1GRRA

Chloramphenicol phosphotransferase in complex with 2-nac-chloramphenicol from streptomyces venezuelae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grrA00
3DM5A 2V6JA 3LLMA 1UAAA 1W4BA 3CNOA 2YOHA 3R8CA 3FMPB 2J46A 3CUEF 1W44A 2AKYA 2ZSAA 3RC8A 1B23P 1GKUB 4BFTA 4TMVA 2FV8A 3DHWC 4M0LA 4RJLA 4BZXA 2HJVA 1DARA 4F93B 1COWA 1DTSA 4ZIRA 1XXHE 1SHZA 2LKDA 2XNDD 3QEJA 3AVQA 3NXSA 3MLEA 1D6JA 1OV4A 4CW7A 2YYZA 3I8XA 2AHOA 1E32A 2ZJ5A 3CM0A 5JRJA 5E7MA 1TL7C 1V43A 1YZKA 5EE3A 4C7OA 4URZR 3CIOA 1M8PA 5ANRB 4D0LB 5L3SA 1JPJA 3L82B 4BECA 4NYMQ 2QGNA 5IK2A 1RC8A 4TL7A 5KPJA 1ESNA 2ERXA 2A9KA 2WWIA 1IN7A 1IN5A 1V5WA 1CU1A 1P2SA 2ZE5A 4OYHA 2AFHE 4PQFA 1Z63A 1S96A 3FFAA 1EESA 3AVXA 5CIWA 3WNBA 1CULC 2QMEA 1KZGB 3NBYC 1DAKA 4PHGA 5KNDA 2PT7A 1W46A 2XTMA 4JYCA 1NMYA 2ZVPX 1KDTA 3UG6A 2OFXA 3WXMA 5FUVA 1FMLA 2VQSA 3NH6A 4AWXA 1OHHD 1Z0KA 4NYJR 2P6RA 2NG1A 3QKSA 3UIEA 5C2JB 8OHMA 5EXPA 5G3YA 5FPHA 3X1YA 3HU1A 2XNSA 3B13B 2G0NA 3FHOA 4LYHA 2FH5B 3TUIC 2ZETA 4FINA 3QUSA 2JJ8A 3GLFB 1KK2A 2PEYA 4KXFB 1D9ZA 4MGIR 2OAQ1 1KOFA 2WHXA 1TU3A 1E2MA 3PEVA 3WP0A 3FTQA 3KX2A 1U90A 4DCUA 2BBSA 3GLIA 2P6UA 2QG6A 2R65A 2C04A 2HF9A 1II9A 4TT3D 3R8FA 5BYKA 4IW3B 4OJKA 3QF4B 3I5XA 2IYYA 3K09A 4F38A 4Q7MB 3MGCA 4N1AA 3CRRA 3WBJA 1C1YA 3BFVA 2QBYB 3LXRA 2OCAA 1CR2A 4DBLC 2ZITA 4URXR 1T4GA 2L0XA 1ONBA 3JVVA 5FTKA 5B2ZA 2CHVA 4NCKA 1MOZA 3PUXA 3VR2A 4G5GA 4KYIB 3AQ4A 2D06A 4AY2A 5C4MA 3CB4A 2FFQA 4AYXA 2PMDA 4YMSA 3HU3A 1ZIPA 3O8CA 1CTQA 5CK4A 3FYHA 1XBTA 4PHHA 2JLSA 1XFAA 1DBSA 4DDUA 3NWJA 2QAJA 1EX6A 4RD2A 2Q9CA 4IDQA 2DWQA 3W3AA 3PXGA 1SVLA 4CEJB 2OCPA 4Q4JB 1S1MA 4OK5A 4Q02A 4L9WA 2ZS8A 2ZJYA 4MH0R 4Q4AB 2FE4A 4JLDA 4RZ3A 3C5HA 2RGNA 5FL3A 3DKVA 1R10A 2GJAA 2GK7A 4OHYA 1BMFD 2XGJA 1H8HD 1A2BA 4ZKDA 2ZI4A 2WTUA 1JXMA 2ONKA 4M1SA 1ZC4A 4YMWA 2NIPA 1KNXA 6Q21A 2QAGB 2VH5R 1NLFA 1IY1A 3QXXA 3IQXA 3GLGA 4B2IA 4PZYA 4B75A 4TL8A 2Z43A 3NBFA 3VR3A 2IYUA 2E9SA 4K8OA 5JJLA 2IS2A 3S1AA 4I81A 1S9HA 4Q18A 5KSYA 2GAOA 3HR8A 5JWRA 4LK2A 4LV8B 2DFTA 2X77A 4ASUA 5K8IA 1G7CA 4U7DA 4RZXA 2V1XA 2FFBA 2YNMA 2FSIA 2AN9A 2WKQA 3CX6A 1PLLA 2O8EB 1S0UA 2B92A 2JLXA 2O0HA 4D82A 2C5LA 2BKUA 1ZM9A 3IBGA 1CJMA 2YWFA 2W2XA 2QTHA 3GFTA 5A0FA 4LCBA 2JLRA 4RZ2A 4RKFA 1XP8A 3QIAA 3TUZC 2MMCA 1UJ2A 5JLJA 1GL7A 1ZNWA 3GD7A 3AVWA 2FPKA 1FNNA 2GF9A 4EPTA 5EXSA 1E1RD 3T12A 3BD9A 2VLIA 2VHJA 4RD0A 3K8YA 5CDFE 2IA5A 4NYIQ 2H18A 1FUUA 2FOLA 2IEZA 2OBLA 1KI9A 2D2EA 2JDIA 4NE2A 1QHHB 2QSYA 5CJ2A 3T34A 3TLXA 4B3GA 1A4RA 3OEHD 3QSYA 1II0A 4M1TA 5DLQC 5J40A 2DB3A 3B1YA 1AKEA 2IYZA 1XRJA 4Z8YA 3K9HA 3A4NA 2AFIE 1OXVA 2JJ1A 5P21A 4HAUA 4XWAA 3SYLA 1AQUA 1D5CA 4A8JC 1HQYE 2IX3A 1FZQA 2QSZA 1ZUNB 3RS2A 3B1VA 5DE3A 2IWHA 5JCPA 1N0WA 1QZXA 1WCV1 3C8UA 1E9EA 1SKYE 4RZUA 5HE9A 4A6PA 4QM6A 3RS0A 5FBLB 2BBOA 3KJGA 4JBXA 2QPTA 1ZD1A 4P0TA 3QVUA 2RMKA 4JIMA 1VPLA 3EC1A 3RSOA 2GETA 4DEXA 4DWJA 4PR0A 3REFA 2ZS9A 4IDHA 2J7PA 1Z6YA 2C98A 2G1JA 3DOEA 4Z54A 3A6PC 4HDOB 3PV0A 4DLYA 1E2QA 1KJYA 1HURA 1PUJA 4R98A 3IILA 2LKCA 2A5GA 2ZU6A 4OHZA 4S2EA 5C1BA 2IT1A 4CF7A 3THXA 1CRQA 4HSEA 1Y3AA 4TYQA 2RGBA 3UATA 4IEEA 4LPSA 1JQLB 3PUZA 3VX3A 4KITB 5CJPA 1U9IC 1BIFA 1Z3IX 3LLUA 1IN8A 1E2HA 4C7OB 3DZDA 4PC7A 1RRGA 5FBRB 3QKTA 1GZSA 4OQXA 4JL8A 2V7QA 4DEYA 5L3SB 1HA3A 1JXOA 3HPRA 4FMDF 4RKEA 2B7BA 4FIDA 2JCSA 2WWFA 3I8SA 4BEJA 4H9GA 2J3EA 4EAQA 3MUFA 1JR3E 3HYRA 1W47A 1CJVC 3CRMA 1B0UA 1L4UA 3U61B 1VTKA 3I1FA 2DY1A 1E0AA 1TPZA 3FB4A 1FP7A 3CH4B 4JZKA 2GXUA 4O2RA 1WP9A 1JAIA 1ZW6A 2ORIA 4LJ4A 3W6OA 1Z0DA 4KLNA 4XSGA 2WWGA 4Q00A 2BJWA 4CEHA 2QUZA 1NBMA 3GFOA 2EYQA 4JLVA 3VR6A 2YOFA 1CLUA 3QKSB 1XTSA 2WZQA 4R2IA 4LX0A 3VQTA 1KO8A 1N5JA 4MRNA 2O52A 3DKPA 1OXSC 1U8YA 1IBRA 2A5FA 1BYIA 2A5YB 3LW8A 1P62B 3CR8A 1ZP6A 1T5LA 1GIAA 5JZVA 1UBGA 4QRHA 1UKEA 1LB1B 2AD1A 3W6PA 2NO6A 2F1JA 4HLDA 3WBKA 4BASA 2ASEA 2JGNA 3B6EA 3R7WA 2KWIA 4NYJQ 4IFBA 1OJLA 3GLIB 4QGFA 5JHHB 2OFOA 1YQTA 3B78A 2GCNA 2CXXA 1KMHA 4HB3A 4GDFA 1G5RA 3SHWA 3C41J 3E1SA 2ZSFA 1XB2A 1F2UA 5L8VA 2XXAA 5CITA 1M7GA 5CK5A 1S3SA 1Z47A 2XJ4A 3Q85A 1G6HA 5IT5A 2BDTA 4QM7A 2ZUBA 4JLOA 3ONWA 2GJKA 3HR7A 3PUWA 3VMFA 1QDEA 2DFNA 3TK1A 2WPDD 4DXAA 4EPRA 1N5LA 1YZQA 4A0GA 4KSBA 1DS6A 4KVGA 3U6KA 1ZJ6A 2O8FA 3WY9A 5FL7A 3ZJYA 1TF2A 3M6AA 1HEIA 1VCOA 1XMIA 2Y8EA 4ZKEA 3ASZA 3RS4A 3AVOA 3AGPA 2DBYA 4HB2A 3KTAA 3NDPA 4DLUA 2OAP1 4ZI3A 4KFTA 4EPXA 4AKIA 1GNRA 3VR4A 1E79A 4MYCA 1DAEA 2HDNB 4RCZA 1E2IA 4HAWA 2UZIR 2EU8A 3VFDA 1TF5A 2QMHA 5FOVA 2PLRA 2JIZD 3AF1A 3H1TA 3P4XA 3RABA 4LYJA 2WWWA 4LBVA 3K9LA 2VHQA 3GPLA 2ZJ2A 3RANA 2KI5A 4NYMR 2A78A 2R2AA 4DCSA 2NPIA 4OQFA 2V6IA 2QQEA 1T0JB 2ZYUX 1N6RA 2Z6VA 5KHOC 3HWSA 4GSYA 4M1OA 4MGKR 3QI2A 3D7MA 5GADl 1IHUA 2ZJAA 1KI8A 1N6OA 5LB4A 2CCJA 2GJSA 1XCPA 1IXRC 4OQNA 1G3UA 3K0CA 3T35A 4OQLA 4DLXA 4V03A 1Z6AA 3H2YA 4FMCF 4IFEA 4ON9A 2F1HA 1SHKA 3S1AB 3GFPA 3W34A 2QMOA 1IXZA 1DVRA 4HAXA 3U4QB 4MDFA 3H86A 5JWOA 1MO3A 3ZVNA 2KJQA 4JVSB 2QTFA 2ZSEA 3EIHA 1E9SA 1XPUA 3NBZC 4DIEA 1Z22A 3OIWA 3H4MA 421PA 1R7RA 4Q9HA 3ADCA 4RD6A 3NKVA 3DMNA 2FNAA 3B8HA 1G3IA 2IS6A 2OILA 4LV6A 1Q0UA 4MQBA 221PA 4CVNA 5JBQA 1S4QA 1COWD 1Q22A 3DL0A 1X8KA 4N0EA 1KI6A 1ZNXA 2C03A 3W8NA 2QN6A 1SKYB 4Q9IA 3R20A 3KFVA 1G5PA 2ZVQX 3CPHA 3U2QA 4DVGA 1HT2E 3LDAA 3F5FA 4TMKA 4HZIA 4D0NA 1N6IA 4OI2A 3QKRA 4ZDJA 3UWKA 3K70C 1DO2A 4HEJA 2JLZA 4OI0A 2WJVA 2HCBA 3WHLA 4C0BA 5IK2D 2BBTA 4YMVA 3CO5A 4AYTA 5DHAA 4EPWA 3A1TA 3GLFA 4Q9JA 4B34A 3U44B 1JI0A 1WA5A 1G8HA 2NO0A 2J59A 4ZO4A 1XJQA 4LHWA 4ZPXA 2ZREA 3K0FA 3SI7A 2OUKA 1YE8A 2IXEA 4OI4A 1G8FA 2OZEA 5FBQB 4XTRA 1UDWA 2IHYA 1W49A 1GKIA 4BZPA 4OHVA 3QF4A 1VECA 2ORWA 2BMDA 4B33A 4GOXA 3AKCA 4UXHA 5E7IA 2NZJA 1CEEA 2XOKA 2G1KA 4UNRA 4PX9A 2QL6A 1LFDB 3EZ9A 5SZJA 3VU9A 1TUEA 4IOKA 1Z6XA 1KDOA 3G0HA 1W5SA 3WRYC 1KZ7B 2I1VB 2ZAOA 1HV8A 1SVWA 4I4LA 1X1SA 1NL3A 3I62A 2QP3A 2ZUDA 3L0SA 5EJEA 4KSCA 5JEEA 3ZD6A 3EW9A 4TLAA 1XD2A 1XCMA 3FE2A 4GZLA 4LHYA 1XZQA 1N0UA 1OFTA 2Z4SA 3LX8A 3MFYA 5AJWA 2H92A 1M7BA 1G7SA 2GCOA 3A4MA 1KMQA 4BRWA 4I1VA 4HLUA 1L4YA 4JJZA 2ANCA 2XZOA 3SJAA 1DPFA 2PZFA 4BEBA 2WOOA 1UADA 1ELOA 4LHVA 2JAQA 2QROA 2AKAB 3AVUA 1N6HA 1FOEB 2V55B 2DFLA 2GJ8A 3AF4A 4ZCLA 2ODNA 3T1QA 3ZQ6A 1P75A 1G9XA 2F3RA 4JSTA 1U0JA 4HDQB 1Q21A 5FUXA 2A7QA 2GEUA 2Z4RA 4Q19A 4BLOA 2OHFA 2C9CA 3DEFA 1GILA 2H5EA 4A36A 2QU8A 4LOAA 4RFVA 5L3VA 4C0QC 3R9XA 3EA0A 1E96A 3CONA 3TRFA 1S3GA 4FMDB 4DLSA 1P9NA 4EJSC 1HUQA 3AV0B 3O8BA 4WVFA 4XVQA 4QKQA 2OXRA 4WA7A 2F6RA 4CEHB 1EFHA 4BLRA 1TX4B 5ELXA 3N2EA 4TTPA 4M4SA 5D3MA 1Q1QA 1VCMA 3ADBA 4IVQA 4KO8A 4TLEA 4A82A 3ZQJA 3DM9B 3PITA 2ZE8A 2A5DA 1XTKA 1E98A 4LUCA 2N1BA 2RGDA 3ZS8A 5TARA 1SXJC 2ZI9A 1JR6A 1CS4C 2VF8A 1NP6A 3CRQA 1JNYA 1YZNA 4MKHA 2J0SA 5EUMA 1ZVQA 2CL7X 2DYKA 2WMOB 5F2EA 1MABA 1U81A 5F9FA 3UKDA 1KMHB 821PA 2PJZA 5FI1B 3UK6A 2PJRA 5JCZA 4EKDA 4HLQB 5FPSA 4UNSA 4HAYA 2XXAB 5DYGA 1CR4A 3VKWA 4ASUD 2BMJA 3I3SR 4HUQA 4KBGA 5FR2A 2P0EA 2QT1A 3TR0A 3AVPA 4Q01A 1G4AE 2OEPA 5BW8A 2AL7A 2WSMA 3QENA 3TSWA 4IKEA 5CLLA 3W8RA 2R6AA 2XZLA 1P6XA 4QHYA 4NP6A 2O8FB 1KAOA 2IYVA 1NN0A 4F91B 3SE0A 2ZXUA 3ZZ0A 4KLZA 2D7CA 4G5RA 3OE7D 2J87A 3BXZA 5GJCA 3GLHE 3CX7A 4CZ2A 3TVTA 1XJCA 3KTAB 1J2JA 1XPOA 3U7EB 4MKFA 5DHFA 3WMGA 1FQKA 3IEVA 2OM2A 4GZMA 5FTMA 5DNYB 3GJ5A 2F9LA 1SQ5A 3QY0A 3EWAA 5DSZA 2W00A 1F60A 2PBRA 1KK0A 4C3ZA 3ZDQA 1UKZA 3UPUA 2W6JA 1XD8A 1AA9A 2JDID 3KQKA 5JECA 1NVVQ 3AKEA 4NONA 3C14C 4A92A 1L7VC 1OFUX 3NHAA 4QHTA 2GVDC 1CJUC 1N6NA 4D25A 1U99A 3BS4A 2BVNA 3CLVA 4ESHA 1FPMA 2GEDA 4TSFA 4B71A 4EPVA 5J47A 2RHMA 1GNPA 4GP6A 1QHSA 5SZKB 4DDTA 2GNOA 2W6IA 3SJBA 3LY5A 4C4PA 1VG0B 3CR7A 3DZ8A 4ILEA 1ZAKA 2H16A 1T5IA 4B43A 2R9VA 1E69A 1QG2A 2KBFA 4IXNA 4ZCIA 5BN5A 4YDHB 2E87A 5JJIA 1NG1A 2ORVA 2ZJ8A 1OXXK 2G83A 1GWNA 1E4YA 1YZGA 1XWIA 3M4YA 3MMPA 1QF9A 2ZI5A 1OT3A 4PXAA 3SBDA 2J7PD 2KBEA 1JBKA 4V02A 3HPQA 3PVSA 4Q9LA 3EA5A 1AQYA 3GMTA 1EFTA 1VHLA 2BV3A 4US0R 1OKKA 1D2EA 1I4LD 1LF0A 4FMCB 3L43A 3IDQA 2ZROA 3OAAA 4I1SA 4FCWA 4XD7A 5AUPB 3QXCA 4GNKA 3LVQE 5FR1A 4JLPA 3KJIA 1OE0A 5IHPA 1JEEA 2HYDA 1KI6B 5EP1A 4DLTA 2VP6A 4RY2A 4F7WA 2ZANA 1TUIA 1I4DD 3GEIA 1U0HC 3WNDA 3O8DA 3NC0C 3BJIC 2V7QD 3LVRE 4IVRA 3UMSA 2XZPA 2HLDA 2R6DA 3D8BA 3QKRB 4MYUA 4WXPA 3ZIAA 1SXJE 2ZR7A 4WXRA 3U5ZB 1YZUA 3N70A 4AYWA 4GL2A 1W36B 1FX0B 1U8ZA 1E2PA 5FUWA 4XSHA 4HAZA 1QHIA 1VDZA 4C0JA 5CM8B 3I4LA 3P1JA 3K0FB 1ZC3A 3LAWA 4DT1A 1R8QA 2J1LA 1SVSA 2BIFA 1XMJA 2WICA 3RAPR 3QKUA 2YHSA 4JS0A 3QOFA 3BWDD 3SYNA 4ABYA 2BBWA 4TLBA 3REGA 4D26A 1VG8A 2DWPA 1ZCAA 1KGDA 4ARZA 1G16A 1NBMD 1NJFA 3VU9B 1Q3HA 4LJ8A 3AUXA 5J4HA 3ND8A 4Q1BA 2WAYA 2P5TB 3G82C 1KY3A 2R44A 5EP3A 3RYTC 1SVKA 4J0QA 2PH1A 2DCUA 2VEDA 4YQFA 3SJCA 3HP1A 2YKGA 4PQRA 4NH0A 3QXSA 3RVBA 1EG7A 2VA8A 3OZXA 4LYFA 3TSOA 1OH6A 1K8RA 1I2DA 1XD2B 4Z1MA 3K53A 4URUR 3EIEA 1J99A 3ADKA 2GCOB 2Q21A 3LQQA 3MWYW 3EWSA 4M1MA 4BLSA 2BMFA 3SFVA 3KQHA 5FTNA 1ZNYA 1G6OA 2OLJA 2IS1A 5A5GA 2NO9A 1KYIA 2BC9A 3A8TA 3GCGA 5CLQA 1CJTC 3C15C 4QBIA 1XTIA 4A1FA 3TE6A 4LDJA 4E03A 3CRW1 2EFGA 3LFUA 1R5NA 4NBSA 1M34E 5C4GB 1ODFA 5GJVC 2IYQA 3CZPA 2BOVA 4JYBA 2YC4C 1AIPA 2J9RA 4M21A 4K81B 4P4TA 4FWIB 2ZRKA 2CLCX 2ZAMA 3Q3JB 4DDWA 2X1VA 4MITA 4YMUA 5M04A 1FQJA 5FL7D 2FPLA 3EZ7A 1WBBA 1KI3A 1QBKC 1DAIA 4AIIA 1G7TA 4Q1FA 1A2KC 1ZM7A 3W6NA 1XD9A 3O47A 3K0SA 1TQ6A 1GM5A 2RKOA 3U4QA 2D62A 2XX3A 1VG9B 5CDFA 5JS8A 1E79D 5KTYA 1GP2A 3PEYA 1E1QA 3I72A 2AD5A 5D3MB 1GDDA 4JSYA 5LPNA 2ZRLA 3FWYA 4B3DA 2E1RA 4Q5IA 1Q3TA 5DIFA 1GRRA 4UNQA 1OIWA 1GG2A 4PQYA 1CXZA 2B21A 4JVNA 4II7A 1PZNA 1H65A 4JVLA 2KB0A 5HZHA 1YRBA 2WJJA 3BRWD 5E95A 2VP0A 1EXMA 5SZIA 3H0KA 3U3RA 4Q7KA 5JHGB 2PL3A 1R0WA 1MABB 4RSGA 3D3QA 2GBLC 3RRMA 3SOPA 1OFHA 5FTJA 3BH7A 2ZR0A 4P4SA 4FCVA 5LD2B 3SN6A 4TTRA 1KI2A 4MRPA 5B30A 1PUIA 2ZRHA 2EFHB 1Y63A 4A15A 2WSSA 4C0LA 1E9AA 4HUQB 3DDCA 3GLGE 4DSTA 3IIJA 1G8GA 2NO7A 1UKVY 2ECKA 1E2KA 3OIUA 4X8LA 3TNFA 3U44A 3W90A 5E7JA 2O8BA 5J4LA 1WMSA 1Z5ZA 3R9IA 1YZLA 2PCLA 4UKDA 1D8TA 1X3SA 2DR3A 4JBWA 4Q48A 2D3WA 1NN5A 1UF9A 3IKJA 2CK3A 3A37A 2GCPA 4A6XA 1XXHB 4QJ4A 2B8WA 2IF2A 2XITA 3RSLA 4KI0A 3TIFA 1VMAA 2Z0MA 2F1RA 2OCYC 3U3JA 2N46A 1HQCA 4QFMA 1KK3A 3CF2A 2J0QA 4BFXA 3B85A 2QORA 2Q9AA 3IPXA 3X1XA 2CL0X 4YDSA 2QY9A 3OEED 1VIYA 1G4UR 1NY5A 4P32A 2Q9BA 4KU4A 4CYMA 2GJ9A 3T61A 2XSZA 4JLNA 5GVSA 3OESA 3X1ZA 3KKOA 4G1UC 5KPDA 1W36D 1JR3A 1MRSA 3PUYA 2IYWA 2NOAA 1XDBA 3P4YA 2O5VA 5HKKA 3W3ZB 3H84A 3GEHA 2XB2A 4HYYA 5DI9A 4WZBE 3B5JA 5EE9A 3QG1A 2V4ZA 2YOGA 4PAOA 4WIAA 4IEIA 1N6LA 4LC0A 2VTKA 1AN0A 3AEZA 2JLUA 1QHXA 4MKIA 1DAFA 4BQSA 1G18A 1NG9A 2XOKD 2OBNA 3DOFA 2C77A 1SULA 3MJHA 1CR1A 1Z0FA 3W9YA 3HDTA 3DO6A 4OKSA 3KFXA 4TN1A 2X8AA 2GRJA 5BYJA 1RFLA 3CZQA 2Q6TA 1IAQA 1NLZA 1N25A 5FI0B 1AKYA 2CHGA 3EC2A 1Z06A 2HYIC 1P3JA 2ZRPA 2C2HA 2F43A 4DSNA 1Q1BA 3P27A 2ZRNA 3CWZA 4XOIA 2CNWA 2B8TA 5H1YA 4PAQA 3EARA 4EIWA 3T1TA 3WYAA 2CMKA 3M0EA 1IJFA 1XEFA 1ZMXA 2ZJBA 1JPNA 3SR0A 5KDLA 1AS0A 3PFIA 1OW3B 4G5QA 1G7RA 1YR6A 3KUDA 4BFWA 4DB4A 2DPXA 2HF8A 2QEQA 1RVDA 3Q8XB 1TADA 4P4UA 4F4IA 4OHWA 1KSHA 2W2VA 1R6BX 2WWHA 3AVVA 4DSOA 1ETUA 4O25A 1E2NA 4KODA 521PA 5L3QA 1AS2A 2JA1A 3EZ2A 4M8NE 4WOPA 2QE7A 1E6CA 1KHTA 4A8JA 3DPUA 2P65A 3MAAC 3I92A 4F4CA 1WDTA 3LA6A 1ZBDA 4DLRA 3KKMA 1UDXA 3IHWA 3I5YA 3BH0A 4HZUA 4JT2A 5EZ5A 4DT1B 1UEJA 4OJQA 1LY1A 2A2ZA 3EPJA 4TZ6A 2JLVA 5EP4A 2WM9B 3SEAA 3L8YA 1NKSA 1O87A 1W4AA 3SHFA 3EAQA 1A82A 4C30A 2MSDB 5HPYB 3RS3A 4I99A 4ARZB 3VHXA 3UMRA 3LBIA 4Q9KA 4XIGS 1TTTA 2IWRA 2JJ2A 3DMDA 5KYKA 4L16A 3WYGA 1GRQA 1XMSA 2HXYA 5KUTA 2MSEB 2QP4A 4MGZR 5AJVB 3THYB 1NVVR 4B44A 4D4JA 3B60A 3IEUA 1VCNA 2FGKA 4AK9A 1U9IA 3GJ7A 1GRNA 3I73A 3IIKA 3QPVA 4QGGA 1XU4A 4X8OA 1GUAA 1BMFA 1RJ9A 2RAPA 3U3OA 4LBZA 2C96A 4G0NA 5JS7A 5J4VA 2ATVA 4D80A 3BE4A 3OFNA 4B3XA 1KK1A 4DCTA 4TQ9A 5EXXA 2VBCA 4EFLA 1MV5A 3B7GA 3BFXA 2CE7A 4QOSA 4F4JA 3TVDA 1MKYA 5AWFC 3LNCA 1MH1A 4X8HA 4DSUA 3SQWA 4D4KA 1E3MA 2YINC 4QJ3A 3KUCA 3PCRB 5C46F 4B73A 5JI2E 3MWJA 4GRAA 3T1OA 4TMXA 4L5BA 4YONB 2OESA 2WKRA 4N0DA 2VF7A 3CPJB 4PHTA 2IS4A 1TNDA 3WRXC 3MWLA 3LD9A 4LZZA 3VTKA 4A0RA 2P2LA 5AUNB 5EUQB 2PX3A 1J8YF 1Q1ZA 4NL4H 5TVKA 1S1CA 2ERYA 3PJRA 2R6GA 2WMNB 4QXAA 5KDOA 4M1WA 1NIPA 3ZVLA 2D74A 1DAHA 3HJNA 3KKQA 2CHQA 2IF0A 5TXGA 2W6JD 3L0PA 4WBSA 4ZDKA 1ZD8A 2BHRA 1LVGA 3D6TB 3KB1A 4I1UA 4B48A 2Q0HA 4AKHA 3ECCA 5DI3A 3T1VA 2FMXA 3OIYA 4HI0E 3EXAA 5AJZA 4HAVA 2FSFA 4ZV4A 2XAUA 4BFZA 1R5BA 1R0ZA 3L8ZA 4G5OA 4TWZA 3VNVA 4AC9A 5J4YA 4MRVA 1G3QA 1E9CA 2FG5A 3PENA 3SFZA 1RYHA 1F48A 4P4SB 2W6ID 1Q12A 2AWNA 2LWIA 2RGGA 1T6NA 4QBFA 1IM2A 2D2FA 1S2MA 2BEJA 4L15A 4LRWA 3VR1A 3Q5DA 2GXAA 4HUTA 2ZRAA 1C9KA 2EFEB 2ZI3A 4MUAA 4W5WA 4R2HA 3SYKA 1F2TA 5GJBA 1YHNA 2BJVA 2C95A 5E4FA 4EQ6A 1LNZA 2QAGC 2Q3HA 1FX0A 4XTCS 3G5UA 4BFYA 2O8BB 4GP7A 2CLSA 2RB4A 1LS6A 2O8DB 3TW4A 1EGAA 3AF0A 4TTQA 5DGXA 1OKKD 1T3LA 2J7KA 2CCGA 3B2EA 4WW0A 1WBDA 4C2UA 3P26A 2UZ3A 3OAAD 1H8EA 1OIXA 4XD7D 4C2TA 1CR0A 2H1LA 1E2DA 5CM9C 4FWTA 2ZRGA 2RCNA 5FUYA 3AP1A 2NGRA 1E0KA 2QNRA 2Z83A 4B2LA 1Z2CA 2JLQA 4GBMA 1G8YA 2PLFA 4ZDWA 2WJGA 2ZR9A 1T3SA 3NVAA 4JMPA 2ZE7A 3EASA 2VL7A 1JALA 2HLDD 3ZIAD 1DELA 2BEKA 1KKLA 1NMZA 1G3RA 2PMKA 4PO9A 5H8WA 1TEXA 4KFRA 1AGRA 3IIMA 4B3CA 4DUGA 1KIMA 4LGMA 3GJ8A 1IY0A 1KSJA 1W0KA 3BBPA 4R71A 2F1IA 1J70A 2V3CC 3A1SA 5JI3E 1FP6A 3N5CA 4RFSB 2VYFA 2OFWA 5H70A 4ACBA 5HCIA 2BM0A 4IOMA 4B3FX 5BN4A 4CEIA 4GMXA 2G6BA 2PX0A 3GJXC 4M9SA 4PC1A 1XZPA 4I1OA 4PC6A 1MO5A 3PR1A 4MUBA 3JZMA 1T9HA 4JBYA 1IOZA 1Q57A 4AD8A 1ZIOA 4TYWA 2O0KA 2F43B 1R0YA 1BS1A 1II8A 4NHOA 5TY0A 2XJ9A 2AK3A 2IW3A 4Z1MD 1PLKA 5EP2A 1D9XA 2ZQ5A 3RLFA 3UXMA 4MKGA 2I1QA 4KAXA 2W83A 3C5CA 4BLTA 4Q1EA 4URWR 1OIVA 5HR5A 4MDEA 3EPLA 1GFIA 4EFMA 1X8LA 2DHRA 3ETLA 1G41A 1IN4A 2IEYA 1NVXQ 4A2WA 4LPKA 4R7ZA 5DN6A 3SNHA 1GL9B 3SBEA 2OXCA 3VHLB 4M9ZA 4PPGA 2IYSA 2QI9C 1G1MA 1US8B 4LV5B 2AXNA 5LB2A 1YU9A 3LBNA 4O0MA 2FN4A 2PEZA 2YJTD 3TUJC 3ZVMA 1OLOA 1U8AA 1RRPA 5G3ZA 2GTPA 5L3QB 4V0ME 2B6HA 3CF0A 1O3YA 1XEWY 2FZLA 5FPTA 4A8JB 2Z5FA 4G01B 4US1R 2AR7A 5KSPA 3Q7QA 3PEWA 2J0UB 2IBMA 1E94E 4KV9A 4QBGB 2VP2A 1E2EA 3TQFA 4E09A 3FPAA 4DCVA 4HZUB 2XTNA 3BFKA 3IPYA 4IXMA 5DISB 3ZVRA 4JJKA 3GLHA 2F9MA 4YLGA 3MG9A 2UVQA 3B1XA 1XF9A 5EE0A 3ZH9B 2F3TA 1KI7A 1P2TA 2P67A 5HE8A 4B2PA 5DO9A 1NN1A 1DG3A 2ZPTX 1T91A 3CWQA 4YC7A 2O0JA 2ZU0C 5GJWC 3RS5A 4LC1A 4Q4HB 4QL3A 5F9HA 4TMWA 1ZRHA 1E1QD 2C9YA 4HB4A 3AVTA 1X8JA 1X1RA 3A58B 3CNNA 4M9QA 2ZSBA 3WYFA 1BYUA 2EYUA 1A5TA 5HTKA 4LBYA 1Z6GA 2WJYA 1NSFA 5CIQA 121PA 1XJ0A 4DDVA 5K8LA 1E9FA 4A0HA 2ZRDA 1P4SA 1I2MA 1XXHA 2QRNA 3THWA 3X1DA 1KO1A 4GPTA 4URYR 1RJ9B 1YKSA 5KSOA 1VHTA 1W2GA 4CGZA 4PZZA 2QGZA 2QQ0A 4S35A 3CW2A 3OIVA 4Q7LA 4LWZA 2CDNA 4B74A 4D4LA 3BGWA 3RWOA 5IRCD 1Q20A 2GXSA 2WSSD 5AJYA 4AG5A 4E07A 2HCJB 4PC2A 2IYRA 5GVRA 3NTUA 3AVYA 2VO1A 4IDNA 3AGQA 2JJ1D 3VX4A 3R9WA 3IO5A 4QNRA 5AJXA 3U60B 1KJZA 1VYTA 2H8KA 1N0VC 4BLQA 3K09C 4Q03A 3A4LA 3NG1A 5L3RA 4EJSA 2CK3D 2R6FA 3GJ6A 1ZD9A 3A1WA 3BAFA 4LYAA 3NC1C 3TKLA 3ICEA 4PSVA 2ZI6A 1SVMA 2YWHA 1UPTA 3AKDA 3EPKA 4OI1A 1SVOA 1BOFA 3I32A 2IYTA 2OT3B 1VIAA 3K9GA 3HU2A 4H1UA 5B58C 3OHMA 3QNUA 3U6BA 3O8RA 3A36A 3B1WA 3FGNA 2GXQA 1J7KA 3TGPA 5JFGA 4G5SA 1T8TA 4XJXA 2REXB 1SXJA 3CBQA 2XSZD 2FWRA 1NIJA 1N3BA 2RGAA 5DI3B 1ZUHA 4YXWA 4FCTA 1JR3D 4KFUA 2OO7A 3NEJA 3WP1B 2FX3A 5HKKD 2F7SA 1XMVA 2VRWA 4OHXA 1WE2A 2RGNC 1R0XA 2WWXA 4A2QA 3AH8A 3OF5A 4O2LA 4LJAA 4A0FA 3LX5A 1UEIA 3BH6A 2V54A 3LRPA 3MD0A 1EX7A 1KY2A 3T06B 5KOYA 4Q66C 1M6NA 4B32A 4NCIA 2WJIA 3BB4A 5BWMA 3KQLA 3L0IB 4B6FA 2K5UA 1KTVA 5C18A 3PIRA 1F2TB 1UFQA 4EQ6B 2HT1A 2FGJA 4IDOA 4TQUS 4EUNA 1A7JA 4F92B 2GKSA 2PCJA 2OCBA 1MT0A 1DEKA 1Z08A 3FMOB 5SZHB 3VR5A 2V1UA 3Q72A 2FFAA 2MSCB 5H68A 2JLWA 4KJZA 3PG5A 1X86B 3FVQA 5TV2A 4E22A 2CNWD 1DE0A 3QXJA 1KDPA 1PJRA 4UNNA 2Q3MA 2ONJA 5JRZA 1L8QA 1N5KA 1IXSB 1NI3A 3QBVA 3KKPA 4Z51A 2GESA 1NKTA 3VNUA 4DLWA 2QM7A 1ANKA 1YVDA 4A9AA 4XWKA 1VCIA 1HE1C 4BPBA 4UXIA 1RKBA 2IXFA 4P33A 1G3MA 1XNJA 2SHKA 4BWYA 5B57C 3E5HA 5HCNA 1U94A 2YC2C 1G17A 3ZYCA 2CVHA 1Q1EA 1OYWA 1I4TD 2QMUA 1CBUA 4MYHA 4GFDA 2REBA 3V4RA 3THYA 4QBHA 4WZAE 3EG5A 2QE7D 5BQ5A 3J81k 3C4JA 1XTJA 2ODEA 3RDPA 3Q9LA 1JAHA 4GT1A 2GK6A 3SJZA 5TMPA 4IRUB 5E3HA 3MRSA 1XEXA 2J0VA 1Z6TA 5JEDA 4JKYA 2J41A 3T5DA 3FHTA 2PZGA 3KZ1E 4D2IA 2WWYA 4QGAA 4V0KA 1P72A 2AX4A 4ZCMA 2WV9A 4CEIB 3ADDA 4WAUA 3KDSE 2IUTA 2CJWA 1GTVA 2FSGA 2NZ8A 3GLIE 2JJ2D 1F3OA 1FFHA 2YVUA 1W7AA 4LSGA 2HJGA 2OLKA 2YWGA 1IY2A 4QJ5A 1AGPA 3KJHA 3EZ6A 3X2SA 5B64A 4PSAA 3SZRA 2B7CA 2QPOA 4JLMA 1II8B 2BCGY 1HTWA 1YR9A 4B47A 3BOSA 3WNCA 3TJZA 1E2LA 2CEAA 4HB0A 3KQUA 3KQNA 5DH9A 1OSNA 2FEOA 4IOLA 3AM1A 3QVVA 4K46A 2GA8A 3IBYA 3LQRA 1NVWQ 1ZYUA 3WMFA 4U5XA 1LS1A 4POAA 3FKSA 3MWKA 3OFND 3LV8A 2WIAA 3X1WA 3K70B 2FA9A 4V0NA 1WB9A 4UXJA 4GMDA 4Y0AA 1UBCA 4C0HA 1YZTA 3K9NA 2O8CB 4DC9A 2H7VA 5FOTA 4CT4B 2FPMA 4YMTA 3IHLA 2CL6X 1NLYA 1LV7A 1U0LA 2BM1A 4HDCA 4JKIA 3CRVA 1ZCBA 4RD4A 3FOZA 5TB5A 1EFCA 3LH5A 3A1UA 4M1YA 1E0SA 1W0JA 1M2OB 1WRBA 3GLHB 3QQ5A 1DADA 1MO4A 4W9MC 4QNMA 1EFRA 1P9WA 1EK0A 2G88A 4JL5A 3V00A 4LJ9A 1TMKA 5D3QA 2GVZC 2WAXA 2AWOA 4DCNA 1ZUIA 4LJ5A 2CLDX 4CDGA 3OE7A 2ZI7A 3ZS9A 2X2EA 5KDDA 2QM8A 2G9NA 4PSKA 4TL6A 4LJ7A 2O8DA 1ZU4A 2QT0A 5CB8A 1Z0AA 3TQCA 3RRNA 2ZRBA 4A4DA 4D0GA 1QRAA 2VSFA 1P5ZB 3KXLA 4LI0A 5JSZA 2IYLD 1GKYA 3GEEA 3RRYA 2ZM5A 3THWB 4PANA 1W1WA 1RRFA 3VKGA 1BKDR 4JLKA 1E4VA 3THOA 1ZM4A 4QGHA 1FL9A 2BCJQ 1TAGA 2YZ2A 1CP2A 2RH5A 3BB1A 2QENA 1E9BA 1T0HB 3QPUA 1EWQA 3QPWA 3NDBB 1HT1E 5FBVB 1TQ4A 2WKPA 1MR3F 2XNDA 1GAJA 3TAHA 2VHTA 1NMXA 1PV4A 3KB2A 4Q4LA 1U2RA 5KO2A 4NPHA 2C99A 4DIDA 2FF7A 1M7HA 2NTYC 1NJGA 2W0SA 1FW6A 1Z07A 4PPQA 1TU4A 2IXGA 4V0OA 4B76A 4FI3C 2VSXA 4NCHA 5JMTA 3FHCB 2HEIA 4EJSB 4ITRC 1H8ED 4PPFA 4RFSA 2R62A 1KSGA 4AG6A 2J45A 1TQ2A 4MRSA 5K8TA 4PPNA 3RRZA 1P7CA 3L2OB 3QG5A 1KDRA 5KNBA 3UANA 1P2UA 5IF9A 4OK6A 2HV8A 1W48A 2GAAA 3A1VA 3QEOA 4PTLA 2VSOA 1KI4A 2JEOA 2ZYWX 4QG7A 4TMZA 4ZIRB 5FH9A 1ZM3A 3RNLA 2RHDA 2XEXA 1SXJB 1OFIA 1R2QA 4Q47A 1OHHA 4RVCA 4DRZA 4X8MA 2P6NA 3ASYA 1N5IA 2IYXA 1FTSA 2ODBA 3B82A 2QRZA 2WVJA 3E2IA 3DVLA 1E9RA 4DUGD 3WHKA 2FU5C 1D2MA 2GBLA 1HYQA 1MO6A 2H57A 3C7KA 1IN6A 2VPPA 1W0KD 4NMMA 4ERNA 2FDCA 2ZJZA 4LY6A 4C0SA 1LF5A 3ICQB 4B6EA 2YV5A 3MCAA 4EPYA 1AS3A 2NQ2C 3ZD7A 1JJ7A 4URVR 4DLVA 1UM8A 1T8UA 1US8A 2CBZA 2XB4A 4H1VA 1RIFA 4MYTA 4M1KA 1R8SA 4TT3A 4O3MA 1OH7A 3K0AA 2BWJA 5EZ6B 3AF2A 5CYOA 4A2PA 1SVIA 1S9DA 3Q7PA 4KBFA 5EXTA 1E0JA 1KO7A 1OPXA 2EWVA 1PLJA 1T3HA 1LW7A 2J0UA 2ZIAA 4NCJA 3TMKA 4CIDA 3SU8A 3K0CC 3IGFA 4CRWB 4Q1AA 5FOWA 1CKEA 1KO5A 3W5IA 2X2FA 5AUOB 3SS8A 1G19A 2NMVA 1S8FA 3GJ4A 2OBMA 4OQMA 2F55A 1Z2AA 4D81A 4XVUA 2N42A 4XH9B 3EPHA 1XTQA 3L0OA 1Z0IA 1Z29A 4FD2A 4Q4HA 4NZYA 4MA4A 4Y0VA 1QVRA 2V9PA 2WOJA 5DN6D 3K70D 1DAGA 2CCKA 2NO1A 3M1IA 2FSHA 5FOUA 2DFKB 2XTZA 2ZYTX 1OYYA 4W7SA 4C9BA 1P61B 5KNCA 3BK7A 1IJEA 3RHFA 4U02A 4NCNA 2FEMA 3AF3A 1OXTA 1NBME 1R5OA 2OG2A 2REOA 4LJYA 4TYYA 1XCGB 2ZYVX 3FFBA 1YRAA 4DKXA 2ZJOA 2ZRFA 1H8HA 1GNQA 3LO5A 1XEXB 1RW4A 3RWMB 4KFSA 4BE7B 1D2NA 1QHYA 2C78A 1M74A 2GHIA 4KYUA 5EQTA 4B3BA 2IL1A 2HT6A 4G3XA 4P3YA 1YR8A 4US2R 3ZZUA 1W36C 2H17A 2WIBA 1FMJA 4BUJA 1ZU5A 1X6VA 3NEYA 4W5HA 4QHSA 1CRPA 2NPFA 1E2FA 3P20A 2FZ4A 1SKQA 2P5SA 4C0AC 2CJWB 4L8GA 3I61A 2MMGA 2HUPA 1AM4D 4C0KA 2RGXA 1NN3A 3EIQA 1F6BA 5FBWB 1AZTA 1KO4A 2BMEA 4NU0A 4Q21A 4QC2A 1LTQA 3V4FA 3TSZA 3TR5A 2W0MA 1OB2A 1NSTA 1TEVA 3LXXA 2ZRMA 5F3WB 4AKEA 2ZEJA 4Q7JB 1JECA 5FOSA 3QBTA 4Q1DA 1K5DA 3V9PA 2GDJA 3TBKA 1G5TA 5CB6A 2QP9X 5TDHA 1HE8B 1M1YE 2EWWA 4UQOA 5K8UA 5AUQA 3T15A 3TAUA 3NHBA 1AJEA 3F3YA 3JVUA 3NBXX 3GP8A 1RYFA 1ESMA 4UNPA 5BN3A 5LDDC 1OH8A 1F5NA 3CF6R 3U3MA 4ZDIA 1OH5A 1E1RA 1KSFX 2AK2A 1UKYA 3W5JA 3GLGB 2ANBA 4IVPA 2EVWX 1JQJC 5FOXA 4HLUC 4RD3A 3F8TA 3WMEA 3E70C 2ZRCA 2R8RA 1JB1A 1NF3A 3Q5EA 2C9OA 3GQBA 5FPKA 4TSFD 3EX7C 4BFSA 1DG1G 3OEHA 4M2LA 2EFCB 1DO0A 1VG1A 4UJ3A 1G291 4IOJA 4B35A 3KKNA 1OF1A 2GILA 2IK8A 5G40A 5UKDA 1RPZA 1TQDA 4D6PA 3VKHA 2GZAA 2ODWA 1SGWA 1Z83A 5CYPA 5F98A 1AK2A 4TYNA 4AKGA 3ZLJA 4LHXA 2Q3FA 4OK3A 4BFUA 3QE0A 4IHQA 1U98A 2QPAA 4JLAA 2VP9A 2A5JA 3AB3A 1GITA 1SXJD 1GSIA 3F0TA 3RS7A 2KE5A 4TZ0A 1W4CA 2EW1A 1K6MA 1NRJB 3FMIA 4YXWD 1AZSC 2J5XA 2X19A 1UBFA 3KXIA 5JSZB 4MGYR 3OEEA 4EDHA 2ZSDA 5G41A 1XEWX 3PEUA 1MRNA 2I3BA 2GZDA 3P32A 1ZM2A 5DYIA 5EE1A 1G21E 2QA5A 4E5UA 2CE2X 5G53C 2IHBA 4PO8A 4M22A 5EE5B 2ZS7A 1P60A 3AUYA 1E2GA 3QF7A 4D4MA 3CPEA 4N3NA 4KVAA 1E99A 1L2TA 2YWEA 4DB2A 3N2IA 4W5JA 1G64A 721PA 1G8PA 1JEDA 4IDPA 5FTLA 1EFUA 3K0EA 1RE0A 2W2TA 4GI7A 1NNEA 4XWOA 1QHNA 3T5GA 3AP2A 1R4AA 2VHCA 5LD2C 2D7DA 1KNQA 2QBYA 2A30A 1K5GA 4BLPA 4PAMA 4HLCA 4TMTA 4JLJA 4Z8XA 2RGCA 3RC3A 1VYUA 3LBHA 1Z0JA 3GLFE 2GWHA 2GZHA 2QZ4A 1KAGA 2WJHA 3ZZTA 4BRUA 1JJVA 4ZI2A 1J90A 1GVNB 1CIPA 4R9UC 3SC3A 3MSXA 2PZEA 3THXB 2G0TA 3CX8A 4NDZA 2VP4A 4V0LA 1N6KA 2GEVA 3GJ0A 1NVUQ 1XPRA 4BGDA 4TLCA 3BB3A 4FW9A 4V0MA 4DHEA 4JVMA 3CKLA 4U00A 2A3RA 2EFDB 4JL6A 2I4IA 4CEJA 3CH5A 4CT5A 1BO6A 2R6CA 4Q4JA 1FNMA 4L4UA 1A1VA 2QTVB 3QJYA 4Q4AA 1KJWA 3ND9A 3C16C 3FDIA 4ESVA 1WQ1R 2G3YA 4P31A 5HZKA 3IO3A 1N2CE 1SZPA 1P9RA 1GOTA 4NTZA 621PA 1OXUA 3SDZA 4JT4A 4PZLA 4TYPA 3SQXA 1TF7A 1GL6A 1BH2A 2OE2A 1ZINA 1W4RA 2G77B 2ZRJA 1C4OA 3GJ3A 1NY6A 3IQWA 4NKRA 3U7FB 1OB5A 1KI1A 5JJKA 2RGEA 4Q1CA 4M53A 4DLZA 4GOJA 2QAGA 2GF0A 2O8CA 1YR7A 1P2VA 3UWOA 2IUSA 3K1JA 2OV2A 5LBIA 4DZZA 2VIIA 1CJKC 1FTNA 2V8OA 4WZ6A 3K0AB 4RD1A 2JATA 2ZRIA 2JLYA 3EZFA 1PVOA 3KXKA 1VKJA 4BFVA 3U7HB 2C8VA 1E9DA 4GOKA 1J8MF 3ZGXA 2OSBA 2JASA 3B1ZA 4FMBB 5BXQC 2BKEA 4FN5A 1Z8FA 1RZ3A 5FFMA 1XTRA 4HATA 3PQCA 1FUKA 4RCYA 3TH5A 2WBLC 1P73A 4AI6A 1Q44A 1ZNZA 3UG7A 2WPDA 4NYIR 4DJTA 5A4JA 4PC3A 2O8EA 3LW7A 3NH9A 3BERA 3B9QA 1XX6A 1UBEA 2DWOA 1YJ5A 3FKSD 2IUUA 3FMFA 2FJUA 3JZAA 4KHZA 2VP5A 5AR1A 2ZUCA 4ACAA 3R7WB 2VHUA 2FFHA 4L9SA 4OBEA 2ZE6A 3PUVA 1DOAA 4TQAA 4IJMA 4UJ5A 1IQPA 1CF4A 1N6PA 1QG4A 4PO1A 4PHFA 3MJRA 3QXHA 5JWHA 3AP3A 3KJEA 5KSZA 5AK0A 2IC5A 2P3SA 4KCGA 3U3KA 4AURA 2CVFA 1F2UB 1HH4A 1QHHA 3KL4A 2JIZA 1QHGA 3D31A 1EWRA 1E2JA 3LWNA 1W0JD 4JLBA 4LBWA 2PT5A 1VYVA 4M9XA 4PFSA 3AKYA 4FXPA 1EFRD 2LCFA 3IUYA 4TL9A 2ATXA 2KSQA 3VAAA 2W58A 3BIFA 5KU1A 3FKQA 1WF3A 3BC1A 2AXPA 1W2HA 4BZQA 5FPYA 1DAMA 4EFNA 1HY3A 4OL0A 2ZTSA 3B9PA 4LHZA 3BORA 2D4HA 2TMKA 3U7GA 4MRRA 1QVAA 4LJ6A 3TW8B 1IONA 2UKDA 5J5CA 4XVRA 4TLDA 3UMFA 2EQBA 1G20E 2HXSA 3HYTA 3CNLA 1Z28A 3NIBA 5J4KA 1RRCA 1KKMA 5IDVA 1WXQA 1W5TA
chains in the Genus database with same CATH superfamily
3DHYA 4RVHA 2X41A 4CL2A 3DM5A 2V6JA 5A9RA 4IH1A 1RBYA 1NPTO 2EX1A 4HD8A 4HEQA 4YTEA 2WQ7A 1UAAA 1FFYA 2J46A 1UL1X 5HFJA 5JCXA 2ZQYA 4FOTA 1HRDA 4G8JA 2ZSAA 3C3KA 3VDMA 4C05A 4AJ9A 4RF2A 3HXMA 1ZK4A 3DHWC 2QGFA 3NIFB 2J5KA 4RMJA 4XASA 5IULC 3AFIA 1VPTA 4OXNA 3OLWA 1OV4A 4XLTA 3F6SA 4ZEXA 3I8XA 4NEHB 4CWAA 4LOIA 4K86A 4MLDA 2G06A 1TL7C 1WB6A 4K2HA 4GOLD 3AOEA 1E5LA 1Y33E 1WUKS 2PS1A 3CIOA 3M34A 1M8PA 4PSUA 4S3MA 3S3TA 1POXA 5ANRB 4D6YA 3ASVA 2OO5A 4OH1A 4AN1A 4BECA 4TLMB 2C4VA 5E6SB 1RC8A 1GFSA 3CLRC 3GRAA 2A9KA 3HBMA 2RG7A 2ZE5A 4OYHA 4NWIA 4NXMB 1U7OA 1TW2A 2NACA 4RTMA 1BOOA 1S96A 1JF8A 4EY7A 1MRZA 1XZMA 5CIWA 4H3VA 1CULC 2IV3A 2C42A 3S7TA 3WRWA 4EHJA 3PGMA 3QLJA 1KZGB 4QPJC 2PT7A 3LLCA 4PYKA 3JVDA 4JYCA 1GUZA 2XQGA 4MWSA 1D1PA 1WXXA 4LDZA 5EZSA 3V8VA 1E6KA 4K9MA 2VQSA 5LXTF 3RREA 1GNSA 3KWFA 3FVRA 1X39A 3UMMA 1N8SA 3CC8A 5D1HA 3ZIDA 5JJCA 5EKDA 1M66A 2QL7A 1TGVA 1KA9H 5DWQA 4DCSA 3AIMA 4ZYXA 1VLVA 1EDDA 3O1IC 5A06A 3FHOA 3QBDA 1XCOA 5KWJA 3JS5A 4DABA 4KXVA 3VOBA 5KNDH 1NQUA 1Q5PA 4C01A 2JJ8A 4F4HA 4MGIR 2LVBA 2OAQ1 5HFNA 1KOFA 3A6DA 3UT5A 4YJGB 1XROA 2R7LA 1NTOA 2DJ5A 2R6JA 1NQ5A 3IEMA 1GSHA 4PGHA 1LFAA 2IYPA 2P6UA 2DKNA 2C04A 1II9A 2ZBPA 3R8FA 1YRHA 4R8VA 3BHJA 5K0LA 1BX0A 4H0NA 1QH0A 5CR9A 2YS6A 4EM6A 3HI4A 4NEGA 3E35A 1MW9X 2G4CA 1OU4A 2G67A 3JQEA 2JGJA 2VDVE 4D3SA 1BD3A 1JA1A 1L7XA 1PSDA 2C7GA 3DDUA 4DBLC 5I9IA 1M5RA 2BZSA 3RSZA 5A62A 1VL1A 4URXR 1T4GA 2BFAA 1TVEA 5B2ZA 3PCTA 5T7BA 3PUXA 3ILVA 1JU4A 3R3HA 2MIIA 2WA2A 3H5AA 4WV3A 4AJEA 5C4MA 3CZ4A 1GLGA 1C1XB 3GJZA 2XWSA 3HU3A 3HXKA 4HRXA 1CYDA 1U9CA 3O8CA 3S5UA 1SQ6A 3QKIA 5FBZA 4G4GA 1IK4A 3S2GA 3VPHA 5FEUA 3FYHA 1GGKA 2YRXA 1P9OA 5FNZA 3T54A 3BTVA 2B4RO 5JQWA 1J5XA 3PF8A 1M1UA 3NWJA 2QAJA 1XNRB 4UPEA 3LZDA 4RD2A 1W52X 4ZU1X 3WB9A 2JCXA 3S2SA 5HQTA 4O6VA 2DBVO 1A9PA 4MMYB 1G98A 2DWQA 2WYWA 4RM3A 4CE6A 2EP7A 4OK5A 4Q02A 4UTRA 4J9VA 1VSQA 2ZJYA 4MH0R 4E14A 3C5HA 5IAAA 4PR3A 1YJCA 4MLPA 4W99A 2Z1MA 1QQBA 1QTQA 4M7PA 3PBKA 1R10A 5ESDA 1W5AA 3OTOB 3T3OA 2WTAA 1VHWA 2H2GA 4AL4A 2ZI4A 1ZI8A 5EXDA 3W7AA 1GG9A 2ONKA 2UYYA 4AQYB 4P38A 2Z3ZA 4IXWA 1BN7A 4YMWA 2A9PA 3H13A 3PX3A 1PG2A 2NIPA 1JKFA 5AW5A 2YICA 5K45A 4NBNA 1O94D 4RKQA 4BCDA 2V7VA 2VH5R 2VK4A 2HA2A 4LXQA 1N7JA 3HO6A 1AZLA 2H1HA 2JFPA 3IQXA 2PRYA 3AYZB 3N6XA 4MS1B 4RGBA 5GM2A 4B2IA 4TL8A 2HMWA 4TV8F 3SR3A 4BLUA 4ZZIA 4Y2PA 1QSGA 3VR3A 1WNFA 1DGQA 3C7AA 3II6X 5J58A 2IS2A 1W0CA 3RVNA 3I64A 3Q6MA 5KSYA 5IWAB 4HJRA 3Q8KA 5I7UA 2X77A 1UJ6A 2XYVA 2C07A 2C9ZA 3I0ZA 5C8ZA 3IOEA 5E1DA 3A2NA 4EW6A 4RZXA 3PVZA 3MF4A 3RBAA 4X93A 2DTXA 4J0FA 5IHXA 1GZUA 3CZMA 4A6DA 4DJFC 1AVTA 4EF6A 1S0UA 1K92A 2B92A 5K7SA 4Z3KA 4MROA 1RXEA 3OJXA 1J4AA 1ZM9A 3IBGA 1MCZA 2YWFA 1A1SA 1XTVA 1FUYB 1RQXA 2C4HA 2QXTA 3MGGA 1IY9A 2OVBA 4RELA 4XUDA 5A0FA 3E05A 4GI2A 2QS9A 3OQ1A 4MV1A 2JLRA 4NQRA 1CVIA 4FQ8A 3QIAA 4O33A 5FD8A 2AG5A 4K9DA 1VPWA 1YJBA 1YDWA 3NUQA 3PC4A 1K4KA 4JH0A 4PIMA 3PEFA 1FNNA 2ZIEA 4RDCA 3KJNA 3V8NA 4EPTA 2W2LD 5EXSA 3VSDA 3BD9A 2LTAA 1FNBA 1MA0A 3CVOA 2ALJA 4NYIQ 4JN6B 4C29A 4MJXA 5TLSA 2IEZA 4EG5A 2W42A 3OLVA 1Q0HA 1OXBB 1EM6A 1QHHB 2D2EA 2JDIA 3OPMA 3QIVA 1RLTA 4WGFA 1A27A 4XXHA 4B3GA 1K63A 1JVSA 1NVBA 1TZMA 2HLNA 3HB7A 1ABEA 3G79A 1AKEA 4YLEA 1XRJA 4Y2HA 2K2QB 4GM1A 1QVWA 1JZQA 3P7MA 2AFIE 1OXVA 4LQCA 2OZKA 4PLWA 4F6LA 2X3FA 5LQJA 1O95D 3SYLA 1VL0A 2FMFA 4NCBA 2IX3A 1GY8A 1FFWA 2J3DA 1JFVA 3NX4A 4N3AA 4OTZA 2IWHA 3T0IA 5JCPA 1N0WA 4EYKA 2CLHB 1WCV1 1D0VA 3C8UA 3PPIA 4HX5A 3T95A 4JYAB 4RZUA 2FFJA 2YW9A 4YN3A 4NNJA 1PYDA 1HFKA 3KJGA 4DBLE 5B36A 4P0TA 1IQRA 5KTRA 5F73A 1ZH8A 3P2KA 4JIMA 4MS3A 2B8EA 1N9KA 1VPLA 3N39C 4GX2A 3SHOA 5BUCA 1VKNA 2C2XA 3ANNA 3JQ9A 3NJRA 4NPCA 5CX1B 1FMFA 1T0BA 1Z5VA 3V8RA 3CLHA 4IDHA 2C98A 3HUDA 1SBTA 1RYMA 1TQ8A 3GIDA 1OBCA 2HXGA 5DBOA 4A2CA 3I58A 1QDLB 5CFQA 4LSMA 3WK8A 2DUNA 3VAZA 1E2QA 4WKGA 3WGOA 5HP4A 3RQIA 3FUTA 2J3KA 2LKCA 2ZU6A 4BCBA 4S2EA 2IT1A 4G4JA 3LX6A 4HRVA 3KD2A 4AY3A 4CF7A 4W1QA 1CRQA 4DA7A 4HSEA 2OCDA 3THXA 1Y3AA 2XBLA 1H2BA 4JFRA 1PJZA 1P31A 4IEEA 3Q3VA 4OFWA 4TYQA 1JQLB 5CLHA 3DBRA 4L22A 2QRPA 2QTTA 4MUYA 3C24A 1L8AA 3EGWA 3DAOA 3D7LA 5EWMB 4J03A 1ZD2P 3DZFA 2IGTA 3UKJA 3ROZA 1XLTC 4PC7A 3W7BA 4D8WA 2WUEA 3C5VA 3OMWA 2ZYDA 1SVUA 1V11B 3DBHA 3KT6A 3MBOA 5KTSA 3A3PA 5L3SB 1HA3A 2R7MA 5I47A 4YRIA 2QVYX 4X60A 2NUAB 2INGX 1E3WB 2WWFA 4G41A 3VZCA 3WZLA 4CG0A 3EQ9A 1E8MA 4M0CA 2PO7A 1YGPA 4L4RA 4NS1A 4RMIA 5EGNA 1DBWA 4RQBA 4D79A 1ODJA 3CRMA 1HM5A 1KWGA 1VTKA 3I1FA 2Y77A 1YKGA 4TZKA 3BIJA 3PGVA 4WKBA 3Q6NA 3G8YA 5LP6C 4MHTA 2HR1A 4ZO8A 3PRJA 2HM7A 4RC9A 2FY8A 3UV6A 2NU7B 2JBAB 3CT6A 3T9FA 5AW4A 2I6GA 4L5IA 4RMHA 3K6SB 3FKJA 2JD0A 1I9GA 4NBUA 3QE4A 2D1FA 2I8LA 4PVDA 1E8DA 2BJWA 1NBMA 2LPMA 5JNWA 4N0MA 2QIOA 3PRKE 2P9GA 4WY2A 3ZE1B 1A7UA 1QC5B 4BS9A 4DJDC 3R5XA 2OHVA 4L0MA 4LX0A 5K0NA 1O77A 1RQPA 3VQTA 1WQ3A 1KO8A 4RSRA 4CTNA 4EW2A 5CDGA 5JV5A 4H35A 4JP2A 3DKPA 2AI2A 1U8YA 3EXFA 3RIGA 3EXHA 3CUWA 5H82A 2A5YB 3FZGA 1KBQA 2GHRA 4FI3F 1Y6GA 1T5LA 4DSZA 1UKEA 5BWOA 4RACA 2ZWPA 3WL3A 4AROA 1ORTA 2AD1A 2PYZA 2H4XA 1W34A 3BE5A 5DX0A 1U1GA 4BASA 2ASEA 4I55A 4BV2A 4BBJA 2VAWA 3KQMA 1PK9A 3L8DA 4KQ6A 2QRQA 4RLFA 4AVYA 4BB5A 2F3SA 4IFBA 3C1OA 4OUDA 2J6IA 2OFOA 3KETA 2GCNA 3VR6H 5BOSA 1H0HA 5FUQA 2Q8NA 3SG0A 2VDRB 2VYNA 3PPYA 4C4TA 3IA7A 3EZNA 3T3NA 3TAXA 1H1LA 5IAEA 4OGFA 2FHSA 4N8SA 3RI3A 1BKYA 1F2UA 1I3CA 2W4IA 5ENVA 5B2EA 5L8VA 5DXAA 1V47A 1Z47A 3G0BA 4Y6OA 1G6HA 2NAPA 3RF6A 1EVZA 2ZUBA 2HBRA 1D6SA 1TLTA 4M89A 5B6IA 2VYCA 3TK1A 2XIQA 3X44A 4BLWA 1M1YA 4FOPA 1Z25A 4KVGA 2K4MA 2X9GA 5FL7A 3WY9A 3WL7A 1TF2A 3ZJYA 1YU6A 2VRCD 3EEBA 5KTKA 1JE1A 5K05A 3IPLA 3ASZA 5ALXA 2Q4BA 1MVNA 2A0WA 3D02A 4RNDB 4LGYA 3ZOZA 5L40A 4HDMA 2IP1A 3KTAA 4JAVC 1ZK0A 5LP1A 1C3XA 2XWPA 3AUUA 4DLUA 4KFTA 4EPXA 3T5PA 2HRQA 4DCOA 3PNOA 2B30A 3H8JA 2GPWA 1QYWA 3R6LA 2AHRA 3WGTA 2XDYA 1Z75A 4NZPA 2UZIR 5AM4A 1KH1A 2R7KA 4FJ0A 1M2GA 2EU8A 2QMHA 3PFWO 3PYMA 2BISA 1TTPB 2F9FA 2YJ3A 1ZD5A 3I2HA 5EMJA 2O2JA 5AIBA 1WX1A 3HV2A 3QX9A 1BFUA 3K9LA 3PXCX 4R8MA 2RBGA 4GLJA 4YQZA 1G59A 1YR2A 1PFUA 1POWA 2KI5A 3F7OA 1KYWA 2A35A 1J97A 2R2AA 2YXDA 3A25A 4J0IA 4RHEA 1V6AA 1R0LA 2P75A 2YY7A 1N6RA 1EUCA 2ZYUX 3DEYX 2HGZA 3QPBA 4MJ3A 4MIYA 4F8YA 2EXXA 2RIPA 5IDWA 1QO0D 1ISRA 3LQ4A 5F2NA 3D7MA 5GADl 1IHUA 2ZJAA 3IUMA 2F2TA 2RB5A 3EFBA 4TGLA 1Y5NA 1NQOA 2R97A 4JBHA 4ZAYA 4A8HA 5INTA 4Z0TA 2GJSA 2OWDA 4DLXA 4CM4B 2PYIA 3FCXA 3QMPA 3LL7A 3QBJA 4FHZA 1QKKA 4Q82A 3V32A 2EZ4A 3B12A 4GF5A 5IM5A 3H86A 2IIVA 2XVZA 3RSFA 5A9SB 3D8TA 5JWOA 4GXNA 2H5JA 2VH2A 4JVSB 5E6SA 2QQFA 3JQAB 3EIHA 2P40A 1WXWA 4DIEA 1R8YA 3IOBA 1PJ4A 2VZLA 3OIWA 3P9PA 4M7WA 421PA 1SUFA 5SYMA 1FP1D 3B6KA 3Q87B 3WL8A 3RRJA 2QV7A 1D2CA 1G3IA 5EZYF 1Z39A 3NTXA 1PZEA 1BNCA 4JSRA 1V1RA 5CCBA 1E92A 1QIHA 2V65A 1VBFA 2WJZB 4MQBA 3W5UA 5JBQA 1LLUA 1COWD 3NTOA 4ES6A 2C03A 2XUAA 1T1RA 1GA1A 4L73A 5CA0B 1SKYB 2B2NA 5K0JA 2LIPA 1G5PA 2QZZA 5AW3A 1ESCA 3U2QA 1HT2E 3OZSA 5F7OA 1UMCA 1BC5A 4QUBA 2WUWE 5EZYA 3J7TA 2ZZNA 3FNEA 2HCBA 5IK2D 1JXQA 2I71A 2IOHA 3CO5A 1PE0A 4O4IB 2YZKA 3Q9SA 1FTQA 1PD1A 1WPGA 3KBOA 1X87A 4ZP1A 2P4UA 4JD5A 3RUPA 4LHWA 4KXLA 4ZPXA 2QQGA 1EX9A 2V3VA 2OUKA 3H16A 3HGMA 2DERA 2EW8A 2W6ZA 4W1RA 3HB4X 4ALLA 3K8OE 1HDEA 2W9XA 2Y0EA 3OICA 4MV4A 3LCJA 5TMEA 4HNTA 3ZE6A 4DBVO 3AKCA 3D4IA 3O31A 1T2UA 1PTJC 4UXHA 4WX2B 2OP0A 4U6QA 3E27A 4I9NA 1FFGA 2KLHA 2XMCA 3K2BA 1LXCA 3DL7A 3PPWA 5SZJA 1QGED 5L6MB 3L77A 2DT8A 4IFIA 5L95A 2CZCA 5IDQA 5D5HA 3ED1A 4Y6SA 3HJFA 1U80A 1W5SA 3WRYC 1TJNA 1YQUA 2LD4A 4U63A 2ZUFA 1HV8A 4C43A 4JYZA 3CG0A 4I4LA 4O4JF 3HZRA 1C7QA 1T1SA 3FZYA 2IJGX 3L8CA 3MWEB 3EW9A 1U1IA 4CU2A 1Z6ZA 2XOEA 1UOQA 1XZQA 1N0UA 2H2IA 3LX8A 3LI2A 2E7ZA 2H92A 4C88A 1DEAA 1N3YA 2GCOA 2OV1A 1YQWA 3OCXA 4H1HA 5LA6B 3UMCA 1KMQA 3Q9NA 3VBCA 3OLZA 3LSTA 1O0BA 2NVWA 1MV8A 3D81A 3ZE7A 3KE8A 1U0SY 2VZ8A 2PQ6A 4JJZA 1LQ2A 3GCDA 3KUUA 1H4QA 4ZCSA 1RTTA 2RHBA 2VNKA 5BQPA 2AIRA 4UFPA 1JW9B 4PRYA 5JVDF 3L4SO 4ID3A 4XQCA 2QMZA 1RKUA 2VWHA 5HKOA 4L0CA 4WA8A 4C4SA 3ZXUB 4MQFB 4RTQA 4UD2A 1XUOA 3UWSA 1FOEB 1CUAA 2HZ7A 2V55B 4Q39A 2DFLA 4LF5B 2GJ8A 3AF4A 3QUCA 1MTZA 1UCFA 2IHUA 2F3RA 2WU0A 4QGSA 1B74A 1U0JA 1NP7A 1GQRA 1ST2A 1GGHA 1XRNA 2JB9A 3NLLA 4FMPA 4WUVA 4G2TA 2Z4RA 4O2AF 4BLOA 2OHFA 3HO1A 1J0AA 5C32A 4FLFA 4FBLA 2QU8A 4LOAA 2UDPA 5HUHA 5IKXA 1YA4A 2NADA 1JYFA 4X3CA 1IXKA 3Q41A 4H4EA 1EVLA 3PDWA 1Y4UA 2ZUVA 3H3XA 2QM3A 3NIWA 1P9NA 3VU1A 3KZOA 5L53A 4DA6A 4Z1OA 1P7WA 2OXRA 1ZOSA 3WKDA 5BQOA 3I5AA 3W3AD 3CHYA 4UUOA 5ELXA 2C82A 1HYEA 4M4SA 3DOIA 1Q1QA 1VCMA 4U0KA 2E4ZA 2XB8A 3HJRA 4MV7A 4QTZA 1IJKA 5LWHA 3E4CA 2MT9A 5CG1A 3CPSA 3WNQA 4QT4A 1GQOA 1HEUA 2V5AA 2ZE8A 1VSTA 2N1BA 2RGDA 4M9UA 1YVRA 4ZV7A 4RTRA 1A2OA 4XI9A 2HPVA 1VGRA 4RVGA 3ZWPA 1LBEA 3AXSA 3ZZNA 3N0RA 1X7YA 3BTSA 1IZZA 3QH4A 3ITKA 2VTBB 2Z6QA 1K9SA 2IKQA 5EUMA 1J24A 1QIEA 2CL7X 1YQEA 1FTWA 2DYKA 2FDXA 2DQSA 5F2EA 1PN3A 1KGSA 1UWKA 3SYRA 4GQAA 1KHHA 5EJGA 2IYNA 2QUIA 2YN0A 2AVDA 3O3CA 2PJZA 1UBTS 2YUIA 1TAHA 3KEGA 1TVCA 4JDUA 2WKWA 1EX1A 3KAKA 2Y4OA 1QIJA 4QXMA 5DYGA 3VVBA 5I6DA 1G20A 2YDXA 1A04A 1PUXA 1DOZA 1O6ZA 3HMQA 1OY1A 3VKWA 4ASUD 3HKEA 3I3SR 2E6UX 1ZGGA 3MA0A 4HSGA 4NAUA 1USWA 1ISGA 4PG4A 4IDEA 2A0YA 2YNMD 3AR9A 3DZHA 4EO7A 3O75A 3QENA 1NVDA 3KU1A 3SC4A 2R6AA 4Z3DA 4DY6A 2XZLA 4L6IA 4G37A 3SKYA 2PL1A 4KIUA 4TUYB 4NP6A 1KAOA 1XZLA 4F91B 1NN0A 1UXOA 4KLZA 3TG8A 3LYUA 3SYTA 1QE0A 1DKOA 1TOAA 3BXZA 2XUJA 4YUAA 3S8EA 1YOVB 4CZ2A 1HG0A 3CJRA 1XJCA 5EIWA 2B4AA 5ALPA 1ZHFA 4MKFA 3EMKA 5DHFA 1RT9A 4CHGA 4ECAA 3SXUB 2OK7A 5DLEA 4KPYA 3V1NA 4R8RA 2IRWA 3A7DA 3N0XA 3I9NA 3GHHA 3MTIA 3VYTB 4S1PA 2P2GA 2PBRA 4C3ZA 3CVVA 1FRFS 1SCNE 4GMGA 1EP1B 3Q5GA 1ENZA 1XD8A 5AKEA 3KQKA 1WP4A 5BUSA 1GQQA 3QQPA 2HPHA 2PGJA 5DN9A 3BKWA 1BQ3A 1FYFA 1E7MA 2FN9A 3C14C 3C8MA 3M4ZA 3LBFA 3NHWA 3NHAA 1OXKB 5EIBD 3QE9Y 1HDZA 3D4OA 1K6XA 3QVXA 4MR7A 4D25A 1U99A 4JIGA 3CLVA 4TVKA 2I2AA 3DBLA 2PRJA 1R0BA 2FDRA 4G85A 2O6HA 1H0RA 5LYYA 4LW8A 3IRVA 2AMLA 1DX4A 2KLBA 2QYTA 2W6IA 3GIWA 4KNYA 1VG0B 1VZ3A 2BD0A 2DULA 3DZ8A 1ZAKA 4ILEA 2VDKB 4Q16A 5ECGC 5I51A 4X95A 4B43A 4F8EA 4KHPB 1QG2A 2KBFA 3HNOA 3UAXA 1V11A 1FDTA 4PLZA 2W6QA 4HQRA 1X74A 2GAJA 4B8WA 3EISA 2G83A 4D43A 4Z53A 3ZTYA 4WCDA 3I2KA 1U2TA 1QF9A 3ZZMA 1OT3A 2NUAA 2QJTA 3WTBA 4C4YA 2CMFA 3HPQA 3PVSA 2QTAA 4FP9A 3CSDA 3ORYA 4Q9LA 4R9RA 3WQQA 1MX5A 2QDXA 1EFTA 1VHLA 2VDMB 2H4JA 4IDAA 1M1ZA 4US0R 3TTTA 3PFHA 2Z58A 1EVKA 4P9NA 2N3ZA 4EEKA 3SJUA 4L50A 4E5DA 5IMBA 2PL5A 4GNKA 5KOHA 1VE6A 4QYTA 2ZZMA 2GEFA 4GWKA 4ZAGA 3KJIA 1USUA 1XCBA 3RC7A 3QLVC 1JEEA 5EP1A 4RV9A 1R6DA 2VP6A 3GT4A 2Q46A 5DOZA 3EH2A 1SBQA 2VT2A 2CDAA 3O5AA 4FT4A 1I4DD 4KQKA 3WNDA 1BWQA 1QC5A 2SCUA 1JG3A 3BJIC 4I6EA 4OLFA 1LDGA 3PNYA 4MVYA 3O21A 2R6DA 4MYUA 3IMGA 4X7PA 3ZIAA 4C22A 2ZSHA 4E31A 1YZUA 2FR0A 3RF7A 5EFZA 4FTWA 3ESYA 4HBZA 2H7YA 1FX0B 2WMYA 5E9JA 2NO4A 2BW0A 3D8UA 4XSHA 4X5OA 1YCFA 3E15A 3R44A 4C0JA 3I4LA 4BO9A 1F4VA 1KFEB 1YULA 4XDYA 3MINA 1MENA 1Z8NA 2ES4A 5DZSA 4BNTA 3IRUA 5CD1A 5CB0A 2QAIA 3KDPA 2YHSA 1T4DA 2H0RA 3QOFA 2OG1A 4AY5A 1NFQA 1WDMA 4DZRA 4UTNA 3SVLA 4CXMA 4F5EA 1KPHA 4TLBA 4D9CA 2Z57A 2ZKIA 3E7DA 1BDJA 3TDMA 2DWPA 5LIRA 4Y30A 3C1UA 2E37A 2FPPA 2VXOA 2H63A 3TJMA 2VPTA 4WOCA 4RV4A 5REQA 1NJFA 1D0SA 2HKIA 1P1KA 3EUWA 3H9CA 2EDCA 3FTCA 1L5OA 4E94A 1SVKA 1WSWA 3EIFA 2DCUA 3Q9UA 2XMZA 4FJ2A 3VR5H 2AYXA 3SJCA 1ESDA 5KX5F 1H3NA 2E0IA 1SXHA 4NH0A 4FFOA 3QXSA 1XRPA 1WTCA 2HA4A 4NV0A 6ABPA 3W5HA 4B6SA 5AKKA 2R5FA 5B3KA 4LS3A 3K53A 4FYPA 3ADKA 1XWWA 5BR8B 1KS9A 1T5BA 2QX8A 5KC9A 1CUBA 1B42A 2QZSA 3SFVA 4WTOA 1OOEA 1VHJA 1P0IA 4LDRA 4XJVA 4BX2A 4PG8A 5IAOA 1FSFA 3J7AC 2VPXA 4C08A 5I7HA 5KX5A 4XCVA 3HUUA 5A5GA 4JQYA 1CVLA 4IZ6A 2IS1A 3A8TA 5CLQA 2J9XB 4QBIA 4BNWA 3TE6A 1ND6A 1YI0A 1YZ3A 1U6IA 3QTBA 4NBSA 4I4TB 2NUPB 1UBRS 5A4AA 4JC4A 5GJVC 4I7EA 2A9QA 1PNTA 3EY9A 1N8NA 3CZPA 4RL6A 1RP1A 4JYBA 5B58T 4YCCA 2YWJA 5TQ2A 3I0NA 3FLAA 1JLLA 4X62B 4YMHA 4M21A 4P4TA 3EYWA 1SOVA 1L5QA 2P91A 2ZRKA 4FDUA 2ZAMA 1PL0A 4CTMA 1MD9A 1FQJA 2WAMA 3DUFB 3M1AA 1VE7A 4ZT4A 4CMAA 1ICIA 1DAIA 1HOTA 4AIIA 1G7TA 1JQEA 3JR3A 5ER9A 4Q1FA 3UEOA 3WGKA 3H8VA 2DTEA 1ZM7A 1XD9A 4R7GA 2CBGA 5CVDA 1JMYA 1TQ6A 4BNKA 4EG7A 2QTRA 1NHGA 1ULSA 1IB0A 1Z6PA 2D62A 2QUBA 2XX3A 3EUFA 4R0MA 3GEDA 5A9SA 5KTYA 3PEYA 1G0OA 1PO7A 2ZIXA 1U5AA 3LLVA 3I72A 4COOA 2I67A 1UBNA 3V7NA 1GDDA 1RRMA 1EAMA 4UVGA 2GN4A 3LC7O 1V5EA 3A05A 1JH9A 2HMUA 1Q3TA 4PQYA 4X71A 2B21A 3BPSA 4LZNA 1PVDA 1NKVA 5KC8A 3ROKA 2V9ZA 1KVTA 4NV1A 4JVLA 4WFJA 5AJHA 1KARA 3TD2A 2PSDA 2DQKA 1YRBA 2DCMA 3BRWD 5ABPA 3A1EA 5SZIA 4LKRA 1U0GA 4MWDA 1ZQ1A 2OB1A 3H0KA 2PX4A 3B3QA 3KV1A 1CUVA 4UEWA 3I6YA 2R7NA 4Q7KA 1UPBA 3U3RA 5A4IS 4A03A 2A0FA 3G0DA 2P9EA 4LTMA 3MZ0A 3Q3IA 1GQSA 3D3QA 3SOPA 2X22A 2XF2A 1IUPA 2ZR0A 4FS8A 4ZYWA 1ZG3A 5LD2B 4YASA 3SN6A 3V3TA 2YMLA 5B30A 4XIJA 2B2XA 2B5OA 5CA1F 2EFHB 2GX6A 3QMWA 4UUPA 1TUBA 2FQ1A 3R9KA 3RYIA 4GGMX 3ZJVA 2H1WA 4KXUA 4CQNA 4HUQB 4JI4B 2COUA 3SE7A 3WDKA 3CUUA 2JW5A 1CWUA 5E2IA 1G8GA 2NO7A 3BGVA 3L7OA 4DSTA 3GLGE 4O4IA 3OIUA 4X8LA 4H15A 1B6RA 2JCGA 4WFIA 5E7JA 3V2HA 4E2WA 5I8WA 1WMSA 4ATNA 3U7QB 4UKDA 4DDMA 2O50A 1KQPA 1SZJG 1Z5UA 2DR3A 2PQ2A 3GT7A 4JBWA 1OR8A 4O2BF 1HOXA 4BB9A 4YNBA 1ILEA 1NF9A 4CM8B 4WHMA 3BVPA 1UF9A 1RHRA 4XDZA 5AD1A 2D8MA 2FWMX 2J3MA 2IZ0A 4YJ3F 1ZUD1 2IF2A 3D7KA 1SEVA 1DZIA 1VMAA 1G63A 2F1RA 2FPXA 5K5EA 1ULHA 3TNDA 3OCVA 4YDHB 3RHTA 3RTCA 4BFXA 5LYJF 3IPXA 3VXKA 1NASA 5FF9A 3JPYA 1IYZA 1QPBA 1DRVA 1U3GA 2ZYIA 4O2BA 4YDSA 4N0PA 1VIYA 1Z34A 1G4UR 4DR5B 2C9DA 4KU4A 1DP4A 2YJNA 4JLNA 1DHRA 1QGOA 4EHFA 1KYYA 2LZ0A 3I2YX 1KJ8A 2IPNA 3MWEA 2WDZA 3OCJA 4UMFA 1BE6A 1ZH6A 4YP7A 4BMCA 1XKXA 2XDQA 2A1UA 2IYWA 5ICFA 1XDBA 1ZD4A 2FE1A 1V16A 1V3TA 2IZZA 2O3QA 2O5VA 1T9GS 2RKBA 2XE4A 3H84A 3ORSA 5LYJA 1M2NA 4HYYA 3VO8A 4AFNA 5EE9A 1ZSYA 5L4SA 1VJDA 1U2PA 5LIPA 3E4DA 4C7JA 4MVJD 4KXYA 3RYCA 1Q91A 2BCEA 3QE3A 1AN0A 1W1UA 3AEZA 4QDUA 5JMPA 2JLUA 2GN1A 1Y3CE 4F21A 4MKIA 2ZB4A 1G18A 4ZOQI 2KYRA 2XOKD 5EJ2A 1L7PA 2CZQA 5J3JA 1E1YA 3CRNA 4ENRA 4MQFA 1W7AA 4MQLA 2C77A 2TMDA 4FNGA 2X0EA 1O4VA 3D59A 1EWKA 5IAJA 3W8DA 4PYOA 4ARSA 2VZ0A 2UVDA 3CLSD 3DVAB 3BFJA 1RS0A 1GPAA 1Z33A 3CZQA 1N25A 5FI0B 3I76A 1KJQA 1OWLA 1P3JA 1UBMS 1Z06A 2J3HA 2ZRPA 2X40A 5HTOA 3G8CA 1YRYE 3BQNB 3E9QA 3CWZA 1ZI6A 1ZOOA 1QX4A 2JAXA 5CNIA 5EIAA 3AONB 2OVFA 3M0EA 1JFFB 2EP8A 4CFYA 3IFSA 1PR0A 1UINA 5DNUA 1IJFA 2ZJBA 2XLBA 1IOLA 1FS5A 2QXYA 4OV6B 4PLTA 1HE5A 1Z4LA 2PV0A 1MQSA 1TA9A 2Q0QA 2ZWOA 1KZHA 8ABPA 2AMVA 4G23A 1WXEA 4G5QA 1M8GA 3RAGA 4BQNA 1YR6A 3TFWA 4DB4A 1AHIA 1VXRA 1T6ZA 1TADA 2IY8A 1KQOA 4FX2A 2OPHA 4JB0A 4F3CA 4I1IA 4F4IA 1KSHA 2W2VA 2H51A 1HKHA 1ZGJA 1Q7GA 4KN6A 4WY5A 3F6YA 4RIFA 3HBFA 2DE0X 5EG5A 1QWSA 1NHWA 1E2NA 4KODA 4F0JA 2C7RA 5L3QA 1Y1LA 4BZWA 2JA1A 5KTNA 2HSGA 1HC7A 4M8NE 2P9ZA 4WOPA 1KHTA 2E85A 4YBRA 2WB4A 4JI8B 3L79A 4YRRA 3QVLA 4F4CA 5LXTB 1ZBDA 1Y4SA 4V38A 3OWHA 3RU9A 5EWLB 1UDXA 4F2WA 3BH0A 4JT2A 3VC3A 2AF3C 4TOIA 5EZ5A 4OJQA 1DBIA 3DFFA 4E6EA 2V5VA 3HB9A 3H5OA 1HSZA 2HSZA 2NTEA 3PR3A 4RMGA 2WM9B 3SEAA 2RAUA 1W4AA 2P6OA 5HSGA 1P45A 5FUMA 3EGDB 3MS7A 4BIMA 3RS3A 3GJQA 2JFXA 3TLCA 3MQ2A 3UMRA 4CQLB 1RXUA 4MK4A 1T0PA 1IG3A 1Y6ZA 3RFXA 4EZIA 1F8GA 1GR1A 1CUDA 4INZA 2BGNA 3ANMA 2CXSA 4BPRA 4P34A 2MSEB 1RABA 2QP4A 2OQRA 1L7MA 1ORDA 1AKTA 3DAYA 1ZS9A 3H6KA 4TUYA 2ZJ1A 2PHZA 2IPOA 3KALA 1ZAYA 4MGZR 1ID8A 1NVVR 2IZOA 4ER7A 4B44A 3UJAA 1VLZA 3N8IA 3B60A 3IEUA 5AOCA 2FGKA 4MWGA 4IF4A 4KLRA 2ZCJA 3VOSA 4HNGA 5FKJA 5F5NA 5I7AA 2WMDA 4LAFA 4X8OA 1GGFA 5AVJA 3ZEAA 3U3OA 1RJ9A 2ZBUA 5KYWB 4LBZA 4G0NA 2G9ZA 3SXUA 5CDUA 1RCUA 1H23A 4YRFA 2VZ9A 2OHGA 1H2HA 2ZM6B 1I7SB 3P9RA 1TKRA 3BE4A 4Q3KA 2CLKB 1KK1A 4LF6B 1R18A 2Q5CA 3NHJA 3FOEC 1MV5A 3B7GA 3FN4A 1O94A 2VYQA 2CE7A 3T6KA 1R4NA 2ZTLA 1Y81A 1W6UA 3K5HA 1RJEA 1MH1A 4U2EA 4FYXA 3AR2A 1JG7A 1H42A 3ASUA 1NVAA 1RHJA 1FEZA 2HRZA 1E3MA 4J1TC 3PCRB 5C46F 5JI2E 4G5FA 2C2WA 3EOBI 3C3AA 3M6LA 4GRAA 2YWBA 3CCCA 3RIYA 5IVPA 4EGSA 2HBYA 1JDJA 2OESA 1W6RA 5IXJA 4E5SA 5KB3A 2VDJA 5EVCA 4HDSA 2CXOA 4PRLA 2XD9A 3BD7A 4XARA 4IXTA 5HKAA 4Y9RA 3W2EA 2I1LA 4LYGA 5BVGB 3TQQA 2ZUEA 4J0EA 3E5RA 3LOQA 5CJJA 3MM4A 4MVCA 4RTSA 5EVJA 1L4GA 1EWTA 4B5LA 5KJCA 2PZLA 2XQIA 1LPPA 2I2CA 3HDGA 4GUDA 5TVKA 1S1CA 3BXFA 3EF3A 4CKCA 3CVWA 4WN9B 2Q4TA 2R6GA 4M1WA 5JAOA 2D74A 1DAHA 3TQTA 2CHQA 2IF0A 3W2TA 1O9GA 2FFRA 3BDAA 5LLSA 2W6JD 1K88A 5TXGA 2ZAIA 1ZD8A 3DZGA 2BHRA 2RHTA 1LVGA 2W2LA 4FFSA 2H31A 4TV8B 5EJAA 2IV2X 4B48A 3HN7A 4AUEA 3LSYA 1LZLA 5DI3A 5AHOA 1BROA 3ZDDA 1QZ3A 3OIYA 4HI0E 4R1MA 4RKWA 5KINB 3U19A 1LI7A 1A9XB 2R11A 4B8YA 4BAUA 2YHAA 1YK0A 3BMCA 3V8BA 2BSAA 5JATA 1YRWA 2WDPA 4G5OA 5DM4A 2PLAA 3KYDA 4PS0A 3GW8A 4TWZA 1GCAA 2ZYGA 4AC9A 1G3QA 1JKJB 3PENA 4LZJA 4L95C 1RYHA 4YV1A 4UE3S 3SNKA 4P4SB 5CX4A 2AC7A 1T36B 2AWNA 2LWIA 4XQ0A 4BNHA 1XJWA 2LUOA 1KORA 3DEJA 4LRWA 4BCCA 5CFZA 1EQUA 4IXDA 1X3LA 1MIHA 3LQFA 4ZA2A 3Q5DA 2GXAA 1ZO8A 2ZRAA 1C9KA 2ZI3A 2VYVD 4OJNA 2PH7A 1IM8A 2IPAB 4CQMA 1F2TA 2PXAA 3KVNA 3LY7A 2WG0A 4M1QA 2VJYA 1D4ZA 4RA6B 4L85A 5E4FA 2Q3HA 3K0KA 3UPDA 4ENTA 5LM3A 1FX0A 2YXNA 3EQZA 3GPCA 4BFYA 3BQ9A 3GMSA 4LOLA 1A71A 1N33B 5F5XA 2ACEA 2J5RA 1V39A 1VI2A 2JHGA 4L7VA 1PSZA 3K1YA 3TW4A 4MGHA 3ROTA 3DPIA 3QX3A 1T3LA 2J7KA 4WW0A 5C1OA 1EK1A 2C2GA 1WBDA 2VQEB 1UMKA 3P0JA 2I6FA 3V2IA 3A9CA 3UWPA 1Q6YA 2C3MA 4DIMA 4UOEA 1KJIA 1RAAA 2D5AA 2A92A 1BHSA 3NCHA 4ZGGA 1Z18A 3W5BA 3ZI0A 5FUYA 2GKGA 2YYYA 4UFOA 4ENWA 1SCBA 1E0KA 1H0SA 2O1EA 1Z2CA 2YMMA 4GBMA 4E15A 3JRNA 2PLFA 4MP6A 1RCFA 5T8KA 2D1RA 4OHOA 5I9MA 3MERA 2VL7A 3VPDA 1KKLA 1U8EA 1G3RA 3K5PA 4Q3CA 1H2YA 4CKBB 1A2QA 3S40A 4GM0A 3BZBA 3GOQA 1RZVA 4IGKA 2BKLA 3IIMA 2LP4Y 3B20A 1IQUA 3KELA 2OGWA 4HQKA 4R5MA 4YAWA 5EIFA 3VH1A 4F4UA 3PLAE 1U8UA 1NXQA 1TYCA 1AKUA 1QGUB 2JH3A 2PSEA 1QGZA 1IY0A