1GRRA

Chloramphenicol phosphotransferase in complex with 2-nac-chloramphenicol from streptomyces venezuelae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grrA00
2ZYUX 4BLQA 2C8VA 4M9SA 1OSNA 1LW7A 3B8HA 4QNRA 4ARZA 3GJ3A 5JWRA 2Q3FA 4A2QA 2GWHA 5KDOA 1XEXB 1VYTA 2ZIAA 4BWYA 4HAYA 5LDDC 2ZS8A 3GLHA 3CZQA 5EE0A 5AUNB 1D5CA 1TMKA 1DELA 1GL7A 2G83A 3QPUA 4R2IA 3C15C 2ZSBA 3GJ4A 5GJVC 2ZRFA 5IDVA 4DIEA 2IYRA 1OIVA 1U8AA 2DWPA 1U8YA 2BC9A 1OE0A 3AF0A 4HDQB 4X8MA 2XOKD 3ZD7A 3KXKA 5KSYA 1CR4A 1N6KA 4NMMA 2R2AA 4NYMR 5EP2A 1TQ4A 2LCFA 1Z0AA 221PA 4JLBA 4ON9A 5JBQA 5JJLA 1G1MA 3ONWA 2J3EA 1GRRA 1NG1A 1ZVQA 3AVUA 1N6NA 2R8RA 3AVOA 4D4LA 5TY0A 3BORA 4M8NE 1FUUA 1P7CA 5DI3B 4AG5A 4O2RA 2PEYA 2WAYA 2GRJA 1TL7C 1W5SA 1J8MF 2VO1A 4TYNA 1SVWA 2ZUCA 3FKSA 2NPFA 1Z47A 1IN8A 1MV5A 4KI0A 2FX3A 4Q1EA 1A5TA 2XB4A 3QNUA 4D4JA 4WXPA 3NC0C 5GJCA 4DCVA 4LV5B 1HT2E 4IFBA 3NEYA 1XXHE 2ODBA 3AM1A 5KU1A 3R9IA 4EQ6A 1N3BA 3GJ8A 821PA 3TRFA 2PX0A 1Z22A 3NVAA 4LPSA 4NP6A 2VSFA 2GBLC 1P2TA 4LJ6A 2O8DA 2YZ2A 1BH2A 2Q9AA 3KZ1E 4CEIA 2W6ID 2RCNA 3CIOA 4PO1A 1ZIOA 2ZR7A 4EAQA 4JL5A 1I2MA 2WKRA 1VG9B 2JDIA 5HZKA 2PJRA 2VHQA 2FDCA 2HT1A 3IEUA 4JSTA 4B73A 4IW3B 1RRCA 1G8GA 1LNZA 2EYUA 2OZEA 4M21A 4Q03A 3ADCA 2JLRA 1Q1ZA 3N70A 3CX8A 1VECA 1KNQA 2BBOA 1JR3A 1RJ9B 4PQRA 1CR1A 3QE0A 4Y0AA 3K0AA 2QRNA 4UJ3A 1G291 4TMXA 3PR1A 2K5UA 4LHYA 1YE8A 1NVVQ 1HA3A 3W8RA 2R9VA 1CR2A 2R6FA 5A4JA 1RIFA 2ZJ5A 2W6IA 3TUJC 1G3UA 3GCGA 1D2EA 4QKQA 5KUTA 1S9HA 3BB4A 1GITA 4M53A 4GRAA 4PSVA 1WRBA 5FFMA 4TMVA 3GLFB 1M7HA 2QP9X 2QGZA 3BH6A 1AK2A 1XCGB 4DBLC 1EWQA 1NN5A 2HF9A 4URXR 3HU2A 2FFAA 3QF4A 1XEFA 4TZ6A 3WNBA 3X1WA 1G5PA 1W44A 4EPYA 3UANA 2O0JA 5EP3A 3FYHA 1QVAA 1CJUC 4AY2A 1Q1BA 5KDDA 2PLFA 3H84A 2WTUA 3RDPA 1NL3A 2O8BA 1DG3A 4HEJA 3AKEA 2PX3A 4FN5A 5SZKB 3P26A 1ESNA 4JIMA 3EPLA 5LB2A 2C2HA 2C04A 4BZQA 5KOYA 3C16C 4UXJA 1DOAA 4V0ME 4YLGA 2ZI7A 1XMVA 2FPMA 2HF8A 3OFND 2QTHA 1E1RA 1VHTA 2R6AA 2O8DB 2PMKA 1KDOA 1DAHA 4OQFA 1ZNXA 2WJHA 5B30A 3FFAA 3QVUA 2REOA 3K70C 4OHWA 4PANA 1DEKA 3W3ZB 2JLZA 3NG1A 5HZHA 1F3OA 1XTRA 2QAGB 1SHZA 3WP1B 2R6GA 1G4AE 2EU8A 2J0VA 2I1QA 1G3QA 1BMFA 4LOAA 5TMPA 1E1RD 1T91A 4LYHA 3RRNA 3ZVMA 3J81k 1Z0DA 4L15A 2H57A 1U0LA 4PAQA 1IXRC 5DE3A 1QG4A 1GNPA 1QHXA 3IDQA 2VH5R 2F1JA 3P4YA 4JYCA 4UNPA 2IS2A 2I1VB 3LV8A 4DDWA 1N0WA 3SU8A 2OBNA 3IIJA 4B2LA 3E2IA 3OEHD 2J59A 5B58C 2J87A 2ZVQX 4NHOA 4KO8A 1NJGA 1AS0A 1YRAA 3P27A 3QJYA 2CCGA 5FOSA 4URWR 1CF4A 1KMHA 4MGKR 4KYUA 5K8IA 1VCNA 5FPHA 3R8CA 1ZMXA 1GRNA 1LV7A 1YZUA 3NIBA 1UKYA 3PENA 2HUPA 3KFVA 4B75A 1JALA 4NCNA 5CDFE 3KXIA 1XJ0A 4M22A 2QP3A 4LJ9A 2NZ8A 3NTUA 1KTVA 2E9SA 2CL0X 3Q3JB 1WDTA 4YQFA 1W36D 2PT7A 1VPLA 3I72A 5KYKA 3AKDA 4E5UA 4PXAA 4BLTA 1R4AA 2HT6A 4Q19A 5FPKA 1DAEA 2FU5C 4Q66C 2BBSA 3QKSA 3ZS8A 2LKCA 1CJMA 1KSFX 1X1SA 1Z6AA 4DDUA 3K0SA 1IN7A 4Q47A 1OV4A 2MSEB 1GILA 1XD9A 2HLDD 1PUIA 4G5RA 5E95A 4ZIRA 1E3MA 3TBKA 3KDSE 1N5LA 3EA5A 1T0HB 1G3IA 1ZW6A 3U3OA 3KTAB 2QM7A 2YNMA 1Z0IA 5E7MA 2FA9A 2C96A 4LGMA 1R5OA 5CDFA 1X3SA 2AX4A 2ANBA 4BZPA 2J45A 2W2VA 3RC3A 4JSYA 2NO9A 2BCJQ 3VU9B 4DSUA 5AJXA 4F91B 3ZIAD 4CIDA 2NPIA 2AFHE 4KXFB 1DE0A 5IHPA 1NVUQ 1ZUNB 4A0FA 4PAMA 4ZKDA 4Q00A 5JJKA 4C3ZA 1KO4A 1UJ2A 1VCOA 3CRQA 1KY2A 4LBWA 4B35A 1AIPA 2EW1A 2I4IA 4QGHA 2V54A 3ZJYA 1GAJA 4C0QC 1Z8FA 3GJ6A 2FFHA 2NTYC 3OE7D 4PPFA 4DLTA 3HP1A 1BYUA 1T3HA 2KB0A 1N0VC 2ZR9A 3CX6A 3D8BA 2V9PA 5GVRA 2QG6A 4NYIQ 1XXHA 3TKLA 5JRJA 3TH5A 3NDBB 5BQ5A 3FTQA 5D3MB 3M4YA 4XSHA 4XWKA 5DO9A 2MSDB 3MAAC 1K5DA 4A1FA 4AURA 4WZBE 2WSSA 2H1LA 4CEHA 2YWEA 2IS6A 1PZNA 5J5CA 5LB4A 2JASA 3NH9A 4YC7A 2VHTA 1ZJ6A 3VR1A 5AR1A 3IHWA 5D3QA 5L8VA 3FMFA 3PQCA 1L2TA 1VYUA 4HLQB 4D81A 4YXWA 1J8YF 1F2UA 4LHWA 1E2HA 1SZPA 1Z83A 1NY5A 1RPZA 2PJZA 3GJ7A 4IFEA 4BFUA 3U3JA 3AEZA 3VU9A 3R9XA 4I99A 1T9HA 1E9CA 2D06A 4WVFA 3RABA 1TAGA 2AFIE 2NQ2C 4LJAA 3CPHA 3T1OA 3O8DA 4DUGD 3EA0A 1H8HD 1VCIA 2ZTSA 1Q44A 1SULA 5HTKA 121PA 1G6OA 5CB8A 3C5HA 3MCAA 4YMVA 4ZV4A 1ODFA 3ZH9B 2WSMA 4RKFA 1CU1A 2VP4A 4IDNA 4JBYA 4MQBA 1VG8A 4QGAA 3WNDA 5BWMA 1FNMA 2F9LA 4C30A 3FFBA 2J9RA 3U7GA 4TYYA 4FWIB 1A7JA 4TZ0A 1S0UA 2PT5A 1E0AA 2ZRPA 1E9SA 1YHNA 3SDZA 4EPXA 8OHMA 4B3GA 2JLXA 3K0CC 1MR3F 5AJYA 4IVQA 2XJ9A 3B7GA 3I62A 3DKPA 2O8CA 1TUEA 3C14C 1T5IA 3ZZTA 3TAHA 3WYAA 5C46F 3QG5A 1E1QA 2FOLA 2ZRAA 1FPMA 1W0KA 1EFTA 2WMOB 5TB5A 4DCTA 4NYJQ 4LBVA 1KI7A 1S1CA 2WWHA 2IL1A 5F98A 4C2TA 2FF7A 1JJVA 2QE7A 4FXPA 3PXGA 4NCKA 1MRNA 4LWZA 1E9BA 1SXJE 1ZCAA 3LH5A 3HYRA 2XZOA 5CM8B 4EFNA 1KYIA 3DM5A 1J7KA 4QBGB 2BM0A 2QEQA 1M7GA 4LRWA 5J4LA 4D0LB 3VQTA 3FB4A 3OFNA 5JRZA 1GNRA 2AXPA 2B21A 2UZIR 4V03A 3RNLA 3KX2A 4Z54A 1T4GA 3KKQA 3RAPR 2WWXA 3Q9LA 1IHUA 5FPSA 3EIEA 4PSKA 2FJUA 1COWA 1KKLA 4C0LA 1S1MA 2B8TA 1YR7A 3VTKA 4M1SA 1ZD9A 2CL7X 4DKXA 2RKOA 3FHTA 4NL4H 1P5ZB 2JA1A 2Z6VA 1D9ZA 1R8QA 4RZ2A 1JQJC 3PEVA 4IDPA 4NH0A 4RD6A 5JI3E 1FFHA 1OFTA 3B2EA 2DWOA 3K0FB 4KJZA 1FL9A 4DEXA 4FWTA 3Q7QA 4HZUA 2OT3B 1NP6A 1OXTA 3X1ZA 2VHUA 5A5GA 1PVOA 3IHLA 1E9EA 3LXXA 3ZZ0A 4PC1A 2YOFA 3Q85A 4ZIRB 4LDJA 2FMXA 4HUQA 3QENA 4R71A 4D0NA 1C4OA 3D6TB 4H1VA 4A0RA 2PMDA 2GZDA 3RS3A 3A1UA 3T5DA 2WBLC 4OQMA 4EKDA 3PUYA 4PPQA 2ZRMA 3AB3A 3IUYA 3IILA 2JLQA 1P3JA 4US0R 3W5IA 1W49A 3MUFA 3G82C 3ZVRA 1SXJB 2WJIA 3QF4B 1GKYA 5FBQB 1SKYB 1VG1A 2AL7A 2OCBA 3C41J 3R7WB 2ZJ8A 1P2UA 2WIBA 4WXRA 5J4HA 1E0KA 3W3AA 4F38A 1X8JA 3ADBA 5AJVB 4MKGA 4HAXA 4PZLA 1K6MA 3SS8A 2YWGA 4YMTA 1EESA 1JPJA 5AWFC 3GPLA 4MDEA 1TNDA 4B33A 2BMJA 2G1JA 2YYZA 1HQCA 4ZCMA 4R7ZA 3L8ZA 4JLNA 4TQAA 1P2VA 3KUCA 4AC9A 1R8SA 1RC8A 3BK7A 2DPXA 5C2JB 5JLJA 4V0LA 4BFVA 5GVSA 3K0AB 5TDHA 3E5HA 1U0HC 4DB2A 1U0JA 2BMEA 1KI1A 1ZINA 4IXMA 3OZXA 3UPUA 4OQXA 5J4VA 1FP7A 1KO8A 3BFVA 3L0OA 1W0KD 4LC1A 3M0EA 2IUSA 3TVTA 3FE2A 1R0ZA 1ZRHA 2IYXA 4HAWA 1II8B 4KU4A 1XTQA 2AD1A 3LBHA 1GWNA 1J99A 4C2UA 4ZDJA 3CRW1 5EJEA 2A5JA 3DOEA 2W2TA 3GJ5A 3K8YA 1OH6A 1JBKA 2QTVB 2BKUA 3SYNA 1LS1A 1F5NA 4HB4A 4A15A 1MRSA 1ZM7A 2N42A 3CRMA 3ETLA 4LY6A 4PO8A 3CNLA 1VIAA 2CVHA 4AYXA 5JZVA 4G3XA 3RS4A 3ZLJA 4AIIA 3VAAA 621PA 4OHZA 5BXQC 4GOJA 4KSCA 5CYPA 4W7SA 1Z06A 2BVNA 4EFMA 4EJSA 3HJNA 1TUIA 3TVDA 2NIPA 2OCPA 3IPYA 1M8PA 2DYKA 3AGQA 4G5SA 1HUQA 3GLGB 1E9RA 3JZMA 3CRVA 2HV8A 4UQOA 1BO6A 4MYTA 3FDIA 2KI5A 1IJFA 1OIWA 1ZAKA 1E2NA 3C5CA 5JS8A 5KO2A 1GFIA 1KMQA 3AF4A 1G4UR 4ESVA 3NXSA 3FGNA 1UEJA 1AJEA 1W1WA 2NO0A 2F3RA 4M0LA 1S8FA 3WRYC 721PA 4JLKA 3QBTA 2HYDA 1E2IA 3LA6A 4O2LA 4M9ZA 3UMSA 1G7RA 4RKEA 4RY2A 1IM2A 4MA4A 1Q1EA 1T3SA 3LY5A 1KDPA 2WKPA 3VFDA 1G64A 2OXRA 3KJGA 2HXYA 2PZFA 2WPDD 4CVNA 2ZU6A 4IXNA 1WA5A 4JBXA 5CJ2A 3CF2A 3RWOA 5JECA 1T5LA 2BCGY 1RKBA 1BYIA 4AKIA 1D6JA 2A2ZA 3H4MA 4PZYA 1OH7A 5J40A 2AXNA 4B2PA 2B92A 2VBCA 4HLCA 4G0NA 1QRAA 1KI6B 3A58B 3EIQA 3PUZA 2ZXUA 3W8NA 2D4HA 3RLFA 1N6RA 2PEZA 3ZQJA 4DUGA 1FMLA 5TARA 3DOFA 1HH4A 4R98A 1GZSA 1KO1A 1U98A 2EFHB 3BS4A 3DZDA 4MRRA 3LAWA 4TT3D 5FTMA 1TF7A 1DS6A 1JNYA 3AP2A 3KQNA 3N2EA 5HKKD 4WIAA 2FSGA 1EGAA 5F2EA 1Y63A 2AN9A 4B34A 1E2KA 3SJAA 3CNOA 4F7WA 3KFXA 4NU0A 1R7RA 1V5WA 2GTPA 1US8A 2G0NA 3REFA 3PCRB 2BV3A 5FBWB 3KTAA 3B85A 3WNCA 4B6FA 1ZC3A 3MGCA 4OK3A 4O3MA 2XZPA 1LF5A 2QUZA 1CS4C 2QGNA 4OBEA 4RCYA 2IUUA 1ZUHA 1OPXA 1U81A 4TLBA 4GZLA 5L3VA 4BLRA 2ZJYA 1OJLA 2J7PA 2C95A 5KSZA 2V4ZA 1G8FA 2IXEA 4LHZA 2J0UA 5G41A 1QF9A 1DAGA 1YZKA 1R2QA 2GETA 3F5FA 1Q57A 1D9XA 1F2TA 2YJTD 4ESHA 3IQWA 3FHOA 3QKRB 1LVGA 1NBME 3MMPA 1SXJD 1JJ7A 4BLSA 1XDBA 4BASA 1SVMA 5IRCD 2V7QA 2BDTA 2P6NA 5CIQA 1PV4A 3MD0A 1Z6XA 1L4YA 3LWNA 3NDPA 3BAFA 1XP8A 2Z0MA 2JATA 4OHYA 4BLOA 4CEHB 1MO3A 1NN3A 1E9AA 1U8ZA 4IVRA 4KAXA 1F2TB 4M1WA 2G77B 4U00A 4K8OA 5DHAA 3B9QA 5FBRB 2IXFA 1OHHD 2WHXA 3C4JA 3K0CA 5FOXA 3QY0A 4Q1DA 5F3WB 3EG5A 4AKHA 2DFLA 4B3XA 3RRZA 2WJJA 3B1XA 4QG7A 3TSWA 4YMUA 1OB2A 4US2R 1ZUIA 1CBUA 3QEJA 2VPPA 4PR0A 2V3CC 1L4UA 4Q21A 1N6PA 3QF7A 4MRVA 4TN1A 4XD7D 4DCUA 2AKYA 1S96A 4LBYA 3NBXX 4LV6A 2FEMA 4BFZA 2NG1A 1MO6A 2QNRA 3K70D 2QAJA 4B3DA 1D2NA 1FX0A 2HCBA 3FHCB 1NMXA 2RGBA 2X77A 2WKQA 4TSFA 3THWB 1M74A 3RHFA 1IY1A 3OAAA 4FW9A 4W5HA 4EPWA 1UKZA 5GADl 5IT5A 1VDZA 2CHQA 1DO0A 3EZ6A 2OV2A 3OHMA 5HR5A 4A4DA 3U44B 1ZCBA 2F55A 1FX0B 3U7FB 1NG9A 2A7QA 2ZAMA 4QC2A 1LF0A 5TVKA 4DXAA 3AVPA 2JJ2A 4X8OA 2QTFA 3THYA 4DJTA 1TTTA 2ZSEA 4L5BA 3TUZC 1NRJB 4Q4AA 1G6HA 1YR9A 1XTSA 4R2HA 4PFSA 1E2QA 2F9MA 1UAAA 1KK0A 3LW8A 2WOOA 5C4GB 2JEOA 3SJCA 3EW9A 3I3SR 3UMRA 3T1QA 3ZZUA 5FBVB 4DC9A 2GF0A 3D7MA 4PAOA 3SR0A 1P2SA 2FG5A 1LFDB 3GLGA 3T5GA 4BFTA 4MRNA 2MSCB 3TUIC 1A2BA 2DFTA 1C1YA 2QL6A 4DRZA 4BRWA 4Z1MA 2EFGA 5FOVA 3ZS9A 3PG5A 4KSBA 1ONBA 2QSZA 3EC2A 1Z29A 4MYCA 2WWIA 1QHHA 3A37A 2GCOB 5EZ5A 4LK2A 4TQUS 4E09A 3UATA 2GILA 4C4PA 5JS7A 5EZ6B 3HDTA 3ZQ6A 2C99A 1I4TD 3DPUA 3O8CA 2H92A 2W83A 3BIFA 2FGJA 1IN4A 4Q4JB 1OFUX 4A9AA 5SZJA 2F43B 2ZPTX 3LVRE 1XPUA 4D25A 2OBLA 2GEDA 3SN6A 3NBZC 2J0UB 5FI0B 3GLFA 5BYJA 3ZVLA 3TW4A 1NLZA 4EDHA 3A36A 3U60B 1QHYA 3RRMA 3KKPA 3LBNA 3QVVA 1I4DD 5BN3A 1EFHA 3EZ7A 4DLSA 1RZ3A 2P0EA 1TF5A 4L8GA 1G41A 1XXHB 1ANKA 1YZQA 4XH9B 1ZC4A 1DTSA 2ZJAA 4A8JC 1KK3A 2GK7A 2BJVA 4IOMA 1G19A 4HUQB 4JLPA 4Z8XA 3BD9A 1P72A 1ZM9A 1E79D 3MWJA 2YWHA 3SNHA 3TR0A 3ADDA 5IK2D 4TQ9A 2VP0A 4KVGA 5KNBA 2KBEA 3AKCA 2EQBA 3ECCA 4QHYA 4MRSA 3K0FA 4DLUA 2R6DA 3SJZA 3UIEA 1E9FA 3TR5A 3KL4A 1E9DA 1S3GA 3VR3A 1UKEA 3PJRA 1HY3A 1YZLA 4Q9JA 2ZE7A 4IOLA 5L3SA 4I1SA 3B78A 1J70A 1JECA 3I32A 4H1UA 2IW3A 2OXCA 2QORA 3VKWA 1XX6A 2GAAA 3C8UA 3HU1A 1KSJA 1WP9A 4XTCS 2ANCA 1PLJA 4A2WA 4BFSA 1F48A 1KJZA 5G3ZA 2CK3A 2O0HA 3EAQA 3HR8A 3DM9B 1IY2A 1AA9A 1Z07A 4RZ3A 5JWOA 1AGRA 2XOKA 4CRWB 3OE7A 4KLZA 2HJGA 1XWIA 1QHNA 4HB0A 1KK1A 2V6JA 4FI3C 4UNRA 5KSPA 1OKKA 4L9WA 1D8TA 2ZRGA 3QXHA 1US8B 4JJKA 4LPKA 1WBBA 1P60A 3I92A 1E69A 1YVDA 3QKTA 4QL3A 4BQSA 2C9YA 4O0MA 1GKIA 1TQ6A 3EASA 1ZNWA 4QHSA 4DLZA 1XEWX 5J4KA 2HDNB 2IHBA 2BBTA 2FZ4A 4NDZA 4M9QA 1VKJA 2WJYA 4IOJA 5LD2B 2NMVA 1OYWA 2D7DA 3UK6A 4AG6A 4LJYA 1Y3AA 1SKYE 4ABYA 1RW4A 4MGIR 3GEHA 3U7EB 3MG9A 1IN6A 2ODNA 3FPAA 2ZS7A 2QBYB 4A92A 4B3FX 1XCPA 2GVDC 3U7HB 1RYFA 3NBFA 4ZPXA 3BBPA 3FOZA 5CM9C 3GLHB 3K09C 3ADKA 1A1VA 2O52A 4ZDIA 2EWVA 5EE5B 4D4MA 4ZDKA 4M9XA 4GSYA 4DVGA 1OW3B 1W2GA 3LO5A 3ICQB 4TT3A 2W58A 3RS5A 2QN6A 4CEJB 1F6BA 1R5NA 4KFSA 2O8EA 1HTWA 1XBTA 1VG0B 4C0BA 1WF3A 3GLHE 4I1VA 1KI3A 1Q12A 5B64A 2A5DA 5JHHB 2DWQA 1CTQA 1EK0A 4G5QA 1R6BX 2JLUA 3TAUA 1P4SA 1XEXA 4CEIB 4US1R 3QIAA 3CR7A 1ZBDA 4DSTA 2RGDA 4G5GA 4GPTA 2IX3A 3MSXA 4L4UA 5A0FA 5L3SB 3GFTA 3B82A 3U3MA 4P4SA 2AWNA 1K8RA 2H5EA 1JQLB 2G88A 2Z4RA 3QPWA 4Z51A 4LYFA 4PHFA 3B1ZA 5C4MA 1ZIPA 4OL0A 2GZAA 4QM7A 2ZRNA 3KB1A 2RGAA 4MYHA 2GEUA 2YOGA 3B60A 1OXXK 1QHSA 3MFYA 5E3HA 3TK1A 2BJWA 4TTPA 4RVCA 2V6IA 1XF9A 1HYQA 4DEYA 2DB3A 3VR4A 4J0QA 4W5WA 1G7SA 3U3RA 1IONA 3DL0A 1GTVA 1W46A 2H17A 3IO5A 3TW8B 4E07A 3KQHA 3SQXA 4A0GA 2FE4A 2ZUBA 1IJEA 3MWLA 2PL3A 2SHKA 2ZEJA 1KZ7B 3THXA 3LLUA 2IEYA 1WBDA 3DKVA 2W00A 2A5YB 4Z8YA 4FCWA 2ODEA 2IT1A 1W48A 4LYAA 1X8LA 2KBFA 4Q4JA 4QGFA 3UMFA 3X1YA 5CYOA 4PO9A 4Q4HB 4URYR 1NSTA 5KNDA 4JBWA 2ZRDA 3MWYW 3A6PC 3Q72A 2YINC 1VMAA 4TLDA 2OAQ1 5HE9A 3L0PA 4OQNA 4UNNA 4CZ2A 2BIFA 2WMNB 4LJ4A 1BS1A 3VX3A 4N0DA 1Z2CA 4LX0A 3CZPA 2CJWA 2AR7A 4HDCA 5EQTA 2OCYC 3EZFA 4B32A 4IJMA 3GLIE 3PV0A 4P0TA 2RHMA 4D26A 1OT3A 2QT1A 3IIMA 2G1KA 2PLRA 5JHGB 1E2FA 1NJFA 3D31A 4OI0A 2X2EA 2O0KA 1N5KA 5FOTA 1WCV1 3RRYA 3K9GA 4P4UA 3EZ9A 2KJQA 1QG2A 3PUXA 4HAZA 4FMBB 2VF8A 1OH8A 3VKGA 3TE6A 1CRPA 4IDHA 1H8ED 2ZSFA 3LQQA 3PUVA 4RFVA 5EE1A 1Z0KA 3OEHA 3RC8A 4GP6A 3G5UA 2CXXA 4F4CA 1W0JA 1P62B 1X1RA 5IF9A 2IK8A 3AH8A 3JVVA 2ZM5A 1G8HA 4NZYA 2ZI6A 4IVPA 1OYYA 1W7AA 2J5XA 3CH4B 4KHZA 3ZYCA 2FN4A 2J46A 2JJ1D 2O8CB 2DY1A 3QG1A 4ZO4A 3REGA 4GZMA 4TLEA 1GRQA 1EX7A 2HJVA 1KK2A 2W6JA 3OIUA 1YR6A 3K53A 1JEEA 2FV8A 2V7QD 1JR3E 5AK0A 3W6PA 4U02A 4B3CA 2GHIA 5H1YA 2GAOA 1KIMA 4QBHA 4P4SB 1MO4A 4C0JA 2ORVA 2NZJA 3KJEA 1SXJC 4BPBA 3O8BA 5L3QB 2PZGA 3CW2A 2JLVA 1G8YA 3SC3A 1GM5A 2ECKA 5DN6D 4YDHB 3SFVA 5JEEA 1WQ1R 1EFUA 2OG2A 1RRFA 4IOKA 4O25A 4U7DA 1S3SA 3P32A 3A4MA 5DI3A 4LSGA 3KKNA 1E2DA 4KV9A 3M1IA 3A1SA 4NYMQ 2VYFA 3CKLA 2GF9A 1DG1G 1A82A 2QY9A 2ZJ2A 4HLDA 1VIYA 3UXMA 2CDNA 1G7TA 4Q9HA 1ZM2A 2ZUDA 4Q9KA 3CB4A 4NCIA 2XZLA 4QNMA 1E98A 4C9BA 2GKSA 1ZD8A 4QXAA 1NIJA 5FUWA 3EWSA 4HB2A 2EWWA 2O5VA 4BUJA 5M04A 1E2EA 3PVSA 4L16A 5EE9A 3TQCA 4BGDA 1KAOA 2RAPA 4JVMA 2FEOA 1CP2A 1Z6YA 4F92B 3EIHA 4TL8A 2WWFA 2DBYA 2OAP1 3FKSD 1ZU4A 3ND8A 4PHHA 4IDQA 3MLEA 1EFRA 1PLLA 5L3RA 3QKRA 5DN6A 1KI4A 4ILEA 2CCJA 1OHHA 1MO5A 2FWRA 3PITA 3TSZA 1JR6A 2ZYTX 5LPNA 1KMHB 3AP1A 2EFDB 4D82A 2IYZA 5BW8A 2WJGA 3PEYA 5JSZB 3A1VA 4OI1A 2Q9BA 5CITA 3OIVA 1XZQA 3K9HA 2BKEA 2VSOA 4B44A 3GLIB 1YQTA 3ND9A 2BMFA 5FR1A 1CRQA 1OXVA 2ZSAA 3IBYA 2PH1A 4IKEA 3SHWA 3IIKA 3BFXA 1F2UB 1QVRA 2XSZA 5EE3A 2QAGC 2XTZA 1FUKA 3VR2A 3BRWD 1E2PA 2ZRBA 1DO2A 1KJYA 4PC7A 1AKEA 3VKHA 3E1SA 4YXWD 3KQKA 3GEIA 5JFGA 1E2GA 2V1UA 2GJAA 1FW6A 2RGNA 4JL6A 1TADA 1VHLA 2FGKA 4WZAE 2IWHA 3ASZA 1XD2B 2GCPA 2HYIC 5F9FA 4QFMA 4HAUA 2P6UA 1CXZA 3MJHA 4FMCB 3PEUA 1G16A 4NPHA 5JEDA 2FH5B 4JYBA 4N1AA 3F0TA 2Z4SA 3QUSA 2P6RA 4P31A 5DI9A 3CONA 3CUEF 2G6BA 4TL7A 3RS0A 3I8SA 3W90A 2VHCA 4Q9LA 2BMDA 2P3SA 2QMUA 3VR5A 3KXLA 1TF2A 1XU4A 3WMFA 3RANA 1SVLA 3UWOA 3G0HA 5GJWC 4GOKA 2FSIA 3FMIA 1NMZA 3AVWA 1COWD 2REXB 2YVUA 1DAKA 2ZRIA 3O47A 4Q5IA 1KY3A 1G20E 2ZRJA 5FTJA 3T34A 3AVVA 1ELOA 4URVR 2F43A 3KJHA 4Q1AA 3BE4A 2CEAA 4MKFA 3RVBA 4CGZA 5DYGA 1XMIA 2Z83A 1XRJA 1MT0A 4XIGS 2ZJOA 4ZDWA 4JS0A 4AI6A 4OHXA 2ZJZA 3ASYA 4TLCA 1JXMA 1JEDA 3L2OB 5EXTA 3GFOA 3U4QB 1HE8B 1OXSC 1VYVA 1DPFA 3OIYA 1M34E 4DWJA 4LC0A 4ZI2A 4PQFA 1R5BA 5JMTA 2XTNA 2A9KA 1R10A 3SYLA 1DADA 2FFQA 4NKRA 4WZ6A 1AS3A 3THXB 2QE7D 4LJ5A 2J41A 2X1VA 3FMOB 3LQRA 3I1FA 1M2OB 2D2EA 1UEIA 2ZU0C 4TYWA 1UBFA 3JVUA 2IYYA 3NH6A 1Z08A 2ZYWX 1XZPA 2IS1A 1QHIA 2D62A 1TEXA 4Q4LA 1NKSA 4DT1B 5CLLA 1UM8A 1UPTA 1N6IA 4JVNA 5DISB 4B3BA 4C0HA 2P5TB 2ZI5A 2GXUA 3RWMB 3LX8A 5FPYA 5FOWA 5FPTA 2A5GA 1KI2A 3HPRA 1Z6GA 5K8LA 1B0UA 2CL6X 3BH0A 1N5IA 2CNWA 2C9OA 4M2LA 3WRXC 2ZREA 1HT1E 2YV5A 2A78A 4WA7A 1GL6A 3VNVA 1N6LA 1AS2A 3PUWA 2C03A 5EP1A 2ZI3A 2ZRCA 5G53C 5CLQA 2RGCA 3B1YA 3WP0A 5DIFA 4B76A 2KSQA 1RFLA 2C77A 5JI2E 4A82A 1KO7A 3ZIAA 2QA5A 2CLCX 2OE2A 1TQ2A 2DFNA 2QSYA 4PHGA 5DHFA 2JLYA 4A36A 2XXAB 3T1VA 4KYIB 3WXMA 4UXHA 4RSGA 1ZD1A 4F4JA 4ZI3A 1IY0A 3QSYA 4FMDB 1T3LA 1G5RA 5E7JA 4TL6A 4U5XA 3Q5EA 1Z0FA 5B57C 1FQJA 4B71A 2ZS9A 2J1LA 4LYJA 2WZQA 3DMDA 5P21A 4AKEA 2WICA 5FTNA 4Q01A 4ZCIA 5J4YA 4X8LA 2QENA 2OM2A 2QPOA 2B6HA 5EXXA 4HI0E 2E87A 4LJ8A 4DLXA 2NGRA 2R44A 3IEVA 2W0MA 5KPDA 4Q4HA 1XCMA 2MMCA 4Q7LA 4JJZA 2WSSD 3AVXA 1U2RA 1Q3TA 2H7VA 3BFKA 1TQDA 4I1UA 4IDOA 4ACAA 5DNYB 4CF7A 3B13B 3WMEA 4B48A 5AUPB 4D2IA 3GLGE 1AQYA 2CE2X 2XITA 1LS6A 1VTKA 3AF2A 2B8WA 1NVXQ 3CH5A 1H8HA 1Z6TA 1KSGA 1E2LA 1U90A 3AVYA 2O8EB 1CEEA 4GL2A 2AHOA 3BOSA 3KB2A 4LI0A 1E2MA 4E03A 1UBCA 4OK6A 4EIWA 2OO7A 2X8AA 1Q21A 1OFHA 4XVRA 3TIFA 3L82B 5TXGA 5JSZA 4GMXA 1EFCA 1KZGB 3LLMA 1HE1C 3S1AA 1E6CA 2QRZA 4B6EA 3HPQA 3OESA 2ZE5A 2A3RA 1RRGA 2XAUA 4KODA 3TNFA 4OI4A 2Z5FA 4GP7A 4BZXA 2CHGA 3WBJA 5AUQA 3IQXA 1HURA 1EXMA 2A30A 2P65A 1BKDR 1Z0JA 4MYUA 5DSZA 3HWSA 2MMGA 1XPOA 1Q0UA 1W2HA 4QRHA 5TV2A 4ERNA 4XOIA 4EFLA 2GXAA 2ORIA 3B5JA 1G18A 1KAGA 1C9KA 2AKAB 3THWA 4C0SA 3AGPA 2W2XA 3Q8XB 4GBMA 4Q18A 3BGWA 5DH9A 2JCSA 1RJ9A 3CWZA 3NEJA 2ZE6A 2H8KA 4KFRA 2OCAA 4V0MA 5HPYB 4MDFA 1Z63A 1XMSA 2PCJA 4DIDA 1NBMD 1XPRA 2F7SA 2WIAA 4OYHA 4JZKA 3K9LA 3EZ2A 2P2LA 4Q9IA 3PEWA 2JJ1A 4RZUA 1CULC 1NVWQ 2YKGA 3GMTA 2VHJA 3I5YA 1P9RA 4K81B 2JLWA 4TSFD 5CB6A 1DBSA 2QI9C 4JT4A 3TGPA 3RS2A 2QU8A 2EFCB 5ANRB 3NHAA 1KGDA 2WWGA 2IYSA 1TU3A 3BWDD 1OFIA 2QAGA 5KDLA 3EWAA 2XTMA 2R6CA 4MUBA 1Z28A 2WV9A 4PX9A 1AGPA 4HYYA 4PZZA 4QBFA 5CK4A 1E79A 3QEOA 5FUXA 3SJBA 1XMJA 4JLVA 4MUAA 1M6NA 4P3YA 1W4CA 1DAMA 4V02A 3IKJA 4QOSA 1UKVY 2IYLD 4G5OA 3TMKA 2VIIA 5CJPA 5J47A 1T8UA 4KBFA 1E96A 3KKOA 4W5JA 4C0KA 1MABB 1YZGA 4LCBA 1M7BA 2ERYA 4LV8B 3NC1C 3W5JA 2IS4A 1E94E 3B1WA 3T12A 4MH0R 1GG2A 3U44A 4GT1A 2VRWA 4RFSA 2GDJA 2H18A 2JDID 5FL7D 4OK5A 4KBGA 2JLSA 2QMOA 1VCMA 2XGJA 1CR0A 2W6JD 1NKTA 1TX4B 2F1IA 4JLAA 2QP4A 1XNJA 2D74A 3U5ZB 3A1WA 1P73A 2GJ9A 1GL9B 3U6KA 1IXSB 4DSOA 1XJQA 4S2EA 4TTQA 1ZNYA 2CK3D 1IOZA 3R9WA 5SZIA 3V4FA 1NSFA 3LX5A 1YKSA 4AK9A 2WWYA 2UVQA 1AZSC 4BRUA 3CR8A 4CW7A 2FSFA 4MKHA 2D2FA 4P32A 2XJ4A 3LFUA 4Q48A 2CLSA 5B2ZA 4C0AC 2IXGA 3GFPA 3TQFA 1Q1QA 1IN5A 4HDOB 2JGNA 2HLDA 2NO6A 3QXCA 1CJKC 1GP2A 1IBRA 3KUDA 3QPVA 4PPGA 3QXXA 2PZEA 2RGGA 1KJWA 3VR6A 2RGXA 4IEIA 1G7CA 4M1KA 3L0IB 2QROA 1XD8A 5HCIA 1QBKC 4OQLA 4FMCF 3CNNA 1V43A 2JJ2D 1E4VA 3Q7PA 1W36C 4JLDA 2YWFA 2G3YA 4PSAA 4WOPA 3SEAA 5JCPA 4M1OA 4V0NA 4JL8A 4DLRA 4WAUA 2FFBA 2GJSA 3OIWA 3EPKA 2C78A 1MKYA 2CJWB 1LY1A 1AQUA 1GIAA 2CLDX 4A0HA 5LD2C 1Q22A 2IBMA 3L43A 2C98A 4N0EA 4XWOA 1MABA 3MWKA 1CIPA 2VQSA 2X19A 4NTZA 3P4XA 5AJWA 2DR3A 3EXAA 3EPHA 5KNCA 3TSOA 2C5LA 1A4RA 4HZIA 4LHVA 1II8A 4XTRA 1RRPA 2ZYVX 3H0KA 2ZRKA 4M1TA 3NKVA 4TL9A 4UJ5A 4DT1A 4Q4AB 2B7CA 2LWIA 1L7VC 2OBMA 2ORWA 3MJRA 4H9GA 4YMSA 4XVUA 5FTLA 5EP4A 1JXOA 3QXSA 3CPEA 1O87A 2XB2A 2GESA 3MRSA 3RYTC 3DDCA 2VTKA 1II0A 3T61A 3U4QA 4QJ4A 1T6NA 3WBKA 1DAFA 4I1OA 1O3YA 3LXRA 1BIFA 2ERXA 4HZUB 4Q1FA 3QKSB 3M6AA 4EJSC 2TMKA 2E1RA 2YOHA 4RZXA 2KWIA 4Q7JB 5C1BA 1X6VA 1W0JD 2R62A 2PBRA 1BMFD 2ODWA 4PC2A 5BN4A 1NLYA 3WY9A 1P61B 2GNOA 3QI2A 1P9WA 1N25A 3LBIA 3H2YA 421PA 3BJIC 2F1HA 5FL7A 2IHYA 4M4SA 2O8FA 5KSOA 4ZCLA 1JAHA 5K8TA 1X8KA 2QBYA 4R9UC 5FBLB 4TTRA 2GA8A 2EYQA 2J0QA 4PPNA 2HCJB 1XTKA 4DB4A 4A8JB 5FOUA 3L0SA 2ZVPX 3RSOA 5GJBA 1PUJA 1D2MA 1G21E 2OHFA 3A8TA 3VNUA 4D6PA 4ARZB 4JKYA 3SZRA 3H1TA 3DO6A 3Q5DA 1XD2A 3QKUA 3X1XA 4FINA 3T06B 2KE5A 3HU3A 3A4NA 2RGEA 2WM9B 3I4LA 2IYTA 4TYQA 2GJKA 1FZQA 1S2MA 4GNKA 1E0SA 4OJQA 2GCNA 4B43A 5FUVA 1II9A 1KOFA 2OEPA 1UBGA 4WBSA 2X2FA 4KITB 3W34A 3GP8A 1UF9A 2ONJA 3L8YA 4Q1CA 1ETUA 3EARA 3CRRA 4D0GA 4X8HA 3EC1A 4DLVA 2QM8A 1A2KC 1JB1A 4G01B 1G9XA 2BEJA 4GI7A 4P4TA 4Y0VA 5CIWA 4CYMA 4IEEA 3E70C 3R7WA 1W5TA 4PHTA 6Q21A 4DHEA 2WVJA 4UNSA 1KI6A 1XEWY 4HAVA 5HCNA 4FIDA 4B74A 1T0JB 1FNNA 3SOPA 1T8TA 2G0TA 5G40A 1OKKD 1UADA 4QJ5A 1NN0A 4DDVA 3I73A 2V55B 3BC1A 4HSEA 2CHVA 1HQYE 2IUTA 5CK5A 3C7KA 4D4KA 4EPRA 4EJSB 4CDGA 3GJ0A 3JZAA 4TMTA 1JI0A 5E4FA 1NIPA 3WHKA 1NMYA 2OUKA 2BHRA 3X2SA 1TEVA 4NCJA 3SE0A 1YRBA 4M1MA 2F6RA 2PCLA 1CJTC 4IHQA 3CWQA 3RS7A 4BEJA 5AJZA 4DLWA 1WXQA 4KFTA 3AVTA 2J7PD 2IC5A 2BOVA 1FQKA 4A2PA 1P9NA 1NI3A 3X1DA 1W36B 3AF3A 2XEXA 1UBEA 2Q9CA 2OESA 5FI1B 4BFWA 4RD0A 2N1BA 4HATA 4URZR 1KSHA 3QXJA 1ZM3A 4L9SA 3CPJB 3WYGA 2GK6A 4GMDA 1SKQA 3LRPA 3UKDA 1FTSA 1N5JA 4XVQA 5DYIA 2RHDA 5FTKA 4LHXA 4A6PA 2DCUA 2VSXA 5KHOC 1E0JA 2CNWD 5HKKA 4RD4A 3KQLA 2ZSDA 3U61B 5EUQB 2J0SA 4TWZA 4DSNA 3I5XA 1N0UA 5E7IA 1KDRA 3SBDA 1ZU5A 3IPXA 1GSIA 4C7OB 1ESMA 1DVRA 3NBYC 3THOA 2BM1A 2ATXA 1N6HA 3GQBA 4MKIA 1N6OA 4S35A 4GDFA 1GOTA 1FMJA 5KTYA 1NVVR 2VA8A 4HB3A 4MITA 5C18A 2P5SA 2Q6TA 2Z43A 2GBLA 3TLXA 3OAAD 1RE0A 2IYQA 2WOJA 4XD7A 4B2IA 2WJVA 2BEKA 1SVSA 1AZTA 2JIZD 2F3TA 5L3QA 1AKYA 4AWXA 3GEEA 2GVZC 2ZROA 1OF1A 3OF5A 4EQ6B 4BECA 1XJCA 1KDTA 1QHGA 4NBSA 2R65A 1P75A 3U3KA 3P20A 3VMFA 4C7OA 2WPDA 1FP6A 1IXZA 1EWRA 2QPAA 5EUMA 1KNXA 3TJZA 4FCTA 2OFXA 4ASUA 2OFOA 2VP6A 4UKDA 3DEFA 3T35A 1SGWA 4EPVA 2QMHA 3CF0A 1UDWA 2QT0A 1J2JA 1XFAA 2FPLA 4QHTA 2Y8EA 3W6NA 1GDDA 5FL3A 1CKEA 3V4RA 1W4AA 2HEIA 2I3BA 4YDSA 5SZHB 2VEDA 3VHXA 3K09A 4PC6A 2WAXA 1Q20A 5IK2A 4QBIA 4LUCA 1OIXA 4JLMA 2B7BA 4JLJA 1NY6A 2GXQA 3CLVA 3QBVA 2FNAA 1KI9A 2YC4C 1N2CE 4E22A 1Q3HA 3O8RA 2FPKA 2ZITA 1L8QA 3DHWC 5HE8A 1TU4A 2VL7A 1OB5A 3BH7A 4NCHA 1I4LD 1G5TA 2IYWA 1QZXA 3N5CA 2ZJBA 4JLOA 3R8FA 5ELXA 4TMWA 3EPJA 2CMKA 3AVQA 2L0XA 2GCOA 4DLYA 3N2IA 2W0SA 3QOFA 3ZD6A 4RJLA 1KHTA 521PA 3HR7A 4B47A 2AWOA 3AF1A 1YU9A 4M1YA 2GZHA 3CBQA 2Q0HA 2DHRA 3LVQE 4OI2A 2IF2A 2ZQ5A 1EFRD 3CO5A 4MGYR 4AYWA 2ZANA 2CBZA 4KFUA 1WE2A 4FCVA 4K46A 3UWKA 1E32A 1ZNZA 1WMSA 3I8XA 3K70B 1AN0A 3IBGA 3IGFA 4DZZA 1B23P 2GEVA 1E2JA 2QMEA 1HV8A 2IYUA 2IYVA 2OILA 4UNQA 2XSZD 1IAQA 3LNCA 4WW0A 3THYB 1WB9A 2ZI9A 3WHLA 3VX4A 3CF6R 1U99A 3R20A 1TPZA 1FOEB 1SXJA 5DGXA 3U2QA 1OH5A 2VP9A 2NOAA 1U94A 3DZ8A 2XX3A 4A6XA 1NBMA 3NWJA 3GLIA 3B1VA 2GJ8A 1U9IA 1JAIA 4LJ7A 2EVWX 2OLJA 2REBA 5FR2A 4JKIA 3BERA 2ONKA 2A5FA 1NF3A 4I4LA 3OEED 1M1YE 1E99A 1G3RA 4PQYA 4ITRC 3K1JA 2O8BB 2ATVA 2UKDA 2IF0A 3KKMA 1G17A 3VHLB 3ZGXA 1CJVC 4Q7MB 3UG6A 1NN1A 1W4RA 3AUYA 1PJRA 4RD2A 3F8TA 4RD1A 4V0KA 3V9PA 3KQUA 1YZTA 1F60A 3AKYA 4I81A 3KJIA 1GNQA 2G9NA 1I2DA 2FZLA 1GUAA 1MH1A 4PC3A 5EXPA 2GXSA 1UFQA 1H65A 4NYIR 4JVSB 2DFKB 3OEEA 1Z3IX 1EX6A 5DLQC 2D7CA 1KKMA 2QQ0A 2C9CA 1QHHB 4CT4B 3LW7A 5K8UA 1XTJA 4II7A 4ACBA 4BFYA 2QQEA 3BB3A 1XB2A 2JJ8A 3FKQA 4JVLA 2IEZA 2BWJA 4RFSB 4DCNA 3U6BA 3CX7A 3FVQA 3GJXC 3PFIA 4V0OA 5JJIA 1KI8A 4PTLA 3CM0A 3HYTA 2IA5A 2D3WA 4AD8A 1S9DA 4KVAA 1JR3D 1BOFA 4CT5A 1EG7A 4N3NA 4AYTA 5EXSA 1NNEA 2XXAA 2XNDA 2Q3MA 4JT2A 1W47A 3SBEA 3BXZA 2ZI4A 2OLKA 4G1UC 5JWHA 3WYFA 4BLPA 4XSGA 3GLFE 5F9HA 1Z2AA 2BBWA 3UG7A 4TMKA 2XNSA 3EX7C 4AKGA 4UXIA 2EFEB 3ZDQA 3DVLA 2Q21A 3QQ5A 2ZE8A 2AD5A 3AV0B 4NE2A 4Q1BA 4OHVA 4POAA 2VP2A 4FMDF 2JAQA 3ICEA 3IO3A 1RYHA 2CCKA 2ZR0A 2RH5A 3AP3A 1YR8A 2AK3A 2NO1A 1H8EA 4XWAA 1SHKA 3ZVNA 2N46A 2V1XA 4TYPA 4QJ3A 2FSHA 3SHFA 1CLUA 4RCZA 5D3MA 4D80A 1MOZA 1NLFA 4ASUD 1S4QA 4EUNA 1E4YA 3WMGA 1W4BA 5KPJA 1J90A 4YMWA 1JPNA 2ZETA 1KO5A 1RVDA 5FH9A 5JCZA 4KLNA 4ZKEA 4HUTA 1IQPA 3W6OA 1SVKA 1ZM4A 2V8OA 2VF7A 3K0EA 1QDEA 4QGGA 3SQWA 4QM6A 1PLKA 3AUXA 4F4IA 4MGZR 3A1TA 4LBZA 2AK2A 4CEJA 2ZRLA 4HLUC 3FMPB 1OXUA 3AQ4A 2CVFA 2O8FB 4FD2A 5LBIA 1DARA 2VP5A 3NHBA 3SFZA 4XJXA 4GFDA 5H8WA 2YC2C 4BEBA 2RGNC 3LDAA 4P33A 5FUYA 1Z5ZA 4IRUB 1FTNA 4URUR 1UDXA 3DMNA 3F3YA 1K5GA 3P1JA 4HLUA 2H16A 2YHSA 1SVIA 3GD7A 4Q02A 3SYKA 5H70A 3T15A 1R0YA 4DCSA 5BYKA 3T1TA 4Z1MD 3B9PA 2UZ3A 4TMZA 4OJKA 2RB4A 4RD3A 3S1AB 4A8JA 2NO7A 3PIRA 4BFXA 2OSBA 1XTIA 5H68A 3B6EA 3H86A 2F1RA 4Q7KA 2OFWA 3SI7A 4KCGA 1E1QD 1LB1B 2XNDD 2ZRHA 4MRPA 3K9NA 4OKSA 1YJ5A 5BN5A 1SQ5A 2WWWA 4YONB 4GOXA 1GVNB 1U9IC 1OLOA 2ZAOA 3I61A 2CE7A 2JIZA 5G3YA 4DDTA 4TLAA 3V00A 1G8PA 1LTQA 1X86B 2QPTA 1R0XA 2P67A 3W9YA 1DAIA 1GKUB 2LKDA 3LD9A 4JMPA 1G3MA 1HEIA 1YZNA 3FWYA 4NYJR 3RSLA 2HXSA 2IWRA 5UKDA 4LZZA 4EPTA 4W9MC 2QZ4A 1AM4D 2J7KA 1ZYUA 1R0WA 2RMKA 1P6XA 1SVOA 2ASEA 4BE7B 3BB1A 4NONA 5AUOB 1ZP6A 2VLIA 3A4LA 3D3QA 4F93B 2Q3HA
chains in the Genus database with same CATH superfamily
4BLQA 2JH3A 4DMLA 1OSNA 3B8HA 4Z4HA 1HE4A 5F4ZA 1ZOOA 1XMPA 3KZVA 2H54A 3OI7A 2Q3FA 4A2QA 1SJ9A 2GWHA 1XEXB 2RGUA 3DOJA 4DNPA 4KUEA 3K9WA 2ES4A 1YCFA 3SXPA 4DYVA 3V6LA 4B81A 5LDDC 1TECE 2ZS8A 2ZT8A 3H4VA 1PHRA 4WLUA 1MX1A 2AZDA 5AUNB 1KOJA 2BISA 1CFZA 4Z1OA 1GL7A 1VZ2A 2G83A 4PIVA 4I50F 1FRQA 4D8UA 3L7DA 4ZYVA 4MAFA 5IDVA 2WJAA 2IYRA 5HILA 5GINE 5EOVA 5EMLA 1AHPA 1VJTA 1JH8A 1ID8A 4YAKA 1XE3A 1PWHA 3BCHA 5C81A 1CERA 5FWXB 1XF1A 4P3PA 2GBGA 4S1PA 2CHUA 3FOFC 3TCKA 3C7AA 2Y05A 4WZAB 1SVNA 5AVZA 4KVZA 1URPA 1XNGA 5HKOA 1ZN2A 2ZJ4A 5KSYA 4I9GA 4R5HA 3TG2A 1DX9A 1TQ4A 1Z0AA 4R68A 3H5LA 2X0IA 1YOVA 221PA 4G8CA 4BO6A 3F7OA 2QS9A 4PGGA 1GQQA 5JJLA 2HK9A 1IG0A 2GM3A 2ZBUA 3QV2A 5IKPA 2GN6A 2I3DA 3PX3A 1N6NA 4C08A 1PEYA 4ZTUB 1M5UA 2Q4RA 2R751 1PJCA 4RESA 1Z73A 2VSQA 3DOHA 3RUAA 2COEA 2H2GA 1P7CA 5DI3B 3LTEA 3T3MB 2PEYA 2WAYA 4CE6A 4OX9Y 2VO1A 4MS4B 2ZUCA 3G8BA 1Y48E 1S01A 3F67A 1X7GA 3OT1B 5JNVA 2AYZA 2A14A 2FX3A 2WF7A 3VOSA 3G1WA 4YRZA 4WTOA 4F4FA 5EZYB 4DCVA 4LV5B 1HT2E 2JKYA 4IUDS 4WXMA 1WJGA 2Z2ZA 4EKGA 4PSUA 3SZUA 1XP5A 3NHJA 5KU1A 3W5AA 1KZYC 5FLEX 2NXJA 1DMSA 4X3PA 2I6SA 2K4MA 3O4GA 3GJ8A 821PA 2P1ZA 4JP5A 4DV5B 4BV8A 1RD4A 1SKBA 4NP6A 2R00A 4DSAA 4QUIA 3LCRA 3ZU4A 1X77A 2GBLC 4P2BA 2QD5A 3MTQA 4UDXX 4F2WA 3GLUA 1I7PA 2O8DA 5BR7A 2QQFA 3KZ1E 1LWOA 2NAPA 3HN7A 2W6ID 5ITWA 1NWHA 4AG3A 1I2MA 1NF2A 1FXWA 2J09A 2W9XA 2XMSA 2WKRA 1GZHB 2XWJI 3FPKA 1EH5A 7REQA 3LHKA 1JBEA 1QTQA 1I0ZA 5HZKA 2P9ZA 4KDEA 1M1ZA 4KNYA 1QU3A 4RE5A 1SCIA 1GPWB 1YS7A 3CX8A 3PP8A 1AUPA 1FUEA 4O4HB 3ZZNA 2A0KA 1CR1A 5K6AC 4IHJF 1VIDA 1JJFA 2QRNA 3BA6A 4H15A 1G291 4TMXA 4N5DA 4O6VA 5NLLA 5IC4A 4MJ3A 3RC1A 1H05A 3VSDA 4P4GA 3QYFA 1P4RA 4PFQA 2R9VA 3IRUA 1GGVA 1M75A 4YECA 2I3ZA 1TD1A 3F7MA 5DXFA 1U4SA 5ICGA 3GCGA 1Y3FE 3HUEA 3BB4A 4F8YA 1YL7A 1QYWA 3IURA 2UU9B 3EZYA 3GGGA 4IF4A 3IKVA 3IR7A 2QGZA 3PE6A 3V4SA 4DBLC 1LSOA 3WYCA 2FZ5A 4AN0A 1NN5A 1PGNA 3N87A 3HU2A 4URXR 2FFAA 3PWTA 4JP2A 2V58A 4ER3A 4LOKA 4TZ6A 1J49A 1YBHA 4RJIA 5EZSA 1N5RA 4EPYA 2O0JA 4EVQA 1U3TA 2I5PO 1H85A 5EZYF 1AH2A 1AK1A 1QVAA 2BUCA 2XVXA 3GNLA 1HDGO 2W42A 2JA2A 5KDDA 2WTUA 1T5BA 3RDPA 2O8BA 3IP5A 2B8JA 4HEJA 2HJWA 3GCWA 4E15A 3A26A 4FN5A 4HBZA 3KEMA 3UFBA 3EPLA 5KI6A 1U0OC 2C2HA 3NCTA 4QJIA 4JHXA 5KOYA 5BORA 3C16C 3H8SA 1Y1QA 3MMSA 1DP4A 3H5WA 4IJVA 1YB4A 1YB2A 2ZT6A 5AKYA 2ZI7A 4J0IA 2SCUA 4ZTBA 2D4AA 2YXPX 4B4VA 3BCRA 1YB7A 1RJFA 2PMKA 4P5DA 2XH8A 4COOA 1KDOA 3OP1A 6NULA 1P0QA 3OU7A 2P2YA 4OQZA 3ZWDA 1IUOA 5AVTA 3FFAA 4Y2YA 2REOA 3VR5H 3D6NB 3DFFA 4OHWA 3S2ZA 1T6YA 4PANA 5E1OA 3HSKA 3W3ZB 3EXEA 2JLZA 5LU9A 2V7VA 1D4FA 3K2QA 1FTGA 1F3OA 5I9LA 2JGAA 4KQ2A 3HDGA 4F2PA 1SHZA 1J0DA 4WGFA 4EZEA 4V38A 1G4AE 2AG5A 1FQOA 2P0YA 2ZYSA 4GZ6A 1E2UA 3CN7A 4LMPA 4V3BA 3RASA 3QX9A 3SE7A 4ML3A 1FFYA 5TMPA 2J9GA 5JLAA 4QYTA 3RRNA 3ZVKA 3LXUX 4ND5A 2OWDA 2FPUA 4EG8A 1Y5NA 3VBCA 3JQGB 3HXMA 3G8DA 1QV6A 3VBEA 2F1JA 1QQ5A 4R8MA 4UNPA 2QN2A 1CY2A 2ZWPA 3C24A 4ZJZA 4DDWA 1N0WA 1GSHA 1NKVA 1QE3A 2FUNB 1AC5A 1JWAB 2OBNA 4QDXA 3IIJA 4B2LA 5KTKA 1P1IA 1UC8A 3TJRA 1REQB 3HKBA 4NHOA 2BI4A 2FJ0A 1CUAA 1MVLA 2B9EA 3QJYA 4F9EA 1J56A 4YMHA 3DEJA 2CCGA 1L5YA 5FOSA 3EVZA 4UAVA 4ER7A 1OXMA 4GBJA 1DFIA 3WKEA 1KMHA 1AB5A 2CFRA 1DBWA 1VCNA 4IV8A 5HS4A 5KMGB 3T0IA 3MB8A 5DGDA 2A94A 3AHIA 3HGTA 4PO3X 5EIBC 2PX4A 4LFBB 1UKYA 1QMGA 4RTRA 3WLIA 3KHSA 1XVAA 2ZBQA 3ZHBA 3FWPA 5I7AA 2X0DA 5CBPB 5IFKA 2EQAA 3D3EA 5JV5A 3CUWA 1T4CA 2GKGA 5B7QA 3NTUA 1KTVA 2SICE 3JD4A 3Q3JB 4V1CB 1QVZA 2GDZA 4N6GA 2XYVA 4YQFA 5C37A 1TEZA 4K6CA 3MCTA 3QYPA 1ML3A 2WHYA 4B0PA 4P4NA 2OWEA 2VYNA 4E5UA 2HHHB 1QYVA 2OBXA 3D0KA 2I22A 4Y2PA 3CVXA 4IQFA 5BSGA 2BRUA 3NHLA 3PWKA 4L2IA 2VWPA 5FPKA 2X1LA 2NU6B 2FU5C 3G49A 1VMDA 1X1SA 2I6GA 4FNAA 2PXAA 1KA9H 4Q47A 4U3JA 1BA3A 2XYHA 2MSEB 3DL7A 4ANFA 6REQB 3U5TA 4F5DA 1ID1A 2QD4A 5E0KB 3LC2O 3TBKA 4ZA2A 3EA5A 3R23A 2N0SA 1G3IA 1ZW6A 5LU8A 4KO2S 1R6UA 4PCAA 2C96A 5AI0A 1R5OA 1PYOA 1GTMA 5D87A 2AX4A 4A5OA 4GYYA 3RC3A 1W9HA 3I2JA 2NO9A 4DSUA 5B7NA 3AR5A 5KWEA 1ZHOA 4CIDA 2NPIA 4DC1A 1ZH4A 4Q3OA 3B53X 3ZWAA 3FPFA 5IHPA 5JQGA 4INZA 4LC9A 4F84A 2QRPA 3MFQA 1T24A 2M98A 4FFPA 4EW1A 1AUOA 2N1MA 3OZEA 4ZKDA 3LHIA 4PLCA 1Z68A 1VCOA 4HY3A 1L9XA 5CA1B 3NNSA 1W8IA 4CHGA 4MV3A 5D7BA 2Z57A 3KK0A 1GAJA 4BDTA 1Z8FA 3GJ6A 2ESRA 3HUTA 3O2SB 4XRGA 2NTYC 3GPIA 2VPIA 3HP1A 3TOZA 1NZDA 3BTOA 1T3HA 1N0VC 1NZJA 2ZR9A 1Z7WA 4H6VA 3TMYA 2QX8A 2V9PA 2X22A 4NYIQ 1XXHA 4P38A 1K7FB 4UE6A 5GVRA 4BVJA 5JRJA 5ILGA 2VWGA 3M4YA 4XSHA 4JI3B 4XWKA 3TE7A 5DO9A 1T29A 2JBWA 4TXLA 5JO9A 1SD2A 3DOUA 4AURA 4BOYA 2WD7A 3ESCA 2OAGA 5CX1A 3V7WA 5J5CA 4C04A 1MAHA 5CPBA 4EUEA 4DG5A 3NH9A 4YC7A 1PT5A 5FHQA 1ZJ6A 1PAUA 3ZHXA 5GY7A 3KE8A 3S5JA 3ROTA 3IHWA 2ZB7A 3AB7A 3FMFA 2FLKA 1SUAA 1P74A 4FI3F 4YI3A 5TPZA 4D81A 3ZCSA 3PHHA 4PZAA 1E2HA 1Z83A 2A1TS 2BFDA 2X3YA 5C1PA 3GJ7A 4IFEA 2YJ5A 3BMNB 4V0QA 5C5CA 3VU9A 2VZEA 1ABFA 2RKWA 1C0LA 1M1NB 1UT8A 4NBWA 5CT9A 1T9HA 2ZB2A 2D06A 5JXWA 1GQOA 1DIAA 2Z5LA 4E5NA 1Z45A 4LCEA 5DHUA 4D6YA 4J1TA 2A33A 2XCRB 1BSVA 4U7HA 4AJNA 2HBYA 1APBA 1EM6A 1Q44A 3QFHA 5I4BA 121PA 3OBIA 1Q7CA 2HJSA 3MCAA 5D3KA 4AP5A 4IQ4A 4KGXA 3LZCA 1G8AA 4U2FA 1ZGJA 4YCBA 4DDMA 5GIPE 1CU1A 2VP4A 2KW5A 2PX5A 1LPNA 3OCYA 1IZ8A 3V5NA 3FSJX 3AIKA 1X1TA 3IL2A 1WVGA 4PVDA 4TKVA 1MXHA 4C30A 1QZZA 2JVKA 3FFBA 3BXPA 2ISCA 4ZI5A 1RWVA 4DNFA 1S0UA 1TDJA 2JBAB 4M88A 2FR1A 3EGEA 1V3UA 1E4OA 2C3PA 1BJRE 1Z2EA 1C30A 3HKEB 5AW5A 1JJIA 1NHWA 1Q3KA 2XEDA 3GCZA 3EFEA 4RAOA 5A9SB 2JLXA 1YSCA 5AJYA 2XJ9A 2PH3A 5BQXA 2P90A 3QWHA 2QUIA 3BDIA 3LKBA 1X42A 4DW8A 5CLHA 4XWTA 4AS3A 3PNMA 3ZZTA 2AMLA 3PC8A 4M55A 4PTYA 1D6NA 3PNYA 3TIVA 2ZRAA 1FPMA 1E1CB 4OQPA 4YA6A 3CLTD 3DSRA 1KU0A 4CEJB 2HU5A 2FZEA 1HFWA 1FMTA 3G5AA 4QPDA 2W8BA 1HZJA 4FOLA 1S1CA 2V45A 2FX2A 3EQ8A 5H83A 1IOWA 1U4NA 3Q9NA 4FXPA 4MQ4A 4U8GA 1H4QA 4D9EA 1OLSA 1SXJE 1N7HA 1JSRA 2HMYB 2V5VA 3C6QA 3HYRA 3DULA 2UZ1A 5CM8B 1SRQA 1KYIA 1A8PA 5D51S 5BVHB 5FOQA 4QBGB 1SM4A 1UK6A 2CXRA 3EIUA 4L02A 3M2TA 2NUAB 3TLMA 5KWIA 1KYZA 1GZ6A 3E82A 3QH4A 2BZ0A 1GNRA 2WJ6A 3LCJA 4IQGA 5AK5A 2B21A 2UZIR 3UCXA 5C32A 1HE3A 3KX2A 3ZKWA 3ROFA 1EIWA 1E63A 4PLZA 4L5CA 2IYFA 2L19A 3SF8A 2O7SA 2VHXA 3JVIA 1XYGA 3L7JA 4YASA 1SNYA 5AVVA 1A27A 2B8TA 4GKAA 4IIXA 4BPRA 3PPYA 4D3FA 1KJQA 5K5EA 3C3YA 2QX6A 1ZD9A 4NARA 1YL6A 1NJ8A 2JLBA 4ISCA 2OZKA 5ICMA 4GXNA 5I7WA 2JA1A 3HA3A 1WCWA 3CJTA 2IYPA 1Y1TA 3AW9A 1J42A 5A9SA 4G4SP 1XZLA 2VTDA 8ABPA 3HMQA 4WQMA 1OFTA 2YQ4A 4RXTA 2V3WA 1FL9A 3OWHA 1UOEA 1SOUA 1J2TA 1KVQA 2X5NA 4IR7A 2VRCA 1W8DA 3SY8A 5TEVA 5C51B 3QA9A 1EVEA 2WSBA 2DR2A 1EBUA 2PWBA 3TB6A 1KYWA 4QGBA 1YRHA 1Z9BA 1NVTA 1SWWA 2B8EA 2VBIA 2FMXA 4IJUA 4HUQA 3HO8A 5AJTA 3VR6H 5KS2A 4H1VA 3G2QA 2O20A 2DH6A 2GZDA 1NATA 3RS3A 4OQMA 1K08A 3EEOA 5ENVA 5DASA 2VC2B 2ZRMA 3EULA 2X1HA 3IUYA 5H3LA 3W5IA 3HEAA 3OT4A 4X65B 5IC5A 3RARA 3G82C 5IVKA 3B36A 1SXJB 4YQZA 1C3EA 2VOEA 2TSYB 4L73A 1ZRSA 3TFQA 3ZE9A 3PXUA 1QGAA 2JD2A 3R7WB 2Q4DA 4UHJA 4QOIA 1TJPB 5T4HA 1J39A 2X0KA 4P7BA 3U4IA 3SS8A 2PPLA 2P2CA 2EJVA 1OI7A 2X2PA 2YWGA 3Q3EA 4INOA 4YMTA 1TA0A 3GPLA 3PRJA 4L07A 2BMJA 3G8AA 3IMCA 2G1JA 1J9EA 4TSRA 4LF9B 2AV6A 2ECFA 3TPZA 4ARBA 1R8SA 4GOMD 4OHMA 3NAQA 2M2IA 4WN3A 1YUMA 4V0LA 3INNA 4WK4B 5M2QA 1SUEA 4OYLA 2EP8A 3N2GA 2B3TA 4MWTA 3NCHA 1U0JA 2P62A 4BQEA 4DA0A 2FN7A 5FB3A 1JVBA 2GFQA 1O95C 1XZJA 3UPUA 3ABZA 3DDOA 2BP7A 3N2KB 1KZ4A 4MIKA 3IAM1 2NV2B 2EIXA 2AJCA 3DWGA 3LBYA 3I05A 2JI8A 1ZRHA 4HAWA 1YDGA 1K06A 2WT4A 4BQFA 2O3JA 4JX9A 5LXTF 1GTSA 1J99A 1YF3A 4KO1S 2DEUA 2YVQA 1V71A 2YHIA 3MRXA 3KDPA 2BF7A 3WWPA 3I9V1 4KQCA 4FDUA 3ZLTA 1MB9A 2EP7A 1F9AA 4D41A 1HYBA 3K8YA 1VLLA 1JBKA 3G9XA 1SY7A 4PQGA 3M82A 5TEWA 1OH6A 3S2UA 1XTTA 4HB4A 4UHKA 1GNSA 3B2NA 1CVIA 3CRMA 4EI8A 3CNLA 3WB1A 3R3JA 1I6LA 2BGJA 3LCMA 3FRHA 4E5PA 4OHKA 4BGEA 3BGSA 4GXTA 3VAAA 3AXSA 4OP2A 4KDRA 621PA 5I4IA 3S44A 3M5PA 5BXQC 5CYPA 1XZBA 1VA4A 4F3KA 4W7SA 4XJVA 3AJRA 5KVVA 1DWPA 1ZXBA 3IQDB 2Y1OA 1TUIA 2XMRA 3HJNA 4EJSA 5KYWA 3CEPB 3I64A 3SCZA 2H07A 3ZHSA 1RSZA 2OCPA 1UP7A 3DPIA 1MAWA 3VYTB 3GVXA 1E9RA 3GLGB 5JD6A 3EQ6A 4II2A 4ZRNA 5AW3A 4UQOA 3PR3A 4MYTA 2CXSA 2KI5A 5B1SA 2NU9B 3PUKA 3SZOA 1NVGA 4YUWA 2E5LB 1YK0A 4M0PA 2G9QA 3PRKE 1IHXA 1N9KA 1Q91A 2B1JA 1KFKB 3LHFA 4FFBB 1Q7EA 3PTLA 3ENVA 4YRFA 4ZO6A 4ZZIA 1CY8A 1Z2DA 2AC4A 4X1YA 3FGNA 1JXAA 2NVUA 2JI4A 2NO0A 2VK1A 2C2KA 721PA 3ZGZA 4YTEA 3QBTA 4R3NA 3V8PA 2QN8A 3LA6A 4LCJA 4O2LA 3I9NA 5G4LA 1G7RA 3UMSA 3NMUF 2GD6A 4RY2A 1B0PA 3ANMA 2EZ9A 2C2OA 1Q1EA 3LY5A 1KDPA 1F14A 2WUEA 2YH2A 5IH3A 3MGBA 3KJGA 4GI5A 1QPZA 1U0BB 4RKRA 4ARCA 4MKXA 4FBLA 3TJMA 1WIWA 2PZFA 4K6GA 4IXNA 4C14A 5BY2A 2IXDA 4U9IS 4PAGA 2BMWA 3CF2A 2R4QA 3K8ZA 3GF4A 3RWOA 3T7EA 5JECA 3QP9A 4K26A 4QD3A 1BYIA 4AKIA 2V0NA 2EWMA 3H4MA 5DHTA 4H7PA 3E81A 2YJ3A 4IBOA 1ZI8A 4Q6WA 2C5AA 4X20A 5DLYA 3OOEA 2GFIA 5J40A 2B92A 5FWYA 3CLRC 3EPPA 4HLCA 4WN9A 3V7NA 4CM4A 7REQB 1QRAA 3EIQA 4AM8A 3PUZA 4M83A 3PNVA 3QLVA 1E7SA 1YGPA 3WSVA 3A3KA 2D4HA 1USGA 2R8XA 3D7LA 1FNDA 3HCCA 5TARA 3DOFA 4CMHA 4DARA 3OY7A 2HMUA 3MJVA 4R98A 5HIIA 5KVQA 1FYWA 3DZDA 4QSHA 1YRYE 1DGQA 3NUZA 2GAIA 3SDZA 3LAWA 1I3CA 3DV0B 3BICA 5G0SA 3KYJB 5KWJA 2D5BA 1SD5A 1N9GB 1MQ8B 1DS6A 4OXNA 2VJAA 3AP2A 4BCCA 2CXQA 4L95C 5FAKA 2W2OA 3A31A 1TYZA 4P2GA 3QE9Y 3A0RB 3S99A 3G68A 2AN9A 2PZAA 4HYQA 3PL1A 4U7PB 2G9ZA 3OZWA 2ATEA 3THRA 4F7WA 3KFXA 3ME5A 4NU0A 3NYRA 1RPJA 5FA5A 4C01A 2F62A 5JNUA 4UATA 3PCRB 4HFRA 4YUZA 3Q9SA 3WNCA 4IMJB 4CNBA 4L76A 2JW5A 3OZAA 1V41E 1ZC3A 4QPJC 1LF5A 2QUZA 3DV9A 1K7SN 5JZ9A 1LK0A 1W87A 4YLEA 5C1IA 2IUUA 5ALZA 3SQOA 3AETA 1R3UA 4EFDA 5JAOA 3IDOA 3ONNA 5B1HA 4JDUA 1DCMA 4X71A 1ZFNA 3B48A 4LNHA 2EKQA 2P6OA 1JA9A 4G24A 1G8FA 3D8RA 4CMGA 1QR6A 2IXEA 1TM2A 3M3HA 4QOEA 1FSFA 4AJ2A 5K0LA 1QP0A 1QF9A 2BGUA 1R2QA 2K87A 1J5PA 2RIPA 3MJFA 3N6RA 4HOYA 3IQWA 3O75A 1IQ0A 2UXBB 3JQBA 1EU1A 2VJDA 4ZQHA 3JWPA 1EVIA 1LVGA 3TLBA 4YJ3B 1NBME 3ETGA 1P0MA 1SXJD 5JDCC 4CG3A 4HN4B 5CIQA 2ID7A 3BM5A 3LWNA 3UWPA 4RULA 3ZV7A 1XP8A 2QSJA 3FYUC 3ZXUB 4BLOA 1NN3A 3E8XA 1YCDA 3QZUA 4M1WA 4U00A 1YB1A 3BTUA 3EVGA 2JB9A 4FHGA 2CJXA 2JK1A 4XYMA 4E32A 5A4FS 5FOXA 3C4JA 3ZKWB 3AR6A 1HZZC 3P9IA 2MOKA 3EYWA 4Q1DA 5T6MA 1IPEA 1Y98A 1OASA 5EJMA 3EG5A 3N2YA 5C1OA 4EW6A 4AKHA 1YHZA 1GXSB 4BP8A 1J9ZA 3EEYA 2VDOB 2WJJA 4FDAA 3T5MA 4PVCA 4YXFA 2PSDA 2R85A 2VKTA 1Z4PX 2VPPA 1ECCA 5EPOA 2V3CC 4QE3A 5J59A 1C3LA 3QF7A 4RK4A 1FF9A 3R6GA 4XQEA 2XDQB 3SM3A 1IL0A 3H0EA 4LV6A 2VUTA 3ZOKA 1YQEA 1MO6A 5EIEA 2DETA 1JDPA 1MVOA 5AT1A 5CA0B 3NNDA 1FX0A 1P1FA 1BDJA 5F1PA 4BNDB 5DBHX 1CQWA 2G76A 4NR0A 3OTGA 1L7MA 1Q5PA 1QC5B 1ZICA 1M74A 1P0PA 1XDSA 3PGKA 1IY1A 3D5QA 4NEGA 4PLTA 4FW9A 4MQEA 5AD1A 2LV8A 3C2QA 3MS2A 4GSKA 4Q34A 3DMFA 1CZLA 2R84A 3KYDB 5GADl 1VDZA 2CHQA 1TB4A 3KZKA 4L78A 1YJBA 1YMQA 3W3AD 2PYZA 2X9LA 4RACA 4DWOA 2ZPUA 2Q6LA 4L28A 3WA6A 1ZCBA 2I80A 3K05A 2R5NA 3O2QB 1VBKA 1KH3A 5H0IA 5HX7A 3TZLA 3WFZA 3U7FB 3LUBA 3NHMA 3FCSB 4QC2A 1NG9A 3DB1A 1LF0A 1QFXA 3CLUD 4FLFA 4RQUA 4TMYA 1A77A 3BMCB 3HM2A 5THKA 1SU8A 2QTFA 1CJSA 2YASA 1GUZA 3H75A 2IE8A 5DMHA 1VI6A 3TUZC 1TTTA 3GO4A 5IJXA 1NRJB 1Y6RA 2JFPA 2OO5C 1YR9A 3FB1A 2YCBA 5AO9A 3VR6D 1E2QA 1A3CA 2F9MA 2EG5A 4G0OA 4MARA 3S4YA 4DTCA 3TX6A 2WOOA 2XUKA 4EYGA 5TQ2A 3SJCA 2CW5A 2X76A 3ZZUA 1RABA 3T1QA 5EJ7A 1N7GA 1LPPA 1WY5A 3SR0A 2QJFA 4IEFB 1OZGA 1JHQA 2PL1A 4NF2A 1F0NA 1LFDB 5K0GA 2HRBA 4MRNA 2MSCB 4L08A 2DFTA 4BMVA 5TRTA 4Z1MA 1VPVA 4RVUA 2XDAA 4L7QA 3FPLA 1PFWA 4MYCA 1Z29A 2XT6A 3MQ2A 1QGZA 4O2BA 5FBKA 1M2EA 3A37A 2ZTHA 5EZ5A 4LK2A 5F7ZA 4LJKA 3QY9A 4BWGA 1ST2A 2HMAA 1A50B 4C4PA 3OKFA 3ZY6A 2QLNA 1N2BA 3CF4G 2H4ZA 2R8BA 1V8ZA 3HDTA 2J08A 5IAJA 5IBQA 3ZQ6A 2H92A 3IERA 2W83A 3MN1A 1MC4A 4FX2A 4Q4JB 4BB6A 1OFUX 2F43B 2ZPTX 4LJLA 5AVSA 1EDEA 1NXTA 1RPNA 3P2YA 5EHNA 5BQOA 2RONA 3X1KA 1RXVA 2J0UB 2FMHA 4QRIA 2G63A 3AY3A 2JKZA 1CUJA 5JFOA 2RDMA 1KRXA 3U60B 2J4DA 4DLNA 1QHYA 3RRMA 3DLIA 3KKPA 3L18A 3LBNA 3SKYA 1I0IA 5JANA 1XVVA 1UBHS 4BWFB 3H42B 1MNQA 4IIYA 1G5HA 4G07A 4N4AA 4OCZA 3M34A 3T7CA 2W2QA 3WHPA 2ZZMA 9LDTA 1TF5A 4GX2A 4L8GA 2QD1A 3PD0A 1XXHB 4XH9B 3RT7A 1DTSA 3Q1LA 3ESRA 1G19A 2C7VA 3IKLA 1M2OA 2J5RA 4Z8XA 3DLPX 5F5LA 4F5EA 2D2VA 1V9LA 3SNHA 1OPRA 4KLRA 2IV2X 2FWAA 4FYMA 2ZUUA 1GZDA 2KBEA 3JALB 3T7IA 5A02A 4TRJA 5KNCD 5T5QA 5BSRA 3FVWA 4R16A 3T7SA 1HY3A 1YZLA 4PG4A 4RH3A 1V1RA 3H16A 3G2JA 1SG0A 1Y3BE 1J70A 2XCOA 1JECA 5TMEA 1JSLA 3I32A 5HF6A 2IW3A 2OXCA 1U9YA 2HK8A 2QORA 4J0CA 4BBAA 1MA0A 1RHUA 3HU1A 3TTSA 4H7IA 5C35A 1A9OA 3C3EA 4ZZ0A 2VR1A 4YRDA 1Q7BA 5A3JA 3NXKA 4AL4A 1UFOA 4KHPB 2II6A 2O0HA 3HGMA 4XA8A 4ZFNA 1MW8X 3HR8A 3VPHA 2CMFA 2PO7A 4DIFA 1IY2A 1AA9A 4D4GA 1I32A 2CDCA 3OMLA 5DBFA 4WBNF 3EXIB 3O9MA 4YJ2A 4BGIA 2HJGA 1WPRA 1E7WA 1R0CA 3EC7A 3RFUA 1SFRA 3TX2A 3CVOA 3GR6A 5CT5A 2WVGA 5LLSA 1E1DA 2GO1A 2CMHA 2REQB 1UUFA 1J1IA 2ZRGA 3D7RA 3DR5A 4FYIA 4JJKA 4LPKA 3IVGA 1VKNA 1XQ9A 3KEGA 1E20A 1GPAA 4LMRA 4RAQA 5CT6A 4BQSA 4YT8A 4X97A 5A7HA 2I78A 4J0JA 4R1PA 4Y2GA 3ZTYA 3GG9A 4KV7A 3WQRA 5J4KA 3PXEA 5JY1A 4COKA 2FZ4A 3ZW8A 2PX2A 1VKJA 2WJYA 3A10A 1NUQA 3O4HA 1T1RA 1A5AB 2IEDA 1RW4A 1V8PA 2A9FA 1UK7A 4A92A 2QBYB 2EV9A 3HI6A 4L57A 4HDMB 4GLLA 1XRRA 2HRCA 3N1UA 5TMBA 5LMNB 4I1RA 3L8CA 4ZPXA 3IELA 3BBPA 3FOZA 1RYEA 2X3FA 3CXUA 4MCJA 1GZ3A 5EJIA 4U2EA 1DIGA 2K2WA 4ZDIA 1HL7A 1JQ3A 5EE5B 5EIFA 4D4MA 1WU7A 4A9AA 1NXQA 5HF9A 3I2HA 1W85B 1W2GA 2WTXA 2YV4A 3ICPA 4TT3A 4C5CA 1G5IA 3RS5A 4DBVO 1JWLA 1F6BA 1R5NA 1U28A 3KWMA 1QCYA 5AKZA 4KFSA 5H4HA 2VAWA 2FWIA 3RAJA 3PC7A 1YUBA 3BIOA 4I1VA 3WC4A 1Q12A 1T9GS 2Y1KA 4I2VA 4LZWA 1W88A 2DY0A 3AESB 1T34A 2AX3A 3IJPA 4JU8A 1ISPA 4PPYA 3TAUA 2G80A 2CY0A 2HD4A 3GGOA 4KEAA 4WECA 3IQFA 4LX8A 1X1AA 1QSGA 2WQ7A 1ZBDA 1ESEA 1JLHA 1L7AA 3JQGA 4RSHA 2HSGA 2IX3A 1BE6A 1GHTA 2M32A 1J22A 4GPZA 2XQIA 3GFTA 5G0UA 3VI4B 2ON6A 1LDYA 4N3GA 2C20A 4WBNB 3U3MA 4P4SA 2H5EA 3QPWA 1SZJG 2G88A 5HFNA 4M49A 2IY8A 3WK4A 1OLUA 4CR7A 1NZFA 3LPDA 4PHFA 3T3GA 1WW3A 5C4MA 4D6XA 2ZT7A 4YV7A 5F5NA 1OJ7A 3WXBA 3R9XB 4C5BA 2YOGA 5TS3A 3H2SA 1QHSA 3E9EA 3MFYA 2AOVA 3C5VA 2AUTA 4MRMB 2BJWA 2FVXA 3TK1A 3MS4A 1ZD3A 3IHKA 4MJ7A 4TTPA 4WINA 5AM0A 1QOPB 2ODAA 4IUBS 4RJTA 1MOPA 4P8RA 3C3XA 2V6IA 1XF9A 2FQQA 3A4IA 4YYEA 4DEYA 2DB3A 1VSVA 4W5WA 3D2CA 2DBVO 2HQSA 3D4OA 2RH9B 5DTJA 5HW0A 1Y7LA 2FDRA 3IO5A 3LKVA 3KQHA 4GWGA 3KVOA 1JIVA 1N5OX 1PFQA 2FE4A 2YXLA 3TNDA 1EJ0A 2E3JA 1FP4B 1PZHA 2SHKA 2DSTA 4X7MA 3DXZA 1UXGA 2CYAA 5T64A 1WBDA 2WEKA 4J9UE 4FCWA 4DYHA 2VH2A 4LYAA 3SKVA 3KKEA 1DMRA 3UMFA 4MV6A 4AP9A 4CN9A 3X1YA 4DTIA 3LTNC 4N6OA 4URYR 3TOVA 2GFHA 3AHDA 2BFFB 2YINC 1O5IA 2E85A 2WU8A 2XA1A 3GAMA 4G1EB 1VOTA 4IJ5A 4KTTE 4Y2SA 4TLDA 2OAQ1 2HRRA 3AEQA 3BXGA 1U0TA 4OQNA 2BYTA 1ZAYA 5CNMA 4HH0A 4I08A 4LX0A 3VTAA 4RVSA 2YS7A 2HF7A 2AR7A 1O6FA 3EZFA 4LTNA 4B3SB 3PV0A 4HWRA 4P0TA 3NKFA 3QHQA 1XZAA 2QN9A 2QT1A 1MGPA 3V1KA 4MP3A 4CKYA 1IRIA 5KTSA 1E2FA 4OI0A 1U1DA 3L93A 3JAKB 2F48A 2ZLBA 3GJRA 4I7EA 1J09A 1V5GA 3EUAA 4FT2A 1AXEA 5FOTA 5C8YF 3RRYA 3K9GA 4KZKA 5ALJA 2JEYA 2KJQA 3TRJA 4U7WA 1M2FA 1U3WA 2YWDA 2FR8A 4K9RA 3VJKA 1QH0A 2OHHA 1H6AA 2JIDA 3RC9A 1DKLA 1FSSA 1VL2A 4MI6A 1E1KA 3FZQA 4OM7A 2NU7A 1ZLYA 5PGMA 4EP1A 4KPUB 2CXXA 3OQPA 4U2CA 1VXOA 1B41A 3GGCA 3UN1A 1IEQA 2CSUA 2EL7A 1VGQA 3HEBA 2HA6A 3EIXA 3PFGA 1OYYA 2J5XA 3ZYCA 3LJKA 1RCUA 3TW0A 3QG1A 1ZD2P 4ZO4A 4GZMA 5GGYA 1R8XA 2HJVA 4MINA 5LQKA 3K1TA 5GGXA 3HWWA 4KDFA 1PBTA 5AK0A 3SIRA 3W6PA 1PJ3A 2XVAA 3BWYA 2H0QA 4LVCA 3V8VA 4KQ1A 3ZV3A 1ESZA 2ORVA 2NZJA 3KJEA 3SHTA 4N40A 3UK0A 4B3HA 2QUAA 1JKJB 3W1WA 1KHHA 3CW2A 4M0FA 4HCJA 4MS1B 2JLVA 1IULA 1G8YA 1EQUA 1RQLA 3AZPA 2NU8A 1A9YA 2ECKA 3R6DA 3NTRA 3LGAA 3LK6A 4YDHB 1WUJS 1WQ1R 1KJNA 4QVIA 1EFUA 3HVUA 4O25A 4U7DA 1DIHA 1TVEA 1S3SA 3C6ZA 1NVBA 1WXGA 2RCYA 1V6SA 2GBFA 4NMLA 4RHFA 4LSGA 5CJJA 5DI3A 4F1JA 1TO6A 2AG8A 3M1IA 3A1SA 1SK8A 3AG5A 3E84A 3ZKAA 1N7JA 3M6UA 4E0BA 3X3HA 4BQIA 1O94C 3AOEA 4DC0A 5DK6A 1STOA 4ZVUA 2GF9A 1DG1G 5ALLA 4DZRA 5L4NA 1MD9A 5BOVA 1WCIB 1VIYA 4GGOA 4HLDA 5IXYA 2ZR8A 4NNOA 2ZUDA 3HO1A 1GXSA 5BWCA 4I55F 4IH9A 3BAZA 5T3YA 4QXAA 4TT8A 5FUWA 1SQFA 2O5VA 3MWGA 3K30A 2WUWE 4L16A 3PVSA 5M04A 1O7JA 3T3OA 4BGDA 1KAOA 3ICCA 1BH6A 2X9GA 4JVMA 3IAUA 4ZVQA 2EERA 3GN1A 3QFSA 4XUEA 3I6MA 5DSXA 1N33B 1Y7HA 4F12A 5KEIA 4TL8A 1HR0B 1SQGA 3DO5A 2YW2A 4XX0A 3U81A 2OAP1 3FKSD 1CPYA 4YRLA 3TLZA 4PHHA 1S8AA 4IDQA 3D9QX 3TNLA 3GL9A 3AXTA 2R7AA 1U3CA 5LP6A 3HCOA 3BCUA 1WB6A 4IFTA 4MLPA 2MYTA 1XRQA 2W5UA 3FUWA 4EB8A 5K0EA 1PGPA 3VHQA 3RJZA 2YWRA 3BPSA 1EBBA 1JHMA 2IYZA 4ZMRA 2WJGA 1CZOA 2M6KA 3K0BA 4YPFA 4UTPA 4HADA 4ZVRA 5CITA 2BKEA 3P5SA 1E1CA 3G5MA 4MW7A 4RK6A 3GLIB 1YQTA 1P7WA 5K3EA 1PI3A 2JIOA 2NSYA 2WHPA 4AULA 1NI4A 1NUTA 2JK0A 2ZSAA 3IBYA 4D02A 2ZB3A 1I2AA 2AOUB 2C94A 2HF2A 3OSZA 4UBNA 4C6TA 3IIKA 4V0RA 3VU3A 6ADHA 3UWDA 1T2DA 1T36A 4J2HA 4HN9A 4MV8A 4OMUA 1XG5A 2XTZA 1BKSB 2I8CA 3ESBA 5EE3A 3VR2A 3ZXIA 2ZRBA 3NATA 1RS0A 3KAPA 1L4EA 3LX4A 5K4HA 1NW4A 3K71B 4N9QA 1EX1A 1M3SA 1KYVA 4PC7A 1AKEA 1XFDA 1QV9A 2BFMA 5DIZA 2OCLA 3ZGOA 4CIXA 2I2CA 3KQKA 3KL2A 1QVVA 3FJ1A 3MMZA 4BNDA 4DFDA 2V1UA 4QOGA 1JLKA 1WCIA 2WYHA 4NENA 2O0LA 4JL6A 1TADA 1A9SA 1L7PA 2QG4A 2WM2A 3KQVA 5KVSA 2IWHA 3AF6A 1D4ZA 1DCFA 3NM5A 2DWCA 1P7YA 2P9CA 5I9SA 3H6GA 4CM8A 5GOZA 4X1KB 2DQKA 1DU4A 2JHPA 3MJHA 4KVFA 4OSOA 2ENWA 3PEUA 1NSYA 2EX1A 4NPHA 1JEOA 5SY4A 5JEDA 2QRVA 2FH5B 4DR2B 5LWHA 2PZ8A 4MV7A 2HWUA 2PA3A 4MJLA 2JFOA 4UAJA 4HDSA 3B3AA 3M9WA 2G6BA 5KKCA 2BKLA 2ICAA 4MVJI 1TUBB 4RE6A 4Z7QB 3MQFA 3SF0A 1NJ5A 2ID4A 2QGFA 4LIPD 4RTQA 5K6TA 3K2EA 3H4IA 1FC0A 3EEBA 5GZ1A 1SVLA 3EEFA 1NAHA 3G0HA 5IKMA 1PTJC 3FMIA 2WYUA 3FR7A 4AJEA 4BMPB 3AVWA 1COWD 1O0SA 2AF4C 2REXB 1RP7A 2ZRJA 3K35A 3S2EA 2OB1A 2OYCA 5HRCA 3BHNA 4Q1AA 1A04A 4OBWA 4RKYA 1NRWA 1XMIA 1RM3A 5ALNA 1JUDA 5EHGA 2ZJOA 4XSVA 5A71A 1PEAA 2E6UX 2R8ZA