1GRRA

Chloramphenicol phosphotransferase in complex with 2-nac-chloramphenicol from streptomyces venezuelae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grrA00
1YVDA 1ZC4A 3ASZA 4ACAA 4EKDA 1OH6A 1BS1A 1Q3HA 2CLSA 1ESMA 4BFXA 3TUZC 4IDQA 2PX0A 1ZNXA 1T3SA 2IYZA 4TLEA 3IPXA 1EFCA 3K70B 4NKRA 3CM0A 1XJCA 2JJ1D 1BIFA 4QJ3A 3W34A 4RVCA 1G19A 3MRSA 2ZRAA 4IDPA 4Q1AA 2CBZA 1GM5A 1JJVA 1KI2A 2AKAB 2H17A 2QAGB 1P60A 3NDPA 4XWOA 2IYXA 4HDCA 3UWKA 1ZVQA 1N3BA 4G3XA 4DIDA 3KJEA 5EE1A 2MMCA 2B8WA 3LXXA 4MUAA 5CDFA 2NO1A 2Z0MA 3IO5A 2CL0X 5JCPA 3SFZA 2YWGA 4BZQA 2NO6A 3FKSD 1US8B 2IWRA 3C15C 2GF9A 2ZM5A 1PLKA 1UBFA 3D3QA 3WMFA 2I3BA 2OBMA 2ZETA 4RFSB 5L8VA 4DHEA 4FWTA 5E4FA 1KJWA 2QI9C 3OFND 2CHGA 2FOLA 4D2IA 2HCBA 4IDOA 2D2FA 4OL0A 3VKWA 1R0ZA 5KUTA 4WAUA 1TQDA 3VR5A 3T5GA 1OXVA 4X8HA 1RIFA 1F60A 2V7QD 1KK0A 3W8RA 2H92A 5HZKA 3K0FB 2P3SA 4R7ZA 3SYKA 1N0UA 2EU8A 3VQTA 1KSFX 1P3JA 2IYLD 2JJ8A 3IILA 1NIJA 1TF5A 4D26A 1K5GA 4Q66C 3N2IA 3T1TA 5TDHA 1FTSA 4KBFA 3B1VA 3THXA 1R0XA 3KFVA 1ZC3A 1KI7A 4UKDA 4F91B 3RSLA 4B33A 2ZJYA 3AVUA 4BLSA 1D8TA 4MRNA 1F2TA 3RYTC 4I4LA 3E70C 2NQ2C 2JJ1A 2QQEA 3O8DA 4DUGA 1XTKA 4AD8A 2F9LA 2ZRIA 1GAJA 1AIPA 2PH1A 1JQJC 4UNNA 2IYQA 5JHGB 3IGFA 2CEAA 3R9IA 1SQ5A 4TWZA 3A6PC 2OFXA 3L8ZA 2VL7A 4HLCA 1Z6YA 2QQ0A 2G83A 1E9BA 4ASUA 4Y0VA 3VR6A 2HYDA 1OW3B 3W5JA 4KSCA 3PITA 2VP4A 3HDTA 3L2OB 5JWRA 5JHHB 3EPJA 4TYQA 5FI0B 2IUTA 4QG7A 4TQUS 2CLCX 3A1UA 4OHYA 1JALA 4OI1A 1CJVC 1FMJA 1QF9A 4L9SA 3U7EB 4A82A 5KO2A 4TZ6A 4UNSA 2BEJA 1E69A 4NONA 1N25A 4WZBE 4QGFA 3DKPA 1FP7A 2D2EA 2ZRFA 3KKOA 4JYCA 1S3GA 4BLQA 1G21E 3V4RA 3W5IA 1VG9B 2ZJ5A 1KKLA 1P75A 4US1R 5JZVA 4M1TA 1HY3A 1U90A 1E2JA 1KZ7B 3BOSA 4V02A 1N0VC 2IS4A 1T8UA 1Z29A 3K0EA 3ZH9B 1KIMA 2WJJA 4D81A 3LFUA 5CLQA 4DSOA 4NYIQ 5FOVA 1DAFA 4GOJA 5KHOC 2XAUA 3T06B 1E99A 3NC0C 2G9NA 3QENA 1OH5A 2FA9A 2FH5B 3H84A 1J8MF 4HAVA 3AF4A 5AK0A 2IT1A 1J90A 1Q44A 2RB4A 2Q9CA 2CE7A 1KKMA 3CH4B 2GK6A 3ADKA 3A1VA 4IRUB 1XCPA 4FMDF 4OQFA 3GJ0A 2AR7A 1VECA 4DC9A 1ZP6A 1T0JB 5JWHA 4DUGD 4RCZA 4V0LA 1V43A 1CR1A 2B21A 1MO5A 4QNMA 5HCIA 1XEFA 2CK3A 5GJVC 1RRPA 4GNKA 4GFDA 1ZCBA 5G3YA 2KE5A 1ZCAA 5DE3A 1DAHA 3MLEA 2QAGC 1Z06A 4CIDA 2JJ2D 1GL6A 3AGQA 1CR2A 3MWYW 1UEIA 1FW6A 4AKEA 3KUCA 4MQBA 1P2VA 4BUJA 5GVSA 1SHZA 4M9XA 3I3SR 4BLTA 3LQRA 2OCPA 1U99A 3C5CA 1GL9B 4HYYA 4CEIB 3BXZA 1GFIA 5DLQC 4R71A 2QAJA 4P4SB 1XEXA 2RGBA 4LX0A 1QG2A 2H18A 2EWWA 2P6UA 4PSKA 3MG9A 2NIPA 1KSGA 2FN4A 4BFYA 2QGZA 2V3CC 3X1DA 1KI4A 2O8EA 1NL3A 4BQSA 3CBQA 3RRMA 3J81k 5CB8A 3K0AB 1W36B 1E9DA 4W7SA 4L4UA 4AKGA 1NMXA 1NY6A 2CHVA 1E1QA 4MRSA 4B76A 1AS0A 5JBQA 2GILA 1KO8A 4PHGA 4Q18A 1NN0A 2EFCB 2A7QA 4CEJA 4QC2A 3SHFA 3MSXA 1NRJB 1NG1A 4HAYA 2GWHA 1S1CA 2G1JA 4IDHA 4OK3A 4S35A 4GOXA 2E87A 4BWYA 1DPFA 4D82A 1U94A 2ATXA 1DVRA 4Z51A 4EAQA 2ZVPX 2VHQA 1ZM9A 3QY0A 3VR1A 2WICA 1TAGA 1KOFA 2DFKB 1OIXA 4KFRA 3KKPA 2I4IA 2OXCA 3IBGA 3DOEA 3GMTA 1MO3A 5JI2E 1KO4A 3KDSE 4QBGB 3ZJYA 2RGGA 4DIEA 4O2LA 3TIFA 3LA6A 1Q21A 1G3UA 4E5UA 1VMAA 1AS3A 2XSZA 4ZKEA 2ZEJA 1SXJB 1OFUX 5J4VA 2VP2A 1YQTA 2GESA 1A82A 4MUBA 4M9ZA 4F92B 2OG2A 2IHBA 4TQAA 3TR0A 4FIDA 4FCVA 1NN5A 2O8CB 4DT1A 3RRYA 3FKSA 3BGWA 4D0GA 5HKKA 2H1LA 2ZRHA 2V4ZA 2EYUA 4A4DA 3QNUA 1UKZA 2BMEA 2ZAMA 3G5UA 2FSFA 2VIIA 4ZIRA 2QMEA 4LYJA 1R2QA 2ZTSA 4N0DA 4FWIB 5FL7D 4BECA 4CEHB 3TBKA 1Z6XA 2F1RA 2OCAA 1ZMXA 3KTAB 3IIKA 3MGCA 1RRCA 1KSHA 1XD8A 2FNAA 4ZI3A 2QMUA 5KDOA 2J7KA 2JLSA 4TL7A 4RSGA 1VHTA 4UJ3A 3AF1A 3TGPA 1YRBA 4B3GA 5CIQA 4WXRA 2JLWA 2WMOB 521PA 1W4AA 3THWA 2IBMA 4DVGA 3CZPA 4BFSA 1YZNA 2DYKA 4DT1B 1EXMA 1GRNA 2YWFA 1YHNA 4RY2A 2YWEA 4HZIA 2BJWA 1XB2A 3FFBA 3MWLA 4YLGA 2DWPA 4BFVA 1VCNA 1MR3F 1CF4A 1CEEA 3THYB 2F43B 4A2QA 5CJPA 2H5EA 4V0ME 1UEJA 2CLDX 3K53A 2ZRDA 5EZ6B 4X8OA 4HZUA 5FOXA 4BGDA 3OIWA 2QORA 4PPFA 2AFIE 2BKEA 3GJ3A 4CEIA 3AF3A 2VQSA 1VIYA 3PUWA 1N5LA 4OQXA 1P9WA 3CWQA 3GEIA 3V4FA 3WYGA 2RAPA 4MKIA 2ZU6A 1PUIA 1TQ2A 2FJUA 3PUXA 3SEAA 1RRFA 3GJXC 2QTVB 3NTUA 3QF4B 3V00A 3WYFA 5AJXA 5FTMA 1MABA 1TMKA 1G8YA 4DSUA 1AQYA 4DEXA 1FUKA 1IBRA 1U0JA 2IW3A 4ILEA 4ERNA 1KZGB 2WIAA 2VHUA 3PEUA 3Q3JB 5TMPA 1XMIA 2Q3FA 3ADBA 1I4LD 1SVIA 1Z6TA 3KQKA 1KGDA 1TF7A 2OESA 3AUYA 3GEEA 2O8CA 1E2LA 1FOEB 2OAQ1 2Y8EA 3CRQA 2G88A 1II9A 1KI1A 2QAGA 4XTRA 1SVSA 1Z0IA 4KV9A 4IFEA 3C16C 4V0OA 3O8RA 2OV2A 4LJ9A 4TZ0A 3ZZ0A 1CJMA 1IAQA 2QROA 3ND8A 4R9UC 4XOIA 3DMDA 4JLMA 1DO0A 4D4JA 5JRZA 3ZVLA 3OF5A 4B3DA 1RC8A 5DH9A 2QBYA 3U3MA 3VR4A 1KHTA 3PVSA 2CK3D 2P5TB 2ZPTX 4RFSA 1JQLB 1II0A 3LLUA 3JVUA 1IHUA 2GNOA 4KSBA 3U5ZB 5C2JB 5DIFA 5H1YA 1Q1EA 4W5JA 3BS4A 3AP3A 1G7RA 3RC3A 4RD2A 4ZDKA 3ZVMA 4NCHA 2OE2A 4PTLA 4Q4AA 3ZZTA 1HURA 4NHOA 4NL4H 1KJZA 4MYUA 2D3WA 4TMXA 4M1WA 4JYBA 1QRAA 1JR6A 4RFVA 4LBVA 2Q3MA 2GJKA 4DLRA 3AVTA 1XEWY 4AC9A 1SXJC 5IHPA 1XWIA 4IVPA 2ODBA 4B3CA 4PHFA 1ZM3A 4OK5A 2GRJA 3VMFA 1EWQA 4ESHA 5FPKA 3MWJA 5CJ2A 1GNRA 2ZYTX 5AWFC 1XP8A 1E2HA 2D7CA 2RGNA 4FMBB 3R7WB 1DE0A 3OIUA 2FEMA 3I4LA 1QHHB 3Q7QA 1F3OA 4TLCA 1XMJA 4YONB 4U02A 1OYWA 4L15A 4TYPA 2C5LA 3GLIE 3DZ8A 1B0UA 2ANBA 3QXSA 3ZD7A 4P4SA 2CNWA 1R4AA 3KQHA 3R9XA 2Z4RA 1GITA 4YXWA 4MDEA 3AB3A 2GKSA 1SKQA 3KJIA 3I5XA 3C5HA 1Z07A 3PEWA 4B48A 1BYUA 3B9PA 1NN3A 2QTHA 2YYZA 3IHLA 1W4BA 5BN4A 4JLJA 1W2GA 4ZI2A 1MH1A 3Q7PA 4XD7D 2XNDD 4IJMA 3HPQA 2KBFA 2PBRA 2FFQA 4LJAA 4DLYA 1T91A 3FHOA 3EASA 1OFTA 4A1FA 4DDVA 5BYKA 4NP6A 1OT3A 1XF9A 2XB4A 5CIWA 2V1XA 4BRWA 1DAKA 2HT1A 3T1QA 3VR3A 1GL7A 4HLUC 3EIHA 4QRHA 2V1UA 4PZLA 3TQFA 4GP7A 1IY2A 5G41A 2WWGA 5SZHB 2G6BA 1U0HC 1ZD8A 5L3QA 2HJVA 2R62A 3OESA 1T3LA 1M34E 2GEVA 4NYJR 1P7CA 4B71A 2WVJA 1EFHA 4HB0A 4LJ7A 2DR3A 3BORA 4YDSA 1OH8A 4FW9A 4PO8A 2DCUA 2I1VB 5G40A 5F9FA 2Z83A 2XOKA 1P6XA 5HE8A 2ZANA 3AM1A 1XCMA 4FMCF 3QBTA 4TTQA 5JJIA 4IDNA 4UXJA 1TL7C 1W46A 1E9SA 3AVXA 5IT5A 1UBGA 2FSIA 4OBEA 1E3MA 2H16A 1T4GA 2ZJBA 1IN4A 4UQOA 4JLPA 3EAQA 2VTKA 4DLUA 5E3HA 4QFMA 2JCSA 2NGRA 1CULC 1E96A 1Q1QA 3IHWA 1N6RA 1S9DA 4Z1MD 1P9NA 1W47A 2O0KA 3SJCA 4IEIA 1M7GA 1FX0A 2VBCA 1XZPA 1IXZA 4MYTA 4C30A 3FHTA 1XPUA 2WTUA 4C7OB 1X8LA 3QXCA 4K81B 4II7A 5FPHA 4M1YA 2QGNA 5SZIA 1XMSA 1ZM7A 2KI5A 721PA 2REBA 4JLDA 4LPSA 1AJEA 1UADA 1E98A 4A0GA 1XU4A 2QM8A 1IXSB 2A5DA 1RJ9B 2ZJOA 3WBJA 4PSAA 3NHAA 4N1AA 3EG5A 4BFWA 1E4VA 5FBVB 3QI2A 4B44A 3MMPA 1NMYA 5JCZA 1HEIA 4PSVA 4HLQB 4M1KA 1KNXA 1ZW6A 1SHKA 2WWFA 2C9OA 2HF9A 3EZFA 4JKIA 1NJFA 2WSSD 2OSBA 3CX6A 4HB3A 2HLDA 3RS2A 4NYIR 4CZ2A 2YC4C 1VCOA 3WNBA 3RS3A 4US2R 4TYNA 1NBME 3GLHA 4OKSA 2QA5A 4A6XA 4QXAA 2WWIA 1E1RA 4TMWA 2O0HA 3THWB 1XDBA 2YWHA 1A1VA 3CONA 4DXAA 3NEJA 3DM5A 1ZAKA 5B64A 1EFTA 1G41A 1T5IA 4Q21A 4Q00A 3F3YA 4EQ6B 5A4JA 1XD2B 2G0NA 3LD9A 4M2LA 2GDJA 4MITA 3EW9A 4M8NE 5AJWA 1ZM2A 1NLYA 2J7PD 1JECA 2ZR7A 4GBMA 1XPOA 4YDHB 1G8FA 4ZCLA 1OFIA 4AKHA 2H7VA 3OEHD 5DISB 1ZD9A 5A5GA 4EIWA 2Q21A 3GCGA 1WE2A 2ZUBA 4A6PA 4TL8A 1OF1A 1QHSA 2CDNA 4JT4A 5DNYB 4B47A 5SZKB 1ZINA 5CK4A 1WXQA 2GZAA 2QMHA 4BLRA 1Z22A 2JLQA 4TL9A 5LB2A 5K8LA 3P26A 2JIZA 2WIBA 3RDPA 3SJBA 621PA 3VNVA 3CPEA 3KX2A 4LZZA 2SHKA 1JR3E 3FMIA 2V9PA 2NMVA 2AXPA 1FUUA 3VR2A 4HB4A 1XD2A 1P61B 3K9NA 4LHWA 4FMCB 1E9EA 2IA5A 2NZ8A 2XITA 1KO5A 1X3SA 4Q4HA 1U98A 3LO5A 3M1IA 5G53C 3FHCB 1G3QA 3AEZA 4FCTA 1NBMA 1OLOA 1K5DA 3AVQA 3GLHE 3R8FA 4RD4A 4Z1MA 1IN6A 5FBQB 1KJYA 2QEQA 2F6RA 2GXSA 4G5SA 3ZGXA 3ZYCA 1AQUA 4L8GA 2EW1A 1JI0A 2JLXA 1KNQA 2W0SA 2BMDA 3N5CA 4Q4HB 4JJZA 2WHXA 3CNNA 2BEKA 5JSZA 2A9KA 2ZRNA 3IBYA 3WMEA 5B58C 1CP2A 1JAHA 2J0UA 4DCNA 1G18A 2A3RA 1PUJA 2J3EA 2VHCA 3S1AB 4JLNA 3PG5A 4Q4JB 1Z63A 1U81A 4BPBA 4WZ6A 1W36D 1E9AA 4PPGA 3ZVRA 5BW8A 1IN5A 4DDWA 3QPVA 1D9XA 1Z6GA 3P20A 1OV4A 3ZS9A 4ZIRB 3CPJB 2J1LA 4V0KA 2OM2A 2ODNA 1SVKA 3T15A 1D6JA 3B1YA 2YOGA 5CITA 2C98A 4EFMA 4EQ6A 4CVNA 1NVUQ 1BYIA 1EG7A 3AKDA 1N6KA 3TW4A 1LF5A 1VYUA 1EX6A 2AFHE 2OILA 4Q1DA 2YC2C 3NH9A 4BEJA 1KI6A 1Z3IX 4DJTA 1IM2A 4M22A 5CLLA 3GLGA 1NJGA 4A9AA 3IIMA 3KJGA 1Q1BA 4ITRC 4TMKA 5C4MA 4G1UC 3GLGE 4R2HA 1P62B 2W00A 3I8SA 1R10A 1T5LA 3B6EA 4KLZA 4O25A 3B82A 3TH5A 4EPXA 3B85A 1YU9A 2B92A 3U7FB 1YR7A 3VX3A 2XX3A 4FI3C 4NMMA 1NG9A 2W6ID 4PO1A 5EQTA 3RWOA 1YR9A 4URXR 2ZJ8A 2J45A 2FU5C 4PC3A 1H8HA 1SXJD 2X2EA 1IN7A 4QBIA 4AYWA 3E5HA 4Q1BA 1Z0AA 4PC2A 1UAAA 3ETLA 4AI6A 2QT0A 3KZ1E 2J7PA 3U60B 2JATA 3E2IA 4OI0A 4C0KA 3NH6A 2AX4A 2PX3A 1DOAA 1II8A 3TJZA 2P6RA 3ND9A 5KU1A 1S2MA 4GZMA 3DL0A 5EZ5A 1N6IA 1XXHA 1E79D 1NI3A 1QBKC 5EXSA 4C4PA 2ZRBA 4KITB 4GMDA 1W36C 1DAGA 2BBTA 3TMKA 2W2TA 3SU8A 4B6FA 2IXEA 3LAWA 1JEEA 3HWSA 3IPYA 1IXRC 4TL6A 4JT2A 1Z83A 5L3SB 221PA 2AHOA 5HPYB 1E2GA 1N0WA 1ZUHA 1Z0KA 4AYTA 4EJSB 4S2EA 3LBHA 1NF3A 1BMFA 1OIVA 4AK9A 3CB4A 1R5OA 3QXHA 1M8PA 1MRNA 1H65A 4HLUA 5J5CA 3TR5A 1E2MA 1AGPA 2BCJQ 2F9MA 5DHFA 4LBWA 5C1BA 2MMGA 3EZ9A 5HE9A 4LHZA 4PPNA 1VYTA 2ZJZA 3KUDA 2ZSBA 3SQWA 2BHRA 4HATA 1G7TA 5DYIA 4I1VA 4LCBA 5TVKA 4CGZA 3CRRA 2R65A 3PENA 4JLOA 3QIAA 4IOKA 1QDEA 2ZRLA 2TMKA 1OPXA 1RPZA 2DY1A 3R7WA 1G20E 2ZUDA 2PCLA 4DB4A 1EX7A 3RVBA 3EIEA 5FH9A 2XJ9A 1VTKA 4I1SA 5DYGA 2HV8A 5UKDA 4X8LA 1QVAA 2GAAA 5TY0A 2V6IA 1XCGB 4QJ4A 3ONWA 5JEEA 4EJSC 4MYHA 5EUQB 4G01B 3GLFB 1XJQA 1ZD1A 4US0R 2IXFA 2Z6VA 5LD2C 1ZM4A 2QRNA 4Q4AB 1TX4B 4KO8A 1U8AA 2F3RA 2J0UB 4AIIA 2QN6A 1Q1ZA 2LKDA 2IF0A 3K70C 3PIRA 5JSZB 4C0AC 2QE7A 2MSDB 5FBLB 5G3ZA 2IS1A 3KKNA 1UDXA 5FR1A 3TQCA 3DPUA 3SI7A 2F1HA 8OHMA 1E94E 4LI0A 2KJQA 4PFSA 1KO7A 3THOA 1AKYA 1LV7A 1ZIOA 4D25A 2CCGA 2O52A 5FFMA 3BJIC 4DCTA 4UNRA 2AK3A 1LB1B 3P27A 4GT1A 4NCKA 4MH0R 2F43A 2IYVA 2BMFA 4E07A 2ZE7A 2QPOA 4PO9A 2ZRPA 1X86B 2GVZC 4RKEA 2PLFA 1HE1C 1MRSA 4LRWA 3CWZA 5L3QB 4Q03A 4LYAA 4PZZA 3EXAA 1GKIA 3B5JA 3HPRA 1IONA 3VX4A 3UATA 3TSWA 2QPAA 4KI0A 4OK6A 5CYOA 1W0KA 2FE4A 2GCOB 5EP1A 1VPLA 3BB4A 3QPWA 4TQ9A 3ADDA 3WRXC 1Q20A 4KAXA 3H2YA 4IXMA 3NWJA 4XH9B 3H1TA 1FP6A 3RS4A 2WPDD 4TYWA 2QM7A 2QG6A 3EC2A 3I1FA 4P4TA 4B32A 3CX7A 3EPHA 4BFUA 3L0IB 5DI3A 3EIQA 3PV0A 2QZ4A 3I32A 4MRPA 3LVRE 5J4YA 1XTSA 2ZI4A 1Z2CA 3X1ZA 5FL7A 3ADCA 4BE7B 4H1UA 3IDQA 3WMGA 2JDIA 4H9GA 1G8GA 2Q3HA 2DWOA 4J0QA 4OYHA 2RMKA 3U4QA 3U6KA 1W4RA 1NMZA 4BLPA 4QBHA 1ZBDA 3U61B 4N3NA 3SBDA 2ZE5A 3BH0A 4PC1A 3TSOA 4POAA 4QM6A 2NO0A 1FNNA 2ATVA 1P73A 3U7HB 3LNCA 3QUSA 1PZNA 4V0NA 4WBSA 3QJYA 3IEUA 1MT0A 2GZHA 2FSHA 3WP0A 1DBSA 1E2FA 4RZ2A 4G5OA 3T12A 4LC1A 4LGMA 3T35A 1K8RA 3GFTA 2W83A 3NEYA 2GJSA 4C0SA 5KSPA 1Q12A 3KKQA 1W4CA 3LBNA 2AXNA 1G5RA 1YJ5A 5CM9C 4UNQA 1E4YA 3FYHA 5JMTA 4QKQA 1GKUB 1AS2A 2ZYVX 1O3YA 1VYVA 2AL7A 4CEJB 4M9QA 2C2HA 4C7OA 4DCSA 3ZD6A 5DO9A 1IY0A 4DLTA 4A0FA 3A36A 1C4OA 3MWKA 2EQBA 5KNDA 1YZGA 4DDTA 1TEXA 2MSEB 1ZNZA 1NKSA 2GZDA 3SOPA 3SR0A 5E95A 4TLDA 4WXPA 1X1RA 4UXHA 2C9CA 3VAAA 2VSFA 2R2AA 2ORWA 2ZI5A 3NIBA 4G5GA 5KPDA 4K46A 3UG7A 1VIAA 2OFOA 2RGXA 4U00A 1NLFA 3G0HA 3AKCA 3FB4A 4ARZA 4EFLA 2H8KA 3I72A 1E1QD 1LY1A 3OHMA 1ZRHA 4FN5A 3Q72A 1DAMA 3QKTA 3K0FA 5KSOA 1E2DA 3AVWA 3A4LA 4KYUA 5JECA 1E1RD 3QKUA 2XNSA 2ZSAA 1OXXK 4BRUA 1DARA 1R5BA 4K8OA 3K9HA 2X2FA 3CX8A 4HAUA 5GADl 3B78A 5AUNB 1AN0A 1W5SA 1UF9A 3FGNA 4P3YA 4PX9A 5EP4A 5K8IA 1EWRA 3IUYA 2ZI9A 4HEJA 2XTZA 3SS8A 2IYYA 4XD7A 2FFHA 3DMNA 3SC3A 4PR0A 1ZU5A 1OKKD 1JR3D 1RFLA 1N6PA 2GVDC 4F93B 3MCAA 4GI7A 2VHJA 4Q9IA 2CCJA 1WA5A 1CR0A 2FG5A 4XWKA 5K8UA 2KWIA 2NTYC 3B2EA 5FPYA 4MRRA 4FXPA 5HZHA 4Z54A 1GNQA 4QBFA 4RZUA 2BM1A 1GP2A 4Q9HA 1G3MA 3ZLJA 2CXXA 1J7KA 3TAUA 1Q57A 2P67A 3KTAA 1SVMA 4KXFB 2EWVA 4BFTA 2QY9A 2F1JA 3TSZA 3GFPA 1NNEA 2J46A 2IK8A 4JVLA 4TT3A 5EJEA 2W2XA 3RNLA 2OAP1 2KSQA 3NXSA 1SKYB 5JS7A 3EWAA 5JEDA 2P0EA 2B8TA 2XB2A 1E2EA 2WOOA 1F6BA 3EPKA 3L0PA 1J99A 1OB5A 3VU9A 5HR5A 2VEDA 2AWNA 3BK7A 4TN1A 1TQ6A 1TPZA 1S1MA 3SQXA 3QXJA 2FV8A 2GBLA 3CNOA 2WJYA 3LW8A 2IEYA 4XSHA 4KCGA 2BBWA 4OQMA 4TTRA 5FTJA 2F55A 5FUVA 4HAXA 2E1RA 2R6DA 1Z2AA 1XJ0A 1M1YE 4A0RA 2GXUA 3T61A 2XSZD 4XTCS 5KSZA 2NO7A 4DSTA 3QSYA 5B2ZA 3ZZUA 1W1WA 5AJVB 2KB0A 3AV0B 3IQXA 3AVOA 3K9GA 4NYMQ 1AGRA 4C0JA 4QJ5A 2GK7A 3QF4A 4PXAA 1XXHE 1GRRA 4Q4JA 4TYYA 4DCUA 1J2JA 4CEHA 1CRPA 1HT1E 2DHRA 3LLMA 3LW7A 2HJGA 4P0TA 3VNUA 4IOMA 3ZVNA 5L3VA 3EPLA 2MSCB 1G17A 2CVHA 3FKQA 5IDVA 2VPPA 1TUIA 3LDAA 3TVDA 4MGYR 3ICQB 3SYNA 3AVYA 1N6NA 3BH6A 3BWDD 3LY5A 2PZGA 3P32A 2LCFA 1LS1A 3JZMA 1JBKA 2GTPA 4PC6A 5DSZA 2VO1A 2C99A 4E03A 1R8SA 1G7SA 1KMHA 2JASA 4M1SA 2RKOA 1XTQA 2JEOA 2A5GA 3VKGA 1E0SA 4LYHA 4PAQA 3GJ4A 2FFAA 3UMRA 5E7MA 1YR8A 4MRVA 3NDBB 2H57A 5FOWA 1G6HA 2G3YA 4ZKDA 4MKHA 2OCBA 2ZE8A 1XD9A 4Q1EA 3K0CC 2ZREA 4Q9JA 2VSOA 5H68A 2DFNA 2ZRMA 4JBXA 1G8HA 1CBUA 1T0HB 4XVQA 1YZKA 1WMSA 2AD5A 3HU2A 2GBLC 2CL6X 3U3RA 3U6BA 5F98A 3I92A 3DEFA 4LJ4A 4DB2A 4HAWA 4JKYA 3I62A 3WHKA 1DG1G 2CHQA 2WAXA 3DVLA 1G64A 3L0OA 4JL8A 1P5ZB 4JLBA 4D4MA 4B3FX 3FMPB 2ORVA 1CIPA 2VRWA 3CRW1 1G8PA 4B2PA 1DELA 1HQCA 3SZRA 2VP6A 4TMVA 2A30A 3GLIA 2QRZA 2DFLA 3FFAA 3PXGA 3CF2A 1E0JA 4LHVA 4D4LA 3HR8A 5C46F 3GD7A 2PJZA 3AKEA 4D80A 4OHWA 3SYLA 3W6PA 5J40A 1QHNA 2QL6A 3NBYC 4YMUA 2VLIA 1AA9A 5EP2A 3GEHA 1CS4C 1GIAA 3CO5A 2XZLA 2OEPA 3GLIB 1FTNA 5F3WB 4ZDWA 2VF8A 1QHHA 2CE2X 5DI3B 1N6OA 1A4RA 3CPHA 1UM8A 5FUXA 3AP2A 3PCRB 4QHSA 2Q9AA 4C0HA 2YNMA 1YZUA 1HT2E 2ZYUX 4C2UA 1TTTA 3C41J 4A8JB 6Q21A 1HUQA 5J4KA 2VP9A 4WOPA 1KI8A 2A78A 1JR3A 1OKKA 2GEDA 2KBEA 4C0QC 4D6PA 4KYIB 4Q9KA 5FOUA 2WJGA 3OZXA 4OHXA 1N5JA 2GCPA 4F4CA 3AQ4A 4LUCA 2N42A 1QZXA 3C4JA 2JLUA 2PMDA 1G5TA 3KXLA 5DGXA 4XVUA 5FUWA 2O0JA 3SJAA 3L8YA 4PQFA 4JL6A 1OE0A 2JLZA 4B6EA 1LNZA 4L9WA 4NPHA 5EE0A 4EDHA 3I61A 2PZEA 1ZIPA 2QUZA 2GXAA 3QQ5A 3CH5A 1XFAA 1LVGA 3ICEA 2C8VA 4ASUD 4EPVA 1PVOA 1GDDA 3NBZC 2IUSA 1JNYA 3F8TA 1AZTA 3PUZA 4DZZA 1HQYE 3BAFA 3KB2A 5K8TA 4A36A 4LV8B 3SDZA 1E9FA 5CK5A 1F48A 4Q47A 3THXB 2V55B 2EFGA 3RABA 1MV5A 1NVXQ 3GJ6A 2REOA 2IWHA 3K8YA 3KQNA 2Q9BA 2C78A 3Q85A 3KXKA 5L3SA 3MJHA 3T1VA 2IYWA 2J5XA 1GKYA 1ESNA 2BV3A 2WSMA 1KSJA 1Z5ZA 3HJNA 5EE3A 1OHHD 1AM4D 3LV8A 5FL3A 1J70A 1US8A 1KK3A 2RH5A 1FPMA 1W48A 4GSYA 2V7QA 3RS0A 4URUR 2A5FA 2VP5A 3CR7A 1JJ7A 4PAMA 2V54A 5KTYA 1NP6A 1NVVR 2PEYA 5EXTA 3A1SA 1Q0UA 1E9RA 1FX0B 5LBIA 2HEIA 4WW0A 4RD0A 2VH5R 3BB3A 1WCV1 2O5VA 4LV6A 2BDTA 2ZVQX 4C3ZA 3BD9A 1A2KC 4UJ5A 2ODWA 1OH7A 4EUNA 3B9QA 5BWMA 1YZQA 2JGNA 3KKMA 1UKYA 1DTSA 2OUKA 4X8MA 2PT7A 2J59A 4QM7A 1S0UA 5HKKD 1RYFA 2WKRA 2PT5A 1EGAA 3OFNA 4BFZA 2WWYA 1FMLA 3CZQA 2XTNA 2Q0HA 2RGAA 4XSGA 4B74A 1G6OA 1XEXB 2XEXA 4KBGA 1MO4A 3LQQA 2JJ2A 2ZAOA 5KOYA 3ECCA 4EJSA 4ZV4A 2FWRA 1TU4A 3U44B 1NVVQ 4DCVA 4RD1A 3A1WA 4BZXA 1L4UA 4GOKA 3ZDQA 1N5IA 2IX3A 3GFOA 3NC1C 4I1OA 1HE8B 1LTQA 5EE5B 4DLXA 3HP1A 2DFTA 2FZ4A 1P4SA 2DBYA 2NG1A 2OZEA 1V5WA 3L43A 3P4XA 3EZ7A 1A7JA 5EXXA 4L5BA 1WRBA 4LJ8A 4BEBA 1XPRA 3RS5A 2AD1A 4G5RA 2IF2A 1KK2A 1KI9A 2Z43A 2B6HA 2L0XA 1X6VA 1D2EA 1AKEA 3NVAA 4NYMR 3S1AA 4F38A 2JA1A 5JS8A 1PLJA 2P2LA 1XBTA 2FEOA 3MD0A 2RHMA 4TMTA 2UZ3A 3U44A 3TVTA 4OI4A 1ZUIA 1JXOA 2FX3A 4HUTA 4PQRA 4AURA 2LKCA 2IXGA 4DWJA 1O87A 2V6JA 2JDID 3FWYA 1Y3AA 3QVUA 2IS2A 4MYCA 3N2EA 1RVDA 5EUMA 1ZNWA 4F4IA 5CB6A 1R8QA 4A8JC 2EFEB 4NTZA 1P9RA 1PJRA 4JVNA 2PEZA 4FD2A 3QXXA 1CRQA 3EZ2A 4QGAA 2GCNA 5AUOB 2W2VA 4TLBA 1XTJA 1HH4A 1GTVA 1GOTA 1E2NA 1U0LA 2BMJA 3HYTA 2RHDA 3QE0A 1VCIA 2FGJA 3NBFA 2IHYA 4AWXA 4G0NA 3LRPA 2V8OA 5FTNA 2IYTA 2W6IA 3O8CA 5TXGA 1U8ZA 4BLOA 4RD3A 1M7BA 1GVNB 3I8XA 2WV9A 3LVQE 2CJWB 1X1SA 2WJIA 3OEEA 2J0VA 2J9RA 4M0LA 4ON9A 3TRFA 3EWSA 2A5JA 3BERA 4PPQA 1RKBA 2AWOA 1JXMA 2QP3A 5IK2A 4O3MA 5HTKA 1PV4A 3RRNA 2JLVA 1N2CE 1Q22A 2RGEA 3HU1A 5FOSA 4WIAA 1OSNA 2ZSDA 2VYFA 2ZRGA 4V03A 4P31A 4Q1FA 4CYMA 1G5PA 1XX6A 2QENA 2QT1A 2OCYC 4B35A 5DN6D 4QGGA 1H8EA 2G1KA 1NY5A 3A8TA 3GJ5A 4B73A 4AG6A 1KAGA 1OYYA 4HUQA 1EESA 3QKRB 3VKHA 2GF0A 3A58B 1JAIA 1A2BA 1UJ2A 4EFNA 1XTIA 4HDQB 4JMPA 1GNPA 2QBYB 2CL7X 1EFUA 3TK1A 2JAQA 2QSZA 5LD2B 2FFBA 3BH7A 3CLVA 3W3AA 5IRCD 2J41A 4MGIR 1G16A 2OLKA 4I81A 1T3HA 4OQLA 3K09C 5FI1B 3PJRA 4P4UA 4KU4A 3GLGB 1RW4A 4URVR 4C0BA 4M1MA 3CUEF 4HAZA 3P4YA 4JVMA 2ONJA 421PA 2HDNB 2G77B 2ZSFA 5JFGA 4YMTA 2PCJA 4URWR 3KJHA 2X8AA 1VKJA 5FUYA 3DO6A 5L3RA 3ZQ6A 2XTMA 4IOJA 5D3QA 2FPKA 3UMFA 3UG6A 4EPTA 1EK0A 4CRWB 1E6CA 1KYIA 5DHAA 5B30A 2HF8A 2BBOA 2ZU0C 2WJVA 1CKEA 1KY3A 2YOHA 4QNRA 1W7AA 5TB5A 4C2TA 1CXZA 4TT3D 1XTRA 1UFQA 2B7BA 2WZQA 1F2UA 2HT6A 4Q01A 4Y0AA 2CMKA 4A92A 4U7DA 3D7MA 1MABB 4IFBA 3Q8XB 4BZPA 4GDFA 3ASYA 1VG0B 4FMDB 3L0SA 4O0MA 3H86A 4WZAE 1N6LA 2RGDA 4HSEA 1AZSC 4B2IA 3Q9LA 5JJLA 3FE2A 3QOFA 5ANRB 4WA7A 1II8B 3FMFA 5FTLA 4R98A 1C9KA 4YMVA 1Z08A 3SE0A 4A0HA 4DKXA 4KJZA 2NPIA 2O8BB 4Q7JB 1IY1A 1K6MA 3B7GA 1KY2A 4Q48A 5JI3E 4RZ3A 1P2TA 2X19A 3UKDA 4PHTA 4B3XA 2O8FA 1YZLA 1YKSA 2NOAA 3X1YA 4D4KA 3CNLA 3REFA 4HZUB 2OT3B 3WHLA 2WJHA 4ARZB 5HCNA 3VFDA 1N6HA 2R6GA 2WKPA 3CW2A 3B1ZA 1KAOA 4WVFA 1Z47A 2IEZA 1KDOA 3GQBA 2AKYA 1QVRA 2VSXA 4B34A 4Q9LA 1COWA 3A4MA 2HCJB 4RZXA 4FINA 5KPJA 2WMNB 2QNRA 2NZJA 5ELXA 3ZQJA 1ZYUA 3LX5A 3NG1A 4OJQA 4JL5A 1AK2A 4JLAA 2ZS7A 5FTKA 4XWAA 4IXNA 1FL9A 2R6CA 4RJLA 3H0KA 1M7HA 4N0EA 1Q3TA 4YQFA 2ZJAA 1ODFA 1KTVA 3DZDA 4AG5A 3EA5A 2WSSA 3BFXA 3IKJA 3N70A 3W90A 4Q7KA 3AVVA 3GLFE 4AYXA 1LF0A 4MKGA 1DS6A 2ZRKA 4JBYA 3UMSA 1TEVA 1RZ3A 4DLVA 1E2PA 1WBBA 2WPDA 4LHYA 4HB2A 4A2PA 2WKQA 1I2MA 2Q6TA 3TKLA 2FF7A 4QGHA 4QHYA 2UVQA 4YMWA 1GWNA 2QTFA 4GL2A 1D2NA 1NVWQ 2IYSA 3QBVA 3QEJA 4UNPA 1W0JD 2ZRCA 1G4AE 5LB4A 3AH8A 2PJRA 1W0JA 4Q02A 1HA3A 4EPYA 3W6NA 2VP0A 3THYA 4HI0E 2HYIC 4YMSA 1U2RA 2GJ8A 1SXJE 1QHGA 3EZ6A 4Z8XA 3W6OA 4KVGA 2R8RA 3VHLB 3UXMA 2BCGY 4GZLA 1YE8A 2XJ4A 4CF7A 1KO1A 1XRJA 1TQ4A 4NBSA 4URYR 1NN1A 4ABYA 2D62A 5H70A 4DEYA 2CVFA 3U3OA 1FNMA 1VHLA 1X8JA 2JLYA 1CJUC 1E79A 2Z4SA 3AVPA 2W6JA 3KQUA 1KDPA 1WDTA 3DHWC 3PUYA 2BJVA 3OE7D 2FPLA 1LFDB 2X77A 3B1XA 3OIVA 4NCJA 5FPTA 5JLJA 4QOSA 3LXRA 1RJ9A 1G3RA 3CKLA 3B13B 4HDOB 1OIWA 2Z5FA 3WNCA 3I5YA 2YHSA 1FQJA 2W0MA 3O8BA 4LWZA 3MFYA 3KQLA 2UZIR 1KMQA 1ZJ6A 1HTWA 2JLRA 4NCIA 5F9HA 3LWNA 1XNJA 4M1OA 4TMZA 2WWHA 1U9IA 4NCNA 1UBCA 1F5NA 2ERXA 1XMVA 4NU0A 3R8CA 2WBLC 3OAAA 2ZS9A 1W2HA 3EX7C 2O8EB 1F2TB 2BVNA 3JZAA 2WM9B 2QPTA 1T9HA 2ZRJA 1H8HD 1UKVY 3RWMB 4A2WA 3ZIAA 4B75A 3FTQA 3T1OA 4KFTA 2G0TA 2W6JD 4U5XA 1CTQA 1KI6B 5JJKA 2ZYWX 1KMHB 1D5CA 3NBXX 1EFRA 1E0KA 2FZLA 5FOTA 3PEYA 5KNCA 1XZQA 2RGCA 4EPRA 2X1VA 1OFHA 1OXTA 2YV5A 1EFRD 5FBWB 2CNWD 1QHYA 4KFUA 4G5QA 4W5WA 1ELOA 3AF2A 2C77A 1KI3A 2GAOA 2FSGA 2PLRA 3HYRA 4CW7A 3CF6R 5AUQA 2ZITA 2OFWA 2C03A 4D0LB 1IN8A 2ANCA 1R0YA 1I4DD 4LK2A 1BMFD 5FPSA 2XGJA 2FDCA 4ZCMA 3QEOA 1Z8FA 3PR1A 1SVLA 3KXIA 2D7DA 3QG1A 2BBSA 1JEDA 3Q5EA 1Z0FA 2GCOA 2N46A 1M6NA 2R6FA 4LY6A 4YC7A 3SFVA 1CU1A 1JB1A 4JIMA 4JLVA 5AUPB 1RRGA 3WYAA 1E9CA 4OJKA 3WNDA 3PQCA 1GSIA 2ASEA 1G4UR 3BB1A 2R9VA 3QF7A 2OHFA 4PC7A 1VCMA 2QP4A 3LH5A 3LX8A 3QKSB 4DLSA 1PLLA 3SNHA 1UBEA 2IYRA 4R2IA 2RGNC 5J4LA 5D3MB 5F2EA 3G82C 2YVUA 4JJKA 4ESVA 1LS6A 4GMXA 1N5KA 1C1YA 3GJ8A 3WP1B 2YZ2A 1SULA 3U4QB 2F3TA 2IUUA 4LSGA 2J0QA 1DEKA 1I2DA 4I99A 4IEEA 4JSTA 1E32A 3QKSA 2YJTD 4TLAA 4M9SA 4JSYA 4LV5B 3RHFA 3FPAA 2WWXA 2K5UA 3W9YA 4XJXA 4IW3B 1DG3A 2UKDA 2XZOA 2OBNA 2ZI6A 1W0KD 4TSFA 5KDLA 1NSTA 3AGPA 3CR8A 4L16A 2EFHB 1GZSA 3RRZA 4C0LA 4NZYA 2A2ZA 3DM9B 2ONKA 1VDZA 2FMXA 2GETA 4PQYA 1KDRA 5KDDA 3TW8B 3HU3A 4PZYA 3D8BA 3K1JA 5P21A 4RKFA 1SGWA 3VHXA 1G9XA 2F1IA 5CDFE 5E7IA 4HLDA 821PA 5EXPA 1MO6A 2ECKA 1ETUA 4E22A 1G3IA 3GJ7A 4Q7MB 4OQNA 4DDUA 1D9ZA 3RAPR 5J47A 5BQ5A 3OEHA 3U3JA 3AUXA 4W5HA 1XEWX 4JLKA 3GPLA 5CYPA 4CT4B 1M74A 3A37A 5DI9A 1BOFA 4MDFA 2NPFA 1SKYE 3A1TA 3UIEA 1CR4A 1P2UA 3CF0A 3TAHA 2QE7D 1SXJA 1YR6A 1COWD 1G1MA 1BH2A 2F7SA 3KB1A 4DLWA 2ZS8A 4M21A 1CJTC 5KNBA 3IEVA 5BXQC 5BYJA 3U3KA 1IJFA 2DWQA 2A5YB 3C8UA 2O8FB 4NYJQ 2ZR9A 2AN9A 4RD6A 1HYQA 1FZQA 1OXSC 1J8YF 2VA8A 2ORIA 5KSYA 4HUQB 1Y63A 5JRJA 1NBMD 1A5TA 5FR2A 2C04A 3B60A 5GJBA 1DAIA 4XVRA 2D74A 5E7JA 2LWIA 1FQKA 4A15A 2GA8A 5C4GB 3O47A 1IOZA 3E1SA 3KFXA 4TSFD 3BFKA 2D06A 2PMKA 2OBLA 5KYKA 1TNDA 1WP9A 4Z8YA 1QG4A 2R6AA 1R6BX 1E2IA 1NLZA 3BC1A 3SJZA 3FVQA 3LBIA 5GJCA 3BFVA 1H8ED 3X1WA 1XXHB 1SVOA 3TUIC 1BKDR 2B7CA 1KDTA 2ZQ5A 3CRVA 2J0SA 4Q7LA 4IKEA 1R7RA 2FPMA 2NO9A 2W58A 4NE2A 1TADA 5CM8B 4H1VA 3TE6A 3WBKA 1QHXA 3TUJC 2HXSA 2HXYA 2ZE6A 5BN3A 1U9IC 4LOAA 1Z0DA 5IK2D 4NH0A 4PANA 2WWWA 3W8NA 4W9MC 1YRAA 3EC1A 3UK6A 1UPTA 2AK2A 1WQ1R 1Z6AA 4M4SA 4O2RA 3RANA 3K9LA 3L82B 3R20A 4MKFA 2BM0A 3BBPA 3PEVA 1UDWA 1ZU4A 4IOLA 5FBRB 1B23P 4LPKA 2N1BA 3D31A 1X8KA 2YKGA 3VU9B 1E0AA 3B8HA 4IVQA 5D3MA 5JWOA 2O8DB 5A0FA 3RLFA 4URZR 3ZS8A 4ZDJA 1ANKA 3B1WA 3F0TA 3W3ZB 1ZNYA 1L8QA 3AP1A 1QHIA 1L7VC 5EP3A 2XZPA 1WB9A 3DOFA 1L2TA 2C96A 3U2QA 3U7GA 2XXAB 1SZPA 2IS6A 2ZIAA 5TV2A 1NSFA 2WAYA 3OE7A 3IO3A 4LJ6A 3AKYA 2ZUCA 1S4QA 4F7WA 4RCYA 4D0NA 1E2QA 1SVWA 4JBWA 5DN6A 5GJWC 4KODA 2IYUA 1MOZA 3P1JA 1JPNA 1NIPA 3BE4A 1OJLA 4ACBA 5H8WA 1IQPA 2DB3A 3QVVA 4LJ5A 1W49A 3RSOA 3UWOA 3C7KA 1G291 3QPUA 3MJRA 4DSNA 4YXWD 4Q4LA 3GP8A 3T5DA 4ZDIA 5EE9A 2I1QA 2OO7A 4ZPXA 3Q5DA 3UANA 3V9PA 2CCKA 4NDZA 2GEUA 4BASA 4FCWA 4MGZR 4XIGS 3ZIAD 4AY2A 4GPTA 3OEED 4Q5IA 5J4HA 4TTPA 3CIOA 3K0AA 2J87A 4Q19A 3C14C 2DPXA 3CRMA 2BKUA 2OLJA 2IC5A 3RC8A 4V0MA 4B43A 1I4TD 2YOFA 4P32A 4F4JA 2HUPA 4E09A 1YZTA 2ZXUA 2E9SA 1G7CA 3M4YA 3H4MA 1IJEA 1W44A 1L4YA 1S8FA 3VTKA 4LC0A 2QP9X 4JZKA 4KFSA 2P5SA 3MUFA 4I1UA 2GHIA 3MAAC 2C95A 121PA 3FOZA 3K0SA 3K0CA 4M53A 3K70D 2HLDD 1OXUA 2QMOA 2GJAA 3GLFA 2FGKA 5LPNA 1TU3A 1R0WA 1T6NA 3DKVA 3M6AA 3X2SA 1TUEA 1D2MA 1E2KA 1M2OB 3WY9A 2IL1A 2ZI7A 2OXRA 1VG8A 4OHVA 4LBZA 4A8JA 2VHTA 3X1XA 5AJZA 3F5FA 2PL3A 3PUVA 1NKTA 5AJYA 4P33A 1TF2A 1ZUNB 3AF0A 2ZROA 4QL3A 4IVRA 3TLXA 1T8TA 1JPJA 2PZFA 3JVVA 5IF9A 1BO6A 1UKEA 3SHWA 4DBLC 4Q1CA 2XXAA 2O8DA 3FDIA 2BOVA 3EARA 4KLNA 5TARA 3PFIA 1LW7A 3D6TB 4B2LA 3RS7A 4EPWA 3I73A 1Z28A 2P65A 4JVSB 4OI2A 3TNFA 2EVWX 2XNDA 4LJYA 2D4HA 1CJKC 3BIFA 2EYQA 2ODEA 5C18A 1DAEA 5LDDC 1OHHA 3REGA 3GLHB 3BRWD 1S9HA 2ZI3A 3T34A 4ZCIA 1RYHA 5B57C 2JIZD 1WBDA 2VF7A 5AR1A 3OIYA 3QKRA 4AKIA 2R44A 2BWJA 2ERYA 3WRYC 1HV8A 1R5NA 4LBYA 3FMOB 4DRZA 1P72A 2ZSEA 4KVAA 4PHHA 1W5TA 2ZR0A 1CLUA 4QHTA 3SBEA 2O8BA 3SN6A 1GILA 4UXIA 3DDCA 5GVRA 4CT5A 4LHXA 2XOKD 2RCNA 3KL4A 2GJ9A 5BN5A 2REXB 3HR7A 1GRQA 4PAOA 1OB2A 1FFHA 5SZJA 1DADA 3OAAD 2QU8A 1S3SA 4DLZA 2WOJA 4C9BA 3WXMA 3K09A 2YINC 3NHBA 3QG5A 4OHZA 1DO2A 1RE0A 1ONBA 3M0EA 4B3BA 4LDJA 1F2UB 1U8YA 4ZO4A 2BIFA 2CJWA 2QSYA 3IQWA 1KK1A 4MGKR 1P2SA 1Z0JA 3EA0A 4JS0A 4MA4A 3IIJA 5M04A 1MKYA 1WF3A 1GG2A 2ZJ2A 1VG1A 2EFDB 3R9WA 2C9YA 4GRAA 4GP6A 4LYFA 2BC9A 3UPUA 1GUAA 1S96A 2P6NA 3NKVA 3A4NA 2GXQA 4KHZA 4CDGA 4IHQA
chains in the Genus database with same CATH superfamily
1YVDA 2A14A 3ASZA 3C6ZA 3X1JA 1RXVA 1DKMA 2QUBA 1ACLA 3CEAA 4QUDA 4FONA 3TSCA 3ELYA 4KDFA 1ZNXA 2HHAA 4DPKA 3TIXB 2IYZA 3PL1A 1CQIA 5C1OA 3K70B 4JX9A 4QIHA 5HQJA 2OYRA 3RU3A 3K0BA 4ZMRA 5HTOA 1A72A 4RTRA 1BIFA 3C6KA 4PZCA 4OA8A 3FR8A 4RVCA 3E2PA 3GRKA 1T1RA 1DB3A 2ZRAA 2R1VB 2YJGA 3ZIUA 1IOLA 3L5KA 2VNJA 4FEEA 1EBFA 3DBLA 5LU9A 1AO0A 1GM5A 1BCSB 1Q0TA 1XCLA 2H17A 1DC3A 2OP0A 1Q7GA 2QAGB 4BP1A 3N0WA 4XQ9A 1A5SB 1O5OA 4UULA 4WINA 4P82A 4DIDA 1J4AA 3CSUA 4OHRA 3D6MA 2B8WA 2C29D 3EWNA 4MUAA 5CDFA 3AR8A 2V7XA 3FDJA 2Q3DA 1JA1A 3KJZA 5JCPA 4MWZA 4QTUB 3SFZA 1HDIA 1WUJS 2P5YA 2YWGA 4N7RA 3SOZA 4BB9A 1JT2A 1V3UA 4DMUB 3LZCA 1QIJA 4IL5A 4JB0A 2IWRA 1ISRA 3HNRA 2ZM5A 1G20A 3C1UA 1ISIA 1B1CA 1M0WA 4QX6A 1VKHA 4ZP1A 2I4TA 4R2JA 1GPNA 3PRHA 4ZT3A 2OBMA 3MBKA 4ND8B 3MFQA 5E4FA 2QI9C 3OFND 3RUHA 3PK0A 4CL3A 1SOWA 1H2RS 2A9JA 2FOLA 1EIWA 3P0FA 2BZ0A 1IK6A 3LM8A 3WNQA 3Q4GA 3VKWA 2EJCA 4KIGA 4NXMB 3VR5A 2H4ZA 4QAJA 1RIFA 3R3UA 1ZCJA 1KK0A 3WADA 4BMXA 5HZKA 3NBUA 3K0FB 1QRUA 2P3SA 4ARIA 1TYBE 4KPFC 1B6GA 3J80A 3PEWA 1N0UA 4LZJA 4GLJA 3VV3A 3M70A 4P35A 4DXDA 4X1IA 1JTEA 3IT3A 4I3HA 3UNXA 5FAXA 1FTSA 2ZIGA 2ZBGA 1KI7A 1DIHA 2NAFA 3KWFA 5IJ9A 5DYTA 2ZJYA 4B33A 3AVUA 1E4EB 4QDOA 3G13A 4ARUA 1D8TA 4YJ3A 1D6NA 1F2TA 2BKVA 3E70C 5GY7A 3WMRA 2Z09A 4DUGA 1WZCA 1XTKA 4AD8A 2ZVJA 1GAJA 1AIPA 1KYWA 1ZR4A 1QO7A 3MB5A 4AS1A 4LSMA 1YO6A 5JHGB 4IG4A 1PR1A 1VOTA 4RQBA 4RVDA 2EP7A 2JFYA 4M1ZA 4TWZA 1CUBA 2PIAA 1QQ5A 4TQGA 1O6CA 4F3CA 5KHLB 2OFXA 3L8ZA 1R15A 4IIGA 1L5WA 1Z6YA 3HUDA 3VKFA 3TQHA 1W85A 3CUTA 3ZE2B 2HCRA 1VPVA 2FXIA 4HQ6A 4Y6RA 4IO1A 4Y0VA 1O0CA 3ABIA 1I32A 2FW8A 2HYDA 2AG1A 4KSCA 3PITA 2VP4A 1DRKA 3RYIB 1UR5A 1QQ7A 2CFCA 2OXEA 3B38A 4TYQA 3RVKA 5I3CA 4QG7A 1PSDA 5CH5A 4DA9A 1HETA 1NVTA 1OWOA 2PQ2A 1ZG3A 2I9PA 4A5SA 2I7VA 2PS1A 5EINA 4L9SA 2FR1A 4A82A 4OUDA 2XNHA 3AHJA 5LXTF 4WZBE 3WKBA 2J3MA 3PWSA 3DKPA 4QGFA 5K3DA 2ACVA 4RHFA 2DERA 4YJ2A 2IKSA 10MHA 4JYCA 3WTBA 1IEQA 3V4RA 4B4WA 2CEKA 1HSZA 2QD3A 2QW0X 4W9RA 2Y2VA 1KKLA 1IZ0A 4KN5A 4HS9A 1MRZA 4V02A 1HY3A 3I9FA 4KWTA 4X7RA 3EMBA 3E7XA 3A3YA 3G2LA 4PS0A 2IS4A 1RWPA 3MJTA 1YQGA 1CY8A 2A94A 4RV5A 2MWMA 1KIMA 2GYUA 3A31A 2WJJA 4JQSA 4RTSA 2C3YA 1G9TA 5FOVA 2AW3A 2X0JA 3T54A 3FSJX 5C32A 2XAUA 4X7MA 1FB5A 3CKYA 3T06B 3NC0C 4IUBS 2ADOA 1KHHA 1XAJA 4ZQIA 4D9CA 3SWWA 3VSBA 1ZSYA 4QPJC 4DR7B 4GI5A 2FPGA 3DWEX 1KEVA 1OZAA 2Q9CA 3LUPA 5KYTA 1GJRA 2I4OA 2HRQA 3ADKA 1I2ZA 3NB0A 2RHTA 2TMDA 3T3MB 2O3UA 3OPVA 4DC9A 3GW8A 4CTMA 1KPIA 4JNCA 3WR5A 3E3NA 4N6GA 4YAIA 1V43A 5AK5A 3MPUA 2CK3A 4JIGA 3SP1A 1YMUA 3ZDRA 2ZP1A 1RRPA 3OIDA 2JFUA 5G3YA 4LFBB 1DAHA 1H2BA 2QAGC 3MLEA 2XAAA 5DHPA 3W9SA 1GL6A 2E6KA 3AGQA 2WHQA 1S3IA 1WEHA 2I8LA 1FW6A 1POXA 3KUCA 3CTMA 5LU8A 1Y98A 2JGAA 4MW6A 2I3DA 2OHGA 4TVOA 1E4EA 4E2FA 1MJHA 3I3SR 2VPTA 3LQRA 3O1JC 4C6RA 1BFDA 4C78A 1ZA2A 1U99A 2OCPA 1NHWA 1DBVO 3DTVA 4L8YA 4PCUA 5TJHA 3UV6A 2QAJA 2FXVA 2RGBA 2DPLA 4ZYTA 1PJ3A 2H4WA 1T9GR 2PSFA 2P6UA 3C3CA 4HJXA 4HYTA 4PSKA 4Y6QA 2UVPB 5HKLA 3BPSA 3TNDA 1H69A 2QIPA 4YS6A 3AZQA 4MUNA 4N7MA 3WIBA 3DAPA 2B1JA 4L50A 3IT1A 3FG9A 4EARA 5JNVA 5HF5A 4HDNB 3CF4G 1Q91A 3ZW8A 3AU8A 1CQXA 2XZDA 3HN2A 3LLCA 3OOYA 1U3DA 3QLJA 4J4BA 3TLZA 3RRMA 4ARSA 4E51A 5CB8A 1JIUA 3QKWA 2A9PA 2DF8A 3DE5X 3K16A 4UCQA 3OT5A 1E9DA 1RXIA 4AKGA 1NMXA 3JD4A 4UPDA 3SVZA 2DSTA 4TV8A 1YR1A 3EVAA 3KRTA 4B0OA 5K3FB 1Z18A 3FTPA 4E3ZA 1M8GA 4IMRA 3WLHA 5KKCA 4Q18A 2WZDA 2EFCB 2A7QA 3TF5A 4WZAA 4QC2A 3DB1A 3BDAA 3HFGA 1XA4A 3Q5GA 4R54A 4Y2HA 5I7AA 3SHFA 3UFXA 1KFKB 2Q4OA 5KVQA 4S12A 4D4IA 1NG1A 4XR4A 3T1HB 3RKUA 1ETHA 4K6CA 4F3TA 4JQZA 1WIWA 1O58A 2G1JA 4L6IA 4OK3A 1MOSA 4GOXA 2E87A 4IIYA 4RH0A 1JIXA 3ZNQA 1LBHA 1R0LA 2ZVPX 4HQRA 1KP3A 3UQYS 1N2EA 4WI1A 1OV6A 1NUUA 2BFPA 1NC3A 1KOFA 1AGXA 1OIXA 2DFKB 4ZVQA 4GO1A 2I4IA 2XUIA 3R7LA 2UXBB 3TZCA 3KWJA 1OBHA 1ODJA 1KO4A 3KDSE 5EJ9A 3I23A 1EE2A 4RE5A 2ZDQA 2YQ5A 2CDRA 4RLHA 2V7TA 3MRVA 2RGGA 2FSSA 2L2QA 3CSDA 3LA6A 1DT5A 3ZW7A 4WNCA 5KQRA 3CN7A 1VMAA 1AS3A 2VUIB 2XSZA 5DP1A 2PUHA 2VP2A 1YQTA 1DTWA 3JALB 2JIQA 2VUHB 1IZ9A 4EGAA 4Q24A 5EJIA 3R7AA 2QVXX 4JJEA 1A82A 4MUBA 4M9ZA 4JHXA 5FJJA 2IHBA 4F92B 2ESRA 2YXDA 4GOOD 2EWMA 1EK2A 2DH5A 4N4AA 4FIDA 3HVJA 4YAFA 2YH2A 4X1YB 3UYKA 2NZ2A 4CCWA 2HQOA 2H0RA 3SHQA 3VO1A 1J8QA 3RRYA 2AEJA 2JK1A 4Q7QA 2PJUA 3FKSA 3O6VA 1JHXA 3JR3A 1YQEA 1Z25A 2V4ZA 2ZRHA 3MLBA 4FEGA 1CK4A 2GD2A 1BC5A 2LUOA 2V7PA 4G07A 4PYIA 2NV6A 3PIIA 3S0JA 1UKZA 2BMEA 4ZIRA 4LYJA 4CEHB 2ZTSA 1U63A 2OL4A 4BECA 3P4UA 1NLMA 4UEOA 4I5DA 1E1CB 1MC1A 1ZMXA 4O0LA 1XD8A 1DMRA 2G36A 2QSJA 2QMUA 3P52A 5NLLA 4ZI3A 4FUQA 1YMQA 1Z38A 3ANYB 4TL7A 3UCXA 1N5RA 1OBFO 3OD5A 3LBFA 4UJ3A 2Z6AA 2HQRA 3TGPA 3GGSA 3AOEC 4MUXA 2B3TA 5CIQA 3QTBA 3N76A 4K9SA 5AW4A 2Z5VA 4MJ7A 3EYAA 1T1GA 2CL5A 3DLAA 3EYWA 4LC9A 4RGBA 4DVGA 4I46A 1TK2A 2GM5A 3IE1A 1YHNA 3ILHA 2FK7A 2HH9A 2DWPA 3L77A 4BFVA 3ZJUA 4FPXA 3K9WA 4Y9DA 2E5LB 2H5EA 4TKZA 1KZYC 1T34A 2CLDX 3S2SA 3MS4A 1LJUA 5JD6A 2YJ4A 5J59A 1A3CA 2FQYA 2FPXA 4HZUA 4ESOA 4YPVA 4JVOA 3HZRA 3NHFA 3GPBA 2QR3A 3O26A 1MC5A 1FFBA 3K8QA 3GJ3A 2GPTA 5LMCA 2VK1A 5D01A 5K4HA 3HVKA 2CVPA 2BTEA 3UAYA 3L8MA 4DJFC 5ER9A 3I1YA 1A8SA 4PNPA 1DBWA 4M55A 2RAPA 4C7XA 1PGJA 4MCAA 3ZKWA 1PUIA 3PUXA 1N7JA 4GL4A 5HQ3B 1QYXA 3NTUA 1Q0RA 5FTMA 1PUXA 5A4DA 1G5HA 1NM5A 1R18A 3G2NA 1FYVA 2C0PA 4ILEA 4DWWA 4RZHA 3L9XA 1GGEA 3NDJA 3PEUA 5TMPA 4NAUA 2Q3FA 1B3BA 4EA6A 1CYDA 1SVIA 2C5AA 2Q1XA 2V5VA 3BHMA 1UP7A 4KXMA 4ZVOA 5MFPA 1JHPA 1KGDA 1TF7A 2OESA 4RPCA 1C7JA 1UJBA 1FOEB 2H48A 2OAQ1 4KPUB 2QN7A 3DKKA 3CRQA 5H7XA 1FUIA 1E3WA 1GLNA 5JDCC 2G88A 3UJCA 3R4VA 1ZHOA 3WA6A 4M8KA 4XTRA 1Z7WA 3FOEC 2Q5IA 3EUAA 2VJQA 2P3QA 5B7GA 4G5XA 1DZIA 5B7NA 5F2KA 2VDPB 4FZJA 1F8YA 1SC9A 3O8RA 4HMQA 2OV2A 1SKBA 4LJ9A 5F76A 2B69A 4H60A 5BSMA 2VYVA 2YWXA 4XOIA 4L08A 3R41A 3KD2A 1DO0A 3M3HA 5JRZA 4UPVA 3TFOA 1BN6A 3ZVLA 1VPEA 1ZJ5A 3OF5A 1NWCA 4MIYA 4OGLA 2EW2A 5DH9A 3REOA 3WRXA 2RGWA 4PRKA 4LQDA 5FPPA 3ZHOA 3GUYA 1P5JA 1E60A 2IZ0A 2E7ZA 2WK1A 2XE7A 2ZPTX 3PXAA 3U09A 4OU5A 5AHXA 4FX2A 2VRCD 5GM1A 5J1SB 1AV6A 1B3RA 1FMFA 2FE1A 4ICIA 3CW9A 5LXTA 4R8SA 4D56A 2R85A 3DAYA 5C2JB 4ILKA 1UJ6A 1N2OA 2E82A 4ZAZA 5H1YA 2BH9A 4QFDA 4QG3A 2XMRA 3P9CA 1YC2A 3KUXA 3S7TA 3E0QA 3N74A 3GNLA 2GM9A 3HRIA 4DG8A 1ADJA 1QLWA 4E5YA 5C7LO 4Q4AA 4MB0A 1HURA 1QPGA 2EJBA 1WXDA 1Q95A 4FR0A 3QYPA 1W0CA 3DBVO 1PE0A 4MYUA 3M3PA 3WJ2A 4NBNA 5DASA 4BGIA 5IC4A 2R6R1 4JYBA 1FF9A 1KA9H 1JR6A 5TSDA 5IXYA 5IULC 2YN4A 2I34A 1Z16A 4RFVA 4UUBA 4LBVA 3KBOA 3A7EA 4JHLA 1XEWY 1SXJC 5EY5B 2XKBA 4TVSA 1GUZA 4KW7A 1B2RA 1E5TA 3K4PA 5AQEA 3G9UA 4EOGA 1P4JA 1B4DA 4JI6B 3I2HA 3IB3A 1ZUD1 3PICA 3ZKAA 1XWWA 4AXBA 2GRJA 2OCDA 2PIDA 4BNMA 5BMVA 5AVYA 1ODKA 1U7XA 5A4FS 1GNRA 3OBBA 4W5QA 2C5BA 3CZMA 2R87A 4FMBB 4RADA 3RBXA 3TB4A 2VQFB 1ECLA 3OIUA 2FEMA 3CZ9A 1JEOA 4MWCA 3LO8A 3FMVA 4L74A 5TIIA 4R0VA 2ODPA 3BZWA 3Q7QA 4F21A 1KJ8A 2Q4TA 5AI8A 2XBLA 2CYCA 3MT7A 4IS3A 3WLTA 3U3ZA 1PL0A 5EHIA 1PNRA 4K9NA 3GD5A 3G2OA 2ZIVB 4IWXA 3ETDA 5BV7A 5I6DA 4LA4A 2A1TS 2C5LA 3ZE0B 1YS6A 1B0UA 1SZJG 2ANBA 2NYAA 3BIOA 2CNWA 3HJHA 1BE6A 1UDRA 3KVNA 3KQHA 3KFLA 3RF7A 3DVRX 4CKEB 4KK3A 1DEHA 1JPUA 4N7JA 3VYWA 2QVGA 4C4TA 4Z1OA 1SQGA 3B9PA 4WVLA 4UTPA 2I2FA 5LMNB 4LMAA 2EJVA 5IJXA 4D0RA 4EW6A 1DPGA 1J49A 3STXA 1W2GA 4ZI2A 1MH1A 3V3TA 3E61A 1E1DA 3KLBA 4IJMA 2ZIXA 3CEPB 3HPQA 4IDBA 1YC5A 2WB4A 1GKKA 3N53A 4A1FA 3TI9A 1OT3A 2XB4A 2JIRA 1T4DA 5FTWA 1TK3A 4P3NA 2ZT7A 3UB2A 3T1QA 2WAAA 3UOWA 3VR3A 3ZWMA 1HNWB 4XLZA 4YWHA 1USGA 1TVCA 5EXDA 2V1UA 1XK6A 3TQFA 1W8IA 1IY2A 4GP7A 2Y05A 4DSAA 1EX9A 5IWAB 5HRAA 1QLHA 1YR3A 5CB4A 4I2NA 5AT1A 4M46A 3DA8A 2R62A 1T3LA 3RFVA 2CUZA 4N54A 2F17A 1W87A 1Q17A 2P9GA 4GWKA 4P83A 4L3WA 1EFHA 3VHRA 3BORA 4HQOA 1AUPA 3TNYA 4HP8A 3GGGA 4BQFA 2DCUA 2ICAA 1RBYA 3OZCA 3T41A 4C88A 4MP6A 1MA0A 3O2SB 3UW3A 5BP7A 2J67A 2D6FA 1XCMA 4FMCF 4TTQA 4QU9A 5A4MS 3ELUA 5JJIA 5KVAA 1TL7C 3H83A 1W46A 4O4LA 3AVXA 5IVKA 5HFJA 3ZOZA 4FNAA 4OBEA 1T4GA 2ZJBA 3MN1A 1IN4A 5K8CA 1Z2DA 1W9HA 4EHJA 3H7IA 1URPA 4DLUA 4QFMA 4N5HX 2JCSA 3E3LA 3WLKX 5BUCA 1E96A 1ICEA 4LVNA 5FI3A 1Q1QA 1A76A 4G37A 3DAOA 1P9NA 4ZODA 2O0KA 2EL7A 4MTLA 3LS2A 1L4BA 3IP1A 1F8UA 4XPIB 4DJAA 2YZGA 3R5KA 3OZGA 4NMXB 3DFIA 3S8MA 3O4FA 1WZEA 1IHDA 1JHAA 2C9BA 1XTUA 4DUYB 2QYHA 4DDKA 2WTUA 4C7OB 4YMLA 4RAOA 5FPHA 4II7A 5IABA 2QGNA 1ZM7A 3BDVA 3E22B 2KI5A 3I01M 1ACMA 4JLDA 4R8LA 3AUJB 2X22A 3K5IA 4LPSA 5HIMA 3TE7A 3V46A 5JZ9A 1E98A 1H6CA 3UY4A 4A0GA 2BGRA 4F9GA 2QM8A 3GNTA 3OQNA 1RJ9B 2O1WA 3PF8A 1LBIA 1T35A 2CNNA 3C1OA 3EG5A 4PWYA 5K3FA 1E4VA 1XQYA 3BXXA 2RG7A 3INGA 3TJRA 1N1GA 5JNSA 1NYTA 3FBWA 3RVLA 2JIBA 2DT5A 3PUHA 4PSVA 3TXAA 4C1NA 5BVHA 1I7DA 1KNXA 4G0VA 1LJ8A 2CJPA 2D7JA 4AJHA 1Q11A 4GGMX 1U6KA 3JQ8A 3QUTA 1H3FA 4FWBA 5CX1A 3GAFA 1YCGA 2R3SA 4RK0A 4YRCA 1C9YA 4WUVA 2YC4C 4BO3A 1KFEB 1VCOA 1XAHA 4HDRB 1KYZA 3CEMA 5FA5A 2XDWA 3ZCXA 2A86A 1OAOA 2PS3A 4FFVA 3GLTA 5LZ8A 3D8UA 4ZAWA 2CYAA 3JVDA 2BGIA 1K08A 3ZHTA 1KPGA 1REQB 5TQ2A 2IEGA 2JZNA 2GM3A 2Q4EA 4N18A 1D1TA 4DJ5X 5CDSA 3TCNA 2IHUA 1Y5RA 1XDBA 2EDAA 1D4OA 4R5HA 1YCHA 2NTEA 2OO5A 1PJ2A 2AJTA 1UH5A 3OZBA 4NECA 4Q21A 4RLQA 4AVYA 5B64A 3F3YA 1NI5A 5IKOA 4MITA 3WLFA 4HDMA 5DCWA 1TI7A 4ISCA 5AJWA 1ZM2A 3BWYA 2OD7A 1EWTA 1JECA 4AS2A 4J9UE 3FTEA 3M3DA 2C2XA 4YXFA 1BWSA 1VPDA 3GBSA 3N5KA 5J1TB 5HHTA 5TPWB 1F0PA 5BSHA 1EJ6A 2PUTA 5A1JA 3GCGA 2X8WA 1Y9ZA 5C8XA 4EJ2A 2ZUBA 3UKJA 4TL8A 4GSLA 1QHSA 4JT4A 5HMMA 4L73A 4JLSA 2X6RA 4S24A 3BBLA 3F4KA 1ZINA 5SZKB 2J5QA 5CK4A 1WXQA 2GZAA 1JHDA 3PFWO 2JLQA 1OA1A 3ZWOA 2APJA 3LQYA 4RZSA 1EWVA 1R6UA 1PYOA 2HIAA 2JIZA 2VSYA 3QPBA 1C5KA 1EVJA 2CXRA 3KX2A 1EK5A 2X5OA 2SHKA 1P2BA 4LZZA 1YJ8A 2OBXA 5EQDA 4W8HA 3P2YA 4MV3A 1GA4A 4HB4A 1XD2A 2HSJA 3G89A 4X92A 3K9NA 1NUQA 2FRVA 2CNKA 2VQ3A 4U7PB 3VMMA 2TECE 4B9AA 2WYOA 4DPLA 2Q6VA 4FMCB 1V96A 1HEYA 4UOZA 5JXIA 2C7PA 2COKA 4Q4HA 5IAJA 1W94A 3O82A 3YASA 3M1IA 4QASA 2WWTA 1Q16A 1QIIA 3FHCB 3PQDA 1QIMA 3NDIA 1WQ3A 3OC6A 5DPMA 1MW8X 4FCTA 1K5DA 1PV1A 3U7EB 3PNBA 2I7TA 2O2EA 5BN3B 4RD4A 3AR9A 4Z1MA 5JYEA 1IN6A 3RTAA 4BMVA 2GXSA 1EWYA 3I5MA 3K1ZA 1RCTE 4JMLA 1X7GA 2V4MA 1GL3A 2EW1A 4L8GA 4L72A 4GLBA 4UREA 1ZJWA 3AINA 3F47A 3PTLA 4V2IA 2JLXA 1KNQA 1SCDA 4J9VA 4CTJA 3LT5A 4D99A 3N5CA 3Q6MA 4UVEA 2WHXA 3C3AA 4JUAA 2BEKA 3PA6A 4HKTA 3OQIB 5JSZA 2ZRNA 3IBYA 3OMLA 4G5HA 1YVPA 1CP2A 1JAHA 4UUNA 3V4ZA 2A3RA 1PUJA 3M49A 5B3AA 3I37X 4CMIA 3PG5A 3W8DA 4Q4JB 4TWBA 1ZGZA 1JG2A 1EVLA 3LUAA 3Q87B 3UJDA 2NXWA 1JFLA 1TAQA 4WZ6A 4QODA 4IGIA 1T8YA 3MEQA 3ZVRA 1YB1A 2DPYA 5BW8A 1N1EA 5ALDA 1ADYA 1O0BA 1IRIA 5I7VA 3P20A 1OV4A 4O1HA 2I6TA 3CPJB 3ZS9A 3CLUC 1F5SA 2ODNA 1TYAE 3E1GA 1SVKA 3ONNA 3HRKA 2FG6C 1Y34E 3VU0A 3D2AA 4Y30A 5B3JC 4FE3A 1MJ5A 1JQAA 1TYZA 3AUKA 1SBCA 1QGYA 4YUXA 4YRKA 5DTQA 1DOZA 4EX6A 3UVEA 4OQZA 1IIRA 3FNBA 1XTBA 5DNDA 1X94A 5EFOA 3TW4A 2AI3A 4C87A 5BR8B 2OPBA 4PLHA 2JD1A 2XUPA 5FB3A 2YC2C 1EINA 1KI6A 1HL7A 4MO2A 3AXTA 1XJ5A 2E18A 4F2HA 4CF3A 3IFSA 4A9AA 4NXNB 4NU6A 3IQFA 4TMKA 5C4MA 5L7WA 4L8VA 3GLGE 3OE1A 4O1IA 3GVCA 3IVMA 3UMBA 3UUEA 1R10A 1T5LA 1ZXBA 2I6SA 1V9CA 1WMEA 2JW5A 4KLZA 3TH5A 3B85A 4KKXB 1YU9A 3UJBA 4E6PA 2WFMA 3B2QA 4NMMA 1OYOA 2W6ID 4B3JA 2C2YA 2CY0A 4W1RA 2IYNA 4Q93A 5F4ZA 4I5IA 5H3HA 1FNSA 4AB1A 2J45A 3SAJA 4EP1A 1IU9A 1IN7A 4HWSA 5IH3A 1JVBA 2GASA 2QT0A 3LECA 1UQRA 3E2IA 2Q6KA 1D6MA 3NH6A 2Y71A 5AVRA 4E94A 2VF4X 3H1GA 1XCOA 2HFJA 4MXDA 1ZDMA 2FLWA 1UFVA 3NM6B 4QQNA 4BNGA 5CEEA 2P6RA 4CI9A 2VWHA 5EZ5A 5CBKA 2A8YA 4WZAB 2CT8A 3D0OA 4NOLA 1YAJA 3BF7A 4Q3NA 4WK4B 4X7PA 1Z56C 5BN4B 4OREX 2F4VB 3KQVA 1F51E 3VC3A 1NXQA 2B2CA 1KGSA 4AY3A 3QUAA 1WMBA 3F3MA 3I6ZA 1L4FA 1JEEA 4A0QA 4YB8A 3F6EX 3IPYA 2YJNA 4YA6A 4TL6A 4JYZA 3U4HA 4BO4A 5L3SB 4C43A 1BQ4A 1F0NA 1KZ6A 1T10A 2WTAA 3BF8A 3QH4A 4RKWA 3KAJA 1I6WA 5AKJA 1K6EA 1R16A 4G26A 4J1TC 4DSZA 4YMHA 1U3TA 3M6WA 3Q8MA 1U5AA 4XYMA 3CB4A 1M8PA 2OY0A 5B6JA 5J5CA 1E2MA 4ND5A 2GEBA 3HO6A 3RYCA 3QELB 1Z34A 1E3SA 2F9MA 2PKWA 3ZWQA 1PR0A 2FZKA 3EZ9A 4CCYB 3HA5A 2N9UA 3ET4A 1B6RA 4LHZA 3OMXA 3PR2B 4LF6B 1NJ2A 5CCXA 5INTA 2YBEA 2P2GA 1VQ1A 5DYIA 5J63A 3WLPA 2HBQA 4S2UA 1GUBA 1V6AA 2VAWA 4JLOA 4R41A 1TKAA 4GLOA 1N0IA 1RWVA 2QE6A 2X0NA 2ZRLA 2TMKA 4ND2A 4PRYA 3UMGA 4FSHA 3R7WA 3UJAA 3OSUA 4U7HA 5ALRA 3LSYA 1L7DA 3KDPA 4CLHA 4ROSA 3IEMA 4GDMA 1S3FA 5CTJA 3HEAA 3JAKB 1XRNA 4I1SA 1IXKA 2VJYA 5AI4A 3AJDA 2HV8A 2PL5A 3MTAA 3UC5A 4BBPA 2G1PA 1VJGA 2FUCA 2V6IA 1PX2A 1YCDA 2FMHA 5BRJA 1CEQA 2Y1FA 1MEOA 2F8MA 1E58A 5JEEA 1N0HA 3MS2A 3UAWA 1SY7A 1ZM4A 2A4KA 3OVMA 1TX4B 3WXBA 4E7OA 1UIRA 1B8NA 4RC9A 4YECA 1MB4A 1L5OA 3GEMA 1GPLA 1Q1ZA 4GOND 2LKDA 1K8YB 4IMPA 4XJTA 2JGIA 3PIRA 2MSDB 1KFBB 5G3ZA 3VR3D 4EUEA 2XH8A 2I6UA 3VC2A 3KKNA 1DKQA 1IHYA 4CL0A 3RE1A 3LKDA 3U48A 1YZVA 3KLNA 2FRDC 1KO7A 2Z1MA 4FQ5A 3HBNA 3QEAZ 4MUMA 3V34A 5FFMA 1I9GA 3LF2A 2AK3A 3HB9A 2HRBA 4GT1A 5D3ZA 3GH3A 3LE8A 3KCQA 3QV1A 1PV2A 2C00A 2IYVA 5EUCA 5B3KA 2YFQA 2RHLA 3EBPA 4EHHA 2FW0A 3AIIA 3FUCA 1UPUA 2H9AA 3RVSA 1MRSA 3L06A 3T3NA 1U0FA 4RVHA 3MF4A 1LDBA 3PQFA 5HEKA 3L8DA 4IGAA 1Z4NA 4GKAA 5DCYA 2INGX 3GYGA 3VX4A 3ZHUA 2O3RA 2ALJA 4KI0A 3VOSA 4ZC8A 3CHYA 5CYOA 3HBAA 4TUYB 1Y42X 1IG3A 1SBYA 4A0SA 3T9FA 3D7LA 5LQSA 3DD5A 5LZ9A 2GCOB 5EP1A 5JG7A 3AUSA 1BHO1 5LP6A 1QV6A 5FFFA 2B37A 4G4GA 1C14A 1Q20A 2PUFA 3E48A 4NOKA 2D0IA 3O7WA 3NWJA 4XH9B 5F7ZA 3E9CA 4QDUA 4LNUB 2GD0A 1FP6A 3RS4A 2ZJ4A 3JRWA 4QUGA 2RKBA 3WK4A 5KJ6A 1E18A 3RVNA 3I1FA 4HNRA 4DA8A 3D6VA 3H2IA 2LVBA 3CX7A 4B32A 1JKIA 3M6MD 4BFUA 2PR2A 5LM3A 5LA6A 1GV1A 3HA3A 3VAYA 2NZVG 4J1SA 3OQIA 5J4YA 1GGKA 5HJ7A 3CN9A 1Z2CA 4NARA 3PHHA 1U04A 2HDOA 5FL7A 4BV2A 1EYZA 5KWSA 3WMGA 1FY2A 4LGVA 4Y7CA 5DXAA 4ALLA 5L95A 1K3UB 3GVXA 3N6RA 1Q92A 4OYHA 3ADPA 4OQYA 3U4QA 1B7GO 1TA9A 1ZY2A 1LDGA 3FNRA 3LQ4A 3O4RA 5JATA 1U1EA 3KBBA 4HNAA 2ZE5A 2AQIA 4PC1A 3TSOA 5EI5A 2OWDA 1SUPA 2Q4DA 4E30A 1AB5A 1YFKA 4M98A 1Y82A 2V58A 4N9QA 4UW9A 2Z2YA 1FNNA 2ATVA 4IQ4A 5JFTA 1YDMA 3MAGA 5COAA 2WF6A 4UTXA 5FWYB 3CT4A 1MMFB 2QV7A 4ZZ3A 4AY6A 1J2TA 1LZLA 2KX7A 4JOCA 3AUAA 2FSHA 4FFNA 1DBSA 4LXIA 2CLMB 2BJHA 3BTSA 4MKXA 4WK2B 4LC1A 5BR1A 2OAGA 3F7TA 4LG1A 4YJDA 1P77A 3GFTA 2GJSA 2EFJA 3VOBA 4AJNA 3AR2A 4KTVE 1MAVA 3ZHSA 2ODQA 2RHGB 3C6MA 5BW4A 3G79A 2QZZA 1ZOIA 3A6DA 3FYHA 4CTKA 5GGXA 4D1YA 1MTZA 4YBRA 4U2FA 2ZYVX 4EYOA 2NO5A 4RU1A 4M9QA 1QDUA 3CLRD 2RE8A 1YXMA 2C2HA 3T7TA 5LUAA 1KL7A 3R0IA 1CQJB 3WGIA 3N8DA 3I05A 3A36A 1C1DB 4UMFA 3MWKA 5JSKA 3QWBA 3WS7A 1NFFA 1BW9A 5ECWA 2TMYA 1QFJA 1TEXA 1C8VB 1XQ9A 4YALA 3SOPA 4HVLA 1XTZA 2ENWA 3GARA 2XV1A 5ECGC 1X1RA 1JYEA 4UXHA 4NBUA 2C9CA 1E1MA 2XB6A 1WKVA 5AKGA 2GFHA 3KQQA 3NIBA 3T5MA 3TQOA 5DTMA 4NBVA 4F9FA 1U4OA 2EARA 4HTFA 4U00A 4ENPA 4RF2A 1VL2A 1JQBA 2MHCA 3D7KA 3FB4A 4X6XA 4BTLA 2GVNA 3RUCA 3OHMA 4Y18A 2OBBA 4X41A 3Q72A 4DTCA 2IP2A 3LMKA 1CZNA 2F62A 1P7WA 1ULBA 8LDHA 3HTXA 3AVWA 1E1RD 3QKUA 4EWLA 1XZEA 1ADGA 1Y1KE 1NRXA 3D2CA 4I9FA 3L6DA 4OF4A 4PX2A 4OFWA 4U63A 4K8OA 3AM3A 1A9YA 2AE2A 1TO1E 3K9HA 3WL7A 2J9FA 3H0EA 2R5NA 1H2WA 4G0PA 5EZQA 5GGYA 3UMCA 1DWQA 4AN0A 3TEJA 3VYVA 4B2YA 4TTIA 1XL0A 1IN1A 1G60A 2NPOA 1JE1A 4HEJA 1BXGA 3EDRA 3VZQA 2IYYA 5LCXA 4CLRA 1ZLYA 2Y66A 3QPDA 3G8DA 2CFRA 2EHJA 2Z4TA 1MVLA 4QPZA 3NAQA 3SC3A 3BT7A 1RACA 4PR0A 2RBEA 1JR3D 1N6PA 1I3CA 2GVDC 3MCAA 3DAGA 2DBVO 2AJLI 2CCJA 1WA5A 1CR0A 2Z2JA 2KWIA 2NTYC 2O1SA 3CGGA 3ZNNA 4CI0B 3B2EA 3F5QA 1NXTA 2E1PA 1SQFA 2X6TA 4ZO8A 1NURA 2PUJA 3TGLA 1T9DA 2ZIXB 2VNHA 4EKEA 1W73A 3MSCA 1NQOA 4RVUA 4DV0B 3ZLJA 2AT1A 4CIBA 5GZ3A 3VO9A 1Q57A 2C2BA 3JPWA 1QZTA 1TVKA 3ZDZB 2QY9A 1CVIA 1EXDA 3CLRC 2I78A 1B6SA 1R37A 2XCLA 1OVMA 2J46A 1F06A 2D54A 3Q1LA 1RZUA 1MNQA 2WG1A 3G5TA 4TT3A 3WK8A 5AKXA 1U1CA 3EA4A 3PJEA 4DANA 5IVIA 4LDAA 4GP9A 1E2EA 1GCOA 2QD1A 4QREA 2WOOA 5LZ7A 2GUWA 1J99A 3FLMA 2FPRA 1C30B 1Y89A 3L0PA 3MWDA 4TS3A 4BRSA 2KHZA 1T2UA 3BA1A 4O4HF 4FC7A 1NDQA 4TOIA 4DREA 2WFLA 3K6KA 1EGQA 4LSZA 2DH6A 1TPZA 2R48A 1S1MA 4F1WA 5JC8A 4UZFA 2FV8A 4PLGA 2ZUTA 3SXUB 1G66A 1LLDA 4AZ0A 3I2YX 3SQDA 3FCSB 2P8JA 3N9IA 5ALXA 2OCXA 3LW8A 4UE3S 4XSHA 1D0SA 3T0FA 3VVCA 2BBWA 3HDVA 4TTRA 5KREA 5GZ1A 5ILQA 3RT7A 5DN9A 4Q9NA 1N2XA 1L7PA 4HAXA 1W7AA 1NNUA 3HVIA 4YCAA 4EB3A 3IBFA 1SU7A 1W75A 2R6DA 2SCUA 3D8HA 3ZIDA 1Z2AA 4QTXA 1QHEA 4Y6OA 3VI3B 1VDMA 4A0RA 3VPAA 1UK9A 5KC9A 3ZCQA 4IWYA 1RR6A 2XVZA 3F6SA 4Q3EA 5KSZA 5DMXA 1QKJA 2P9BA 4EUHA 4YUWA 5AJVB 1DOHA 3KAQA 1JSLA 5JROA 5JXGA 4KAAA 3H5VA 3IQXA 3ISTA 2W8BA 2ZUSA 4C0JA 4QJ5A 4FNGA 1W5AA 2GZRA 1CS0B 3I2IA 5IC5A 4J2HA 3OQ6A 1TXGA 4DCUA 3ZOKA 4LX8A 1HT1E 3ROMA 3VNUA 1L5HB 2O4CA 1ZK4A 5CW1A 3ZDYB 3EPLA 5SICE 2IOFK 4F4DA 3AT1A 5JQGA 3TRHA 3FKQA 1DQSA 1K7EB 3F3SA 5EJMA 1V11A 1JEQA 4NHEA 1RBZA 1N6NA 3BFJA 3BH6A 3H1BA 4FHGA 3OF2A 3SGLA 4EEKA 5TVGA 1EGVB 4ZEMA 3JZMA 2LDBA 1NMEA 2NSJA 5IHXA 3L40A 3DV2A 4B7CA 1L7QA 2FZ5A 4KGZA 3WNZA 3D8TA 3GOHA 4AF8A 1JT9A 3OLXA 3TLGA 4V2UA 5CFNA 3ZQUA 5ALZA 1W5EA 3L0ZA 2Y68A 4GPEA 3RLIA 4MA0A 4YV7A 1J39A 2W11A 3VKGA 4C0XA 1E0SA 3ZV3A 3NWOA 2VOEA 4PAQA 5KVVA 4AICA 1XYVA 2L82A 3GJ4A 4R9SA 1Z6QA 1GQQA 5K6AA 1TK9A 3GLRA 1H1TA 4MRVA 4MVJH 1GR0A 1VL1A 2C4VA 4L85A 5E4TA 4EI8A 5FOWA 4ZANA 3MWEA 5ABPA 3ZNOA 1BSVA 1TLTA 1Y80A 4EO9A 2IW1A 2ZE8A 3S68A 1XD9A 1T5OA 4C3UA 4Q1EA 3ZBQA 3CJTA 3K0CC 3ODPA 1G2QA 1SA0A 4CNBA 3TTYA 1T0HB 2ZKLA 4HN9A 1YZKA 2HV9A 2RAUA 4KHPB 3HU2A 2WHPA 4WLVA 1WR8A 1Y3DE 5E9QA 3I92A 5CT8A 1KJNA 3I62A 4WOJA 2CHQA 1DG1G 1MZVA 4KR6A 1G64A 2BEWA 2DBQA 4MW9A 5FI5A 1PQPA 3EEBA 4PCVA 2EC5A 1QRTA 4ARCA 4B3FX 4TS1A 1E1LA 5C5IA 1JDZA 1CF2O 1K75A 5AYVA 2WILA 3U4CA 4C22A 3OZSA 4IIXA 3RF6A 4RELA 3UJ8A 3KQTA 1DELA 4LXTA 4Z49A 5KINB 3GLIA 3QLVA 4KR9A 1QQBA 1V8BA 1BEUB 4R8RA 1NPYA 3A0RB 3BQNB 3CF2A 3WL8A 3QW4B 3FPSA 4MQ6A 1NQWA 5HUHA 3HR8A 4CETA 5ILOA 5J40A 4ADSG 2PZ8A 2RG1A 1RZVA 3E84A 3EIOA 3NBYC 2J3HA 3PD7A 3L84A 5ECDA 1UCFA