1GRRA

Chloramphenicol phosphotransferase in complex with 2-nac-chloramphenicol from streptomyces venezuelae
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
total genus 60
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grrA00
4Q21A 4BWYA 4L9WA 1G7TA 3ONWA 2HCBA 3IILA 2OFWA 2H8KA 3CF0A 4PSVA 1L4YA 3I8XA 2O0JA 4TSFD 3B9QA 2TMKA 1W0KD 5J4LA 2C9OA 4ZDIA 3GLIB 1R0YA 4JIMA 2ZJZA 1ETUA 3FDIA 3UATA 3I3SR 4ZPXA 1N6HA 4BE7B 4AKGA 4HB4A 1ZD9A 3NKVA 3MRSA 1TPZA 3P32A 3TBKA 1VCIA 3O47A 5C4MA 3X1WA 1G3MA 2RCNA 3P4XA 1HY3A 4RZ3A 4DWJA 5EJEA 1F2UA 2QG6A 2GDJA 1U98A 4IRUB 2NPIA 4BRWA 2F7SA 2QMOA 3W3AA 5FPHA 1XNJA 1UKVY 4CRWB 2XITA 1U81A 3CX8A 3VR4A 4IXMA 2O8CA 3VX3A 4C0SA 5GJBA 1I2MA 2Q6TA 1JR3A 2J7PD 1NN0A 2CE7A 4L16A 2CK3A 1W0JD 4BLOA 3PEUA 5UKDA 2GVZC 1KSGA 3PQCA 2WKPA 4HAXA 1J7KA 3THXB 4TLCA 4A2PA 3CLVA 1NP6A 3H0KA 3Q5DA 5F3WB 3GJ7A 4U02A 5BW8A 3KB1A 1TUIA 3I1FA 3IIJA 2PZFA 2ZSDA 1Z22A 4LV5B 1BO6A 2WAXA 3AVUA 3CPJB 4DSNA 1U94A 1CEEA 4WXRA 1EFRD 1XZQA 3EXAA 3N5CA 5KYKA 1VMAA 2W00A 2NIPA 2NO9A 4N3NA 1MR3F 2XTMA 3QXJA 3Q3JB 4D2IA 1HQCA 3VFDA 3PVSA 1H8ED 2NZ8A 3RYTC 3SHFA 3VR6A 3AGPA 1Q21A 2KSQA 3GLIA 2ZRAA 1UPTA 5BN5A 2B7BA 4TTPA 1U99A 2X2EA 3EWSA 5F9FA 4KFTA 1ZD8A 1P2SA 2ZRMA 1BOFA 3T1QA 4KVAA 3LLMA 4BEBA 2ZE5A 1D2EA 5F98A 1KI6B 4LYHA 1NSTA 1G5RA 4K46A 2FJUA 4WXPA 3G0HA 2VP4A 2KBFA 1IXRC 1OF1A 2QMUA 4MYUA 5C46F 2XTNA 2A5GA 5DGXA 1T8UA 4B34A 3CF2A 4YQFA 3LXRA 2W0SA 3M4YA 4JVLA 3IBGA 1F48A 3BK7A 4EQ6A 4LJ4A 3W90A 3A37A 5SZHB 5HCNA 4ZIRA 5IRCD 1N6NA 1J2JA 4Q1BA 3R8CA 4D4LA 4BRUA 4P0TA 1ZU5A 1N25A 3KQNA 3THXA 4ZCLA 4RZXA 2WSSA 2LCFA 4NTZA 1KI4A 4LBZA 4EJSA 4HLDA 2I1VB 4LYAA 1TUEA 1LY1A 4QOSA 4CGZA 1N0UA 3K53A 2Q9BA 5JWRA 2XSZD 2OAP1 1W44A 4JVSB 4UNPA 2B92A 5KPDA 4U7DA 2XB2A 3REFA 2IXGA 2REBA 3KKPA 1G16A 2HEIA 2EVWX 2P5SA 2WKRA 3ADBA 3I5YA 1PLLA 1X86B 3H84A 1GDDA 1NKSA 1R5NA 1SHKA 1OYWA 4GPTA 1NIPA 4LBWA 1WB9A 4POAA 2ZAOA 1E2LA 4V02A 1WE2A 5HZKA 1IN7A 4CVNA 2O8BB 2XTZA 1E9RA 4A6PA 3H86A 3B1ZA 4G5GA 2HUPA 2C03A 5FI1B 3VQTA 4URVR 4NKRA 5CJPA 2QORA 4D0LB 1CU1A 1KIMA 1KI6A 3LWNA 1DTSA 4KYIB 1MH1A 2ZE6A 3ZQ6A 5JZVA 4MDFA 3QKSB 5FOWA 1KAOA 4QM7A 4QGFA 2X2FA 3KL4A 1XEWY 1MKYA 1E2FA 1A2KC 3C4JA 3QIAA 1U2RA 2FF7A 4IEEA 4UNNA 2IUUA 3U4QB 1NLZA 4LYFA 5E3HA 5TDHA 1VCMA 3V4FA 4DDWA 4UNQA 1II8B 5TMPA 4H1VA 2FGJA 2IS1A 3ZS8A 3CKLA 5FUXA 1X1SA 2GESA 1GNQA 1G18A 1C9KA 4LC1A 1M34E 4CIDA 2AL7A 2QUZA 3THWB 3AKDA 1S4QA 4URXR 3LA6A 1Q57A 4LBYA 4M21A 2YWHA 3O8BA 2PZGA 4P31A 3GPLA 5EZ6B 2XB4A 3EASA 4I1SA 3SQXA 4OQLA 5K8TA 2H16A 5HCIA 1FX0B 5M04A 1A82A 1MV5A 1Z47A 2QTFA 3VHXA 3CWZA 2X8AA 3AF2A 3AVOA 1ZBDA 3FFBA 1XPOA 2GZHA 1R8QA 3ZJYA 4RFVA 3SJZA 3TRFA 4QHSA 3B60A 4Q9IA 5AUOB 1E32A 3IQXA 4B32A 2O8FB 2ZS7A 4OI4A 4URZR 4PFSA 1SKQA 2D74A 2O8BA 5GVSA 3TLXA 1FP7A 3D7MA 1AGRA 2AFHE 4DCSA 1SQ5A 2A78A 2OEPA 3PFIA 1UKYA 1SVKA 4XD7A 5J4HA 2EWVA 2ZIAA 3AF0A 4B3GA 3GLGE 3QKSA 1K6MA 2QNRA 2W58A 3ZD7A 4WZ6A 5F2EA 3HYTA 3EAQA 2VTKA 1DAMA 2VSOA 1VIYA 2FU5C 2WPDA 4HB0A 2CCJA 3LDAA 4Q1FA 2AX4A 3GFOA 4LJYA 3JVUA 1VECA 1ZUHA 3N70A 1N6LA 1II8A 3SYKA 2CHGA 4Z54A 3THOA 1IONA 2FPLA 2A5YB 4MYCA 4Q66C 3X1XA 2JIZD 2V4ZA 2ZRGA 3K9HA 4QG7A 1UEIA 3TSWA 1IHUA 3THWA 2IYLD 1LNZA 4HZIA 4IDOA 2F3TA 4B47A 1W48A 3KFXA 1XMIA 1G8PA 4FD2A 1G3QA 4GOJA 2AXNA 4FCWA 2ATVA 3HR7A 3LO5A 2ONJA 4YMSA 1EFHA 2NMVA 1XPRA 1HE8B 1N2CE 3AVXA 3R8FA 1FX0A 3FHCB 1M8PA 1NJGA 3C41J 5B30A 1RRFA 2P67A 1IQPA 2H92A 3EC2A 4ASUA 3CNLA 3B1XA 3U6KA 1AS2A 2ZXUA 1JR6A 1FTNA 2YOFA 4TLEA 5EQTA 5A0FA 4FWIB 1KGDA 4R7ZA 2PLRA 3KUCA 2ZSAA 2QI9C 4CT5A 4UXIA 3B1WA 1Q3HA 2QEQA 4ZO4A 1RC8A 1P7CA 2GF9A 2FSGA 2ZI9A 2GNOA 3BERA 3N2IA 1OFUX 2ZM5A 1ZYUA 4P4UA 2GVDC 4MRPA 3PUVA 3U7EB 3DDCA 3FMPB 4QJ4A 2VL7A 1Y63A 2GA8A 5AWFC 2F43B 2YOHA 3IO5A 3LNCA 1J8YF 1IY0A 1TTTA 3NXSA 3PIRA 1GNPA 3FMIA 4KYUA 3AM1A 4Z1MD 2EQBA 4P4SB 2DY1A 4PAOA 2H7VA 3D8BA 1ESMA 2G6BA 2YKGA 5CK5A 1QHXA 1JI0A 2VIIA 1BMFA 1LW7A 3ETLA 1VTKA 1XD8A 3LBNA 3SS8A 3IO3A 2VHTA 1T3SA 4TMKA 1SKYB 2QU8A 3AF4A 4JBXA 5EE1A 2QL6A 3QOFA 2OXRA 2GK7A 3SHWA 2WJVA 1RVDA 5EE5B 1YVDA 4F4IA 1E2EA 1IM2A 3L8ZA 4D4KA 4TT3D 2UZIR 3K70C 3LAWA 1DBSA 1EFCA 3SEAA 1FNMA 1BH2A 3R7WB 1N6PA 2V6JA 3MCAA 4DDVA 4I1VA 3UMSA 4C4PA 3PJRA 1Z06A 1EX7A 3U7FB 4QRHA 2IK8A 1T6NA 4FWTA 2YJTD 2R2AA 4JKIA 4GOKA 3RHFA 1E1RA 4IVQA 1P60A 5GJWC 1E9AA 3TKLA 1YE8A 1NBMA 5JHHB 3BOSA 2H57A 4C2TA 1TQ2A 1IN4A 4RCYA 5KO2A 1OV4A 4QBFA 1QG2A 4YMTA 3X1YA 2CHVA 1KNQA 4YDHB 1NG9A 4D25A 4MGIR 4MGZR 2JJ1D 1U0LA 1JXOA 2JLQA 2C95A 1Q1EA 2QP3A 2GAOA 2ODWA 1RYFA 3F0TA 5EP3A 4GFDA 5JCZA 4EPVA 1N5JA 2YWGA 4I1OA 2AD5A 5BXQC 3QKRB 4CEJB 1PLKA 1JXMA 4NYMQ 1C1YA 2GWHA 3VR3A 2QBYA 3K0FB 4P4SA 2J46A 4B3BA 4URWR 1WCV1 3ZS9A 4QM6A 1JR3E 2YC2C 5FOVA 4DSTA 3MGCA 1AKYA 1UEJA 4DIDA 4OYHA 1P6XA 3B78A 4A0GA 1I4TD 4FINA 2G3YA 3NBXX 3BRWD 2ZU6A 5AJWA 4HUQB 3IHWA 3RVBA 1GIAA 3EPHA 1AN0A 1N6KA 2DFTA 1XZPA 2IL1A 1KNXA 2QENA 4KXFB 4E03A 3TUZC 5HR5A 1OB5A 2VRWA 4F7WA 1B23P 3OAAA 4JL8A 4NCHA 4JL5A 1ZCBA 4YLGA 1LF0A 1YR6A 1G8HA 3FMFA 2QE7A 2WAYA 3LVRE 1UADA 2KI5A 4GRAA 4LC0A 2RGXA 4DDUA 4NE2A 2IF0A 4HSEA 3HU1A 3CIOA 4NMMA 5DSZA 5J4KA 3LVQE 621PA 1KAGA 3LBIA 3GLIE 2QAJA 1HV8A 3I73A 4Q1EA 5JLJA 4UQOA 2E87A 3DHWC 4AG6A 4URYR 2GHIA 4IFEA 1Q12A 1MABB 4TYQA 4TZ0A 2QAGC 1GTVA 1Z8FA 2EFEB 3AVYA 3CRW1 5AUQA 4Q1CA 1DAEA 1N5LA 4WZBE 5CB6A 4Q01A 3REGA 3QF4B 5TVKA 5DYIA 1OXXK 1HT1E 1YR9A 3F8TA 3KFVA 3KXKA 2YOGA 4JBWA 1NMZA 2LWIA 1XJCA 1G20E 4CEJA 5FBRB 3BJIC 1KDPA 1KKMA 1W49A 3KQKA 3K0FA 3MMPA 4BLSA 3B1VA 4GZLA 2R6AA 4KVGA 2ZROA 5KTYA 1E0KA 2EW1A 4G5OA 1KMHB 3EA0A 3BH6A 4XSHA 2XOKD 5FUYA 4HUQA 4OBEA 2ZRLA 4V0NA 4OK6A 2IYYA 2QM8A 2ATXA 1SGWA 2PEYA 1SXJC 4LUCA 4JVNA 4RCZA 2OBNA 4B2PA 2QRNA 1QG4A 3KUDA 2CLSA 2QN6A 5CK4A 4ZV4A 5JI3E 2IXFA 3GJ6A 4M9QA 3ZGXA 4HB3A 1IJEA 4BECA 3EZ7A 5SZIA 1AA9A 1FP6A 1D6JA 2AFIE 2ZS8A 4LHVA 1WQ1R 2Z4RA 3ZVLA 5KSZA 1VCOA 3NTUA 1X8JA 3W6PA 1NRJB 1G1MA 2GILA 2GKSA 2GZDA 4IVRA 3WNDA 2CHQA 3NVAA 3ZZUA 4NYIR 1TQ4A 2MSEB 1E2MA 1ZMXA 3OEHA 4MGYR 4DSOA 5DE3A 1MABA 2CL6X 3DZ8A 5HE9A 4DVGA 1WF3A 3E1SA 1GL6A 3NBZC 3RRNA 4BASA 1FQJA 2GBLA 3QF4A 3EZ6A 1Z6AA 2ZI6A 2JLRA 2ZRFA 4HI0E 2O8EB 3CZQA 3FKSD 4F4JA 3I62A 3OESA 4QHTA 5G3YA 3UANA 3U6BA 4BPBA 4X8MA 1N5KA 2O52A 3WYAA 2VSFA 2ZYVX 3B82A 3VNUA 4C0BA 2ZU0C 1KMHA 4WA7A 2XEXA 1N0VC 3AVWA 1YHNA 1MOZA 1UBFA 3ZVRA 2PCLA 2DWQA 1WMSA 4B3FX 1SXJD 1FUKA 4KU4A 5DH9A 2J9RA 5IT5A 2BKUA 4O2RA 3B7GA 3EZ2A 4LHZA 1G41A 3C5CA 3PUWA 1EWQA 3FHOA 2E9SA 1HTWA 2O5VA 4Q9JA 4DEYA 2ZPTX 1OB2A 4LCBA 1QDEA 3DZDA 4TQ9A 3SNHA 4BFVA 2C99A 1P2VA 2BJWA 2ERXA 3CR8A 1OH7A 1MO4A 1II9A 2IYZA 1ESNA 5GADl 2FOLA 5BN4A 1NNEA 3OFND 4RKEA 1JEEA 1OIVA 1OFTA 5FOXA 3Q7PA 1Q1QA 1UDWA 5JJIA 5AUPB 1FMLA 2QPOA 5EE0A 3RS2A 2FPKA 3L0OA 3FB4A 2WKQA 5DISB 4KBGA 4MQBA 1Z08A 2PX3A 2JLZA 4X8OA 1R4AA 3WNCA 1K8RA 2A5JA 4TL7A 2V8OA 4RD0A 2ECKA 5FBLB 5P21A 2Z6VA 1COWA 1T3HA 3UK6A 1U8ZA 3F3YA 1CULC 1NMYA 4A9AA 5L8VA 2O8EA 1Z28A 1FMJA 1TQ6A 3PXGA 4G01B 2CJWB 1Z29A 3QBVA 4G5SA 3SR0A 5B57C 5FOSA 4CF7A 3UMRA 3GCGA 4G5RA 1PV4A 5FTKA 3A1VA 2ZETA 4ILEA 4PC3A 2NPFA 5JSZB 1G8FA 3OEED 3AVQA 4M4SA 2H17A 4TYPA 3FPAA 5KSPA 4B76A 3IHLA 5AJXA 4NCIA 4DLVA 3A4MA 4RD2A 2R9VA 1JPJA 1OKKA 2W6IA 2WMOB 4TMTA 4ARZB 2XXAB 1SHZA 1G8YA 4JL6A 3RRMA 3BAFA 3MUFA 3AF3A 4TL6A 4GT1A 2GXAA 1EK0A 1KY3A 1X8KA 2FA9A 3DMDA 2IEZA 2SHKA 2WMNB 3BD9A 1YZQA 3FKQA 3BWDD 2R8RA 4RSGA 3UKDA 1NI3A 3LW7A 1Q44A 1ZUIA 3JVVA 3OIWA 2P2LA 1GWNA 1AQUA 2EFCB 3AP2A 2KB0A 1JAIA 5JRZA 1GG2A 4Y0AA 2YNMA 2WJJA 3NHBA 2DR3A 2JDIA 3Q7QA 1E79A 1F6BA 4GL2A 4LSGA 4TN1A 4WZAE 1UAAA 1Q0UA 2FFAA 3TE6A 4IDNA 4LJ8A 1YZKA 2V3CC 3IIKA 2WWXA 3GLFB 4M8NE 4MYHA 3UPUA 5JFGA 4MITA 4AK9A 2DWPA 3U7GA 1EXMA 2NO6A 4M1MA 5L3QB 1QHYA 1YZGA 1V5WA 2ODNA 2X19A 2NO7A 2N42A 1SZPA 3NDBB 2PT7A 5EXPA 2VF8A 3QENA 3UIEA 3VKHA 4IDHA 4NH0A 3W34A 2ZI5A 5JSZA 1SVWA 1YKSA 4B35A 1G9XA 3TVDA 3K1JA 3NG1A 4Q9LA 4FCTA 5HTKA 3QQ5A 1N6RA 2FEOA 2LKCA 2D06A 4ARZA 2XXAA 3UG6A 4YXWD 3PV0A 3ICEA 4N1AA 5FTLA 4QNMA 1VIAA 5SZJA 1KO5A 1JJ7A 2ZEJA 1Q1ZA 1P73A 3IPXA 3CZPA 1AZSC 2DHRA 1ZVQA 1IXZA 4PZLA 2QM7A 721PA 4HYYA 5J47A 2ZRHA 2FN4A 1KMQA 1TAGA 1XMVA 1FPMA 3T15A 5KSYA 1NVVQ 2ZTSA 1Z3IX 4LBVA 2WSMA 2H1LA 4MRNA 1IOZA 5CB8A 2RKOA 1RPZA 4DCTA 4IHQA 4MUBA 5D3QA 2ZREA 5LD2C 3I61A 4L5BA 5KDOA 3EG5A 4O0MA 5DN6A 1S3GA 1W46A 3RWOA 2J0QA 4V0KA 8OHMA 1NBME 2CLCX 1R5OA 4KSBA 2WIBA 4B71A 2ZJOA 5FL7A 3LQQA 4OJKA 4AC9A 4LI0A 1E69A 1U9IC 5DHFA 3NWJA 3TGPA 1K5DA 3NH9A 1H8HD 3U3MA 2QMHA 2CNWA 2DFLA 1US8B 2JLUA 1W47A 1ZC3A 1ZP6A 3K70B 2ZJYA 2B21A 3AV0B 4URUR 3BC1A 1E2HA 3ZIAA 2IS4A 1XU4A 2CLDX 2IA5A 2RGDA 1AZTA 1T0JB 1UM8A 3NBYC 2ZRBA 1GKIA 2IW3A 3L2OB 3U3JA 2JAQA 1MT0A 1VYVA 4DRZA 1G5TA 1MRSA 2IYSA 3LRPA 1KK1A 2VYFA 4B73A 2J0UB 4Q48A 1KHTA 2D62A 4TYYA 3BFXA 1WA5A 2ASEA 4EPYA 2ERYA 3EARA 4FMDF 2IWRA 4Q4AB 1SKYE 2C9YA 1AM4D 4KBFA 5JS8A 2KBEA 1E2KA 4IOKA 4US0R 2B8TA 3BB1A 1JPNA 1P62B 1G8GA 5G41A 3PITA 3DM9B 2WJIA 2WOOA 4OI2A 4GMXA 2OZEA 1E94E 2J0VA 4QNRA 3RS0A 3SZRA 4A0FA 5JEEA 2ZVQX 3F5FA 2PMKA 4M1WA 4C30A 5DYGA 4D4JA 3AKEA 3T34A 1E9FA 2W6JD 3BBPA 2CVHA 1HYQA 1KI1A 1TU3A 1ZW6A 1D2NA 2C78A 1HT2E 2QQEA 3ECCA 4JLAA 4F38A 4A8JC 1K5GA 3BIFA 4OHWA 1E0SA 2OV2A 2FFQA 1RKBA 2OUKA 4A15A 1N5IA 1E1QA 4NZYA 3A8TA 2EU8A 3E2IA 1F5NA 3BH7A 4NYJR 5B2ZA 3CBQA 3DL0A 3LLUA 3HU3A 1XEXB 3PUXA 5IK2A 4WW0A 2ZE8A 2Q3HA 4A92A 1US8A 1EFTA 4B74A 3MG9A 1CR1A 4HAUA 3LY5A 4ON9A 2BEKA 1ZM4A 4PQYA 1BS1A 2FEMA 2ZRDA 2D4HA 2MMGA 5FL3A 2G1JA 1I2DA 2C9CA 1R2QA 2IUSA 2A30A 1XCPA 4Q4LA 3ADCA 1SVLA 1KK0A 4D80A 4M22A 2ZRPA 3K9LA 4DC9A 3NDPA 4Q1AA 3TIFA 2J0UA 1TU4A 1E98A 4DKXA 1DEKA 1Z0JA 3WHKA 2ZYUX 4Q9HA 4JLJA 3H1TA 3GQBA 2GRJA 1FFHA 4Q18A 2B7CA 3P27A 2IYQA 1J70A 4WBSA 2V54A 5FUVA 5HKKD 2V6IA 4Q4AA 2QAGB 3AGQA 1GZSA 4Q9KA 3AVTA 3C8UA 3RAPR 4WOPA 3DOFA 3A6PC 4Q5IA 2V1UA 1ZM7A 2FE4A 5JWOA 3WHLA 1S9DA 5E7IA 1LVGA 1OHHD 2I3BA 4KFSA 2ZSEA 4XVRA 5HPYB 2REXB 4HUTA 4XVUA 5JBQA 2DYKA 1N6OA 1ZNYA 5H68A 2ZI4A 5E7MA 2RGNA 2GEUA 1ZINA 2QROA 1RJ9B 1Z0IA 2J1LA 3K8YA 3TH5A 4NYIQ 2BOVA 4DLRA 2NTYC 1O87A 2DB3A 3QXSA 3U4QA 2Q3FA 1D9XA 3W8RA 2ODEA 4GBMA 1HA3A 4M1OA 5ANRB 3KQLA 2OAQ1 2IHBA 1UJ2A 1N3BA 1Z0FA 5CDFA 2J59A 2GCPA 2BHRA 4JLMA 3A1SA 1W36D 4C0AC 3RC8A 1J99A 1NMXA 2P5TB 3DM5A 4OL0A 4M9ZA 3FTQA 2JJ2A 4A4DA 2AN9A 2DWOA 4FMDB 1SXJB 3ZZ0A 4IKEA 4TQAA 2ZRJA 5FTNA 4NU0A 4OI1A 4HAZA 4LY6A 3KDSE 1QHHB 4RVCA 4PC6A 4DCVA 2I1QA 1PUJA 4LYJA 4B6FA 3AKCA 2O8DB 2F55A 3OE7A 1KI8A 4IDPA 4LV8B 4S35A 1DG1G 3K9NA 3QJYA 4RFSB 4V03A 3DEFA 3L0PA 3ND8A 1F3OA 3TUIC 4C3ZA 3CONA 4KV9A 3RLFA 4OQXA 2VP6A 5E95A 4I1UA 5JCPA 2Y8EA 4NCJA 1UBEA 2IYUA 3QVUA 2BBSA 1CR4A 3B2EA 1E2PA 4TLBA 3TVTA 4PZZA 4OQMA 1JR3D 1XTIA 3WP1B 1QHIA 2QAGA 2F9LA 2DPXA 2CK3D 1E0AA 2O8FA 3PENA 4QJ3A 1KDRA 2FSFA 4PHTA 4M1SA 4KITB 2Q3MA 1R6BX 3QKUA 4PPGA 1GRNA 1XJ0A 4DSUA 5B58C 1W5SA 1X1RA 2BV3A 1M2OB 2ZRCA 3JZMA 1XEFA 1R0WA 2NO0A 3KTAB 4JLBA 4PHFA 2OESA 2IS6A 4L8GA 3DOEA 5KHOC 4KCGA 1TADA 4V0LA 4OHVA 1KSFX 1R0XA 1G21E 2PMDA 3EZ9A 3B6EA 1VG1A 5FTJA 1YQTA 3R9WA 3U7HB 1JQLB 1YR7A 1YZUA 1KO7A 2V7QA 4B3CA 5AUNB 1E2QA 3ASYA 3M6AA 2ORVA 5G53C 2H18A 2QT1A 2AR7A 3QXHA 4PAQA 4UNRA 4RZ2A 1A5TA 1T5IA 2BVNA 2PH1A 3LH5A 3V4RA 4W7SA 4HAVA 4DUGA 1UBCA 2O0KA 2OBLA 2RAPA 4LHYA 5FR2A 2ZITA 4EDHA 5KNCA 4KAXA 1VG0B 1XTRA 1MO3A 4AYXA 1QHHA 1SVOA 3KQUA 1UKZA 3CO5A 1RW4A 2O8DA 3N2EA 2NQ2C 1VG9B 4RFSA 1Z6GA 1LB1B 3TSZA 3UWOA 4AD8A 2F3RA 2BMEA 2P3SA 2WWIA 2ZVPX 3KB2A 2HXSA 1M6NA 1YZLA 4HB2A 1IN5A 2ZRNA 1E6CA 1JB1A 2RH5A 4JJZA 4Q4JB 3SBEA 1CRPA 3BH0A 4ZKEA 4BLRA 2N46A 5BWMA 2FSHA 3WP0A 4MRRA 2XNDA 1KSHA 1ZIOA 2WSSD 2ANCA 2UKDA 3WBKA 4V0MA 5CYOA 2FV8A 2Q9CA 4BZQA 3AQ4A 2PBRA 3GFPA 4DCUA 1IN6A 4C2UA 3KTAA 2IEYA 3GJ0A 3SE0A 4MRVA 4P4TA 5L3SB 2GJAA 1LS1A 1CKEA 3KZ1E 2WTUA 2BBTA 4Z8XA 2QTVB 5EUQB 4UXHA 2ZJ5A 1G3UA 1G7RA 4PO9A 3OF5A 3SJCA 4D4MA 1E9BA 1U90A 1RE0A 3SYNA 2F43A 1Z83A 2FWRA 4U00A 3SOPA 1O3YA 4HAWA 2VP2A 4PPNA 2QPTA 2FSIA 5CIWA 1UDXA 4E22A 5C18A 3RSLA 3HU2A 2PL3A 5C4GB 4P32A 1MO5A 2NG1A 2H5EA 2HLDA 2WWHA 1ZM2A 2XZPA 3RS3A 3EX7C 3NIBA 1QHNA 2VP9A 5JS7A 3TQFA 2R6DA 2ZUCA 4A1FA 4F93B 3VKGA 2JA1A 3OZXA 1Z63A 4IDQA 2VO1A 1OH8A 3E5HA 4TSFA 3RNLA 1NSFA 2J87A 3U3RA 2PEZA 3K0CC 1W0KA 3C15C 2QPAA 1GKUB 2AWNA 4NCNA 1XD9A 4IVPA 3CNNA 2D2FA 4ESHA 4C9BA 1G7SA 3KKNA 3TR5A 2VBCA 1Z2AA 3B85A 5DHAA 4E07A 4YMVA 3V9PA 4LWZA 1TQDA 3FVQA 1CF4A 2GJ9A 1XTJA 1Q3TA 1GVNB 3R7WA 4FCVA 4JLNA 1GRRA 4OKSA 3W5IA 5E4FA 1DOAA 2R44A 4K81B 1WDTA 4PHHA 4GMDA 3CWQA 4BZPA 1KK2A 1XWIA 4CT4B 4GNKA 1YU9A 3T1OA 2ZR7A 1QHSA 4Q7LA 2MMCA 4LX0A 2EYQA 1S3SA 3H2YA 2J5XA 4D26A 3VKWA 2J7PA 1KI9A 2IHYA 2ZSBA 4KI0A 4U5XA 1W0JA 3OIUA 2WIAA 2C96A 2UVQA 3WRYC 4Q03A 3HYRA 4M9SA 1BIFA 2GAAA 3W3ZB 4E5UA 1A2BA 4Q47A 2EFGA 3AB3A 2JATA 4PSKA 2QQ0A 3I92A 1T0HB 3B13B 2VPPA 5J40A 3QKRA 5BQ5A 3RRZA 4EKDA 5JECA 3W6OA 1EFRA 1RRGA 3HPRA 1NLFA 4HLCA 4PC2A 1EG7A 1RFLA 4X8LA 3M0EA 1FNNA 1P9WA 1ZM9A 4MKFA 2IYVA 2XAUA 4BLTA 4EIWA 3RABA 3GLFE 3KJIA 1OH6A 5AJZA 2YYZA 1GKYA 4ZDWA 1H8EA 1DADA 1P75A 5HZHA 4UJ5A 4IEIA 1DVRA 2G77B 4KODA 2NZJA 1ZNWA 4XD7D 3SDZA 4BQSA 1G17A 4M1TA 5LD2B 1TX4B 4Z51A 2ZR0A 3BORA 4RD3A 4B6EA 2VA8A 2GK6A 5FBQB 1F2TB 3FGNA 4KSCA 5TV2A 4HZUB 1ONBA 3MWLA 4M0LA 2LKDA 2QT0A 3RDPA 1JJVA 2RMKA 2BMDA 3PG5A 3R20A 2WBLC 3QI2A 4LV6A 3SYLA 2WPDD 4NP6A 3CNOA 4BLQA 4BFTA 1E2JA 5KNDA 3CPEA 4MA4A 4RD4A 2ZUBA 1G3RA 3GJXC 3HPQA 3RS7A 2QA5A 3IKJA 4JLKA 2WWYA 3RS4A 5FUWA 3A1WA 2BBOA 3D31A 1TF7A 2V55B 2QSZA 4Q7KA 1NIJA 2NGRA 2FPMA 1D2MA 4JLDA 2DFKB 3T5GA 1BKDR 2ONKA 1FZQA 3D3QA 5LB2A 4C0LA 1RRCA 2MSDB 3S1AB 4B2LA 1AGPA 2R65A 1CTQA 1GILA 1GAJA 1XTQA 3U3OA 3X1ZA 2XSZA 4A6XA 3T5DA 2QZ4A 3ICQB 3SQWA 4UKDA 4NYJQ 1E0JA 3NEYA 4NCKA 4ASUD 4XOIA 4BFSA 4CEHB 1OXTA 1EFUA 3C16C 5G3ZA 3CUEF 3DPUA 2G88A 4JYCA 2OILA 3AF1A 4HLQB 1Z0KA 2ZJ8A 4NBSA 4YC7A 1ZAKA 4PAMA 1G4UR 5LB4A 1IXSB 1XB2A 1Z0DA 3U44B 2ODBA 4HDCA 4Q1DA 2ZAMA 4TQUS 4A2WA 1X6VA 2VP0A 3IPYA 1F2TA 4JLPA 4HZUA 1HEIA 1XD2B 3E70C 1EGAA 1TL7C 3BXZA 1NY6A 4B44A 3QXXA 2FH5B 5D3MB 3BS4A 3T35A 3V00A 1NN5A 3U60B 1ELOA 4A8JB 4LHXA 3GJ5A 4O25A 5TXGA 4W9MC 1VKJA 4MUAA 4Y0VA 5CLLA 4X8HA 4PSAA 4E09A 4RJLA 3PCRB 3K9GA 1WP9A 3GMTA 1RIFA 1P4SA 2Z43A 4Q19A 4MKIA 5IF9A 3WYGA 1BMFD 4M53A 3T12A 5GVRA 1UKEA 3L0SA 3BFKA 3QF7A 4IOLA 4UNSA 3ZYCA 2ZE7A 3QPWA 4EPTA 3VMFA 1G4AE 3LXXA 4EPWA 4DCNA 2BCGY 3S1AA 2WM9B 5F9HA 3VR5A 4EUNA 3GLHB 4PHGA 5DNYB 1M74A 1N6IA 3NC0C 4HDQB 3KKQA 3LQRA 3KKMA 3QG1A 2QRZA 1E9SA 2QSYA 2AKAB 2WV9A 1CBUA 4XIGS 1F2UB 1AK2A 4IJMA 4OK5A 2XZOA 1Q1BA 5IDVA 3KXLA 4TZ6A 2KWIA 3A58B 3KX2A 2RHMA 3U2QA 4XWOA 1ZRHA 1E1RD 1T9HA 4MH0R 5JRJA 3UWKA 5CDFE 1XP8A 1NBMD 4FI3C 3LX8A 4GSYA 2OHFA 5EE9A 2BEJA 1P2TA 4TLDA 4IXNA 2V9PA 2P6UA 1W4AA 2HF8A 3NHAA 2ZYTX 4TMXA 5J4YA 4EFMA 4PX9A 3K09C 3U44A 3MSXA 1L8QA 4TMWA 4JZKA 1GFIA 4JSYA 1UF9A 4QGHA 3RWMB 1E9DA 4PC7A 1YRBA 3CF6R 4RY2A 5D3MA 4TTQA 3FMOB 3QE0A 4A8JA 3ZZTA 2Z5FA 3WBJA 1L4UA 1ZM3A 3IBYA 1CJKC 4I4LA 1OXSC 1Z0AA 2QP9X 1OT3A 3EC1A 4LPSA 2CBZA 1S2MA 5K8UA 1CP2A 1Z6YA 3GD7A 3VU9B 4AYTA 4RZUA 1AS0A 1I4LD 2J7KA 1R8SA 3TNFA 2G0TA 3VR2A 1GOTA 2JIZA 5L3RA 4P3YA 3GLHA 2VHQA 3L43A 1GP2A 2CL0X 2BMJA 2OCAA 3MD0A 3OAAD 4QXAA 2YC4C 2VHCA 3EZFA 2WWFA 1V43A 2WJGA 4NPHA 4JS0A 4OQNA 3EPLA 5JMTA 2AHOA 1G6HA 2CJWA 4TWZA 2QE7D 1L7VC 4AG5A 2ZI3A 4TL8A 5J5CA 1A7JA 4F91B 3CH5A 2P65A 3WMGA 3MJHA 3PEYA 4PR0A 1VHLA 2QP4A 1XFAA 4JJKA 1YJ5A 3SU8A 4EQ6B 4NHOA 3QEJA 1W2GA 3FYHA 1W4BA 1SXJE 3BGWA 3DMNA 3L0IB 4KFUA 1SVMA 2FNAA 3OIVA 4NYMR 2FG5A 4ZCMA 3HP1A 4ZIRB 5J4VA 3GEIA 5E7JA 3TAUA 2G0NA 1VHTA 2ZJAA 1YZTA 2RGBA 4D82A 2XZLA 5BYJA 5FFMA 4EJSB 2IWHA 2IXEA 2IBMA 3MAAC 4O3MA 4F92B 1XDBA 2OLKA 3SJBA 4DB2A 1S8FA 1SVSA 3EIHA 4CEIB 3KQHA 4YMWA 5CITA 1YRAA 221PA 2ZYWX 3ZVMA 1EWRA 4FW9A 1XPUA 3A4NA 2C2HA 3X1DA 2GBLC 2WVJA 4KLZA 3ZDQA 1IY1A 3LD9A 1G3IA 4NONA 2HDNB 3GJ3A 2DBYA 2JLSA 3VU9A 2Q9AA 4B2IA 3TJZA 1QF9A 3CB4A 4JMPA 3VNVA 3PUZA 1E2GA 2RGCA 1NVWQ 4Z1MA 2W2XA 4V0ME 3THYB 2JLVA 4JYBA 5L3VA 5GJCA 5KOYA 1ZUNB 2IT1A 1C4OA 3B8HA 3IEUA 3GLFA 3A1UA 1NL3A 3IDQA 4MKHA 2GETA 4LJ9A 4DHEA 1IN8A 2VP5A 2WHXA 1KZGB 4JKYA 2JLXA 2IYRA 1OH5A 4ZDKA 5L3QA 4CYMA 4W5HA 3JZAA 4HLUC 2AKYA 1FUUA 2A3RA 3I8SA 4PC1A 4KFRA 1OXVA 4TT3A 2EYUA 5AR1A 3FHTA 1T4GA 1W1WA 1KI3A 3O8DA 5TB5A 2NOAA 1S0UA 2WJYA 3ZQJA 1A1VA 3T1TA 1ZNZA 1QZXA 3AUYA 3OEHD 3RSOA 2D7CA 2B6HA 4UJ3A 2YHSA 3SBDA 2BDTA 3QPVA 4MDEA 4PPFA 3TUJC 4AI6A 1E4YA 1Z6XA 1KZ7B 2CMKA 1P2UA 3BFVA 4ACBA 4CEIA 2QY9A 3AP1A 2D3WA 6Q21A 1FQKA 1OW3B 4F4CA 3W9YA 4WAUA 3VR1A 1YR8A 5H8WA 2JJ1A 2CVFA 1XX6A 1TEVA 4Q02A 1XXHB 1ZJ6A 5G40A 1PVOA 2OM2A 3KJGA 2MSCB 3TMKA 4W5JA 5KU1A 1G64A 1IJFA 1Z2CA 2FZ4A 5HE8A 3WNBA 2OCBA 3AKYA 1MO6A 4PO8A 1DE0A 1DO0A 5CM9C 4IFBA 3THYA 3EA5A 4C0HA 3GFTA 1M7HA 1WXQA 2DFNA 2CCKA 1ZU4A 2AD1A 2QGZA 5H1YA 4PANA 1GUAA 3ZH9B 2AWOA 2BWJA 3I4LA 2IX3A 3LFUA 5JJLA 1W5TA 5DI9A 5KUTA 4C0KA 3ZD6A 1AS3A 1A4RA 4W5WA 4DLSA 3BB4A 4K8OA 1D9ZA 3AEZA 3CRQA 5TY0A 1W36C 4A82A 1KSJA 1HURA 1CJVC 1DAIA 2F1IA 2FMXA 3I5XA 5EXSA 5FH9A 3T06B 1BYUA 3QKTA 2IYWA 1X8LA 4XSGA 3FWYA 3AUXA 4TMZA 4BLPA 2HYIC 4JT2A 3H4MA 4GOXA 3FE2A 2X1VA 3R9XA 5TARA 4OHYA 1M7BA 4GP6A 5KDLA 4AKHA 4DLWA 3ZLJA 2KJQA 2PJRA 2IS2A 2ZRKA 2R62A 4DLTA 1KYIA 3ADKA 3SI7A 3LBHA 4M2LA 2WWGA 1COWD 2CEAA 4AKIA 4ITRC 1X3SA 2OBMA 5EP4A 3O8CA 4LHWA 4FMCF 1G6OA 2OCPA 3Q9LA 4AWXA 4CZ2A 5EE3A 1R5BA 5FPKA 2JLYA 3P1JA 2FX3A 1DPFA 1DELA 2XJ9A 1XXHA 2BJVA 3M1IA 1LFDB 4LGMA 4OHXA 1KJZA 1CXZA 2HV8A 2RB4A 4MGKR 1E96A 2CDNA 1D8TA 1G291 1M7GA 1OFHA 2IYTA 1SVIA 1GITA 4B43A 1OKKD 2W6ID 1XF9A 2D7DA 5K8LA 1KO4A 3K0CA 1XCMA 3CRMA 1KJYA 4EPRA 1CRQA 1E2NA 1EX6A 1ODFA 3KKOA 1XEXA 3EW9A 2XOKA 5K8IA 4FXPA 3AH8A 1KO8A 5CYPA 2N1BA 4LK2A 4PPQA 1XMJA 3W5JA 4DLXA 2GCOB 5FPTA 1OIXA 4UXJA 4HATA 1GRQA 1QBKC 4JT4A 4N0EA 2EFHB 2RHDA 1KY2A 2FDCA 5FPSA 4AY2A 1UFQA 1XJQA 1OIWA 4TYWA 1E2DA 2JDID 2HT1A 3FFAA 1E79D 1R7RA 3Q5EA 2J45A 4LJ7A 4OK3A 2G9NA 1G5PA 3SN6A 3VX4A 2P6RA 4Q7JB 1AIPA 3MJRA 1NY5A 3RC3A 3NC1C 3O8RA 2K5UA 2OLJA 4BZXA 1KDTA 2Q21A 1F60A 5B64A 2BCJQ 2YV5A 2ZR9A 3GJ4A 5IHPA 5DIFA 2OG2A 3B9PA 1DO2A 5BN3A 1LV7A 4TYNA 1MRNA 1QVRA 4IOMA 1WBDA 3QVVA 1PUIA 1L2TA 1P3JA 3QBTA 1TNDA 1XEWX 3U3KA 2HXYA 3DVLA 2ZJ2A 3CPHA 3OHMA 2Z83A 1U0HC 4B33A 2C04A 3WYFA 2CL7X 1JALA 2BM1A 1E9CA 3T61A 3TR0A 4LPKA 2IUTA 3FKSA 4Q7MB 4EJSC 1XBTA 3BE4A 3Q85A 5SZKB 4DB4A 3MWJA 1RJ9A 1GSIA 1CLUA 1E9EA 5FBWB 1VG8A 3EIQA 2YINC 2BMFA 2G83A 4Q4HB 1R10A 2R6FA 4PQRA 2OO7A 4BFYA 4JLVA 3L8YA 1WRBA 4AYWA 5KNBA 1KOFA 3LW8A 4JLOA 3WMEA 2PJZA 4L15A 2OE2A 4DBLC 1KK3A 1U8AA 1RRPA 1SXJA 3PEVA 3WRXC 1EESA 3K0AB 3EPJA 4G5QA 1NN3A 3DKPA 3UG7A 1Q20A 2GCOA 4QGAA 3GJ8A 4FMCB 2ZANA 1H65A 2VQSA 4EPXA 1TF5A 3DO6A 4QC2A 1CJUC 4GZMA 4CDGA 1YZNA 4D81A 3QXCA 2QTHA 5AJYA 4BFXA 1XTSA 1IY2A 2GTPA 2PT5A 4ACAA 5DN6D 1BYIA 1DAFA 2B8WA 1NVXQ 1E3MA 1KO1A 4PQFA 3OFNA 2QBYB 2HCJB 4TTRA 1P9NA 3A36A 2UZ3A 5FI0B 5FL7D 4AIIA 3W6NA 1FOEB 2GEDA 2O0HA 2PZEA 2PLFA 3EWAA 3NEJA 1T5LA 2VF7A 2CNWD 1SULA 4JSTA 4XJXA 1CS4C 1ZD1A 1JBKA 1S1MA 2GCNA 4RD1A 4DZZA 2WICA 5ELXA 1HE1C 1DAKA 1J90A 4O2LA 3ZIAD 1CJMA 3A4LA 4XTRA 4G0NA 1FTSA 2BIFA 2G1KA 3HWSA 1J8MF 4QKQA 2BM0A 2AK2A 4HDOB 4D6PA 1W4RA 2W2TA 3QPUA 1CR0A 1E99A 4MKGA 3UMFA 1NVVR 4LZZA 1M1YE 2A5DA 4Q4HA 1OFIA 3KJEA 2NO1A 3NBFA 4WIAA 1ZC4A 1T91A 3OEEA 1ANKA 1D5CA 2ORWA 1NJFA 1VYTA 1S96A 3K0EA 4LJAA 4M9XA 4ZCIA 3GEHA 3CH4B 4A2QA 4A36A 1LS6A 2IF2A 1OE0A 4A0RA 5EZ5A 2FZLA 2Z4SA 4OI0A 3K0AA 5FBVB 3GLHE 3I32A 4QBGB 5EUMA 2D2EA 3PUYA 3IEVA 2ZRIA 4ZI3A 2ZSFA 2F9MA 3CRRA 3I72A 3QUSA 4BFUA 1R0ZA 1HUQA 2GXQA 2Q0HA 1HQYE 2FGKA 3HR8A 4R98A 5CIQA 5JEDA 1RYHA 2FFHA 3DKVA 2JASA 4R71A 4C0JA 2P0EA 1PZNA 4EAQA 3EIEA 2VHUA 2RGGA 1PJRA 4JVMA 1FW6A 1Z6TA 4DLYA 1CR2A 1FL9A 2A7QA 2RGNC 2A2ZA 1OPXA 3KXIA 5A5GA 1T3LA 3AVVA 1E1QD 4Q4JA 2E1RA 1B0UA 1KI2A 2A9KA 2GJKA 2XJ4A 4I99A 1OSNA 5DO9A 4P33A 2OXCA 5C2JB 3Q8XB 5IK2D 3C7KA 3HJNA 4LDJA 1QHGA 1TMKA 3K70D 2Z0MA 4ABYA 4BUJA 2ZS9A 3IIMA 5FR1A 3L82B 2GZAA 3C14C 4XH9B 2JGNA 1ZCAA 4FN5A 1II0A 2CE2X 2WZQA 5L3SA 2J3EA 4DLUA 4H9GA 2R6CA 3CX7A 4PO1A 2R6GA 3K0SA 2ORIA 1G7CA 5A4JA 4XWKA 1LF5A 2OFXA 3SJAA 5AJVB 4GDFA 2XGJA 1XTKA 3T1VA 2XX3A 4QBHA 4HEJA 4EFLA 3GLGB 1P9RA 2XNSA 1JAHA 1E2IA 1TF2A 4N0DA 4QJ5A 2JEOA 3MWKA 1I4DD 2BBWA 1DS6A 1KI7A 3K09A 4KO8A 3SC3A 4C0QC 421PA 4LJ6A 3CR7A 5EXTA 521PA 3KJHA 3GEEA 4D0GA 2GXSA 4MYTA 4YXWA 5JJKA 2IC5A 3HDTA 3EPKA 2PX0A 3Q72A 4KHZA 5FTMA 4FIDA 1W7AA 4KLNA 1KKLA 3RANA 1VDZA 4L4UA 3TAHA 1NLYA 4M1KA 3UXMA 4ESVA 1XRJA 2HYDA 3AVPA 1U8YA 2F1HA 2HT6A 4YDSA 3FOZA 4B3XA 4BEJA 4BFWA 2A5FA 4US1R 1P61B 1W4CA 4XWAA 4DLZA 5JHGB 1Y3AA 1OJLA 1QVAA 2IYXA 2YWEA 4GP7A 4ZDJA 4ZI2A 4QFMA 1TEXA 3J81k 1N0WA 4HAYA 2OSBA 1GL9B 2YWFA 2GEVA 2JJ2D 4G3XA 4J0QA 4DIEA 3P26A 4I81A 5FPYA 4DDTA 2ANBA 5FOUA 1T8TA 5DLQC 1XMSA 4DT1B 2BC9A 4LJ5A 2VEDA 4B75A 1S1CA 5C1BA 4BGDA 1W2HA 1WBBA 1H8HA 4EFNA 2JLWA 4XTCS 4DXAA 3QG5A 2C77A 5KPJA 3B5JA 1JEDA 2HF9A 1Z5ZA 1NF3A 4NL4H 3OE7D 2I4IA 2J41A 1DAGA 4US2R 4QL3A 3WY9A 1S9HA 2RGAA 3PEWA 2ZQ5A 1DG3A 5EP2A 3VAAA 2GJ8A 5DI3B 4OHZA 1NVUQ 1XCGB 4G1UC 3GLGA 2V1XA 2VLIA 3LV8A 3P4YA 5EXXA 5LPNA 4R2IA 5CLQA 3CW2A 3WMFA 3GP8A 4TLAA 3VTKA 2FFBA 4PXAA 3TW8B 2F1RA 4C7OB 3RRYA 3LX5A 5LDDC 3ZVNA 2QGNA 4Q00A 4M1YA 4QBIA 4RKFA 4YMUA 5KSOA 1U0JA 3QEOA 4OJQA 1Z07A 3G5UA 1OLOA 2C8VA 4ZKDA 3G82C 2WJHA 5H70A 2W2VA 2F1JA 3PR1A 2VH5R 4RD6A 4CW7A 1CJTC 4LOAA 2YZ2A 2OT3B 4GI7A 3RS5A 821PA 5FOTA 1P72A 2VHJA 1PLJA 1IBRA 5EP1A 1KJWA 3WXMA 3SFZA 1NKTA 2EWWA 1P5ZB 1AJEA 4NDZA 5BYKA 2L0XA 2C5LA 4L9SA 2CXXA 3CM0A 4D0NA 2J0SA 1RZ3A 2V7QD 2HJGA 2W0MA 2WOJA 4WVFA 2W6JA 1VPLA 1ZIPA 2AXPA 2X77A 5GJVC 3QNUA 4FMBB 1U9IA 2GJSA 4AURA 2AK3A 3VHLB 4PZYA 2ZJBA 3TSOA 4DUGD 2GF0A 3U5ZB 1NG1A 3A1TA 4DT1A 2QMEA 1AQYA 1CIPA 4JBYA 1KTVA 4XVQA 1GM5A 1Q22A 1W36B 4HLUA 2JJ8A 3ASZA 4LRWA 2OCYC 5CM8B 4B3DA 3QY0A 1G19A 4QGGA 4DJTA 3TK1A 3MFYA 4R9UC 3B1YA 1XXHE 5DI3A 4IW3B 2WWWA 4DEXA 3SFVA 2BKEA 5AK0A 4YONB 4C7OA 4CEHA 4ERNA 3U61B 1UBGA 2KE5A 4II7A 1JNYA 2EFDB 3NH6A 4AKEA 4B48A 1GNRA 2W83A 1JQJC 1LTQA 2GXUA 4IOJA 2XNDD 1JECA 2DCUA 4PTLA 3R9IA 4TL9A 2OFOA 3MWYW 4H1UA 2JCSA 3CX6A 2O8CB 2C98A 5HKKA 1GL7A 3MLEA 1DARA 4KJZA 5CJ2A 1OXUA 2ZUDA 4A0HA 2REOA 3P20A 1ZNXA 4QHYA 3D6TB 3QSYA 3IQWA 1VYUA 4Z8YA 2PCJA 3TW4A 4TMVA 3TQCA 2RGEA 3AP3A 3CRVA 3X2SA 1NN1A 1KDOA 1E4VA 1HH4A 1OHHA 1DAHA 1XD2A 4V0OA 5JWHA 4BFZA 3C5HA 4S2EA 3W8NA 2CCGA 1QRAA 2ZI7A 2HJVA 2P6NA 4OQFA 3IUYA 3ND9A 2VSXA 3IGFA 5LBIA 3ADDA 1IAQA 1OYYA 2HLDD 1AKEA 121PA 5KDDA 1VCNA 3OIYA 3BB3A 4R2HA 2YVUA 4MRSA 2F6RA 5JI2E
chains in the Genus database with same CATH superfamily
5KVAA 5CVTA 1GZ3A 4C7XA 3C6XA 1EFPB 1LPAB 1Z35A 4OH1A 5EA2A 3IILA 2OFWA 3VC7A 2H8KA 3QKIA 5F5LA 3QQPA 1UK9A 3U4CA 3B9QA 1W6UA 2TMKA 3LUAA 5J4LA 4R8VA 1HETA 4MEBA 3GLIB 3RUIA 2SKEA 1XAJA 3GJQA 5DP2A 3I3SR 4ZPXA 5BOVA 2WT4A 2A1UA 4B82A 4AKGA 5G0TA 2PS1A 5EHZA 1C9MA 2EP5A 1SUWA 1TPZA 2NVUA 3MRSA 3P32A 2X14A 3TBKA 4QXOA 3X2EA 3X1WA 1G3MA 4JCCA 1LA2A 4RZ3A 2RBEA 4UHCA 4E11A 1LZKA 1BEZA 2E3JA 1F2UA 1OZHA 3IVRA 4OUDA 1ES9A 1Y4SA 4QUIA 3I0NA 4A03A 1A9SA 1U98A 2DY0A 4MR7A 5I7HA 3WK8A 1IIBA 2RHHA 4EELA 3RARA 3C3XA 4Y2PA 4O59O 3QNMA 3GP5A 1HQDA 2F7SA 1G20B 4PFKA 4BRWA 3ABRB 3FSJX 4RKRA 3GGPA 4O2BA 5FPHA 3P9XA 2AJDA 1UKVY 4DQVA 4EEKA 4R9SA 1Q14A 2XITA 3RAGA 1FDWA 4MJXA 4RANA 1HEYA 3LDUA 3QVXA 4H18A 1L4BA 3VX3A 1TMOA 5GP1A 3KJQA 3TSAA 1N3LA 3G7UA 2J7PD 3IQDB 1NN0A 4ZOQI 1JT2A 3AMVA 4XIJA 4CL2A 2NT4A 1XV5A 2CK3A 2Q2WA 1KSGA 2AYYA 2WKPA 3R0VA 4HAXA 3VOSA 5COBA 3ANYB 3THSA 4BVLA 4TLCA 3DUFA 1Z5VA 1SU8A 3CLVA 2ESRA 3DBHB 3GJ7A 3H0KA 3N1UA 1SOAA 4HK4A 4BKQA 2O8VA 5A03A 1TW2A 1A27A 2XNJA 2PZFA 4QSHA 4H6VA 3ZGOA 5HK9A 4LV5B 3C4VA 4DA8A 3CPJB 4N5MA 4P35A 4E6PA 2VWPA 1FXSA 4UOEA 3TTUA 5EUBA 4DDMA 4FR5A 1EFRD 1TAHA 1XZQA 3EXAA 1QYRA 3N5CA 4QATA 4XD2A 2W00A 1EBBA 2J9FA 1EVIA 2BEWB 4UAVA 2HQ1A 3QFFA 1F5SA 5BXYA 4QTYA 5FAXA 1U0GA 3Q3JB 4Z4HA 1YDGA 2B3DA 3HCOA 3T99A 4CLOA 1R66A 4WLNA 2CNDA 4E94A 1PR1A 4O4HF 4KPUB 1DMRA 2NUPA 3RYTC 3SHFA 3VR6A 1D09A 2I55A 4TYMA 5IT4A 3OLVA 2MYPA 2CVZA 5E2IA 2AQIA 2OV3A 1UPTA 4ALIA 3RK0A 4EG0A 1T1JA 1FP1D 5THXA 4B09A 4ZVMA 1L5ZA 5DMHA 2H59A 3NHMA 3AHJA 3EWSA 1Z7BA 3QEMB 3FBTA 4RA9B 2ZRMA 4IY1A 2XKJE 2PKQP 4PCLA 3L7CA 1Z73A 2V7EA 2PIAA 4RC9A 4R1PA 1G5RA 1OTXA 2KBFA 2QMUA 5KYTA 2A5GA 3IT2A 1CUZA 1G66A 1MAHA 5TQVA 1V11B 3FRJA 3BJMA 1E7MA 3UGTA 4YUWA 2B99A 4JVLA 4KRYA 1RRMA 2HEGA 3BK7A 2CYAA 5K1ZA 3PXBA 4CI0B 3C3BA 5IZCA 1TT5A 4BGEA 2BEUB 3HY6A 4J0FA 4ZYTA 1X14A 1GUDA 3ZE2B 1SU6A 1L7NA 2H1CA 4XB6B 1N25A 3ND5A 4ZCLA 2NSJA 4RZXA 2WSSA 2LCFA 4RQUA 1IQ0A 4I5IA 4CUZA 2C4VA 5K9ZA 3M9XA 2DPYA 5D5QA 3OF3A 5KZMB 1TUEA 3S4YA 1ML3A 4DHWA 2JAXA 3P9SA 2JJQA 4ROTA 2BTQA 1Q92A 3P0IA 3K0BA 4QOSA 5AICA 3NPAA 3Q2OA 1QVVA 2XSZD 3DNFA 3PI6A 1A5ZA 3KNZA 5DYNA 1PUXA 3HFSA 4UNPA 4RF5A 2IKSA 2P30A 3F4LA 3I9MA 3WYEA 2B5WA 1HK7A 3REFA 3COVA 2DRIA 2Y0CA 3G8DA 1H93A 2CLFB 4FYPA 3UAZA 3VHXB 4E51A 4PYOA 3ADBA 3I5YA 2AFIA 3UWDA 3ZWMA 1PLLA 4ZJZA 1X86B 3LOPA 1GDDA 1NKSA 4JQYA 4GPTA 5MGNA 3KPJA 1XG5A 2IZ7A 3O4IA 4G1MB 2QYTA 2JFQA 4HVAA 4JWKA 2J6BA 4OAQA 1V3UA 3BCRA 4POAA 1S2OA 2HB6A 5CA1F 3H8VA 4AJHA 3G0GA 4UAUA 3DZBA 4KL8S 3BTOA 1EDDA 2X8JA 4Y1GA 3MT9A 4QPJC 5KAMA 3KKLA 4BRUA 2C03A 1YB1A 3GG2A 3NHSA 1RKXA 2YN0A 4GC5A 2W9XA 3A25A 5H3CA 3VPGA 4URVR 1C9EA 5CJPA 1EUZA 2QORA 3DF7A 4ZYWA 4KYIB 2WQ7A 2QL9A 3EGXB 3TECE 1THMA 2UZ0A 4NG4A 2FDRA 5JZVA 1Y3DE 1DBQA 1O94C 3DTNA 3VI3B 1VJDA 4E30A 1KU6A 1FVFA 2R7AA 2X2FA 1AUOA 1XEWY 4M0PA 2OD2A 1A2KC 5AIAA 3AG6A 5LQUA 4KE8A 4YRRA 4P7GA 4XIIA 1Z2EA 4M6WA 2YBEA 3KETA 3U4QB 1HLGA 2J08A 3VVCA 1HORA 2EZ8A 1UK8A 2G76A 2WYOA 3GA7A 4KMOA 4DR1B 4WQMA 5TMBA 2FGJA 5IJ9B 2PKRA 2ECPA 5HFNA 3ZS8A 3ZWCA 1ZK4A 5FUXA 1X1SA 1ZSNA 2HNKA 4R51A 2QRKA 1G18A 2NU6A 4V3BA 1L3BA 3MCWA 4LC1A 4CIDA 4RHYA 1RACA 2R4UA 5KWSA 1S4QA 4Z4EA 1Z38A 4B8ZA 4NEHB 4WKNA 1TXGA 1SXGA 2H2HA 3KR9A 3L07A 4UE3S 2F3PA 1SD1A 3H9UA 3O8BA 2PXCA 3UCFA 5K3EA 3OZTA 3ABQB 3GPLA 3EASA 2QTCA 3HRKA 2WWRA 4DFDA 2B4QA 5BVHB 1Z47A 1MV5A 4RDIA 2HDOA 4DGSA 3CWZA 2X8AA 3IAM1 3AVOA 1ZBDA 2W6ZA 4CMEC 2GZHA 4JD5A 5IDXA 1ISFA 2GK4A 3ANTA 4LKRA 3RVOA 3SJZA 3TRFA 4DZRA 1RYNA 4FJ0A 2WZBA 4DNXA 2E85A 1JT9A 1K92A 2UYYA 3G8CA 5JU6A 2O8FB 3ZH2A 4KHPB 4OI4A 4HDKA 4ZQCB 2D74A 1QHFA 2HHCA 3LQYA 3RTDA 3U62A 4AF6A 4BCBA 3DONA 1HTTA 2IYPA 4LHEA 4OLFA 1XN1A 1YK1A 1GTL1 2JVIA 2XDYA 2ZYAA 5J1SB 1JDNA 4GMHA 3UW3A 5B1IA 4QQ8A 4F6LA 5CEEA 1Y1SA 1YB6A 2OEPA 1LPSA 3PFIA 4KQEA 4JJGA 2VPYA 1YOBA 2H1OA 2EWVA 5F5NA 2JD2A 3T52A 1P18A 2O6HA 3QKSA 4LGCA 2QLLA 3F8SA 4FGSA 3I30X 3AERA 5IDYA 2R8YA 1Z0ZA 4Q16A 5F2EA 3C7DB 4LF9B 2JFWA 3SC2B 2YVQA 3MWDB 5K0NA 5FB3A 2VTKA 1G63A 2NTJA 3RRXA 3LDAA 5ILOA 4Q1FA 1V9CA 3PA6A 2AX4A 1T1GA 3DQZA 3GLUA 4Z54A 3N70A 1JHQA 1II8A 1N6LA 2WP0A 2WUGA 3A6ZA 1FU8A 3DEYX 4FFBA 4O4HA 4ZAZA 3T54A 4XGKA 1ILEA 1P0PA 4Z4QA 1V26A 2X4GA 2FPLA 2A5YB 4Q66C 5IP5A 2ZRGA 2V4ZA 3ILHA 3K9HA 3W7AA 4DUZB 2HFKA 3CRZA 3JXEA 4CM7A 3ROKA 3IJRA 4MOWA 2IP4A 3DB2A 3X3HA 4QFDA 3U4GA 3K6JA 5IBQA 3O90A 3WWCA 5TPZA 5C9ZA 1FFWA 1JPVA 2EP7A 4Y6OA 4OQQA 1M10A 3E6AA 1N7IA 5AVJA 3DGEC 1FMTA 1WJGA 2E4ZA 5ALTA 4UVDA 1VJ1A 4F1JA 4PM4A 4UFPA 5IWCA 3R8FA 1XPRA 3FHCB 4N18A 3ZDEA 2WLTA 4DR6B 4LRTB 1M8PA 3FGPA 4NZMA 4P86A 1Z8DA 2R60A 1F1BA 1VIMA 5B30A 1ZA1A 4IIJA 5CX1A 2JPDA 3VC3A 4QOHA 4RGBA 4IINA 3RI3A 3ZY3A 4AY4A 3CNLA 4DEVA 2CXOA 5DNCA 1XDDA 1QYDA 1YSCA 4DRXB 4ENPA 5I9LA 3LBFA 3ZWPA 2Q3JA 3O8QA 4WZAA 4FWIB 1IEQA 2AOXA 4R7ZA 3FGZA 5A0FA 1L5HA 1RM5A 1E3TA 2PLRA 4HFJA 3MUOA 4AUKA 4CT5A 4BLVA 2HM7A 1MQ9A 2ZXFA 1U3TA 2PBFA 4O8CA 4WBNF 3F2IA 3G68A 4L51A 2IHZA 1T34A 3FHLA 1U5AA 4PIVA 4ARCA 2XF8A 4L7VA 2AI2A 3U4IA 4QTZA 3I3OA 3W1WA 2M1ZA 4B6GA 5IEJA 2CJYA 1A9PA 4BYGA 3KB6A 2GNOA 2ZM5A 4MRPA 2AOVA 4WXMA 4FC7A 2Q8QA 3U7EB 1B14A 2Q49A 2GA8A 1HMPA 5AWFC 5HOEA 2YOHA 3WGGA 3ZOZA 1J8YF 2R8ZA 1IY0A 1TTTA 3BMQA 4DTIA 3IUEA 2AMLA 1LJUA 1KVQA 2ZGVA 3RJ9A 5EHQA 1N1EA 3NHUA 4KGDA 4AROA 3B3FA 4PAOA 4LFCB 4CG0A 2YKGA 4F7DA 4TXHA 4YMLA 1A9ZA 3DTVD 5JMPA 3UCXA 3W0LB 2GPWA 4WKCA 4LZOA 3SS8A 1K4KA 1HFEL 2VT3A 3IO3A 2NV0A 4KWTA 2I6FA 5CXUA 2JA2A 3OZGA 3EWNA 5AOVA 1K8QA 3FPJA 1SKYB 5K0LA 1ISIA 1I9CA 4N3BA 4BRZA 4KLCA 2QL6A 5D85A 1KIFA 7REQB 1U7DA 2WJVA 3LHDA 1B6TA 4MZDA 4E2XA 4F4IA 2BZ1A 4D4KA 1KEKA 4TT3D 3VBEA 5JAUA 4C7VA 1P1IA 2ERCA 5EZYA 3EQ6A 5JH7F 1BH2A 4J0HA 3BGDA 3R7WB 1W30A 4D02A 2V6JA 2Z2XA 3GFQA 3L49A 2B8NA 3KJFA 3MCAA 2IZOA 4S1OA 3Q8MA 3U7FB 4H6WA 4OATA 1T6NA 4K8RB 2CXQA 4U9UA 4GOKA 2O1XA 4ZHQB 4XUEA 5I4CA 2XUGA 1LI4A 2A9QA 1E1RA 3RHFA 3KIPA 3KXPA 4XB1A 4RJIA 3TKLA 5BWBA 4C5CA 5HQTA 1JEYA 1YE8A 3KO8A 1BN6A 2GN0A 1QGED 1CYDA 3OFVA 5KEIA 2DKNA 3BOSA 4Z3KA 2B98A 4RCYA 1FA9A 4YA6A 3G2PA 4YI5A 3EVCA 3FUTA 4YRNA 4D8VA 5KO2A 2IHJA 2HF7A 4C2AA 2P8JA 3LS2A 1JX6A 4YDHB 5T3UA 1SURA 4ZREA 4MGIR 4G1EB 1U0LA 2JLQA 1SCQA 2FWAA 2Q8NA 3KVOA 3ZC3A 2FZ5A 3F98A 2P2GA 2OXEA 3PIDA 3E8SA 3HJCA 3QUQA 4P4LA 4U3JA 3F0TA 4MWDA 5JNTA 4QRIA 1E6WA 1OBFO 1PYOA 1JDTA 2AD5A 3HCNA 1EHIA 1G8MA 5BXQC 2IEAA 1WCXA 4HCJA 2GWHA 4GYYA 2DFVA 3PGMA 4OYRA 3T1YB 2Q1YA 3N05A 4FOPA 1DB3A 4EI8A 3WA7A 4URWR 1WCV1 4N49A 4I2NA 1JR3E 1RP7A 1ZN9A 3TB4A 1K7XB 3JQ8A 3GX1A 3QVKA 3S2GA 2PS9A 4J43A 1E6MA 1I4TD 3CLUD 1AVTA 2G3YA 4FINA 1IMJA 1UWLA 1XQ9A 3BGSA 3H1FA 4P38A 3K2QA 3IHWA 5DTIA 4RVUA 1J8QA 3RVBA 1EQAA 2B2NA 2I4MA 3E9EA 3LC7O 4GW3A 2R87A 2PGNA 4V2IA 4C7JA 4NZ9A 3BHIA 1NU6A 5HR5A 5DPMA 1CZKA 2PIDA 2CB9A 4EB3A 2DQKA 3ETJA 4AJNA 5JYCA 2HIHA 3CH6A 1XA4A 2V6MA 1G8HA 1NYLA 1YUNA 3FMFA 4JIGA 1VDMA 2ROQA 3LVRE 1UADA 4GRAA 1BJTA 2W71A 3OTIA 4AFNA 5I9NA 1PG2A 3PIIA 4ZHSA 2D0DA 4D4HA 5L7TA 1QZTA 3HU1A 3CIOA 3IODA 3OZBA 3QELA 1IOLA 1P0QA 5DSZA 2NV2B 3LVQE 3HBMA 3LBIA 2GTHA 1HV8A 5JLJA 1GYQA 3QVJA 1R9GA 2HY7A 2QRQA 3DHWC 3ORQA 1BHO1 1Z8FA 4UHHA 4RPCA 3ZJVA 3CRW1 4PRLA 4Q1CA 4WZBE 4JI4B 5TVKA 2G1AA 2BHTA 3FVVA 1FSGA 2P91A 1UBUS 3A06A 3EEIA 3F8TA 4MNTA 4R69A 2CY0A 1M0SA 2YOGA 5H80A 5MFPA 1EI9A 2IPNA 2CFTA 1XJCA 3MINA 1YBHA 1Y7PA 4ZFNA 4JJEA 5FO1A 1KDPA 1Y1TA 3KQKA 3MMPA 4BLSA 1DJQA 4Q05A 3B1VA 4YPVA 1NNUA 3LKZA 3QUBA 2G9ZA 2PU7A 3FWZA 3HKEA 4CV1A 1T2NA 4YCBA 2J5QA 2HSZA 4CG1A 3IMFA 4F11A 2AZXA 1KXJA 4OIMA 5AKLA 2QF7A 1PT9A 3RUHA 4R1QA 4X1IA 1NDUA 4HUQA 5FUYA 3C6QA 5K3FA 4QPNA 3UQYS 3GPBA 3PQDA 4OBEA 2ZRLA 4F45A 1ZVVA 3GFSA 1ZGAA 1M6YA 2SNIE 1OI7A 1YU6A 1Y8RB 2QM8A 4HWRA 1XQ6A 1YL7A 2AEEA 4AJKA 3HBJA 1I7PA 1SGWA 2PEYA 2XH8A 4YX9A 4LFBB 3W5SA 1WVMA 5BOSB 4X1OA 1QB8A 1QG4A 4G4SO 1SG0A 2CLSA 5CK4A 5TMEA 3S5JA 3TYXA 4ZV4A 4MWEA 2R7NA 4C76A 2G1UA 2BPOA 1OAKA 2IXFA 1ZHOA 1DWQA 1IJEA 5EL0A 2O19A 3KHTA 2WFLB 2ZIEA 4K9RA 5SZIA 4BJ1A 4DBLE 7MHTA 3OJ0A 1D6JA 2XVMA 4LHVA 3UCEA 2Z4RA 1KFJB 3RUFA 3TTTA 5ERYA 3C70A 3ZEAA 1NXXA 3TINA 3W6PA 3LT4A 1FFEA 2GZDA 5AO9A 4CQLA 4IVRA 5D8DA 3H8JA 5KNDH 1T3ZA 4QECA 3H0EA 3QOXA 1O8CA 2P3OA 1X80A 1E2MA 1ZMXA 1H3FA 5JCOA 1ULUA 4DSOA 4UPEA 4WFQA 2OV4A 1YTUA 5ICCA 3NBZC 5LKAA 1BN7A 1SPBS 3FZNA 3O94A 3GVXA 3PB3A 1VPWA 4YRDA 3QF4A 1RAGA 2IGTA 4A0SA 3NOOA 2ZI6A 1PX2A 3QE9Y 2ZWAA 3CZQA 1Z7GA 2H4HA 4HT3B 5EVJA 5REQA 2CJPA 3EZNA 1C3LA 5G3YA 1B7GO 3INYA 5CVDA 3UANA 3ZWVA 1IEWA 1N8KA 2O52A 1WEKA 2VHZA 4Y6LA 2PGXA 4EI2A 3MGKA 1N2CA 2ZYVX 3SVTA 3OZIA 4QX6A 4J6EA 3UMYA 1NBHA 1Q2UA 1KMHA 4WA7A 1DKPA 4NBWA 2ZIWB 2VPTA 1YHNA 4FU0A 3PXDA 4G0MA 5CVJA 4Z6KA 1I32A 5C5IA 3M5DA 3VDMA 3HP4A 3T3EA 4NU5A 4HNGA 4WJZA 2DWQA 3ZOKA 1WMSA 2VDKB 5BSGA 4DR2B 1D1TA 3CGGA 3H11A 1I5RA 3FF4A 3C5CA 4HN9A 4QQFA 5ADVA 1YHYA 4X66B 2A1TS 1GA6A 1DUSA 4FOSA 3AFMA 4BO0A 4WECA 5JTTA 2I2CA 3LO8A 4IQ0A 3RASA 4CBVA 1HTWA 3QBEA 4Q9JA 1PTKA 5FWYA 1OROA 1UK6A 1RWOA 1VFPA 2I67A 3HU5A 4EHAA 1QDEA 1L5WA 1GPLA 3DZDA 4IYRA 1DSSG 1RZUA 2D2IA 3VM6A 5C81A 1P2VA 4R2LA 2HMSA 3WQHA 4QAJA 4LWOA 3GEMA 4LJRA 3K4PA 1J0EA 2J0EA 5GADl 1ESNA 2IYZA 3CEJA 3EVTA 5BP7A 1I3NA 2K2QB 2P9BA 2QXTA 3QU7A 4UCFA 2DU8A 5I51A 1JEEA 1MF7A 3MSCA 4PR3A 3OT1B 2V97A 1A8IA 4JUFA 1V37A 2FW0A 3OCVA 1D2AA 4AS3A 2J4DA 5EE0A 3L0OA 2BFBA 5HUHA 1YGYA 4GM1A 3TLEA 5IU6A 5EYPB 3FB4A 1QTQA 3INTA 1UIMA 5DISB 2IYEA 2DFPA 3A6GA 1I4OA 4L8WB 4OF4A 3GDOA 4MI9A 4CFSA 4RJ2A 4X8OA 1OLSB 3WNCA 1K8RA 4R83A 4TL7A 4PYQA 1ZCFA 4BV3A 4RAOA 5LUAA 2ECKA 3M1LA 4LOJA 5FBLB 1COWA 1T3HA 2I71A 3EVEA 4U1RA 5P21A 5JYBA 3OTOB 3VBCA 3C6YA 4OQEA 3D8NA 2VYVD 3FTNA 1O6ZA 2D00A 3KEOA 5E3IA 1KVTA 1Z29A 3QBVA 3DQPA 4H31A 3VR5H 5B57C 1P4AA 2A9RA 5C34B 1SB8A 1YL5A 1IOVA 3DFZA 3OJCA 3T4XA 3FTEA 1NJ5A 3A1VA 3DHVA 3DL4A 4ILEA 1L7EA 1VCHA 4U2CA 1C8BA 1E89A 3OEED 3IS3A 4D42A 1UDBA 3BD8A 5H3LA 3H0CA 4MDYA 3KYJB 3DEHA 3QWHA 3FPAA 1SUDA 3ZW9A 4BL5A 4RDXA 1XAGA 2PFGA 2DKFA 3A4MA 3IT0A 4AP9A 2R9VA 2L2QA 3NUZA 3T7CA 3WLTA 4YV7A 2QW1A 2SKDA 2W6IA 4ARZB 4IP0A 3GEGA 1DQZA 4ENVA 2A14A 2NM0A 3ZTYA 5LQRA 4J1NA 4YAUA 1O4VA 3DMRA 3F46A 4IIUA 1WWKA 2UXDB 3VNSA 3EJ6A 2GXAA 4FB4A 3UHFA 1PZMA 5D2CA 2D8AA 3LUBA 2J8ZA 3PDIA 2YXLA 4JFAA 3T5MA 4N12A 4C6SA 2Y1WA 3IXMA 4RSGA 2R8RA 4U2BA 5HS4A 1Q44A 1AKWA 1ZUIA 5CH3A 1KJ9A 2HKIA 3S29A 4JGIA 3F2VA 4O4IB 2UUAB 2HWXA 4FX5A 2KB0A 3PD1A 2PRIA 1GG2A 2YJZA 4Y0AA 4UU7A 3B3GA 1RWNA 1NM5C 2DR3A 2JDIA 3MPOA 2YW2A 3CH7A 4URHA 4GL2A 5I6DA 2X9GA 1GZUA 3OM1A 4KX5A 3L0DA 3CVVA 4CM8A 2A6PA 4PS1A 5EMKA 5HM6A 2FFAA 2PZJA 3TE6A 2PMEA 3W6UA 4O0LA 3L6UA 5F3DA 4IDNA 3L3BA 1JSRA 2J5KA 4QUEA 4B3RB 4C4TA 4C03A 2C7QA 1NBEA 3CVUA 4K9LA 1C9DB 1H2AS 1HMYA 4HMOA 4M8NE 1KYWA 1PHPA 1Z3CA 1XLWA 3UOGA 2DLDA 3RVDA 2DWPA 4MS1A 2I9PA 3NFYA 1EXMA 5K7SA 3U7GA 5CHEA 1YO6A 4R8SA 1YZGA 2M9MA 3EXEB 4ZEVA 1WMDA 2PG3A 4XZ3A 1REQB 4ZAWA 1DAPA 4LY3A 5HJEA 4KTTE 4JNCA 3WK9A 1FP4B 5TSDA 1PI3A 3GJRA 4NH0A 3DBRB 4Y2RA 3CVXA 1CEXA 2B9VA 2F1KA 1SVWA 4Z53A 3TVDA 1VKOA 3K1JA 1CLEA 4Q9LA 2ZIZA 4PRZA 1XT6A 3TD2A 1V1RA 5EGNA 1EFAA 1EX9A 2LKCA 4G9GA 3DBOB 3RR2A 1MH9A 3WSTA 2JFPA 1VMDA 3I42A 4U7HA 3R0QA 3Q3CA 2VTBA 4NBUA 1JJ7A 4XWWA 1V3VA 1P73A 1WW8A 4ND8A 3GRPA 4CRWB 2Z5VA 3W04A 2HHJA 2VJBA 4K6CA 1CQIB 1GUFA 4AXBA 4NI5A 1WZEA 1BW9B 2ZRHA 5JJCA 2CV0A 2DEUA 2W8BA 1TAGA 2I4LA 3I23A 1FNDA 3QVLA 3ZDDA 3NYQA 1GTMA 4NFHA 1CK4A 4AJ2A 2C5FA 2N9UA 1JDSA 3BCUA 1IOZA 3FDXA 3N87A 4G6ZA 4NXNB 2JBAA 4WPGA 3WLSA 3H5LA 2IBSA 5BR8B 1VPTA 5CFMA 3VPBA 4U7FA 1TKAA 4I4TB 1MA3A 4RXMA 1F6WA 1T4BA 5KYVA 4AIRA 3CPSA 3RLIA 1K2VN 4KDFA 5DN6A 5H5JA 4W6ZA 3B5IA 4OPMA 4V0KA 5IHXA 3ZNQA 8OHMA 1NBME 1R5OA 3B6ZA 2H06A 1GQRA 2EQAA 2WIBA 3I58A 2J3JA 4KQ1A 1T8PA 5GZ6A 4B71A 3T38A 2GA9A 1QQ6A 2PKXA 4UVIA 5FUBA 1EYZA 2QYSA 1DJMA 2WU3A 4V1CA 3ACDA 2FZKA 1U9IC 3P2JA 3ISTA 3TPCA 3NH9A 3U3MA 5A5DA 2QMHA 4LZJA 1L5NA 3DEKA 3RTGA 2WJPA 3W1VA 1G8SA 4CLXA 3USCS 4F3RA 2CWWA 3RYCA 3LFHA 5CNMA 1P9LA 4YRQA 1CR6A 2ZJYA 4QICA 1E2HA 4L8FA 1XU4A 2FMKA 1AZTA 3ZQ4A 3SY8A 5BW6B 1DKOA 1GKIA 3TBFA 2JAQA 3QWIA 3W5AA 2FUG6 1MRSA 3MIZA 2PN1A 2WU1A 1WABA 1QPGA 2BGNA 7AT1A 1WDMA 1MIOB 3V32A 3GRKA 1EP2B 3WISA 2JGRA 3G02A 1QCZA 3DP7A 3KVYA 3LX6A 5DW0A 3EODA 5TC4A 1K7SN 4JGGA 4D41A 5BUSA 3KUUA 4EJ0A 2HQBA 4OLBA 3IDAA 2ZUWA 3VA7A 1C9JA 1U3GA 1GSOA 1MBZA 4LW8A 4FMDF 3C1UA 4S2UA 4UCQA 3BGVA 5F4BA 3V9AA 1NXVA 4Q4AB 1N4AA 2CXSA 4WHMA 1MX5A 1FSPA 4IMPA 4GXNA 1E2KA 1DWUA 4RENA 1TD1A 3L8DA 3REQB 1ULSA 1C4KA 1HG1A 3KYDA 3BB1A 1JPNA 5G41A 3ZWQA 1VLJA 3PITA 4LSMA 1PW5A 3Q0IA 4Q3NA 2AT1A 4Q1VA 3GRRA 3T1HB 2FQXA 2WOOA 4GMXA 2OZEA 3DB1A 4TWJA 3RS0A 3GOHA 3SZRA 1A04A 3M1AA 4ER5A 2ZVQX 3NO4A 5JFTA 3D7NA 1GQYA 3Q41A 2VXYA 5DYGA 1KP2A 3WGJA 1E9FA 2P35A 4XDHA 5T4HA 1VB5A 3BBPA 4NSNA 1GA1A 2JGIA 4UULA 4BS9A 1H9BA 2G0AA 3FNEA 3N0TA 4JLAA 2CXPA 2G5PA 3SNKA 4A8JC 4BX3A 4F38A 4L08A 4LY0A 1E0SA 3OX2A 4OHWA 4MLCA 3VSBA 2IE0A 2YV2A 4CIBA 1U7HA 1IHXA 4J7UA 2G5TA 2EU8A 3ILVA 1LDGA 4II2A 1PQPA 4HVTA 5B2ZA 3A2KA 1ESCA 3DL0A 1EB8A 2A5LA 3HU3A 2D1TA 4A92A 3FNIA 1HE2A 2VYCA 1JLKA 1EFTA 4B74A 5C80A 3MG9A 1EZ1A 3NP9A 5FT9A 3QSGA 4HAUA 1NQAO 2NACA 3LY5A 2BEKA 3AO0B 5G1OA 1Y8CA 1JKFA 2PJDA 5CCDA 2ZXEA 4R40A 4YCDA 5DT2A 4RESA 5FL3A 3PPWA 1DJPA 1FE8A 1VHQA 5KCMA 1T25A 3EGEA 3V4VB 2IUSA 4MIKA 4ZU3A 1OC4A 2JCXA 1TIBA 3H9CA 4HWKA 4OVKA 5L95A 1T5TA 4D80A 2O9JA 4B7ZA 3CUSA 3BWXA 4IDGA 1HSOA 3TXAA 1AKQA 3MQ2A 4X64B 1GZHB 1AB6A 4UUNA 2POCA 1WUKS 1ZVJA 5E3JA 4BEWA 4GVLA 4YAIA 3HA2A 1A9XB 1KEEB 4JLJA 3A70A 3DOIA 4RTQA 3AR6A 1R4NB 1TO2E 4ZYZA 4IWXA 4N7MA 2BJHA 2QN7A 1FLNA 3Q8KA 1QRTA 2H2AA 2V6IA 2YASA 4PXYA 1EZZA 4PYMA 1GZSA 1CUUA 3AVTA 3C8UA 3Q8LA 4Q6WA 1C7JA 2O5EA 1YQUA 1PQYA 4Q5IA 1V35A 3U1VA 2HMUA 1BMTA 1Z4QA 3D5EA 1NZDA 3NNNA 3O1IC 3OCCA 5ENDA 4BVJA 3WHLA 3EISA 4UTZA 5E7IA 1YFLA 2UUPA 3KEFA 3LOQA 1JG3A 2VRCA 4HUTA 1I6LA 5JBQA 3K6SB 5H68A 3IAUA 1KEWA 3DEIA 2HA4A 3C5WP 3G9ZA 1FSZA 1LKZA 2ZSJA 2RGNA 4D9KA 2QN8A 3TCXB 1M0TA 1AO3A 4YYEA 4Z5XA 2R1UA 3DOCA 4P0PB 4DV7B 2BKLA 4DJJA 5GOZA 4MVJF 1KEZA 1NP3A 3QXSA 1V6AA 4RY0A 3W8RA 4GBMA 5ANRB 3MCTA 1WPXA 2IHBA 1O89A 3KT0A 3DEZA 3NI2A 1G1AA 5CBKA 2YBDA 1QIGA 4C0AC 3RC8A 2GLXA 5CNJA 1PDOA 3HXPA 3KYCB 4RQBA 4I55F 1B43A 3GJSA 4TXNA 5EJ9A 1UZUA 2GYVA 1W19A 2Y2VA 1P1BA 4IKEA 3EDMA 1R6AA 1SUAA 5LDHA 2ZRJA 1M83A 5FTNA 4EBFA 2ZYIA 4NU0A 4OU5A 2Y1OA 4REQA 5FWXA 5JXIA 1AXGA 3KQQA 1MQ8B 2O2JA 2XDAA 2I1QA 1UXGA 2ATEA 1KI8A 3H19A 3HSYA 1JVNA 4YJGB 1HDIA 4QOJA 5IW8A 3K9NA 2PZLA 3QJYA 4V03A 4U7JA 3TUIC 4CHGA 4C3ZA 3IKMB 4MQEB 4NK5A 4M0FA 4OQXA 5E95A 4I1UA 3IT3A 2BCEA 3MW8A 4A1OA 2VPQA 5A6SA 3QVUA 3WWZA 4O1IA 4JLWA 1FSFA 4YN3A 4EGFA 3DOJA 2XXBA 4TLBA 3OOEA 4DY6A 5HM8A 4PZZA 5EWLB 4AMZA 1XTIA 3F6CA 4AZ3A 1QHIA 2QAGA 1K9SA 4I66A 3WO1A 2PYDA 1X1DA 5IN4A 4MW5A 1LVUA 1W85B 1KDRA 1JSCA 1UJ5A 3ZE9A 5B36A 4F6RB 1E3WA 4C4RA 3HVRA 3S44A 3OQ1A 4HDRA 4CIWA 2GYYA 4PPGA 3ES9A 3STTA 1YZYA 4CMIA 1E4EA 1X7WB 3AFOA 4IDBA 1FDSA 3KTAB 2ZRCA 4JLBA 1R0WA 3MJEA 3T7JA 2EJCA 2GZMA 1A4XA 1U8UA 2IS6A 1IK4A 4C06A 5JZMA 3BHNA 4J75A 1UBSB 1GLVA 4W5WA 5JMWA 1P2GA 4KCGA 1D8AA 5KHOC 1TADA 3MBKA 3OMWA 3TQIA 1KSFX 1M6VA 1G21E 5JAHA 1EIWA 3B6EA 1VG1A 3M6LA 1QXSA 3CLKA 2P0AA 3W5BA 1JQLB 1BE6A 1YR7A 4F9TA 1T6YA 1YZUA 2BKXA 2BR4A 1Q0SA 1X0VA 3EBLA 3VNBA 3TLKA 4B3CA 3M6AA 2O3TA 2ORVA 4B7UA 4UNRA 4J1SA 5AP9A 1TVKB 3V4RA 4J0DA 3SXUB 2HGSA 4DUGA 1K6IA 4IMRA 5KNBH 5I01A 2GN6A 1H2YA 1JIJA 4C3OB 5JDIA 2ZITA 3JCZA 3R6WA 3TEMA 3KSMA 3RKSA 1VG0B 3EEQA 1IIRA 1AHHA 4ETMA 1WNTA 1SD2A 2ZK7A 3CO5A 1ZQ1A 1RW4A 2D13A 5FHQA 1P0MA 2Z95A 3P9NA 3DLAA 2NQ2C 1BCSA 3AT1A 1Z6GA 2LW7A 1KP3A 4G5FA 4RFSA 3TSZA 1QTIA 3HJBA 5AM0A 4F8EA 4AY6A 1PR9A 4M8SA 2BMEA 5I48A 4XM0A 5JV5A 3EGCA 3KVVA 4HBZA 3N07A 2ZVPX 4K6MA 4ME6A 5DEIA 2OYCA 2AVDA 2VT7A 4NOKA 2HXSA 3B5EA 1GZ7A 1M6NA 3R3YA 1BVHA 3IQFA 4HB2A 2RH5A 5EMHA 4LQDA 4Q4JB 4B46A 3HV2A 5HX7A 1POWA 1SUEA 1T15A 3K8OE 3P9RA 3ZQUA 4RK1A 2MYTA 4PW0A 3ZNNA 2FSHA 4N39A 3VZPA 3PSHA 4BLRA 4CJXA 4KQJA 1QKJA 2O2DA 1G0OA 2XNDA 1KSHA 1EH5A 2ANCA 2RAFA 3LIPA 3M3HA 4V0MA 1SOWA 5AQEA 3CT4A 2Q9CA 1F4VA 1LPOA 4LVCA 5AK6A 5CB4A 5FUMA 5CBPA 2PBRA 4AWAA 1R6DA 4Q37A 3RBAA 2IEYA 1NI4A 1QYIA 3IB6A 1P5HA 3UJPA 3ULKA 1BXZA 3PLRA 2GJAA 1YDHA 1SA0B 2PQ0A 3EXHC 3KZ1E 4QJIA 1QE5A 3OD1A 4UZSA 5EUQB 5HOQA 3TQSA 1G3UA 1RKUA 1Y6JA 3MB8A 4PO9A 3SJCA 2V96A 4CN8A 4DMKA 1E9BA 5BUZA 5KOJA 1GXSB 5KYYB 2F43A 1Z83A 4U00A 4WKPA 4RPGA 1O3YA 3GMDA 1K98A 4KN9S 1P5FA 2NYVA 3D4PA 2QPTA 1ISGA 3SSMA 1UDXA 2M2IA 1U0OC 3TGWA 3H9EO 2VDMB 1KQFA 1DFIA 4P32A 1XHEA 3BSFA 4BFLA 4POOA 2H5EA 5E1OA 5JXJA 4KQFA 3EX7C 3AUSA 4CTNA 5JSFA 1QHNA 2VP9A 2JFZA 1GZVA 1OBHA 1PTJC 3ZCRA 1HPLA 1K4MA 2SCUB 2ZUCA 4A1FA 4NG5A 1IY8A 2G28A 1PVVA 3RF6A 4CKYA 3UAYA 5KTKA 3UPTA 5G4LA 1ZR4A 1Z63A 3QX3A 3E5HA 4JQOA 3DE4X 4J0JA 1NVAA 1DQPA 1T2FA 2DQZA 2POQX 2PEZA 4JJAA 4KMRA 1QHEA 3SHQA 3R40A 1CRLA 2VWGA 4TXMA 3NKLA 5LU9A 1XKTA 5ALGA 4IVPA 3WKAA 4ESHA 3PICA 1XVVA 2ICAA 3B85A 3M70A 1WY7A 4YMVA 1YNSA 1VL1A 2ZATA 2CUZA 4PF1A 5AOBA 2QPLA 1Q3TA 1HT0A 2W2QA 3BQ9A 1D04A 1YIDA 2HADA 2R44A 1KYQA 3D2BA 1U0FA 4K81B 2PAAA 4PHHA 2NXJA 2R4TA 3NM6B 3ZHRA 4BZPA 5ENZA 2I8AA 4CT4B 4GNKA 1K8ZB 2XYVA 4K3VA 2DSNA 3T1OA 5CDYA 1MORA 1NBWB 4LX0A 4M9RA 4OHKA 4PO3X 3GJYA 2C07A 4AG3A 2J5XA 4ZRMA 1W1IA 4JB8A 4B4VA 4PNPA 3H5WA 2J7PA 3BXGA 3F6RA 4U5XA 4D8YA 4HV4A 3IHTA 1R8YA 3OIUA 2QM3A 2PMCA 5AW0A 1M1NB 4RK7A 1P29A 3FIUA 5DNDA 3WRYC 4YJHB 3VPAA 4YUXA 1ZWKA 2QTVA 4DBVO 1A8PA 1QR2A 1K27A 1Z2PX 2XCQA 3NATA 3R77A 4Q3EA 4U7GA 3CSUA 2NXCA 3GT4A 1BIFA 3OT4A 4W63A 2JIRA 4ARVA 1K5HA 2DBZA 1XEAA 2I22A 4UUAA 4ZYXA 5CFPA 4PSKA 2XMPA 1VIDA 2D1SA 1CEQA 3UYKA 5JECA 2VPPA 1V3QE 2PMWB 4G86A 2C9DA 5EWJA 3IBCA 1AN9A 4OP1A 1U28A 1EFRA 1RRGA 3B2QA 1NLFA 3V7UA 1ID1A 5KVQA 3WWPA 1J42A 5CH5A 1R37A 5KIAA 1C7IA 4BLTA 1FNNA 1WXIA