1GS8A

Crystal structure of mutant d92n alcaligenes xylosoxidans nitrite reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVNFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs8A02
1ASQA 2ZONA 5PAZA 1BXUA 2MRYA 4YL4A 2N0MA 1A4BA 1PF3A 1ET7A 3FU7B 1KGYE 2XV0A 1ZIAA 1AG6A 2XLLA 1JXFA 1SDDB 1JVLA 3ABKB 4GY4A 1GS6X 1BXAA 5E9NA 4A2FA 1PLAA 1NWOA 1RZQA 2BP0A 1V55B 4G71B 2VSMB 2OV0A 2R7EA 2MTAA 4ENZA 4YSQA 2DWTA 3PAZA 4KNUA 2IWEA 1ZDSA 1GYCA 2I7SA 3NSYA 2PPFA 2DV6A 3FT0A 1AIZA 3D12B 5LDUA 1XB6A 1WS8A 3WNIA 2XWZA 1R1CA 1XB8A 2VMJA 3QJQB 4DP5X 3T9WA 1PAZA 2BO0A 1DYZA 2XX0A 3EF4A 1JVOA 1FA4A 1SDDA 1SFHA 1SF3A 2YXWA 3PXLA 5A7EA 2YAPA 2B3IA 4G70B 2BWIA 2GBAA 4HHGA 3H56A 3N2JA 4AX3A 1W6LA 2HLEB 2I85A 2EIMB 2GHZA 1AANA 1RZPA 3EH3B 2E86A 3EH4B 2PP8A 1XB3A 2VM3A 4KO5A 4DP2X 2BW4A 3FS9A 1WA0X 2QPDB 2YAHA 4KO7A 4E9TA 5EHFA 1AS7A 4PAZA 2PPEA 2UXFA 2YAMA 1JERA 5F7BA 1BYOA 3WI9A 3WKQA 5I6KA 2UXGA 3S3DB 3NYKA 4KO6A 3MX0B 1JZJA 3T71A 1ASPA 1A8ZA 2VW4A 4G7SB 3UGEA 3QJRB 3WNJA 4G7QB 1L9QA 2DY2A 5F7AA 3S3BB 2W88A 3OD3A 2AFNA 3DIVA 1SF5A 1X9RA 4HCGA 3TA4D 3QPKA 3CG8A 3C75A 2HX8A 1BXVA 5I28A 2UX7A 3NJJA 1ASOA 1L9SA 1PZBA 2XXFA 1ZIBA 3X2QB 4A67A 1ZV2A 1ETJA 1AZNA 1OCOB 3IN2A 1I53A 4DPBX 3NJMA 4NAJA 4YSOA 4DPCX 1BAWA 1BQ5A 1N70A 1NDTA 3AZUA 6PCYA 2FT8A 5I6NA 3SBQA 3TBCA 1SFDA 3IE9A 2IDQA 3NT0A 2PCFA 4BXSV 1WA2X 3NJHA 4YSAA 4BWUA 2I7OA 1E65A 3RYMA 5B7FA 3GYRA 5FC9A 1J5DA 2XU9A 3ASOB 3V9EA 4AKPA 1MDAA 2OCCB 1AZBA 2YAOA 1GR7A 1AS8A 2J5WA 3CVDA 3KW7A 1GW0A 1QHQA 3ASNB 4M3HA 5I5JA 1URIA 3X1EA 2CUAA 3X1BA 1E5ZA 1J9QA 2BHFA 2BZ7A 4E9WA 4GXFA 3S3CB 1AZCA 5I6LA 3JT2A 2YAEA 4W9ZA 2CJ3A 3AW5A 1KYAA 1SHXA 2A3TA 2J55A 2BW5A 1NTDA 4WKXA 5B1KA 3UACA 1BQRA 2XV3A 2IAAC 4KNSA 4HCFA 1PLCA 2JKWA 3WG7B 3FU9A 4DP1X 1PNCA 2PP7A 3H4HA 4E9VA 2EILB 5D4JA 4TXVB 1AS6A 2FNWA 1XMEB 3V9CA 4E9YA 3HEIB 1NIDA 3N55A 2UXTA 4F2FA 1RKRA 1ILSA 3KW8A 2IDUA 5I5IA 2B08A 9PCYA 2P80A 2CBPA 3NP3A 4GP4B 1J9RA 4KNTA 1BQKA 2H5UA 2P80D 1GS8A 5I5MA 3IBOA 3G5WA 1HFUA 1PCSA 1MZZA 4AI7A 3PLYA 3TBBA 2IH8A 1QLEB 5AKRA 2FT7A 2DYSB 3NJNA 1JZHA 4GP5B 1N68A 1A4CA 2QPEB 5PCYA 4P5RA 3HB3B 5I6MA 4P5SA 2H3XC 1KDJA 4DP4X 1M57B 5B7MA 1BEXA 2AVFA 5B7EA 4E9RA 2AANA 1CURA 1NIBA 2IWFA 3NJIA 4E9QA 1JZFA 2EIJB 4YSRA 2QDWA 4AKOA 4JHUA 2OJ1A 2UXVA 2FTAA 3FU8A 2GC4C 2NRDA 3AG1B 4RH4A 2XV2A 4QKTA 1SJMA 2GB2A 3OMIB 4E9SA 2TSAA 1NZRA 2VW7A 1OCRB 4HHWA 2IDTA 4YSUA 2CALA 1HAUA 2QDVA 1GY2A 3OM3B 3X1FA 4BWTA 2FWLB 1PZCA 5B1JA 4A2DA 3X1NA 3FYEB 4GYBA 1CC3A 1AR1B 1PLBA 1NPNA 1J9TA 2AZUA 2H47C 3S8GB 2PCYA 4JKNA 1KDIA 2FQDA 2YARA 1E5YA 2HX9A 4W1TA 3UADA 3ZIYA 3TASA 1OV8A 1NWPA 1PZAA 3FPYA 4GP8B 1JZGA 5AFAA 4BK5C 2XYBA 2GC7C 3CDZB 4G7RB 1EHKB 1M9WA 2XVBA 1NIEA 2EIKB 1E67A 3CZUB 1KBWA 1SHWA 2FQFA 2YQBA 1KCBA 1TEGA 1JZIA 1OE1A 2Q9OA 2VM4A 4DP6X 1IKOP 2YXVA 1OE2A 4DPAX 2LLNA 3NSFA 3IN0A 2YAFA 1IBZA 5D4HA 4YSTA 3UAEA 4F2EA 5B3SB 1J5CA 1CYWA 2DWSA 4KOCA 2IH9A 3CDZA 3JTBA 1GY1A 1ET5A 3BQVA 1OCCB 1KV7A 3DTUB 4UF7C 3ABGA 3AG2B 3FQ2A 3FSZA 3EHBB 4QLWA 3FSAA 4YSSA 4AKQA 1PMYA 5B1AB 3WKPA 4E9XA 1A3ZA 1AAJA 1NIFA 2HX7A 2X88A 4EF3A 1J9SA 1WAEA 2X87A 4YVNA 1IC0A 3SBPA 1QNIA 2HRGA 2CAKA 2J57A 2FT6A 4KOBA 2DYRB 1A65A 4NB7A 4X4KA 1L9RA 1JXGA 2ZOOA 3BVDB 3PAVA 8PAZA 3QJTB 1KBVA 1JXDA 1AACA 1ADWA 6PAZA 2RACA 1TU2A 3PCYA 1PNDA 3S8FB 3QJUB 1FWXA 5I6PA 1CUOA 1EZLA 3UABA 1NICA 4BWWA 7PAZA 2FQEA 3PAUA 5I6OA 3GDCA 5AZUA 2TSBA 4MFHA 2XX1A 3SQRA 2BWDA 2PLTA 4YVUA 4YSEA 4N8UA 3AG4B 1OOWA 1W8EA 2BP8B 2WO3B 3FSVA 2FQGA 4YSCA 1PY0A 2HZHA 4UANA 5TK2A 3T6XA 3TU6A 3H4FA 4HCIA 3FU7A 3QJSB 4F7KA 3X1GA 1ID2A 2JXMA 1IUZA 4K9JA 2J56A 1CYXA 2PPCA 3FYIB 3WIAA 1V10A 4HALA 4Q89A 4A68A 1AG0A 1NPJA 3CVCA 2IDSA 3OMAB 1B3IA 3ZBMA 3QQXA 1UATA 2VN3A 1RCYA 1BYPA 5IY5B 4UAHA 4AZUA 1AZRA 1ET8A 5TK4A 1OF0A 3PPSA 2ZWNA 3OQRA 2BZCA 1W6WA 2PP9A 1MZYA 4DP8X 1FFTB 5ANHA 4A2EA 1KCWA 2WO2B 3NJKA 1NINA 2BP8A 1L9PA 3NSDA 3FPXA 1VLXA 4ZK8A 3OMNB 1HAWA 1E30A 1TKWA 2PPAA 4FA7B 2XXGA 5I26A 1MG2C 3NJGA 2IWKA 1X9UA 1AZUA 3ABMB 1MG3C 2UX6A 4DP7X 3NJLA 3AY2A 1AOZA 2EINB 2Q5BA 3UAAA 3QJVB 4YSDA 1F56A 2JFCA 3U25A 2GI0A 1TEFA 2GSMB 2Y69B 4G72B 2HXAA 1NIAA 1YLBB 1GS7A 3GXUB 3MBWB 2YAQA 3T6VA 3ZDWA 3FQ1A 5B1JC 4PCYA 4BDVB 4L0PB 1WS7A 3NSCA 2WSDA 2AZAA 1A4AA 4DP0X 4CSZA 1JZEA 1L9TA 2W8CA 2XUWA 3AG3B 4HAKA 4HIPA 4A2HA 1JOIA 4Q8BA 4HZ1A 2GIMA 3NP4A 1AQ8A 2FJSA 4NERA 4CSPA 3CVBA 1M56B 3NJFA 4YSPA 1OE3A 4N4YB 5B1BB 2HRHA 1ZDQA 1ILUA 2ZXWB 4M4RB 1T5KA 4JHVA 3SBRA 2BP0B 1SNRA 2VSKB 3DKHA 3EH5B 4A66A 1GSKA 4KO9A 3ZX1A 2R7EB 2Y1AA 1ZPUA 1V54B 2VW6A 1IBYA 2CCWA 3ERXA 3FSWA 4A2GA 4DP9X 4WTQA 4BXVA 1OCZB 2IDFA 2PPDA 3L45A 4FAAB 3T6WA 7PCYA 3IEAA 3FQYA 5D4IA 1WA1X 3ABLB 4BDVA 3T6ZA 1L9OA 1DZ0A 2QT6A
chains in the Genus database with same CATH superfamily
4FCAA 2BHUA 2FECL 3SDCB 5L2JA 2VABA 4HWZA 2D8KA 1IX2A 1TJMA 2P28B 4ANWA 7CGTA 2X9ZA 1RIVH 2XY1A 4V33A 1NEZA 2X4NA 1TCRB 1BZ9A 4HC1H 2R1WB 5BS0A 2L04A 4I9XA 2V8MA 2Y2WA 4Y4KB 5LN4A 6FABL 4HH9B 1BXAA 3UTSD 1KXQA 1NWOA 4GG8B 1V55B 5IMLB 2NX5A 1MHHB 5CSBA 4AL8L 2CXKA 1QWHA 1SY6A 4JPVH 4ZUTB 1E4JA 4WTWA 3RUGF 3PAZA 2FLMA 2E4TA 2Y2TA 1GYCA 3Q2VA 4OZ4B 5ALBH 2WV3A 3N1PC 3TT1H 2NQDA 4I3GA 1J1OL 3TFKC 1J0ZA 1RZJH 4MAZA 5FGRA 3DXAB 3VXSD 4K7FB 5LGHH 1NCIA 3RWHA 4I0CC 3IDGB 3Q2NA 3QO1B 4WI2A 3MNDA 5EUKB 3ARRA 2J8UA 1CVRA 1OKEA 4DP5X 3B2DC 1XH3A 1FA4A 3GHBH 2BX5A 3V9FA 1J86A 4R26L 3I9GH 4ZTPH 1KMGA 5IQMA 3PXLA 4ATWA 2XCMC 1G1KA 2GBAA 4U3XA 3D08A 3T4AC 2DJ4A 1F4WH 3RE0A 2A77H 1A4JB 3FF8A 2Q7YA 2EIMB 2PYEE 4RA0C 4GKNA 4ICWA 3NEOA 3EH3B 1PIFA 2VDQB 2BY1A 1KIUB 5IW3A 1S7WA 3W57A 4LP5A 4OF7A 1P4UA 4U1MA 2LV4A 3DGCR 3D9AH 3VCLA 1B2WL 5CEXB 3KS0J 2UXGA 3AB0C 3L3JA 5E4AA 2WZPA 2VZOA 2NY6D 1LO2L 1GW6A 2ZUTA 5J57B 1CGYA 5MP6H 3MA7A 5IMOA 1MREL 3BD4A 4UYPA 6FABH 1G7IB 4QRSB 1K3IA 4LO9A 2JKTM 1GH7A 4AL8H 3EYSH 4B9KC 2H6UA 1SOSA 5CBEA 1PX3A 2R4RH 5GGVY 4NPYA 1HCYA 2IOMA 2ZNXA 1HE7A 1T0NB 3C87A 1J1OH 3F2LA 4YDVB 3NJJA 3ARDA 3K6OA 3BZEA 3UZQA 1KB5L 1R33A 1U91B 1AE6H 1JWUA 1MLBB 2VLRA 5A6IA 1R47A 3UG3A 2VZVA 3V6OE 4APXA 3SO3C 4NAJA 4OFYD 4HG4J 2X42A 2Y36L 4FJYA 5TDOA 2VTFA 3EW3B 4R26H 4X7FC 5I74B 3SGEI 3VW3L 1IT9L 2QGEA 2KL6A 5CWSB 4P2CG 1QATA 1XTMA 2PXYD 1A4KA 1JGDA 2CDFA 4OLXL 5ISZB 1PY9A 4AKPA 4X6CA 4GKZB 5CEYB 4LSTH 4WENB 4YIQB 1AS8A 1GMIA 3ZRFC 1BFOB 1S7XA 2DEXX 4M48L 5I73B 3SKJL 3EAKA 5C70A 3G9AB 4FTVB 3PWUA 4LBEB 4ORGB 4S2SB 3VXUB 4EUPB 1E5ZA 3CFBB 5CZVH 4GXFA 1FRGL 3KCPB 2UVFA 2VDNB 2GCYA 5BQ7A 1B2WH 2A6JA 4WKXA 4TLKA 3FU5A 5EV7A 5KSBB 1MJJB 5AB9A 4JANB 4UIKL 1LO2H 1T1ZB 2LT9A 4HCFA 3MV8E 1MREH 2NY3C 5E7BA 3WNOA 3PHQA 1ZKAA 5IMKB 1FV1B 2EE0A 3QT2A 1CFTA 3L3OA 4RGNE 3CFDB 4NRXA 1M71B 4DTGL 3WJLA 1YDPB 1FGVL 4LU5L 4ZSOA 5C09A 2C9RA 2F8OA 5DQJA 4F2FA 1H3WM 3U1SH 1HE8A 4FHKA 1NGZA 1C7SA 4UQ2A 4QD2E 5JIHA 1OHQA 1SDYA 1T4KA 3QAQA 3ZE2E 2Q8AH 3WL9A 5DDHA 1OW0C 3TBSB 3D2TA 3PUUA 4KNTA 3U46B 3A5VA 2OJZL 3O8XA 5KJRL 1KB5H 4NNYB 2ARWA 5IFAL 3MA9H 4NHCL 3A4FA 1L6XA 2NQ3A 4MRCA 4AYDC 4XMLL 3ARVA 5IG7B 1KWKA 5I0VA 2HT4C 1RV6X 5C97A 2ADYA 2Y36H 2JI3A 5HGDB 4HHAA 1FO0H 4APQD 4UQ3B 3GPSA 3VW3H 4C4UA 2MQ0A 2DYSB 4G6KL 3NJNA 3ZYZA 2NYYC 4GW4B 1UZ8A 1P5VA 5D1ZB 3OJ2C 4H1LA 4WDIA 3ESUF 1OGPA 3AXLB 4FDWA 1S9YB 4AEIL 3HZMB 5DZVA 1I3GL 5L2KD 5D7JD 4FQXA 5B7MA 1HHHB 1TEYA 3E0GA 5D1XA 2YA2A 3QIWD 4IRSD 4M48H 4Y4FB 1WCBA 2WZ6A 2H32H 2RQEA 3SKJH 1XD1A 2ADGA 2YJQA 1GL4B 4WGKA 2R15A 3QRFM 1FRGH 4PJ5D 1LE5B 3HW7A 4U3SB 4PRDB 4KRPD 4CC4C 3H9YA 4XX5A 4UIKH 1O9VA 5DF0A 4OGQC 4MX7A 1A14L 1IJ9A 1HSBA 4XP6H 5D2LB 4BWTA 1CR9H 4GRLC 1LQSR 3GMQA 2MCAA 2ETWA 1PZCA 3CV5A 4JM4L 3TYGL 3KLQA 4JRXA 4QHNB 4P5MA 4AT6B 4RIRB 4DTGH 3HG1D 5C0BA 1FGVH 1XZWA 4LU5H 4PEEA 2H47C 4EXKA 3MRNB 4N0UE 3QZPA 1QX1A 2HVKA 2JK5B 2OP4L 3CUPA 4GB9A 1AJ7L 5KJRH 2BNQD 2OJZH 2PN5A 2VM9A 4KK9C 5EU7C 4P46D 4Z3IA 5IFAH 5KN5B 2QADD 1S7RA 1BOGB 4XMLH 4BK5C 1MY7A 4M5SA 1KYDA 5A43C 2ITCA 25C8L 1U95A 2FCBA 5B8CB 2XN9B 1W2KT 3HRZC 3IU3A 4WNJA 1BG1A 1NIEA 3GTVA 4G6KH 4Z7OE 1MF2L 2WLJA 3KJ6L 3NSXA 2QR0B 5D8JH 4JK0D 4MJIA 4J12A 4Q4EA 4W93A 3PS6A 3KWWA 4M43L 1BSIA 1UVQB 4L4VE 1IBHA 2X3CA 4G8GA 3TVMB 1FNEA 3BQUA 4XN1A 3MV7A 5EBLA 4MD5B 2ZWKA 3F7VA 4KOCA 3X17A 5FXCH 3ZQWA 3VFSB 4LSVL 3CDZA 5CD3A 2ZAGA 1IIIA 1TQCB 3NIGE 1MIEL 4PCKA 3UBXB 4JPIA 4IIZA 3AROA 1A14H 1CDIA 3MLSL 3M6DA 4N26A 2WJ5A 1EDHA 4JM4H 1U8QB 3NVQA 2X88A 2K3TA 2XVGA 1D7CA 1LMKA 5L7XL 4MA3B 2NXZB 5BUPA 1WWCA 3Q13A 2A1WL 3IVKB 4XODA 1Z2KA 2C4FT 2A9AA 3UDWC 1LO0H 4PUBL 2OP4H 4I4WB 3ZYJA 2P4AB 3ZIMA 2ZOOA 4D9QE 4N2NA 1WSST 4Z7WB 3CN3A 1B0IA 1AJ7H 3KXFB 6PAZA 2V8LA 4EN3B 3HNTH 2ARJB 2CUMA 1CDJA 4C83B 3FB8A 3V0JA 4PJDE 5KSAB 1TQWA 1WICA 2FE0A 3BUYA 2VMCA 3UL4A 2HT2D 25C8H 4KK8C 4PB0L 4BFEA 1F6AB 2Z7ZA 5TDPA 4DGIL 5BS0D 3H1ZA 4Z95L 5I0YA 1K5NA 4HK0A 3VB9A 1AKJB 1OGTB 3BH9A 3NZUA 5F7DA 2X4SB 3KJ6H 5IBLC 1T1WA 4ONGL 4QRRB 4Y9CA 4YPGA 2WO3B 1TFHA 4MMYB 2FWSA 3BGFC 3Q01A 4ONFL 4NBYB 4FYTA 1JHLH 3MLTB 4NQDE 4TVPD 4M43H 3SZ6A 1SJHB 2P7TA 2HA1A 2GJ6A 4X0KA 5SV3A 5C07E 4MXVE 3D4CA 4KKBD 3NFSL 1BQLH 5DWUH 3KPOB 4J3OD 5D1QD 3UYOD 4V1DB 4N3UA 4BK4A 3SDXF 1OGAE 1YMHA 1MIEH 4TLUA 3ZBMA 4XCYB 3HS9A 3K7UA 1JRHH 5GRWA 3KLKA 5DQDL 2DJMA 5TK4A 3JQOB 3MLSH 4Y5VA 3ZMEA 3SKMA 2K8QA 2APWA 4HKZB 4PRHB 5HI5D 4W9KC 5M94B 1XF2B 2X0WA 2BP8A 5L7XH 3U9PL 4XI5C 2NLJB 4PJXB 2F53D 2XQYG 2EO7A 2ZXBA 4PWKA 1KYOK 3HE7C 4PUBH 2WTRA 3T2OA 4DSYA 2XOTA 3CQPA 4U05A 2HB0A 2RJMA 4JFZL 4Z7QF 2GITA 1B4JL 5EU4A 3BFOA 1OTTD 1AZUA 1ZY9A 2CMRL 2YRZA 5KVMC 1NL0L 1G1YA 1GVIA 4M1GL 1DQLL 4PB0H 2G30A 3FN9A 4Y89A 3BWUC 3DECA 4CADB 2JFCA 5F9AC 2BHZA 1YN6B 3OHXA 4M9PA 3ECQA 5ITBL 1O7DE 4ONGH 1NAMB 4ZO6A 3MLUL 3EDJA 2SEBB 2P49B 2ESVD 3QXDB 3ET9F 5B1JC 2WUBL 3BT2H 5IT2L 3WY2A 2DQMA 1LD9B 4EI5A 2UWEE 3IBEA 4PRIA 4WRLA 4ONFH 3V5DB 1Z3GL 4DP0X 3MJ9H 4GAAA 1F0LA 2B3RA 4Y4HB 4JQXC 4DKEL 4Y9GA 4JZOA 3FULA 2DQEL 3HLKA 1IC7L 3NFSH 2O5XL 2DLTA 4Z0XA 5B1BB 2HRHA 2MNUA 1H3VA 4M4RB 1Q1JL 3TN0A 1I8IB 2YLHA 2J8HA 2YPKA 4LPUA 3U4EB 1DVFD 3CFEB 2DIAA 3O2DH 1K3ZA 1KCUL 2WVUA 5DHDA 5DQDH 3NEXA 1HZHL 3EOYG 3IJSB 1EHLL 1NJ9B 1C08B 4P9HC 1YHPA 2A0LC 3KPNB 4OCLC 2PPDA 4LOFA 1W0YT 2JJSA 3FQYA 3UERA 3U9PH 3QYMA 1SHSA 5I8EB 1DFBH 4BDVA 1L9OA 1JUFB 1I4FB 1F1AA 2OMBA 5EU3B 2P46B 1ZMYA 3ABKB 2IAND 2WYTA 1EO8L 1A6ZA 2LLGA 4FF9A 4JFZH 2ZG3A 4LP8A 2NW2A 2WXPA 4KI5D 2JVUA 4LLAA 1UH4A 3KBPA 4NN5B 2NR6D 5DRWB 5GIRB 2CMRH 3KHOA 3GMPA 1NL0H 3C6SB 5JHMA 2YZ8A 5ICYB 4M1GH 3OR6B 1DQLH 2EYRB 3IDNB 2XVKA 3TWYA 3QISA 2LTQC 4QOKD 3FCSB 2J5LC 2AQNA 1HQ4A 5B4MD 4F1SA 4KK6C 1NDMA 2M2DA 4MCNA 1P0SE 3BH8A 5ITBH 3TBTA 1E3ZA 1UHVA 3MLUH 4R0LB 1CFSA 4ZX6A 1N6UA 3ARSA 5IT2H 2WUBH 1AHMA 1HT6A 1IU1A 3GSWA 1TR7A 2UY6A 5DXWA 2Z35B 4XT1C 4P5TD 1Z3GH 4PGEB 1YEEL 1J8RA 4L3EB 4NI3A 1ORQA 4DKEH 1GIGL 1H0DA 2W60B 3OF6D 4PLJD 4PU2A 1PAZA 2DQEH 4HGWB 1SDDA 5I76B 5DFTA 5AB2A 3FT2B 4M8UA 1T0PB 3TF7C 4L4TE 1Q1JH 2QELA 3I3BA 3KBHE 4R7XA 4Y4KD 3CFCL 4GRWE 4QJ4B 1KCUH 4CJ1A 1PG7W 2IPKA 1TFPA 1HZHH 4X99A 4FQ2L 1EHLH 1K4DA 1QA9A 2J1YA 4C59B 4P2RA 3G6JE 1H8OA 1LLAA 4H20L 4X5XA 4NP4L 2Q86A 2X4TB 3QUMB 2CSPA 2AERT 3GMMA 3WLBB 1XCQA 1DO6A 1WA0X 2XXCB 1AS7A 2BVPA 2UXFA 1HYSC 1ZE3C 3BSHA 3WKQA 1EO8H 3BT0A 2ZX9A 3DXAD 3M8OL 4U7SA 3K0YA 5EIQA 1ECZA 1DQIA 2RQ8A 4XPBL 1TVBA 4ODSL 2Y0SA 3CE1A 2YD1A 4LLVA 3B5TA 4N8CH 3SYOA 3L7FA 3RIFF 1BFVL 3GJFA 4AQAA 3RGVB 2Z92A 2PCPB 4DCQA 2GY5A 1R3HB 4JRXD 5JQIB 1KT2A 1ZHNB 3PQYA 5T3XL 2EC8A 1KNOA 1R24A 2CO7A 2YPLB 4DETA 2YQ2A 4UTCA 5KANG 2ATKA 2Z4QB 5E8EA 2PYEB 2O30A 4XO3A 3KGSA 3BUPA 3RRQA 4TVUA 4UCFA 2B14A 3C5ZA 2RALA 5F7WC 5GS2D 4N2LA 4NPKA 2FZ3A 4ECNA 4JFFA 4K71B 1K72A 1GIGH 4WWKB 3MSPA 1HHGB 1X9LA 4JKPL 1S7QA 4F92B 3LH2H 1J88A 2J6WA 2R83A 4KXDA 4R84A 5GRZA 3AS0A 4I9WE 3CFCH 4YSAA 1BVLA 2YGPA 3QIBB 3EFFA 4JW3A 5B7FA 3BISA 2X2JA 1KY7A 3QO0A 3ZDXF 4YBLB 5I6XC 1AR1D 4NP4H 3STLA 1Z9LA 4NP9A 1DQTA 4X6DA 4POZC 4DFHA 2DQIL 1G7HB 5IW1A 1M2VA 2R56L 1NCAL 2AAAA 2Z31A 1FYHB 2EEFA 1HL4A 1KTLA 2BS9A 3K46A 1KLUA 4DEPC 3IDYC 4O2FA 2XPZA 3WUWB 2OCJA 4ODSH 3VQMA 4EKXA 5H35A 4P2AA 5KSUA 1PNCA 1N26A 3WGVB 1BFVH 3B9KD 4TXVB 2FNWA 2X3BA 3OKEA 1XF4B 2EACA 1XGPB 2WYIA 2QVTA 2JLPA 1CD8A 3PWPA 4XXWC 4E5XB 3KVQA 4HW6A 5T3XH 5I5IA 3FONA 3V4VH 4PRPE 3L3IB 4ELKA 1S9KC 4PJAF 5DK0A 5SWSD 3X12A 2IH1A 1IEBA 1JF1B 3O9WC 2F1AA 2MIZA 1JDCA 4FTVD 3QXVA 5A3ID 3VXUD 1FIGL 4LLWB 5GS3A 4DZ8A 3BWAA 3QZNA 4M9OA 4X7TA 4U1KA 2IMNA 4W6YB 5AYUL 5BW7A 1MZZA 5C92A 1I3VA 3TBBA 3BVTA 2R27A 1NKGA 4TQ8A 1R6VA 2Y7OA 1DQQA 1DVXA 5J12B 1F13A 1IB5A 1XCXA 2TRHA 3Q2WA 1MCIA 1JDAA 3MV8B 2NSXA 3VFMA 4P9HL 3RILA 3QDHA 4F3FA 1TXKA 1ADQL 3BCFA 3OR7B 2OMVB 3KPLB 2IWFA 1XMWA 5MEQA 4WSJA 3WIHA 5C8JA 1FNHA 4PVNA 1N8ZB 3EDKA 4FRWA 1BVNP 1QEWA 4NKOA 1MRFL 1GZHA 2FL5B 3ZE2B 2R56H 4RH4A 3IF1B 3WIFA 1NCAH 3VXOA 4YFLF 3G5XB 3QQDB 3LQMA 4TNFA 5GGSA 5EN2A 4ONHA 5ACZA 2ICWA 1FLRL 3V4PB 4OM1L 2IPUK 3R4RA 4NO0A 4HEME 2CLRA 2MFNA 1Z5LA 3VE0B 4OCRL 2YXMA 3VWKA 1QPKA 1JZDC 2N1TE 3E7JA 1WDAA 3WMQA 1BQHA 2IFFL 4NFDA 3II1A 1KXVC 2C4XA 2PW1B 5D1ZD 2YGNA 4L8DA 1WCQA 3EJZC 1HINL 3GSOB 1S7UB 3U36A 3CHSA 1T5WA 1KOAA 2WANA 4FD0A 4AQ8C 5HSFA 2YD2A 5HI4C 3IMSA 4ETQB 3N06B 5IEHB 3NFPA 5T5FA 5JNYA 4FMKA 5F2FA 3T65A 1FIGH 3QUXA 5MENA 3VXPB 3REVB 5AYUH 3X14B 2QTVA 2RH0A 4H40A 1PPIA 12E8L 5AENA 1XGTB 5HP5A 2NYZA 4OI9A 5IK3A 3K6FA 3GMOA 5EBWB 3RIKA 3WAJA 2EDDA 3WJMA 3GLZA 1UXSB 1SXZA 1SHWA 3OAYH 5K9KA 3CBJB 3ULVD 3KYNA 2XWBA 3HC0B 1A7RL 1B2YA 1I1AC 3GTNA 3IJEA 2ILLA 3QORC 4X98A 5JMOC 1ADQH 3JVGA 1A1OA 1G6RL 1OTSD 2LLNA 4M5TA 2I24N 2R2CA 4PTUA 5D4HA 1BZDA 4EI5D 5FS5A 3N9GL 3DVNB 4XPGL 3QEQE 1MRFH 1I7ZB 1A02N 3N0AA 3Q9PA 2JNZA 3FB6B 4WUKL 4IYKA 1RK1A 1KCKA 4LARL 1DANU 3B2UC 3QDMA 3IDJB 1FLRH 4W70A 2QGBA 2PTTB 3DTDA 4OM1H 1O0VA 2A99A 5HYQB 4D7BA 3AG2B 3RDTC 4EVNA 3OTTA 3KLDA 3KBFA 2GFBB 1H8NA 3BI9X 4WHYG 3WLWD 1NIFA 2Z93B 1MRCL 3I9IA 2BSEA 4GNKB 4PBVC 5F70A 1WAEA 2XN1A 2I27N 1VACB 5JHLA 1KPVA 4LKCA 2A9MH 2IFFH 4XNMB 4Z7OB 3WY4A 4QT5A 2WXIA 4LE8A 1HINH 1QG3A 1ZA3B 2VISA 3MJ8A 2OCFD 1DQJA 4MDIB 5E4OA 3V6ZA 2DWEB 3PAVA 2OZ4L 1P6AB 2NNAB 3CHOA 4L2YA 3VRJB 5E8PB 4L4VB 4Z7VE 1LQBC 5F9DC 3S8FB 5F7FA 4AQ1B 1RUML 3UAJC 3T4AA 2EYSB 2W1NA 3ARZA 5HVHC 1A0QL 12E8H 3U82B 2HCZX 4K73A 2G75B 5FYLD 1JPGA 2YEZA 4YSEA 2DTSA 4G6ML 5LBVA 3NIGB 4OZHA 2F7PA 4BQ6A 2YIHA 3LRMA 4GXUM 2F15A 3N85L 4TLSA 4DGVL 4PYHA 4QR7A 3NZHL 3VFVA 2XWTB 1HNFA 5C9JB 3H2PA 3VD7A 1NBZA 1A7RH 3ZHNA 3RIFK 3C6EA 2NXZD 3MV7E 1CXLA 1MCOL 1T22B 3DX1A 2ZUXA 3N9GH 2HFEA 4TQIA 4R5TA 5FB8A 5H94A 2X1WL 1F11A 2GAZA 4WU7B 3PXHA 4WUKH 3V0DA 3FTGA 2J4WL 3CVCA 1A1NB 3KXFD 4LARH 4TSAL 1F4YL 4D0BB 4EN3D 4ZMLA 3QFJE 4E42A 4IOSA 2QSCH 5HHPB 2OI9B 3BH4A 5KSAD 4RAUB 4UI2A 5GGTL 4PJDB 4KQ0A 4FQQA 3BRFA 4IRZL 4XZUB 1JMXA 1YEIL 1AKJD 3U6RA 2AQQA 4BGDA 4GG6F 1MRCH 1RZ8A 3BP6B 4TMPA 4MNHB 1IKFL 1HAWA 1BZQK 3KPQB 2VITA 2X0UA 4QRRD 1WT5C 1XR9A 2WQ8A 1MCJA 1T6BX 2IDCA 1QO3A 2OZ4H 2FIKB 3KLAB 3MBEC 3D39B 1KN4L 5ESVA 5HYSB 1RPQA 1L5GA 1MG3C 4XGZB 3BXNB 2J72A 3NJLA 2AJYL 4S1QH 3QI9A 4V1DD 1A0QH 2JCWA 1SOQA 3G3LA 4K5MA 3MKGA 4I85A 4N0CC 4G6MH 1OGAB 1WF5A 2X6VA 4JO3L 4G8EA 3Q8EA 1MLCB 1Y0LB 35C8L 5JUEL 3OLEA 4AENA 4TYUA 4DGVH 3P69A 4LRIC 4PCYA 2WBJB 2JELL 4NGHL 2FD6L 5CILL 5D72H 1B90A 3LCYA 5IBTL 4Z8FL 3SDAB 5HHQA 3FFOA 5J6GB 1MCOH 1I1RA 5E6IB 4AK1A 5JPNA 4GLRI 2ERJC 4K8RL 3TZVA 2EP6A 5CEZL 4RZCA 1OPOA 3V8CA 2FBRA 1M3IA 3NQIA 1X9QA 4N4YB 1R5IB 4WEBH 4QJ3B 1F4YH 1ZDQA 3RPBA 1FORL 5HGHA 5D71L 1T5KA 4HP5A 5LBSA 1A64A 3SIKA 1T6WA 5JW4Q 4XHQA 4PSPA 1SQMA 5EF0A 4WVRA 2F58L 1HK6A 1ACXA 2Y1AA 3NQKA 1L7IH 4NZUL 4LCWE 4WI4A 5JHDE 3BEWA 3ERXA 2MKLC 4IRZH 5B22A 5B39B 1YEIH 2JE8A 1OW0A 3L45A 5SX5K 3IJ9A 3EXLA 4DZBB 2VZSA 1FZOB 4GXUN 2PTVA 1FL3A 1IKFH 1MRDL 2QVFB 2X6CA 4HJ0C 4LCIL 4ZAKB 3T6ZA 1TQBC 3MFGB 4NQXA 4FTDA 3MRMB 2ZONA 4N90D 3EDEA 2MRYA 4OVVA 3QHZL 2YN5A 3KPPA 1T5XA 5CHNB 4JJ5A 2UWEB 1PG7X 3BPLC 1W8OA 4M02A 5DUJA 4QY8A 2XLLA 3U30B 3GFUA 2DL2A 3F05A 5DMGC 2IOOA 2Y7LA 3FO9A 5I24A 4OZIA 3JZ7A 2BNUB 3VFNB 4G71B 5FIEA 3OZ9L 3NUKA 3TYFB 5K33A 4ENZA 5ECJE 1E50A 2VQUA 1DJZA 3RVXC 2VZ3A 4M7JL 4N2OA 3N43B 1QEXA 2YD4A 2XICA 1KTCA 4JO3H 3SY0A 35C8H 5JUEH 4M7LH 3PWPD 1BX2B 5CMAA 5JPMB 3CX5J 5SX4H 3T08A 1EFQA 3FJTA 5CILH 2JELH 4NGHH 2FD6H 4PJCE 3SE6A 1RZGA 4EMZA 1QAWA 4FGMA 5LJYH 3U2SB 2E7DA 1CD1A 5IBTH 4XO5A 4Z8FH 2BPBA 4G42B 3HZKA 4CC4A 4PJBA 3ZKQD 3L5XH 2XWZA 4WI0B 3LMJH 3R06B 3CZNA 4K8RH 5I1CL 4YHPA 5CEZH 1QFWL 2CNYA 4GRLA 4WAFA 2B20A 1SFHA 4Y1AE 1SF3A 4BUQA 4GQZA 1WFJA 1FORH 2YXFA 4JO5A 1LWHA 2Q3XA 4P2QE 5D71H 2AXHA 2GT9A 2KT6A 2F58H 2J6EL 3LNDA 5E8DL 3RVVD 3K6SB 1P1ZB 2XNAB 4NZUH 5FUZL 1KBPA 2QHRL 2COVD 4BSWA 1FGNL 3MJWA 1I85C 4TN9A 3TJEL 4LCIH 1MRDH 3FS9A 4HIHB 1UGNA 4BK5A 2KKQA 3A3YB 1NDGA 4IIQB 2PCXA 4F15B 3QHZH 1KIRB 1QUNB 2YBRB 5FFGA 3L5HA 1I1YB 2FWOB 2VDRL 3HRZA 3P2BA 4L3ED 4X4XB 1TPXC 3DO7A 3KYOB 2LAGB 1JV2A 3WNJA 3UGEA 5T1MA 4L0YA 4HKXA 5F7AA 4DO5A 3EDFA 3OZ9H 1ZHBB 1ZWIA 4E2OA 1MFVA 2NDFA 5ID0A 2AEQH 4GINA 4L4TB 4M7JH 4FADA 3GLEA 3HB3D 2V5SA 3SE9L 3CVHA 4CBPA 4JO1L 2M83A 4KK5C 4GRWB 1RVFL 4QYOB 5FCUH 1CTMA 4G7YL 3T6QC 1P9MC 4HZLA 3RNQA 3EJYC 1NLDL 3GXDA 1NCHA 2BVOB 2CK2A 1SDAB 3G6JB 1ZIBA 4NKIL 3X2QB 3RY6C 3P1VA 4K5PA 4XVJL 4Y2LA 3MYJB 4HWZB 3WKML 4M5YL 3NJMA 3O45A 4IEFA 5I1CH 3FQRA 5I75C 3HE6B 3MGOA 2CKBL 1NEZB 3OJMB 2X4NB 1QFWH 3BE1H 4XE5B 5DUBB 5FV2A 4I48B 5IVXE 2MHAB 3HC3H 3OWEA 3SBWA 1MFAL 2EADA 2X9YA 3DOSA 3UTZB 5E8DH 2WXNA 2D7QA 3WFZA 1CICC 1SEQH 1MDAA 4JUSA 4MJHA 3RGVD 2QHRH 1GR7A 1PG7L 2N0KA 3OVUB 3CVDA 1MEXL 3BVXA 32C2B 4JJOA 43C9A 2Z7YA 4I7ZC 5DMYA 5HGGS 3C9NB 2BZ7A 1IFHL 1H19A 2PYED 4G9DA 3TESA 3BVWA 3GZKA 5C0AA 3A21A 5SV4A 1ANUA 2VDRH 2IAAC 4GSDL 4NQEA 4YFEA 1OVZA 2J8UB 3ME0A 1RUAL 2YWZA 1XH3B 3K8LA 4BZ1A 1D5RA 1UADC 1CFBA 1OD7A 3AT9A 3WG7B 1N64L 1HSAB 2A9NL 3ZKXC 1XF3A 3L1FA 5D4JA 1FFNA 5CAYB 1KN2L 2MOGA 5FA4B 3CDGB 4LVHC 3LSOA 2UXTA 4MXQC 5E8NA 2KQNA 2ED9A 2BSED 2HVJA 4JO1H 5JORA 3QIBD 1J05B 1BMGA 4KZCA 3CQQA 4G7YH 3WV0A 1RZIA 4Q6IB 3DGGA 1NLDH 2Z8WC 4P23B 2OJEA 1S7WB 5FECA 4QRQA 1XIWD 1HEJC 2WTOA 4XVJH 3RWCA 2BFGA 5IB5B 3G04A 3E80A 3WKMH 4GT7A 4M5YH 1IEHA 2WXHA 1NLBL 3FH8A 5DJ8A 1YEKL 1FE8L 4PJ7E 4U3CA 4LCVA 4L8BB 2KDYA 2EXWC 2GJJA 3GXNA 3AU0A 4TSCH 4BSVB 2YEVB 5HI3D 5FX3A 5KG9A 3C60C 4FFWD 3QR1A 4ZRGA 1U33A 4PGJA 1X4ZA 2ZX7A 3HE7A 4BQ8A 2LU5A 4HCRA 4OUUB 1MAJA 3QQ4B 1IZJA 3HLAA 1PG7H 5EFIB 2AANA 2R2BB 3DK2A 4UM8A 5DSCA 1NIBA 4YDJB 1CLOL 4CVUA 1FG2A 1TQVA 1CD0A 4I77L 3K8MA 2QV4A 1IFHH 3ARDB 2WWKT 4XCNA 5TD4A 2O5ZL 4FCHA 4AV4A 1C9SA 1KFAL 4PRPB 4BCZA 5IMMA 1OWRM 1QUPA 5HGAA 3OKYA 4JNXA 2A6IB 3DSNA 2BCKB 2ADIB 1UKQA 1FG9C 4OQTL 5I71B 5BPPA 4X6EB 1HAUA 2OFQA 3A4AA 3LDBB 5IHHA 5FKPA 1N64H 1OAUL 2A9NH 2CDEB 1Z9SB 5F71A 2X41A 5B1JA 3OXSA 1KN2H 4TF4A 4R3SB 1A7PL 5T1KA 2MOVA 1EBPA 1FP5A 3NZ8B 4JKMA 5H4ZA 3GM8A 2OS7A 2VDLB 2YSTA 5FM8A 4TQHA 2OMUA 5JZ7C 3U0TA 3MV8D 2NW3A 4J1UA 1KDIA 4JQXA 2ITEA 1S7XB 4HLEA 2BIOA 2EIBA 4RGND 2C9SA 1XGQA 3MOBL 4M5ZL 4OZFH 4KXAA 3IAPA 4C56E 4G7VL 4DKFL 4Q97A 1NWPA 1UUNA 3G6DL 5LXGL 1VEPA 3GO1L 4ZX4A 4F1ZA 4X4ZA 3N40F 2XYBA 2A6JB 4MS6A 1NLBH 1GGTA 1YEKH 1FE8H 4G6AC 1N5AA 4LCUB 4MS8D 4MMXB 1BVOA 3FU3A 4Z1PA 2IAMA 4AV5A 4P2OB 2YJLA 4QNPF 4GMSH 2OL3L 4UV7L 5B1CA 1UWGH 2EIKB 3ZK0A 3C8KB 1QBBA 2KZWA 3CZUB 1KBWA 4WHTB 1CGVA 3L5WB 1CFTB 1YA5A 5EU5B 3TBYA 3FCGA 4OBSA 2NUTB 5A16A 3VWJC 4GQPH 2DQTH 5C09B 3F12B 5DQJB 4LMQI 1X5XA 1WAAF 3O3BB 1CLOH 3FUEA 3IN0A 3NFNA 1U8PB 4I77H 4PGDA 4PTTA 3UAEA 5DDHB 5L8KB 2G2RB 1O5PA 2O5ZH 3RLSA 1KFAH 4GXVL 3PGFL 4NQTA 2K6WA 4OD1L 4KUCF 3ZZLA 4N8VG 3BQVA 3G6AB 4OQTH 5I1AA 1HDMA 4B5ZA 5DLLA 3CU7A 2EYTA 1EJFA 4HHAB 2D4DA 4IGBD 3GBNL 1T1XA 5J11B 1OAUH 4JFHE 2DN7A 3QDGA 2XTJE 4PRNA 2DLIA 4PB9H 1A7PH 4YVNA 1P5VB 4G8FA 2CHWA 4M1DL 4WDIB 4LMQE 4GAGL 2GTWA 4GFXA 4RMUA 2FT6A 3GSQA 4KOBA 5F0LB 1JTOA 3NJXA 8PAZA 1KBVA 3GWJA 3MOBH 1KFGA 4M5ZH 4OGXL 4P2YA 4WHYH 5L0QC 2DJSA 4EZMA 5K1NA 1TO5A 2P48B 4DKFH 4G7VH 1KBBA 5LXGH 1IAII 3GO1H 3U9WA 4FQCH 1IAIM 4ODHL 4JGJA 1QHOA 1CUOA 3QEQB 3IRCA 1EZUA 3RX7A 1LEIA 4BELD 2E9JA 3WFHA 1CD9B 2PKDA 4U1SB 5L88L 2BWDA 2KLRA 3MQIA 1DQKA 2LQRA 4FJZA 2OL3H 1WTLA 1RZ7L 2K7PA 3QUZC 3B9VA 1EANA 1OOWA 5L4IA 3IJHB 4KVNL 4R97C 5LWYL 2ZCLL 4P4KB 2FQGA 4YHIA 5AWNL 4HGKC 5KWYC 1H8SA 2HVKB 5I1IH 1U0QA 1IUZA 2OR9L 4L0ZA 1L3NA 1O6VA 5TFSL 4H7VA 4AQOA 3EOAA 4HALA 3RFZB 4LLQA 4GXVH 5DZ9A 2F74B 1U2CA 4RISL 3PGFH 3D0VA 2E9GA 3K6NA 4LIQH 3ALWA 4OD1H 2FJFB 4PGCA 4L4VD 4DUVA 5LQBH 4FQIL 1WBYB 3LYRA 5IY5B 4Z7VB 3GXIA 3NRPA 2JCCE 3CBRA 1E28B 5KBKA 2DD8L 1W6WA 1UZGA 2QLVB 4PS8A 4IBWA 1BAFL 4MB5A 1MY5A 1VLXA 1W72A 4MJIB 4M1DH 3CSYA 4GAGH 5JA9A 1U8LB 4TL5A 2HLAB 5F89A 2CKNA 5JW4R 1RH8A 3C6LC 5DURB 3W5MA 2JKJA 3ESOA 2OYMA 1SEBA 1UA3A 4G8GB 4OGXH 1FNEB 5E5RB 1NFIA 1J5OL 3MV7B 4Y5YA 1JN6B 2ITDA 4Q9BA 2YD7A 5E94A 3OKOA 3PL6C 2ICEA 5H37G 1EAQA 2EINB 4JDZA 4JPIB 4FNLL 4XNZB 4UT7L 2Y69B 3QFJB 5AVTB 4IK6A 5DUPL 3MRDA 1RZ7H 2HXAA 4DQOL 3F3HA 3FFCE 4NNXB 3GXUB 1XBDA 1YJDL 2YD9A 4QWWD 3RX8A 3WE6A 4KVNH 5LWYH 3QPQD 2Q3ZA 3L3GA 2ZCLH 3QUYD 3K1DA 2CIIA 1LTXA 5AWNH 5CD5D 2L8AA 2GYSA 1Q0XL 2KLTA 3VXNB 1GRWA 3CFQA 2OR9H 1E90A 1C16A 4NZTH 2WVSA 2APVA 4WHCA 4Z7UF 5TFSH 4RBPH 4NZDA 3D85B 1HXKA 3HBQA 3IU4L 1NQBA 3KLSA 1E42A 2DRUA 3G5ZB 4GPVA 4JG1L 1AO7E 2OTUB 2V9UA 4NQDD 2AV1A 2ZKWA 3FB8B 3P0VL 3P9MA 4GOSA 5DVPA 4FQIH 2BP0B 1SBSL 2EDEA 4TULL 4XXWA 2NY4C 1MWAB 1HWGB 1X5GA 5C07D 4WI5A 4XXCC 2EVFA 4JLRB 3BH9B 2DD8H 4DNLA 1XWVA 5DVKA 4KRMB 1FFPB 3T8MA 1BAFH 1OGAD 4KJQC 4EAEA 1ESOA 3L7EB 5DHMC 1P7HL 2WLYA 1UURA 2D0HA 5JW5A 1QSFA 3HN3A 1OT1A 3DO4A 4X6FB 1DDHB 2WBJD 4Y5XA 3ULUL 3BAYA 4OUOA 1HVXA 1ET7A 1FF5A 1MI5E 1MCHA 2P7TB 3SDAD 5E95B 4AH2B 3FQNA 3QK0A 1J5OH 5E6ID 2XTSA 2H1XA 4NN6C 4IDJH 2QSVA 3ZSTA 1PLGL 4NKDB 3GC3A 1PLAA 3ATBA 3JVFC 3RJDA 1YUHB 4XNXH 3S5YA 1YMHB 4QRPE 5CSZB 4FNPA 4UT7H 4HOWA 1AQDA 3EJCA 1NCOA 1PZ2A 1U93B 4KNUA 4KI1A 1UC6A 2R1XA 1PZ3A 4DQOH 3EYQC 4TL4A 1AHWC 2AABH 3ILPB 1YJDH 3SE3A 5JHDB 4LCWB 3DIDA 3HTLX 1XL4A 1OP4A 2J1XA 3UBXG 3II3A 4ZAKD 4XWGL 1Q0XH 1JZ5A 2R1YA 2VQ1A 2CO6A 6TAAA 3QUHA 1RY7B 2Y1VA 3B6SB 4NDMB 2B5IB 5F88B 3UIZA 3BVNB 5EU4B 1CIDA 1VFBA 3IU4H 1IBGL 4AC2A 1FZKA 4YHNB 3D3VE 5A2AA 2AK4E 4ONOA 2TRYA 3P0VH 2YPVA 4PW3A 5F3FA 5FW7A 4WW1A 1SBSH 4DW2L 4LOEA 5EZIL 3AQXA 3FO0H 3CXHJ 1MCNA 4OLYH 2CWRA 3G08A 1G9NC 6CGTA 3W0WA 4AQ8A 4EDWL 1DBJL 1YPZE 2ZXDA 5F8QC 3OSKA 1KJ2A 3MUY1 1M7UA 4G83A 4KO5A 3MV9E 4TTDD 5AAMC 5KYXA 3W9DA 2VDMB 1XH0A 3ULUH 3GLAA 2RD0A 1BIHA 3VB8A 1JE6A 4PJCB 3HAEB 3QZBA 5K1VA 4GUPB 3HC2A 2IQ9L 3LD8C 2ZKMX 3A22A 1BD2A 4J3OH 5CR8A 2AF2A 4EPSA 2OYKA 4HULB 4JZOB 4Z3EA 2WBKA 3GUFA 4V2BA 1ASPA 2OMXA 3TO2A 4CN1A 1PLGH 4P48A 2IGTA 5DS1A 2OQJB 3FCBA 4MNQE 4Z0XB 3T77A 1CFQB 3BKYL 4YDIL 1AGEA 4Y1AB 5DHVB 1RXLA 5F21B 4YH6A 2R2EA 4JFXB 4P2QB 4QHUB 4C47A 1BDYA 3JXAA 5GXBB 1MJ7H 3DVFA 5D7HA 3ECUA 1UD5A 3EZJB 4Y1SA 4KX7A 1XHHA 5EEUA 3QW9A 2XXFA 3CSTA 5DA4A 5C3TA 4E41E 4XWGH 3DDGA 3KL0A 4N86A 5FM5O 4XHJD 2GBTA 1CLZL 1YN7B 2OMZA 3V7AE 3W2DL 3RDTA 2HH0L 3O6KL 6PCYA 3QRLA 1IBGH 3TBCA 4IOFC 4ZPTB 2F08A 3WAKA 2PWDA 4DHLA 3KWUA 4GI6A 4S1RL 2WLIA 4M56A 1A6UL 4N87A 1MCEA 1ED3B 4DW2H 2YOCA 4X8CA 1A2YB 1IGTA 1K8DA 3UZVB 2CHZA 1NDMB 2Z6FA 4O2CA 3FT3A 5IHLB 1DBJH 2YHGA 4B9GA 3P77A 4L4TD 1BVKB 2JQAA 5F1NA 3CXDL 5I5JA 1XGUB 3G7TA 5HVGB 4QHPA 4PJEE 3D69A 4L8SB 3GSWB 1MFCH 5F3HB 3L6FB 4CKQA 2LVCA 1ZXKA 3T0EC 3UACA 4NUGL 3QEGL 4NCC1 1BQRA 1ORQB 2OX5A 2IQ9H 1GTNA 4BHUI 3NG5A 3V0AC 3CLWA 4UIMA 4N2MA 3W11D 4FG6C 3AREB 3UPRA 5KBLA 1AS6A 4YDIH 4WI6A 5GRYA 4EI0A 5IVXB 2BSTA 2ZUYA 3P4MA 4L5FL 4PP1C 5T5NF 2IPKB 2X1QA 4PR5B 3MLVL 1PSKL 4X99B 1X5MA 2ZOKA 1DN0A 2A74C 3AS1A 3N5AA 3ARBD 4P2RB 4H44C 4X5XB 1P5UA 5E9DA 5GGUB 2Q86B 4PJ8A 4AUJA 4WO4B 4JO2L 5E4EC 3GMMB 4UNVA 5IJKA 3CHRA 3NIFF 4PGBA 2VLJA 5DYOA 2GIYA 4R7VA 2OMNA 3VG9C 4K9EC 5I5MA 1H6EA 1RD6A 1EWHA 3R1GL 1CLZH 3W2DH 4KZEL 2WQWA 3O6KH 2K7QA 2DJUA 4OLUL 5ACMA 5DJ0A 5CLXA 1YY9D 4JCWA 4F80A 3ULSA 4ZMPA 3LVTA 1PZDA 4S1RH 1RURL 4ZX3A 3AS3A 1H5BB 3KJ4B 2HFGL 4L1TA 1WG3A 1S9XA 1WT5A 1BJ1H 1YNTF 3DETC 1Q94A 4MD4A 1X6LA 4CGTA 3WTTA 2F8XC 4HUUB 4J28A 4CMMA 4KQ3H 4YHML 1XD0A 3HBZA 4I9WD 1KNOB 4MCYB 3CXDH 1X7TA 3LKNB 1LJMA 1LMIA 2APTA 2ATKB 2W07B 2WIIA 5E8EB 5BZWB 1HQRB 4XPFL 2YZ1A 3PHOA 4P23D 4QKTA 2GB2A 4M3KB 5BVJA 5K59F 1BFSA 3JTTA 4HLZG 4NUGH 5D7LE 5CCHE 4NUJA 3E3QC 4JFFB 1U3JA 5T3XE 5JA8B 4HH8A 4HHWA 4W9JC 4H5SA 3CDCA 3DOHA 4OFPA 3BMVA 1U30A 3CPLB 1E9QB 4PJ7B 4PVBA 1IAKA 4GYBA 2A73B 4L5FH 1I8MA 1BVLB 3MLVH 1PSKH 2AJXL 3PV6B 3CFJA 4U33A 4CU7A 2BSCA 2HWZL 3LIUA 1P7QA 3QAZC 2BXYA 1IIKA 2E3VA 3STLB 3MRGA 4M7LT 1D5XB 3NAAL 4JO2H 3IXTB 1S8DA 4S1DD 5HDOA 4ZMAT 2ZOLB 2G5BB 1RU9H 2V2XA 3FPYA 4GP8B 1E40A 3R1GH 4D0CA 1INEL 4PRPD 1WBXA 3TBVA 4NQCE 4KZEH 4G7RB 1M9WA 5FLVA 3SPGA 1GHFL 4KVCL 1WWBX 4BE6A 2NY5L 5KSUB 1RURH 4GSXA 5GHWL 3SDXA 1H3TA 2HFGH 3ESPA 4FKKA 4WI3A 5K9QG 3BGMB 4U6HB 1F1GA 1KB5B 1G9NL 3FQWB 3TCXA 1CDGA 3DURA 3I3DA 4X7CC 4R7NB 4CMHB 4N5ED 2QTEA 4YHMH 1C5DB 4YSTA 1E5BA 1KGXA 1JDDA 3HNSH 4ELKB 5DC9B 5C71A 1OPGL 4XPFH 2WN2A 3SE4A 1U8IB 2VDNL 1HKLL 3WXVL 4NAMA 3BWAB 5EOTB 5KVEE 4R4NC 3KPSE 3OAZH 3RY4A 4C56B 3WN5B 4CN4A 5DD6B 3UBHA 4N9GB 3AY4C 3IPFA 1JTTA 3ZE1F 4Y7MA 1SXCA 1ZT4A 5HVWA 1NC4B 5DO2C 3QIUC 1INQB 5I1DA 1UB6A 2H26A 4XBMA 4WLCA 4P2OD 1FVCB 2Z0UA 1TYRA 3S5LG 2AJXH 4NZJA 4F37F 2HWZH 1KCRL 3ZYIA 4F3FB 2NSMA 1QI5A 4H25A 5MEQB 3FUFA 3QJHA 2B2XL 1E6JL 3GBLA 4HFUH 2RACA 3VGFA 4NKOB 1GGCL 3PCYA 43CAB 1OT2A 4WW2B 5CCGE 1UXMA 1NEPA 2JKRM 1FWXA 3O41B 3VXOB 2HAZA 1T0OA 3U48A 2IXQB 1INEH 4OF6A 5EN2B 4OKVA 2FQEA 4ONHB 5ACZB 3RWGB 3SKOA 1GHFH 4KVCH 3WU1A 2DM2A 2ZF8A 3MMEA 2EUVA 3QP3A 3VFUA 2DH2A 4RAVB 2NY5H 4NO0B 1I85A 1W0VA 4EI6A 5GHWH 3QWRD 1AGFA 5GRUH 1RJCA 4A1RA 2R29L 1D5ZA 3CGTA 4MZIA 4U7MA 5ERWA 1DJSA 1G9NH 4HA1A 5BOZG 1CG9B 2X6AA 2XTJB 4L8DB 3RWEB 2C8NA 1TJXA 3FU7A 5DR5L 1WZMA 3SKUD 1F4XL 3LN9A 4OY9A 3M1BA 3WUWG 3Q3GB 2C4FU 3FYIB 4HVBA 1V10A 3AVEA 1OPGH 4S11A 3HBGA 4J3VA 4A7GF 1S9WA 1U4EA 5EIIA 2VDNH 1HKLH 2YKLL 1HHIB 4NIYE 3OX8B 3QUXB 2IV8A 2IDSA 4JDEA 4LVOC 1DLHA 4OIIH 4L29A 3RPIB 4E5XG 1Y6KR 5C0EA 3J2PA 3QEQD 4AZUA 4UTBA 4JY6A 2ZWNA 1DBML 1MHCA 1K9TA 1A7QL 1NOLA 1P9MA 2B0SL 3QH3A 3QZWA 2BNRE 4FQ1L 3QWOB 4EDXA 4KJPC 1BAGA 2DI7A 4ZUWB 3KWVA 1LWRA 3PWVB 5K9KB 4KH9A 2XWBB 3IDXL 5B38A 1OARL 1A6AB 3IJEB 2WKLA 1U8OB 4P4KD 2ADJA 2FGWH 2CO1A 3ARFA 4GSRA 4OGYL 5TE4L 4A38A 2B2XH 1E6JH 4RMTA 1XF5A 3OKLA 4AGLA 1GGCH 3GI8L 4LCCA 2UX6A 1GGBL 2ED8A 2WB7A 5G5DB 4HWNA 3D30A 3HBPA 1RK1B 1S7TA 3PY9A 3QHFL 4RFEA 4CW1A 1FH2A 4BIKA 2EUXA 4K3EL 1VCAA 1DFXA 1HJCA 1QOKA 3ELAT 4G72B 2XZQL 2R29H 4MA1C 4ISVB 3T6VA 3SPIA 4NQSB 5H37H 4XP4L 4FS0A 2EEXA 3IRPX 2EXYD 1W0WB 1JZEA 4JFDA 5DR5H 5IQ9A 3MJ8B 3JWNC 1F4XH 4AGOA 4Q9QL 3V6ZB 2FX9L 3SYCA 1AQ8A 5DURD 1CYGA 5HYIA 1H15A 3S36X 2YKLH 1OE3A 3B4NA 1N8OE 2EDNA 1U8MB 1INDH 3FBKA 4Y2NA 5EO0A 4P4RA 2FYYB 1S9VA 4N0FB 1VADA 3GSVA 3T4AB 4WFEE 3T3PE 2X4QB 1F3JB 2GSGA 5EBGA 2R9HC 4YHZH 3IFPA 1V54B 1DQVA 1DBMH 4BA8A 1A7QH 2F1BA 2XQ0A 3BWZA 4O9HL 4S1SL 3T6WA 4J3OF 5EUOF 1DLFH 2V9RA 3RUGE 3GSRB 4R2GD 4ABQA 3IDXH 3KPRA 1OARH 3ARTA 3FFCB 5I18L 1XGYL 3O3EA 5F97E 2J43A 4XOAA 3AB0B 4OGYH 3ZPDA 5TE4H 2CU9A 2WO4A 3IJYA 3EJUA 1FO0A 4FXKC 4A37A 3GI8H 4ANXA 2FO1A 5HHVH 1OTUD 2F6AA 3QHFH 2I07A 4K3EH 3ECBB 1AO7B 1GAFL 4KJYB 1FVDA 3FT9A 4P5KA 5ICZB 1IGJA 1HH6A 4M8QA 3ISWA 2XZQH 2H32A 2I9TB 5GRXG 4G5AA 4TNVF 1MAML 2ODHA 4XP4H 2F19L 3KMDA 5IF0A 1BWMA 3CX2A 3P54A 4JM2C 2W0KA 3K71A 5BJTB 3SO3B 2FEDC 1PYWA 3P0GB 4Q9QH 4RWYL 3BFQG 2FX9H 5D5MF 2ZSVA 4RNRB 1B88A 3T9WA 1DYZA 5J1AA 1BLIA 5ESVB 3SQBB 1J8SA 1ZJBA 1WWAX 2ZSWA 3V0WL 4WEUD 1MI5B 5SX4I 5DJAB 3JYCA 3O6FB 4HUVB 3VI4F 1UCBH 4P57A 5IB2A 3D50A 2BIPA 2V2WA 3H56A 1NA8A 5LDSA 3EO9H 2G3NA 3V2AR 4JPSA 3FZUC 2P5WA 4S1SH 1FZJA 3H6AA 4O9HH 4QRPB 2DM4A 3UC2A 4ESKA 1L7TL 1PEWA 2PP8A 3FUMA 3H9HA 5FWRA 4AGQA 3JV6B 4F5CA 4S0HA 3EJPA 3GQFA 5JHDD 5I18H 3B43A 1XGYH 4WUUE 1AMYA 1UASA 2YFOA 3WI9A 4EZJA 3NOIA 5KBMA 1AVAA 2Y9RT 3T71A 2NY3B 1JZ4A 5GZNA 1L9MA 4PY7A 3WIIL 2W88A 4OJDH 3VWJA 2PO6A 3M07A 4C54A 1J5IA 3D3VB 4ELMF 2QKSA 2AK4B 1GAFH 4IKKA 5HYJE 4JAMA 5JXAL 5CINL 5CEZE 2WM0A 4HCGA 4KI5F 1UQSB 4XVUD 1QLFA 5I28A 4KKCD 3S36L 4J4PD 1MAMH 3PABA 1KJMB 2F19H 4J8RA 1YPZB 5I17A 3OB0H 2BVTA 4K23L 1JHTA 4A2LA 3DROA 1A7OH 2L0DA 3DIFB 4HSQA 1FLTX 4F37K 5ANME 3IJ7A 3FQTA 3Q6FB 3V0WH 4ADGA 4HPOL 5AVYB 4OZIB 3M45A 2AXGA 3PE9A 1AC6A 3N41B 3DX6A 3AM8A 2XWCA 4JFTA 3HHSB 5DK2A 2BM3A 5FC9A 4MNQB 3U4BH 4Y1AD 3V55A 2WB1A 5L9DL 1IRAY 5DQ9A 4A7VA 3JWOC 1L7TH 1QFWI 3R0NA 4KRNA 4LF3B 4P2QD 2ZAIA 3UZEA 1QFWM 3J07A 1UOLA 5CMAB 4N1CA 4LDOB 2OMWA 1GOGA 1DBKL 2R4SL 4KAQL 3L3DA 5T1JA 4Z6AT 5I6LA 2DZEA 2Y6SD 1ZGLA 4FLHA 1BD2E 4P0DA 5LNDA 4RBPK 3D5OF 2X1OA 5I30H 4LLUA 4UT9L 1CLYL 1YMMA 2E56A 1OHZA 4K7PX 4E41B 4R7DA 5DTFA 4YAQA 4NO2B 3WGUB 3JZYA 1D9KA 3GSUA 3QUZA 1GXEA 1CU4H 1EJ6A 3UPCA 4KFZC 2C3VB 3OMZA 1Z9PA 1ZA6B 3NK3A 5D2NA 1JCVA 5HD8C 5JXAH 3E9TA 5CINH 4E0RA 3UEZA 4CSSA 1T66D 5DRZA 4CL7A 1I1FB 1NAMH 1HWHB 5DZPA 4MKTA 4U1HA 2CJUH 3S36H 5FWQA 1U8NA 4MLIA 2DPKA 5F7UA 1G84A 1RLWA 4FFVD 3SB3A 4K23H 4LHUG 4LSUL 4IMKC 4FX5A 2XG5A 1LEKB 4PJEB 1A1MB 4XO4A 2J2ZA 3G5VA 3HPJA 2WYZA 4NXSA 3FUKA 5B39G 2PABA 3Q0HA 5LAXB 3DO7B 4JS7A 1NC2D 1YNKL 4HPOH 2W0FB 1WZ1L 4HKXB 1A4CA 3ARED 4DGYH 1FNSH 2NSQA 3F01A 1I3UA 4WK2B 4RFNC 3C6LA 3SPVB 4CUCA 4E9RA 5L9DH 1SYVB 1MVUB 1TF4A 3NCMA 5E2WL 3OG6B 3VG0H 4IM8A 2VLLA 2F7OA 5LB1A 3VD9A 3UMNA 4KAQH 4LCYA 2R4SH 4ZXBC 2DWDA 4WO4D 3PL6A 4FQHA 1U58B 5DJZB 4I1PA 15C8L 4OF3A 1EO5A 3ZZSA 5HDWA 1FFOA 3IMTA 4UT9H 4GJTB 2TSAA 1CLYH 1NZRA 2NCMA 3EZ8A 5KOVC 3ULAB 3MGOB 3RVWD 3B5HA 3BUDA 2AEPL 2W38A 1YC8A 4RFOL 5F1SA 1FL6A 5E5MB 5JOPE 5LBGA 1LVEA 3TA3C 3FYEB 4Z3TA 1MFEH 2CA4A 4MYWB 4DQAA 4PV9B 5E08L 4ZMYA 4HLZH 4LFHD 4YBHA 2PCYA 3DJRA 3MJ9A 2RR3A 3ZRCC 4Z3FA 1UXWA 1FDLL 4X5WA 3W39A 3IAGC 43C9B 1MCKA 3ZQ9A 3FFDB 4M03A 2IALB 2CBQA 3ZIYA 2YC1B 1V27A 3L5IA 5JXEC 4LOUD 2AJ3B 1G7LA 2X09A 4QXTB 3SCMD 3FRPG 2DLEA 3FTVA 5KS9F 3TWCL 5DJ2A 4MAYA 3O2DA 2NY6C 4LAQL 1KWGA 2D3JA 5FGBA 5BRZE 3ME0B 1JYWA 2HLFD 1YNKH 5D7LB 2AKRB 2NDGA 4IRJA 4RSVA 1J12A 4XP5L 5KVFE 5DD0L 4G43A 2WINA 1KCBA 3TJHD 3EH1A 5HDBB 4NQVA 5JQ6L 3EYUL 5HDQL 2UYLB 5JQHC 4XBPB 2HVJB 4RMBA 1P6FA 5E2WH 4AM0A 4K7PL 4C58B 5HY9B 5KSBF 1WZKA 1UZ6F 3TNMB 3DNKA 1R0AL 5GSRA 2X3AA 3L4WA 3R8BB 2WAQA 4AQEA 2VR4A 5FFLA 1P84J 3N04A 4EO5A 15C8H 5CZXD 4TNVK 4WJG3 3JTBA 1GY1A 4MASA 1I9RH 4F2MA 1QLRA 2EE3A 2KC0A 1UB5B 1MH5A 2AEPH 1PMYA 1P6WA 5BUGA 3EKCA 3LQZB 4RFOH 4NQCB 1Z9OA 5KG9B 2PXYC 3HIZA 1PDKB 2EDWA 3LNIA 5T8IA 2JF1A 2X44D 5E08H 1RP9A 4ODUA 3HE7B 1CFNA 1ODUA 1Q9LA 3KWXA 5KVDL 4QCIA 4MCMA 3H8NA 3HLAB 1FDLH 1NEZG 3MCG1 4UM8B 3H9ZA 1QQDA 1AQMA 4XTRD 5LGKA 3L9RA 3C8DA 4TUOB 2DI9A 3M1OA 3RKDC 2CUHA 4Y2DA 4NAQA 3DJTA 2W65B 3TWCH 2IF7A 5DC4B 2Y3NA 3GDCA 1YEJL 2E7MA 4LDLB 4CVZA 1AXSA 1A8JH 1OM9A 3GSXA 4UDTA 3SKNB 4C56D 3DMMC 4NRZA 5ESQA 1BP3B 2H6PA 3KPSB 1B6DA 4HUXB 4AEHL 4XP5H 3GHEL 1NC4D 1T80A 4OB5L 3PG2A 5DD0H 3PGDA 4MDJB 5T1KB 5ALCH 4YSCA 1ZPLA 5GISL 1AGDA 3MJ7A 2HZHA 5JQ6H 4PJ9B 5HDQH 3FQ4A 3JWOL 3U0TB 4J1UB 4UNIA 4AV0A 4W68A 2BY3A 4N2AA 5DEGA 4GBXA 4ZPVB 5D2LF 2M1KA 3EFOB 2Z9TA 2ZG1A 4IMLB 4KHTL 3S97C 3ULVF 2Y23A 1SPDA 1DSWA 4Y1TA 5CKGA 5JW4M 3OMAB 5CIPA 4APQC 3X11A 1JI2A 1IAOA 1OQOA 2H3NB 3KLLA 1DDTA 3PPSA 3P02A 4HOZA 2XHNA 3DOIA 1TETL 3DJ9A 1MW2A 3RWJB 1FFTB 3MV01 3KVPA 3BZFA 3RNKA 1NINA 1G9MH 1M7IA 4PJFE 3ALXA 3EGXB 2YN3A 4ZK8A 2QQNL 4ZS6D 1J0IA 1I9EA 3SJVE 3TBYB 5AUMB 3OKNA 2X38A 1TKWA 1A47A 4IRSC 3GSNL 4MA7L 4NZRL 5KVDH 4JFHD 1BLNB 4GAYB 2XTJD 5F1OB 1FN4A 3SDDA 3NPSC 3RTLA 4KRPC 1VKXA 3UP6A 3MLPA 2HFFB 3IMRA 2AV7A 2LTQB 2V4LA 2UUDH 4PREA 2J5LB 1IO4C 3HZVA 3ZT7A 5KZCB 2BSDA 5I1AB 3U25A 4AJVA 2EYTB 1BM7A 2GSMB 1TEFA 2I9LB 3HUJE 4WCYL 3BVVA 5JDSB 4ZZFA 5MI0C 5FK9A 5FEBA 1X5YA 2CRYA 4XCFH 3QDGB 2K8MA 5DK3A 4ZNEA 3FQ1A 1A9VA 1NMCC 5GISH 3C5JA 3NCFB 2LHAA 4G80A 2KI6A 5BXFB 3JWOH 2Y22A 3GSQB 1MPAL 4MZRA 3AG3B 4A2HA 5I0DA 5SWQB 4PCTA 2ATAA 1F41A 1C1EL 2P8LB 4Q8BA 4G9FE 3AJ7A 5AAWC 5I8CB 4P46C 2BLFA 1AGBB 1HS6A 2QADC 5E9AA 4GO9A 4KHTH 4G59C 4MSWB 4YDMA 1U8JA 4NO5B 1ZK5A 3MNVA 4ANKA 4JZJC 3V4PH 4ZZKA 4Z18A 2X28A 3IM1A 2R7EB 1VFAA 5E1IA 5DMKB 3T0XA 3V4VA 1G6RB 1TETH 1CE1L 1RP8A 3WJJA 4KH2A 4ZUUB 1KTDB 3TCLA 1WA1X 2QQNH 5C7XH 3RVUC 3TFKD 3VQ2C 3T4YB 2QT6A 3QS3A 4OVUA 4MA7H 2A6KA 3GSNH 1BXUA 2WP3T 3L8QA 4NZRH 3ZHFA 1KCVL 3FOMB 3AC0A 5DEFB 1F02I 1MKFA 2UZIH 3KYMA 4YHKL 4FFZL 5EO9A 1AG6A 3PUCA 3HI1B 3KZ8A 5C0IA 1F2XK 4WWNA 2V9TA 1YY8A 2HTKD 3CJJA 3D0VB 2WD0A 2J20A 3O3DB 2Q2LA 4PGCB 4QO1A 1KPRA 5JW4N 5EBMA 3L4UA 3K2IA 3P73B 3X3FL 2CDGB 4ABVA 1XH2A 2IWEA 4WCYH 2JKSA 4I0PC 5C3LD 3T3PB 2FAUA 1OAZL 3PF2A 4PN6A 4FQLL 1WS8A 3UMTA 1R5WA 2GUOA 4EKJA 3A67L 5KYYB 4I13B 1MPAH 1I7UB 4YGVB 3CSPA 2J3SA 5DUML 3RUGB 3ZL2A 1ZJAA 4A7SA 4CU8A 5J5EA 1QFPA 1C1EH 3BDYL 5KAQG 4UZUA 3FFCD 3I2CL 4OI8A 1NFAA 3HMXH 3SGKC 4OGAD 1X4YA 5MERA 1TQTA 2W91A 4GW5A 1U6AH 3HI6L 4QRTB 4XOBA 2W0LA 2HT2C 1ZVSB 5KYWA 4H1LG 3RTQA 3OJDB 4ADIA 3OKOB 3CFKA 4GQ9H 5K9JL 3N2JA 4PJXF 1W6LA 5DFAA 2RTTA 3AS2A 5I6XB 3R7RA 5DU7A 1VSCA 1CE1H 4N6QA 1NFDE 5DS8A 3FQXB 3MRCB 3M7OA 4HWEL 4UINL 1UUSA 2BW4A 4Y19A 5GGRY 3L3GB 4NNPL 4ZG1A 2PPEA 4P3CL 4PLNC 4FKHA 2ADFH 3ZOAA 4DEPB 3IDYB 4NHUA 1E8ZA 4KKBC 4YHKH 4FFZH 1J8HE 4WU5A 5D1QC 2WWKO 1D5MB 3IS1X 2VKWA 5DI8A 3SO5A 4UOW1 5HHNA 5EC2A 5MEPA 1VB9A 5AVSB 2DIJA 3KBEA 3QC5X 4TUUA 1MI5D 1MNUL 3NCEB 3O6FD 1IL1A 3X3FH 5EOQL 1SF5A 3VXME 3TEZA 2O5YL 3S2AA 1S7VA 1F1DA 4ANVA 4Y16B 3O9WB 3ZDXE 1RLBA 4PD4J 1L9SA 3BLPX 3DDFA 4FQLH 4XMVA 1WFMA 1A7BA 5DRXA 3A67H 5DUMH 1QSFB 2FX8L 1NCBL 1OCOB 1FNGB 2N01B 2ZOUA 2N3JA 4XAKD 3BDYH 4Q2ZB 1G1OA 4AIOA 1OTTC 3I2CH 1MQ8A 2FJGA 1FZMA 2OTWB 3IE9A 4MAYD 4WUUB 1WUNT 3HI6H 2PF6A 1N2RA 5HHOE 2V0AA 4ALAC 1TTBA 2CLZB 3ULUE 4BWUA 5K9JH 4UMSA 4XXDB 1OOAA 2HG0A 1A5FL 2YLKA 3V8OA 4NUMA 4KV5E 3KL5A 1TZIA 1X5AA 4PI2A 2DYPA 3OXRB 2R1XB 1DUZB 1ZHLA 3ASNB 5HYJB 3PAYA 3LRSA 4HWEH 1JJUA 4UINH 3X1BA 1ZLDA 1JNHA 5J4MA 2X0VA 2BHFA 4E9WA 2BXZA 4PJAE 4NNPH 3VM5A 4WY7L 4TVSa 3C5SA 2YS4A 3HA0A 4P3CH 3V0FA 3ZL1A 4H8VA 4WGWB 1HILB 2VN7A 4WJ5B 5DZNA 1GC1C 1XGZA 5F8RC 2IBBA 2CLVB 2HT4D 1Z9NA 3MV9D 4WFGE 4AVIA 2JKWA 2OSYA 2FO4A 4UBDC 3I3EA 4HISA 1DVFC 3A24A 5ANMB 2Z1PA 1QSEE 5HJBA 1MNUH 1RJLA 2G9HB 4CBZA 1NGPH 3OAUH 3D33A 5EOQH 4GO6B 4TUJA 1JF6A 2IDUA 3Q9QA 4U31A 2O5YH 4LVNC 1DSYA 3FO2B 4MNQD 4X9BA 1OLLA 4DH2A 3AUVA 1SN0A 2WQXA 3DPBB 4CVXB 2VLKA 1IC1A 2P80D 3VH8A 2FX8H 3NCBB 1NCBH 3EGDA 3MRRA 1WAAA 2R0KL 3TO4A 3UCRA 3RBGA 3CPUA 1EERB 2R0WL 3L16A 2NR6C 5KTEL 1BD2B 3EG9A 1R75A 2WTPA 5IV2A 4W9CC 3TO2B 3CSGA 3STZA 1IC4L 1KIPB 5E00A 3MV11 4E41D 3Q06A 1UWXH 1Z32X 3PRZA 4YNYA 1G7JA 1LL1A 2AJSH 4H0HB 1AGEB 1I1AB 4Z23A 5CBAB 4JG9A 1A5FH 3GJEA 3QORB 3MRQB 5C08E 5SWZE 2IH3A 1ZTXE 3WJLC 2GTZB 2R2EB 1Z3RA 3ETBF 3KE0A 4AWJC 5E1HB 2V7NA 1H9VA 4RMSA 1ES0A 1P7KA 1VAHA 2BVUA 2X4OA 2OZ4A 4AKOA 2Z8VC 1IM9A 1ZT7A 4PPTA 4P5TC 3FU8A 1AHKA 3N1QC 3CNKA 1OAJA 4LQ1A 5E51A 4H88L 5F3BB 4WY7H 4KK9D 3ZHKA 4Y9EA 1SJMA 4GBXD 4M1CD 4PLJC 1T20A 2X4PB 2EJ1A 2B77A 4I2XA 1OCRB 1KEML 3DUSA 1HH9A 4A2DA 4YJZL 5CN2A 3IGFA 3AT0A 5C0RL 4POUB 3UTTA 3WXWL 1ZLUK 2OR7A 1IGTB 5M95B 1K8DB 5GRVL 3MRKA 1D5BB 3A4DA 4JKNA 1DVUA 2APSA 4O2CB 4X4MA 1AP2A 3QXAA 4ZFFA 4FQXC 1B0RB 2ZUSA 4JFEE 1JTPA 3RZCA 2XXMB 4H2AA 3ZTJG 2WK2A 5HGBA 3SD5A 4ZODA 4L2LA 2APXA 5TE6L 4J6RL 4RETB 2R0KH 3AAZB 3E38A 3IXAA 4K7PY 5DRNA 5I2IB 5HVHB 4F58L 4LESA 2R0WH 2OX5B 5KTEH 3VFPB 1BZ7A 3LRHA 3MRHA 1E4KA 2ZXAA 3QQ3A 1IC4H 3L95B 4POYA 3NPZB 5DVNA 5FF6B 5INCB 2XQBL 4X80L 5D7EA 4D9LL 3P4MB 3LEVL 1SY6L 3PJSA 3QWQB 4KPHL 3HAEG 4JFQB 1OD9A 4LPWA 1DN0B 4F27A 1EX0A 5ESAA 1TVHB 3ES6A 3APFA 4FXKA 4M61A 2G3ZA 3T0BA 2CKBB 1FHNA 2CHNA 2A4EA 3NA4A 4H88H 2ALAA 3MFFB 4L5FE 4PGBB 3TNNA 1KTJA 5ES4B 4MNGE 4LLMB 5I8OL 2CO4A 5GS0L 5AEAA 4D8PB 4KK8D 4B3VA 1DEEA 5DJ0B 4PMFA 4U1NA 4E9XA 2YKKA 2BDNL 4LSQH 1Q9KB 2VB5A 4FNSA 2HX7A 5C0RH 3PP4L 5BRZB 4HV8B 5IVZB 5IBLD 3Q2LA 5T3XD 3WXWH 1GMEA 2I26N 1JNNL 2C9AA 4UZSA 2IADB 3J27A 1AR1C 2J57A 2XZAL 1N59A 2OXGA 4F57L 5JTWA 4CMMB 5KJ7E 1E4HA 1T7WA 3MBEB 3QJTB 2VR6A 2UZYA 2BY0A 4M6OL 5DD5H 1F90L 3BQUC 1DVYA 2WXMA 3K6IA 3WHXA 1T03L 1F8TL 1M05A 4FQPA 3P2DA 4J6RH 5TE6H 1QRND 3MZTA 5EZJA 1PGRB 3SPHA 4F58H 4ELDA 4KGJA 2F7IA 1JK8B 5E1QA 3SODB 3VFWB 2K3HA 4I18A 1FJ1A 5AZUA 4Z7UA 3QG7L 2MOQA 2EDOA 4H5SB 1K6QH 1B0GB 3B9KC 2PTUA 3IFOB 4YHYC 1NPUA 3WMSA 4YFDB 8CGTA 2XQBH 3L9EA 1O6SA 4X80H 4DUWA 1NBYA 4NQCD 3BEVA 4O5LL 2OPCA 3ZE2F 5ILTL 4N6RA 4GG6E 4ZUVA 3GS0A 1FI8C 1GOHA 1SY6H 3MRFA 4KPHH 2HRPH 1G0DA 2QBWA 1CE6B 2ERJB 3UX9B 3UO1L 1SN5A 4JFPA 2NZIA 2C7UB 1DE4A 5FDWA 5A3IC 2BOCA 4MDRA 3LPGA 4A68A 4YDLC 1X5ZA 2X12A 5I8OH 1GC1L 4BFRA 5GS0H 1BWWA 8FABB 3QYNA 2K6ZA 2RA1A 5ITFA 4WEEA 1NGYA 4JGNA 1OF0A 4QHLB 3OQRA 3TL5A 3QNYA 4R4FL 4RMRA 4DP8X 4I1NB 3PP4H 3WDJA 4L3AA 1GZQA 1E7VA 3VO0A 1JFHA 3KPSD 4PP2A 3RWFA 5L8LB 1TQBB 1G87A 4F7EB 2IBZX 4HDIB 3MNWA 4OFQA 3DURB 4TQPA 2P3YA 3PGCA 2VR8A 4F57H 3TH4T 4JRYA 4QRUB 4PJ9D 3BPLB 4UQCA 2OULB 3OQ3B 1UH2A 4M6OH 1F90H 1X9UA 3QJFA 4PYGA 1T03H 4HJGA 1F8TH 3SPJA 3LZOA 3DYMA 4Z0BL 4LFHG 4PW9A 2A9DA 2L7JA 4UOQA 2XPGA 4DIXA 5AW8B 3DX2A 2OW7A 5T33L 1WGOA 2VIRA 3FTZA 3KM1A 4RAHA 4AG4L 4OCYL 4Y5VC 1R3KB 1HKFA 4XC1L 2JIXB 2A0LD 2KS0A 1E2WA 4I8DA 5DVOA 3V0HA 5I1DB 3FH5A 3WENA 4O5LH 2BMKA 3GXMA 5ILTH 4MB3A 2HTLD 4YMPA 4L0PB 4AJYV 1EEZA 4K4KA 1UD4A 1IJNA 4PJFB 1QFUL 4CSZA 1PZSA 4UQEA 1QHPA 3UO1H 3SJVB 3EXJA 1N0LA 5C0DA 5CO1A 3FHQA 3O4LE 4ZFOA 5DFWH 3DX8B 4TOYL 2DQJL 1H3GA 1EO7A 4YSPA 2ZF9A 2BVQB 4NJ9L 3LKQB 5EEVA 1S3RA 5F44A 2NUPA 2VSKB 4MYPA 4WJKB 5HVFB 1ONQB 4KITB 1ULVA 2L7EA 4Z7OF 1U8HA 1CCZA 4QLRA 2ZUUA 4X83A 3GGWA 4XB3A 4R4FH 3D2UA 3VFUB 5KZCD 1HYSD 1DP0A 1PQZB 4ODWB 3OHXC 3GBMH 3H9SA 5GZOD 2D7PA 2VRAA 3ULVC 1OAXH 3M88A 1KF9B 2ZPKL 3T0AA 3U7WL 1R4XA 3LAFA 3EYFB 2VDLH 1F6FB 4F91B 1YYML 1OTSC 4JO4L 3UROR 5BOJA 3U2JA 4YL4A 4X9HA 4EI5C 4IOIB 2QL1A 5J06A 2C1PB 3FU7B 2BNRD 3I6KA 5AVQB 2WVVA 1T1YA 1IC5H 1P1VA 1TPXB 3UTSA 4H26A 3GXPA 3HN5A 3NIGF 2ARJQ 2PR9A 2ENJA 4H8PA 4GSUA 4Z0BH 3PV7A 3ML9A 4G9FB 1FCCA 3TONA 1J0HA 3KH3A 4Q0XL 1AD0B 1SXAA 4Z5RA 2D4FA 3P4NA 3TN0C 4LBAA 2VSMB 3S3JA 4DKTA 1Z0NA 3Q5TA 4MJ6A 4YSQA 2DWTA 3ZHLA 3EJQA 4AG4H 4OCYH 2UZPA 1KLGA 3EJJX 3OLDA 4MQ7A 1MHCB 4XC1H 3T0EE 3P3SA 3VXSA 4FE9A 3MXWL 1XEDA 4FP8L 2JJSC 2XT1B 2F8IA 1AIZA 3D12B 4GAJH 1ZSHA 3QULA 3U0PB 4J23A 2X70A 1QFUH 5I75B 3MRJA 2ED7A 2ADJB 2A5UA 3IGAB 2WC7A 2J73A 2DBJA 4PJDF 3OKLB 4WV1A 4TOYH 2DQJH 3DRTA 5GGVH 4NJ9H 4PJHE 4OR1A 3VXRE 4B9JA 2YAPA 1AD9B 3T1WA 4BH7A 1S7TB 2B3IA 3DV4B 3QEHB 4ZO8A 4CW1B 1CICB 2VC2L 3ZVVA 3QXTA 4TNEA 4HKJB 3DBXB 3RPKA 1KXHA 3K5RA 1AANA 5EH1A 3QXUA 3GXTA 3QNZB 4F7CA 4QTHA 5F9JB 1XCTB 4OZFA 3E9UA 1QVOB 3DV6B 4H1LH 4WFED 5C0CE 2KZ1B 1YYMH 2QPDB 1HL9A 2YAHA 2XN9E 3VI3A 3OC5A 3UBXI 1DJIA 4JY4B 4MXVF 1IKNA 3N44F 4RGMC 4OD2B 4GQRA 2B4CC 4JL1A 3WY1A 3NN8A 2WQAA 5JIPA 1TSHA 1DJYA 5MEOB 4RMWA 1IGFL 3FB7A 3ZKXB 3TIDA 3AFLA 2VXSL 2Q0ZX 2WLLA 3DI3B 3CHQA 1NGWB 3S3BB 4BCXA 4LVHB 4Q0XH 3RHWF 1LNUA 4XNUL 4QTIH 5EA0L 3BIKA 2CXGA 3PWLB 1O7VA 4W9FC 2XI9A 1KIQB 4X7DC 4OCWL 2GSGB 4FEMA 2AEIT 3IFPB 5IHZB 3M46A 2B1AL 3UJIL 1R3IL 2K78A 3TIEA 5DFVC 3EBIA 1ZT1A 3LIZA 3MXWH 4PS7A 4FP8H 4WK0B 1B3JA 4OIFA 4RMVA 1YNTA 3RL1A 1NFDB 4OFYA 1UH3A 2WHVA 4POZD 1BJMA 3SZKC 4YS4A 4ODBD 5KYUA 5FHBL 3WEXA 5IWLA 5IREA 1ITBB 4OQTA 2MKWA 1PS3A 2GJZB 3VYPA 3ILDA 1DQMH 3C60B 2UUDK 2PXYA 4UT6L 1M7DA 1OY3B 4N2KA 1J8HB 2C3XA 3CFUA 5IROD 2YD0A 1XZ0B 3QEUA 3LKOB 2RFXA 3M1CA 4ZO7A 4AYEC 4MRBA 4LKXA 1FVDB 1D6VL 1HH6B 3C08L 4M8QB 4NYLB 2UWEF 3NJVA 1NCCL 4A7UA 3KAAA 3VXMB 4Y16D 3O9WD 1PKOA 1IGIL 3ZL4H 3ZDXB 3K71B 2YMTA 1U3HB 5TGBB 2X7LB 1OP5H 3V95A 3GEFA 1PYWB 4NN7B 4B97A 3SD2A 1T3FB 3LB6C 2ZYSA 3DUHA 1NGQL 3N43F 1AKPA 2B59A 4KJWD 3Q8FA 2VXSH 1RHHB 1DBBL 2EKSA 2OL3A 2F54E 4NKQB 3AT8A 3MROA 3FHAA 2CK0L 3A6OA 2BIQA 4XNUH 2DQDL 3EBGA 5EA0H 5IB2B 1VESA 3UIYA 4P06A 4QXUL 1KXTB 5HHOB 4OCWH 4FG0A 1LP9E 2XN2A 4NZFA 2C26A 5GRJL 3DA0A 4XRCB 3LKSA 2B1AH 9PCYA 3B3IB 1SVZA 5AKVA 2V3EA 2XKNA 1R3IH 2E7BA 2CBPA 3QDJA 4ZQKA 3DVGB 3SQOL 3H9HB 3LXAA 4F8OA 3VD2A 3VM7A 2R0LL 1JV5B 5HYJD 2P5PA 4K8RD 3DI2B 5CEZD 3ABZA 5FHBH 2E27L 3FNKA 1U92B 3MXVL 4HS8L 3TH3T 3VFOA 4APQA 2NZ9C 3US9A 2Z31C 1ORSA 4PRHE 3CC5A 1AR2A 5A2BA 4PJAB 5CJOL