1GRWA

C. elegans major sperm protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
SVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.6 A Resolution Crystal Structure of Helices of the Motile Major Sperm Protein (Msp) of Caenorhabditis Elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cytosketal protein
molecule keywords MAJOR SPERM PROTEIN 31/40/142
total genus 26
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1grwA00
5IFJA 3FN9A 4Z7OE 4UTAL 1VFAA 3GJEA 1KEGH 4Z7VA 5IFJB 1WISA 3OBAA 1BQLL 1GGIL 2IH1A 1DQML 4UV7H 4LSUL 3HMXH 4PRHB 4XVUD 3OKYA 5KSBA 1FNFA 3KPMA 2E7BA 2BOBA 1UWXK 3HZVA 5DR5L 4D3CH 4M7LT 1CCZA 3QNYA 5GGQL 4LF3A 5GGQH 3V7MA 5T1DL 2AQ3A 4TQEL 2ICEA 4JHBA 1W0WA 4MAUH 4U1GB 3QIWC 5ALCL 5IHBA 2ZUVA 4P3DA 4U1JA 1QP1A 5LGHH 3WD5H 1HH6B 1ZEAH 3AM8C 3JV0A 2KQNA 4NKMA 2ZUTA 4R4NC 4KJWC 4A6YB 4WJ5B 3NBNA 3MMEA 3EYUL 2AJZA 1KJ3L 2XKUA 2D7NA 1S7XB 1NFIB 5FYKL 3MV9D 4IOFC 2QL1A 4LASL 4NO3B 3IDYC 1G9ML 1HILB 1AD9B 1N5AB 1Q0YH 2V2TA 1EJOH 1AD0A 1KBGL 1P2CA 1KBGH 1MF2H 3CZJA 4ZXBC 4OFYA 5CIPB 4X4MA 1KCRH 3V52L 5KS9B 1I8KB 3P3YA 4C54A 5LGJA 1BJ1J 1XZ0A 4MDIB 4JRWA 3KHOA 1C08A 4JO2L 3V7AE 2CJUH 2XN9B 3I3BA 3RUGE 4G8EA 4WV1C 4R4BB 5I8OL 2JKXA 4JJ5A 5HTSA 3B9KB 1T0PB 2YK1L 3MRHB 4K94L 3VXNA 3NFSH 3HRPA 3Q6GH 3G6DH 5IVNA 1ZWIA 3P0GB 5GGSY 1GC1C 5D7IE 4KFZC 3RPKA 4CDGC 4IHOA 1LEKA 5CJ8A 2J8UE 2KDGA 4JQIL 5EIIB 3NCYS 1FPTL 3FB7A 3K4ZA 3RWJA 4OT1H 4G6FB 4L3AA 4JHZA 2A77H 5EUKB 4UUJB 1KXTB 1QSFD 4PJDA 2P24A 4HDIB 1G7LA 4KJPD 3LD8B 4H1LH 5E8PB 5MI0B 2R4RL 1VA9A 3S36X 1KCVL 1NKOA 5EC1B 4I4WB 3TO4C 3ZKXB 3KNBB 5DD1H 1EEZA 1NCWL 5CWSB 4GMSL 4NM8H 1FL3B 4H8WL 3QUZC 4JFDD 5KBNC 3KVQA 5KTEH 1LDSA 1PBYA 1FL6B 2V5YA 4F7PB 3EOTL 2E6PA 4FFYH 5I66A 4K3JL 4JHWL 1YEDB 3BEVA 5TDNA 4K94C 2F5AL 2I5YL 4M5ZL 5FO9A 4P57B 1S3KH 1TZGH 3WHXA 1MCOL 4P5TD 5FIEA 4WEBH 4WUKL 4OF6A 1C5CL 1FZOA 3MZGB 3SGKC 4JZJB 1GOFA 4NQVB 4RWYH 3EHBC 3LSOA 4M7LL 3RTQD 3PGDB 3DXAE 1A7OL 1BVZA 5D7SH 3HE6A 2D9CA 5GGRA 2XWTA 4LLMA 1JHKH 5DC9B 3BP7A 2GJ6E 3WLWC 4G7VL 1ND0A 2OL3B 3U7WL 2YKLH 1P7QA 1K5NB 4Z7QE 2VDMH 5JO5A 3UC0H 1WZLA 5F1NB 1MPAH 4U6XA 4J1UB 1GHFH 4QXGH 2WBJC 3DURA 3RWEA 5J12B 4J3OC 4M6OL 1IC7H 3WUWB 3ZL4L 4Z77B 1CDBA 4X6DB 2YSSB 5IMOA 1V7MH 1O7SA 3ULUL 1NMBL 2BY0A 3OKLA 2PYEA 2H32H 3UTPD 1ZGLB 5FA4B 1DZBA 1JK8B 1U3ZA 2VISA 4GKSA 4QHNB 5HGHB 3MLUL 3MNWA 3LHPL 4PGEB 5HYSA 3FT4A 3QDAA 4JFPB 3HRZB 3ZE2E 4LBEB 4XI5D 4NWUL 3TV3L 1XGUB 5HVGB 2LU3A 3CK0L 4H25B 4YC2C 5ICZB 4PJ5B 4KDTA 5F8RC 4YXLH 1NGPL 3T2NH 5IEKB 1U8KA 1Z5LA 2H26B 4GG6A 4XH2B 3MBEC 2R2BB 1N6UA 5BV7C 1AQDA 1TXKA 2N7BA 2JB5L 3C8KB 3CFCH 3HI1A 4OKDA 4F15B 3V6OE 3QQ9D 2XXCB 2VXUH 1MCWM 3PIQA 1MHEA 3MV11 5FUOH 2H3NB 1GVIA 3PP3H 5B21A 3E3QE 4MGXA 5IMLA 4QRRD 5D96C 5M7QA 2GT9A 3LKSB 1AXSA 4P0DA 3P4OB 4AMKH 4L3CB 3VW3H 4GW5A 3EO1B 1NUDA 2VERN 4F57H 4XI5C 3W0WB 1AGFB 3AAZA 5TQ2H 2C9AA 4PRIA 2W60B 5D7IB 1DVFB 1V3LA 3PP4H 3JWOL 1FH5H 3NZHL 4IM8A 5HHVL 1BQLH 2DM3A 3CDCA 4EJ1C 2FB4L 3ROLB 3RY4A 1DSFL 2OQJA 3IXTB 15C8H 1A4JA 3VFMB 2DM7A 3H9SB 2XOTA 2PYFB 2XWTB 5MEOA 1EO8H 5AEAA 2APFA 2ZOLB 2UWEA 1T0MB 2DKMA 4D9QD 4HAGA 5DFVD 4NQXB 2O5YH 2BNRD 3CLEH 4NQVA 3MXWL 1FGNH 5ETUA 4IMLB 5I1CL 2XTJC 2NYYD 1XF5A 3I2CH 1BBJB 4HIXH 1FNLA 3FHQA 2F8VA 1BECA 1RVFH 4NO0A 5DURD 1RJYA 3PL6B 1MI5A 3CMOH 1DJSA 2YD4A 1J8HE 4FQLH 1FORH 3C60B 4X4XB 3T0EA 4HKZA 2YD7A 5F1NA 3T0AA 3HAEA 2J8OA 3F58L 4WFFE 4Z9KB 3VD9A 1MCDA 5FXCH 1U8IA 1DCLA 4U6YB 3CU1A 3KPPA 1Q38A 3SDCA 2J4WH 1BZQK 1AO7A 4JVPA 1I3RB 5LXGL 3AREB 3RWIA 4W6YB 5F7WC 2R0KL 4P3CH 1PAMA 3IDNB 1S9YA 1T1ZB 3BZ4B 4HIIB 3G5ZA 1BFTA 1L7TH 4G3YH 2AJSL 1R3HB 4HMCA 4MNQE 1KCSL 3MJGX 3WS6A 4NO5B 4YE4L 4M61B 2YBRA 1AP2A 4YDIH 4M93C 3U7YL 1KGCD 2EDKA 1TJIL 1JGEB 1U91A 1LE9B 4YAQA 5IV2A 4GMTL 2EH8H 3QDMB 1G0YR 1IC5H 2VN4A 4HDIA 3BMWA 3KLAB 4DN4H 5HPMB 4N90D 3Q6FB 4I3SL 1ZV5A 2ZSVA 1HCVA 2GCYA 3GBML 3QSKB 2P5EB 1WWWX 5AAWA 3OPZH 4Z0XA 3OGOE 5J13B 4D8PB 3PUCA 1P4IH 2B2XL 3MLTB 3EYFB 4LP4A 1MELA 5CHNA 1DUZB 1KCLA 4FFVD 4F58L 4QRSB 1BGXL 5T3ZE 5CUSL 5KW9H 2K7PA 4GSDH 4UOW1 2UV3A 5CUSH 3MNVB 4Y8AA 5HYQA 5IESH 1OP5K 1WZKA 5J11C 4P9HL 3L95B 1Z6JT 2VR4A 2R29H 4XCYA 4YIQB 1DQQA 4HJ0C 5DMYA 1CICA 5EZLB 2YUVA 4I9WD 5IBUB 2NNAA 3J8F7 4O9HH 4KI5E 5F7MC 3GKZA 5DR5H 3PHOA 1ADQL 5T1DH 3ZE0F 4TULL 3FQWA 5F9JA 3PG2A 5E2VL 2W0LA 5E8OA 1YY9D 3TO4A 2ZUQC 2GY5A 3FB5A 3LCYA 4X7TB 2I07B 3R0MA 3VXOB 1IKNA 3HFMH 1LD9A 3QUYB 4BZYA 2AK4E 3CVHH 1DE4B 2R4RH 3UBXG 3OX8B 5E8NA 3EYUH 4CBPA 1U42A 4ZUWB 5A16A 5EZOL 4KI1A 3D25B 4WI3A 3G5XB 3V79C 1I4FA 3IDJB 5HHMD 3SKJH 3O6ML 4NO0D 1NCAH 4XVTH 1I7TA 1KIRB 4HCRA 1E4XL 4XHJD 1LHZA 3DUSB 4KKBD 2ICWA 4RDQG 3L3GB 2VLRE 4LLQB 5KJRL 4PGDA 4NZRH 3ABZA 4KROB 5I6XC 3SGJC 4K3JH 5L8JB 1O0VA 4P49A 4R96B 4OZHA 3OB8A 1GOGA 2VB5A 1R3JB 4FFYL 3MPCA 4RNRA 1D3CA 5D1QD 1Y6NR 3EOBB 5DC4B 1MHPL 4LLYB 4PJFA 3BHBB 3FQWB 5GGVH 1M7IA 1E4KC 5D9SB 2CMRH 4MNGB 4D9QE 1P1ZB 2D0GA 5EU5A 1A1OB 2D03H 2DOCA 4KGLA 2E6QA 3OL2A 4XPAH 3S3SA 5B3NA 5DTFB 3MCLH 2BFVH 5J0BA 1I1FB 4OCXL 4POZD 3LHPH 5L2KB 3R8BB 3KLDA 3STBA 1V7ML 2OR9L 4QOKB 3X14A 4BQ8A 4OZ4A 2YEZB 4BELD 1QSVA 4L9LA 4E5XA 2NY2C 4JFEB 3VGAB 4GW1A 3QG7L 5ESQB 1LK3H 4Z78B 4GAJL 1CDCA 4S0SD 4N8VA 1DBBH 2PN5A 2VDLH 3MRIA 1M7XA 5E8NB 5EZJB 3FOLB 4OAWA 4JFFA 5CBAA 1V7NL 5I2IA 4PY7A 5DD3H 3C60D 1YYML 5BV7H 4HEME 1RZJL 4JG1H 3U79A 4XP1H 4JO1L 2F53E 3MGAA 4HF5H 3W0WE 1EMTL 2BNUA 1FORL 4RFEA 1T7XA 3B9KC 4ZUSB 1CICD 5EULV 5IJVB 1IQWH 2QQLH 5DJ6B 2EEDA 5EO1A 3QEQE 3SDYH 3PWPB 1M7DB 3T2NL 4CMHB 4LHUG 4CMMA 1IAIL 4I48B 3QFJD 1A2YA 4KXZH 5L8LB 4HK3J 4QEGA 4ODSH 3TVMC 5A43C 4YXHH 3DNKA 4G9FA 5D7LE 2R23B 5SX5K 4ESKA 4PB0H 3H8NA 4YDJB 3WNPA 1OGAB 2LABA 1PJ9A 4TSCL 5CHNB 2A74A 5T33L 1IGTA 2OZ4H 1DSFH 1S7UA 2A74B 1OPGH 3QDJB 3SGEI 3FAWA 2V17H 3QRGL 1ZVSB 1AHWC 1DBMH 1X4XA 3I6GB 1YEEH 4YDVB 1F02I 4YR6A 4NT6B 2ZPKL 2FJGB 1J0KA 1HXYB 2LTQC 3TC9A 4NWUH 4KC3B 4MX7A 3FO1A 2NXYD 4XNUL 1BX2A 3G9AB 2H8PB 3ARUA 3HZMA 1E4XI 5DK3A 2ZCHH 1VKXB 1QNZH 3RGVD 3U1SH 2E7LC 3L3HA 2X4TB 5KSBE 4JGMA 4X7SH 4ZS7H 2X4NB 3ULUC 5D5ME 5D7JA 3SDCC 2FEDC 1INDH 2GCYB 1WFOA 4U7KA 2AXGB 2CK0H 5F6HI 3ZT6A 4Q2ZA 5DEGA 4NOBA 3ARZA 4Y4FC 1T1WA 3D2UD 5C0EB 1PW3A 5IFHL 4QRSA 4DK3A 5B4MC 1AQKL 2FX8H 1EEYA 3ROOB 1A14H 1LE9A 2JLLA 2NXZB 2M2DA 4XCFL 3T0ED 4PJBB 4UIMB 5E5RB 1UFUA 1MF2L 5IHLB 3QIWA 4WWKA 4HWEL 4LSDA 3C8HA 2EYSA 2VTFA 4KPHL 1JRHI 3AM8A 1PGRB 2ADJB 4ZPTA 4CJ1A 3KLAA 2FHFA 4JHAL 5L88L 5E70A 2OQJB 1KB5B 2R56L 4JJHA 1IRAY 1NGZA 3NCEB 3DJ9A 2LQRA 5SWZB 4MA3B 1J8HA 5AG9A 1CQKA 5EC2A 4JM2D 3D9AH 4UT7L 1NBYA 2E8ZA 3VFVA 3PWJB 3VMNA 2R2BA 1TTUA 4FXKB 1JHLL 2LAAA 3CAFA 4YHOH 4YHOL 1HQRA 3BHBA 4L8SC 2IANE 4K8RD 4X5WB 5JA9A 1S7QB 1FNGA 4IIQC 1DFBL 1RFDL 2X1PA 3C60A 1VGEH 3IXAA 2WANA 5BMFL 1XF1A 2X4RB 3LRSA 4IRZL 4PBVC 2NY6B 3QDMD 5A1AA 1MI5D 3L1OH 1UA6L 5I71C 4HS8L 3CCHB 4ZUUB 4LRIA 2W60A 3FFDA 1QKZL 4J3SA 4BK4A 4MCZB 3S88H 1HN1A 2G60H 5H35A 5JW3L 4J23A 5JR1L 1S7TA 5IBLD 1P4IL 1MVUA 4Y2DD 1PG7L 3O9WD 4I5BA 5FGBC 2J12B 4DW2L 2Y25A 1VFOA 4DAGL 4L9DA 4JHWH 3LN4A 5KG9A 3U48A 4WTZG 1W0VB 3TJEL 1KB9K 1UCTA 1ZSDB 2IMNA 3PABB 5JQ6H 4GRLB 2YPLD 5F7DB 5DMJB 2Y5EA 1XF3B 3JTSB 4JO2H 5EOTB 4XH2A 1M6OA 2YMXH 1NH6A 3VXOA 3HPJA 5EU6D 4EIZC 4ZD3L 3FHAA 4N8CL 1ZHKB 2C1PB 2VDOL 5JUEH 4P2RA 4M7ZB 4FQXA 1B4JL 2IFFL 5C70A 2FECL 4U0RB 3VFUB 1OHQA 4XVTL 1YMMA 5DVNA 3QEGL 4PLOB 2HTKC 4I3SH 2HN7B 2ZKHL 3O3DB 3VI4E 1YEDA 1HHJB 4LU5H 3FQXA 4N0YL 5DK2B 2MNUA 1JZ8A 2E27H 2QHRL 5CSBA 1KN2L 2B4CL 4KKCD 4NHCH 1OP3H 4N9GB 4LLDB 1KTLA 3HNTH 1UWGL 3GB7B 4XNYL 4EVNB 4N0UB 3PGDA 5SWSB 4X99B 3TZVD 4YWGH 4NNYA 1FAIH 1FDLH 3QRFM 3QIUA 1SY6L 3RAJL 4TSAH 1HHHB 3GZKA 2DDQH 5EU4A 4LOUD 3UJIH 4EQ2A 2C1OB 3DUHA 5EN2B 5ITBH 1QLFA 1WBYA 3O8XB 4ELME 2BVEA 3QWOB 4F7PA 3K8LA 1UYWH 4I3GA 2WP3O 4WI8A 4OGAC 4K3EH 1J5OH 2VN7A 3EOTH 1MCKA 4Y4HB 2X41A 3WFCL 1QFUL 3I85A 2V7HA 5FA3B 5GS3A 5DUPH 5EO0B 1Q9KA 4Z7WE 5ERWB 5D6DA 1UGNA 1JJUA 4GH7B 2YZ8A 1FVEA 3TWCL 4OLVL 2EDJA 4PRAA 1WC7A 4JRYA 4JJ5B 3WJLC 3EDFA 1C7TA 5DD0L 1QTYT 5L2KD 3I84A 3EYQC 3EDJA 3W2DH 5C6WH 4K9EL 4DGVL 3QO1A 1U8JA 3IFNH 1U92A 3MLXH 2C26A 1HE7A 2YA2A 3M1BA 2VABA 3WFDL 1XCQB 3RPIA 1P6AB 3BPNB 1SM3H 4GKZB 1EAPA 2NX5D 4JAMB 4YX2L 4M6AA 4QXGL 3NVQA 4EUPG 1JPTL 2OXGA 4WWID 4TSBL 5FM5M 3WIHH 4EI5D 1QG3A 4KHTL 5DHYA 4WU5B 3PV7A 2GAZA 4BSVA 4R0LC 2CLVB 5KANG 1S9XB 2EDEA 4ZFZA 4WHYG 5FUZL 2B0SH 3KYOA 1RUMH 2K3TA 1RI8A 2WM0A 4YHYB 4MSWB 3AMLA 4LAJH 4EXPX 2B39A 4NQUA 2VZ1A 4Y2DA 1IAIH 2BSSB 1GYAA 4RCAA 4I4WA 3CZFA 1NL0H 2YXFA 1UB5B 4KQ3L 4NQCB 5B39G 1J1PH 2ARJQ 4FFZH 4P57A 4PJDB 4UNTA 5MENE 1NDMB 4ZPVB 1EBAA 2IF7A 5IVZB 2EE3A 3ES6A 2FATH 2QSCH 5EU7C 1FSKB 2V7NA 3NOIA 3EJZD 5CZVL 2CIIB 3ROLA 1OPGL 3O4OB 4WW2F 4OCWL 5KS9A 4C4KO 4JDVA 5E4EB 2Y7QA 5EO1B 2XWBB 4ZNCD 4HKJB 4PPTA 4MNGA 4QHUA 1T1YB 5I15L 1TVBA 4WW2B 1RHHA 4HXAL 3V4PL 5I1IL 4Q6IB 5LAXB 3B9DA 1M4KA 5SWZA 1T5XB 3RDTC 1EX0A 4Z7UB 3LEXB 3BDBA 2R15A 3RTQC 4XHQA 2ZPKH 1XGYL 3SDDD 4LSPH 3SE9H 3PP3K 4S1QL 1FCCA 2HH0H 4JQVA 3JUYA 3VFTB 3T3ME 2BVOB 4OI8A 3A6BH 5F7EH 4K8RC 4DKFL 2HT4C 4WFGD 5I8CA 2V5RA 2AJXH 5KVMC 3B6SB 3ZTNH 3HUJB 3KPRD 3JUZA 4Z6AT 3MQIA 1D9KC 4Z76B 1E28A 1IEAB 5CP3H 1AQKH 4NQDE 1WLHA 2BOCB 2F54E 2FX8L 3HC4H 4MWFB 4TRPH 1RSFA 3GJEB 4OUOA 2GJJA 1ZAGA 2A6IA 3QHFL 1CTOA 1JRHL 3QHFH 4PJ5E 2FCBA 1Q9OB 3DX6A 5DJXA 5GRVK 1RVFL 3OHXB 1NCDL 3FO2B 3E2HB 1OLLA 3GJFB 1X5HA 5ESVA 3D0VB 4X6FB 2CK0L 2VL5A 4PJEB 1IC4L 3MNWB 5F44A 4HG4K 4C55A 4RGNB 2CQVA 4QNPE 1Q9LB 3ALWA 5TE7H 3DI2B 2VZSA 1DBKL 2CLRA 1E6JL 2UZIL 2XZQL 4C83B 2ZNWA 3ARED 1C16A 2FZ3A 2NXZC 2QR0B 2Q76A 1K85A 3C5SB 3DURB 4LLWA 3EGSA 1JTTA 4QCIB 2F53D 4YK4C 5DDHA 2ZUYA 12E8H 5EG6C 2ARJA 3PHSA 4H0IA 2X42A 3I6LE 4JFYB 1IC5L 4G5ZL 2EYTB 4PGDB 1GGCL 4D3CL 1D6EB 2JJUA 1VEPA 3MROA 5SWZD 2A38A 3ARBC 4S10A 4UQ2B 1J9CT 1RMFL 4M62H 3DLQR 3HMWL 4EBQH 5F7UA 3MV8D 3SN6N 1CD8A 1H5BB 2X40A 3R1GL 1LILA 5IMKA 4MVBD 5E94A 4I3RL 5GGUB 2HRLA 4XC3H 4JPWL 2R2CA 5C0AA 5TDNB 3LKNA 3MV7A 5D1XC 5CD5D 4WI2A 4NC2B 5LKNA 25C8H 1TZHB 5DI8A 4WIQA 5D2NB 1XH3B 1NCAL 5JHLL 3MLWL 2YZ1A 5KSUB 1U9KA 4GRWB 1U8OA 4HUXB 4TNVK 4ERSL 2P5WB 2P44B 3IDGB 5B38A 4K3EL 1MFBL 3GSVA 2BSED 3MYZA 4HQQL 4AEIH 1WIUA 2DBJA 1CD1A 2VLLB 3LEXA 3IDXL 5C0CA 4KJWD 4GXUM 1T7YA 3S36L 1L6XA 4L3ED 4UNUA 5FYKU 4ELKB 4WEMB 3K1KC 1G7QB 5A3IC 3DVNB 1AGEB 1D5IL 4JDVB 4H88H 5JQ6L 3QCUL 5SX5H 3SKJL 4JFDB 3SO3B 4F37K 3OKMB 2YD8A 4NGHH 1F2XK 3HNTL 3QUYD 3OR7A 1FSKC 1WEJH 4OZGB 2A73A 2IAMC 4LVNB 1QPPA 4XVJH 4RMUA 3MUGB 2A9NH 2D0HA 4JAMA 4XPBH 3MRBB 3WIHA 3QDMA 2X1WL 4ETYA 2Y7QB 4NO0B 3GBNH 3EOBA 2G60L 1A9BB 3GSNH 4C59B 3T0XA 5JW3H 2XZZA 4X9BA 1K8DB 5EBLA 3RP1A 2AJUH 3DX9B 4X4ME 3TBYA 4GRWE 1AD9A 1N5AA 3O6KL 5D4QA 1YN7B 1MCPH 2HFGH 3O2DA 5ISZD 3IFOA 3V9FA 5LBSL 4LCYA 1FAKT 2VDLL 4Y16C 5L0QB 3SOBH 1YEHH 5IMKB 2DTML 1NGQL 1M1SA 2UUDH 3MRLB 4ONFL 2X10A 4NZRL 4PIRF 5KSAD 4PRPA 4UT9H 3O0RH 5HVFB 1ZLSH 5T1KB 3AREA 1DEEA 4FXGB 1KPUB 4XRCA 3QA3A 2BSRB 3DVNA 2OCFD 5E99H 2EXYC 2BFVL 3OKKB 5HHQA 5BS0D 5F3HB 2AEQH 4XBGB 2NZ9C 3O2WH 2CO6B 3T1FA 5DHYB 4Z0XB 2WAHA 3NPSB 4XCCL 5D70H 3UAJD 4R6UA 4AIZA 5ADPH 2DLGA 3X17A 2VZOA 1IGIL 1A6ZB 4NOFA 3F65A 3D3VA 3QPXL 4OM1H 4NPYA 1GGYA 5T5NG 2XQBH 3CSGA 4L8DA 3VE0B 2OP4L 1MCSA 4Z7NE 2VZTA 4X7TA 1NCBH 2BVYA 4EOWL 4EVNA 1VESA 2A83A 1H8OA 1I7ZB 2DIBA 2AAVA 3HAEG 1MH5A 4OZFB 2F19L 2YA1A 5LCVL 4E41E 4ZFGH 4YX2H 3IF1B 5HI3C 4UDUA 3X11A 3VXUE 3F5WA 1RAMA 3WDIA 4U4BA 3MYJA 4KUZH 4NNXA 1BJMA 5FCUL 5I71B 1H8NA 3WFDH 4HD9A 3VFPB 2OTWB 3R06B 5I1KH 4KKBC 5GS1B 2VWEE 1D9KD 5FHAH 3F7QA 5D71L 4KXZI 4XNZC 5D71H 3RDTD 1E4WL 4JM2C 3TFKC 1FFNB 2OLDA 3BRFA 1X5FA 1AHWA 5JOFA 1CE1L 3U4BH 4LCIH 5K9QG 5GXBB 1UH4A 1N0XH 2BJML 4Z77A 4JRXE 5L6YH 5AYUL 5BOPA 3KYKL 3F6LA 3U0TA 3MRNB 4TPRL 1U8QB 4NBYB 3ZE0E 5HHXL 3B83A 4KJYA 5HI4D 2OJZL 5IJKA 3WBDA 5IROA 5FF6B 4WUUB 3SE3A 2C3WA 2AGJL 1HSBA 1N3NB 4IMKC 1JPTH 3A6CL 5IQ7H 3LIZH 5MHSE 4XXCC 4V1DB 1S7VB 4UV7L 2K9UA 4ZUVB 5DMGD 5F7EL 1VPOL 5IB2A 3RVTD 2D0FA 2FB4H 5K9OA 5DRZB 2AEPL 1BQHG 4V2CB 1NSNL 1D6VH 4EUPA 5DURB 1CFQB 1JNLH 2E5EA 1W72B 3S96B 4Q6IC 2VIRB 3T08A 5JORB 1HIML 2NY1B 1BJ1H 1NBVH 4LRNH 1YMHB 4RMVA 4LSSH 1MH5B 1WK0A 2UY6A 4JPWH 3LS5L 3KS0H 5DJZB 5F9OL 1U6AL 3TPUA 1U6AH 3WNKA 4P2OB 5D1XD 5CD5C 5C8JA 1CDHA 3QPQD 5C07A 3MO1A 5EUKA 5E8DH 2MKWA 2Y06L 2YD5A 4WI6A 1MWAB 5FO8B 5C08A 3ZYZA 5IKCB 1TETL 1EH9A 2VDQH 1MIML 3PWJA 2CRIA 5LWYL 5IT2L 5I16B 3I50L 1HNFA 1NMAH 1C12B 4MB3A 2W0FA 3LSOB 2DL9A 2DQUL 2BSTB 3CLFH 4YPGA 2J88H 5TH2B 4NQDB 3PV6A 4KVNL 1FHGA 4K71B 4W4OA 3WE6A 4G3YL 4PJ8D 3W11C 2X4QB 4Q58C 4RZCB 3PHQB 2ADJA 4R4BA 4ODHH 3BQUD 3IT8D 4X83A 3C5ZB 1XGTA 2YOCA 2DF3A 4F7TA 5ERWA 4N1EA 4Y19B 5JW4R 3NAAH 3QDHA 3FO0L 4GMTH 32C2B 3FN0L 2M8XA 3P73B 4Q9RH 4QRTA 4LHJB 4MX7B 4UV4H 2BNRB 2WLYA 1A6WH 3OKNB 3MLPA 5D72H 4V2BA 3MV7E 5IK3B 3C5ZD 1QBMH 1HDMB 1P4LA 4JKPL 1F11B 4H8WH 4HH9B 3QYCA 4LLAA 4OKVB 1NC4D 5IF0A 1CXHA 3UAJC 1AH1A 4ELMB 4P46B 3SE8H 4CVUA 1ONQA 3C6SB 3KPSB 3QWRA 5JHLH 4JRXD 4LCCB 4ZOCA 4XPFH 4LLVA 3KWWA 3P9MB 2UZIH 4XP6L 3U9UB 3H9HA 3QUMB 4KMLB 1OP3K 1AE6L 3L1OL 5SWSE 4ZOAA 1LP9F 3H9ZA 4HXBL 1UENA 5GS2D 1JPGB 1GJIA 3JV6A 3O8XC 1HCFX 4NKOB 4OUUB 4OQTH 3VFPA 4DTGL 1T3FB 4AZ8A 3QUZB 3RY6C 1DVFC 1QLRA 1JN6B 4Z7VB 4PRAB 2IAMA 1HEZB 3VFUA 3RWHA 5F6IC 5C9KA 1I7RA 1BF8A 4M6NH 4RDQF 3C09C 1U8HB 1KACB 2KZ1B 3B43A 4QY8B 4F2MA 4G8GD 1UKQA 2IH3A 4R7DB 5ID0A 3VJ6A 5EOTA 2K7QA 4NT6A 3C6LB 4FQHA 5B4MD 1KN2H 3SJVA 1X4YA 2W0KA 3BP5B 4F7CB 4OT1L 4PLJD 5I0ZA 1MWAA 5FO8A 3GBLA 1K5NA 1NMCC 1YEKH 3FQTB 3OKEA 4KROD 1D5XA 3DIFB 1S7UB 1CXIA 3JVGC 1G7PB 5J1SC 5I19H 4P4KB 5FEBA 1DLFL 3VGAC 5E9DD 3BP4B 3LV3A 2XWJB 3I9GL 1FG2A 1QSFE 4M9OA 4IOIA 4HMDA 4LIQH 1ZT4A 4NHUB 4ERSH 1OT1A 1JGUH 2E7HA 4OV5A 3G08B 2EYTA 4FG6D 2X6MA 4P4KC 2I9TB 1CFVL 4WRLA 5DMKA 5DTFA 3T09A 3K4AA 3UYPA 5C7XH 1ZS8B 3PWPA 1MJUL 2PXYC 5IOPB 4M5ZH 1MJUH 5JPMA 2HFEB 2HJKA 2FL5B 1C08B 4HWUA 3WXVH 2JB5H 3MV8E 5MERA 4JRXA 3HNVL 3CGTA 1YUHB 1TTFA 1T04B 3FFCB 2QLVB 1MRCH 1X7QB 4QYOA 5C0FB 1K4CA 5HGDB 1PSKH 3REVB 4PY7B 4PRDA 5L2KA 5EO9A 1F4WH 2ICWJ 2X9XA 4N0CD 4MNQA 3HE7D 1QHPA 1A3QA 4NGHL 3RRQA 2HG5B 2X09A 4YHMH 1WEJL 2AI0L 3QJFB 2AI0H 4U1SA 5KVGH 1MPAL 1YPZA 4JFEA 3RWJB 4M7JL 5C0BE 5T3XE 2R69L 3FB7B 3GEWB 3A6CH 4G8GB 2R2EB 3EAKA 5IQ7L 3BGMB 3F7VA 5HHVH 4MJIB 5K9JH 2NY4C 4L4TB 4HS6A 2PF6A 1MCEA 2XZAL 1W2KT 4PY8J 1S9WA 5I74C 4IRJB 1EAJA 3DMMA 3L3OB 5IFAH 2WBWB 5GIRB 2R1WA 4NKQB 3D25A 3UMTA 4JZJC 5LBSH 1JNHA 1FVCB 1TTGA 5IM7B 3PWNA 1QBBA 5AUMA 4BZ2H 2HKFH 1F3RB 4BH8B 3ARDD 5HDBE 1RZGB 4LSVH 4LCIL 2CLRB 2DWDB 4LMQE 1NLDH 1OWRM 3ZYOA 3HI6H 1IAKB 2WNGA 2BY3A 4HKJA 3BH8B 2OSLA 5DHVH 3T04D 3PWPD 4IMKA 3TT3H 1VKXA 4J7RA 2AV1B 5B8CA 3G6AB 2AQ1A 5HHOA 5FKAA 5BVPL 4HGWA 2AXFB 2G5BA 3ARGD 3N06B 4JDZB 4U1NA 5DUBB 4L1HA 1KB5A 1KB9J 3V6FA 3SKOB 1R0AH 2I07A 4XGZB 4P5MA 4HXAH 3V4PH 3D3VD 4PB0L 1S5IL 5JXEA 4TSCH 4BUHA 3HZKB 4I77L 3IETA 1XGPB 5I17A 5MENB 3O11B 2VLKD 5CEXB 2NY0B 4UDTB 4NQCE 3T4AA 5C09E 4Y1AB 4WUUD 1T5WA 4X9HA 1T1WB 2VXQL 1KPVA 4UTAH 1KEGL 3MRLA 3QULA 1KJMA 5D1ZA 3EHBD 4TNWF 3C9NB 2A1WH 5INDA 3BD5A 1SYSB 1U8NA 2BNQE 1SJHA 1UQSB 2X7LB 4LEOA 1Q0XH 4NN6C 3F7YA 3MRPA 3BYTA 4LPXA 1T80A 1BAFL 1D5MA 1KLUB 4FQIH 4U7SA 4NP4H 4OJFL 3Q1SH 1INEL 4PLKC 4YIQA 5D1QA 1F00I 1MCNA 3GMOA 4JFFB 2MOVA 1KJ3H 1KYOK 2ATPA 8FABA 2YR3A 4GG6F 1FVCA 3GSQA 3MREA 2ARWA 4PJBE 1EERB 4JFDA 4JM2B 1LEGB 2BSSA 3ARBB 5ID1B 2EDFA 2YWZA 3QZWB 4G43B 1ETZB 4Z7WB 1WIOA 2DQIH 4DN3L 3C2SA 1OT2A 3QNXA 1RZIA 4KVNH 5GGSB 1NSNH 5C6TH 1UG9A 5CCKL 3V95A 5DGRA 2PTTB 3AROA 5FKAB 4WFGE 2EEAA 2HT3D 3DV4B 1OTTC 3DMMD 4UU9B 5LGHL 4HZLB 3CFKB 2C1OA 5EN2A 1KV3A 1EHLH 3HFML 3V5HB 1ZA6B 3QQ4B 1HINH 1WAAE 1YEJL 5IG7B 5IW3A 5C9JA 3DROB 4EDXB 2SEBA 1I8MB 2EDTA 4C56B 3FMGL 1YNKH 4TVPH 2DQDL 2XRAH 1RIHH 4KVCH 1JZ7A 2JCCB 2XNAA 1J0JA 3TBSA 3QIUD 4XP4H 1OSPH 1CBVH 3V8OA 4HULB 1H3XA 1PLGL 1TJGH 4Y4FD 3OSKA 5KN5A 1BZ7A 2XKNA 1OGAE 5HDOA 3WS6C 1NFDF 4D0DA 2CUHA 2E9JA 2W9DL 5I74B 4NN5C 4OV5B 1BQHA 2PKDA 1WIPA 4P46C 1TLKA 1FZMB 4NSKB 5GZOC 5KVFL 2YD6A 5DQDL 3EO1A 5TQ0L 3DUSA 3PGCB 3PWUB 4PJHE 3NH7H 4JFOA 5DRWA 2VE6B 1L4IA 1MFCL 4Q97A 5C8JB 4DGIL 1U8MB 4GUPB 4Z95L 4UB0L 4BSWB 3AXLA 5M94B 4LPTA 3MLZH 3FRPG 3HE7C 1S78D 3MX0A 2AV1A 1SJVA 4HEPG 4MHHG 4WEBL 3ILQD 4JGUA 4U2YA 1CLOH 3QCUH 4ZSOE 4S2SA 1JI1A 2JIXA 2JCCF 4P4KD 2WMPA 3WIIH 3JVGA 1CIUA 3WNLA 1VFBA 3MRCA 1T1XA 5IB5B 3ECBB 1REIA 2AK4B 3M1BB 5DA4A 4N9GA 2PW1B 2EDLA 3QJHA 3TYFA 2B20A 3CFDA 4KK6D 4GXUN 2O61B 4HUUA 3DECA 3FAXA 3GMPA 3ZE1F 1NBZA 2YKLL 4UQ3A 3GJFA 1DLHA 5TE6H 1S5HB 3UC0L 4ZODA 1JGUL 1ORSB 4OSUL 1ZTXL 2VISB 4GKSB 2IG2L 1AKJB 3OKLB 4MJIE 4ENED 1ADQA 2AK4A 3WN5A 4S1RL 2QQKH 5D93C 1OOAA 1MCFA 3NFNA 1RIVH 1OGTA 3FQUB 1SYVA 1VHPA 3MA7B 1IM9D 2CH8A 2DQFA 3UJIL 3VH8A 5DT1H 1XT5A 4P2OC 3EO9H 3VH8B 2J7LA 2VOTA 4MXQC 3S97C 3GIVA 1ED3A 3NCBB 2P8MB 3H6JA 3IDUA 4FQ2H 1MSPA 2BNRA 1IQWL 2VZVA 2OI9B 5IW1B 2YD2A 1NGWB 4F2MB 1JMXA 1NGYB 3V6OC 1IZKA 1QBLL 3BN9D 3QQNA 5DYOA 1IJ9A 3ULUF 1KLFA 5H37G 4YXKL 2Q8AH 3VWKA 4MQXD 4JFPA 4PREB 4DQOL 2MFNA 5BJTB 2AJ3B 3MJ6A 4OCLC 1UZ8A 1C8PA 2HLAB 4XB7A 4BFGA 5KVGL 4F8TA 2YPVH 1YN6B 3WO4C 5JIIA 3VXRA 4FQXB 5EIQA 4XPAL 1G9NC 3HE6C 4M43L 4JFED 3INUL 1BEYH 1FCGA 5H37H 1I3RA 2X4NA 3QEQA 3KXFB 4NQCA 3VE0A 3UTOA 2FR4A 1AI1L 3NGBC 4K8RH 1ZA6A 3QQ4A 1IC7L 3GMLA 3VCLB 3VXQA 5E8EA 2FSEA 3X3GL 1CYGA 4IBLT 5KVEL 1BFOB 4KJQD 5KVEH 1TVHB 3M07A 2FEEL 1FC2D 2WBJA 5AD0A 4PJXF 1RZIB 1ZVYA 4M9PA 2RFXA 5HDQL 3VFRB 2VQUA 5C0AE 3NCJH 3DYPA 5IJKC 4M1DL 4H5SB 4MD4A 3LY6A 1IM3B 1INDL 4OZGF 1FYHB 1RJYB 3P9WB 4NP4L 1CFTB 3CIQA 3STLA 4JB9L 4HZAA 3ZDYE 4M1GL 1OP9A 4U3XA 1IL1B 3H3PH 3BKML 3QDJE 4N1HB 1RZJH 3L7EB 4LVEA 3UROR 4LEXH 4DUVA 2GYSA 3DVFA 3GSQB 2BHUA 2N1KA 4FP8H 3TPKA 2J8UF 3VFMA 5I9QB 3EIFA 3D39A 2E7CA 4FQLL 1OAYL 1FYTD 1ITBB 1WTLA 5T1KD 3SDDB 3KPSE 4HIJB 2XQYK 4D9LH 3X12A 1D5ZB 3FB6A 4WEUD 3W81A 3DBXA 4PRPE 3UTTB 1NCNA 4JPVH 2IEPA 2YD3A 4NWTL 4XNMB 1I1YA 4F33B 3C08H 3QEQB 4YEEA 3C08L 2FWOA 4IRSA 3TN0B 3ARFA 2BC4A 4ODTL 2OJZH 3SBWC 3PWVB 1KPRA 1QRKA 1HI6B 2EKJA 1NBQA 2HLFC 2NLJB 4DOHB 4JR9L 5GJTL 1CL7L 3CC5A 4G6KH 4UT6L 1JZ5A 4LSSL 1J87A 2VNCA 1ZOXA 3GIVB 3PNWA 3V0VB 3K2MC 5IHUH 3T4AB 2A6JA 2ADFH 4BQ9A 3PL6D 4RMQA 1FN4B 3HI6L 3HLAB 1IEBB 1IARB 1EPFA 3S8WA 4U1GC 1CLYH 1F4YL 3K0WA 3ZZ1A 2XG5A 3VMPA 2R23A 4HLZG 2WBJD 3WDJA 1GGBL 3WN5B 8FABB 3ZDXE 1Q8MA 5A2KH 4OI9A 1YC8A 2HAZA 1XZ0B 4MDIA 3TVMD 1YEIH 4GQPH 2HLAA 2W0FB 5ANME 5GQBA 1HHJA 4OB5L 3RDTB 4PRNB 4P9MH 2R2HB 3MYJB 4RISL 1KJ2B 2A6KB 3KPQA 3TT1H 4TTGA 1DQJB 1DANT 5CJXC 4OZIB 4APQC 2H8PA 4ODVH 4EDWL 3VRJB 35C8L 4GXVH 5ELIA 1G7JA 3VMOA 2QADC 2ITDA 4KV5F 4YGAB 1FVDA 1R3KB 4OLEA 3OGCB 1YEJH 4L8DB 4XWGH 2OBGA 1CGSL 3TIEA 1VERA 5EUOF 5T3ZH 5KG9B 4X5XB 4PJ8B 1ODAA 4G9DB 1JYWA 1W0WB 5C0RL 3K2UH 4NZTH 4H26B 1Y0LB 3P4MA 4DVRL 3QIBC 3IETB 4XTRD 4MAUL 3QXUA 5E08H 1K4DA 1RZFH 4OGYL 3FJTA 1U8KB 3RGHA 1CXFA 4KK9D 2QBWA 4P5MB 4KUCF 3G5YA 3RGVA 5BVJB 4JFZH 4FS0A 4UT7H 1OCWH 2VLRD 4YHYC 4FZEH 1HQ4A 2JJWA 4X6EA 1NC4A 4QHKJ 3U7YH 2NTFA 4LFHD 5K9OB 4NIKB 2XKNB 1TDQA 3NAAL 4MB5A 1KXQE 2VQ1B 5I1JH 5ILTL 1RUPL 4PJAE 2X4RA 1RIHL 4KVCL 5DJCB 4TSAL 1Q0YL 3BUTA 2BVUA 4YGVB 2JF1A 2HTKD 3PGCA 3PWUA 2J5LB 2FIRT 2GJ6A 3VXMB 4PJ7B 1KCRL 4ALAH 4JRXB 1BOYA 3MLSL 1UYWL 2KUTA 1FV1B 4ZYKB 4G6JL 3UO1L 4IIQA 1JNNH 4B5EA 4CN1A 1IGYA 5EZLA 4N5EC 2JTDA 3WFBL 3KPOA 4MJ5B 4PV8B 2I26N 5GRJL 1JBJA 3G6DL 1MHCB 1BWWA 3L3GA 2XXMB 3EJYD 2WIIB 4P2QB 3AY4A 3CH1B 4GOSA 1FG2B 3BO8B 3AB0C 3BGMA 2IPTH 4P4KA 2FLRT 4RGOL 4ZFOA 3A6OA 3IFNL 5J9PB 1FL5A 4MB4A 3CFBA 1RJLB 3CFJA 4MMZC 1BZ7B 1UJ3C 2ZKHH 2ZCLL 4LPUA 1A8JH 1I75A 4E41D 2RR3A 5HPMA 1A1OA 2G5RA 3WYRA 1YN7A 4JQXA 3C6LA 1B4JH 3BEWA 2BVPB 3MZTA 3VFNB 2NY7L 1INQA 4Q2ZB 5DEGB 1TJHH 2CD0A 3IDGA 4I13B 3O9WB 4JG0L 4YO0A 1KJVB 2HTLC 1PD6A 5FGSA 2ITCA 1FIGL 4ORGB 4P2YA 3HG1D 1QQDB 5L2JB 1FIEA 3FT3B 5FUZH 2B4CH 3JTTB 2QQNL 4KKAC 1YQVL 2NCMA 3U36A 2R9HC 2VKXA 4NUJA 5KVDH 1X5YA 1K3IA 1MRCL 5DT1L 4GAJH 3ULSA 1TZGL 1MCOH 3H7BA 4PJBF 1QSFB 3HAEH 1FJ1A 4BFEA 3TJHD 1CFVH 4ZTPL 3H9HB 5ITBL 1MY7A 2YUXA 4LSTL 1RD6A 1BIHA 1ONQB 3KPSA 3VXSD 1LEGA 1ULVA 2R69H 2CLVA 3VRLE 2GUOA 1X4ZA 2PO6B 2AP2A 5DO2C 5BZDB 2WWKT 4QHMB 1V5JA 4XPGH 2H9GB 3SJVE 5DD0H 5C0CB 3DSFL 4WO4A 3QPXH 5FOBA 5K59E 1I3GL 2DLIA 3TWCH 2MHAA 1ZT7A 1GZPB 3PDGA 5IQ9B 5I1HH 1MHHB 5J3HC 1A1MB 4YO0B 2EKSA 4I77H 5DJ6A 3AS1A 4Y4KA 3I3EA 1I3UA 1MFAL 1OAUL 1R5WA 2DWEB 2ZZUT 4RGMB 1U58A 4RFNB 4WO4B 4PB9L 4XGZA 3UJJL 2ZJSH 2FYYA 4CNIB 1RJLA 3CFJB 3ME0A 3G5ZB 5E24E 4JO4H 4HGWB 3TH3T 5E9DB 3H9SE 4U6HB 1CF8L 5EUOA 1JNHB 4U2ZA 5ISZB 3JZ7A 4Z7NF 1WICA 4JY6A 1HH9B 2GI7A 1BVLA 3U82B 5HHOD 5BQ7A 4TN9A 1JI2A 1U8IB 3H3PL 5BRZD 3HCVB 2XN9E 4ELKA 4NBZB 3HNSH 4L3EA 4ETQB 5HJ3B 1G9EA 2X4PB 1L9MA 4H20L 4KZDH 3VWKD 3SBWA 3ZHKA 3UX9B 2VH5L 3BYYA 3ESVF 3DSNA 2GITA 1TPXC 2H6PB 1RIUL 1RUKH 2J3SA 2YD1A 2Q6WA 3O3AB 3BUYA 4MJ6B 3D39D 3CNKA 2VXSL 2AGJH 3DO3A 4YGVA 4JPVL 5CZKA 4IRJD 5F8QC 2ZUQB 5HDLA 3RU8H 4FTVA 3REVA 5C0JA 5CEZL 4LSUH 2DD8L 5KZCB 1Y6MR 3UPRA 4CVZB 2EZ0D 3LAFA 1JWSA 4FMKA 4PV9A 2Q86A 4U1HA 3WFEL 2AVGA 3N9GH 1Q72H 5EB9A 3REWB 2HT2C 3RY5A 2AABL 4EI5A 5ACZB 15C8L 1ZT1A 2A6DA 1JWUB 1MCHA 1F90H 4N8VG 3IJSA 4FQIL 3QRGH 4R4ND 1B0RB 3ARDB 4ISVA 5FK9B 1A1NA 4PP1C 2MQ3A 2VAAB 1F2QA 3EDDA 4LRNL 1MHCA 4G9FE 4J12A 4M1GH 5D7LA 4RGND 4MQXC 3L5XH 5FYKH 4LSRH 3LN4B 5DDHB 4KTYA 3ZDXF 4HKZB 4ODUB 4RISH 5CKAA 25C8L 4J2XA 4PRPD 1U8LB 1JRHH 3NTCL 4PG2A 3ARGB 1RJCA 5DZOA 4XMKH 5FB8A 3DI3B 5EOCJ 4M48L 2DLTA 3LS4H 3FFDB 4JY5H 1CK0H 1LP9A 4MQTB 1GH7A 1F6FB 4Y89A 3WIFA 3GNML 4LLMB 4QRRB 3S37H 4NC0B 2DIAA 2OMBA 4WW2C 2X1XR 2VO5A 3FCTB 3SEPA 2VABB 1XR8B 2XWJA 1W72A 5TE4H 4R4FH 1XMWA 4CN4A 3RA7L 3C87A 1L7TL 2HKHL 1EJOL 3D39B 1JWSB 4PV9B 2ERJB 1NFKA 1UJ3B 4H1LA 1AGCB 1AGBB 3JV4A 3MFFB 3VA2C 3DX7B 2AEWA 4WUUE 4M1CD 2P5ED 1K4DB 1BD2A 5DMIH 1CFSA 4WWKC 5ESAA 4RMSA 2NY6D 1N0LA 4N8CH 1OB1B 1OF2A 1RUPH 4X6DA 2C7UA 4MA7L 4JFHD 3NFSL 2MKLC 4GG8B 1QBAA 3GMNA 2A0LC 4PJIA 3MLTA 4S11A 4O00A 2WBJB 1KNOB 5J12C 5AD0B 5K9QI 4AIZB 4HUWA 3ZDYF 2BHZA 1A9EA 4KHXL 3FOMB 3JWNC 1YNKL 4GRMB 5JR1H 4YHZL 1OL0A 2AJUL 4X8JA 2D4DA 4OZGE 3CDYA 4GRWH 2Q7YA 5BW7A 5EIIA 4YJZL 2NX5A 4Z18A 2H26A 3KXFA 1EAPB 2B5IC 3T77A 1CU4H 2NY3B 1M05A 1X44A 1BGXH 4HUMB 43CAA 4WHYH 4LASH 4XP6H 3H9YA 3RJQB 1FDLL 1G9MH 1KTLB 1QFWI 4G6AD 1F6AB 1KCVH 1YPZF 4K7PY 4XZUB 1QYGL 1BPVA 1CN4A 3FOMA 1ZLWH 3T0EC 1CR9H 2Y72A 4PJGE 2P8LA 2P8PB 1ACYL 1UJ3A 4LRIC 1Z9SA 4G7YH 5FKPB 2CK2A 2O61A 1B0GA 5GZND 4CU6A 1Q9KB 4Y5YA 1K6QL 1EHXA 4NQEE 1D5IH 1MCIA 1QFWM 3LKOA 1NDGB 1M71A 1CLOL 3CPLA 1TPXB 2FIKA 4OKVA 3WHE1 3EYSH 4JO3H 4R97B 3L3IA 3L6FB 3PHQA 1WAAF 5EZOH 5GISL 3MV8A 1KNOA 1HWGB 1CGWA 2YPVL 2VAJA 2IBZX 5IEHB 3BP7B 3MC0A 1NCTA 2C3GA 2FJHB 3DBXB 3UTTA 3M17A 3TPUB 2EXWD 1XGRB 3TA3C 4X6BB 3OR6A 1FNEA 32C2A 3O45A 1ZWIB 3MFGB 2BMKA 4MCZA 5F9AC 1RU9H 3ARVA 1QLEL 1ZGLM 4ZQKB 5I1KL 1AKJA 5HYJE 5GSRA 1UCBH 1XGTB 3VXNB 3W9EB 4L4VA 4M3KB 1WCBB 3H9SA 5IUSA 4YWGL 5CGTA 5CEZD 5B38B 2FH8A 3VWKB 1NGQH 2MWCA 4HC1L 2AJVL 3UTZB 3UYRL 1E27B 5FYLE 3GMRA 4M03A 5EPMB 2HT4D 4ACPA 4Y88A 4NJ9L 4RQQB 2KKQA 1IC1A 7FABH 3U9PH 3KG5A 3S5LA 2RFXB 4Y4KC 3MLXL 2I9LA 1P5UA 4JFDE 5I1HL 1QA9A 1WF5A 3EO0A 3O3AA 1VFUA 1IGIH 3L7FA 3LN5A 3AXLB 5CGYC 4M7JH 4OCXH 4XCEA 3P0VL 1I3GH 3PP4L 5ITFA 3U0TB 2R4SH 3O2WL 2YEZA 1CGYA 3U7WH 4XPGL 1NAML 3GB7A 3BXNB 3I6KA 2H1PL 4HKXA 1WJ3A 2GK2A 1OTUC 4OQTA 3N1QC 2YPLE 1CZ8L 3HUJE 3KJ6L 4QXWA 4PRHA 4F57L 1MEXL 2GTZA 2DQHL 4U31A 5DFVC 4GLRH 2GITB 4GJTB 4NUGH 5D8JH 3W5NA 5EA0H 5DS8A 3GSRB 2H2SD 2XYCA 4OZHF 2W91A 5EU3A 4PJFB 4Y5XC 1PKQA 2P42B 5D7KE 2DWEA 3CVIL 4DK6A 1AIFB 2Z9TA 4OM0L 1XIWC 3B2VL 1RUKL 2Y1VA 1UQSA 3GK8L 4V1DD 1MI5E 3B8SA 4PJCA 2NY0D 1DQLH 1KEML 3N50A 4U6HA 4PJEF 5GGUA 4OTXH 3QAZC 1UWEH 1U36A 1KJMB 4Z7WF 4J4PA 3D18B 3QNXB 4MJID 4NC1C 3O6LH 1Y18A 5KOMC 3D3VB 5JMRA 4NJAH 3TCLB 4N0RA 3HKFA 2Y36L 2DLFL 2A0LD 5CD3B 1UXWB 2UYLA 5TF0A 4FTVB 2GQHA 1BIIA 3CSYB 1CLCA 2VXSH 1KUMA 5EUOE 1T66C 1T6VN 2OZ4L 1EXUA 1FZKA 4OCWH 3I75A 3V2AR 5D6DC 1OAXH 5C0CD 4M1CC 1UJTA 2ATPB 1QRNB 1UEMA 5HYFA 5E9DA 3BZEB 1CE6B 3BISA 3QHTC 4FTVD 4G9FD 4WW1B 4PJAA 5B39A 1S7QA 1A6ZA 2R39A 4JFQA 4QHMA 3TGXA 2HYMA 5F1OB 5D7JB 1Q9LA 1SEBA 3P0YL 1B2WL 3OAUH 1QFHA 1BFVL 3P9LA 4JN2B 4UIKH 1BFVH 4L4VD 2V2XA 1N8ZB 4UT6H 2DQGL 3RDTA 2Z91B 3TNNA 3SKMB 4U49A 2DWDA 1YJDL 3SY0A 4U1MA 5JPNA 2QHLA 2F54A 1A6AB 3HZYA 3BRDA 3MUGA 2ILLA 3P30H 4I0CC 5F97E 3RKDD 4J6RH 1N5YL 1VEOA 3BKYH 1GGBH 3NZ8B 2XPGB 1YA5A 1GZQA 2OR7A 1CK0L 5BQ7B 4PJDF 5I8CB 1MUJA 5D93B 5HYSG 3U4EB 4EUPH 3QXVA 4HKBA 5EWIH 4Q9CA 5ISZA 3SDXB 4DN3H 4HPYL 4MJIA 1QUNA 2DQIL 1INQB 1A6AA 3HZYB 2PCPB 4XWOD 3UBXI 5C6TL 1EHAA 3CDGA 5J4MA 5AZ2H 4WU5A 2E3VA 4R0LB 5DF0A 2Y4SA 3DRTB 3QI9C 4R4FL 3FB8A 2NW2A 1TFHA 4L4VE 1IGML 3TBYB 5BS0A 4JPKH 2FX7H 2P5WA 2EKSB 5HYJA 3H7LA 5DLMH 1R6VA 1P7QD 1P7KB 4AEHL 5EU3B 5D7LD 1T2QL 4FQQA 1QSFA 3CDGB 1QSED 1A6WL 3FO9B 5T1LB 1VFMA 1MWAL 4S1SH 1S9YB 4JPIB 2FL5A 4HFWB 1CBVL 5C0ND 3RWIB 4OBRA 4Y16D 4JZNA 5ID1A 1QLEH 3AUVA 1ERNA 1FZKB 4X6EB 2APBA 2EIEA 1IGTB 1MFBH 1TZIA 5F1IB 1DP0A 2H41A 5TF1L 4NRYB 4JG0H 4YPJA 5I1EH 5JNYA 1NCWH 1U3HC 5F93C 1ZHBA 3VXUA 3L5WA 5J13C 3BJLA 3TCLA 5I1AB 3IAPA 4QO1A 3D0LB 3V6FB 3VFRA 4NDMB 4P2OD 5D1XB 1G7IB 2B5IB 2MPAH 3OF6D 2HT2D 3QHZL 2IPUK 4KTDH 1QLFB 1WBYB 4QWWD 3OKDA 2L7JA 4ZTOH 2F53B 2DJSA 1ZK9A 2VLKA 4HWBL 2CIKA 4YFLF 1MREL 4ZD3H 4I18B 1M7IB 2J5LC 5CJQH 5LQBL 5JUEL 4X5LA 4TNVF 1PY9A 4AK1A 1U8HA 1NGXB 4YDLB 1GCFA 2VZ3A 3VFNA 3P11H 2UZXB 3SCMD 4CVXA 1WCBA 1MJ7H 3C5ZC 5TPWH 3BWUC 3NIFF 3GRWH 4XT1C 3RHWK 4XTRC 4FQJH 1KIQB 3QXAA 4M3JA 5JHDA 2CMRL 2CRZA 1DVFA 3QCVH 3ARRA 1A6VH 2XN9D 4LLUA 4N68A 3W39B 3FQRB 1CU4L 2BMKB 2CKBH 5BVJA 1MY5A 5KVDL 1UWGH 3DGCR 4N90E 3S4SG 3BDYL 4MXWH 4O2EA 4YZFE 2A9NL 3B6SA 3UCRA 4GBXB 4O2FB 3NIGE 6FABL 1EDQA 3EO9L 4IS6B 5FO7B 3T1WA 2YN3A 3VXRE 3D2UB 1CGTA 2DBLH 1PZUB 4MAYD 4FQHB 3SJVB 4ZUTB 1ZMYA 5C1MB 3KPLA 3AS3A 1LK3L 4HPOL 3DO7B 5A2JH 2YD9A 1DDHB 3MGOA 3TBVB 3FFCA 4N1CA 5E03A 1N26A 4R7NB 5FECB 4I0PC 3DX8B 4JN1L 3D85D 2BDNL 1TCRB 4JDTL 4W6XB 2W9EL 5HHNA 3MRMA 1Z9OA 1NCBL 3K46A 5FUCC 3QXWA 5HPOA 2HLFD 4IRSD 4PGEA 5HYSB 3ILPA 3LQZB 4KZDL 3P4NA 5JW4Q 4F3FB 1BZ9B 4HIEA 4MAYC 1T1XB 4ZSOB 4ZS6C 5C0BD 5T3XD 2ENSA 4KAQL 2MCG1 1MNUH 4P5TC 1F8TL 5C0GA 1BLNB 5BXFA 4X6CE 2JK5B 1N7MH 4PUBL 1XIWA 3FQNA 4M4RA 3VA6A 4G9DA 5FHAL 4JREC 1F4XH 1YY8A 4PJIB 1MLCA 1CTNA 5IB1A 1E4JA 1M71B 1MLCB 2YS4A 1FVDB 1CZ8H 1HI6A 1CFBA 1JHTB 4R2GC 4OJFH 4NKDB 1YJDH 1HIMH 4JO1H 3RWDB 3NA9H 1G0XA 1NL0L 5JXAH 2OJEA 1NBVL 3STZB 3I2CL 2C3VB 4YFDB 2A6JB 1URLA 4XNUH 3FB6B 2Y36H 4PJFF 3FTGB 4L29A 1VCAA 4AG4H 5IB1B 4XCYB 1U8JB 2O26U 4X9FA 3AB0B 5GSRB 4FHBD 1WCQA 5JHDE 3LIZL 5K9KA 2YPLB 1C12A 4E42A 1G1YA 3VCLA 3VXQB 4HFUH 1OAKL 1S5IH 3G6JE 4JRYB 4QRPA 3VXME 4LPYA 5H94B 5I15H 2P24B 1ZVHA 3Q5TA 3ZLQC 4YXHL 2Z35A 4PLNC 4AIOA 4YHNA 3TBTB 4H5SA 1U92B 4JFXA 1U3HD 2H2PD 3LKRB 4P23B 4LNVA 3WL9B 4XC1L 2ZUXA 3H0TB 5C0BA 2C7UB 4LSRL 2EYSB 4KMTL 1S9VA 2DQFB 3FN3A 4ZXBB 3U1SL 1OW0C 4CUCA 3IJYB 4LCUB 1HYSC 1P4BL 2UWEB 5E2TH 1F90L 3BGAA 3F58H 4RMTA 4BQCA 3SDDA 1B2WH 3SE4A 1BZ9A 1SMOA 5IB3B 5CP3A 1NEZA 2WLZA 4GKNA 5F72S 3BZ4A 2J1KA 4OZHE 3L3JA 3GBMH 4EKXA 3FFCD 3KWWB 3FCTA 4WFED 2OXHA 3GSWB 2F54D 3G5VA 2BNQB 2EC9U 3QI9A 4ELMF 5IR1A 1BFSA 3GMNB 5C0IA 3RIFF 2ZCKH 1HSBB 3P30L 1DL7H 3TH2T 3HUJF 5I30H 5I30L 2EDQA 3BKYL 4GRWF 4MNGE 1NGWA 2CXKA 4JCLA 4WY7H 1G1CA 2YN5A 4LVOC 1LO2L 1U41A 4JY5L 3B8YA 4W68A 4YDIL 1BD2B 1BD2D 3B2UD 5EORH 5CCKH 1QYGH 2APTA 4L29B 2X4PA 4DJMA 1DQMH 3T4YA 1OF2B 1NCCH 3QEQD 4A6YH 4PREA 3BPOB 2R0KH 4U0RC 3P0YH 1DANU 3EW3B 2ORBH 5B38G 3VI4F 1YMHA 2HKHH 3CFIC 3IDMA 1HWHB 3LDBC 2VYRE 1A4KB 4OIIL 2YRPA 1KN4L 1TQBC 1EGJH 4W81A 1QO3B 2VLRB 2IFGA 2P48B 4YHZH 5E00B 2BVQB 4N9OB 2VLJE 1HHGA 4JKLA 3R1GH 4XXCA 3PABA 3H42H 2ICWI 4OD2A 2FDBP 1X5LA 1U93B 2L0DA 4ONHA 1J8KA 3QH3B 4Q9RL 3FT4B 4MS8C 5IB4B 4MA7H 3VFSB 4UDUB 2X4UA 3D0LA 3IKCA 2RCSL 4KDTC 4G8IA 4CU7A 4Q9BA 3WSQH 4DVBB 3OG6B 4O02L 4ZOBA 1VADA 1X5XA 2NY4B 1GC1L 3LKSA 2GT9B 1XF3A 2E9WA 4HWBH 1HYRC 4G6JH 3UTSB 1KIQA 3QXAB 1PX4A 1LO3H 3DRTA 4UUJA 4ODXA 2DN7A 4K23L 2RBLA 3HPLB 1EVTC 3CFEA 4PJIF 3TH4T 1IBGH 4FABL 4LCWE 3KR3L 1ES0A 4M02A 5GGSA 2BDNH 3CSPA 3CVHL 4L4TE 1MVUB 5HHOE 4YHPA 4M7LH 1MJ7L 1WFNA 1QFPA 1YZZA 5C3TA 4AQOA 5E1AA 3QUXA 4QRQB 1KIPB 1WSST 4JQIH 5JMOC 2IADA 1XGUA 5E6YA 3VFVB 2VC2L 2P5WD 4ZUUA 1UXSB 5DZNA 3NCFB 3UTPE 2PXYB 4W4OC 3DV6B 2YA0A 1RUAH 1FZJA 4N5ED 2VDRL 2QJDA 3TBVA 3L5WB 1RUQH 3TO4B 1N6QL 1JIBA 5FV1L 3VI3E 4RSVA 1FIGH 4LU5L 1N8ZA 2E27L 3VFWA 4RA3A 5DJAA 1F45A 3QIBB 2VDNL 2AERT 2V5TA 4JFFD 4GRLD 5FYKD 3LPFA 4HK0A 5FOBB 2DYPB 3OKDB 1MAMH 2A73B 2CLZB 1A7PH 2DQHH 4L3EB 1AJ7H 4R3SB 2EC8A 3C9NA 5JOFB 4Y4FB 1YEHL 3G04B 3SOBL 5D6CB 5DJDB 2X9WA 4FQQB 2Z92B 3LH2L 3QNZB 5ICYB 4H1LG 1ZHBB 1Q1JL 3DYOA 2VZUA 1MUJB 2DMBA 2PO6D 3GO1L 3IRPX 4PYGA 5D5MF 4OZFH 4XCCH 4P5KB 3LQAL 5D70L 5F7HA 2NTSP 5GRUH 2O93L 2B4CC 4OTXL 3WLBB 3SKOA 4CVWA 1S8DB 1EO7A 5ANMA 1GHFL 4KQ3H 5JIKA 3SCMA 3JWDL 1FV1A 4ZYKA 1FRGL 3AGVA 1K8DA 5EBLB 5ACMA 1AXIB 5JHDD 1A9BA 3QEHB 4G6AC 1U8OB 1FE8H 4LHUA 2W1NA 3JWOH 1WGOA 4L5FH 2FD6L 3GFUA 1YYMH 4UILL 5TJWK 5BV7L 4M4PA 3SDAA 3MREB 2XG4A 4CADB 4NZDA 1F4XL 2OL3L 2IGFL 5D1ZB 1YYLH 1TNMA 4C4KT 4ZFOB 4LK4A 5IFAL 3MNVA 4HUNB 4POUB 5HYQB 2ESVD 4N8VB 2ENYA 2CRMA 3CXDH 4G43A 4FQ1L 3CLEL 4UDTA 4QHKI 1H3PL 3VG9B 3CFCL 5ISZE 4DKEL 5DK0B 4PV8A 2VLLA 3QULB 3MXVL 4JKWA 1IGCL 1QRNA 3H3BC 3SDXA 2PXYA 4UBDD 4ODVL 4Z78A 3TBWB 4WWKD 2Z91A 4BA8A 2HFTA 1HXMB 5I76A 4WY7L 2X4SA 4HJGA 1ZLUK 3A67H 5TQ2L 5MENA 1LVEA 4MNQB 5E6IA 3RU8L 3LRGA 2M26A 5T3XH 3D85B 4WFFD 1TITA 1ZLUH 2J8HA 2UYLB 3P77A 4G42B 1J7VR 2WIIA 3TESA 4N0FB 5GRVL 4LVHB 2R56H 5J89A 4DZBA 4HIIA 4R90H 1J0ZA 4QNPF 3PWNB 5JZ7D 3BMVA 4NM4L 1E0OB 1GPOL 3NACL 1NDMA 4ZPVA 4HKBB 2KQMA 4PGJA 5AAMA 1FGNL 4ZAKA 4R9HA 1HKFA 1Y0LA 2AJXL 3P4MB 3WHE0 1CLYL 1F4YH 1KIUA 4PJ9C 1N4XH 4G80A 4RAVB 4B7IA 1D9KB 1ZT4B 4NHUA 3TVMB 1WFTA 3ARFC 5IBLC 2HWZL 5DS8B 1R3JA 3BZFA 3HN3A 1X3DA 3OG4B 4OZHB 2ADGB 1WITA 4M8QB 3SQOH 5GJSL 4YBQD 1KC5L 3ZKMD 2JELH 3V6ZA 1ZEAL 4GFTB 2EICA 4HLJA 1IGFL 3OX8A 1B6UA 4U1KB 3O2DH 5DD5L 4D2NA 1S9WB 5DWUH 3WXWL 4OGXH 5DWUL 1F58H 3WXWH 3OXRA 1CXKA 1UACL 4IOIB 4KJPC 4LKCA 4X6CA 5DJYA 3WFBH 4LAQH 3M17B 3L3JB 3BRGC 1RQ5A 3GSXB 4O4YL 3QO1B 2R29L 4DW2H 3GI8L 4Y5VA 1GIGL 4TUOA 1YJDC 3O4OC 5CILH 2XZQH 4AYFA 1KCSH 1MOEA 1KLGA 3KPNA 5T3ZL 4EIGB 5MEND 1A4KA 3SO3C 1XCTB 4F9PC 4XZUA 3WNOA 4XWGL 3ZSTA 4QRUA 3MUHL 2W38A 2KH2B 3LDBB 1PEZA 1OD9A 2UZYB 4X6BA 2EC9T 3VGHA 3G6JB 2YK1H 4K94H 4LCWB 3QXTA 1YUHA 3T77B 5CEYB 4HS8H 4QXUL 5I8EA 2W9DH 4Y0GA 3LKRA 4QXUH 1J86A 1C16B 2W65B 1EEUA 3VDCA 3BQUA 4KHXH 3CVHA 4EN3C 3QPQC 3QJFA 4U1SB 2Z35B 1X5ZA 2ZSVB 4X7FC 1O7VA 2DQDH 2XRAL 1DFBH 4PJ7E 5CMAA 1SVCP 3O6KH 3H42L 4PS4H 4QRPB 4G8FA 1PYWA 4F58H 1DL7L 5T1MA 4XNYH 5IESL 3FO2A 3UTSD 5EH1A 2QADD 5KW9L 3QI9D 3IB4A 2EIDA 2J8UB 2BNQD 4LLDA 3U46B 2VDKL 4HBCL 1FLTX 5J3HD 4F7EB 2D7PA 3DHJA 3PQYB 4R26H 1HDMA 1P4LB 1FGVH 1VACB 3IAQA 4TUJB 5DQDH 5TQ0H 1VACA 3Q6FA 1OSZB 1GC1H 1MJ8L 3G6JF 3QDJD 3EFFA 4Y19D 3GSUB 1EZVY 2IH3B 4R7DA 5ID0B 2OJEB 2IJ0C 3P9MA 1K6QH 4NC1E 5E2VH 3U9UA 2HA1A 5FGRA 4WUKH 3JTSA 4PJFE 4RWYL 3ZL4H 3WIIL 4U6XB 2ZSWA 3BIBX 1NLBH 2VLKE 3EDEA 1RK1A 4UZGA 1PQZB 4EQ3A 3RKPA 3MODH 1II4E 4ZDHB 4JCMA 3UTQB 1MCCA 4KUCD 2VXVH 1J1XH 5GRYA 3RVXD 1T1YA 2AEQL 1IQDA 4PP2B 1TJHL 4UILH 7CGTA 4LLVB 5CJ5A 2VDML 1N6QH 1A7BA 4FNLH 4KAQH 1A5FL 4MNHA 5L8KB 2E7LA 3PDOB 1JPSH 4LSQL 1SBBA 1XF5B 2EDBA 3BPOC 1I1AC 5L7XH 4P46D 3WIHL 1HZHL 1PQZA 4G8GE 4HUWB 1NGPH 4I2XE 4FG6C 5EU6E 3H0TA 3PQYA 4UQ3B 3S96A 3C5JB 1AGDB 2C3VA 3TFKD 4PJGA 2XIDA 3WN5C 1MCBA 4LKXA 5FDWA 1FO0H 3QUMA 1JF1A 3MRDB 3RWCA 1EFXA 4MJ4A 5GRUL 3O6FB 4P5TA 1VFBB 3MLYL 1KFAH 4MQSB 1KFAL 3U9PL 3SDCB 1OAQH 4QWWC 4XBEL 3BIKB 4E42B 4GKOA 5EC2B 1MRFL 3EYOB 5DSCB 3RZCD 2UUDK 2NX5E 2ZSWB 1Q94B 3TZVC 3MMEB 1FFOA 3MCLL 1AXSB 5MEPB 2NMSA 4FZ8L 3IRZA 1RURH 2BSTA 3BP6B 1T03L 1Z9MA 1K3ZA 4JDTH 3F12B 4I0PB 3VD4A 5L9DL 1S7TB 2Z8VC 4HWBA 2R1YB 2Z31D 3QISA 5I16A 4NN7C 3O2VL 4OLXL 4OCRL 2IALA 4GS7B 3VWKC 4U1KA 3WNMA 4YHLH 3TA3D 3JWDH 3MA9H 2NY0C 2AABH 1T4KB 1RUML 4U6TA 3VW3L 2LFGA 5JHDB 5CINL 4NKDA 1MEXH 3BKCL 1G6RB 5E6ZA 1S5HA 5DHVB 2EDHA 1A4JB 2IGFH 4F7EA 5I9QC 3KAAA 4Y5VB 3Q5YA 4HIXL 2Z8WC 4K8RL 1ED3B 5IGXL 1JWMB 1FNGB 4OBSA 5IGXH 2KL6A 3IU3A 4J3TA 1NAKH 4RAVA 5I1GH 5IW1A 4HF5L 3GSUA 3GIZL 3VFGH 3WFHB 5HGHA 4X4YB 3ZT5A 2HJLB 1NC2D 4GQ9H 2QQLL 4K7FA 3OKOA 5DJ2A 3E8UL 3ESUF 1RULL 1U3JA 3NCMA 3FQRA 1T83C 1UWEL 2BRRL 4A6YA 2BRRH 2MMXA 3U46A 3L3DB 4GLRI 4YDLC 2ZP0T 4KRNA 2GIYA 1TMCB 3OXRB 4HBQA 4LKCB 3O41A 4X6CB 5DJZA 1TCRA 1C5DB 5HHNB 5T33H 2RHEA 3C8KA 3ARPA 1NGXA 5FA4A 3TT1L 1FH5L 3NZHH 3LKPB 4UAOC 2Q8BL 5EFIA 1MHHA 3ECBA 3GHBL 1QHOA 1T2JA 1P84K 1MCQA 1W72H 2ADGA 5JW4N 4HV8B 3BH9B 2YPKA 3Q3GB 3X13A 3VRIB 1YYLL 1I8LC 3T8XA 3RKDC 3GMPB 5HI5D 5IW6A 1MFDL 3VXPB 5CAYB 5FYJU 5F88A 3MJ9L 1YMMD 4NNPL 3QXDA 4JFHE 2FX9H 3HR5B 3K2UL 3OAUL 4B53A 2NW3A 4Z7QF 2IWGA 1LP9B 3MOQA 2DM2A 4JY6B 4Y19E 2YC1A 4MJ6A 4CAGA 3QEHA 3CX5J 2PTUA 4KMTH 2B2XH 3RL2B 4M8QA 3UZEA 3OXSB 4S1DC 5MHSD 4XHJC 1C1EH 5D1ZD 2F58L 2F74B 4I3RH 4XNQA 4R3SA 2BOCA 4XPTL 4KDVA 3B5GA 3OQ3B 4F15C 4K3DH 2GTWA 4YHKL 1HOCA 3KJ4B 3K8MA 1FBIH 4EI6A 1IGJB 2P7TA 1P53A 3RZCA 4XCNA 1IAII 1P7KA 1YEIL 4JZNB 1CD9B 2BVOA 5E8DL 1KPUA 4XRCB 3BPCB 4X80H 5FK9A 4FFWC 3TF7C 1RZKH 5MI0C 3RVVC 1UB6B 4WTZA 5L88H 4K7PL 1FZJB 3L5JA 3BEWB 4MLSA 5AZ2L 3EOYG 5KSAA 1ZA3B 5FM8A 5KS9F 4GSDL 3S36H 1ZA3A 4HUKB 35C8H 4GXVL 1XGQA 4DGYH 5J56B 1AE6H 1UXSA 1ORQA 3WEXA 3X11B 5DJAB 3U83A 3CH8A 3WEXB 2Q1EA 1NBYB 4RGNC 1J12A 1I9IL 4CW1A 2VDOH 2H2PC 4O58L 2UVEA 5EUOB 1EV2E 3BAEH 2EDWA 4Y2OA 4O9HL 1P2CB 5D7IF 1ES0B 4XP4L 1CE6A 1J0IA 1TIUA 4TULH 2VKWA 3KPOB 3O4LA 5D72L 5FYLL 2LVEA 4WV1B 5FYLH 2NY5L 2PW2B 4JKPH 2WV3A 1RMFH 2R1WB 4M62L 3OJMB 4UV4L 3QIBA 3R0NA 3FT3A 1EIBA 4KDWA 3SQBA 4LP5A 4Y4KD 3B2UC 5I18L 4I8DA 5I73C 4GS7C 3BPNC 4OGZA 3S34H 5J57B 3DTXB 3GSNL 3QDGB 4P3WA 1EHNA 4DEPB 5SWQB 4MA1C 3KR3H 1AY1H 1OTSC 2EE6A 4JN2A 4UB0H 2VDNH 5LVEA 3IVKB 4DGIH 1AR1D 2BY1A 3VGBA 4OQTL 1NPUA 2GSGB 5DUMH 3VXPA 3MGTB 1KCUH 2HT3C 4K07A 2IADB 3PJSB 3F7YB 1LO0L 4HV8A 2NZIA 5CLWA 2YMXL 4BYHA 4NFDA 4HUXA 5I8OH 5E99L 4AJ0A 5F88B 3GHEH 4PFEA 3WXVL 1XH3A 2DI9A 2HFFB 5D6CA 3MRKB 1S7RB 4APQA 4M6NL 4U6VL 4LQ1A 3ZTJG 1FYTE 3I6GA 4XMLH 3MOBL 4J8RA 3O4LB 3PXHA 4GMSH 5JDJA 4QT5B 5EDXA 2I25N 3OKMA 5KTEL 4A2LA 3VFWB 4M5YL 1CI5A 3AY4C 5ICXB 3HZKA 4P23C 1WWBX 4C83A 5FA3A 1EEQA 4PGCB 3SPVA 3MRFA 3QFJE 4FNLL 4DWHA 1JPSL 1LNUA 2VL5B 5GS0C 3KLSA 5K9JL 3KPRA 1UM6H 4AL8L 5CSZA 4W70A 5JTWA 3QIBD 1NLDL 2UWEF 1I3VA 4LL9A 3TIEB 4I2XB 5EU6B 1A0QL 4KK9C 4B7LA 4P2RE 2EO1A 4X4YA 1F4HA 2F8XC 4PRIE 4UBDC 4HC1H 1T5XA 1GGUA 1IAMA 3PXJA 3O9WA 1F97A 1EXUB 1T4KA 4MQ7B 4G8IB 1JGEA 1U91B 2XQBL 2A6KA 3KPQB 3ZKNC 4JN1H 4M6OH 5AUMB 1S9VB 4AQ1B 4Y5XB 3CFEB 2DM4A 4NJAL 4MCYB 3EJZC 4HS6B 3HNSL 3QZWG 4OLUL 3T4YB 1NANI 3F12A 4U1IA 1R3HA 5AYUH 3BP6A 4WHTB 2NTFB 1J1OH 4XP5H 2ICES 4R2GD 3OGCA 2VXTH 4Y1AE 4WHDA 4LHUD 4G7VH 2NZ9D 2IALB 3L7FB 5JZ7C 2YRLA 4UOW0 4YBQC 4MWFA 2WUCL 2CDFA 3BESR 1J05A 2X1OA 1C7SA 2Y5TB 4YHPB 1H3UA 4WDIA 1UM5H 1PEWA 3HTLX 5MEPA 1FRGH 1B6DA 2OZ4A 3UTZA 3WCYA 4PJ8A 1F11A 4QYOB 3LQMA 5IHZA 2EDYA 4MD4B 1LQSR 1YNTB 1LGVA 1KTRL 4PJGB 5HDQH 2B0SL 4FFWD 3DYMA 1MI5B 3MRGB 5EO9B 4U7MA 3QUXB 3TBTA 2HVKA 3BFOA 2Y9RT 4S1DD 3P73A 1K2DB 3OJDB 1IKFL 3KS0J 3HA0A 4R8WH 1EMTH 1U2HA 3ZTNL 2Z8RA 5CZXD 1FNHA 3O45B 3D0VA 4X6FA 3RFZC 5BO1H 3QUZA 4O51B 1JZ4A 2DS4A 4YHKH 5J8OA 5CGYD 5C2UB 4M00A 3VG0H 5E00A 2OYPA 4YHNB 4DVBA 2JE8A 1ZANL 1RULH 1RZKL 3KDMB 2V2WA 1CDGA 3OKOB 2FWOB 4WCYH 3ZE2F 3OB0H 4LCUA 4LARH 3L5IA 1DUZA 3V6OA 1IL1A 2XWBA 4PRIB 1UC6A 1F58L 5HHXH 4BJLA 4QY8A 1F3JB 3RWCB 1A9EB 2OK0H 4HIEB 5A16B 5IK3A 3VXRB 1W72L 1J18A 2IMMA 1KXVC 1JMZA 2RQ8A 2DKUA 3LS5H 5J6GB 3GMQA 4KRPC 4RFNC 4Z7UF 3GMLB 3EYVA 3O81A 1C1EL 3PHOB 5CIPH 2ED7A 2NY3C 1QR1B 4NZUL 4PJHA 1OGTB 4NZUH 4Y2DB 3GSWA 3U0PB 2FH6A 4TUJA 1GPOH 4CGTA 4NKOA 3S98A 4ZUTA 2Q7YB 4U3CA 1FYTB 3L95A 1A3LL 2J8UA 4OGXL 1Q9WA 4X80L 3L9RA 3W9DB 4BKLA 5HGBA 1JP5A 4F9PA 4TVPL 5F21B 4KROC 4JM4H 4PJXB 2WQ8A 4YQXH 4XNMA 1FBIL 1ZKAA 4KKNA 1PFCA 1RZ8A 3NFNB 4KK5D 5DYOB 3T0WA 4LCCC 2B1HL 5GJSH 2B1HH 3QB7C 4EDWH 3AU1A 3RX5A 3CUPA 3V7AG 4XVSL 3E6HB 3L3KB 5C07B 4X7CC 3QG6B 2CKBA 2P8MA 3Q5OA 1KELL 3U6RB 4PJ9D 1W0VA 4PY8I 1AGBA 4MCYA 3ELAT 3NH7L 5DD6A 3V5DA 3CLFL 1L0QA 4DKAA 1IGMH 5D7LB 1AQDB 1GXEA 2YBRB 1KOAA 3U0WH 1F42A 3WJJC 1KLGB 3KPNB 5T1MB 4KRLB 2Y07H 3RUGA 3QCVL 3HHRB 1ACZA 1QFWL 3KYMB 3HB3D 3I02B 4D0BA 2FRGP 4MHHI 5DLML 2AV7B 2NY5H 3FN0H 3FQNB 4EI5C 3BW9A 3CFDB 3VFOB 4NZJA 2E8YA 3ULUD 1QOKA 1FL3A 5E95B 2CDFB 4ZSOA 2LU4A 5D5MA 5GHWH 2SEBB 1I8MA 4WFEE 1A0QH 3EFFB 4K2UH 4NHCL 5F7DA 5DK2A 3OZ9H 5HXMA 4Z95H 3V5HA 2ZUWA 3S9DB 4XPHL 1G84A 5IHZB 4H1LB 2BNRE 4U3HA 2R0ZH 1L0YA 4FQCH 2R0ZL 4FABH 2G2RA 4HUUB 3S35H 4PBWD 4HBCH 5ETUB 1IAOA 2H2SC 3QIUB 5DRWB 1IEHA 1B4RA 2VAAA 3ULVH 5GGRB 4P9HC 5IROC 1LEKB 1OWWA 1AC6A 2XQYG 4IHOB 5D7SL 3SE3C 2RIKA 4V1DA 1U3HA 4MA8H 3T65A 4NSKA 4OFPA 3QIWB 1CFQA 1I1AA 2PYED 1BM3H 4C56D 3QCTL 4F7MB 3JWOC 3QUML 5DRZA 1BBDL 3OJVC 1QFUH 5AWNH 4O2FA 3V5KB 1MCWW 3MOAL 2X4OB 4CVXB 1OARL 2CKBB 1SYVB 5E6IB 3FO9A 4PUBH 2XNAB 2EDOA 3HS0A 3G6JA 4HJ0D 2VR9A 3CUPB 2PYEB 3DTXA 5CWSA 1BOGA 4Z7OF 4S1RH 3DO7A 1N59A 3PF2A 4OLXH 4RWHA 1F3DH 4QRUB 5F1IA 2H6PA 5AYQA 4K9EH 1SY6H 3MRPB 3QQ9C 3R4DA 3O6MH 5I19L 4QT5A 3MUY1 2CKBL 1B0RA 3ARDA 4ISVB 2GSGA 3TZVA 3NIDF 4KKAD 3LN9A 1EFXD 3OR7B 5DUML 3BSZH 5DVMA 2AJZB 3GMOB 2ATKB 1YECH 2PCPA 4MQ7A 2AK1L 4AT6B 3HE6B 3RZWA 4CW1B 4IRJC 4LSTH 1Q1JH 3OAZK 4FTVE 1ZLVK 1JTPA 5C08D 4GQ9L 2DQEL 1U95A 4OFDA 1H3TA 4R2GB 3IDJA 3MRHA 3SDCD 3DV4A 4ODWB 4ZFOL 1DQLL 2AJVH 3VRLF 4WV1A 2Y6SD 5HBBA 3IFOB 3LRSB 1RPQA 2XICA 3BT2L 3HC3H 5SWQA 4YR6B 3TIDA 4V1DE 2EDRA 1OM3H 2PR4L 2DJUA 4ORGA 1WT5C 2C4FU 3MRFB 3I75B 3VXSA 3TNNB 3MACL 3IFPA 3K7UA 1Z0NA 2E9IA 1XEDA 4PJBA 5IG7A 5D2NA 3CXHK 4ZAKB 1CLZH 1NAMB 5EA0L 2R0LL 3OKKA 4Y5YC 4ZAKD 3RX8A 5I8KL 5F9WC 5FDYA 1SYSA 1U8NB 4XP1L 2OL3H 5KSAB 1NUGA 3ZKMC 1FJ1B 1AI1H 2FJFA 4NDMA 2FJGA 4JO4L 3IFLL 4ENEC 1T5WB 2WUBL 5K59F 3SKMA 2DYPA 4P4RA 3E6FA 2ICCA 4MAYA 2V2XB 1IKFH 1BQHB 1G7QA 1UADC 3PGFH 4X7SL 1MQKH 2FO1A 2O5ZL 3G04A 3H7BB 3WHXB 3HZMB 1ZANH 5E9DE 1AO7D 3TYGL 3QWRD 5IHUL 1IILE 2IH1B 2PTTA 4WCYL 3KPTA 4PJAB 2OTPA 3IVKA 2XA3A 1G9NL 3NCYP 1UH2A 1IGCH 1I9EA 2X4OA 4TNWK 3SGKA 4NRZB 5EFIB 1DBML 4C56A 4Q0XL 4AM0B 1P1ZA 3N85H 3VGEA 4P48A 3GI9H 1NCDH 3MJ9H 2WK2A 5ICYA 3NA4A 5IBTL 4MZ3A 5CEZE 3BE1L 1I9RH 2XA8H 4XCEB 4KZEH 3OXSA 1N64H 4FQPA 4KZEL 2CGRL 4KKLD 3RI5K 5FYLD 5TGBA 8CGTA 3SDAB 5FYKE 4PGZA 3BPCA 1CD1B 3MROB 1FP5A 2IANB 3RZCC 5DVLA 1W8NA 4EI6B 3L5XL 1TJIH 5JW4M 4PTUB 3EOAB 1XFPA 3IFPB 4HS3B 3THML 1DBJL 3QXDB 3QUKA 3MRRB 1ZHNA 5ADOH 5J1TC 5CBEB 2FX9L 3MR9B 1J10A 3TIDB 3UTSA 3MLVL 1I1FA 4OZFG 2MTPA 3MRJA 4DN4L 2VQ1A 3LKQB 4Y1AA 4KPHH 1T66D 1G7JB 5FV2A 4BH7A 2Z0BA 2Q7NA 4K55A 2MJWA 4JFZL 5DMKB 2HG5A 3MJ7A 1UM4L 4XVSH 3MV9E 1X5IA 3Q0HA 4K7FB 4K7PH 5EU5B 3U2SA 1IGFH 2UWEE 2VDQL 4JKKA 1TETH 5DD5H 2OR8A 3O2DL 2ZCKL 4QRQA 5I73B 5TE7L 2NXYC 1MRDH 3BI9X 4XPTH 5MEOB 1N5YH 4P9ML 2FJHA 4YQXL 2O5XL 3LD8C 4WI7A 1JWMA 1RZGA 4F37F 2G2RB 3BZEA 3FOLA 4OAWB 3V5DB 2EIZA 1HSAA 4X7DC 2AJSH 4K71C 4ZO8A 4NQED 5FGCE 4Z5RA 4RIRA 4ONGL 4DCQB 12E8L 1T3FA 1SJXA 3MLSH 1GAFH 3Q2CA 1SEBB 3CZFB 5D5MB 4LLQA 5CJOH 4XB8A 2Z8SA 5KSBB 3EUUA 3TJHC 4XBPB 2C4FT 4BH8A 1UA6H 3Q6GL 2HTLD 4RRPA 5IM7A 2B8OT 1QBML 5TPWL 2WP3T 5KSVB 4OCMC 1CICB 5AZEH 3L3IB 3RVUD 3W9EA 5F7NC 4WGVB 1OCWL 5IB3A 3PQYD 4XNXL 1LEIA 1MCPL 1IAKA 2VLME 3PE9A 4S1SL 2J6EL 1E4XH 1WFUA 2ICWB 2J6EH 3V4VH 1XAUA 1XGRA 2QQKL 3U0PA 2CPCA 5FYJE 4FQCL 4OF5A 3ARXA 1F13A 5JLZB 4ZTOL 4Z7VF 2CRYA 4PP2A 4XAKE 2DIJA 3UJTH 2R1XA 1A7RH 3KJ4C 1MIEL 1J88A 2I60H 2ATKA 5D7JC 4HGMA 5F9WB 4D8PA 4AEIL 2V7NB 4BK5A 3P40A 3IGAB 4R26L 1MREH 1LDPH 3LQAC 4XPHH 3BN3B 3S88L 2I9LB 1H15A 2CO7B 5BZWA 2PNDA 4EN3D 4K2UL 1PG7H 4P23A 1JK8A 3PWPE 5E4IA 2CDEB 1N59B 2NQCA 3IDNA 4MNHB 3RBGA 4HWZA 1JGDA 3IU3B 1JPFA 3HC3L 3DOSA 1B90A 1I1YB 2X4UB 1UKTA 1TNNA 4GO6B 1JN6A 1QFWH 3O0RL 1KTDB 5FYJH 1F5WA 3S4SB 1Q9WB 3MODL 4TTDD 4OD2B 4RGOH 5DRXB 1T2XA 3RAJH 2HVJA 3DXAB 2KPNA 2R0LH 4BZ1H 4F33A 1T1ZA 4OZIE 1SEQH 2VRAA 1AR1C 3I9GH 2WZPD 1SHMA 4RGNE 2FECI 3O9WC 4FRWA 2ZOKB 1A6TB 5EOQH 1A5FH 4OM1L 3SJVD 4LKXB 5FDWB 1RU9L 4UTBL 4YC2B 2OP4H 4JGJA 5GS2H 1A6VL 3C5ZA 1ZXQA 1R5IB 3O6FD 1J0HA 1L7IH 5HY9B 4KY1H 3S4SA