1GRWA

C. elegans major sperm protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR SPERM PROTEIN 31/40/142
publication title 2.6 A Resolution Crystal Structure of Helices of the Motile Major Sperm Protein (Msp) of Caenorhabditis Elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cytosketal protein
total genus 26
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1grwA00
2RCSH 5IHUH 2ATPA 3MFFA 1QTYT 2YMXL 1EFXA 4XAKD 5HY9B 1MAML 4R2GB 3UZVB 1JRHH 1R3IL 1RURH 3WFHB 4QY8B 1E4WL 2VLLA 3HAEG 4MSWB 4NNPL 4Y4KA 3ZKMD 4JPIA 3T0ED 1P5VA 3EYVA 3TT3L 2PR4H 5DJ6A 4L3CB 1O7SA 4B0MM 1Z5LB 5I19L 1JGUH 4OGZA 1A0QH 5EORL 4MWFA 3TH4T 1ORQB 3EYQD 1AXIB 4X99A 3PABB 5HHPB 3IDIB 3SE4A 2PO6A 2VDNL 4OGAD 3TA3C 3GKWH 2VUOA 3ZSTA 5I1GH 1N3NB 1ZGLM 1UKQA 2VDRL 1Q0YH 3HG1B 2F53A 4EDWL 4NQDA 3IXTB 2FBOJ 4V1DB 4WY7L 2I9LA 4G42A 5IHBA 3OJDA 1ED3B 2R0KH 4U6HA 1XGTA 3FKUS 3SDCD 2GJJA 2OK0L 4P4RB 1GIGL 3CVHB 4RIRA 5EU5B 4YDVB 1R24B 2A1WH 3PJSB 2FIKB 4MHHI 1JPGA 4TSCL 2E7HA 4OB5L 3FFCA 4Y1AE 1F45A 3OF6A 3GB7B 3IDMA 3SN6N 3EJYD 1DE4A 5D7JB 1KN2H 1XCTA 3CFKB 3HE7C 5HHOD 3EHBD 5GS1B 4N9GB 3S9DB 1FO0H 4IRSB 3TIDA 3O4LB 3O6KH 4WW2F 4XCEA 3X11B 4LSSL 1K4DA 3FO9B 3P11H 1B4JL 1T0MA 1GRWA 3KVQA 3QEQE 1QOKA 4Z77B 5T3XL 4TUJB 1FLTX 4PPTA 1G9MH 4LPUA 3G6JE 3T0BA 4UDUA 4R0LC 1T04B 4ZOBA 1HK6A 1U3YA 3D1MC 5CEYB 2EH8L 5CP7B 1B9ZA 3I6LE 3AGVA 2RR3A 1M7DA 3N1MC 3QO0B 4YHPA 5EZLB 3VW3L 2JJSC 3OKOB 1ZHKB 3MGTA 1ZS8A 4XXCC 1M71A 3G5XA 3I75A 1X5JA 5IEHB 3UJIL 4ZDHA 4OD1L 1MJ8L 3WNPA 3VI3F 3CXHK 4KXZH 1H5BC 3VD5A 1NAMB 2EDRA 5EOCH 3RWIA 3B9AA 4YGVA 3V6OC 3LAFA 4FTVE 3GSRA 1MFBL 2CRIA 3BN9C 2W0KA 1NANI 5SWSB 1DBKH 1IKFH 2WAHA 4A6YL 3OB8A 3B2VH 3CCHA 4L8BA 2ZWLT 4X6CE 1JNNH 3U1SH 3LS4L 3C8KA 2G75A 3GEWB 3ULUH 5FECA 3FQRB 1R3JA 5D6DA 15C8H 1IM9D 1ZSDB 1DLHA 1PX3A 3QHFL 4DN4H 1SYVA 2VITA 5DD0H 4ZSOB 4Y5XB 1YMMA 4PJGB 3N1PC 3PWNB 4M6ML 1J1PH 4OCWH 5DK2B 5T1KB 4MNGE 5DUPL 1YC8A 1FCGA 3MXWL 3T4AA 4RMTA 3QCUL 5D6CA 4O2FB 3FT2B 5ESAA 4LF3B 5JIIA 2IAMD 3VXNA 4DKAA 5CD5D 4YAQB 4XP4H 3O4OC 3W5MA 1OTSC 5CILL 4DCQB 2BXYA 1X5LA 3DIFA 2NW3B 2JJVA 4NJ9L 2R0LH 2ARJQ 5ERWB 5B38G 4M7LH 2HYMA 2GFBB 5CGYC 4UT7L 3DLQR 5ADOL 3HZYA 5JW5B 1EAJA 5AZ2L 2XNAA 4DTGL 5AG9A 1IC5H 2R1WB 4LVOC 3S5LA 2R0WL 5AG8A 2UWEF 3DUUB 4S0TD 5K9KA 2AXFB 4UZGA 3DVIA 2DKUA 4MNQB 2F54A 1LDPL 4ZAKD 4Y1AA 2EIEA 4QRUA 1RZFH 2VQ1A 4U1KA 5D5MA 2CGRH 1RUQL 2FATL 4RMVA 4S2SA 2VDOH 4NKOB 1CDBA 2AJYH 3QUXD 3UPRB 4ELKB 3DXAA 2HJKA 5KVDH 5I15H 2R29H 3D3VE 1NC2D 2IBZY 1QQDA 1ONQB 5A40E 3UAJD 2QHLA 3FB5A 4JQXA 4GKOA 3TIEB 4N68A 4KHXH 2PXYB 3L5IA 5ILTL 1I1AC 3O2VH 3L9RB 1A4KB 4M8QA 3G6JA 1DQQA 4JDTL 4YBHA 3MR9B 3IKKA 4JFXA 4LIQE 5F7DA 4N90D 3P9LA 1N0XH 1S9VB 1MSPA 3LEXA 3ROLB 4PJ8C 1TITA 1L7IL 3C6LB 2NW2A 4NKIL 5ENWB 1G7QB 3W9EB 3Q6GL 5D2LF 4PRPD 3SOBL 2JK5B 5H35B 4JN1H 5GGTA 3V52L 4GG6F 2D03H 3RVXC 4FTVA 1K4CA 4LGSB 1QLRB 4BH7B 2F5BL 3CFJA 3Q48A 3BUTA 3L5HA 3GSUB 1GGBL 4XI5C 5C0DA 4AZ8A 1MCJA 4PV9A 3I50L 1TQCB 3O2WL 1YMHB 1IKNC 5MP6H 3N1FC 1P2CB 4PREB 3ZHDA 2BRRH 4NPYB 1MVFA 4U1GB 4UIKL 3H8NA 4PJ9B 3M8OH 4H8WC 4FXLA 4J6RL 2Q86B 4HIHA 3EOTH 4L9LC 1AKJA 1QLEL 2GUOA 2OP4H 3H3KA 4MNGA 3LZFH 5IMOB 2AJZA 2FX9H 4Y2DD 1T83C 3WDHA 5DLML 3DSFL 4YHLL 1MI5E 2CJUL 3ILQC 5C92A 2WZPD 5ICYA 1YECH 2IBZX 3O3AA 1NCAL 1V3JA 1DN0B 3L3JA 1IC4H 4OCRL 2FIRT 4JFED 4BQCA 2H32A 2Y07H 3K80A 4XPBH 5TE7L 3PQYA 3DUSA 1FGNH 1PDKA 1U3HB 4KVNH 4HMEA 3ZKXB 1I7TA 2YBRA 3QWQB 1IQDA 1DEEB 4U3XA 3L6FA 4QHNB 3RPIA 3MV9A 4WV1B 4OI8A 3ARGA 3EO1A 4CVWA 3MRBA 4JZJA 1KIRB 4YXLL 1EEUA 4UU9A 4I48B 1ADQH 3CZFA 3PWVB 3WIHH 5JHDB 2AJUL 4X4ZA 3RNKB 5EPMA 3NIGE 4KTEL 4N1CA 4YDLC 4RAUB 4P46D 5C0FB 1NEZG 3T2PA 2CK0L 1HNGA 3B8YA 4G8EA 4BFBD 4PLKC 5SWSE 5T3ZD 5HY9A 4HIXL 5FM8A 5C07B 3WFHA 2I26N 4K9EH 2MPAH 5IBLD 4MSWA 2OJZH 4JY5L 2V9TA 3TP4A 4JVPA 3FB8A 3QI9B 2F5AH 5TQ0H 4L3CA 3IVKB 5JDSB 1Z5LA 1G6RL 4OZFH 4OQTL 3AREC 3B9KB 1ORQA 5A2JH 2GYSA 3FZUC 3PABA 5IQ7H 3RKDC 5HHPA 3N50A 3IDIA 4KK5C 4O51B 1OAZL 2J4WL 2OTPA 2VWEE 3RIAF 2NY0B 2BHYA 1N3NA 3F65A 3WFBL 4POYA 3MNVA 3HG1A 5CEZL 35C8H 3IXTA 4LAQH 4V1DA 1Z2KA 1ED3A 3RKPA 1RK1B 1J8KA 5HDBE 5HI3C 2BVEA 4E5XB 5AEAA 4P4RA 2B7DT 2X41A 3CVHA 5EU5A 2AEWA 4YDVA 5DGRA 1XIWD 3T0EE 1R24A 3B83A 2CH8A 2NY7L 4HXAL 2FL5B 1LEKB 2FIKA 4LCWD 4YH6A 2I27N 3QQ3B 5LGKA 5HVHC 3X14B 4JCMA 4R97B 1A6VL 2VO5A 5D7JA 4EN3C 3CFKA 5D2NC 5GS1A 4N9GA 2HWZH 3GRWL 4O00A 4P3CH 4IRSA 6FABH 3E8UL 4QNPE 3MLRH 1FG9C 2Y23A 2HVKB 3O4LA 1X5HA 3X11A 2CUIA 2GKIA 5L88L 1TJHH 3FO9A 5DVMA 5ADPL 1MF2L 3O6LH 4JJ5A 2R23B 4Z77A 4LHUD 2EZ0C 1CD9B 4TUJA 4ZODA 4AL8L 3NIDE 5F21B 4XVJH 4PY8J 3QISA 1I9JH 4WEBL 1T04A 5ACMA 1ES0B 3BT2L 3B2UC 4DJMA 5CP7A 1BAFH 4CNIB 1INDH 3QO0A 3OR7B 3HMWH 5EZLA 2YUXA 3OKOA 5AZEH 1ZHKA 3E3QE 3VFRB 5EU6B 4FA8A 5JXEA 3RVUD 5MI0C 1FZMB 5CJ5A 5IEHA 5HHOE 4KROC 5FB8B 3JVGA 1HZHL 1BJ1J 2QJDA 3BHBB 1IJ9A 4QXWA 1RPQA 3T2NH 2X05A 5D70L 1NAMA 1VCAA 4OF8A 4OTXL 5GGRB 4IS6B 5M95B 4JREC 2FSEB 1BOYA 5C0RL 1Z3GH 4ZTOL 2CKNA 3CZJA 5SWSA 4YHKH 2O5YL 1EXUB 3WIFA 4N8VA 3EZJB 4NN5C 5JLZA 5M7QA 2CRYA 3FQRA 3DROB 4K3EH 2SEBA 1ZSDA 2HFGL 5E9DB 1I1CA 1IBGL 4ZSOA 4GRLC 4Y5XA 4RA0C 4M8VA 3MBEC 4X6CF 4XCCL 5CINH 5DK2A 1MJ7H 1JZ7A 5D93B 4X98B 4KY1L 5ACZB 3IDXH 1DZBA 5DFVC 4O2FA 3FT2A 4LF3A 3QPXH 4KQ3H 5DHVB 3HE6D 4X83A 1WEJH 2XXCB 4YAQA 3LH2H 5JO5B 1NMAH 2XIDA 4QRTB 2NW3A 3ILPB 5ERWA 4X4MA 2GFBA 4TUKL 3F7PC 1EH9A 3V7MA 5JW5A 1L0QA 2K7PA 2LQRA 3MRNB 5HHVL 2R1WA 4OIIL 4ODVL 4WJ5B 3DUUA 5GJTH 2AXFA 1FYTD 2D3VA 1ZLSH 1YEDB 4MNQA 2EE2A 2DLEA 1L9MA 4JRXD 4UDTB 3MUY1 4PJCE 1O7VA 5F1NA 3PG2A 2EDXA 1AXSA 4NKOA 1YZZA 2JJUA 3UDWC 2UZXB 4KJPD 2Q87A 1P7HL 3UPRA 4KU1A 4ELKA 2CRZA 4XP6H 3SGKC 4LSTH 1TQBB 5LGHH 1ONQA 2VSDA 1NUGA 4JFDB 1TETL 1F6LL 1H8OA 1FFNB 1LILA 3S96B 2PXYA 3MBXL 5FGCE 3D5OF 4X7DC 4IRJC 1JZ8A 3L9RA 4X7FC 3VRLF 4YDIL 2LFGA 4QGTA 2X89A 4YHOH 3MR9A 1XF4A 2P5WD 3B5HA 3REWB 1S9VA 3ROLA 2LABA 5FDWB 2ITCA 3SE9H 2WLYA 3C6LA 3WLBB 3NN8B 5AWNH 5ENWA 3LB6C 1KPRB 2XTJB 5IWLC 1G7QA 4PTTB 2CDEB 3JXAA 2JK5A 5H35A 4NZJA 3MRQB 4P0DA 2RCSL 5IHUL 3BEWB 2VZOA 4JKMA 1DQLH 1QLRA 2XZQH 1Q38A 3QYCA 1II4E 3O3DB 3WLWD 4BH7A 2YWZA 4MZ2A 1JRHL 1RURL 1MRDL 1MCNA 1AY1H 3DPBA 3GSUA 5CCKH 4N90E 1LGVA 4AY0A 3S34H 4PJEF 1EHAA 1YMHA 3HC3H 1I8LA 3F6IA 4AIZB 1IFHL 2PR4L 1P2CA 4NPYA 5DRWB 1JGUL 1X5GA 4XH2B 4PJ9A 4P5TB 4HJJL 3TBTB 4XXDB 4PRPE 1OP5K 2Q86A 3S35X 2K9UA 2UZIH 2XTLA 4ZXBC 3WKNA 5IHLB 4PR5B 1PBYA 1MCHA 2AXGB 2YD8A 4J3SA 5IMOA 3LQZB 5I1GL 4ONFH 5L6YH 4PS4H 1Q0YL 2C3GA 1JJUA 4HD9A 1X44A 1DN0A 2NY1B 3IRPX 4XP5H 2R0KL 4I5BB 2EYSA 4XB7A 2DQFB 5I8EB 1UM6H 5DMJB 2YS4A 3ARDD 3ZMRA 1F2XK 2A1WL 3V79C 1UZ6F 1U3HA 4MAYB 4WW1B 1Z9MA 3HKFA 1DEEA 3G08B 3IJHB 3IFLH 4QHNA 4OSUL 4WV1A 5IB5B 3NCCB 5L8JB 2XPGB 1KN2L 5D7KE 3GMNA 1KIRA 5EU6E 4I48A 1FO0L 2WBJD 3O6KL 3BZEB 3PWVA 5JHDA 1D3CA 4P9HH 2AQ2A 3RNKA 5KS9E 3P11L 4FQXC 3RGVB 4G6JL 1AE6H 1A47A 4DKDC 1NCNA 2D2OA 4UINH 4I4WB 4RAUA 1W2KT 5DDHB 5C0FA 5GGRY 5J1TC 1G9ML 3MRIB 1FNEA 4I18C 2CUHA 3ARBC 2FEEI 4M4RA 4KRPD 1GPOH 4F37K 2VH5H 1Y6NR 2BFVH 3UTTD 1S7RB 1QRND 2F58H 1MRFH 1D5IH 1KCUH 4JJHA 1WIOA 3O41B 5DI8B 2EEDA 3RVWC 4I3SH 1HHJB 3QI9A 3G5ZB 5IFJB 5E08H 3IVKA 5DEGB 1AGBB 5SX4H 5JZ7C 3LQMA 5EOCL 1A1NB 1CDIA 1AHWC 2XRAH 4Y88A 4WI8A 3D39B 5KN5B 3VXMB 4O51A 3V4VL 3NFPB 1TPXB 1IKFL 2WM0A 3QIBD 2GITB 3QIUD 4HC1A 2YSSB 5GQBA 2DMCA 3U1SL 1JNNL 5T3ZE 2N7AA 1A14L 1TTGA 4FQJH 4NC0B 3ULUL 4OV6F 15C8L 3EDJA 3LIZL 4DN4L 1RK1A 3L3KB 3P3YA 3NBNA 2WUCH 5DD0L 2APWA 1HHGB 1PKQE 2X7LB 3CFDB 4WI3A 2FL5A 1U8KB 3V6BR 1J1PL 4OCWL 3PGCA 3SDYH 3QQ3A 1CFBA 2XZZA 1YEEH 3X14A 3WN5B 4NQSB 2CUMA 4P4KC 4XP4L 4NZRH 4WFED 1HH9A 1J1XH 5A16B 2HRPH 3T3PF 3VFWB 5H2BB 2HVKA 3QHZH 5HHMB 4D2NA 4Y4HB 2R0LL 4M7LL 4L29A 2QQNH 4JFDE 3SE3A 3FFDB 4Z18A 2R23A 3K3QA 3UTQB 4TN9A 3T1FB 3BN9D 1NH6A 2CIKB 3CSPA 1ES0A 3QPQD 2VZ3A 4LRIC 4CNIA 4LCWE 1FDLH 3WKML 1RZFL 2BOBB 1L9NA 2X10A 2CGRL 3OR7A 5EZIH 5F7EH 2VXSH 2VDOL 5EA0H 5IR1A 3VFRA 2A6KB 5EU6A 3VFUB 3JZ7A 2L7UA 3NIDF 5IIEB 1FZMA 3ZSSA 5KVDL 5I15L 2I5YH 3BHBA 3MLXL 5HPMB 1H3VA 4NKDB 4RGMC 5J89A 4U0QB 5GGRA 4IS6A 2FSEA 1N6QH 4UV7L 5DO2D 5GRZA 4FQIL 3B9EA 1B0RA 2A2QT 1R5IA 1LO3H 1B0GB 1EXUA 1N0XL 5F89B 1F6AB 4UAOC 3BZDA 1HHHB 5CP3H 3DROA 5E9DA 5CMAB 1A7PL 2Y7QB 2VLKB 4JN1L 2W92A 5DURB 1HSAB 5I1IH 3HNSL 3ZE2E 4IRZH 2OYPA 2R56H 4GAYB 4X98A 3WMSA 2J1KA 3U0PB 2FHBA 2PW1B 2YXFA 4MD5B 4J4PC 3UJJL 3MV7E 3NCYS 2D7TH 1G7LB 4PBVC 5JO5A 3ARRA 1RUAH 4UNUA 3QDAA 2ATKB 1JPSH 2V7HB 3ILPA 3TT1H 3MLYL 1L4IA 4HCRH 2Z31C 1U36A 2BRRL 1SJEB 3T2OA 3MRNA 5BVJB 1PKQA 3M8OL 5HYSB 4WJ5A 1OGTB 3EOTL 2P5EB 2OP4L 5ABDE 1G9MC 1YEDA 1F4AA 1OY3B 3BGMA 3LZFL 1RUPH 2FX9L 5D72H 4UDTA 1WFUA 4QHMB 2RJMA 2H26A 2XY2A 4FQQB 1YECL 3V5KB 5ISZB 3LQAC 1IC4L 2DQJH 3TPKA 1EMTH 3HE7B 4OBSA 2IEPA 4JFDA 5C0BB 1DLFL 1FFNA 3S96A 2Y07L 3VXTB 5GRYA 3BSZH 1FGNL 4KVNL 5F9DC 4QF1B 3WD5L 3T65B 5JQ6L 4HGWB 3T0XA 3REWA 1FYTE 3KR3H 5EU3B 1CIDA 3ZKND 3RFZC 5FDWA 2VDPL 3DMMC 4P99A 4R0LB 5C1MB 3I6KB 3WLBA 4JRXE 5GGTH 3SKJH 3NN8A 3L7FB 1T1YB 1ADQL 1KPRA 2HJFB 4PTTA 2CDEA 3WIHL 4MNHB 4LLWB 1ZLWH 2V2TB 1S7QB 2FO4B 4ETQB 3U7YL 3MRQA 1OT2A 5T33H 1BZ9B 2NX5B 1A3QA 2H41A 4Z95H 4JCLA 3BEWA 1PY4A 4J1UB 3WJJA 1ZTXH 3VXME 4PUBH 1YYMH 5E2WH 7FABH 1WWWX 4LHUG 1IGIH 3U79A 5EUOF 5E8PB 4WCYH 3X3GH 4XX1G 4MJID 5SX5H 4K9EL 2MPAL 1AR2A 4W4OA 4K23L 5D7SH 2WQ8A 2EICA 3NZ8B 1VKXB 4YHIA 3TPUB 1P84J 2EE6A 3GJFB 4QOKB 2E6JA 4AIZA 4MXVE 2F5AL 5DRWA 2JLLA 4XT1C 4XH2A 4P5TA 4RAHA 3TBTA 2FECI 3WSQH 4UBDC 5BV7H 1MFEL 1NGZB 5IQ7L 2OQJB 1QFPA 3OGCB 4R7NB 2AEPL 2AXGA 3SJVD 3LQZA 4OD3H 2WP3T 4W6YB 4K55A 1RHFA 3QXWA 2DWDB 2W9LA 3L5XL 3MV7A 2H32H 3BD4A 4LAQL 1OAXH 3OL2A 2YPKB 5IW1A 3Q2CA 4I5BA 1NBVH 5GS0H 2DQFA 5I8EA 1PLGL 1KCSL 4K71C 2P49B 1R6VA 3BESR 1J8HD 4MAYA 4WW1A 1SJHB 4LVOB 3G08A 3IJHA 3C09C 1C1EH 1MCRA 2ARWA 3CU7A 5IB5A 5J11C 5C8JB 5I30H 1JPTL 2VLME 2XPGA 1BF2A 5INDB 3LRHA 1S7UB 3MTRA 1NCBL 2HWZL 4P3CL 3VXPB 3N1GC 4NO0B 6FABL 3MLRL 5I1HH 1EK3A 3KYMB 3QUYD 1PAMA 4ETYA 3H9SD 5I1EL 2Y6SD 4JO3L 4CDGC 2OX5A 2NY5H 3RGVA 5T1KD 3FN0H 4LIQH 1DSFH 4I4WA 1PG7H 2E6PA 5DDHA 1MIEH 3RHWK 3BJLA 3MRIA 4XVJL 1T5XA 1I9JL 5EO9B 5KS9F 1JF6A 3HLAB 1I1AB 1INDL 2YC1B 2V5TA 1C08B 3HMWL 1C5CL 1IGYB 1F42A 4ZOEA 3MO1B 1MCIA 3GSXB 2HN7B 5DI8A 2X9YA 4PJ8B 2JB5H 5FV2A 1K85A 1P4LB 1HHJA 2VXTH 4XMKH 3G5ZA 5IFJA 1PEWA 5DEGA 3O81A 1AGBA 3T2NL 3VG0H 4BA8A 3VWKD 1XR9B 2FD6H 1J0HA 1WFNA 3OR6B 3D39A 5EFIB 5KN5A 3VWJC 3VXMA 4O9HL 1Z3GL 5JOFB 1WWAX 2Z35B 3NFPA 4YHKL 3UYOD 4OZHF 2K7QA 2YSSA 2FO1A 2EIZB 2X40A 5I74B 3O3UN 1OP9A 3M17A 1WSST 4B7IA 3OAZH 3VI4E 3UTTE 2A6DB 4K3EL 1Z6JT 1QRNE 3L3KA 4IOIB 4L4TE 3ULVD 2NLJB 2DD8H 5FUZH 1A7OH 5E6ZA 1HHGA 2X7LA 3CFDA 1PSKH 5HYJE 3MLSH 3G04B 5D7LD 3MLPA 1U8KA 2DKMA 2P5EE 3RZWA 4PJ7B 2OXHA 2Z9TA 2DBLH 2YPLD 5IFAH 3IDXL 3WN5A 4NQSA 1UWXK 2JB6B 4L9LB 4KQ3L 1WEJL 3T0DA 3LH2L 4M03A 3SGDI 2WW8A 1MHEB 2GTZB 3KDMA 5ETUB 5H2BA 3VFWA 5A16A 4UNTA 2FZ3B 4Y4HA 5J3HC 1H3XA 1SEBB 4PD4K 4S1RH 3FFDA 1FH5H 4X0KB 3UTQA 4NBZB 4OIBA 5GJTL 3T1FA 1JZ4A 4KDVA 2AKRB 2CIKA 4M61B 1J7VR 4U1LB 1HKLH 3FO0H 2NPLX 3ARFD 1N2RB 2BOBA 1ZV5A 4K9EC 1B4RA 3TEUA 2A6KA 5DK3A 3VFUA 4D9RE 4A6YB 4HUWB 4XP6L 3QXTA 4UQ3B 4WFEE 4LSTL 3VA6A 3EGSB 2LVEA 3BDXA 4HGKC 5HPMA 4G9FD 3HRZB 4NIKB 3Q1SH 5TH2B 1DQTA 1EEQA 3ZTJG 3V7AG 3HC4H 3RA7H 4YHOL 2H45A 4I0PD 1B0GA 3JWDH 3V8CA 1NLBH 3SE9L 5F89A 3GMLB 1F6AA 3I84A 1HHHA 1EEZB 1T0PB 1DBMH 3GGWB 4QOKE 3GHEH 4IOFD 5CMAA 3BPOB 4FN0A 2YPVH 4EKXA 2R8SH 2Y7QA 1ZHLA 1U9KA 4HWBA 2VLKA 4F2MB 1HSAA 1U95B 5DQ9B 3MCKB 1DQLL 4GAYA 1MLBB 4YLQT 5BQ7B 1T66D 2XZQL 3AREB 3EJJX 3U0PA 4TPRL 3GIZH 4MD5A 1CGSL 3WUWB 1AY1L 4XHQA 5CCKL 1X6NA 3TA3A 1G7LA 3P9MB 3ZE2F 2HMID 2D7NA 1AGEB 3S34L 2ATKA 3TBYB 2V7HA 5E24E 1OOAA 4L4VB 1J18A 3HC3L 2DAVA 4L4TA 2QSCH 1SJEA 5L2KD 4XVSH 5BVJA 4NO3B 1X3DA 3S5LG 5DFWH 4NCC2 5HYSA 1OGTA 5C07D 2P5EA 2EC9T 3QXUA 2IAND 2NXYD 3C60C 4ONFL 5L6YL 2ZG1A 4TSBH 4PS4L 3REVB 3EZ8A 5HVHB 4LVHC 3QDMD 4UT9H 4FQQA 3V5KA 5CAYB 4HUNB 4XP5L 5DHXB 2YRLA 3HE7A 4AT6B 3MV01 5D2NB 3B9KD 5L8KB 3S36X 1UM6L 5C0BA 3VXTA 4PRHB 1NGYB 3NCFB 3T65A 4Z78B 1DVFB 3S88H 1NGXB 3IFLL 4HGWA 4Z7NF 2GJ6B 5EU3A 4MXQC 2X4NB 1FRGH 1BZQK 3QEHB 2V5MA 1HN1A 3EJZC 4R0LA 3I6KA 1OF2B 3L7FA 1GAFL 1T1YA 5DJCB 2HJFA 4P9HL 4MNHA 4LLWA 4ALAH 3AS0A 2JJSA 1S7QA 5DMGC 3KPRD 2FO4A 4ETQA 3Q3GB 2JIXD 1AE6L 2FNBA 4B50A 2X4TA 3RTQB 1BZ9A 2NX5A 5KANI 4KROB 4MS8C 5HHXH 4J1UA 2HT4D 2R69H 5IUSA 5F7HA 1H5BA 3LOWA 1T80A 3ARPA 5D96B 5E8DH 2R4RH 1SJVA 4BK5A 1AGCB 4JREB 3V6OA 2JKXA 1GPOL 2NXZC 3CPLB 5E8PA 5C7XH 5IGXH 2VH5L 2BFVL 3S3JA 2F58L 1D5IL 1KCUL 2DI9A 2X6MA 4R4NC 3NZ8A 4JKLA 4L3AA 3TPUA 3LKPB 5K59E 1NFIB 4G6AD 5KTEH 4QOKA 1BFSA 4I3SL 3DSNA 4NN5B 3LMJH 5E08L 4WW2C 1YEKH 4RX4A 4F7PB 4Z8FL 4XPHL 1OHQA 1VADA 1G84A 3VFVA 3ZKQD 2XRAL 4LOUD 1NGZA 2OQJA 4GRLB 3S8WA 1MQKH 3OGCA 4M7ZC 1WZLA 3MBEB 4OBRA 4MXVF 5E70A 4LRNH 4F7TB 1MLCB 1RZ7H 4OZ4B 2AJ3B 2ZUVA 3GDBA 3RUGE 2DWDA 3WXVH 4IBLT 5DJZB 1HKFA 2JF1A 4RWYH 4FQJL 4ZFFB 3W5NA 2YPKA 1DUYB 4MJIE 4G80B 1BFOB 4G7YH 2WUCL 4XAWH 2EDFA 2ID5A 4KKBC 4RRPA 5MENE 4GLRI 3C6SA 4WIQA 3LRSA 4G8GB 4N0YH 2Y72A 1TJIH 3X13B 1MCLA 4GW1A 5AUMA 3NIFE 2FEDD 1SJHA 3OKDB 4PJDE 2VL4A 1MHHB 43C9B 2ZSWA 1V7NH 5BS0E 1LE9B 3BWAA 4KKCD 2HTLC 5INDA 3SJVE 5IW6B 4NZRL 1S7UA 1CGVA 1J1XL 1KEGH 2HRPL 1R5VB 3VXPA 2DI7A 4NO0A 4FNLH 1F11B 3QHZL 3TO4B 3KYMA 1HE7A 4X6FB 1CFTA 3HZMB 4F37F 2FR4B 3D2UB 1GGIL 3HUJE 2QQNL 5E7FA 4LGRB 5KVEH 3WFDH 5FYKD 3QEUB 2K3TA 5CJOH 5KG9B 5T1DH 1G6RB 3MRJB 1EA9C 5EO9A 2YD3A 1J8HE 1HWHB 1I1AA 2BVTA 4IRJB 1FDLL 2YC1A 2QSTA 3NA9H 1IGYA 5F7EL 5EA0L 2XWBB 1JNLH 3MO1A 5AAMA 3GSXA 2HN7A 4PJ8A 4HEPG 1MUJB 1K3ZA 5ANMB 1P4LA 3VXUB 1IC1A 2I5YL 3H9SE 1XR9A 1UC6A 4ZFGH 4WU5B 4YEFA 3FB6B 1Y6KR 3OR6A 5EFIA 3DO7B 5JOFA 2Z35A 1YUHA 3RZCD 5TGBB 3F7RA 1A7QH 5I18H 1LO3L 1NPUA 3HNTL 2EIZA 1SBSH 2P1YA 3QG7H 4YDJB 2Y9RT 2A6DA 2KUTA 4IOIA 1JGDB 3HI6H 2NLJA 1U41A 2Q3AA 2B4CC 2EXWC 4OCMC 4XP9H 5E5UB 4YUEH 1IKNA 5K33A 5FXCH 1MWAB 1I7ZB 1LO2H 4RMWA 3VI4F 2VOTA 5I1IL 3BKCH 3TN0B 4PJ7A 2R56L 5HI5C 5D8JH 2BZDA 1NCTA 4JRWA 2JB6A 4KJWD 4L9LA 4QO1A 3WFZA 4ZXBB 4F33A 5F7LB 2D7TL 1T83A 4CADA 3QQ9D 4KMQA 4ZO7A 1MHEA 2GTZA 1RUAL 5DMKB 1JPSL 2FZ3A 3TT1L 4XGZB 3KPSB 4P9HC 4HCRL 5D2NE 1AD9B 1AD0A 3VFMB 3QWRD 2DM7A 5D5MF 1AXTH 1FAIH 1UKTA 5MENA 3AMLA 2WQRA 1T7WA 4PD4J 1CBVH 3ULVE 2GW5A 4L1HA 1EO8H 4WHCA 3P0VH 3RX8A 3MUHL 2AKRA 5FGRA 4KTYA 4Z7OF 4M61A 5D7LE 4U1LA 4XTRC 4R4BB 5BS0A 1KSRA 5D72L 1KCLA 3UMTA 1SQ2N 3K1KC 3O2DH 1N2RA 4MHHG 1DUZB 1REIA 4ESKA 1JGEB 1AIFB 5F3HB 3HB3C 5CJXC 3ULSB 1I85C 2PCPB 1U8MB 3RDTD 4B5EA 1OWWA 4A6YA 2VYRE 4HUWA 4WVRA 1CE6B 2DQJL 4UQ3A 4JDVB 2OLDA 1BWMA 4HH9A 3EGSA 2FDBP 2DTSA 2RQ8A 3HRZA 1JBJA 2F74B 5TH2A 1N5AB 1DBAH 5CZVH 4FQXB 3V6FB 3GSNH 4JRYB 1J1OH 2HT2D 4OLYH 4BSVB 2FX7H 4RGOH 5TDOB 3VMOA 5HBBA 4LDOB 3ZT5A 3KR3L 2YD4A 1KJ2B 3ZDYE 1N4XH 1Y0LB 3GMLA 2X4OB 2HH0H 1E6JH 3ARBB 5J6HB 3O9WD 5GGTL 1QP1A 3SKJL 1EEZA 4QRQB 5GZOC 3GGWA 1YJDC 2YEZB 2FJFB 1PZ5B 1TZHB 4KDWA 3RAJH 2J8UB 2VJXA 4F2MA 4LVNC 4E41D 2VZVA 1MHPH 4YXHH 1G7JB 4Z95L 1U95A 5DQ9A 5T3ZH 4PUBL 1YYML 4G9FE 5E2WL 3MCKA 1MLBA 5BQ7A 7FABL 1YPZB 3AREA 1AHWB 1IGIL 1KB5B 4PGDB 3FQXB 5DJ8B 2C7UB 3KPNB 1A6TB 3WUWA 4P2QD 3IGAB 3P9MA 5D7SL 1AGEA 1T5WB 4L8CB 3TBYA 1TTUA 4L4VA 2NY6D 3IRZA 2JCCE 5C6TH 3S37H 4NO3A 3NCEB 4IJ3C 4M93C 3WSQL 4PJIE 3X12B 5BV7L 5FKPA 3TZVC 1FGVH 1JTTA 1JZ6A 2FLRT 1JRHI 1KEML 3REVA 2MWCA 2AK1L 5FM4A 5LBSH 5IESH 2HTKC 1QD0A 5EIIB 1SMAA 4M5ZH 1UJ3B 2QBWA 1CD8A 3MRDB 3OHXB 4KVCH 4EN3A 1BQHB 1NBVL 4AT6A 5GS0L 1OAQL 5D2NA 1LEGB 3ZE1E 4OZGB 1QBBA 2R2BB 3AY4C 5HDQH 4R96B 3OAYK 4PRHA 4QCIB 3MA9H 5L2KE 1NGYA 3SCMB 4N5UA 1CK0H 4Z78A 5FO9B 1DVFA 5IEKB 1E6OH 1FE8H 1NGXA 4LLQB 4NN7C 4QRRD 2GJ6A 8FABA 5CS7A 2X4NA 5I30L 2ITDB 5TJWK 4LARH 2IANE 1OF2A 4TSAH 2D7PA 2IC2A 3CH8A 5DJCA 5I1HL 3JV4B 5KOVC 3QDME 1XGQB 2Y1VA 2NY5L 4PJHB 3FN0L 5GISH 1D6EB 3DURB 4LIQL 1DSFL 1OTTD 3NCYP 4G6FB 2V5SA 1PG7L 3QRGH 1MIEL 3F58H 4DZ8B 2LAGB 4RGMB 1SVCP 4LSRH 4NOFA 4PLJC 1AGCA 2V2XB 5E6IC 3CPLA 5DK0B 2VZTA 3GBMH 5HHMD 2HLFC 1CGYA 3LKPA 3MCLH 1NFIA 4MJ6B 3VCLB 2VXTL 4XMKL 2EECA 4UAOB 5FYKU 3RP1A 2VXVH 4F7PA 5HVWA 5SWZD 3MYZA 4FOMA 2KQMA 1DJSA 2ZKHH 4Z7VB 2FD6L 2DB8A 3KPRE 4APQC 5E03A 1JPFA 1C8PA 3D9AL 4GRLA 2BY3A 4EI5B 3MBEA 4F7TA 3BX7C 4OZ4A 2AJ3A 4NBYB 3N85H 5E2VH 4W68A 1UWGH 5DJZA 1U92B 4OT1H 4ZFFA 1IZKA 1MVUB 1DUYA 4UMGA 4G80A 1BFOA 3WHE1 2JCCA 2BNRE 2HKFH 3RUGF 5GXBB 4TULH 5FUZL 2X1OA 1FO0B 1A7OL 12E8H 1G7IB 4H1LH 4KXZI 4ZQKB 4ZTPH 1PSKL 1UCBH 3U9UB 3MLSL 1FL3B 1OQXA 1HIMH 3SE8L 3SKNA 4PJIA 2J6EH 4WEMB 4AEIH 2YKLH 5DQDL 3K4AA 1OW0C 43C9A 5IFAL 4BZ2H 4EUPG 1LE9A 4Q74A 4BQ6A 1NGQH 2D4DA 5DVNA 1ERNA 5IW6A 1KACB 1AFVH 1A6WL 4PJDF 1R5VA 3RHWF 1MFCH 4YBQC 1F11A 3TO4A 4X6FA 4LSPH 3BAEH 3HZMA 1O0VA 3UDWA 4POZD 3D2UA 3BEVB 3BE1H 1T6VN 3SBWC 2APTA 4YE4L 1N8ZB 1FH5L 3SGKA 2W65B 4DKFH 5GRUH 2DLIA 1KJMB 1G6RA 3MRJA 2VDLH 4FQ2H 4IDLA 2QHRH 4ZUVB 1HKLL 3FO0L 1UM4H 3AM8C 3HUJF 2H9GB 4IRJA 1F4WH 1JMZA 2XWBA 5MERA 1NAML 4HV8B 3STBA 1PZUB 3NPZB 3O8XC 3TBWB 4D0BB 3DMMB 1MUJA 1OP5H 4GAJH 3FQUB 5ANMA 5HGGS 1OSZB 3JTSB 4C4KT 5CZXD 5IWLA 3MLVH 2IG2H 5ALBH 1EJ6A 3Q1SL 4Y5YC 5BV7C 3DO7A 4WWKD 2ENYA 3HC4L 3RA7L 4C56D 4IMLB 5FYKE 4MA8H 3QAZC 3MJ9H 5TGBA 2NY2C 4PJGF 5ISZD 3CU1A 3W9DB 2EKJA 3H2WA 4PG2C 1NLBL 3OKKB 2E9IA 3BP5A 1MQ8A 1NFDB 5H8DA 1BVKB 1GC1H 1YC7A 3OXRB 2MOVA 3PWPD 4YDJA 3W82A 3WXWH 1DBML 1INQA 4Y5VC 2LVCA 3L3DB 3W2DH 1T7XA 3SDDC 4OGXH 3TJHD 2YPVL 2NY3D 4NFCA 5IF0B 1BF8A 1IAIM 3ZL4H 1MWAA 4P2OC 1U6AH 2BVUA 4NWTH 5FIEA 1JYVA 2QQKH 3BQUC 3TN0A 4JZOB 2XT1B 3TV3H 1FNLA 1A9EB 4MDJB 2CD0A 3MZTA 3NFNB 3W11D 4Q0XL 3GIZL 4QRPD 1KG0B 4ZXBA 3FO2B 5HHQB 3DBXB 5DA4A 1NUFA 3HHRB 5DMKA 1KPUB 4R8WH 2QADD 3EAKA 1ZT1B 3KPSA 1T89C 1AD9A 5GS2D 4OZGE 1JVKA 3VFMA 2BNRA 2QSCL 3PNWA 5H37H 4TVSa 2GT9B 5CJ8A 4XVSL 4R4FL 1B6UA 1IMHC 3WFEL 1X4XA 4NO5A 3LKQB 4P3DB 3MFGB 4K71B 5ALCH 3BVNB 2WIMA 2X42A 4R4BA 5FOBA 2VXUH 4KJYB 3ARVA 4TSBL 3ULVF 1BVLB 1JGEA 3O6FB 5F3HA 4UT9L 3C09B 2P24B 3ULSA 3IKCB 2PCPA 2D9QB 3DRQB 4U7SA 1U8MA 5J11B 2ZUQC 1CE6A 4JDVA 4MVBC 2AK4B 5FHBH 4RMQA 5EZOH 5IB3A 2HLAB 1L6ZA 3SO5A 1NAKH 2F74A 1RULH 4FQXA 4LLMB 3V6FA 4JRYA 3GI9H 3S88L 4Z7UF 4BSVA 3L7EB 5TDOA 1KUMA 1MCWM 4M4PA 1DR9A 1RZJC 1KJ2A 1PD6A 1JI2A 3UJTL 1Y0LA 5DT1H 3V0AC 4I18A 1QSFB 4X5LA 2X4OA 1OPGH 5J6HA 3ARBA 1IAIH 3MUZ1 4QRQA 3QDGD 5DC0A 1IGFH 1FNHA 4ZUUA 3IFOB 3MGOA 2YEZA 1UVQB 4ALAL 2FJFA 4NHUB 1TZHA 5LCVH 5JUEH 3EDDA 4K94H 3I3DA 5EU4B 2GAZA 2J8UA 1KXTB 3R0MA 1X6LA 1G7JA 5FYJD 5HHXL 2R69L 1AR1D 4QYOA 2WWKO 2G9HB 5E8DL 3V5HB 1YPZA 1AHWA 1KB5A 2R4RL 4ONOA 4PGDA 3FQXA 5DJ8A 2C7UA 3KPNA 5C7XL 5IGXL 3F12B 3VWJB 5KOMC 3DV4B 5CSGA 4M7KH 1BGXH 5C9JB 1U0QA 2R9HC 1T5WA 4L8CA 1XGPB 4Q2ZB 1S9YA 4J3UA 3GJFK 5KTEL 3LMJL 5IJKC 1YEKL 2J7LA 3R06A 5IVZB 3X12A 2ZCKL 4MZ3A 2EXYC 2IPUG 4E41E 1XH3A 1INEH 4HG4K 4LRNL 4U49A 1RZ7L 1WZMA 1HYRC 4CU7A 5EIIA 1HYSD 4RWYL 4OLXL 3MRDA 3OHXA 4P4KA 1BQHA 1XGYH 1DANT 1LEGA 3SDXB 4OZGA 2R2BA 4FZEH 4WUUB 1LD9B 4N0YL 1T3FB 1TJIL 4R96A 4IOSD 4D8PB 2BY0A 3TCLB 4DVRH 2A0LD 1I9IL 3OJMB 4LBEB 5FO9A 3OG6B 5IEKA 2V5RA 4X6DE 4LLQA 3PWLB 1V7NL 4XNMB 3JWDC 1D5BA 2ITDA 1R3KB 4O58H 2EKSB 1JFQH 1U8HB 2AXJA 4LRIA 4R4ND 1KEGL 3QUZD 1ND0B 4FNLL 3JV4A 3O3BB 5KJRH 4YHMH 1XGQA 4NZTH 5JHLH 3E2HC 3MSPA 4PJ5D 4PJHA 3MLUH 3D85B 4F80A 5KVEL 3LV3B 5T3XD 4KK6D 1PFCA 2ZSVB 4NJAH 5CJOL 5IM7B 4DZ8A 4OFYD 5T1DL 4OZFB 1EFQA 3K2MC 1J0ZA 3TFKD 4GSDH 2V2XA 4YFLF 1NGWB 2CR3A 4RBPK 4OJFH 1KCRH 5DK0A 1NFDE 3NA9L 3ZKMC 5IMLB 4QRRE 5LQBH 4QTIH 1JNLL 3T0EC 3MZGB 4I2XB 3MJGX 4EVNB 2QQLH 4H5SB 2Y5TB 3VCLA 3CXDH 1RJCA 1CWVA 3EYQC 4C83B 1RU9H 2A6IB 4Z7VA 4BZYA 4NRXB 4OGAC 3VH8B 2BMKA 2VLJE 2IMNA 3QRFM 4R90H 1AI1H 2ADGB 4OUUB 1A7QL 1T6WA 5I18L 2PETA 4HEME 5IW3A 3BN3B 2VL5B 1PX4A 4WFGD 3BPNB 2Y5EA 3QG7L 1U92A 3G5VB 1MVUA 2BNQD 2DM3A 4OF3A 3SDCC 3VXQB 4NRZB 4J4PA 4WO4D 3BW9B 4PG9B 4ZYKB 1FO0A 1G7IA 5T1MB 4ZQKA 4XP9L 4DUXA 4YUEL 3QEGH 2Z31A 2DQUH 3U9UA 1FL3A 1LO2L 2OR9L 2A77H 3I02A 3BKCL 5SWZE 3SKUD 3UTSD 3E3QC 1DEDA 5F7YC 2X1PA 3FCTA 5D8JL 3EJYC 5H94B 3S98A 3EFFB 3EHBC 1UB6B 3HMXH 1KB9K 3C60B 3AAZB 3O45A 3OPZL 3S4SB 4LVHB 4PJAE 3BEVA 4WFFD 1AXTL 1FAIL 1FZKB 1N8ZA 3EDFA 1EO8L 4TUOA 3P0VL 1KJMA 5JW3L 4YZFF 4X6DA 4ZUVA 1P7QD 1S7XB 3MNWB 2H9GA 3O2DL 1RY7B 4XHJD 2DOCA 3MOAL 5CGMA 5GSVB 4N8CH 1NBYB 5J06A 5C09B 3VXRD 1N59B 2DDQL 1WAAE 4HV8A 4LPYA 4RGND 1K3IA 3MOQA 5CGTA 1J86A 1CDUA 4D0BA 2I24N 3DMMA 4WI9A 3FQUA 1OSZA 1TMCB 2YOCA 4HHAB 4OD2B 4JM2B 2KQNA 2X1WL 1L0XA 1QFOA 1DBAL 2X4RB 5CZVL 2LU3A 3GSNL 1RD6A 1J1OL 3LN5B 3OKMB 4IMLA 2DL2A 4OLYL 4F9PC 2WNGA 2FX7L 3EO9L 3NAAH 3WDIA 3W9DA 4B41A 2R2CA 1N4XL 3FL7A 3OKKA 1CDHA 1NFDA 3AXLB 4PJXE 2HH0L 1BVKA 1E6JL 3OXRA 5C0GB 3KPTA 3L3DA 4K7PH 1S9XB 4WENB 2ED9A 2XFXB 3NOIA 3PDOB 1NC4B 4H8WH 4YPGB 5E6YA 5IF0A 3FO1B 1CGXA 2ZUXA 1MHPL 4P23D 4YXHL 4NFBA 4X9HA 4WW2B 5T3ZL 3T0VA 4JZOA 4FFWD 2IAMC 1A9EA 1UH2A 3HZKB 5F9OH 5T1LD 5CD5C 3NFNA 2B0SL 1IILE 3MRLB 4C54A 1K5NB 1RUMH 4M7ZB 2XWJB 3FO2A 5HHQA 4LVEA 2BVYA 3U7AA 3DBXA 2E9BA 1URLA 2C26A 1KPUA 3G9VA 1ZT1A 1QBAA 3VXSB 3RTQD 3BMWA 5D71H 5C6TL 3PWPE 3S37L 2GT9A 4JDZB 4HZLB 3JBG7 4QXGL 2WWKT 2CLRB 4K2UH 4KUZH 5GS3A 4W4NA 3LKQA 4P3DA 1CICD 1CFNB 3A6BH 4ZAKC 3BVNA 4LPTA 3B9DA 3BD5A 1FGVL 4RWHA 1JF5A 2H3NB 2AJSH 4KJYA 1AO7D 5D1QD 5CD3B 4PB9H 1BVLA 3QUXC 3MYJA 1T2QH 5LBSL 2P24A 3UZQA 3IKCA 4PJBE 5IESL 3DRQA 3DTXB 3NCJH 4DFHA 2XN9D 2IPTH 4KVCL 5GRVL 3UAJC 2AK4A 2P8LB 3P0YH 4HUKB 4NNXB 5K9QI 5BO1H 3QH3B 2HLAA 4XMPH 5C70A 2DQHH 3UTPD 5HDQL 3B43A 5DVOA 4XPAL 3MA9L 5JIHA 3EDEA 2R39A 3DGGB 2VAAB 4LASH 1CK0L 4H0IA 1E6OL 1FE8L 3JUYA 3L7EA 4Y4FD 3P30H 2ESVD 5D1XB 4X7CC 1QSFA 2FX8L 4LARL 5C71A 1MCQA 4TSAL 5MEPB 2EH7H 1ITCA 2XKNB 4IDJH 1A3RH 1GOFA 2BHZA 4G8GD 3IFOA 3F6LA 4JO2H 1UVQA 4Z7QE 3U2SB 1KXQE 4NHUA 5TFSH 2UUDK 5EU4A 4X7SH 3T09A 1HXMB 1UWXH 2UYLB 5KSBB 4WI6A 3IDYC 3QRGL 4NSKB 3F58L 3TZVD 4WTZA 3WE6B 1ZEAH 2G9HA 4Z7WB 1U91B 3RVTD 2FGZA 3V5HA 4LSRL 1NMCB 3NTCH 5GIRB 3PV7A 3KLDA 3F12A 3VWJA 3BYYA 2NYYD 3DV4A 4Y19B 3GBML 5GRXG 4M6AA 5IQ9B 3BZ4B 4PP2B 5C9JA 1XGPA 4Q2ZA 3NZHH 3MCLL 4PRID 1C5BL 4X9GA 3U0TB 4HUVB 3QDGE 2D7OA 5DC4B 2ZKHL 5FGSA 4RFNB 4GQ9H 5IVZA 5AD0B 1TXKA 3IJYB 1M4KA 4Y2DC 5JQHC 2CLVB 2GQHA 3OZ9H 4H0HB 1RUKH 1LDSA 4HG4J 3N85L 3K0WA 4RA3A 5CEZD 3KPQB 1UWGL 2DF3A 2QV2A 4MAUH 5KSAD 4G5ZH 3VXUD 5C0AB 4OT1L 3ULVH 3U7WH 1TCRB 1X5XA 1CTOA 3EIFA 1FN4B 3SDXA 2HKFL 5IFHH 4TULL 4KHTH 4WUUA 12E8L 1LD9A 1ADQA 5JNYB 3OQ3B 1T3FA 3UPAA 1BLNA 2ATPB 4ZTPL 1UCBL 4OLWH 4DN3H 5SX4I 5IMMB 4D8PA 4FG6D 3N9GH 3TCLA 1GOHA 1WIUA 2J6EL 4FS0A 4LBEA 4AEIL 2YKLL 3PWLA 3SDAD 1CXEA 4BZ2L 1GZPB 2VLLB 1IGJB 4XNMA 3AFLA 1NGQL 4UT6H 1R3KA 4GG6B 2EC9U 2EKSA 1AFVL 2FYYB 3ETBF 3ES6B 1E4KC 1MFCL 1ND0A 3O3BA 4GMSH 4LSDA 3BAEL 2NTFB 4C58B 3IJSB 3BE1L 1RQ5A 5J56B 4P46C 5GJSH 3LV3A 5L9DL 1KF9B 4DKFL 2ZSVA 5GRUL 1ROWA 3TM6A 2DRUA 1FZJB 5IM7A 4GKSB 3UPCA 4OZFA 1FJ1B 2VDLL 3QP3A 4FQ2L 2QHRL 1H9VA 2NY4D 2NR6D 1BJ8A 1UM4L 1NGWA 2F53B 4P2RE 1F4WL 5IMLA 5F1KC 2I60H 3MMEB 2IPKB 1I3GL 3DJ9A 1XGTB 3K7UA 1W8NA 3W0WD 1MFAH 4EVNA 4H5SA 2Y5TA 4GAJL 1UWEL 3INUH 4X80H 2YD1A 5F7WC 1RHHB 3NH7H 4C83A 2BVOB 2IG2L 2AEIT 5ALBL 2A6IA 4PJ5E 1JPGB 1TLKA 5ICZB 4NRXA 3VH8A 1KN4H 5TF0A 4LVNB 2VZSA 3MJ9L 4OUUA 2ADGA 3LPWA 2VQTA 2Y4SA 3KWWA 2ICWA 4MA7L 3DECA 3QWOA 3VDCA 3MACH 3PDDA 4EQ2A 1GC1L 4GRWE 5EOQH 3G5VA 5LJYH 3VXQA 4NRZA 3W2DL 4PG9A 4OGXL 1UM5L 4ZYKA 2A9NH 4EUPH 4RRPG 3TVMD 5I71C 5T1MA 2ZCLL 3ZL4L 3U4BH 2ED8A 4S1QH 3V0VA 4NWTL 2QQKL 5IB1B 1PG7W 3QIWD 4KTDH 3FOLB 1NBQA 3WS6C 4M93B 3U48A 5H94A 3EFFA 3VI3E 5TF1L 4X9IA 1S7VB 4N5ED 4G43B 5JMOC 5FF6B 1UB6A 4G6MH 1ZS8B 1TENA 2HKHH 3I75B 3C60A 4M6OH 3BWUC 4ZDHB 3AAZA 5KZCB 1KB9J 4R8WL 3S4SA 4WFGE 4YEEA 4XWOD 4UTAH 4TNWK 2I07B 1D5XB 2BNQE 4I9WD 3NFSH 1FZKA 5BW7C 5E8NB 3ZDZF 4LLUB 4PJAF 5ALCL 3A6CH 3MLWH 2YA1A 1G7HA 1S7XA 2VXUL 3MNWA 1V3MA 5D1ZD 2YXMA 3SHSA 2G75B 5GSVA 1EX0A 1R3JB 5C09A 1N59A 4NN7B 3RVUC 1J0IA 3DHMA 5BVPH 2Q76B 2VITB 5FYLD 3TWCH 1PW3A 5EZOL 4HBCH 4ZPVB 5CWSB 1MRCH 4HHAA 5F71A 4OD2A 4YDKH 1WAAF 4JM2A 1NAKL 2FGWH 1RULL 3QQ4B 3L5JA 5E8EB 3WFCH 2AERT 4WFFE 5DD3H 1X4YA 1CXKA 3LN5A 4J3VA 2UVEA 3OKMA 1A4JB 3GI9L 1D5ZB 1RJZB 3BP6B 2IQ9H 4P2RA 5DT1L 2UWEE 1YN7A 3AXLA 5ICXA 1IAIL 2DIJA 5E6IB 5B38B 5C0GA 1IGFL 3MC0A 4JR9H 1S9XA 3VXRE 2XFXA 3PDOA 5LCVL 1NC4A 2UZYB 4K94L 4YPGA 2EE3A 3KXFE 3SCMD 3FO1A 4PJXF 5I16A 1ZT4B 1BOGB 1ZHBB 2W9DH 3H7LA 5CBAA 4JM4H 4WW2A 3MXVH 2B8OT 1KJ3H 5B39A 3IFNH 3BKYH 4Y1AB 3HZKA 3M07A 3H3PH 4APQB 3MRLA 1OAYH 5F7MC 4BQ9A 4GAFB 2V5YA 1K5NA 5J12B 2XWJA 3RWCA 4M7KL 1BREA 2HJKB 4MYWB 1BGXL 4WHDA 1JL8A 2OR7A 2Q8BH 4Z9KB 2VXQH 3LN4B 1EBPA 4TTDD 3VXSA 2OBGA 4BYHA 4K3JH 3QEQB 2BY1A 2Z4QB 5FCUH 4JDZA 4HZLA 5J13C 1XF1A 5HGAB 1WGOA 4NQED 2DTMH 3BPLC 3G6JB 1X5YA 2DM4A 4TVPE 1CFNA 4M7JH 5D2LE 3CLFH 1OAUH 1WK0A 3AS1A 1OSPH 2DJSA 1INEL 1BFVH 2YRZA 5HPOA 1OCWL 3QULB 2VABB 4XNZC 5F96H 5B22A 5CD3A 1NKOA 2NW2B 4P2CG 4KJPC 2P48B 1FFOB 3DTXA 1KELH 1XGYL 2P8LA 2V17H 3OKNB 4NNXA 5EBLB 3QH3A 3SE4C 4KV5F 4FZEL 3WO4B 3CFIC 4EI5D 4KC3B 1JTPA 3D48R 4CRPA 2E7LC 2P43B 2GI7A 4FTVB 1WZ1H 4P5KB 2AJVH 4DVRL 3V6ZB 3HR6A 1RK0B 2VAAA 5KSUB 1JPST 2N7BA 1UXSB 4YBLC 1JZ5A 4EIGB 4X6CB 5IKCB 2B5IC 3UO1H 4HIJB 4PV9B 5MEPA 2E7MA 1GC1C 3KJ4C 4EBQH 1Y18B 2XKNA 1W72H 3KLSA 4LSUH 1T4KB 5KJRL 4YHML 4NZTL 5JHLL 3U2SA 3EYUH 4FMFA 4WFHD 5FYKH 3MLUL 5C3TA 1MHCB 4Y8AA 1HXMA 2UYLA 1AKJB 1I1YB 3MRCB 5DMYA 5CJQH 5KSBA 3LD8B 4MJ5B 2DKSA 4NSKA 5BRZD 2JJTC 4NJAL 4X9BA 3WE6A 3UTPE 3WLWC 3KYAA 2NQCA 4GSDL 5BV7B 5GIRA 4ZS6D 4OJFL 1KCRL 4ZO8A 4PRNB 5J0BA 5A3ID 1LEIB 3WUWG 5GHWH 5IQ9A 5E5MB 3BZ4A 4PP2A 5DJYB 5LQBL 3VGAB 4OF6A 4QTIL 2NY2B 2ESVE 4L1DA 3IDNB 2QQLL 3MV11 3ROOB 3U0TA 1FVCB 2H32B 4HUVA 2Y06H 1N6VA 1RZKH 3QFDB 3KXFA 4Y5VB 3RWJB 3MA7B 1RU9L 3UYRH 3SDDB 4Q6IC 4XZUB 1ZLVK 4P5MB 4PGCB 2PW2B 1KTDB 4LMQE 3RWDB 3UCRA 2CLVA 2ZOKB 4P2OB 1BVZA 3ARGB 3LEYH 4R90L 1AI1L 4KPHH 1LO4H 1K8IB 3KPQA 1ZVYA 4HFUH 3VGHA 2ADJB 5C0AA 4FFZH 5TE6H 3D3VB 1QUNA 1TCRA 4CU6A 1U8PA 3ARDC 1D5MB 1FN4A 1U3JA 3CSYB 5DD1H 4XCFH 5JNYA 4BUHA 4PRIE 2DQUL 3MODL 3OGOE 5IMMA 4U33A 5EC1B 4G8EB 2A77L 3V4PH 3BP4A 5JW4M 5KW9H 3HCVB 1GZPA 2VLRD 1IGJA 3EUUA 5B3JF 1LMKA 4GG6A 2WBJC 3D25A 3HMXL 5GGVH 2FYYA 2I9TB 3FB8B 3GUTB 1D9KB 3ES6A 4NFDA 4U31A 2LU7A 5CJXA 2X4UA 2NTFA 1K2DB 1YNLH 3IJSA 1E4JA 2P4AB 2YRPA 4K94C 2H2PC 4ELMF 2ZUQB 5I1AA 2XA3A 4QT5B 2LU4A 1PYWB 4MA1B 1FZJA 3WNKA 2VN4A 4GKSA 4KRPC 2WINB 1FJ1A 3MNVB 3MRKB 4NGHH 4F7EB 4JKKA 4L3ED 4PYGA 2VISB 4N8CL 4LLYB 3FQTB 3MMEA 2IPKA 3PL6D 4ZMAT 3U36B 25C8H 3PGDB 2GHWB 5BJTB 5FUCE 4AG4H 1X9QA 1YNKH 1I4FB 5CLWA 1X7QB 3C8HA 1RHHA 2BVOA 1Q9OB 3QFJE 4J3XA 4LEOB 5ICZA 5DWUL 2EE9A 3C5ZD 3I3EA 5DXWA 3O6FD 3QIBC 3QIUC 1MI5B 1CIUA 3NAAL 4Z6AT 3MROB 1BX2B 4U2YA 1F4XH 4NZUH 3VFTB 3OAYH 1F4HA 4K7PL 1NQBA 2KPNA 1X5FA 5GGQH 1CDJA 4JJ5B 4H8WL 3W0WE 2WIIB 5KSVB 1IT9H 4BFEA 1A7RH 4G6KH 4PFEA 1OP3K 1M7XA 1OGAB 4JO1H 2AV1B 4GRWF 3WNOA 4YNYB 5IB1A 4JG1H 3TLRA 3FOLA 3ARTA 1F2QA 3P0GB 5F9OL 5GZND 3BKJH 4NQCD 1S7VA 1YY9D 4G43A 4GRMB 5FF6A 3NA4A 1RUML 3LQAH 5CSZB 3IAPA 5KVGL 3P4MB 4AYFA 4PTUB 2I07A 1D5XA 4NUGH 2W60B 3E6FB 1UACH 4LFHG 3JWOH 2O93L 4K2UL 4KUZL 4TRPH 1QEWA 3QPQC 5E8NA 3O6ML 3HI5H 2FLBT 3A6BL 4LLUA 3AY4A 5I1KH 3WIFB 4N8VB 1AGDA 2AABH 2AJSL 5JLZB 1BD2D 4PB9L 1T2QL 5I6XB 1T7ZA 1HOCB 2SEBB 3NCJL 2Q76A 3UC0L 2IPTL 1SY6H 3P0YL 4PY8I 3PIQA 2DQGH 5CP3A 4ZPVA 4XMPL 5CWSA 5DMIH 3UP1A 2DQHL 4U1IB 1A7NH 3IAGC 5DO2C 3E2HB 3QQ4A 5E8EA 4PLNC 2MSPA 5C0CD 4I9WE 2D0HA 3RNQB 3H42H 4UB0H 4HMDA 4LASL 1A4JA 4ONGH 1D5ZA 2HA1A 1RJZA 5JR1H 3P30L 3BP6A 2P46B 3DHJA 3DVGB 4PGEB 3KLHD 2PYED 3PUCA 3U30C 2GSGB 3K8LA 5E6IA 2EH7L 4GFTB 5B38A 2MQCA 4IDJL 4WUUD 3BDYL 1A3RL 2AEQH 4JO2L 4ZG1A 4X6BA 1SYSB 1OT1A 3T0EB 2B20A 5F1IB 3WUZA 2OS7A 4X7SL 5EDXA 1ZT4A 4GBXD 1BOGA 1ZHBA 3QFJA 4HCRA 5FYLE 3RWHB 4XBEH 2G60L 1T20B 2EDYA 5E4IA 4ORGB 4Q9BA 3BH9A 1ZEAL 2Q8AH 4EDXB 1YN6B 3MRRB 5F1NB 4APQA 4EOWH 1AXSB 2IBGA 3NTCL 4M43H 2UVFA 1AP2B 3VFPB 4NT6B 1TZGH 2NZ9D 3MV8E 3VRLE 3TNMB 5I76B 3D85D 1UZ8B 3NZHL 3LN4A 3QEQA 1EUTA 2Z4QA 3BIAX 3SDCB 5HGAA 2ICEB 3HNVH 5JOPD 5C2BH 5I1JH 3TNNB 2ZOLB 3IYLW 4GQ9L 5HGHB 1B3JA 1XF4B 1F13A 4XPGH 5I75C 5GGSB 3RVVD 3OZ9L 3T4YB 2ITCB 1RUKL 3G5YA 3QULA 2VABA 3U83A 4FP8H 4DAGH 1OW0A 1LWRA 4JHWH 4OLEA 2R15A 4MAUL 4MD0A 4G5ZL 1FFOA 1M7IB 5HHOB 3ULVL 1S3KH 2ADFH 2P7TB 1IARB 5LXGH 3OKNA 5EBLA 5I2IA 5L7XH 3QR2A 4XWGH 5IFHL 4KHTL 4CW1B 2AGJL 4OLWL 1HSBB 4P5KA 3N9GL 5I0DA 4PJEE 2E9WA 3V6ZA 1RK0A 4KKAD 5KSUA 1UXSA 1DL7H 4NQEE 3ZKNC 4JFPB 4G8IB 1BZ7B 4X6CA 1ORSB 5IKCA 4UT6L 1XEDA 2VUYA 1CQKA 4HIJA 2XQBH 3AM8A 1Y18A 1FZOB 1JMXA 1T4KA 4L8DB 1RVFH 1FC2D 3DI3B 3GBNH 4HJ0D 3LPFA 1MHCA 3UBXG 3MRCA 1I1YA 7CGTA 1F4YH 4MJ5A 1QPXA 3BGFC 3FN9A 4IRSC 4JPKH 5EBMB 5IK3A 3PXJA 4Y5YA 4Y8DC 4BZ1H 3GSWB 4HGMA 4PRNA 3D0VA 1LEIA 3GMOB 1UZ6E 4OF0A 5E5MA 2I60L 5DJYA 3C08H 2A6JA 2EYSB 3IDNA 1MFAL 4PG2A 4RDQG 5D7IE 4ZD3H 4JY6B 3ROOA 1FVCA 4YQXL 5E00B 4X80L 4GXUM 3QFDA 2VZUA 1UH4A 3NH7L 4XP1H 4Y5VA 3RWJA 1OGAE 3MA7A 5JPNB 1W8OA 3IFPA 3SDDA 4XZUA 3DV6B 3B8SA 4P5MA 4PGCA 2PW2A 1KTDA 4HKBB 3RWDA 2ZOKA 5ITBH 4P2OA 3BIKB 4PJCB 5BRZE 2XZCL 5C08D 3BQUA 3GMNB 4QTHB 1E27B 5E7BA 3VGDA 4XB8A 2E3VA 1K8IA 2MQ3A 1E4XH 1SMOA 3MACL 2ADJA 5EOQL 3MV8A 3D3VA 1YQVH 4DZBB 1D5MA 1F3DH 3CSYA 5ECJE 2A9NL 2G2RA 5FGCB 2PKDA 3PHQB 1NEZA 2J2ZA 1T89A 1L0YA 3FQNB 4S1QL 5EC1A 1FNEB 1CLYH 1B2WH 2ORBH 4MQXD 4JFFE 1XGRB 3HCVA 1Q9LA 1N6UA 1WISA 1GXEA 4G6ML 2WK2A 4Z0XA 4ZAKB 1YEIL 2I9TA 4ZFOA 3GUTA 1D9KA 2LE9A 3QUYC 5ID0A 2Y6SC 4JKPH 1CD1A 1LP9E 5DR5H 5GS2H 2B1AH 3G9AB 3QUXB 2IGFH 4QHKI 1K2DA 1L7TH 5EUOB 1L6XA 1NC2B 1UB5A 4JY4B 1P6AB 5EUKA 3NFSL 4F8TA 4QT5A 4QXTB 1DANU 5IBTH 1PYWA 1DFBH 2DQEH 5CSBA 2WINA 3A6CL 3MLWL 1J9CT 3MRKA 5E1AB 4F7EA 5EOCJ 4XAKE 2VISA 4LLYA 3FQTA 1ZVSA 3VA2C 3U36A 2VLRE 3PGDA 2FBJH 4ZS7L 3STLB 2OTWB 2IQAB 5BJTA 2F15A 4DW2L 3VWKC 2JELH 1KJVB 1I4FA 1X7QA 2APBA 5FDYA 4PRPB 1F02I 1MRCL 1Q9OA 2CRMA 4YDKL 3PGCB 4LEOA 3T3PE 2FGWL 3WFCL 1H0DB 5DD3L 2NMSA 3V95A 4M3JA 3MLTB 2X4PB 4NP4H 1MI5A 4OZIF 1ZT7A 1I8IB 43CAB 3IDYB 1F58H 1QSED 2DYPD 3MROA 3LPGA 1HH9B 1S9KC 2ENSA 1BX2A 1CG9B 3AU1B 3VFTA 2AP2A 2CO6B 5LAXB 1MWAL 3ULVC 1K9TA 4L29B 1QRKA 1WITA 1VGEH 4L3EE 4QXUH 2VR9A 4JR9L 1JYXA 2GJZB 3OKEB 2WIIA 5KSVA 2X1XR 4JAMB 1OGAA 2AV1A 2W9DL 4KZDH 3FAXA 5ELIA 2UV3A 4YNYA 1NCUA 4JM4L 5IJKA 3MXVL 4M1GL 3C6LC 5D1XD 1KJ3L 1MIMH 3IFNL 5DHYB 1EHXA 3BKYL 1R3IH 4TNWF 5GGSY 1OAYL 4GRMA 3FTGB 5IR1B 4NNPH 3CC5B 3HS0A 5CSZA 4NKQB 4Y16D 5F7FA 1OARH 3FRPG 2Z91B 2Q8BL 2VXQL 5IOPB 5KS9B 3P4MA 1FORL 4K3JL 4PTUA 1JHLH 2W60A 3E6FA 3QA3B 4ODTH 5FCUL 3ZT7A 4HUXB 1FBIH 1CF8L 3BXNB 4HLZG 4RBPH 4JFEB 2DTML 5JMRA 1B0RB 2VDNH 4NWUL 1T0NB 2YHGA 1R5IB 3CAFA 4WTWA 1IM3B 3ARFC 4Y19D 3V9FA 3L3IB 1OAUL 3CLFL 4JFFA 1OSPL 1BFVL 4XBPB 2FHFA 1U2CA 3QDJD 5F96L 1HHIB 3GSNB 1F8TH 4MMZC 1HOCA 5K9JH 4NQCE 5FM5M 4OV5B 1QBML 2ZUWA 4C57C 4OFDA 2ARJA 4N0CD 3MQIA 4FMKA 3VRIA 3DETD 2W91A 4CUCA 3PV6B 3QBTB 4ZFZB 3I9GH 4U1IA 4UILL 4WUKH 1KJ2L 2DQIH 2VQUA 1WZ1L 5CJBA 1AQDB 2AJVL 3FHAA 2C3VB 3RNQA 5I17B 4I0PC 4P46B 1A02N 4XNQB 1Q0XH 1JHKH 1A5FH 3DVGA 1E28A 5J1SC 4PGEA 3UO1L 3VJ6B 3IAQA 2GSGA 5F9AC 3T08A 4IOFC 1W72L 1BD2E 4LSUL 1YPZF 2BJMH 4OM1L 1I3RB 3ARZA 1SYSA 1EFXD 3EYUL 1PKQB 3T0EA 5FYKL 5F1IA 5T3XH 1KB5L 4M9PA 1NL0H 3Q5TA 2ZPKH 3RWHA 3BGMB 4RDQF 1T20A 1T66C 3L1OH 4ORGA 4GH7B 5GRWA 4GRWH 1VHPA 4Y4KD 1K6QH 4EDXA 1YN6A 1IL1B 3MRRA 4GAGH 4X5WB 5C0CE 2H26B 4BFIB 2HMIC 1AP2A 3VFPA 5GHWL 1GGTA 2P8MB 1CT8B 4NT6A 3WYRA 4Q9RL 4S11A 3TNMA 5FO8B 1HEZB 5I76A 1UZ8A 2WUBH 4PBWD 2PYEE 1QZ1A 1OLZA 4JB9H 2PO6D 4FQLH 2Y06L 4O2EA 1RZKL 3FMGH 4XCYB 4LPWA 3SDCA 4PJFE 2ICEA 3UYRL 1W0WB 1XIWB 2C9AA 2HP4A 2ZOLA 5HGHA 3TNNA 3VGEA 2F53D 5I71B 4NQDD 2NXYC 4M62L 5GGSA 4LCWB 3DX6B 3LEYL 1M05B 3T4YA 1YDPA 4HT1H 4KPHL 3CFEB 4HFUL 1M7IA 2EIDA 4FFZL 5TE6L 5HHOA 3T2QA 5FFLA 3B9KC 2P7TA 1LK3H 1KCVH 1KIPA 5EUOE 2ZUSA 5F7KC 5F8RC 4CW1A 1N64H 2J8HA 3FFCD 3OF6D 4JGUA 1HSBA 2CXGA 1EUUA 1U2HA 1OVZA 2Q6WB 5C0ND 3OX8B 4HKJB 5JOPE 5DC9B 4JFPA 4G8IA 1BZ7A 1QR1B 1KBGH 2PUQT 9CGTA 3CIQA 1ORSA 3RI5K 5CILH 1P84K 5GGVL 4NJ9H 4YHIB 1WF5A 1FZOA 4L8DA 1Q9KB 5AZ2H 1YNLL 3M45A 1A0QL 1VFOA 2R0WH 4H25B 2HT4C 2W59A 4JO4H 3KHOA 3H7BB 1HILB 3GKWL 3SY0A 2GEEA 4WTZG 3MOBH 5EBGA 5EBMA 3QT2A 4QGYA 3VFNB 1FPTH 1JCKA 4NGHL 1RUQH 3GSWA 3MV7B 5KZCD 5CIPB 4Z7VF 3GMOA 5IW1B 1ZANH 4F9PA 3EW3B 1HCFX 4G6AC 1EPFA 1T7VA 4JY6A 2B4CH 4FXKB 4AG4L 2N1KA 4F58H 5E00A 1IM9A 1YNKL 2IALB 2Z93B 1YNTB 4OLVH 4LOUC 4F57H 3OSKA 1MCWW 5JPNA 5TQ2H 4UOW1 5E94B 3DV6A 4HH8A 5CUSH 5D7IF 1YEGH 4H1LB 4HKBA 1AJ7H 4D9QD 4HWZB 3BIKA 4PJCA 2YZ1A 3U0WH 3HTLX 4QTHA 1E27A 1YMMD 2IAMA 3HE6B 1F4XL 1XCQB 4NZUL 3Q6GH 4DZBA 3SOBH 3OV6A 1F90H 4TVPH 1R5WB 1ULVA 2NCMA 1NCWH 3V52H 2H2PD 1IT9L 1A7RL 2FEDC 4G6KL 3PHQA 4JO1L 3HAEH 4JFEE 4CVXB 1SEQH 3FQNA 1T5XB 2HG5A 1OL0A 4KKCC 2QLVB 4CJ0A 5J13B 1FYTB 1XGRA 4N1EA 1XZ0B 3BPLB 3BKJL 4KMTH 1X5ZA 2W0PA 1RMFH 3DWTA 2OZ4A 1MFDH 2YA0A 3R4DA 4JRXB 4YC2C 4ZAKA 3K8MA 3LQAL 2UUDH 1WT5C 4XNXH 4U1JB 5C08E 4XNZB 3QUXA 5J57B 4Q9CA 3RIFK 5EUOA 4OZHE 4X8JB 1NC2A 4JY4A 1RJYB 4NUGL 2F54D 3H0TA 4EJ1C 4F3FB 1UACL 4QXTA 4Y1AD 3JTTB 1LP9F 2D9CA 4TRPL 4K7FB 4U3CA 3HI5L 1DBKL 5HI4D 3ZTNH 5I1KL 5E1AA 2CJUH 3B2VL 3DXAD 3ULUF 3CDCA 3KPMA 4YIQA 3M17B 2P5WB 2BK8A 3IT8D 3LY6A 4YBLB 1QFWM 1YJDH 2AVGA 1S78D 4OCRH 3STLA 2B5IB 2OTWA 4GKZB 4PP1D 2IQAA 5LWYH 4XRCB 4M02A 3KJ4B 2DQGL 3LVEA 1KJVA 3RJQB 5C0JB 1RZKC 4PRPA 5DMIL 3VDAA 1A7NL 2ADIB 4WHTB 1H0DA 3RZCC 1DCLA 3H42L 4DK6A 4UB0L 4OAWA 4F8QA 4MX7B 3MLTA 1TNMA 2X4PA 5IBUB 1I8IA 43CAA 5JR1L 3MRMA 2CDFB 3UXFA 5JPMB 1S9WB 4QKXB 2M2DA 3KDMB 2DQDH 1CG9A 3AU1A 4S1DD 2VTFA 5LAXA 2F8XC 1XAUA 2OR8A 2AEQL 3VG9C 3RRQA 2GJZA 1IC5L 1IAMA 4FTVD 2P8PB 3OKEA 1F3RB 1QBLH 2GCYB 4JAMA 1MY5A 2CK0H 4M9OA 1VENA 1F3JB 4H20H 5DS8B 3EO0B 5DHYA 1YYLH 3BRGC 2Q8AL 4KJWC 4Q6IB 4EOWL 4Y2DA 3Q5YA 3QQ9C 3FTGA 2AJYL 4L5FH 3CC5A 5F70A 4PB0H 5EULV 4Q9QH 1TZGL 1IAII 2R29L 1VB9A 1QSEE 2F9BT 2Z91A 3O2DA 3I2CH 1P6FA 3LN9A 5IOPA 4MDIA 3WJJC 5KS9A 1AKJD 3QZWG 2J5LC 4NC1C 4NRYB 4KHXL 3SO3C 3QA3A 4HUXA 5J4MA 3O2VL 5A2FA 2RGSA 3BXNA 3ARDB 1YEFH 3HNVL 4JFEA 5I1JL 4W70A 2K1MA 1T0NA 1QFWH 5DA0B 4XPGL 1IM3A 1ZMYA 3L3IA 4OI9A 4XX1E 4Y0GA 3H6JA 4XBPA 1HHIA 1ZOXA 3GSNA 4FP8L 4PBXA 5D4QA 4DAGL 1GH7A 3RDTC 1JIBA 1LQSR 4JHWL 4LQFH 4PGJA 5EC2B 3PXHA 4OV5A 1EZVY 2IH1B 3BMVA 3PQYD 3MUGB 1S3KL 2ADFL 3CVIH 3T0WA 1ZHLB 2YD6A 5LXGL 2BVQB 4MQ7B 5GS0D 2PTVA 1CVRA 5L7XL 1E4KA 1LO5A 4XWGL 1I9EA 3MV9D 3PV6A 3S37X 4ZFZA 2C5DC 2X9WA 4OCXH 2D03L 1UCTA 3ARGD 4R7DA 1DBBH 1JWMB 2R2EA 1AQDA 2HT2C 2C3VA 5I17A 1CZ8H 4P46A 1DL7L 4XNQA 1SM3H 1GL4B 3TA3B 3O9WC 4KRPB 1TIUA 3VJ6A 2XQBL 3UTTB 1QRNB 3QDJE 1QFHA 5MP6L 3R8QA 1RVFL 4L4TB 5SX5K 1I3RA 3AMKA 1J11A 3GBNL 2GTWB 5HYJB 1CGUA 2QSQA 3BP7B 3JSSA 4R2GD 1BBDH 2FWOB 3ZE0F 4ORZC 1F4YL 5GRJH 5HHNB 5I66B 4WEBH 3UTOA 1RZIA 4I3GA 3GHBH 1IL1A 2COQA 4X5WA 1D9KD 2OL3H 4N0UE 4NM4H 5DZOA 4BFIA 4BJLA 3SGJC 3QIBB 2P8MA 1CT8A 3RL1B 3E6HA 3C08L 2R4SH 2NY6C 3D87B 3OXSB 5FO8A 1HEZA 5IB2B 2OI9C 4ZD3L 4BK4A 4Z7NE 3MJ6A 3MUJA 3DVFA 5D70H 3EDKA 4XPBL 4XVTH 2ICCA 4XCYA 1W0WA 1XIWA 3HG1D 2A73B 3JWOC 3ALXA 4ZTOH 4U6YB 3GO1H 4PYHA 1NGPH 4YWGH 4G3YH 4V1DD 2O5YH 4LCWA 3RWGB 5ITBL 3DX6A 2VZ1A 4RMSA 1M05A 1U8JB 1KTLB 3CGTA 1EO5A 5JXAH 1EZVX 4PJFF 4ODBD 3CFEA 2QEJA 3WS6A 1E4XL 4RMUA 4OLZH 4RQQA 1RI8A 1YQVL 1ZWIB 1KIQB 4CVZA 4J3WA 4AIOA 2X4TB 3ALWA 4FZ8H 1XF5B 2MJWA 4XCCH 1PVHA 5DTFB 3AB0C 5HDLA 5ITFB 1WUNT 4NUJB 4MXWH 1H5BB 5D7JD 1FFRA 2Q6WA 5EOTB 1CLYL 3OX8A 4LHUA 1B2WL 2ORBL 4HKJA 3QUKB 4IRSD 3O4LD 5BW7A 4CN1A 1QR1A 1CN4A 5CZKA 4NQDE 2P5WE 2OJZL 1H8NA 3RY6C 4P3WA 2Y25A 4JKPL 5DR5L 2B1AL 5TQ0L 2MTPA 1Q9KA 4WDIB 4ENEC 2IGFL 5HHVH 1VADB 3QUMH 3VFVB 5E99H 1OTTC 4H25A 4GXVH 3GZKA 1P9MC 4MD4B 5K9QG 5IBTL 1YQ2A 4Z5RB 3H7BA 1HILA 1DFBL 2DQEL 3FFCE 5JXED 2C3WA 3VFNA 5EB9A 4I0KA 3CUPB 35C8L 1HDMB 3ARXA 5CIPA 3V8OA 1RZ8B 2XG5A 3O4OB 5FYLH 3C6SB 1TETH 4FXKA 3LRSB 3WEXB 2JELL 4G7VH 2IALA 4GW1B 2Z93A 5AUMB 3D18B 1YNTA 1QFUH 5SWSD 3IDUA 2EDJA 5E94A 2ZSWB 4H1LA 3C2AH 3BWAB 2IFGA 2W9EH 4JFYA 4HWZA 1A64A 4NP4L 4UUJB 4HF5H 3ZYZA 3NVQA 2J6EA 1F58L 4JZNB 4N0UA 4CN6A 3HE6A 1XCQA 4LPXA 1CFTB 5IVXF 1TJHL 1VGEL 3LS5H 1KNOB 3ZYOA 3O6LL 4WI7A 1R5WA 1FIGH 1CU4H 2FJGB 3V7AE 4CVXA 3KG5A 3MCG1 4KZDL 3IU3B 4HPYH 4XVUD 1MIML 1BAFL 4LCCC 1FYTA 4B53A 2EYRB 1MRDH 1XZ0A 2X9XA 4HKXB 1I8KB 4JRXA 5AZEL 4D9QE 1CXFA 5I75B 2HT3D 2M8XA 1QACA 5E95B 4U1JA 2GK0A 4Z76B 1OARL 1IFHH 4POZC 1YMME 2VAJA 4X8JA 4HJJH 4EIZC 1JHLL 1RJYA 4MNQD 4ODTL 2WWMD 2BOCB 4F3FA 1FBIL 3JTTA 4OLUH 4OQ1A 5F9JB 4WU7B 1YUHB 4K7FA 4XMLH 4R6UA 4JQVA 4GUPB 1RZJH 2E7LA 4FQ1H 4JM2F 1F8TL 2P5WA 2I25N 5SV4A 3TJEH 5K9JL 3P77B 3MJ9A 4YR6B 5I1DB 2PXYD 4GKZA 4BM7A 1ZLVH 5CZXC 4XRCA 4LNVA 2X89D 3OG4B 1MCDA 3F8UB 4V2BA 5DJXB 5C0JA 5CINL 3C8DA 3I9GL 1MJ7L 3ARYA 3QO1B 2ADIA 1F6FB 4WUKL 4WWKC 4WHTA 2Z8RA 2DQIL 3CDFA 3QG6B 1CFVH 2F54E 3C6LD 3VGFA 4OSUH 4MX7A 1MOEA 3QPXL 3RUGB 5FA3B 5D5ME 4F33B 2CDFA 2JJTA 1JHKL 1Q0XL 1A5FL 3BGFB 1S9WA 1BQSA 5DD5H 4CADB 5JPMA 3V2AR 1NMAL 1KXVC 3SQOH 1SJXA 5HTSA 2DBJA 3DXAE 4MJIB 1V3KA 2VKWA 1AD0B 4Z7OE 2WANA 3TJHC 2BJML 2R0ZH 2NY3C 4G6JH 5MENB 2P8PA 3BO8B 3NMEA 2GCYA 1NL0L 2ZPKL 4TNVF 5CEXB 2APXA 1ZLSL 4PJDB 2H2SD 5BOZG 4RZCB 3HR5B 4K07A 1F3JA 4J2XA 2Z8WC 5BS0B 3L1OL 5DS8A 4J3TA 4W81A 5HVFB 3EO0A 3PHOB 3W11C 4KJQD 1K6QL 2HFFB 4KK8D 4GAGL 4Q6IA 3SJVB 3FT4B 4HKZB 1HXYB 4ZO9A 2EC8A 2QADC 4HLZH 1BQUA 4PJ9D 5AYQA 3K2UH 5LGHL 4HH9B 1GGCH 2WUBL 1I7UB 5EBWB 3HUJB 3BRFA 4IHOA 4JB9L 3J8F7 4NRYA 4FQLL 1GJIA 2H6PB 3FMGL 3N1QC 5KVFH 3ARDA 1CCZA 1JNJA 3KPLB 1VEPA 1TVHB 3V4VH 4YDLB 1J8HB 3KS0J 2CKBA 4GG8A 1IEAB 5HYFA 2E27H 4HT1L 4UI2A 2APVA 1A14H 5AWNL 1KYOK 5EC2A 3MJ8B 3LIZH 2DN7A 2IH1A 3MUGA 3U9PH 1LK3L 1U3HD 4DGIH 2WBJA 1KCVL 2BVQA 4MQ7A 3QUYB 3H9SB 3VFGH 1N64L 2YZ8A 3HPJB 1JWMA 5SV3A 3K74B 4LCUB 1CLOH 1U8NB 3ISWA 5ID1B 1UENA 3WCYA 5JHDD 1KBGL 5LKNA 1ZA6A 5KSBF 4KK9D 1Q1JH 3UTTA 2BNUB 4NQUA 1QRNA 1OP3H 4Z7WF 1TCMA 3GK8H 4OI7A 1P1ZB 5GPRA 4LKXB 5HYQB 5B4MD 2GTWA 3PQYE 3RQ3A 5HYJA 3QXVA 4OIAA 3BP7A 1AR1C 5FKPB 4O4YH 4JO4L 2FWOA 2UZIL 3VWKB 5HHNA 4JFQB 5I66A 1C5DB 2CQVA 3MV9E 1DN2A 3M1BB 1BJ1H 1FYHB 2GY5A 3MOBL 3WKMH 3QXAA 5JA9A 4DOHE 1FPTL 3QI9D 1MPAH 3QIBA 3QHTC 3QIUA 1ZANL 3RL1A 4EN3B 1A1MB 3OXSA 5EWIH 3CDGB 5IB2A 3MLXH 4XBGB 2B4CL 4F58L 2NY0D 4OLVL 4K8RD 4F57L 2X2YA 4JE4B 4UV7H 5TQ2L 1NCDH 3I6GB 4FQIH 2A73A 1IAKB 2F8VA 5CUSL 4U6YA 5D7LB 1PEZA 5IMKB 1YEGL 8FABB 5DGQA 3GMPB 1AJ7L 1T2JA 4M48H 3RWGA 1U8JA 1WTGT 3CMGA 3EOYG 1KTLA 5AAWA 2YPLB 3U0WL 3K81A 1GCFA 2PTTB 5BZDA 1HYSC 5BMFH 3P4LA 5TE4H 5LGJB 1MCFA 3WL9B 1A7PH 1KFAH 4Z7UB 4ZNEE 1ZWIA 1KIQA 4XXCA 1F90L 4TVPL 5MI0B 3RGHA 4UQ2A 3RI5F 1LHZA 3CMOH 1NCWL 1XF5A 5DTFA 1WJ3A 4UINL 5ITFA 3HNSH 2A0LC 4NUJA 4CVUA 3X17A 1SEQL 5EOTA 4JN2B 5I74C 4ERSH 2FH8A 3QUKA 3S6CA 3HG1E 5C0EB 1WIPA 2EDOA 1QR4A 4KMTL 3UJJH 1KGCD 1RMFL 2W0LA 1MRFL 2QR0A 1MFDL 4V1DE 4YO0B 5BZWB 3ARFB 3QUZC 2WBKA 3JV6B 3VGGA 4XNXL 1MCBA 1SHMA 2V2WB 3MLYH 5C6PB 2XQYG 4IIQC 4AMKH 4WDIA 4O5LH 5FHAH 4P57B 1MREH 4OFPA 4KK6C 5F93C 4WHYG 1JPFB 4QWWD 3STZA 4KKLD 1HQRB 4MD4A 4G9FB 3UYPA 4K7PY 4FFYH 4Z5RA 3DX8B 5D7KD 4GO6B 3T04D 5HD8D 3TFKC 5EU6D 4JGMA 3ZTNL 3CUPA 5JORB 1HDMA 2B2XH 1RZ8A 4I0PB 2LAAA 1I9RH 3O4LE 4LCIH 5TDNB 4FQPA 4XC3H 1YJDL 1UG9A 4URTB 2JCCB 3GMRB 1JN6B 5LWYL 5IV2B 2YR3A 3VRJB 4JFHD 3WEXA 1DLFH 4GW4B 1H8SA 1Z9OA 3D18A 3SKNB 2X1QA 3DVNB 4PJIB 3WD5H 3P9WB 4AEEA 1FSKC 1G0XA 3SDYL 3MLZH 5CBEB 4GMTH 1YEEL 5JQ6H 4KI5F 4EUPB 4U7KA 4UUJA 2VDPH 1EHLH 4JZNA 4CKVX 5E9DD 1HCVA 2ED7A 4U7MA 2DQDL 4N1HB 4FFVD 4YFLI 1EV2E 1QHPA 5BCAA 4WO4C 5DZNA 4P59H 1LE5B 3U7YH 1KNOA 3HMXA 4R26H 1WWBX 3R1GH 2FJGA 1QBLL 4HJGB 4BQ8A 1JK8B 1RIHH 5L2KB 3PGFH 2OZ4H 3VFOB 4U1NB 3IDJB 1BBJB 3FB7B 3IU3A 4H20L 3RIFF 1YYLL 5CHNB 2EYRA 4QY8A 3VMPA 5HGBB 5EZIL 1U8QB 4LK4A 2VXSL 2IANB 4HKXA 4CAGA 1I8KA 5MERB 2NXYB 3ZHLA 3BPOC 4K23H 4YGAB 4L5FL 1JV5B 1QA9B 4PB0L 2VDKH 2DJ4A 3K1DA 2CDGB 2ZP0T 1EIBA 1FC1A 4Z76A 4Q9QL 5C86A 1EGJA 1F5WA 3QDMB 4I77H 3I2CL 4ZSOE 4ZNEA 3QXDB 2XXMB 4PJGE 4HWEH 4K7PX 1JZ2A 2BOCA 1A21A 1MFEH 1N6QL 1RZGB 1YEFL 5F9JA 5JTWA 2AEPH 4WU7A 1QFWL 4UV4H 2CMRH 4GUPA 1A6PA 4XHJC 3L5XH 1G9NH 3BP5B 2AS5M 3GNMH 5DEZA 4RGNC 1FIEA 4HX1B 4JFDD 1GSMA 3P77A 4LQFL 1INQB 2LV4A 4YR6A 5I1DA 4X4ME 1UYWH 2ERJC 1T1WB 3CVIL 1PLGH 1KCSH 1EJOH 5EG6C 4POUB 5F7UA 5DJXA 4P2YA 1ETZB