1A 1PNJA 4CC4B 1CWEA 2AK5A 2C9WA 2H46E 1UTIA 4J9DA 2K79B 3VGOA 3VRRA 4F59A 1IJRA 5IHKA 2CS0A 3OV1A 1NG2A 1BK2A 1O47A 4QSYA 5HKZA 3GXXA 2EYYA 5GJHA 1O4NA 2HDXA 2CRHA 2EU0A 1BKLA 4XZ0A 2IUHA 1GBRA 2KGTA 2CIAA 4DGXA 4JJBA 4H34A 4J9BA 2BZ8A 2DMOA 1LUMA 1NYFA 2VWFA 4JE4A 2GGRA 3N8MA 2X3WD 1SHAA 1SRMA
chains in the Genus database with same CATH superfamily
3QPHA 1NJIC 2EIFA 3VS1A 2E3HA 2CKKA 3H8ZA 3OMGA 5FRMA 3C7IA 4DBQA 3C4SA 4FL3A 3SD4A 1RAEB 3J80E 2X4WA 4HCBA 3TKZA 1O48A 4A4GA 3H9NA 1WFWA 1I0CA 2QA4A 4NL3A 2L3TA 2B3OA 1O4PA 5CKHA 4WWQA 1VQ5T 1BIAA 1KD1C 5EEQA 3OYNA 5KE2A 1A07A 1PRLC 1F1BB 1VQ8A 3RKYA 1CSYA 1DJ7B 2O31A 4LDXA 3OYJA 2XICA 3E2UA 2YUQA 2HQHA 3CC2Q 2HKNA 4CI0C 2LCLA 5KYUB 3RKXA 5AXIA 2C0TA 3PIOA 1M90C 3CBLA 2AIRB 3EFSA 1CSZA 4XU0A 3JB9H 1SPKA 3OY9A 4E68A 1Y1UA 1ACMB 2JJ9A 2QGFB 1YJNA 1YVHA 3A98A 1ZX6A 3PS5A 6AT1B 1U06A 3GNFB 4B9XA 2EO6A 1WIEA 5DF6A 1IHVA 5GAOn 3QDRB 1O4EA 5GAOq 4IUUA 2YSXA 2C0IA 4C92F 1XNIA 1PSEA 3CCLA 4QVZA 3RNJA 2JNGA 4M75F 1K9MR 1SKJA 3BE3A 1AYBA 2R5MA 3I55Q 3MEUA 2O2OA 2YDLA 1Y57A 2GSBA 1EIFA 2YRVA 1YIJQ 3X26B 1YVLA 1K9MU 1WXBA 2HAXA 1M1GA 2YWWA 4B9WA 3GBQA 2JW4A 3VJPA 3TEEA 1RL2A 3CCQQ 2QDYB 2F2WA 2IG0A 1UGSB 3OB1B 3Q1JA 4JRIA 1LUNA 2CZ0B 3EGDB 2KNBB 4FT4A 2AZVA 2MYSA 1O4FA 3QWXX 5BO4A 4N0AA 3GOXA 2XK0A 1D4TA 1OU8A 1OOTA 4OMQA 4OMNA 1WPYA 4PNOA 1A08A 1ZSZC 2EJ9A 2B8AA 2LJ1A 1UGPB 3JCMV 1KQSA 3K2MA 2A0FB 1SF9A 1NPPA 1EZZB 2LJ0A 1OYXA 1N27A 2GCXA 3CCVT 1BM2A 2K57A 4ZGJB 3OW2P 3VS3A 1LCJA 5LJ3e 5FROA 1RLQC 4J9IA 3URGA 2DIGA 3JCMb 1GXIE 4FCYA 3EG3A 3C94A 4BI8B 2Z0WA 3H0HA 5DM7R 1B34B 2YLBA 1X0NA 3VYHB 1VYVA 2OX7A 2RSYA 2Y1NA 3D7SB 2VXFA 4QQDA 4J9GA 2CREA 2NUZA 1PCXA 4PJOF 2P0QA 2CSIA 2QEXQ 2FRYA 1VQ7Q 2A28A 4OMPA 4E2FB 2CH4W 3FC3A 2COZA 1BI1A 2AT1B 2XD0A 4HVVA 1IO6A 2CSQA 5DLQE 2ZPIB 5LJ3f 1RI0A 3VRYA 1CWDL 2OQ1A 2DF6A 1VQ9Q 3FJPA 4C5HA 1GHUA 2C0OA 1VQ4A 1I4K1 3CCEA 1VIEA 1FU6A 1M30A 2RH2A 1VQKT 1ABQA 4EMGA 2BIVA 1QP3A 2MRKA 4DBHA 1UDLA 3G6EQ 3EGXB 2ATCB 1O4RA 1M2VB 2KRSA 2M9UA 2EQIA 3NMZC 4M78C 3EG0A 2B86A 4R56A 1K76A 1G83A 2RD1A 5GJIA 2M02A 3V8JA 2DVEA 3NGPA 1BI2A 2KK4A 4J7FA 1OO4A 1KG1A 4XZ1A 1HCSB 3CQTA 4L59A 1WQUA 2QGGA 3FJ5A 4KT0E 5CKDA 2FZCB 3M55A 2JTMA 4QKUA 1NLOC 1O44A 5IAYA 1XA6A 4QVDA 3E9GA 1A1EA 4EPCA 2QYZA 1I07A 1RAGB 5IBSA 2M51A 2NUTA 3QIIA 2P0PA 4XU2A 1JJ2P 1VQOA 1VQ6A 2YLCA 5GAN8 4IKFA 3H0FA 1O4BA 2JYQA 1VYUA 4EMHA 3EGXA 4ATOA 2RMOA 4EY0A 4Y28E 3G1JA 1M2VA 3A5ZB 2EQJA 4P9ZA 1CKBA 1QWEA 3FB9A 2L4KA 1AYCA 1PD1A 1YI2Q 3RDVA 1WYXA 2ZZDA 1MMNA 2K3BA 2XG8D 4E6RA 1F1WA 1OX9A 5FU6C 1RLPC 2EQKA 3UYOA 3NTIA 4F16A 4RTUA 2GQVA 1KQSS 1YN8A 4JJCA 1KA7A 3CMEQ 1K9MC 1VQ8T 1JO8A 1U5SA 1KQ2A 1K0XA 3R6NA 5KYWB 4PJOC 2COYA 2OAUA 2RHYA 3QYHB 1BLKA 1D3BB 2YT6A 2YUOA 3ASKA 4DOVA 2F5TX 1YJ9A 3M0SA 3GP8A 1H92A 1YWPA 2FRWA 2KYMA 5A0GA 3FLGA 3CPFA 1HSQA 2L3RA 5EG2A 1JYUA 5LJ3g 1M61A 1FWZA 3THKA 2AOAA 4LUEA 2QQ9A 3C12A 4RTXA 2Y1MA 3IMJA 2K5FA 2CT4A 2DNUA 1K1ZA 3CPWA 4C0ZA 3HCKA 3M53A 3VKIA 4Q5WA 1MV3A 4EMKC 4HVWA 3EG2A 2HDVA 2YHTA 3CCLT 1JQQA 5GMKi 2XDDA 3I9QA 1VQ5A 3PLFB 5I11A 2H8HA 2LTOA 1BFIA 4P5NA 5KYWA 1BFJA 4RTWA 3OB2B 2DBMA 2HL5C 1S72T 1D1AA 1VYTA 4BI4A 1SHGA 2QQRA 2JOYA 2VC8A 3OW2A 2DAQA 1KC2A 4C8QG 1AWJA 3TQ7P 2M16A 1NRVA 4XTWA 3PMTA 4J6WA 3G71T 1UECA 3OB9A 3UA7A 5I6VA 3PSKA 2DL8A 2DJQA 1BYMA 4M77G 4L5GA 4KGXB 2ROTA 3MEVA 4RKUE 1K73R 4JJNK 3HHMB 3QXEB 1PKTA 2QASA 3BUWB 2H5KA 4M77E 4JJDA 4OGCA 1K73U 2L3QA 4BE1A 5HK3A 7AT1B 2RI3A 2EJFA 2HL3A 1N9RA 3OA6A 2EYZA 4LDWA 1LKKA 3RKWA 2KEAA 1UFFA 2DILA 3CD6T 4ESRA 3MKDA 2VGMA 3DB4A 2PVOB 1AOTF 1FBZA 2R5AA 5I2SA 4LNPA 1NYGA 1FYNA 4E7HA 2NLUA 2VUBA 3H6ZA 3VS2A 2ED1A 1PNJA 2X4JA 4BB7A 2AK5A 3EFOB 4CC4B 2X9HA 3VRRA 2CS0A 2XHCA 3L2UA 2RB6A 1O4NA 2EU0A 3VU3C 1GBRA 4XTYA 3LWHA 4JJBA 3CCEQ 3FEOA 4F7UE 2BZ8A 1MNDA 3KUFA 2DXTA 4JE4A 2GGRA 4K45A 1TS9A 2ED0A 3LYIA 3JCMe 3S8LA 5GAN2 4TZIA 5M9OA 2RJEA 4QT7A 4J8OA 2EBPA 2ETZA 3RMSA 2K4YA 4LD9K 5GMKh 1B07A 2MMPA 1GBQA 4M77B 1TOVA 1VQPQ 3CCVA 4FT2A 1IGUA 2QDLA 4FYXB 4EDUA 1YHQQ 3JCMc 2F2XA 2KQWA 3META 1Y96B 1JJ2A 1X27A 1X43A 4PFOA 3EFOA 4M7AC 2KR3A 3M0QA 3PSJA 2DERA 1QCOA 1LJOA 3IQLA 2D0QB 3TSWA 2HZYA 1SG5A 1H3ZA 1YNZA 3IN8A 3ZL7C 1VQOQ 1YCSB 1QVFP 2EGAA 1O4HA 2E64A 1O4QA 2HNIA 4C0FA 2ROLA 4AFUC 1JU5C 4H1OA 2E70A 5GAMe 2AKKA 1WDXA 3DLLA 2KT1A 1O49A 3S3MA 4DBRA 4J9FA 5EHPA 1IZ6A 2HKQB 2JT4A 1YJWT 4AFSC 1NLPC 1NZLA 2RK2A 2RPNA 1OPLA 2JN0A 2FEIA 2XU8A 2YSQA 4MZPA 1RJAA 1FMKA 4RG8A 3OW2S 1FMVA 5A2QE 3BY7A 1V29B 2M0YA 1N8RR 4ZN3A 3OSVA 1T0JA 2DM0A 2DLZA 4BUGA 3HRTA 2VIFA 1SRLA 2JM8A 1N8RU 3M9QA 2EGCA 5EG3B 4K11A 4A4HA 1RQQC 4A4FA 5EHRA 3CCRQ 2XDPA 3HFOA 3CCJQ 2LZ6B 1FBVA 5GAMf 1O9SA 3KFJA 2FG0A 1MNEA 4C8QF 2M0OA 1PHTA 5CVIA 2HSPA 1UHCA 3M56A 1W6XA 1Q95G 2EYVA 3MO8A 3QO3A 4M77F 2F5KA 2LMJA 4F7UA 3CCSA 1P92A 1A81A 3QKJA 4M7DC 4FYYB 1UJYA 1OPKA 4KUIA 1QWFA 4ME7A 2DD5A 4Z02A 4E7IA 4E93A 4N4HA 2OTLA 1UJ0A 4JUVA 2YRCA 5D6WA 2BUDA 3UDCA 1WHJA 5GAN4 3M54A 2LQNA 5HKYA 3M4YA 3JCMQ 1TUGB 2MWOA 2P4TA 5L23A 2DTIA 2AZSA 4HT9A 1BMBA 3BDUA 2Y4YA 4C0GA 2DD4A 2RQTA 5LJ5e 3CC7Q 1K73C 4N4GA 4L6V5 2GFUA 4MDWA 2PQWA 3QHSA 1OULA 3PVQA 3VRNA 4IIOA 1UUSA 3QSUA 3L2QA 2XKOC 3S3OA 1O75A 2O9SA 2NYSA 3VRZA 2EYXA 3ULRB 3CC4T 1G3YA 3S8OA 1MUZA 2V1QA 5GAOm 4R0KA 1BCMA 2WSEE 5A0DA 2L5QA 3PJPA 2D8JA 3OVEA 4F5AA 1SHBA 1NEBA 5LJ3h 4LD6A 3JCMg 3QDFA 5CAIA 3QYGB 1JJ2S 4XTVA 3OP0A 1D0ZA 3SFMA 2RMXA 2OTJT 1TCEA 1RPYA 4PJLA 1Q86R 3LH0A 4ZNXA 1WHHA 1OI1A 2O88A 2E1HA 3L1AA 3I56A 1UEBA 2GBQA 4II1A 2ZPFB 3G4ST 1UHFA 8AT1B 4RCCA 4X9DA 4ANJA 2E4HA 3VS5A 1VOMA 4D8KA 1Q86U 1F2FA 1JBMA 4C5GA 3BUXB 2X51A 2IIMA 2HQEA 2K7AA 1QVPA 3DB3A 2E6NA 1BCOA 3H41A 4OHDA 2PZ1A 4HCKA 2VASA 3MP6A 1UGQB 2LCSA 1VQMQ 1BI0A 1Q7YR 1TU0B 2FPEA 4N4IA 2GTJA 1GCQC 2F1LA 3M0RA 2JZ2A 5CCAA 2EGEA 4A4KA 1I5LA 3MCAB 4CC3A 3IMDA 1Q7YU 1JXOA 3P8HA 1QVGP 1M8MA 4C8QC 5LJ3j 3CC2T 3PFVA 2K6DA 2H3EB 1D0XA 2GF7A 5GAMg 3RR6A 1EX4A 4X34A 1S72A 3M0PA 4XK8E 3S3NA 3CMAT 3FDRA 1M27A 1NEGA 3HIZB 4KGZB 3HSBA 3SWNC 3G71A 4QW2A 1GFDA 4JS5A 3GLXA 3CCUA 2CT3A 4DEYA 2ENMA 3OSSC 5FWCA 3P8BB 4M78D 2J05A 2LQKA 2WACA 2MI6A 2IVWA 1GCPA 1KA6A 2E3IA 2XI9A 4Z88A 3VYGA 5GAMd 2OZOA 2DEQA 4M4ZA 1G5VA 5FLXE 1IS0A 2DLPA 4ELZC 2EYWA 1VQNA 2QQAA 3RUXA 2IZVA 2KXDA 3ZBDA 3OMCA 1OU9A 1TUDA 3X25B 3CBPA 1WA7A 1WXUA 5HKCA 4DEXA 3CD6A 4EIKA 2EPDA 1N8RC 8ATCB 5CKBA 5HKWA 2HMHA 4DA4A 2MF2A 3TU4K 3M7FA 3OS0A 1GL5A 4IUPA 1U1TA 5KAZA 1TXQA 2MAMA 4J83A 5GAOl 3JRZA 3OYCA 1O4GA 4UC4A 5CIUA 4TVRA 3ZEHA 4E7ZA 3JV3A 1A1BA 5DC9A 2CH4A 2FZGB 3BFMA 2DJZA 1YBYA 2BTTA 1VQKQ 3VUZA 2ZPBB 4EIHA 1QCNA 1VQLQ 1R0BG 3S6WA 1S1NA 2LX7A 1M3BA 2GE9A 1EFNA 1TTHB 4KGVB 3E9FA 4A4EA 4EMKA 5CKFA 4WCIA 4FL2A 3PQZA 4OMMA 2NUTB 2J6FA 2EAYA 1BKBA 3CBMA 1LOJA 1I81A 2RQWA 4ZTJA 2E41A 4A53A 3HKSA 1Z3KA 5GJVB 3C95A 3S8NA 4C92C 2EFIA 1PG5B 4M75C 2XP1A 1PC0A 1AYDA 2DCRA 2LJ3A 4OB3B 2L3SA 4LE9A 2QEXT 2DYIA 1VQ7T 1AYAA 4KH1B 2SHPA 3LGFA 2WSCE 4XTUA 1WJRA 4P9VA 4KBMB 5CQXA 3SB2A 5GANe 2DXCA 2NUPA 3QG1A 3CCST 1PRMC 1X6CA 1PM3A 1XQHA 2JXBA 5FU7B 3KBGA 2OTLT 1YJWA 1H8KA 2RO0A 2VVKA 2G3RA 2RN8A 4U1PA 2PTKA 1Q86C 2F69A 2I0NA 4B6MA 5IXFA 1NM7A 2QA4Q 2DZCA 4FIBA 1GRIA 2Y4XA 3GQIB 1Y0MA 2LCCA 4AG2C 4ROJA 4JZ3A 4BD3A 4J9HA 2CP3A 2BE7D 2E5KA 1VQ8Q 1H3HA 2RA2A 3EH2A 4HXJA 3HPWA 2LNXA 5GANf 4FSXA 2L3PA 4X1VA 3CCMA 1Q82R 1QVFS 2C9WA 1WNLA 3A8MB 3OYAA 3OV1A 1W2BP 5GAN7 1LPLA 1BK2A 1Q7YC 1Q82U 2DEUA 2ZAEA 3OYFA 2D9TA 4DGXA 1WQWA 4LDYA 4N0AC 4XTXA 2VWFA 1B7TA 4FYVB 1G3WA 1YJNQ 1IHWA 2FL7A 3HP9A 2VYTA 1M5Q1 4BY6B 1I1JA 1SPRA 3I56T 1IREB 2COWA 2KBTA 3JSCA 2PUOB 2DX1A 3CCLQ 4JPBW 5GMKm 3L42A 2FHDA 4C0DB 4L1BB 4RG2A 4BE2A 1ZBXA 4M7AA 1O4KA 2V26A 5CO7A 1XTDA 2QTXA 3EHQA 4GPLB 4LDVA 3MEAA 3CXCP 5KE3A 3JCMh 2EQUA 1O4OA 4OHLA 3A8LB 2DL5A 2QI2A 4ZGEB 2M1HA 2YU7A 1FMWA 4DQ2A 2L8DA 4J6YA 2GQIA 1SSFA 3CC4A 1ZQ1A 3L2ZA 3G71Q 2KRNA 4OHIA 3HL8A 4FYWB 4MZTA 1JU5A 4JLIA 3BUNB 1ZLMA 4IUTA 4NL2A 1O4DA 2GNCA 3HRUA 5LJ3d 2DL7A 1OEBA 1I8FA 1P13A 2OI3A 2CGHA 2OTJA 2XIDA 5IN1A 3N84A 5CQYA 4M7AD 4J7IA 2EVRA 4AT1B 3G4SA 2PLEA 2A7YA 4PK4A 2MK2A 2LX9A 1R0CB 3CCUT 2CDTA 4E7JA 2AOBA 3GF5A 4GLMA 1O45A 5IXBA 2KT8A 9ATCB 1ZUKA 4F17A 5J3XA 5DY9A 5GAMh 1HK9A 2KROA 3DLMA 4QVCA 2DO3A 1R1QA 1VQNT 1AZEA 4OVAA 4OF1A 1BBZA 4BI3A 2KNOA 2JMCA 3TL0A 3VROA 2DRMA 2RNAA 5HY6A 5GANg 1Y7XA 2CP5A 3CC2A 4M7DA 3LWIA 4IUQA 3EHRA 2IPOB 3QZ5B 3CMAA 2FPFA 2ZPEB 3US4A 2GTOA 3MP8A 3UF4A 1AWWA 1C1AA 1JB0E 4F7UG 2W10A 4RTVA 3BUMB 2LNWA 1C6VX 1VQ4Q 3MAZA 5I21A 1MMDA 1QKWA 1NE8A 4NS5A 1UURA 3OYIA 1NZ9A 2O4XA 3MXYA 3VRQA 5CKEA 2OJ2A 2PNAA 1TWBA 5GAMj 3PFSA 1E6HA 5KYXA 4HT8A 1ARKA 3MHXA 4GL9E 3H0IA 4FW2A 3EG9A 1D1CA 2RM4A 2AKLA 3I35A 3T04A 1BIBA 4J6XA 1XJWB 4M7DD 2DK3A 5J26A 1SHDA 3OYKA 2MRJA 1R77A 2E12A 2V1RA 3L2VA 3I55A 3JB9J 1QVGS 1YCYA 4JGHA 2EW3A 4RUGA 1MILA 1VIFA 1YIJA 1IB8A 4AFQC 2LCTA 3R6OA 3T9NA 2V8JA 2DZ9A 3A8HB 2XMFA 2V8KA 3CCQA 3VS4A 2KDSA 3V7CA 1KJWA 3QJYA 1Q82C 2WSFE 3JCMf 1ZUYA 2JTFA 4FU6A 4GBQA 3KFVA 3BKBA 1AD5A 1VQ6Q 4JRKA 3SHWA 1G8XA 2A3LA 2EKHA 2R57A 1ZA1B 1G3TA 3BDLA 3KXTA 3LH5A 1JYQA 5GAN3 4RTYA 4QQ6A 1O43A 4JEGA 4F5BA 2ZPHB 3O5ZA 2LT1A 3TVTA 1N6AA 5J3BA 1M2OA 2DE0X 2NWMA 2G6FX 4F7UB 1T3LA 3WXMB 2HUWA 1CKAA 1WHKA 1W4SA 1QLYA 2R58A 1VQPT 5GMKj 1W70A 3TCJA 5IBMA 4OMLA 1HJDA 1GCQA 3EG1A 4M78G 4RTTA 3FRNA 2K3XA 2D1XA 1RAFB 3GNGA 3J81E 3PGGA 5CK9A 2RHIA 3M0UA 2RHZA 2ESWA 4M78E 2O9VA 2LQ8A 3CCMT 4WTOB 1WQ7A 4XU1A 2QEXA 1VQ7A 2YXYA 3OYDA 4RTZA 3SWNA 1YJ9Q 2P84A 2E10A 4OHHA 2QTVA 4GLKA 2VXEA 3K2TA 2JM9A 1PKSA 3OQ5A 3CXCA 2X35A 1MW4A 2K5LA 3V8LA 4PFPA 4X6SA 3QZ9B 1KFZA 1IRXA 5IHIA 3P8DA 3OYHA 2DLYA 3CBOA 2FCIA 4A63B 4OB1B 4CC7A 2CP6A 1X69A 4LDUA 5I22A 1ZSZA 2C06A 1NPRA 3EAEA 2DIQA 2FZKB 3JB9D 1C0MA 2QQBA 4FM4B 4C8QD 1QMCA 4K44A 1WHGA 2DTOA 3WA4A 1O4JA 1PD0A 3REBB 3VS0A 3NTKA 3CC4Q 3G6EA 1VUBA 2DYBA 2LNHB 1K9AA 1VQ5Q 2QMSA 1JXMA 2CZ7B 2ECDA 4ELYC 2JS2A 2H3JA 1G2BA 1M8VA 2CYZB 3WVEB 2DX0A 2EYQA 2KSSA 4LXCA 4MMKA 3LLRA 4FW1A 3NHNA 2K7AB 3RIRA 4F7UF 2CZ1B 5DLOA 2RORA 2E6ZA 4M78B 2CS7A 2EJGA 1RAHB 3G4SQ 3M0TA 4PL6A 4U17A 2HSEB 1YITT 4D8DA 3GIBA 1ABOA 4XU3A 2Y90A 2MCNA 1RAIB 3A1PA 4PJOE 2P4RA 3N7YA 3LX7A 2LDMA 2X4YA 4KH0B 1TG0A 1WX6A 2PLDA 3N5BB 1KC8R 1AOJA 1YFNA 2DFUA 1LCKA 1H641 3ME9A 3EAZA 5LJ5f 2X3XD 1O41A 2LRAA 4YTLA 4PJNA 2RJCA 3VV0A 5IH2A 1X6OA 1A1CA 1KC8U 3EGUA 2D0NA 4J5YA 1AOUF 3CC7T 4HKEA 3EH1A 3LW5E 2GFAA 2K79A 4OB2B 2MQIA 3U23A 1GFCA 1N9SA 1R1SA 3RESA 3DKMA 4R55A 4C92A 1KK7A 3ER0A 3E1SA 1FU5A 1YI2A 1OX8A 4M75A 3JAME 2KVQG 2DBKA 2LNVA 4PFZA 3JCMd 3CMAQ 1W2BS 2RQUA 4M78A 2DETA 4A4BA 2SRCA 2HMAA 2RF0A 2QAZA 3CMEA 1CJ1A 5FU6B 1R8OB 5D6XA 1D4WA 1TH7A 2DRKA 3UWNA 2E65A 3M4GA 2CI8A 3UA6A 1TSFA 2A36A 1I5OB 2YRDA 1BI3A 1SSHA 3EACA 1BHFA 2ZCFB 4FSSA 1MHNA 2RHXA 3OS1A 4PJOB 4Z89A 1U1SA 2EOBA 4M77C 4OMFB 2EQMA 2JVVA 1HXDA 1OQKA 3MP1A 4IUVA 4C92D 1WHLA 1FYRA 4M75D 2DTHA 1MMGA 2V8IA 1O46A 4M78F 3CCVQ 2AUGA 3TREA 5KYUA 1E7OA 3CXCS 1QVFA 5GANh 1LUKA 2DA9A 1ZSGA 1O4CA 1QW1A 1VQMT 2SEMA 3JB9I 2CUBA 2J7IA 2PVGB 5C0MA 3NPFA 1AWOA 1BG1A 3CPWP 4EMKB 1UTIA 3I55T 1IJRA 5IHKA 3JCMP 4C5IA 3GXXA 2EYYA 2VV5A 1YIJT 1BKLA 2IUHA 2CIAA 2LC4A 4PJOA 3OYLA 3MJXA 4H34A 1LVKA 2HD0A 2DMOA 2KI7A 1LUMA 1NYFA 3OYGA 3CCQT 2X3WD 1SHAA 3OBYA 4BACA 4OGEA 3V7SA 4MDXA 1PICA 2PU9B 1MV0B 3OYEA 2HBPA 2FYKA 2KGYA 2KAFA 1K4US 4KULA 4ZN1A 2DL4A 5CDWA 5LJ5g 5GANj 1Z9ZA 3M57A 3QBYA 5IT9E 2RK1A 4JLGA 3PIPA 4AFZC 5AULA 1HCTB 2I2LA 2NUPB 2DL3A 5C6SA 4HCCA 4FL6A 4M7AG 3HTRA 3NTHA 2HEQA 4J9EA 4PLIA 3A8OB 1BLJA 2ECZA 1R1PA 2MWPA 2RHUA 1A1AA 1U3OA 4PJOD 3EGDA 3CWGA 2ABLA 3JCMX 4M7AE 4E7LA 3J7AF 2CP0A 5GAOp 3S9KA 4E47A 5LJ5d 4OHEA 4CRIA 1M1KR 3LGLA 3CCSQ 1X2QA 5KCHA 2EKOA 3X24B 3MPUB 1G3SA 2OTLQ 2CUDA 4E7KA 1M1KU 3E19A 3HFNA 4NWGA 1QG1E 2L2PA 4CC2A 2JMAA 2D8HA 2BZYA 1BHHB 2EKXA 2LVMA 1VQLT 1PSFA 4RCBA 1B34A 4O6JA 4Y91A 1QCFA 4V2SA 3OBWA 1UG1A 2L6KA 1VQ9T 2MOXA 4AG1C 3QUIA 4DBFA 1KC8C 1FXXA 1VQPA 3RMQA 1D1BA 1JRIA 4ORZA 1O4AA 1YHQA 4O5VA 3I5RA 1TUCA 4OP0A 1M4ZA 1RUWA 3G6ET 2L89A 1QP2A 1UGVA 2DKGA 1WLPB 1YP5A 1X6BA 1O42A 5D0JA 5FW9A 5KCOA 1JWOA 3PT9A 1K8AR 2FO0A 2LT4A 4OMOA 1M27C 2BKDN 4M7AB 2YUPA 3INZA 4M7DG 3X28B 1MGQA 1K8AU 1QQJA 3AHUA 2KXCA 1BHHA 1O4MA 1AB2A 3I56Q 4XTZA 1ZHIA 4M7DE 1B47A 1HD3A 2JS0A 3JCMJ 1KHCA 3O8VA 4GY5A 3IN7A 4XQ3A 2DXUA 1KQ1A 1Q81R 1WJQA 1UE9A 1QVGA 1Z9QA 4NOYA 2QA4T 1WJSA 1UB4A 1WHMA 2RVFA 3A8GB 1Q81U 5A0LA 1FX7A 1D09B 3CCRA 1NZVA 2HBWA 3CCJA 1O4IA 2K2VA 5CR2A 4LN2A 1NBEB 1Y07A 1YI2T 1H9OA 1WI7A 1SEMA 2AHJB 2EL8A 2RQVA 5DC0B 1S72Q 5DC4A 3PVLA 4KRTA 4PJMA 1IGQA 3PNWC 4BDZA 3WVDB 2EWNA 1D0YA 2KK6A 1JYRA 3MEWA 4ZTFA 2PNIA 1BKMA 3CEYA 3CMET 3V7RA 1YITA 3OYBA 2X4XA 2RJFA 1ZBJA 3L2WA 1AVZC 3G7ZA 1V76A 3CCUQ 1YJNT 4FBNA 3L2RA 1M3CA 1BB9A 4IURA 1ZUUA 2DPPB 3UT1A 4M7DB 1X2KA 3AT1B 1LNXA 5IHNA 2YUNA 2KE9A 3JCMW 4M7AF 3QWYA 2MPXC 2Y3AB 5L8RE 3CC7A 1JEGA 1VQNQ 3VS6A 3M59A 1A09A 2P0KA 4JRQA 4JS4A 1D3BA 3CD6Q 4PJJA 5FWBA 2PVDB 1M9SA 3UPUA 4PKCC 1D1ZA 2VB6A 3OS2A 2O4XB 2XDBA 3UATA 2CZ6B 1RI9A 3JB9G 4WF2A 3X20B 2IUIA 5KYXB 1O4LA 4IIMA 3EG9B 2FB7A 4J9CA 4PLLA 1NJIR 5GJWB 4VUBA 4AMCA 3TSZA 3MXCA 4C8QE 1ZFPE 1LKLA 2QK0A 1NJIU 2KYBA 1FHSA 2BBUA 2JUFA 4OB0B 4RMOA 5GAOr 2LP5A 2J06A 1OV3A 1HYOA 5GAN5 2FPDA 4KUDK 1UUEA 1M1KC 4Y92A 4MZMA 5ECAA 1W1FA 3OYYA 3VS7A 4MMLA 4D6WA 2KRMA 3REAB 1QKXA 1A0NB 1KD1R 1IXDA 3GPLA 2K3YA 2O01E 1KHIA 2QG9B 4DGPA 4C5EA 2VGNA 1KD1U 2K5IA 1OO3A 4JRPA 1WXTA 3SEMA 3CD3A 1Y71A 3PE0A 5GANd 1RACB 1QADA 3VRPA 1AWXA 1VQMA 2MK5A 4X9CA 1M90R 3CXLA 1AT1B 5GMKl 5FRNA 4GWFA 4M7DF 1KIKA 3BUOB 4K2RA 1CSKA 2KY9A 5HK0A 1V1CA 3PTAA 3LYVA 1WGSA 4JDSA 1M90U 1AZGB 1YWOA 4HA8A 3OYMA 2W0ZA 4DOWA 4ZGDB 3EFRA 4JZ4A 5FU7C 3BW1A 2K2MA 2D6FA 1K0SA 4HVUA 2A08A 2MC1A 3HRSA 4C8QB 1RABB 5LJ5h 5KYYB 5EC7A 2EO3A 1K8AC 4BE0A 1VQ4T 1T0HA 1YJWQ 1RAAB 2PNBA 2LQWA 3CCET 5I2MA 2CP7A 5D7UA 1VA7A 3M5AA 3M58A 3RBBB 3ZFJA 4A4CA 1B3QA 2CP2A 3SWNB 3C0CA 3NFCA 2OAWA 2BE9B 2J6KA 4HCZA 2PUKB 1I3ZA 2ZPGB 1BF5A 1OZ2A 4BDYA 5J39A 5EELA 3QJ6A 1RADB 4QQGA 1W2BA 2HCKA 5D6YA 1E6GA 4F14A 1AEYA 5LL6S 4C92G 3CPWS 2DVJA 1Q81C 4NWFA 4M75G 2JTEA 3CCMQ 1M1FA 3ZNIA 1ZSZB 1OZ3A 1X6GA 1YHQT 2F2VA 1ZA2B 2J6OA 5HCKA 4C92E 2CBLA 5GAN6 2DM1A 2IUGA 1M3AA 4M75E 1KQSP 2LRQA 4C8QA 3SDZA 5KYYA 2HDAA 5LJ5j 2CI9A 2QXFA 2VKNA 1UGRB 4BY6C 1MMAA 1BU1A 3I5SA 3FIFA 1SHFA 2E5QA 4M77A 1WZOA 1VQOT 3RERA 1VQ6T 1T3SA 2BZXA 1U8RA 1KSWA 1SKUB 1Y96A 4C0DC 1VQKA 5AT1B 4F04B 2ZGWA 1X75C 1VQLA 1SPSA 2A37A 1LUIA 1X01A 2QQSA 5KH6A 2L0AA 2K9GA 1PWTA 1VQ9A 3GXWA 2FVUA 1N5ZA 3JB9F 4LUDA 2HQXA 3OS5A 1TZEE 2DXBA 2CR4A 2MIOA 1XOVA 2RI5A 1J3TA 4Z8AA 2RQRA 4A54A 1YITQ 4M77D 1CWEA 2H46E 3VUBA 4J9DA 2K79B 3VGOA 3F70A 4F59A 3V8KA 1NG2A 3CCRT 1O47A 4QSYA 5HKZA 5AYFA 5GJHA 3CCJT 2HDXA 2CRHA 4XAXB 4C92B 4XZ0A 5GMKe 1AHJB 2KGTA 5KYNA 3PMIA 4M75B 4E7SA 1YJ9T 4J9BA 3HHTB 4PJOG 2RJDA 2KMTA 2OTJQ 2RI2A 3N8MA 1SRMA
chains in the Genus database with same CATH topology
2ED0A 1PICA 1MV0B 3VS1A 3S8LA 1I1JA 1SPRA 4TZIA 4QT7A 2EBPA 1K4US 2ETZA 3C7IA 2KBTA 2DL4A 2DX1A 4FL3A 5CDWA 1Z9ZA 1B07A 4JPBW 3TKZA 1GBQA 1O48A 4AFZC 5AULA 1HCTB 4L1BB 2DL3A 1WFWA 1O4KA 2QDLA 1I0CA 2L3TA 2B3OA 2F2XA 1O4PA 4WWQA 1X27A 1X43A 2HEQA 4J9EA 3EHQA 4GPLB 2ECZA 5EEQA 1R1PA 1BLJA 1A07A 1A1AA 1PRLC 1O4OA 2KR3A 3M0QA 3PSJA 1U3OA 4OHLA 1CSYA 2DL5A 3IQLA 2O31A 2YU7A 3CWGA 2ABLA 2GQIA 2YUQA 3TSWA 1YNZA 2KRNA 4OHIA 3S9KA 3IN8A 3ZL7C 1YCSB 4OHEA 5AXIA 1JU5A 2C0TA 2EGAA 1O4HA 1X2QA 3BUNB 1ZLMA 3CBLA 1O4DA 1O4QA 2GNCA 1CSZA 2ROLA 4AFUC 2DL7A 1JU5C 1SPKA 2CUDA 1OEBA 4H1OA 1P13A 2OI3A 4NWGA 4E68A 1QG1E 2L2PA 1WDXA 2AKKA 2KT1A 4CC2A 1O49A 2JMAA 1Y1UA 4J9FA 5EHPA 2D8HA 2BZYA 2JT4A 1BHHB 3N84A 4AFSC 1YVHA 1NLPC 2EKXA 3A98A 2EVRA 1NZLA 1ZX6A 2PLEA 2RPNA 3PS5A 1OPLA 2MK2A 2FEIA 1U06A 2YSQA 1RJAA 1FMKA 2EO6A 1QCFA 1WIEA 5DF6A 2CDTA 1UG1A 1O4EA 2AOBA 2L6KA 2M0YA 2YSXA 2C0IA 1T0JA 4GLMA 2MOXA 4AG1C 1O45A 2DLZA 3RNJA 2DM0A 5IXBA 2KT8A 2VIFA 1ZUKA 4F17A 1SRLA 4ORZA 1O4AA 2JM8A 5J3XA 1SKJA 1AYBA 2EGCA 3I5RA 4K11A 5EG3B 2O2OA 1RQQC 2YDLA 5EHRA 1TUCA 1Y57A 2KROA 2GSBA 1R1QA 2LZ6B 1RUWA 1AZEA 1FBVA 1YVLA 1BBZA 1WXBA 1UGVA 2KNOA 2JMCA 2FG0A 3KFJA 1WLPB 3GBQA 1YP5A 2JW4A 1X6BA 1O42A 2DRMA 3TL0A 3VROA 5D0JA 1PHTA 2HSPA 1UHCA 2RNAA 5FW9A 1JWOA 2FO0A 1W6XA 4OMOA 1M27C 2EYVA 2F2WA 2YUPA 3EHRA 2LMJA 2FPFA 1A81A 3OB1B 3US4A 1UJYA 1OPKA 2GTOA 2KXCA 3UF4A 1BHHA 1AWWA 1O4MA 2W10A 1QWFA 4RTVA 4E93A 1LUNA 3BUMB 1AB2A 2KNBB 1UJ0A 2LNWA 2AZVA 1O4FA 3QWXX 5BO4A 1B47A 1D4TA 3MAZA 1QKWA 1OOTA 1HD3A 2JS0A 4OMQA 2LQNA 4OMNA 5HKYA 1A08A 1UURA 5L23A 2LJ1A 2AZSA 1BMBA 3K2MA 3IN7A 3MXYA 3VRQA 2OJ2A 2LJ0A 2PNAA 2RQTA 1BM2A 1E6HA 1UE9A 1ARKA 1Z9QA 4GL9E 3VS3A 3H0IA 1LCJA 1RLQC 2RVFA 2AKLA 4J9IA 3I35A 3T04A 3EG3A 1SHDA 3PVQA 3VRNA 4IIOA 2MRJA 2V1RA 1UUSA 3H0HA 1X0NA 4JGHA 1NZVA 2O9SA 2EW3A 1VYVA 2EYXA 2HBWA 4RUGA 3VRZA 3ULRB 4LN2A 1H9OA 1MILA 1O4IA 2RSYA 1WI7A 2Y1NA 3S8OA 1MUZA 1SEMA 2V1QA 4J9GA 4AFQC 2LCTA 2CREA 2NUZA 2EL8A 4R0KA 2RQVA 5DC0B 5DC4A 2XMFA 3PJPA 3PVLA 2CSIA 4KRTA 2FRYA 2A28A 4OMPA 2D8JA 3OVEA 4F5AA 1SHBA 1NEBA 2KK6A 4K45A 2CH4W 1JYRA 3VS4A 2PNIA 1BKMA 1KJWA 3OP0A 1ZUYA 2RMXA 1TCEA 4HVVA 1IO6A 1ZBJA 4GBQA 1AVZC 2CSQA 3KFVA 1RPYA 1AD5A 3BKBA 4ZNXA 2O88A 4FBNA 3SHWA 2GBQA 3VRYA 2EKHA 1M3CA 1CWDL 1BB9A 1UHFA 2OQ1A 2DF6A 1ZUUA 1GHUA 2C0OA 3VS5A 3LH5A 1JYQA 4D8KA 4RTYA 1X2KA 1O43A 4JEGA 4F5BA 1F2FA 3O5ZA 5IHNA 2YUNA 3TVTA 1FU6A 2KE9A 2DE0X 1M30A 2G6FX 2NWMA 3BUXB 1T3LA 2HUWA 1CKAA 2IIMA 1ABQA 1QLYA 3QWYA 2Y3AB 2K7AA 1JEGA 1W70A 2MRKA 3VS6A 1UDLA 3H41A 1A09A 4OHDA 5IBMA 2PZ1A 4HCKA 4OMLA 1HJDA 1O4RA 1GCQA 2LCSA 2KRSA 2EQIA 3NMZC 3EG1A 5FWBA 4RTTA 2FPEA 2D1XA 1GCQC 2B86A 2GTJA 3EG0A 1D1ZA 3M0RA 1K76A 1G83A 5GJIA 2EGEA 3UATA 1RI9A 3IMDA 3NGPA 4CC3A 3M0UA 1OO4A 1JXOA 4XZ1A 1HCSB 2ESWA 2IUIA 1M8MA 3CQTA 1O4LA 1WQUA 3PFVA 2O9VA 4IIMA 2K6DA 3FJ5A 4J9CA 3M0PA 5GJWB 1NLOC 3TSZA 3MXCA 4RTZA 1M27A 1NEGA 1O44A 1ZFPE 3HIZB 1XA6A 1LKLA 1A1EA 2KYBA 4OHHA 1FHSA 2BBUA 1I07A 2JM9A 1PKSA 2J06A 2LP5A 1OV3A 1MW4A 5IBSA 2M51A 1GFDA 2FPDA 4X6SA 1KFZA 1UUEA 2CT3A 4Y92A 5IHIA 4DEYA 2ENMA 5FWCA 5ECAA 2DLYA 2FCIA 1W1FA 4A63B 2J05A 3VS7A 4CC7A 3H0FA 1X69A 1O4BA 1GCPA 2KRMA 3REAB 1QKXA 5I22A 1KA6A 2JYQA 1VYUA 1A0NB 2RMOA 4Z88A 4EY0A 2OZOA 4DGPA 4M4ZA 4K44A 4P9ZA 3WA4A 1O4JA 1CKBA 3REBB 3VS0A 1IS0A 1QWEA 2DLPA 2L4KA 2EYWA 1OO3A 1WXTA 3SEMA 1AYCA 3CD3A 2IZVA 2KXDA 1WYXA 3PE0A 2DYBA 2K3BA 1K9AA 2LNHB 1TUDA 1JXMA 2QMSA 1QADA 1WA7A 1WXUA 3VRPA 1AWXA 4E6RA 1F1WA 4DEXA 2ECDA 4EIKA 1RLPC 2EPDA 2JS2A 3CXLA 3UYOA 4F16A 1G2BA 4RTUA 4GWFA 2DX0A 1KIKA 5HKWA 2HMHA 3BUOB 4K2RA 1CSKA 1YN8A 1V1CA 4JJCA 1KA7A 3M7FA 1GL5A 3NHNA 1AZGB 1YWOA 2K7AB 1JO8A 1U5SA 1K0XA 5KAZA 2W0ZA 3R6NA 2RORA 4JZ4A 1O4GA 2K2MA 1K0SA 1BLKA 3M0TA 4U17A 2YT6A 4HVUA 2A08A 4D8DA 1ABOA 2YUOA 2MC1A 2MCNA 2P4RA 3M0SA 5EC7A 3N7YA 3JV3A 1H92A 1A1BA 5DC9A 2EO3A 1YWPA 1TG0A 1WX6A 2CH4A 2PLDA 2FRWA 2KYMA 2BTTA 1T0HA 1AOJA 1LCKA 2PNBA 2LQWA 3EAZA 4EIHA 1HSQA 2X3XD 1O41A 1S1NA 1JYUA 1M61A 2LX7A 3THKA 2AOAA 4LUEA 1VA7A 3RBBB 5IH2A 1M3BA 1A1CA 4A4CA 1B3QA 3EGUA 2GE9A 2D0NA 1EFNA 4RTXA 2Y1MA 3IMJA 3C0CA 2CT4A 1AOUF 2DNUA 2OAWA 1K1ZA 4WCIA 2J6KA 4FL2A 1I3ZA 2K79A 3HCKA 3PQZA 1BF5A 4OMMA 5EELA 2MQIA 3U23A 1MV3A 2J6FA 1GFCA 2HCKA 1R1SA 4HVWA 3EG2A 2HDVA 1E6GA 4F14A 1AEYA 2RQWA 1JQQA 1FU5A 1Z3KA 5GJVB 2DVJA 3I9QA 3PLFB 3S8NA 5I11A 2H8HA 2DBKA 4NWFA 2JTEA 3ZNIA 1BFIA 1BFJA 4RTWA 1X6GA 3OB2B 2RQUA 2XP1A 2F2VA 1AYDA 2DCRA 2J6OA 2DBMA 5HCKA 4A4BA 2LJ3A 2SRCA 2L3SA 2CBLA 1VYTA 4LE9A 2DM1A 2RF0A 2IUGA 1SHGA 1M3AA 1CJ1A 1AYAA 2SHPA 2CI9A 2HDAA 1KC2A 4P9VA 2VKNA 1D4WA 2DRKA 1AWJA 1NRVA 2CI8A 1BU1A 3I5SA 3UA6A 1SHFA 2A36A 1UECA 1SSHA 3EACA 3UA7A 1BHFA 4FSSA 3PSKA 2DL8A 5I6VA 2DJQA 1T3SA 2BZXA 1PRMC 4Z89A 1X6CA 1KSWA 2EOBA 2JXBA 2ROTA 3HHMB 1PKTA 1H8KA 2VVKA 2RN8A 1SPSA 3BUWB 2A37A 1FYRA 1LUIA 4U1PA 2H5KA 1O46A 4JJDA 2PTKA 2L3QA 2I0NA 2L0AA 2AUGA 2K9GA 1PWTA 5IXFA 1NM7A 3GXWA 1E7OA 1GRIA 1N5ZA 2EYZA 3GQIB 1Y0MA 1LKKA 4AG2C 1LUKA 4ROJA 2DA9A 1ZSGA 2KEAA 4JZ3A 1UFFA 2DILA 4LUDA 1O4CA 4J9HA 1TZEE 4ESRA 2SEMA 2E5KA 2MIOA 2CR4A 2CUBA 1H3HA 4HXJA 1AOTF 1FBZA 2J7IA 1XOVA 4LNPA 2LNXA 1NYGA 1J3TA 4Z8AA 1FYNA 3NPFA 3VS2A 2L3PA 2RQRA 4X1VA 1AWOA 1BG1A 2ED1A 1PNJA 4CC4B 1CWEA 2AK5A 2C9WA 2H46E 1UTIA 4J9DA 2K79B 3VGOA 3VRRA 4F59A 1IJRA 5IHKA 2CS0A 3OV1A 1NG2A 1BK2A 1O47A 4QSYA 5HKZA 3GXXA 2EYYA 5GJHA 1O4NA 2HDXA 2CRHA 2EU0A 1BKLA 4XZ0A 2IUHA 1GBRA 2KGTA 2CIAA 4DGXA 4JJBA 4H34A 4J9BA 2BZ8A 2DMOA 1LUMA 1NYFA 2VWFA 4JE4A 2GGRA 3N8MA 2X3WD 1SHAA 1SRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  1PIC A;  1MV0 B;  3VS1 A;  3S8L A;  1I1J A;  1SPR A;  4TZI A;  4QT7 A;  2EBP A;  1K4U S;  2ETZ A;  3C7I A;  2KBT A;  2DL4 A;  2DX1 A;  4FL3 A;  5CDW A;  1Z9Z A;  1B07 A;  4JPB W;  3TKZ A;  1GBQ A;  1O48 A;  4AFZ C;  5AUL A;  1HCT B;  4L1B B;  2DL3 A;  1WFW A;  1O4K A;  2QDL A;  1I0C A;  2L3T A;  2B3O A;  2F2X A;  1O4P A;  4WWQ A;  1X27 A;  1X43 A;  2HEQ A;  4J9E A;  3EHQ A;  4GPL B;  2ECZ A;  5EEQ A;  1R1P A;  1BLJ A;  1A07 A;  1A1A A;  1PRL C;  1O4O A;  2KR3 A;  3M0Q A;  3PSJ A;  1U3O A;  4OHL A;  1CSY A;  2DL5 A;  3IQL A;  2O31 A;  2YU7 A;  3CWG A;  2ABL A;  2GQI A;  2YUQ A;  3TSW A;  1YNZ A;  2KRN A;  4OHI A;  3S9K A;  3IN8 A;  3ZL7 C;  1YCS B;  4OHE A;  5AXI A;  1JU5 A;  2C0T A;  2EGA A;  1O4H A;  1X2Q A;  3BUN B;  1ZLM A;  3CBL A;  1O4D A;  1O4Q A;  2GNC A;  1CSZ A;  2ROL A;  4AFU C;  2DL7 A;  1JU5 C;  1SPK A;  2CUD A;  1OEB A;  4H1O A;  1P13 A;  2OI3 A;  4NWG A;  4E68 A;  1QG1 E;  2L2P A;  1WDX A;  2AKK A;  2KT1 A;  4CC2 A;  1O49 A;  2JMA A;  1Y1U A;  4J9F A;  5EHP A;  2D8H A;  2BZY A;  2JT4 A;  1BHH B;  3N84 A;  4AFS C;  1YVH A;  1NLP C;  2EKX A;  3A98 A;  2EVR A;  1NZL A;  1ZX6 A;  2PLE A;  2RPN A;  3PS5 A;  1OPL A;  2MK2 A;  2FEI A;  1U06 A;  2YSQ A;  1RJA A;  1FMK A;  2EO6 A;  1QCF A;  1WIE A;  5DF6 A;  2CDT A;  1UG1 A;  1O4E A;  2AOB A;  2L6K A;  2M0Y A;  2YSX A;  2C0I A;  1T0J A;  4GLM A;  2MOX A;  4AG1 C;  1O45 A;  2DLZ A;  3RNJ A;  2DM0 A;  5IXB A;  2KT8 A;  2VIF A;  1ZUK A;  4F17 A;  1SRL A;  4ORZ A;  1O4A A;  2JM8 A;  5J3X A;  1SKJ A;  1AYB A;  2EGC A;  3I5R A;  4K11 A;  5EG3 B;  2O2O A;  1RQQ C;  2YDL A;  5EHR A;  1TUC A;  1Y57 A;  2KRO A;  2GSB A;  1R1Q A;  2LZ6 B;  1RUW A;  1AZE A;  1FBV A;  1YVL A;  1BBZ A;  1WXB A;  1UGV A;  2KNO A;  2JMC A;  2FG0 A;  3KFJ A;  1WLP B;  3GBQ A;  1YP5 A;  2JW4 A;  1X6B A;  1O42 A;  2DRM A;  3TL0 A;  3VRO A;  5D0J A;  1PHT A;  2HSP A;  1UHC A;  2RNA A;  5FW9 A;  1JWO A;  2FO0 A;  1W6X A;  4OMO A;  1M27 C;  2EYV A;  2F2W A;  2YUP A;  3EHR A;  2LMJ A;  2FPF A;  1A81 A;  3OB1 B;  3US4 A;  1UJY A;  1OPK A;  2GTO A;  2KXC A;  3UF4 A;  1BHH A;  1AWW A;  1O4M A;  2W10 A;  1QWF A;  4RTV A;  4E93 A;  1LUN A;  3BUM B;  1AB2 A;  2KNB B;  1UJ0 A;  2LNW A;  2AZV A;  1O4F A;  3QWX X;  5BO4 A;  1B47 A;  1D4T A;  3MAZ A;  1QKW A;  1OOT A;  1HD3 A;  2JS0 A;  4OMQ A;  2LQN A;  4OMN A;  5HKY A;  1A08 A;  1UUR A;  5L23 A;  2LJ1 A;  2AZS A;  1BMB A;  3K2M A;  3IN7 A;  3MXY A;  3VRQ A;  2OJ2 A;  2LJ0 A;  2PNA A;  2RQT A;  1BM2 A;  1E6H A;  1UE9 A;  1ARK A;  1Z9Q A;  4GL9 E;  3VS3 A;  3H0I A;  1LCJ A;  1RLQ C;  2RVF A;  2AKL A;  4J9I A;  3I35 A;  3T04 A;  3EG3 A;  1SHD A;  3PVQ A;  3VRN A;  4IIO A;  2MRJ A;  2V1R A;  1UUS A;  3H0H A;  1X0N A;  4JGH A;  1NZV A;  2O9S A;  2EW3 A;  1VYV A;  2EYX A;  2HBW A;  4RUG A;  3VRZ A;  3ULR B;  4LN2 A;  1H9O A;  1MIL A;  1O4I A;  2RSY A;  1WI7 A;  2Y1N A;  3S8O A;  1MUZ A;  1SEM A;  2V1Q A;  4J9G A;  4AFQ C;  2LCT A;  2CRE A;  2NUZ A;  2EL8 A;  4R0K A;  2RQV A;  5DC0 B;  5DC4 A;  2XMF A;  3PJP A;  3PVL A;  2CSI A;  4KRT A;  2FRY A;  2A28 A;  4OMP A;  2D8J A;  3OVE A;  4F5A A;  1SHB A;  1NEB A;  2KK6 A;  4K45 A;  2CH4 W;  1JYR A;  3VS4 A;  2PNI A;  1BKM A;  1KJW A;  3OP0 A;  1ZUY A;  2RMX A;  1TCE A;  4HVV A;  1IO6 A;  1ZBJ A;  4GBQ A;  1AVZ C;  2CSQ A;  3KFV A;  1RPY A;  1AD5 A;  3BKB A;  4ZNX A;  2O88 A;  4FBN A;  3SHW A;  2GBQ A;  3VRY A;  2EKH A;  1M3C A;  1CWD L;  1BB9 A;  1UHF A;  2OQ1 A;  2DF6 A;  1ZUU A;  1GHU A;  2C0O A;  3VS5 A;  3LH5 A;  1JYQ A;  4D8K A;  4RTY A;  1X2K A;  1O43 A;  4JEG A;  4F5B A;  1F2F A;  3O5Z A;  5IHN A;  2YUN A;  3TVT A;  1FU6 A;  2KE9 A;  2DE0 X;  1M30 A;  2G6F X;  2NWM A;  3BUX B;  1T3L A;  2HUW A;  1CKA A;  2IIM A;  1ABQ A;  1QLY A;  3QWY A;  2Y3A B;  2K7A A;  1JEG A;  1W70 A;  2MRK A;  3VS6 A;  1UDL A;  3H41 A;  1A09 A;  4OHD A;  5IBM A;  2PZ1 A;  4HCK A;  4OML A;  1HJD A;  1O4R A;  1GCQ A;  2LCS A;  2KRS A;  2EQI A;  3NMZ C;  3EG1 A;  5FWB A;  4RTT A;  2FPE A;  2D1X A;  1GCQ C;  2B86 A;  2GTJ A;  3EG0 A;  1D1Z A;  3M0R A;  1K76 A;  1G83 A;  5GJI A;  2EGE A;  3UAT A;  1RI9 A;  3IMD A;  3NGP A;  4CC3 A;  3M0U A;  1OO4 A;  1JXO A;  4XZ1 A;  1HCS B;  2ESW A;  2IUI A;  1M8M A;  3CQT A;  1O4L A;  1WQU A;  3PFV A;  2O9V A;  4IIM A;  2K6D A;  3FJ5 A;  4J9C A;  3M0P A;  5GJW B;  1NLO C;  3TSZ A;  3MXC A;  4RTZ A;  1M27 A;  1NEG A;  1O44 A;  1ZFP E;  3HIZ B;  1XA6 A;  1LKL A;  1A1E A;  2KYB A;  4OHH A;  1FHS A;  2BBU A;  1I07 A;  2JM9 A;  1PKS A;  2J06 A;  2LP5 A;  1OV3 A;  1MW4 A;  5IBS A;  2M51 A;  1GFD A;  2FPD A;  4X6S A;  1KFZ A;  1UUE A;  2CT3 A;  4Y92 A;  5IHI A;  4DEY A;  2ENM A;  5FWC A;  5ECA A;  2DLY A;  2FCI A;  1W1F A;  4A63 B;  2J05 A;  3VS7 A;  4CC7 A;  3H0F A;  1X69 A;  1O4B A;  1GCP A;  2KRM A;  3REA B;  1QKX A;  5I22 A;  1KA6 A;  2JYQ A;  1VYU A;  1A0N B;  2RMO A;  4Z88 A;  4EY0 A;  2OZO A;  4DGP A;  4M4Z A;  4K44 A;  4P9Z A;  3WA4 A;  1O4J A;  1CKB A;  3REB B;  3VS0 A;  1IS0 A;  1QWE A;  2DLP A;  2L4K A;  2EYW A;  1OO3 A;  1WXT A;  3SEM A;  1AYC A;  3CD3 A;  2IZV A;  2KXD A;  1WYX A;  3PE0 A;  2DYB A;  2K3B A;  1K9A A;  2LNH B;  1TUD A;  1JXM A;  2QMS A;  1QAD A;  1WA7 A;  1WXU A;  3VRP A;  1AWX A;  4E6R A;  1F1W A;  4DEX A;  2ECD A;  4EIK A;  1RLP C;  2EPD A;  2JS2 A;  3CXL A;  3UYO A;  4F16 A;  1G2B A;  4RTU A;  4GWF A;  2DX0 A;  1KIK A;  5HKW A;  2HMH A;  3BUO B;  4K2R A;  1CSK A;  1YN8 A;  1V1C A;  4JJC A;  1KA7 A;  3M7F A;  1GL5 A;  3NHN A;  1AZG B;  1YWO A;  2K7A B;  1JO8 A;  1U5S A;  1K0X A;  5KAZ A;  2W0Z A;  3R6N A;  2ROR A;  4JZ4 A;  1O4G A;  2K2M A;  1K0S A;  1BLK A;  3M0T A;  4U17 A;  2YT6 A;  4HVU A;  2A08 A;  4D8D A;  1ABO A;  2YUO A;  2MC1 A;  2MCN A;  2P4R A;  3M0S A;  5EC7 A;  3N7Y A;  3JV3 A;  1H92 A;  1A1B A;  5DC9 A;  2EO3 A;  1YWP A;  1TG0 A;  1WX6 A;  2CH4 A;  2PLD A;  2FRW A;  2KYM A;  2BTT A;  1T0H A;  1AOJ A;  1LCK A;  2PNB A;  2LQW A;  3EAZ A;  4EIH A;  1HSQ A;  2X3X D;  1O41 A;  1S1N A;  1JYU A;  1M61 A;  2LX7 A;  3THK A;  2AOA A;  4LUE A;  1VA7 A;  3RBB B;  5IH2 A;  1M3B A;  1A1C A;  4A4C A;  1B3Q A;  3EGU A;  2GE9 A;  2D0N A;  1EFN A;  4RTX A;  2Y1M A;  3IMJ A;  3C0C A;  2CT4 A;  1AOU F;  2DNU A;  2OAW A;  1K1Z A;  4WCI A;  2J6K A;  4FL2 A;  1I3Z A;  2K79 A;  3HCK A;  3PQZ A;  1BF5 A;  4OMM A;  5EEL A;  2MQI A;  3U23 A;  1MV3 A;  2J6F A;  1GFC A;  2HCK A;  1R1S A;  4HVW A;  3EG2 A;  2HDV A;  1E6G A;  4F14 A;  1AEY A;  2RQW A;  1JQQ A;  1FU5 A;  1Z3K A;  5GJV B;  2DVJ A;  3I9Q A;  3PLF B;  3S8N A;  5I11 A;  2H8H A;  2DBK A;  4NWF A;  2JTE A;  3ZNI A;  1BFI A;  1BFJ A;  4RTW A;  1X6G A;  3OB2 B;  2RQU A;  2XP1 A;  2F2V A;  1AYD A;  2DCR A;  2J6O A;  2DBM A;  5HCK A;  4A4B A;  2LJ3 A;  2SRC A;  2L3S A;  2CBL A;  1VYT A;  4LE9 A;  2DM1 A;  2RF0 A;  2IUG A;  1SHG A;  1M3A A;  1CJ1 A;  1AYA A;  2SHP A;  2CI9 A;  2HDA A;  1KC2 A;  4P9V A;  2VKN A;  1D4W A;  2DRK A;  1AWJ A;  1NRV A;  2CI8 A;  1BU1 A;  3I5S A;  3UA6 A;  1SHF A;  2A36 A;  1UEC A;  1SSH A;  3EAC A;  3UA7 A;  1BHF A;  4FSS A;  3PSK A;  2DL8 A;  5I6V A;  2DJQ A;  1T3S A;  2BZX A;  1PRM C;  4Z89 A;  1X6C A;  1KSW A;  2EOB A;  2JXB A;  2ROT A;  3HHM B;  1PKT A;  1H8K A;  2VVK A;  2RN8 A;  1SPS A;  3BUW B;  2A37 A;  1FYR A;  1LUI A;  4U1P A;  2H5K A;  1O46 A;  4JJD A;  2PTK A;  2L3Q A;  2I0N A;  2L0A A;  2AUG A;  2K9G A;  1PWT A;  5IXF A;  1NM7 A;  3GXW A;  1E7O A;  1GRI A;  1N5Z A;  2EYZ A;  3GQI B;  1Y0M A;  1LKK A;  4AG2 C;  1LUK A;  4ROJ A;  2DA9 A;  1ZSG A;  2KEA A;  4JZ3 A;  1UFF A;  2DIL A;  4LUD A;  1O4C A;  4J9H A;  1TZE E;  4ESR A;  2SEM A;  2E5K A;  2MIO A;  2CR4 A;  2CUB A;  1H3H A;  4HXJ A;  1AOT F;  1FBZ A;  2J7I A;  1XOV A;  4LNP A;  2LNX A;  1NYG A;  1J3T A;  4Z8A A;  1FYN A;  3NPF A;  3VS2 A;  2L3P A;  2RQR A;  4X1V A;  1AWO A;  1BG1 A;  2ED1 A;  1PNJ A;  4CC4 B;  1CWE A;  2AK5 A;  2C9W A;  2H46 E;  1UTI A;  4J9D A;  2K79 B;  3VGO A;  3VRR A;  4F59 A;  1IJR A;  5IHK A;  2CS0 A;  3OV1 A;  1NG2 A;  1BK2 A;  1O47 A;  4QSY A;  5HKZ A;  3GXX A;  2EYY A;  5GJH A;  1O4N A;  2HDX A;  2CRH A;  2EU0 A;  1BKL A;  4XZ0 A;  2IUH A;  1GBR A;  2KGT A;  2CIA A;  4DGX A;  4JJB A;  4H34 A;  4J9B A;  2BZ8 A;  2DMO A;  1LUM A;  1NYF A;  2VWF A;  4JE4 A;  2GGR A;  3N8M A;  2X3W D;  1SHA A;  1SRM A; 
#chains in the Genus database with same CATH topology
 3QPH A;  1NJI C;  2EIF A;  3VS1 A;  2E3H A;  2CKK A;  3H8Z A;  3OMG A;  5FRM A;  3C7I A;  4DBQ A;  3C4S A;  4FL3 A;  3SD4 A;  1RAE B;  3J80 E;  2X4W A;  4HCB A;  3TKZ A;  1O48 A;  4A4G A;  3H9N A;  1WFW A;  1I0C A;  2QA4 A;  4NL3 A;  2L3T A;  2B3O A;  1O4P A;  5CKH A;  4WWQ A;  1VQ5 T;  1BIA A;  1KD1 C;  5EEQ A;  3OYN A;  5KE2 A;  1A07 A;  1PRL C;  1F1B B;  1VQ8 A;  3RKY A;  1CSY A;  1DJ7 B;  2O31 A;  4LDX A;  3OYJ A;  2XIC A;  3E2U A;  2YUQ A;  2HQH A;  3CC2 Q;  2HKN A;  4CI0 C;  2LCL A;  5KYU B;  3RKX A;  5AXI A;  2C0T A;  3PIO A;  1M90 C;  3CBL A;  2AIR B;  3EFS A;  1CSZ A;  4XU0 A;  3JB9 H;  1SPK A;  3OY9 A;  4E68 A;  1Y1U A;  1ACM B;  2JJ9 A;  2QGF B;  1YJN A;  1YVH A;  3A98 A;  1ZX6 A;  3PS5 A;  6AT1 B;  1U06 A;  3GNF B;  4B9X A;  2EO6 A;  1WIE A;  5DF6 A;  1IHV A;  5GAO n;  3QDR B;  1O4E A;  5GAO q;  4IUU A;  2YSX A;  2C0I A;  4C92 F;  1XNI A;  1PSE A;  3CCL A;  4QVZ A;  3RNJ A;  2JNG A;  4M75 F;  1K9M R;  1SKJ A;  3BE3 A;  1AYB A;  2R5M A;  3I55 Q;  3MEU A;  2O2O A;  2YDL A;  1Y57 A;  2GSB A;  1EIF A;  2YRV A;  1YIJ Q;  3X26 B;  1YVL A;  1K9M U;  1WXB A;  2HAX A;  1M1G A;  2YWW A;  4B9W A;  3GBQ A;  2JW4 A;  3VJP A;  3TEE A;  1RL2 A;  3CCQ Q;  2QDY B;  2F2W A;  2IG0 A;  1UGS B;  3OB1 B;  3Q1J A;  4JRI A;  1LUN A;  2CZ0 B;  3EGD B;  2KNB B;  4FT4 A;  2AZV A;  2MYS A;  1O4F A;  3QWX X;  5BO4 A;  4N0A A;  3GOX A;  2XK0 A;  1D4T A;  1OU8 A;  1OOT A;  4OMQ A;  4OMN A;  1WPY A;  4PNO A;  1A08 A;  1ZSZ C;  2EJ9 A;  2B8A A;  2LJ1 A;  1UGP B;  3JCM V;  1KQS A;  3K2M A;  2A0F B;  1SF9 A;  1NPP A;  1EZZ B;  2LJ0 A;  1OYX A;  1N27 A;  2GCX A;  3CCV T;  1BM2 A;  2K57 A;  4ZGJ B;  3OW2 P;  3VS3 A;  1LCJ A;  5LJ3 e;  5FRO A;  1RLQ C;  4J9I A;  3URG A;  2DIG A;  3JCM b;  1GXI E;  4FCY A;  3EG3 A;  3C94 A;  4BI8 B;  2Z0W A;  3H0H A;  5DM7 R;  1B34 B;  2YLB A;  1X0N A;  3VYH B;  1VYV A;  2OX7 A;  2RSY A;  2Y1N A;  3D7S B;  2VXF A;  4QQD A;  4J9G A;  2CRE A;  2NUZ A;  1PCX A;  4PJO F;  2P0Q A;  2CSI A;  2QEX Q;  2FRY A;  1VQ7 Q;  2A28 A;  4OMP A;  4E2F B;  2CH4 W;  3FC3 A;  2COZ A;  1BI1 A;  2AT1 B;  2XD0 A;  4HVV A;  1IO6 A;  2CSQ A;  5DLQ E;  2ZPI B;  5LJ3 f;  1RI0 A;  3VRY A;  1CWD L;  2OQ1 A;  2DF6 A;  1VQ9 Q;  3FJP A;  4C5H A;  1GHU A;  2C0O A;  1VQ4 A;  1I4K 1;  3CCE A;  1VIE A;  1FU6 A;  1M30 A;  2RH2 A;  1VQK T;  1ABQ A;  4EMG A;  2BIV A;  1QP3 A;  2MRK A;  4DBH A;  1UDL A;  3G6E Q;  3EGX B;  2ATC B;  1O4R A;  1M2V B;  2KRS A;  2M9U A;  2EQI A;  3NMZ C;  4M78 C;  3EG0 A;  2B86 A;  4R56 A;  1K76 A;  1G83 A;  2RD1 A;  5GJI A;  2M02 A;  3V8J A;  2DVE A;  3NGP A;  1BI2 A;  2KK4 A;  4J7F A;  1OO4 A;  1KG1 A;  4XZ1 A;  1HCS B;  3CQT A;  4L59 A;  1WQU A;  2QGG A;  3FJ5 A;  4KT0 E;  5CKD A;  2FZC B;  3M55 A;  2JTM A;  4QKU A;  1NLO C;  1O44 A;  5IAY A;  1XA6 A;  4QVD A;  3E9G A;  1A1E A;  4EPC A;  2QYZ A;  1I07 A;  1RAG B;  5IBS A;  2M51 A;  2NUT A;  3QII A;  2P0P A;  4XU2 A;  1JJ2 P;  1VQO A;  1VQ6 A;  2YLC A;  5GAN 8;  4IKF A;  3H0F A;  1O4B A;  2JYQ A;  1VYU A;  4EMH A;  3EGX A;  4ATO A;  2RMO A;  4EY0 A;  4Y28 E;  3G1J A;  1M2V A;  3A5Z B;  2EQJ A;  4P9Z A;  1CKB A;  1QWE A;  3FB9 A;  2L4K A;  1AYC A;  1PD1 A;  1YI2 Q;  3RDV A;  1WYX A;  2ZZD A;  1MMN A;  2K3B A;  2XG8 D;  4E6R A;  1F1W A;  1OX9 A;  5FU6 C;  1RLP C;  2EQK A;  3UYO A;  3NTI A;  4F16 A;  4RTU A;  2GQV A;  1KQS S;  1YN8 A;  4JJC A;  1KA7 A;  3CME Q;  1K9M C;  1VQ8 T;  1JO8 A;  1U5S A;  1KQ2 A;  1K0X A;  3R6N A;  5KYW B;  4PJO C;  2COY A;  2OAU A;  2RHY A;  3QYH B;  1BLK A;  1D3B B;  2YT6 A;  2YUO A;  3ASK A;  4DOV A;  2F5T X;  1YJ9 A;  3M0S A;  3GP8 A;  1H92 A;  1YWP A;  2FRW A;  2KYM A;  5A0G A;  3FLG A;  3CPF A;  1HSQ A;  2L3R A;  5EG2 A;  1JYU A;  5LJ3 g;  1M61 A;  1FWZ A;  3THK A;  2AOA A;  4LUE A;  2QQ9 A;  3C12 A;  4RTX A;  2Y1M A;  3IMJ A;  2K5F A;  2CT4 A;  2DNU A;  1K1Z A;  3CPW A;  4C0Z A;  3HCK A;  3M53 A;  3VKI A;  4Q5W A;  1MV3 A;  4EMK C;  4HVW A;  3EG2 A;  2HDV A;  2YHT A;  3CCL T;  1JQQ A;  5GMK i;  2XDD A;  3I9Q A;  1VQ5 A;  3PLF B;  5I11 A;  2H8H A;  2LTO A;  1BFI A;  4P5N A;  5KYW A;  1BFJ A;  4RTW A;  3OB2 B;  2DBM A;  2HL5 C;  1S72 T;  1D1A A;  1VYT A;  4BI4 A;  1SHG A;  2QQR A;  2JOY A;  2VC8 A;  3OW2 A;  2DAQ A;  1KC2 A;  4C8Q G;  1AWJ A;  3TQ7 P;  2M16 A;  1NRV A;  4XTW A;  3PMT A;  4J6W A;  3G71 T;  1UEC A;  3OB9 A;  3UA7 A;  5I6V A;  3PSK A;  2DL8 A;  2DJQ A;  1BYM A;  4M77 G;  4L5G A;  4KGX B;  2ROT A;  3MEV A;  4RKU E;  1K73 R;  4JJN K;  3HHM B;  3QXE B;  1PKT A;  2QAS A;  3BUW B;  2H5K A;  4M77 E;  4JJD A;  4OGC A;  1K73 U;  2L3Q A;  4BE1 A;  5HK3 A;  7AT1 B;  2RI3 A;  2EJF A;  2HL3 A;  1N9R A;  3OA6 A;  2EYZ A;  4LDW A;  1LKK A;  3RKW A;  2KEA A;  1UFF A;  2DIL A;  3CD6 T;  4ESR A;  3MKD A;  2VGM A;  3DB4 A;  2PVO B;  1AOT F;  1FBZ A;  2R5A A;  5I2S A;  4LNP A;  1NYG A;  1FYN A;  4E7H A;  2NLU A;  2VUB A;  3H6Z A;  3VS2 A;  2ED1 A;  1PNJ A;  2X4J A;  4BB7 A;  2AK5 A;  3EFO B;  4CC4 B;  2X9H A;  3VRR A;  2CS0 A;  2XHC A;  3L2U A;  2RB6 A;  1O4N A;  2EU0 A;  3VU3 C;  1GBR A;  4XTY A;  3LWH A;  4JJB A;  3CCE Q;  3FEO A;  4F7U E;  2BZ8 A;  1MND A;  3KUF A;  2DXT A;  4JE4 A;  2GGR A;  4K45 A;  1TS9 A;  2ED0 A;  3LYI A;  3JCM e;  3S8L A;  5GAN 2;  4TZI A;  5M9O A;  2RJE A;  4QT7 A;  4J8O A;  2EBP A;  2ETZ A;  3RMS A;  2K4Y A;  4LD9 K;  5GMK h;  1B07 A;  2MMP A;  1GBQ A;  4M77 B;  1TOV A;  1VQP Q;  3CCV A;  4FT2 A;  1IGU A;  2QDL A;  4FYX B;  4EDU A;  1YHQ Q;  3JCM c;  2F2X A;  2KQW A;  3MET A;  1Y96 B;  1JJ2 A;  1X27 A;  1X43 A;  4PFO A;  3EFO A;  4M7A C;  2KR3 A;  3M0Q A;  3PSJ A;  2DER A;  1QCO A;  1LJO A;  3IQL A;  2D0Q B;  3TSW A;  2HZY A;  1SG5 A;  1H3Z A;  1YNZ A;  3IN8 A;  3ZL7 C;  1VQO Q;  1YCS B;  1QVF P;  2EGA A;  1O4H A;  2E64 A;  1O4Q A;  2HNI A;  4C0F A;  2ROL A;  4AFU C;  1JU5 C;  4H1O A;  2E70 A;  5GAM e;  2AKK A;  1WDX A;  3DLL A;  2KT1 A;  1O49 A;  3S3M A;  4DBR A;  4J9F A;  5EHP A;  1IZ6 A;  2HKQ B;  2JT4 A;  1YJW T;  4AFS C;  1NLP C;  1NZL A;  2RK2 A;  2RPN A;  1OPL A;  2JN0 A;  2FEI A;  2XU8 A;  2YSQ A;  4MZP A;  1RJA A;  1FMK A;  4RG8 A;  3OW2 S;  1FMV A;  5A2Q E;  3BY7 A;  1V29 B;  2M0Y A;  1N8R R;  4ZN3 A;  3OSV A;  1T0J A;  2DM0 A;  2DLZ A;  4BUG A;  3HRT A;  2VIF A;  1SRL A;  2JM8 A;  1N8R U;  3M9Q A;  2EGC A;  5EG3 B;  4K11 A;  4A4H A;  1RQQ C;  4A4F A;  5EHR A;  3CCR Q;  2XDP A;  3HFO A;  3CCJ Q;  2LZ6 B;  1FBV A;  5GAM f;  1O9S A;  3KFJ A;  2FG0 A;  1MNE A;  4C8Q F;  2M0O A;  1PHT A;  5CVI A;  2HSP A;  1UHC A;  3M56 A;  1W6X A;  1Q95 G;  2EYV A;  3MO8 A;  3QO3 A;  4M77 F;  2F5K A;  2LMJ A;  4F7U A;  3CCS A;  1P92 A;  1A81 A;  3QKJ A;  4M7D C;  4FYY B;  1UJY A;  1OPK A;  4KUI A;  1QWF A;  4ME7 A;  2DD5 A;  4Z02 A;  4E7I A;  4E93 A;  4N4H A;  2OTL A;  1UJ0 A;  4JUV A;  2YRC A;  5D6W A;  2BUD A;  3UDC A;  1WHJ A;  5GAN 4;  3M54 A;  2LQN A;  5HKY A;  3M4Y A;  3JCM Q;  1TUG B;  2MWO A;  2P4T A;  5L23 A;  2DTI A;  2AZS A;  4HT9 A;  1BMB A;  3BDU A;  2Y4Y A;  4C0G A;  2DD4 A;  2RQT A;  5LJ5 e;  3CC7 Q;  1K73 C;  4N4G A;  4L6V 5;  2GFU A;  4MDW A;  2PQW A;  3QHS A;  1OUL A;  3PVQ A;  3VRN A;  4IIO A;  1UUS A;  3QSU A;  3L2Q A;  2XKO C;  3S3O A;  1O75 A;  2O9S A;  2NYS A;  3VRZ A;  2EYX A;  3ULR B;  3CC4 T;  1G3Y A;  3S8O A;  1MUZ A;  2V1Q A;  5GAO m;  4R0K A;  1BCM A;  2WSE E;  5A0D A;  2L5Q A;  3PJP A;  2D8J A;  3OVE A;  4F5A A;  1SHB A;  1NEB A;  5LJ3 h;  4LD6 A;  3JCM g;  3QDF A;  5CAI A;  3QYG B;  1JJ2 S;  4XTV A;  3OP0 A;  1D0Z A;  3SFM A;  2RMX A;  2OTJ T;  1TCE A;  1RPY A;  4PJL A;  1Q86 R;  3LH0 A;  4ZNX A;  1WHH A;  1OI1 A;  2O88 A;  2E1H A;  3L1A A;  3I56 A;  1UEB A;  2GBQ A;  4II1 A;  2ZPF B;  3G4S T;  1UHF A;  8AT1 B;  4RCC A;  4X9D A;  4ANJ A;  2E4H A;  3VS5 A;  1VOM A;  4D8K A;  1Q86 U;  1F2F A;  1JBM A;  4C5G A;  3BUX B;  2X51 A;  2IIM A;  2HQE A;  2K7A A;  1QVP A;  3DB3 A;  2E6N A;  1BCO A;  3H41 A;  4OHD A;  2PZ1 A;  4HCK A;  2VAS A;  3MP6 A;  1UGQ B;  2LCS A;  1VQM Q;  1BI0 A;  1Q7Y R;  1TU0 B;  2FPE A;  4N4I A;  2GTJ A;  1GCQ C;  2F1L A;  3M0R A;  2JZ2 A;  5CCA A;  2EGE A;  4A4K A;  1I5L A;  3MCA B;  4CC3 A;  3IMD A;  1Q7Y U;  1JXO A;  3P8H A;  1QVG P;  1M8M A;  4C8Q C;  5LJ3 j;  3CC2 T;  3PFV A;  2K6D A;  2H3E B;  1D0X A;  2GF7 A;  5GAM g;  3RR6 A;  1EX4 A;  4X34 A;  1S72 A;  3M0P A;  4XK8 E;  3S3N A;  3CMA T;  3FDR A;  1M27 A;  1NEG A;  3HIZ B;  4KGZ B;  3HSB A;  3SWN C;  3G71 A;  4QW2 A;  1GFD A;  4JS5 A;  3GLX A;  3CCU A;  2CT3 A;  4DEY A;  2ENM A;  3OSS C;  5FWC A;  3P8B B;  4M78 D;  2J05 A;  2LQK A;  2WAC A;  2MI6 A;  2IVW A;  1GCP A;  1KA6 A;  2E3I A;  2XI9 A;  4Z88 A;  3VYG A;  5GAM d;  2OZO A;  2DEQ A;  4M4Z A;  1G5V A;  5FLX E;  1IS0 A;  2DLP A;  4ELZ C;  2EYW A;  1VQN A;  2QQA A;  3RUX A;  2IZV A;  2KXD A;  3ZBD A;  3OMC A;  1OU9 A;  1TUD A;  3X25 B;  3CBP A;  1WA7 A;  1WXU A;  5HKC A;  4DEX A;  3CD6 A;  4EIK A;  2EPD A;  1N8R C;  8ATC B;  5CKB A;  5HKW A;  2HMH A;  4DA4 A;  2MF2 A;  3TU4 K;  3M7F A;  3OS0 A;  1GL5 A;  4IUP A;  1U1T A;  5KAZ A;  1TXQ A;  2MAM A;  4J83 A;  5GAO l;  3JRZ A;  3OYC A;  1O4G A;  4UC4 A;  5CIU A;  4TVR A;  3ZEH A;  4E7Z A;  3JV3 A;  1A1B A;  5DC9 A;  2CH4 A;  2FZG B;  3BFM A;  2DJZ A;  1YBY A;  2BTT A;  1VQK Q;  3VUZ A;  2ZPB B;  4EIH A;  1QCN A;  1VQL Q;  1R0B G;  3S6W A;  1S1N A;  2LX7 A;  1M3B A;  2GE9 A;  1EFN A;  1TTH B;  4KGV B;  3E9F A;  4A4E A;  4EMK A;  5CKF A;  4WCI A;  4FL2 A;  3PQZ A;  4OMM A;  2NUT B;  2J6F A;  2EAY A;  1BKB A;  3CBM A;  1LOJ A;  1I81 A;  2RQW A;  4ZTJ A;  2E41 A;  4A53 A;  3HKS A;  1Z3K A;  5GJV B;  3C95 A;  3S8N A;  4C92 C;  2EFI A;  1PG5 B;  4M75 C;  2XP1 A;  1PC0 A;  1AYD A;  2DCR A;  2LJ3 A;  4OB3 B;  2L3S A;  4LE9 A;  2QEX T;  2DYI A;  1VQ7 T;  1AYA A;  4KH1 B;  2SHP A;  3LGF A;  2WSC E;  4XTU A;  1WJR A;  4P9V A;  4KBM B;  5CQX A;  3SB2 A;  5GAN e;  2DXC A;  2NUP A;  3QG1 A;  3CCS T;  1PRM C;  1X6C A;  1PM3 A;  1XQH A;  2JXB A;  5FU7 B;  3KBG A;  2OTL T;  1YJW A;  1H8K A;  2RO0 A;  2VVK A;  2G3R A;  2RN8 A;  4U1P A;  2PTK A;  1Q86 C;  2F69 A;  2I0N A;  4B6M A;  5IXF A;  1NM7 A;  2QA4 Q;  2DZC A;  4FIB A;  1GRI A;  2Y4X A;  3GQI B;  1Y0M A;  2LCC A;  4AG2 C;  4ROJ A;  4JZ3 A;  4BD3 A;  4J9H A;  2CP3 A;  2BE7 D;  2E5K A;  1VQ8 Q;  1H3H A;  2RA2 A;  3EH2 A;  4HXJ A;  3HPW A;  2LNX A;  5GAN f;  4FSX A;  2L3P A;  4X1V A;  3CCM A;  1Q82 R;  1QVF S;  2C9W A;  1WNL A;  3A8M B;  3OYA A;  3OV1 A;  1W2B P;  5GAN 7;  1LPL A;  1BK2 A;  1Q7Y C;  1Q82 U;  2DEU A;  2ZAE A;  3OYF A;  2D9T A;  4DGX A;  1WQW A;  4LDY A;  4N0A C;  4XTX A;  2VWF A;  1B7T A;  4FYV B;  1G3W A;  1YJN Q;  1IHW A;  2FL7 A;  3HP9 A;  2VYT A;  1M5Q 1;  4BY6 B;  1I1J A;  1SPR A;  3I56 T;  1IRE B;  2COW A;  2KBT A;  3JSC A;  2PUO B;  2DX1 A;  3CCL Q;  4JPB W;  5GMK m;  3L42 A;  2FHD A;  4C0D B;  4L1B B;  4RG2 A;  4BE2 A;  1ZBX A;  4M7A A;  1O4K A;  2V26 A;  5CO7 A;  1XTD A;  2QTX A;  3EHQ A;  4GPL B;  4LDV A;  3MEA A;  3CXC P;  5KE3 A;  3JCM h;  2EQU A;  1O4O A;  4OHL A;  3A8L B;  2DL5 A;  2QI2 A;  4ZGE B;  2M1H A;  2YU7 A;  1FMW A;  4DQ2 A;  2L8D A;  4J6Y A;  2GQI A;  1SSF A;  3CC4 A;  1ZQ1 A;  3L2Z A;  3G71 Q;  2KRN A;  4OHI A;  3HL8 A;  4FYW B;  4MZT A;  1JU5 A;  4JLI A;  3BUN B;  1ZLM A;  4IUT A;  4NL2 A;  1O4D A;  2GNC A;  3HRU A;  5LJ3 d;  2DL7 A;  1OEB A;  1I8F A;  1P13 A;  2OI3 A;  2CGH A;  2OTJ A;  2XID A;  5IN1 A;  3N84 A;  5CQY A;  4M7A D;  4J7I A;  2EVR A;  4AT1 B;  3G4S A;  2PLE A;  2A7Y A;  4PK4 A;  2MK2 A;  2LX9 A;  1R0C B;  3CCU T;  2CDT A;  4E7J A;  2AOB A;  3GF5 A;  4GLM A;  1O45 A;  5IXB A;  2KT8 A;  9ATC B;  1ZUK A;  4F17 A;  5J3X A;  5DY9 A;  5GAM h;  1HK9 A;  2KRO A;  3DLM A;  4QVC A;  2DO3 A;  1R1Q A;  1VQN T;  1AZE A;  4OVA A;  4OF1 A;  1BBZ A;  4BI3 A;  2KNO A;  2JMC A;  3TL0 A;  3VRO A;  2DRM A;  2RNA A;  5HY6 A;  5GAN g;  1Y7X A;  2CP5 A;  3CC2 A;  4M7D A;  3LWI A;  4IUQ A;  3EHR A;  2IPO B;  3QZ5 B;  3CMA A;  2FPF A;  2ZPE B;  3US4 A;  2GTO A;  3MP8 A;  3UF4 A;  1AWW A;  1C1A A;  1JB0 E;  4F7U G;  2W10 A;  4RTV A;  3BUM B;  2LNW A;  1C6V X;  1VQ4 Q;  3MAZ A;  5I21 A;  1MMD A;  1QKW A;  1NE8 A;  4NS5 A;  1UUR A;  3OYI A;  1NZ9 A;  2O4X A;  3MXY A;  3VRQ A;  5CKE A;  2OJ2 A;  2PNA A;  1TWB A;  5GAM j;  3PFS A;  1E6H A;  5KYX A;  4HT8 A;  1ARK A;  3MHX A;  4GL9 E;  3H0I A;  4FW2 A;  3EG9 A;  1D1C A;  2RM4 A;  2AKL A;  3I35 A;  3T04 A;  1BIB A;  4J6X A;  1XJW B;  4M7D D;  2DK3 A;  5J26 A;  1SHD A;  3OYK A;  2MRJ A;  1R77 A;  2E12 A;  2V1R A;  3L2V A;  3I55 A;  3JB9 J;  1QVG S;  1YCY A;  4JGH A;  2EW3 A;  4RUG A;  1MIL A;  1VIF A;  1YIJ A;  1IB8 A;  4AFQ C;  2LCT A;  3R6O A;  3T9N A;  2V8J A;  2DZ9 A;  3A8H B;  2XMF A;  2V8K A;  3CCQ A;  3VS4 A;  2KDS A;  3V7C A;  1KJW A;  3QJY A;  1Q82 C;  2WSF E;  3JCM f;  1ZUY A;  2JTF A;  4FU6 A;  4GBQ A;  3KFV A;  3BKB A;  1AD5 A;  1VQ6 Q;  4JRK A;  3SHW A;  1G8X A;  2A3L A;  2EKH A;  2R57 A;  1ZA1 B;  1G3T A;  3BDL A;  3KXT A;  3LH5 A;  1JYQ A;  5GAN 3;  4RTY A;  4QQ6 A;  1O43 A;  4JEG A;  4F5B A;  2ZPH B;  3O5Z A;  2LT1 A;  3TVT A;  1N6A A;  5J3B A;  1M2O A;  2DE0 X;  2NWM A;  2G6F X;  4F7U B;  1T3L A;  3WXM B;  2HUW A;  1CKA A;  1WHK A;  1W4S A;  1QLY A;  2R58 A;  1VQP T;  5GMK j;  1W70 A;  3TCJ A;  5IBM A;  4OML A;  1HJD A;  1GCQ A;  3EG1 A;  4M78 G;  4RTT A;  3FRN A;  2K3X A;  2D1X A;  1RAF B;  3GNG A;  3J81 E;  3PGG A;  5CK9 A;  2RHI A;  3M0U A;  2RHZ A;  2ESW A;  4M78 E;  2O9V A;  2LQ8 A;  3CCM T;  4WTO B;  1WQ7 A;  4XU1 A;  2QEX A;  1VQ7 A;  2YXY A;  3OYD A;  4RTZ A;  3SWN A;  1YJ9 Q;  2P84 A;  2E10 A;  4OHH A;  2QTV A;  4GLK A;  2VXE A;  3K2T A;  2JM9 A;  1PKS A;  3OQ5 A;  3CXC A;  2X35 A;  1MW4 A;  2K5L A;  3V8L A;  4PFP A;  4X6S A;  3QZ9 B;  1KFZ A;  1IRX A;  5IHI A;  3P8D A;  3OYH A;  2DLY A;  3CBO A;  2FCI A;  4A63 B;  4OB1 B;  4CC7 A;  2CP6 A;  1X69 A;  4LDU A;  5I22 A;  1ZSZ A;  2C06 A;  1NPR A;  3EAE A;  2DIQ A;  2FZK B;  3JB9 D;  1C0M A;  2QQB A;  4FM4 B;  4C8Q D;  1QMC A;  4K44 A;  1WHG A;  2DTO A;  3WA4 A;  1O4J A;  1PD0 A;  3REB B;  3VS0 A;  3NTK A;  3CC4 Q;  3G6E A;  1VUB A;  2DYB A;  2LNH B;  1K9A A;  1VQ5 Q;  2QMS A;  1JXM A;  2CZ7 B;  2ECD A;  4ELY C;  2JS2 A;  2H3J A;  1G2B A;  1M8V A;  2CYZ B;  3WVE B;  2DX0 A;  2EYQ A;  2KSS A;  4LXC A;  4MMK A;  3LLR A;  4FW1 A;  3NHN A;  2K7A B;  3RIR A;  4F7U F;  2CZ1 B;  5DLO A;  2ROR A;  2E6Z A;  4M78 B;  2CS7 A;  2EJG A;  1RAH B;  3G4S Q;  3M0T A;  4PL6 A;  4U17 A;  2HSE B;  1YIT T;  4D8D A;  3GIB A;  1ABO A;  4XU3 A;  2Y90 A;  2MCN A;  1RAI B;  3A1P A;  4PJO E;  2P4R A;  3N7Y A;  3LX7 A;  2LDM A;  2X4Y A;  4KH0 B;  1TG0 A;  1WX6 A;  2PLD A;  3N5B B;  1KC8 R;  1AOJ A;  1YFN A;  2DFU A;  1LCK A;  1H64 1;  3ME9 A;  3EAZ A;  5LJ5 f;  2X3X D;  1O41 A;  2LRA A;  4YTL A;  4PJN A;  2RJC A;  3VV0 A;  5IH2 A;  1X6O A;  1A1C A;  1KC8 U;  3EGU A;  2D0N A;  4J5Y A;  1AOU F;  3CC7 T;  4HKE A;  3EH1 A;  3LW5 E;  2GFA A;  2K79 A;  4OB2 B;  2MQI A;  3U23 A;  1GFC A;  1N9S A;  1R1S A;  3RES A;  3DKM A;  4R55 A;  4C92 A;  1KK7 A;  3ER0 A;  3E1S A;  1FU5 A;  1YI2 A;  1OX8 A;  4M75 A;  3JAM E;  2KVQ G;  2DBK A;  2LNV A;  4PFZ A;  3JCM d;  3CMA Q;  1W2B S;  2RQU A;  4M78 A;  2DET A;  4A4B A;  2SRC A;  2HMA A;  2RF0 A;  2QAZ A;  3CME A;  1CJ1 A;  5FU6 B;  1R8O B;  5D6X A;  1D4W A;  1TH7 A;  2DRK A;  3UWN A;  2E65 A;  3M4G A;  2CI8 A;  3UA6 A;  1TSF A;  2A36 A;  1I5O B;  2YRD A;  1BI3 A;  1SSH A;  3EAC A;  1BHF A;  2ZCF B;  4FSS A;  1MHN A;  2RHX A;  3OS1 A;  4PJO B;  4Z89 A;  1U1S A;  2EOB A;  4M77 C;  4OMF B;  2EQM A;  2JVV A;  1HXD A;  1OQK A;  3MP1 A;  4IUV A;  4C92 D;  1WHL A;  1FYR A;  4M75 D;  2DTH A;  1MMG A;  2V8I A;  1O46 A;  4M78 F;  3CCV Q;  2AUG A;  3TRE A;  5KYU A;  1E7O A;  3CXC S;  1QVF A;  5GAN h;  1LUK A;  2DA9 A;  1ZSG A;  1O4C A;  1QW1 A;  1VQM T;  2SEM A;  3JB9 I;  2CUB A;  2J7I A;  2PVG B;  5C0M A;  3NPF A;  1AWO A;  1BG1 A;  3CPW P;  4EMK B;  1UTI A;  3I55 T;  1IJR A;  5IHK A;  3JCM P;  4C5I A;  3GXX A;  2EYY A;  2VV5 A;  1YIJ T;  1BKL A;  2IUH A;  2CIA A;  2LC4 A;  4PJO A;  3OYL A;  3MJX A;  4H34 A;  1LVK A;  2HD0 A;  2DMO A;  2KI7 A;  1LUM A;  1NYF A;  3OYG A;  3CCQ T;  2X3W D;  1SHA A;  3OBY A;  4BAC A;  4OGE A;  3V7S A;  4MDX A;  1PIC A;  2PU9 B;  1MV0 B;  3OYE A;  2HBP A;  2FYK A;  2KGY A;  2KAF A;  1K4U S;  4KUL A;  4ZN1 A;  2DL4 A;  5CDW A;  5LJ5 g;  5GAN j;  1Z9Z A;  3M57 A;  3QBY A;  5IT9 E;  2RK1 A;  4JLG A;  3PIP A;  4AFZ C;  5AUL A;  1HCT B;  2I2L A;  2NUP B;  2DL3 A;  5C6S A;  4HCC A;  4FL6 A;  4M7A G;  3HTR A;  3NTH A;  2HEQ A;  4J9E A;  4PLI A;  3A8O B;  1BLJ A;  2ECZ A;  1R1P A;  2MWP A;  2RHU A;  1A1A A;  1U3O A;  4PJO D;  3EGD A;  3CWG A;  2ABL A;  3JCM X;  4M7A E;  4E7L A;  3J7A F;  2CP0 A;  5GAO p;  3S9K A;  4E47 A;  5LJ5 d;  4OHE A;  4CRI A;  1M1K R;  3LGL A;  3CCS Q;  1X2Q A;  5KCH A;  2EKO A;  3X24 B;  3MPU B;  1G3S A;  2OTL Q;  2CUD A;  4E7K A;  1M1K U;  3E19 A;  3HFN A;  4NWG A;  1QG1 E;  2L2P A;  4CC2 A;  2JMA A;  2D8H A;  2BZY A;  1BHH B;  2EKX A;  2LVM A;  1VQL T;  1PSF A;  4RCB A;  1B34 A;  4O6J A;  4Y91 A;  1QCF A;  4V2S A;  3OBW A;  1UG1 A;  2L6K A;  1VQ9 T;  2MOX A;  4AG1 C;  3QUI A;  4DBF A;  1KC8 C;  1FXX A;  1VQP A;  3RMQ A;  1D1B A;  1JRI A;  4ORZ A;  1O4A A;  1YHQ A;  4O5V A;  3I5R A;  1TUC A;  4OP0 A;  1M4Z A;  1RUW A;  3G6E T;  2L89 A;  1QP2 A;  1UGV A;  2DKG A;  1WLP B;  1YP5 A;  1X6B A;  1O42 A;  5D0J A;  5FW9 A;  5KCO A;  1JWO A;  3PT9 A;  1K8A R;  2FO0 A;  2LT4 A;  4OMO A;  1M27 C;  2BKD N;  4M7A B;  2YUP A;  3INZ A;  4M7D G;  3X28 B;  1MGQ A;  1K8A U;  1QQJ A;  3AHU A;  2KXC A;  1BHH A;  1O4M A;  1AB2 A;  3I56 Q;  4XTZ A;  1ZHI A;  4M7D E;  1B47 A;  1HD3 A;  2JS0 A;  3JCM J;  1KHC A;  3O8V A;  4GY5 A;  3IN7 A;  4XQ3 A;  2DXU A;  1KQ1 A;  1Q81 R;  1WJQ A;  1UE9 A;  1QVG A;  1Z9Q A;  4NOY A;  2QA4 T;  1WJS A;  1UB4 A;  1WHM A;  2RVF A;  3A8G B;  1Q81 U;  5A0L A;  1FX7 A;  1D09 B;  3CCR A;  1NZV A;  2HBW A;  3CCJ A;  1O4I A;  2K2V A;  5CR2 A;  4LN2 A;  1NBE B;  1Y07 A;  1YI2 T;  1H9O A;  1WI7 A;  1SEM A;  2AHJ B;  2EL8 A;  2RQV A;  5DC0 B;  1S72 Q;  5DC4 A;  3PVL A;  4KRT A;  4PJM A;  1IGQ A;  3PNW C;  4BDZ A;  3WVD B;  2EWN A;  1D0Y A;  2KK6 A;  1JYR A;  3MEW A;  4ZTF A;  2PNI A;  1BKM A;  3CEY A;  3CME T;  3V7R A;  1YIT A;  3OYB A;  2X4X A;  2RJF A;  1ZBJ A;  3L2W A;  1AVZ C;  3G7Z A;  1V76 A;  3CCU Q;  1YJN T;  4FBN A;  3L2R A;  1M3C A;  1BB9 A;  4IUR A;  1ZUU A;  2DPP B;  3UT1 A;  4M7D B;  1X2K A;  3AT1 B;  1LNX A;  5IHN A;  2YUN A;  2KE9 A;  3JCM W;  4M7A F;  3QWY A;  2MPX C;  2Y3A B;  5L8R E;  3CC7 A;  1JEG A;  1VQN Q;  3VS6 A;  3M59 A;  1A09 A;  2P0K A;  4JRQ A;  4JS4 A;  1D3B A;  3CD6 Q;  4PJJ A;  5FWB A;  2PVD B;  1M9S A;  3UPU A;  4PKC C;  1D1Z A;  2VB6 A;  3OS2 A;  2O4X B;  2XDB A;  3UAT A;  2CZ6 B;  1RI9 A;  3JB9 G;  4WF2 A;  3X20 B;  2IUI A;  5KYX B;  1O4L A;  4IIM A;  3EG9 B;  2FB7 A;  4J9C A;  4PLL A;  1NJI R;  5GJW B;  4VUB A;  4AMC A;  3TSZ A;  3MXC A;  4C8Q E;  1ZFP E;  1LKL A;  2QK0 A;  1NJI U;  2KYB A;  1FHS A;  2BBU A;  2JUF A;  4OB0 B;  4RMO A;  5GAO r;  2LP5 A;  2J06 A;  1OV3 A;  1HYO A;  5GAN 5;  2FPD A;  4KUD K;  1UUE A;  1M1K C;  4Y92 A;  4MZM A;  5ECA A;  1W1F A;  3OYY A;  3VS7 A;  4MML A;  4D6W A;  2KRM A;  3REA B;  1QKX A;  1A0N B;  1KD1 R;  1IXD A;  3GPL A;  2K3Y A;  2O01 E;  1KHI A;  2QG9 B;  4DGP A;  4C5E A;  2VGN A;  1KD1 U;  2K5I A;  1OO3 A;  4JRP A;  1WXT A;  3SEM A;  3CD3 A;  1Y71 A;  3PE0 A;  5GAN d;  1RAC B;  1QAD A;  3VRP A;  1AWX A;  1VQM A;  2MK5 A;  4X9C A;  1M90 R;  3CXL A;  1AT1 B;  5GMK l;  5FRN A;  4GWF A;  4M7D F;  1KIK A;  3BUO B;  4K2R A;  1CSK A;  2KY9 A;  5HK0 A;  1V1C A;  3PTA A;  3LYV A;  1WGS A;  4JDS A;  1M90 U;  1AZG B;  1YWO A;  4HA8 A;  3OYM A;  2W0Z A;  4DOW A;  4ZGD B;  3EFR A;  4JZ4 A;  5FU7 C;  3BW1 A;  2K2M A;  2D6F A;  1K0S A;  4HVU A;  2A08 A;  2MC1 A;  3HRS A;  4C8Q B;  1RAB B;  5LJ5 h;  5KYY B;  5EC7 A;  2EO3 A;  1K8A C;  4BE0 A;  1VQ4 T;  1T0H A;  1YJW Q;  1RAA B;  2PNB A;  2LQW A;  3CCE T;  5I2M A;  2CP7 A;  5D7U A;  1VA7 A;  3M5A A;  3M58 A;  3RBB B;  3ZFJ A;  4A4C A;  1B3Q A;  2CP2 A;  3SWN B;  3C0C A;  3NFC A;  2OAW A;  2BE9 B;  2J6K A;  4HCZ A;  2PUK B;  1I3Z A;  2ZPG B;  1BF5 A;  1OZ2 A;  4BDY A;  5J39 A;  5EEL A;  3QJ6 A;  1RAD B;  4QQG A;  1W2B A;  2HCK A;  5D6Y A;  1E6G A;  4F14 A;  1AEY A;  5LL6 S;  4C92 G;  3CPW S;  2DVJ A;  1Q81 C;  4NWF A;  4M75 G;  2JTE A;  3CCM Q;  1M1F A;  3ZNI A;  1ZSZ B;  1OZ3 A;  1X6G A;  1YHQ T;  2F2V A;  1ZA2 B;  2J6O A;  5HCK A;  4C92 E;  2CBL A;  5GAN 6;  2DM1 A;  2IUG A;  1M3A A;  4M75 E;  1KQS P;  2LRQ A;  4C8Q A;  3SDZ A;  5KYY A;  2HDA A;  5LJ5 j;  2CI9 A;  2QXF A;  2VKN A;  1UGR B;  4BY6 C;  1MMA A;  1BU1 A;  3I5S A;  3FIF A;  1SHF A;  2E5Q A;  4M77 A;  1WZO A;  1VQO T;  3RER A;  1VQ6 T;  1T3S A;  2BZX A;  1U8R A;  1KSW A;  1SKU B;  1Y96 A;  4C0D C;  1VQK A;  5AT1 B;  4F04 B;  2ZGW A;  1X75 C;  1VQL A;  1SPS A;  2A37 A;  1LUI A;  1X01 A;  2QQS A;  5KH6 A;  2L0A A;  2K9G A;  1PWT A;  1VQ9 A;  3GXW A;  2FVU A;  1N5Z A;  3JB9 F;  4LUD A;  2HQX A;  3OS5 A;  1TZE E;  2DXB A;  2CR4 A;  2MIO A;  1XOV A;  2RI5 A;  1J3T A;  4Z8A A;  2RQR A;  4A54 A;  1YIT Q;  4M77 D;  1CWE A;  2H46 E;  3VUB A;  4J9D A;  2K79 B;  3VGO A;  3F70 A;  4F59 A;  3V8K A;  1NG2 A;  3CCR T;  1O47 A;  4QSY A;  5HKZ A;  5AYF A;  5GJH A;  3CCJ T;  2HDX A;  2CRH A;  4XAX B;  4C92 B;  4XZ0 A;  5GMK e;  1AHJ B;  2KGT A;  5KYN A;  3PMI A;  4M75 B;  4E7S A;  1YJ9 T;  4J9B A;  3HHT B;  4PJO G;  2RJD A;  2KMT A;  2OTJ Q;  2RI2 A;  3N8M A;  1SRM A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  1PIC A;  1MV0 B;  3VS1 A;  3S8L A;  1I1J A;  1SPR A;  4TZI A;  4QT7 A;  2EBP A;  1K4U S;  2ETZ A;  3C7I A;  2KBT A;  2DL4 A;  2DX1 A;  4FL3 A;  5CDW A;  1Z9Z A;  1B07 A;  4JPB W;  3TKZ A;  1GBQ A;  1O48 A;  4AFZ C;  5AUL A;  1HCT B;  4L1B B;  2DL3 A;  1WFW A;  1O4K A;  2QDL A;  1I0C A;  2L3T A;  2B3O A;  2F2X A;  1O4P A;  4WWQ A;  1X27 A;  1X43 A;  2HEQ A;  4J9E A;  3EHQ A;  4GPL B;  2ECZ A;  5EEQ A;  1R1P A;  1BLJ A;  1A07 A;  1A1A A;  1PRL C;  1O4O A;  2KR3 A;  3M0Q A;  3PSJ A;  1U3O A;  4OHL A;  1CSY A;  2DL5 A;  3IQL A;  2O31 A;  2YU7 A;  3CWG A;  2ABL A;  2GQI A;  2YUQ A;  3TSW A;  1YNZ A;  2KRN A;  4OHI A;  3S9K A;  3IN8 A;  3ZL7 C;  1YCS B;  4OHE A;  5AXI A;  1JU5 A;  2C0T A;  2EGA A;  1O4H A;  1X2Q A;  3BUN B;  1ZLM A;  3CBL A;  1O4D A;  1O4Q A;  2GNC A;  1CSZ A;  2ROL A;  4AFU C;  2DL7 A;  1JU5 C;  1SPK A;  2CUD A;  1OEB A;  4H1O A;  1P13 A;  2OI3 A;  4NWG A;  4E68 A;  1QG1 E;  2L2P A;  1WDX A;  2AKK A;  2KT1 A;  4CC2 A;  1O49 A;  2JMA A;  1Y1U A;  4J9F A;  5EHP A;  2D8H A;  2BZY A;  2JT4 A;  1BHH B;  3N84 A;  4AFS C;  1YVH A;  1NLP C;  2EKX A;  3A98 A;  2EVR A;  1NZL A;  1ZX6 A;  2PLE A;  2RPN A;  3PS5 A;  1OPL A;  2MK2 A;  2FEI A;  1U06 A;  2YSQ A;  1RJA A;  1FMK A;  2EO6 A;  1QCF A;  1WIE A;  5DF6 A;  2CDT A;  1UG1 A;  1O4E A;  2AOB A;  2L6K A;  2M0Y A;  2YSX A;  2C0I A;  1T0J A;  4GLM A;  2MOX A;  4AG1 C;  1O45 A;  2DLZ A;  3RNJ A;  2DM0 A;  5IXB A;  2KT8 A;  2VIF A;  1ZUK A;  4F17 A;  1SRL A;  4ORZ A;  1O4A A;  2JM8 A;  5J3X A;  1SKJ A;  1AYB A;  2EGC A;  3I5R A;  4K11 A;  5EG3 B;  2O2O A;  1RQQ C;  2YDL A;  5EHR A;  1TUC A;  1Y57 A;  2KRO A;  2GSB A;  1R1Q A;  2LZ6 B;  1RUW A;  1AZE A;  1FBV A;  1YVL A;  1BBZ A;  1WXB A;  1UGV A;  2KNO A;  2JMC A;  2FG0 A;  3KFJ A;  1WLP B;  3GBQ A;  1YP5 A;  2JW4 A;  1X6B A;  1O42 A;  2DRM A;  3TL0 A;  3VRO A;  5D0J A;  1PHT A;  2HSP A;  1UHC A;  2RNA A;  5FW9 A;  1JWO A;  2FO0 A;  1W6X A;  4OMO A;  1M27 C;  2EYV A;  2F2W A;  2YUP A;  3EHR A;  2LMJ A;  2FPF A;  1A81 A;  3OB1 B;  3US4 A;  1UJY A;  1OPK A;  2GTO A;  2KXC A;  3UF4 A;  1BHH A;  1AWW A;  1O4M A;  2W10 A;  1QWF A;  4RTV A;  4E93 A;  1LUN A;  3BUM B;  1AB2 A;  2KNB B;  1UJ0 A;  2LNW A;  2AZV A;  1O4F A;  3QWX X;  5BO4 A;  1B47 A;  1D4T A;  3MAZ A;  1QKW A;  1OOT A;  1HD3 A;  2JS0 A;  4OMQ A;  2LQN A;  4OMN A;  5HKY A;  1A08 A;  1UUR A;  5L23 A;  2LJ1 A;  2AZS A;  1BMB A;  3K2M A;  3IN7 A;  3MXY A;  3VRQ A;  2OJ2 A;  2LJ0 A;  2PNA A;  2RQT A;  1BM2 A;  1E6H A;  1UE9 A;  1ARK A;  1Z9Q A;  4GL9 E;  3VS3 A;  3H0I A;  1LCJ A;  1RLQ C;  2RVF A;  2AKL A;  4J9I A;  3I35 A;  3T04 A;  3EG3 A;  1SHD A;  3PVQ A;  3VRN A;  4IIO A;  2MRJ A;  2V1R A;  1UUS A;  3H0H A;  1X0N A;  4JGH A;  1NZV A;  2O9S A;  2EW3 A;  1VYV A;  2EYX A;  2HBW A;  4RUG A;  3VRZ A;  3ULR B;  4LN2 A;  1H9O A;  1MIL A;  1O4I A;  2RSY A;  1WI7 A;  2Y1N A;  3S8O A;  1MUZ A;  1SEM A;  2V1Q A;  4J9G A;  4AFQ C;  2LCT A;  2CRE A;  2NUZ A;  2EL8 A;  4R0K A;  2RQV A;  5DC0 B;  5DC4 A;  2XMF A;  3PJP A;  3PVL A;  2CSI A;  4KRT A;  2FRY A;  2A28 A;  4OMP A;  2D8J A;  3OVE A;  4F5A A;  1SHB A;  1NEB A;  2KK6 A;  4K45 A;  2CH4 W;  1JYR A;  3VS4 A;  2PNI A;  1BKM A;  1KJW A;  3OP0 A;  1ZUY A;  2RMX A;  1TCE A;  4HVV A;  1IO6 A;  1ZBJ A;  4GBQ A;  1AVZ C;  2CSQ A;  3KFV A;  1RPY A;  1AD5 A;  3BKB A;  4ZNX A;  2O88 A;  4FBN A;  3SHW A;  2GBQ A;  3VRY A;  2EKH A;  1M3C A;  1CWD L;  1BB9 A;  1UHF A;  2OQ1 A;  2DF6 A;  1ZUU A;  1GHU A;  2C0O A;  3VS5 A;  3LH5 A;  1JYQ A;  4D8K A;  4RTY A;  1X2K A;  1O43 A;  4JEG A;  4F5B A;  1F2F A;  3O5Z A;  5IHN A;  2YUN A;  3TVT A;  1FU6 A;  2KE9 A;  2DE0 X;  1M30 A;  2G6F X;  2NWM A;  3BUX B;  1T3L A;  2HUW A;  1CKA A;  2IIM A;  1ABQ A;  1QLY A;  3QWY A;  2Y3A B;  2K7A A;  1JEG A;  1W70 A;  2MRK A;  3VS6 A;  1UDL A;  3H41 A;  1A09 A;  4OHD A;  5IBM A;  2PZ1 A;  4HCK A;  4OML A;  1HJD A;  1O4R A;  1GCQ A;  2LCS A;  2KRS A;  2EQI A;  3NMZ C;  3EG1 A;  5FWB A;  4RTT A;  2FPE A;  2D1X A;  1GCQ C;  2B86 A;  2GTJ A;  3EG0 A;  1D1Z A;  3M0R A;  1K76 A;  1G83 A;  5GJI A;  2EGE A;  3UAT A;  1RI9 A;  3IMD A;  3NGP A;  4CC3 A;  3M0U A;  1OO4 A;  1JXO A;  4XZ1 A;  1HCS B;  2ESW A;  2IUI A;  1M8M A;  3CQT A;  1O4L A;  1WQU A;  3PFV A;  2O9V A;  4IIM A;  2K6D A;  3FJ5 A;  4J9C A;  3M0P A;  5GJW B;  1NLO C;  3TSZ A;  3MXC A;  4RTZ A;  1M27 A;  1NEG A;  1O44 A;  1ZFP E;  3HIZ B;  1XA6 A;  1LKL A;  1A1E A;  2KYB A;  4OHH A;  1FHS A;  2BBU A;  1I07 A;  2JM9 A;  1PKS A;  2J06 A;  2LP5 A;  1OV3 A;  1MW4 A;  5IBS A;  2M51 A;  1GFD A;  2FPD A;  4X6S A;  1KFZ A;  1UUE A;  2CT3 A;  4Y92 A;  5IHI A;  4DEY A;  2ENM A;  5FWC A;  5ECA A;  2DLY A;  2FCI A;  1W1F A;  4A63 B;  2J05 A;  3VS7 A;  4CC7 A;  3H0F A;  1X69 A;  1O4B A;  1GCP A;  2KRM A;  3REA B;  1QKX A;  5I22 A;  1KA6 A;  2JYQ A;  1VYU A;  1A0N B;  2RMO A;  4Z88 A;  4EY0 A;  2OZO A;  4DGP A;  4M4Z A;  4K44 A;  4P9Z A;  3WA4 A;  1O4J A;  1CKB A;  3REB B;  3VS0 A;  1IS0 A;  1QWE A;  2DLP A;  2L4K A;  2EYW A;  1OO3 A;  1WXT A;  3SEM A;  1AYC A;  3CD3 A;  2IZV A;  2KXD A;  1WYX A;  3PE0 A;  2DYB A;  2K3B A;  1K9A A;  2LNH B;  1TUD A;  1JXM A;  2QMS A;  1QAD A;  1WA7 A;  1WXU A;  3VRP A;  1AWX A;  4E6R A;  1F1W A;  4DEX A;  2ECD A;  4EIK A;  1RLP C;  2EPD A;  2JS2 A;  3CXL A;  3UYO A;  4F16 A;  1G2B A;  4RTU A;  4GWF A;  2DX0 A;  1KIK A;  5HKW A;  2HMH A;  3BUO B;  4K2R A;  1CSK A;  1YN8 A;  1V1C A;  4JJC A;  1KA7 A;  3M7F A;  1GL5 A;  3NHN A;  1AZG B;  1YWO A;  2K7A B;  1JO8 A;  1U5S A;  1K0X A;  5KAZ A;  2W0Z A;  3R6N A;  2ROR A;  4JZ4 A;  1O4G A;  2K2M A;  1K0S A;  1BLK A;  3M0T A;  4U17 A;  2YT6 A;  4HVU A;  2A08 A;  4D8D A;  1ABO A;  2YUO A;  2MC1 A;  2MCN A;  2P4R A;  3M0S A;  5EC7 A;  3N7Y A;  3JV3 A;  1H92 A;  1A1B A;  5DC9 A;  2EO3 A;  1YWP A;  1TG0 A;  1WX6 A;  2CH4 A;  2PLD A;  2FRW A;  2KYM A;  2BTT A;  1T0H A;  1AOJ A;  1LCK A;  2PNB A;  2LQW A;  3EAZ A;  4EIH A;  1HSQ A;  2X3X D;  1O41 A;  1S1N A;  1JYU A;  1M61 A;  2LX7 A;  3THK A;  2AOA A;  4LUE A;  1VA7 A;  3RBB B;  5IH2 A;  1M3B A;  1A1C A;  4A4C A;  1B3Q A;  3EGU A;  2GE9 A;  2D0N A;  1EFN A;  4RTX A;  2Y1M A;  3IMJ A;  3C0C A;  2CT4 A;  1AOU F;  2DNU A;  2OAW A;  1K1Z A;  4WCI A;  2J6K A;  4FL2 A;  1I3Z A;  2K79 A;  3HCK A;  3PQZ A;  1BF5 A;  4OMM A;  5EEL A;  2MQI A;  3U23 A;  1MV3 A;  2J6F A;  1GFC A;  2HCK A;  1R1S A;  4HVW A;  3EG2 A;  2HDV A;  1E6G A;  4F14 A;  1AEY A;  2RQW A;  1JQQ A;  1FU5 A;  1Z3K A;  5GJV B;  2DVJ A;  3I9Q A;  3PLF B;  3S8N A;  5I11 A;  2H8H A;  2DBK A;  4NWF A;  2JTE A;  3ZNI A;  1BFI A;  1BFJ A;  4RTW A;  1X6G A;  3OB2 B;  2RQU A;  2XP1 A;  2F2V A;  1AYD A;  2DCR A;  2J6O A;  2DBM A;  5HCK A;  4A4B A;  2LJ3 A;  2SRC A;  2L3S A;  2CBL A;  1VYT A;  4LE9 A;  2DM1 A;  2RF0 A;  2IUG A;  1SHG A;  1M3A A;  1CJ1 A;  1AYA A;  2SHP A;  2CI9 A;  2HDA A;  1KC2 A;  4P9V A;  2VKN A;  1D4W A;  2DRK A;  1AWJ A;  1NRV A;  2CI8 A;  1BU1 A;  3I5S A;  3UA6 A;  1SHF A;  2A36 A;  1UEC A;  1SSH A;  3EAC A;  3UA7 A;  1BHF A;  4FSS A;  3PSK A;  2DL8 A;  5I6V A;  2DJQ A;  1T3S A;  2BZX A;  1PRM C;  4Z89 A;  1X6C A;  1KSW A;  2EOB A;  2JXB A;  2ROT A;  3HHM B;  1PKT A;  1H8K A;  2VVK A;  2RN8 A;  1SPS A;  3BUW B;  2A37 A;  1FYR A;  1LUI A;  4U1P A;  2H5K A;  1O46 A;  4JJD A;  2PTK A;  2L3Q A;  2I0N A;  2L0A A;  2AUG A;  2K9G A;  1PWT A;  5IXF A;  1NM7 A;  3GXW A;  1E7O A;  1GRI A;  1N5Z A;  2EYZ A;  3GQI B;  1Y0M A;  1LKK A;  4AG2 C;  1LUK A;  4ROJ A;  2DA9 A;  1ZSG A;  2KEA A;  4JZ3 A;  1UFF A;  2DIL A;  4LUD A;  1O4C A;  4J9H A;  1TZE E;  4ESR A;  2SEM A;  2E5K A;  2MIO A;  2CR4 A;  2CUB A;  1H3H A;  4HXJ A;  1AOT F;  1FBZ A;  2J7I A;  1XOV A;  4LNP A;  2LNX A;  1NYG A;  1J3T A;  4Z8A A;  1FYN A;  3NPF A;  3VS2 A;  2L3P A;  2RQR A;  4X1V A;  1AWO A;  1BG1 A;  2ED1 A;  1PNJ A;  4CC4 B;  1CWE A;  2AK5 A;  2C9W A;  2H46 E;  1UTI A;  4J9D A;  2K79 B;  3VGO A;  3VRR A;  4F59 A;  1IJR A;  5IHK A;  2CS0 A;  3OV1 A;  1NG2 A;  1BK2 A;  1O47 A;  4QSY A;  5HKZ A;  3GXX A;  2EYY A;  5GJH A;  1O4N A;  2HDX A;  2CRH A;  2EU0 A;  1BKL A;  4XZ0 A;  2IUH A;  1GBR A;  2KGT A;  2CIA A;  4DGX A;  4JJB A;  4H34 A;  4J9B A;  2BZ8 A;  2DMO A;  1LUM A;  1NYF A;  2VWF A;  4JE4 A;  2GGR A;  3N8M A;  2X3W D;  1SHA A;  1SRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...