1GS8A

Crystal structure of mutant d92n alcaligenes xylosoxidans nitrite reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
b'QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVNFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Biochemical and Crystallographic Studies of the met144Ala, Asp92Asn and His254Phe Mutants of the Nitrite Reductase from Alcaligenes Xylosoxidans Provide Insight Into the Enzyme Mechanism.
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gs8A02
5B7FA 3AY2A 1M56B 1E65A 1MZYA 2I7OA 4N4YB 1AS6A 1BQRA 1L9QA 3PXLA 4AKQA 3AG3B 4QKTA 2IWKA 1NDTA 5I26A 4DP5X 1SF3A 4AX3A 4YL4A 3BQVA 1BYOA 2XXGA 4AKOA 8PAZA 4PAZA 2IH8A 2B08A 4DPBX 3KW7A 1OCCB 1ET7A 1XMEB 2CAKA 2GI0A 3PAVA 2JFCA 1J9SA 4G71B 2TSBA 3AG2B 3CVDA 4DP1X 4GY4A 3RYMA 3EH3B 5FC9A 3GDCA 2Y1AA 1KBVA 2YARA 1ET8A 4AKPA 3IN0A 1SHXA 1IC0A 5B1BB 5B7EA 3TASA 3JT2A 4JHVA 1JZEA 3CDZB 3WI9A 1X9RA 4UANA 1EHKB 1A4AA 1QHQA 2XV0A 1WA2X 1GS8A 2AANA 2EILB 2BWIA 1RZQA 4GP4B 1EZLA 4DP9X 1PF3A 2CJ3A 2YAHA 1XB3A 1KYAA 2WSDA 1ZDQA 1AOZA 2XWZA 2EINB 3EH5B 1SFDA 5LDUA 1L9PA 1JVLA 3GYRA 2HX9A 2QDWA 4W1TA 4BXSV 4DP2X 2I85A 3MX0B 2W88A 3CDZA 3TU6A 2DWTA 2IH9A 4GYBA 1ID2A 4NERA 1A8ZA 1V55B 1YLBB 1GS7A 2ZWNA 5E9NA 1OF0A 1ETJA 4A2HA 5D4HA 2FT8A 7PAZA 3S8GB 1IUZA 1QLEB 1JZHA 2UX6A 2PPCA 3MBWB 2IDUA 2WO2B 4QLWA 2E86A 1KCBA 3EF4A 3T6XA 3U25A 4E9YA 1ET5A 1AZRA 1ASOA 2GBAA 1NIBA 3V9CA 3WIAA 3S8FB 3FT0A 2YAQA 3S3DB 3FQ1A 4X4KA 1SJMA 4CSPA 2YAEA 2PCFA 4KNTA 4BWUA 3SBPA 4G70B 3T6VA 4E9SA 1E5ZA 1VLXA 1W6LA 2YXVA 1A4CA 1L9OA 1J9TA 1ZIBA 3OMIB 2FTAA 1JXGA 2HRHA 1IBZA 1ZDSA 2TSAA 1KDIA 2VM3A 5PCYA 1UATA 2W8CA 3CG8A 3FSWA 1CYWA 3IE9A 6PCYA 1WS7A 1RCYA 3FQYA 4DP0X 5I6NA 4KO9A 4A66A 1JZJA 3X2QB 2AFNA 1T5KA 1NPJA 3C75A 3FU8A 3UGEA 1RKRA 3T6WA 4NAJA 2XX1A 2HX8A 2UXFA 3N55A 4P5RA 1XB6A 1A65A 2VN3A 2XXFA 1L9TA 3CVBA 4PCYA 4BWWA 3FYIB 2P80A 2IDSA 2HLEB 1JZGA 3ZDWA 1OCRB 1JXFA 1AS8A 2FNWA 2PP9A 1PNCA 1MDAA 3IEAA 3WG7B 1V10A 1HAUA 1PAZA 4BWTA 1BEXA 4M3HA 1AZBA 2PCYA 1GW0A 3X1GA 3NSDA 1BQ5A 1BXVA 4HHWA 3TA4D 1AAJA 2RACA 3NJLA 4EF3A 3H4FA 3FSZA 4YSTA 4YSSA 2R7EB 4DPAX 4E9XA 1BXAA 4BK5C 1SDDB 2UXVA 4WTQA 1OCZB 1TKWA 1NTDA 2X88A 3QPKA 2IDTA 1AG6A 1NWPA 2AVFA 4FAAB 2VM4A 1GSKA 4HCGA 3SQRA 4KO6A 2DV6A 3X1EA 4AI7A 2GHZA 3H4HA 2YAPA 7PCYA 1CYXA 2YXWA 3X1NA 1JZFA 1NICA 2PPEA 3PPSA 1OE2A 2FJSA 4HZ1A 3HEIB 3SBQA 4BXVA 1AZUA 2CCWA 2XYBA 3NJJA 2HX7A 2R7EA 3CZUB 4G7QB 2JKWA 1SDDA 2GC7C 4F7KA 4HAKA 1CC3A 4Q89A 2VW4A 3ABMB 3WNIA 3FS9A 2BZCA 3QJRB 5I28A 4P5SA 5F7AA 2AZAA 5AZUA 1GS6X 1W6WA 1FWXA 1PCSA 4ENZA 4KO7A 1MG3C 1WAEA 3QJQB 2J5WA 2FQEA 1J9QA 1HFUA 4KOCA 3T71A 3AZUA 1RZPA 1AS7A 4YSQA 2BZ7A 5IY5B 1PNDA 3L45A 3NSFA 5B3SB 3FU9A 2DYRB 4E9QA 3NJHA 1AIZA 5AKRA 1KCWA 1QNIA 5I6LA 1JXDA 3AW5A 1N70A 1OE3A 2BHFA 2DY2A 3H56A 4E9VA 1SHWA 2XVBA 2GIMA 5ANHA 3CVCA 5B7MA 1FFTB 1I53A 3OM3B 4UF7C 4L0PB 1A4BA 3NJGA 3KW8A 1PMYA 4DPCX 1IKOP 4A2EA 1ILUA 2QT6A 3PCYA 1GY2A 2J57A 2BP0B 3ABGA 3ABLB 4UAHA 5I5MA 4MFHA 4A2FA 1J9RA 3S3CB 3IN2A 1OE1A 1GYCA 2ZONA 2Q9OA 4A67A 4YSDA 5B1JC 2BO0A 2OJ1A 3S3BB 2OCCB 1AZNA 1PZAA 4CSZA 5F7BA 1DZ0A 1AR1B 5B1KA 3NP3A 1M57B 2XUWA 2N0MA 3UADA 1F56A 2MTAA 4YSCA 2AZUA 3OD3A 1NWOA 4YSOA 1OOWA 2BP0A 2A3TA 1XB8A 2MRYA 4E9WA 4F2EA 3FSVA 2DYSB 1J5DA 1J5CA 2UXGA 3GXUB 2BP8B 3QQXA 2X87A 1IBYA 5B1AB 4K9JA 2I7SA 2J55A 3OMAB 4JHUA 1OV8A 1KV7A 2PLTA 3EHBB 3NJFA 2UX7A 3UACA 4W9ZA 4HIPA 5TK2A 2XX0A 3OMNB 2GSMB 1JOIA 3FYEB 4NB7A 1AG0A 3FU7B 1X9UA 2YAMA 5PAZA 3WNJA 4HHGA 1A3ZA 3ZBMA 3BVDB 3UAEA 3NJKA 2J56A 1HAWA 3AG4B 2BP8A 3NJNA 2FT7A 2BW4A 3ASOB 1BYPA 2QPDB 3EH4B 1NIFA 2YQBA 2FQGA 3HB3B 4GP8B 4E9RA 4KNUA 4YSAA 2PPFA 2GC4C 5I6MA 1WA0X 1PLAA 5I5IA 3UABA 2ZXWB 2CUAA 3PLYA 5AFAA 1NZRA 3FU7A 4BDVB 2LLNA 4G72B 1BAWA 3NJIA 2VW7A 3FPXA 4YSPA 1FA4A 3UAAA 1URIA 3T6ZA 9PCYA 2UXTA 2QPEB 3ASNB 3V9EA 1ILSA 3DTUB 1KGYE 1ASQA 2PP7A 2XU9A 4KOBA 1E67A 2CALA 2HZHA 4F2FA 1SNRA 1JERA 4FA7B 5D4IA 2IWFA 3DKHA 5I5JA 1E5YA 1NINA 4BDVA 1JZIA 4YSEA 4HALA 1R1CA 2BWDA 2GB2A 3FSAA 1M9WA 4YSRA 1PZCA 2IDFA 4KNSA 3N2JA 3ZIYA 4DP6X 1NIDA 1ADWA 2FT6A 1NIEA 1TU2A 2FQDA 3T9WA 1PY0A 1SFHA 2H5UA 6PAZA 5B1JA 3JTBA 3PAUA 2HXAA 1DYZA 4ZK8A 2PPDA 1V54B 3D12B 1TEFA 4YVUA 1W8EA 5A7EA 2JXMA 4RH4A 1AACA 2WO3B 2NRDA 2YAFA 1CURA 2YAOA 1AANA 4G7SB 3TBBA 4DP4X 1CUOA 2CBPA 2P80D 2B3IA 1KBWA 1PLBA 2XV2A 3X1FA 3X1BA 1ASPA 1NPNA 3NJMA 3TBCA 2XLLA 2VW6A 1ZPUA 4A2DA 3FPYA 3QJUB 1N68A 4DP8X 3NP4A 4E9TA 4GP5B 1E30A 2PP8A 2VSMB 4WKXA 4HCFA 2Y69B 2H3XC 1WA1X 2FQFA 1L9RA 4DP7X 1BQKA 5I6PA 1GR7A 5I6OA 4M4RB 1MZZA 2DWSA 1OCOB 1PLCA 1B3IA 1JVOA 3NYKA 1GY1A 3ERXA 1PZBA 5EHFA 4AZUA 2FWLB 3NT0A 2OV0A 3ABKB 1WS8A 3FQ2A 3OQRA 1AZCA 1TEGA 1KDJA 1BXUA 2ZOOA 3PAZA 3NSYA 4YSUA 4Q8BA 2BW5A 2IWEA 2XV3A 2PPAA 2VMJA 1AQ8A 4A2GA 3WKQA 4HCIA 4GXFA 4N8UA 3QJVB 4YVNA 1L9SA 3AG1B 4KO5A 3SBRA 3G5WA 4JKNA 1ZIAA 2HRGA 2IDQA 1ZV2A 1NIAA 2EIKB 2IAAC 3DIVA 1MG2C 3NSCA 4A68A 2QDVA 1SF5A 2EIMB 2VSKB 2H47C 3QJSB 5D4JA 4G7RB 3QJTB 4TXVB 5TK4A 5I6KA 2EIJB 3IBOA 2Q5BA 3WKPA 3ZX1A
chains in the Genus database with same CATH superfamily
1ZLWK 1MZYA 3WE6B 3KE0A 4NSKB 2Y9RT 1PW3A 4JL1A 1F4AA 2D3NA 1XGZA 3GSOA 1RK7A 2MQCA 4OR1A 2AF2A 1DQVA 1IBHA 4R84A 3FOLB 3T2PA 4WW2F 2DKUA 4K71B 4HDIA 1AGDA 4KXCA 3TM6A 3IDGB 5I17B 3A4AA 4UQAA 4JGUA 3VTMA 2DQUL 1JV5A 1YDPA 2GI0A 2J8UB 2V17H 4LOEA 3OZ9H 4L23A 3UH8A 1J1OH 1CL7L 4R7DB 4Y5XC 2OZ4A 2YS4A 3CSYA 1GKEA 1FLRH 1SN2A 1UWGH 2ENYA 4NCC2 4AYDC 4QYAA 1OGAD 2V2TB 2ZKMX 2XC8A 2EVFA 4AZ8A 1Q38A 2ZCHL 4H88H 4UTBA 1IC0A 5C0FB 1IFHH 3GMOB 5IW1B 1KOAA 4GS7B 4I0CC 3FTZA 4XVSH 4FNLL 2EDTA 5JPMC 2F54A 2GYSA 4PW3A 5TH2B 5JQHC 1JK9B 3O6FB 1IT9L 1KLUB 5IG7B 4Z7VA 4ZMOA 5J89A 3ULVF 1UCBL 3AJ7A 3GBMH 7CGTA 1RZQA 4HG4J 3B9AA 4YDJB 1ED3A 4ZUUA 5KYWA 1KYAA 5DZLA 1H15A 3GHEL 1KTDB 3VTAA 2CDFB 3PY9A 1T6VN 2DIJA 1JVLA 3O3AB 4EKJA 1CFBA 1J9CT 2B5IC 3BUYA 5DJZA 2XPYA 3UPAA 5DZVA 3QUZC 3WO4B 2QR0B 5IBTL 1G7QA 1MHCB 1ID2A 5JORA 3CZLA 1MHEB 5F6HJ 1I7ZA 5T5FH 2V0AA 1ORQA 3PHAA 3OKKA 3BZ4A 2NR6C 3QP3A 1QAWA 3GJEA 4B96A 5I75B 2OMBA 5GRUL 4JCLA 1I9EA 2B20A 4JLRB 3I2CL 2CLZB 2IADA 3G6JE 4OGAD 5EB9A 2KH2B 2V5RA 4P46C 4DZBB 1JF5A 1AZRA 1R19A 3T04D 4MZRA 4WSJA 5LXGL 3FT0A 1XEDA 3C8KA 1H6EA 3C60A 2CNZA 4WENB 1O6SB 5FO8A 2YAEA 2FYYB 1G6VK 5SWSD 3SBPA 2PWEA 4NX0A 3W2DH 1AR2A 3PWPE 1TTRA 4Y5YB 5D5MF 3RWFB 1EGJA 1T04B 4OD1H 4HSCX 3IU3A 4O51B 2HYMA 1UXSA 4G8GA 4GRLB 1L9OA 1FNAA 2DEYX 3L9YA 4WHYH 4BHUA 4NUJA 2XJKA 3RZCC 4MNQB 3ZTJH 5LNGA 4NO0A 4ZOCA 4S1RL 4FLSA 1OGPA 2J71A 5KBPA 4UV7L 3RL1B 4JQVC 3V0EA 3GO1L 4OM1L 4R5XA 1U30A 1UJ3B 5C3IA 3QEQE 4MA7L 1HL4A 1MVUB 1HQRB 3E6FB 4PJ8A 3OGCA 2QVMA 5F96H 4XCYA 1U93A 1H3XA 4OLUL 1E8XA 1KLFA 3PHSA 2XTLA 4JFHD 5HHOB 4LPVA 1L9NA 3DOSB 2N59A 3ENEA 3WEMA 4BWWA 1SUJA 5HHPA 2Z93A 1HHGB 1Y18A 3DX6B 3LSOB 1QLRA 1MFCL 4LEXL 4WNQA 5IUSA 1LEGA 4DGYL 5IOKA 1QFWI 4TSAL 5HGDB 1O7DC 2VERN 3MCKA 3WG7B 1JHKL 3WY3A 1AZBA 4WJKB 4TNVF 1GW0A 1ZTXE 1FNSH 2GJZB 2HFGL 1YSOA 3P1VA 3RQ3A 3BIAX 4RAVA 4MMXB 3NIFF 2H1XA 3NQKA 3RU8H 1HSBB 2ZP8A 1BXAA 2UXVA 2MPAL 4ODHH 3B2MA 1AHMA 4GO9A 5L0QB 1FH5H 3B6SA 3CUPA 4P2YA 2DQGL 4H8HA 5DWUL 3QNFA 1VACA 3TS8A 4HAFA 5C6TL 1RLWA 2PCXA 1QRNE 2MEJB 5D1ZD 2AJ3B 5FYJE 3SGKA 2AXGB 5F9AC 1FE8L 25C8H 4KVCH 4X9HA 4FHBD 4G8EB 5DK3A 3SBQA 3WD5H 3L4VA 3QIUA 4HS8L 3SE9H 3IDMA 1KLGB 1BZ7A 3AUWB 4HZAA 4ZUVB 5I18L 5KN5A 4JFXB 4GI6A 5C0NC 1EWHA 1QSFB 4G80A 2W81C 3ARBA 2WWMC 4QOKA 2VXTH 3HZ3A 5T5FA 4E0RA 4GRWE 2Z8SA 2EYTA 3IJSA 3Q1EA 2AJYH 4XVTL 4F8PA 1ZS8A 1CT8A 3EOTL 1MCEA 3GXTA 5HYFA 3H55A 1U92B 2HRLA 5ILTL 5AKVA 4XRCB 1KENL 3RTQD 4QUOA 2A0LD 4KC3B 4B9ZA 2VDPB 2CRIA 3MCYA 3FU9A 3WAKA 2ZOLB 3NJHA 1KN2L 4PI2A 4U33A 4FNQA 5FLVA 1AGEA 1PD6A 3D69B 3ZDZE 2BXZA 1KGCE 2DY2A 4UT6A 3JV4B 3U79A 1AGFA 4R4FL 1DHKA 4RZCB 3TEZA 3ES6B 4U2ZA 4WO4A 4MA8H 5AYTA 4OLWL 4HQQH 1ZV9A 3RURA 3S34L 1MFEL 4FULA 5CP7B 4KJWC 2EEFA 3P9MA 4XO8A 4CNIB 3MJ9A 5FYKD 3KYMB 3Q7JA 3MRCB 1ZVNA 2OJEA 3NGBC 5C07D 2XPGB 4MB5A 2GEQA 3ZOAA 1HIMH 4KAQL 2XJLA 4LLQA 3LJ3A 2XFXA 4UINH 4B7IA 4Z5RB 4N2OA 5ID0B 1GYCA 3US0A 1UXLA 2WHVA 2Q9OA 3VFRB 4HKXB 5IMKB 1AQHA 1PY4A 2IAMB 2X2IA 1CDBA 4GPVA 5BS0B 1WFMA 1OAKH 4FYRA 2V7HB 3MZGB 1RHHA 4XPGH 3FT3B 4ZYKB 1AR1B 1T1XA 4Q56A 5B1KA 3RNQA 4I0PD 3GMLA 1A7BA 4AK1A 4F37K 4KDVA 4U1MB 5DD6B 5FFGA 3CE1A 4E9WA 5CCJA 2VXQA 4TYUA 2P43B 3GXUB 4GXVL 2G3MA 3ZL2A 4HOXA 2E3VA 4GMTH 5EBMB 1KJ3H 4H8PA 3TFKC 1U3HA 4GKLA 2I9TA 4OT1H 1FUNA 4XP9H 1PZ3A 1OAZH 5EO0B 4HCRL 4EZLA 5TE7L 5FGCB 2WVTA 4ZFGH 4WFED 5FYLL 5TK2A 1S7XB 4PRPB 4QF1A 2BVEA 4AW7A 3LEVL 1P9MA 4W6WB 1A7QH 3LPFA 2JLLA 1A3ZA 5E08H 2VIRB 4DTGH 3D0LB 1HH9B 3ZYIA 5JDSB 4LOUD 1IGIL 1EA9C 1HSAB 3QZBA 3RGVD 1I9RL 1QPPA 5KVEL 4OLZH 4UIKL 4XX1E 2HVJB 5CU5A 2DQEL 4KK6C 3BP6A 2ZG3A 2XWBA 4B41A 4Z3HA 4WUUA 3O41A 4YWGH 4GI9A 2GABA 4JN2B 5FYKU 4X6CB 4Y16B 1NZRA 3KM1A 3BD3A 2XETA 4ELKB 2EDOA 1NBVL 4GG8B 3FPXA 3PHOA 2J8UF 5BVPH 1Z9PA 1RUPH 3HG1E 3SJVA 4YLQT 1G1KA 3AB0C 3T65A 1CLOH 2A0LC 5D6CA 2F15A 4XVOA 5FK9B 5T3ZH 3TO4B 3VG0L 2WWOA 3GXPA 4LKCB 5IVZB 3NFSL 3BDBA 4V11A 1S9VA 1KGYE 3CFMA 1R5VA 4YLBA 3QCTH 4MJ4A 4P2QB 2ICEA 1K6QH 1G7LB 3FW6A 3L48A 4WTWA 2MNUA 1DANU 1NDMA 3R06A 1U8NB 3QEHB 3WBDA 2W5PA 5DA0B 1SRDA 3I75B 5DLMH 4P05A 4NQSA 3C5JA 1CI3M 3WKML 3JYBA 5KS9B 2FT6A 2ZYIA 1HZHL 1YNKL 4JFDA 3PHQB 4MNHB 3T0AA 2FQDA 1SYSB 4R2GD 3UXFA 2EXTA 2IMNA 1FAKT 1YEIL 1NMAH 1CGVA 2VDMH 4DVRL 1HXYA 1PZDA 4S0HA 3OKDB 3D12B 2DKSA 2R0KL 3MI6A 2Z4QB 1LL1A 4XPTL 5D2NB 1JHLH 3T5WA 4BQCA 1YMMB 3BUTA 4L5FE 5F9OL 5D7JB 3ZQXA 3EYOA 1FORL 3TBBA 1CUOA 2CBPA 2GQHA 2CO7A 2OMZA 2XBTA 3WOVA 2DEWX 4X7SL 4I0PC 1R5IB 4LQFH 3FUMA 2XQYA 3ARFB 4GG6E 1HKLL 5GRWA 3OHXC 3RDTA 3UGUA 3LX9A 3O4LD 3ARGB 1WWCA 5CKAA 2JB5L 1A6PA 3AS3A 3DJZA 3ISWA 5EULV 4N0UA 2ZP0T 1FYTB 5LGJA 2C1OA 5CSZA 2AEQL 3FCSA 1P7QB 2H2PD 3LIZH 1CR9L 1DQDL 1PS3A 1SOKA 1I9IH 1JPGA 2Z31D 3SPGA 4H20L 4X6DE 3PFQA 1S9KC 5EU4B 5E6YA 2NX5D 2QADC 5DQDH 3OL2A 4AV4A 4DP7X 3V0VB 4FABH 4JZNB 1E2VA 2VLJA 2ZCZA 3KNBB 3MUGA 2XRAH 3EJCA 1D5MA 1KTLA 2X05A 1MHPH 3FTUA 4LOUC 4FCHA 4Z7UA 2IIJA 3G08B 1V3KA 1VERA 2F18A 3RGVC 1M1XA 3V0WH 3NT0A 3ZKSD 1U3JA 4Z7NB 1E9OA 1BX2A 4YFLF 5D9SA 4EBQH 3D3VD 3WELA 3EOAB 4N9GB 2NOYA 4J6RL 4TVPH 4UU9B 4JG1H 3IJEA 3RI5F 3B2UD 1YNTB 5JLZB 5LAPA 1N64H 4HUXA 1QFWH 1L4IA 1GJUA 1U8CA 1R6VA 3BLBA 3EUDA 1QBBA 1NIAA 4YEEA 1QYGH 4N6RB 3C5ZB 5EO9B 1AO7E 1OSPL 3RVVD 3GWJA 5ENWB 2AK4B 3K2UH 4MJ5A 2QPUA 3MDJA 3WKPA 3H7BB 4Q74A 1F58H 1HYSC 3HNVL 3FQRB 1CLYL 3ZLQC 4MXVE 2NDFA 2O5NA 3HG2A 5DO2C 1R5VB 2XWJA 2Q76B 3MRPA 5KSAD 1R4XA 1WICA 1RUMH 2MTPA 1CPUA 4IRZH 1Q9KB 5HHNA 3R06B 1PZ5B 1Q9OB 5D7IE 4Z76B 2EUVA 5HHXH 1ZLVH 1BYOA 3QZWG 4WDIB 1YECL 1CXEA 1NGWA 2EIBA 4G9DA 4B95C 4R2GC 3JVGC 5D70L 1Z3GH 5E8NA 4KH2A 5IJVA 3FQXA 3ZDXF 2EVGA 1CMOA 3KDMB 3UJTH 3DK0A 5EFIB 1MI5D 2QQLH 2YD2A 5D7LB 1NGZA 5F88A 2EUZA 4PJHA 1NL0L 2A7BA 2X4SB 1ROWA 3I6SA 4APQA 4KKRA 3UBXB 4ANWA 3LEYL 1K8DB 1YJDH 4N0FA 4F80A 4RGMB 2BLFA 4NNPL 5B1BB 1N10A 3GKWL 3QNXA 2NY1D 5I1GH 5INDB 1GGTA 1TVHA 3KCPA 4FFZL 3B9KD 5I8OH 3T6QC 3U7WL 3TWCH 1MW2A 2IFFH 1WZ1H 1A1MA 3O9WA 4OKDA 4AQ1A 2YD8A 2V33A 4B9KC 2AANA 3VQLA 1SVCP 5GS0H 3H3KA 4XODA 1KGWA 1ZTXL 2OK0H 5LNEA 4NQDE 5EU3A 2DH3A 3Q44A 4J3VA 1QPKA 2Z31C 2VISB 4YDIH 5I8KL 1MCPH 3HG0A 2XWZA 4OIIH 2DH2A 3EJUA 1OQXA 3QUKB 3G5VB 1VZHA 5FO7A 1LILA 1WV7T 4ANUA 4FD0A 3MLTA 4M5ZH 1JFHA 2ZXGA 4YHYB 3O2DH 4P5TA 2IWGA 4HJ1A 4F8NA 3GB7B 1C08B 3IBEA 2LGNA 3B1UA 4R0LC 3A4DA 5FYJL 4DVBA 1I8MB 3MJWA 2E4FA 3U6XA 2CJTA 1T03H 5FKPB 2ESVA 4A2HA 5F2FA 4ZUWA 5F7WC 2C9PA 2BVUA 4LCIH 5CBAA 1AI1H 4JRXE 3KPSB 3VGAC 5JIMA 1OB0A 2AJZA 4NO2A 3FKUS 1AGBB 4WUKH 5HGAA 2PXYA 4QWWC 5E70A 3U25A 2IO5A 3TYGH 1XZ0A 2GBAA 1NIBA 5KJ7E 2DDQH 1MFNA 3WIAA 2YAQA 4JB9H 5C0AD 2K7QA 3FQ1A 4KRMB 3FN3A 3JTTA 2PCFA 3PDDA 3WFBH 1MRDH 3GK8H 1IL1A 4KNTA 1M6OA 5JNYA 1WPCA 2ISDA 1KBGH 3RVVC 3LKSB 1RZFL 3VYPA 3T0EB 4G70B 4IBTA 4XE5B 4APXB 2WTRB 1CLZH 1P5UB 1I7RA 2FH8A 1P0SE 2AXFA 2P7TB 4G1EB 3VH8A 2APFA 4WO0A 2YGVA 1CD0A 3H9SD 1MFDL 3IGAA 3QO1A 3TN0B 4JFOB 4L8SC 4X5XB 3D2TA 5C9JB 2OL3L 3IJ8A 2ICWI 3OXSB 4NGHL 4IRZA 2XWRA 2Z91B 5FW8A 1GGIL 2X9YA 5DD1H 5IWLA 2PW1A 3BT2L 5FGRA 1S4IA 2YEZB 3C75A 3QI9B 5DURD 2JIXB 4XNZC 3F7QA 5I1KL 4YDVA 1P4BH 5FA3A 4PRBA 2CSPA 3RY6A 4LLYA 1LK3L 3PL6D 3E8VA 1X5XA 1XSIA 5BJTB 2XXFA 1QSEE 3LRKA 3NRPA 1L9TA 3D50A 4N24A 3FCBA 3VGHA 3SDAB 1TKWB 3K2MC 2HLAB 2VQ1A 2VDMB 1RZ8A 4IRJA 3ZDWA 3ZJAA 4AVKA 5I71C 4ORGB 5BRZE 4MDJB 3E6HB 1I7UB 2R0LL 4KXDA 5AQ0A 4AH2B 2CJUH 2R2BB 3P4LA 4JRLA 1YYMH 1UD2A 2NY1C 1YCSA 4HJIA 1BQ5A 1QW8A 4OGXL 5ALCL 4R97B 3EOBA 4MS6A 3B9KC 3DDFA 4TNGA 2LT9A 4XMLL 12E8L 1MRFH 3FSZA 1A3LL 3WFEH 4PRIB 5CWSB 5I66B 3BZFB 1IQWL 1OHZA 3GXNA 4XNQA 3C6LD 1HJBC 3P3YA 2R1XA 3OAWA 4Z6AT 2KHAA 1A6VL 1ONQB 3D33A 2HH0H 3OLIA 2D0FA 3Q9QA 3RWJA 1RJLA 4RFEA 4LCYB 1CYXA 1HC1A 5K9QG 1A14H 1OE2A 5TE4H 3RTLA 4LL4A 4MAZA 5I16B 4OGYL 4HIQA 1EZVX 3L5XH 4Z7QE 1UENA 3FT2A 3TH2T 1MNUH 4ZUSB 2CGRH 5C0JB 1NQBA 3CLWA 5DLLA 3SGDI 4QHNB 5AB9A 3EJPA 2JKWA 4NQCA 1F6FB 3O2DA 4EI5D 4ZXBA 5E8EA 4EUPH 3V4UL 2XVGA 5HJ3A 3MLUL 5H35A 3SKNA 5I28A 2G3NA 5KS9F 2DD8H 3PYCA 2F1AA 3REVA 1D6EB 2GHWB 2YQGA 4Z9KB 3CQFA 2WO4A 2Y5QA 3EO0A 3RPBA 1E4HA 2NZ1A 4PJEF 1E2ZA 4MMYB 4DKAA 1UKSA 4UI2A 2P4AB 4IJ3C 1ITCA 4PJXA 2ZUYA 5B3SB 2V2XA 1WT5A 5I6LA 2YMTA 3COOA 5DQ9A 1E8WA 4FYSA 5DGQA 5I9QB 3APCA 2ITEA 2EO9A 3RY4A 1T22A 1ZY9A 1I53A 3GZQA 4BSJA 4MZ3A 1DANT 2OMWB 4IDLA 2F53D 5F0PB 4HH9B 4MMZC 4AXWA 3CH1A 1JZ3A 2OSLA 3ABLB 3L3HB 4IMKA 1DSWA 5C0BA 4A37A 1KPRA 3O4OC 5AYUH 5F1NA 3OKOB 3MA7B 4HWBA 1XD0A 3DPBA 2EEBA 5LGHH 1IM3A 4IBSA 1IAIM 3DUUA 5T1LD 2PYEB 4MJJA 3AY4C 2NY7L 3CVIL 3CV5A 3V0FA 4Z7NF 4R7NB 1QKZL 1FGVL 2IPUK 1LO4L 2BNQE 4BK4A 1FFPB 2A3TA 1F1DA 2Z9TA 4L5FL 5DMGC 2B3RA 3QDJD 5EO1B 5HYSG 4U3CA 4LPCA 1KT2B 1MJ8L 2X87A 3UL4A 2HVBA 4HU2A 3V6BR 3ZUCA 1YNTF 1OHQA 3QCUH 5L6YL 2EE2A 4NN6C 2FZ3B 2Y1VA 4ZRGA 5CJOH 1YG9A 4KK9C 1RURL 2YFNA 4LMQE 4QJ4B 1TQBC 4RA0C 4FTVE 2H1PH 3O8XA 3G5XA 3IKKA 4YHNB 4EVNB 3IWVA 3MRQB 1M7IB 4RMWA 3ATEA 2EXSA 1BIIA 3DX8A 5JDJA 1ETZA 4HUVA 1VFUA 3PREA 2J56A 1CIUA 3ILPB 2QSCL 2YK1L 4Q97A 3VXOB 3KPQA 2Y2YA 4PJBA 1ADQH 4LLVB 5ITBL 4BH7B 1WIOA 4EI5C 3L3OC 2VE6A 3QPQD 2X1WL 4L18A 2E74C 4Q52A 1A1OA 4EUPA 2F5AL 4G1MB 3STZA 3U30B 4BD4A 2Y7QB 4A7TA 3WHXB 1JNNH 4F7MB 2FAUA 4BUHA 3RVWC 2AJUL 3A6BL 1U91A 3SKMB 3VMNA 4GAGH 4D0BA 3UAAA 1BLNB 3V9FA 1QNZH 4NP4L 1C16A 4YMPA 3BDXA 3X17A 4HJTA 2OZNA 3F6JA 4NIKB 3SDCD 1IBBA 1VIWA 4F58L 1BVLB 2VUYA 4PTTB 3P0VL 4GBXA 2I5YL 3HPJA 3KLQA 3PGCA 2YWZA 2ZXDA 4L48A 3UO1L 3BWUC 5EIVA 2DJMA 5MP6H 2BVPA 4LDOB 3DETD 1IM9A 4GEJA 3S5LG 2HT3D 2YMXL 1ZVSA 2K6ZA 3CK0H 4K7FA 3MTRA 5CILL 1BW8A 1I85A 3BGFC 3N2JA 1T89C 3AU0A 1DVFB 3IS1X 4MA1C 4JFUA 1AE6L 4NFBA 3VI3E 2I26N 4CN6A 4U1HB 5EWIH 4YHIA 4WHTB 1IE4A 3JTBA 5TTRA 4ENED 3RWCA 1DYZA 2Z0BA 4KRNA 1K3IA 1LO0L 4QRRD 2BC4A 1V54B 2R4RH 2MOQA 4UZSA 3P77A 2PNDA 3KPRB 1MOEA 3GSRA 3I9PA 4YBQC 2NRDA 2ZT9C 3VXTB 1DQLH 4P5MB 3WMPA 1H6FA 5ADPH 4XBPA 3DX7A 3JV0A 1JPSL 4X4ME 5EU6B 4FMFA 4I5BB 1TZHA 4UV4H 3F62A 3MJ7A 1XO8A 3CMGA 4ZD3H 1ASPA 5AVSB 3ZYOA 4JE0A 1S7QB 1KB5H 2A9NH 1TSHA 3HN5A 5FF6A 5CJXC 4O9HL 5FUZH 1H5BA 3OZLA 2HMID 5FYLD 4XAWH 4O58H 5BVJA 5IFJB 1FCGA 5M7QA 5JA9A 4HCFA 5FUCE 4HYTB 1D5XA 2ZKWA 2ZYSA 4N26A 4JDVB 3GRWH 4M48H 1PG7L 3S36L 4MB1A 3QRGH 1YEDB 4PLJC 1PY9A 3BP4B 3AREB 4P2AA 1HS6A 3TYFB 4JRFA 4QAMB 1GOGA 1OCOB 3FFCB 3DVNA 5A2JH 3EF7A 3SO3C 3TBSB 4F33B 4M8UA 5KANG 3BZEA 1ZAGA 3K6NA 1WS8A 2FUQA 2NLJB 5K1JA 3NAAL 2EDEA 2NXYD 1F6AA 4Q8BA 2IWEA 4KZ0A 3VD3A 5BUAA 3SBWC 2R59A 1NM9A 2NTSP 2X0VA 3DTXA 5J06A 4NHUB 3QJVB 4PRHE 4ZDHA 3TT1H 1Q94A 5IHUH 4PCSA 1M53A 4K4KA 1NAMH 1U91B 1X7TA 1KTCA 2FEDD 3D85B 3G5ZA 2VSKB 2H47C 5KOVC 2MWCA 3QJSB 4M1DL 5E7BA 4M6NL 3SDCC 2GT9A 1HEHC 4BFIA 4P9ML 3CN0A 5HDBB 1T0PB 1UUNA 4O2FA 3FH8A 2FL5A 4DUVA 1OM9A 1UH3A 2J2ZA 1OZTG 3MXVH 4AKQA 2WC7A 1G7IA 2NDGA 1VGEH 2B16A 4NAMA 2PWDA 4W4OC 3Q0HA 3WS6A 2CKBA 4BH8B 3P54A 4BUGA 5BO0D 4P49A 4AENA 3DRTB 5JR1L 1DBML 4I88A 5HP5A 3VFWB 1M42A 1WP6A 3KEHA 1NUGA 4KKAD 4ZFFA 4ZO7A 3A0OA 4JG0H 4HFUL 4NZJA 4HHAA 4U1SA 3C2AH 4Y4KA 5F3FA 4F3FB 5BRPA 1VKXB 1REIA 3HFFA 4G71B 4ENEC 5I1JH 4Z7OB 2IF7A 3UTPE 3VXSB 4WFGD 4KJYA 4NQEB 3STLA 2AQSA 3CFNA 4P3DA 4QXUL 1KGIA 5J13B 1MQKH 4Y5VB 1IC4L 5KSUB 3L3GA 2C7UA 5D8JH 3IN0A 4FL4C 2VJXA 3NIGE 5DMJB 5CIPH 4B60A 5B7EA 1GGCL 3X13B 1K72A 2ZE0A 2NCMA 1M7XA 2WUCL 4LVEA 2AERT 3F83A 3FFDB 4XC1L 1JBJA 3RFZA 4PWKA 5GGRB 4UDTA 1DE4B 3KLAB 1EHKB 2ZKXA 2BSCA 2XV0A 4N1HB 3ULSB 4F5CE 4N22A 2EILB 5TPWL 2P5PA 1I1CA 2X2YA 1KB5A 4LVHC 1SGKA 4ODXA 2HMIC 5CBEB 2XA8L 3G6DL 5AW3B 1OCWH 2GBTA 5I1EL 1RZIB 2ZSVA 1ZDQA 3ECBA 3S0PA 5FLUA 5TE6H 3W39A 3GRWA 1SLXA 4PSRA 3RHWF 2TRYA 1UT2A 4H5SA 4XNUL 1L5GB 3CDZA 5FM5O 4HS3B 3D18B 2IH9A 1OP3H 2OBGA 3CFKA 3V4VH 1O9VA 2GUYA 1I8LC 5EZIL 1E5UI 3U36B 2VJ8A 4AEIH 1PYWB 3SPHA 1I3RB 3DHMA 3ILEA 1XGPA 2VC2H 4BFRA 1G5GA 1LO5B 1RSFA 1MRCL 4N90E 1T7ZA 5LAXB 4ZFOB 2NXYC 2NY0D 4N8CL 3GBLA 3BGMB 2RTTA 5L2JB 4LL9A 4K7PL 4PLKD 1KCBA 3MV9A 4WNJA 4ZTPH 1AFVL 4FQIH 3EYSH 4NYLA 1BVOA 2QVIA 1ACCA 1I9JH 1KV3A 4LRIA 4LCWD 4ZS7L 5HDOA 2EDJA 2Y06H 3UCQA 3LEXA 4MJ6B 1AMYA 1NAMA 1WIPA 4I13B 4WI8A 2WUBL 5E5LA 1EMTL 2HVKB 2CR6A 3QJHA 3LXCA 4Y5XB 3MXWL 1NBYA 3PWLB 3LRGA 1OAQL 4GSDL 1TETL 1LDSA 4XXCA 4MGXA 2YXVA 1A4CA 4ABVA 3OF6A 3OMIB 2FTAA 3H3PL 3S37H 3PWPD 4KXZI 4UT9L 3Q6GL 2AABH 1Z9SA 5TQ0L 4J3SA 4YOKA 1KJ2H 3U0WH 2COQA 5DR5H 4XMKL 3L9EA 3DOHA 5JPMB 1RCYA 2APSA 4OV5A 2EXWC 2JKRM 2Z1KA 3QJFB 4DKDC 3PIQA 1TMCB 3DX9B 1D5ZB 1BMZA 4G6AC 4KKAC 1NPJA 1ICTA 1VA9A 5CZKA 4Z95L 2EDQA 3BH9B 4AYBA 4BSVB 4TMPA 4HVBA 4LZKA 4OCYH 5CF3A 5K9QI 2DI8A 1R24B 2H0FA 2G60H 2FBJH 1CJYA 4XN9A 5LCVH 5BZDA 3QEQD 4PGDA 2E9IA 3DVGB 1VFBA 3U2JA 5GRVK 3CFQA 3K8LA 5AYQA 1AHWA 5BCAA 2YJLA 2EYRA 3MUZ1 1CG9B 3HC0A 4QXTA 4U4IA 3SD5A 3VQ2C 1TQCC 4OVVA 4A2LA 4HIJA 1QWHA 4WI3A 3QUZB 3DNKA 2IANE 4M3HA 1XZWA 1TQSA 2NY6C 3GGWB 3HR6A 5CIPA 2UVEA 1AAJA 4UYPA 1PIGA 1BF5A 5TGBA 4E9XA 4PP1D 5JIHA 1JWUB 2WBJD 4YFEA 1E4WH 1KN4H 4N3UA 3GUTB 1KB9J 2MCPL 2MNWA 5DMKB 5GS2D 1J8HA 2Q20A 3AQZA 3V6FA 3QR0A 4P46B 4BZ1A 4M6OH 3AGVA 3QBTB 5J56B 2YSSA 2B59A 5DK0A 1HKFA 4HUUB 5A40E 4W6YB 3ALXA 4WJG3 3VNZA 5HHQB 2HTLC 5DVMA 4XWOD 3ARDD 3FMGL 4BXVA 1D6VH 4XX5A 4R3SA 1QRND 1QSVA 5FYJD 1S9XB 1N7MH 2C3GA 4HJGA 4PCKA 1G94A 4WHDA 3OR6B 5IJKA 4N6QA 3ZDYB 5IMOA 1DQMH 1XL6A 1KIQA 4UT7L 4N25A 3V4VA 2ICWB 5AB2A 3MJ8A 3RZCB 1ZT7B 2C9XA 4D0DA 1MCWM 1QVOA 4YGVA 5FYKH 1SM3L 5DQJB 5GGVL 2CCVA 4QXGH 2JJSC 4DOHE 4OGZA 4GRMA 1GXEA 3QHZH 1INDL 1G6RH 2ATKB 2B1HH 3ZYJA 4J3TA 3U0TB 1JZ7A 5I1DB 1QEWA 2X6UA 3ZUNC 2UYLA 2N3JA 3WNOA 5IJBC 1YPZF 2WZ0A 1WD8A 1HWGB 4H13C 1Q4NX 3GMQB 5D55A 2EDNA 2OXHB 3AS2A 3CPLA 3HAEA 4ODUB 4OM0H 3T3MB 5FO2A 3RNKB 3U82B 3DYPA 2FECL 3CFJA 3M6DA 3L45A 5ADOH 2X4RA 1FSKB 3KJ6H 5ALBL 4JHZA 4M9OA 3TEYA 2R29H 3HB3C 2R56H 3CU1A 1OGAB 1OY3B 1SY6L 1NKGA 2F58H 5CCKL 5ANHA 3BFQG 4PBDA 2D9QB 2GTZB 4PG2A 4HKBA 5DZAA 3NVQA 1KGCD 4MX7B 2X53A 1Q1JL 2X41A 2XVKA 3KW8A 4K3EL 4X2UA 4MCYB 5F8QC 3W5MA 3DI3B 1C5BH 2HPOA 3EG9A 2V7NB 1NGYA 3LN4A 2D3JA 3JQOB 2QVFB 5B3JE 2FJGA 4DFIA 5JHLL 2JE8A 3D2UD 2QSQA 3DC0A 1IILE 3V5DB 3HKFA 1S78D 1NANI 4YX2L 2ZNXA 2NYYD 4I3SL 5D1ZA 1NCNA 3LN9A 3ZMEA 3FH7A 1FFQA 4GIAA 4AGNA 4P2CG 1H9VA 3S3BB 4Q6YA 2OCCB 2E4TA 1CL7I 1XSJA 3MRJA 4PG9A 5FYJU 2FWSA 1WTGT 5DS8B 3ME0A 2XBDA 1MCOH 2IMMA 4GW4A 3V55A 3PPEA 2MTAA 3LCYA 2JSFA 4EZJA 3QQ3B 1A7PH 2DM3A 2F54E 3MOBL 2UXGA 3ETSA 1II4E 4X6EA 4GW1B 2FGZA 5KAQG 5C2BH 4PP1C 4Z7VE 5IHZB 2WBJC 2Z3FA 2XZQH 3WJLA 2NW3A 3FQUA 9CGTA 1Q1PA 3IDUA 5KOMC 4FLOA 3UACA 4IOIA 3IXTA 5J6GA 2OMTB 1XGUA 3FUJA 3B9EA 3BX7C 4FKKA 1RQ5A 4UQBA 2KC0A 3Q48A 2G2RB 4N2FA 1JTPA 3BHBB 3HMWH 5I82A 4U6XA 4YXHH 5DK0B 5PAZA 3GT6A 2X12A 1P1ZB 2XNAB 4XWOC 5SWSB 1KPUA 3QULA 5HDBF 1F8TH 3B5TA 1JZ5A 4POUB 4W9KC 5CZXD 3BDYL 4C56B 5KTEH 1R3HB 2MKLC 4KTEL 4JK0D 5DEFA 4ZJ9A 5BXFB 2QPDB 5HGHB 1NIFA 1TQUA 1QFPA 1MLCA 3EGXB 2ZOKA 1DCEA 1DDHB 4HW6A 3CCHB 3GIVB 2C8NA 3TIDA 4J12A 4NHCL 1ESOA 1WA0X 4JFEA 2WIIA 4KU1A 1WBXB 4JFQB 1EUTA 2XN0A 2O5YL 2VC2B 4OZ4A 4OJAA 1FL5A 1W0VA 4G72B 5C07A 1ZLSL 3KEDA 5G4MA 3RI5K 3WFDL 2H6PB 3LQAL 5CEXA 3N6YA 5DA4A 1G6RA 4CBPA 4J28A 4Y2OA 2OMXA 1U21A 9PCYA 4WWKD 2KLRA 1TF4A 3HG1D 3Q1SL 4PJ9A 1IVLA 4JCMA 4XNYL 4YDKH 4KKBD 4GOSA 4G8GE 3X11B 1KBPA 4G5ZL 4FA7B 1A0QH 3BUDA 5MEQB 3GSNA 2JKXA 4Z23A 1OWRM 3BVNA 4YSEA 4HALA 2N01B 3GI9L 2R29A 4RETB 1I31A 1O5DT 3R18A 2YD3A 3IDJA 4J3UA 3THMH 3KPNA 2BVOA 4QRBA 3WTWA 2KT6A 3BSZL 3LB6D 1KJ2B 1AD0B 4FFYH 4RSVA 4Q6IA 4WEUD 1IJ9A 2K9UA 1BQHA 3LN4B 2E0PA 3CXFA 5C09A 3K8MA 1I82A 4U1JA 1HHIA 4KX8A 2V4LA 4CC1A 2VDKB 2NYYC 4R96A 1YNLH 4CSSA 3ZGIA 4PH8A 5A7BA 5HDLA 3M7FB 3L1EA 1MCRA 1SN0A 1YC8A 4XPBL 5DEGA 4FE9A 1ZWIB 4A7VA 3ZT6A 3RB7A 3M1CA 1GPOH 1N4XH 3I6GA 3QZWA 1CURA 1HZLA 4A7SA 2A6JA 1IC1A 1XF3B 4LEOA 3MA9H 3INUL 1MCDA 2XT1B 4M3KB 1P7BA 1INQA 3TJEL 4GW5B 4M4PA 4NQVA 4TQEH 1H3UA 3O6KH 3QRLA 4PJIA 4YQXL 5DFVD 4GIPD 1QEXA 3LQZB 3IMSA 1G7MA 3QJUB 4IS6A 3WEXB 5FHAL 3L8QA 1S7RA 4UUJA 1GHFH 4WKXA 3KWTA 4PV8A 3EFFA 1JNHB 3K72B 2VLRB 3G9VA 4M6MH 2CIIA 2VDOH 2Y69B 4G6MH 4PBWD 4W9IC 3C09C 4XO4A 5KVMC 3EO9L 2VKWA 4JDZA 1MF2L 4M1GL 4PVBA 3RTQB 1YN6A 3H54A 3RWEB 4XCCL 2IOOA 2DWSA 5GRVL 2D31A 1B3IA 4X8CA 3IMRA 3LKRA 4JQXC 5CZXC 4JFPB 1MCQA 1H0DB 2IQ9H 4AZUA 2ITCA 1KCRL 3NRQA 2VITA 4OFYD 1MCNA 1MIEH 1L7IH 4J4PA 5AUMA 1AZCA 4DUWA 1XF2A 3UYOD 1DQKA 1UADC 3LDBC 3RWIA 3GS4A 1PKQA 1J0ZA 4Q4IA 2DL9A 2WOBA 2X1PA 3U6RB 2WIIB 4W9JC 1N8OE 2DQTH 5DYOA 4M4RA 5HYIA 5F7MC 2DMCA 4JS7A 3DGDA 2DLGA 4X9BA 2IDQA 4UOJA 5E6UB 1JNLL 4YHOL 3JWNH 5BZWB 15C8H 3LZFL 5HI3C 4G7RB 3FQNA 5I1HL 4WWKC 1XF5B 4NQUA 2IGFH 1QUNA 1S5HA 1EO5A 1LJMA 2FX7L 2YC1B 2LU7A 4H44C 4KKBC 1KGUA 1M56B 4NC1E 1AO7D 3MREA 4RGOL 5LGYA 2Z7ZA 2PO6D 4JO2H 4JDTH 2RD0A 4X9GA 4WJ5B 3L08A 3P9WB 4TUOB 3PRZA 4I0PB 1RZKL 1UA6H 1UYWH 2A73B 4U7MA 1YEFL 4WLCA 1AC6A 4MSWA 1NCTA 3OHXB 1RIHH 5L2KD 3VSUA 4X7TB 1FQ9C 3VD4A 3U83A 4JJHA 1A2YA 2XKUA 4M43H 5EBWA 2BVOB 3OC5A 1PX4A 3QUGA 1X9QA 3PAVA 1CQKA 1SLUA 2IBBA 3M1BB 1B88A 5HGBA 3EKCA 1SN5A 4L3CA 5LVEA 4XX1G 1GGBH 1C5CL 1JGLL 3L95A 3RYMA 2YO3A 3ILDA 3QISA 3WE1A 4JY5H 2YGOA 2X6CA 2Y1AA 2NTFA 1Z5LA 2NY2D 1NCDH 1OZUA 4ZW5A 3BPNB 3JV6B 2D8KA 3ZDYF 4Y4HA 5F9WC 3RGVB 3BN3B 5J1AB 4Q2ZB 5DO8A 3GJFH 2A9BA 4Y1SA 3KPMB 5HVGB 3SCMD 3K1KC 2J1YA 4FXKA 4PJDB 2X3BA 3N06B 3TZVD 4YHZL 5C0CA 5E4AA 5DFVC 4F7EA 2EE6A 1MY5A 3WU1A 4P4RA 4Z0BH 4M8RA 3FOMB 4OLXL 1UOLA 5DJ2B 4DP9X 5E03A 5IM7B 2YAHA 1XB3A 3UTSA 2LHAA 1NCCL 4CW1B 5IFHL 3EBHA 3T3MF 3DX0A 3TTSA 2BH0A 4R6UA 1OKEA 3EH5B 4PD4J 3EXLA 5HSFA 1HK6A 4X42A 4NQDD 4BXSV 4Z3TA 1EAJA 1TYEB 5A2IH 1A6WL 3FRUA 4PGJA 3BPCA 4GO8A 2ZUQC 3CFTA 5GISH 4YO0B 2H32H 3VXRA 4G5AA 2FDBP 4CL7A 3PJSA 1NKRA 1UVQB 1ZSDB 4NKDA 4D3CH 5E9NA 1OF0A 4PJEA 1F02I 1IEBA 2BRRL 1ETA1 4L0ZA 4WUUE 4GH7B 4GQ9L 5GIRA 5EEWA 2DQUH 1T66D 2O6PA 1ORSB 1I4FA 4V2CB 3DSNB 4WWID 3MX0A 4B9GA 3T6XA 1HHJB 4GFXA 3SPJA 5CGBA 1UZ6F 4R2GB 5HPMB 4NN7C 3SJVE 3SZ6A 4ACTA 1YUHA 2X7LB 4CSPA 1EAOA 1GKOA 1U8MB 1M2VA 1U3YA 3E9TA 3SKUD 1MCFA 1UT9A 1N6UA 3F05A 5CINL 5AW7B 3T3PF 1YN7B 5F0MB 2Z8VC 1J9TA 4W4NA 3I6KA 4NOFA 1CFNB 2VXSL 5I73C 4OY9A 4NDMA 1B0RB 1URZA 5GSVA 1UCBH 3R7QA 1G7PB 3MRMB 4Z77B 1A7RL 4PP2A 4MXQD 4PLOB 1R47A 3C08L 3O4LB 5LQBH 3AC0A 1QRKA 2ADIA 2VDLL 3MLYL 4NRYA 4PRAA 4JFDE 4A66A 1Z5YD 2OFQA 1S7UB 4KKNA 4ZMTA 5D7SH 4EJ1C 3DRQA 3ZQWA 2JK5B 3CFDA 3B8SA 2Z6FA 1JGUH 3HCVA 4C83B 4V33A 2Z31B 4RQQA 3VFTB 2NX5B 3V0IA 4I18A 5E1IA 1TTBA 1YQVH 4NNXA 5MERB 4X99B 1QSED 5IROD 3GZOA 5GRUH 2NY2C 5EEXA 1PAZA 5GXBB 3ZQ9A 2NNAA 2ZSWB 4BWTA 4HWZA 2OZ4L 2XWXA 4R0LB 2APVA 1BXVA 1HEZB 2JB6B 2ZUWA 4JZJC 2DQIH 2R2HB 3SCMC 3MBXL 3D3VB 3GM8A 3OJVC 5G55A 3HS0A 3TZVC 5LXGH 3NZ8A 4UTBL 2OA9A 4G8FA 3BYYA 3LXUX 4N0UE 3SPVA 3P2BA 4XZ4A 4HUNB 5GRXG 3VGAB 5D72L 3NFNA 4NXKA 4HMCA 4Q9BA 4XMPL 4XNXL 2AVFA 2VM4A 1R3IH 3QIBD 3PV7A 2RJMA 5C0AA 1HOCA 2QVTA 2YAPA 7PCYA 4BQBA 5LWYL 1IAOB 1K8IB 2YGQA 3PPSA 4D9LL 2QMJA 1JGEB 4NN5C 4GQZA 1S6NA 1KXTA 3P4NA 3ULAB 2MHAA 1FIGL 1JMXA 2CH8A 2VLJE 5DGRA 2VDOB 2FUTA 2CGZA 5B8CC 1SZNA 1RUQL 4JFYB 2IJ0C 4Z7UE 1VHPA 5JXEA 3QZOA 1LVEA 2LAGB 3L2MA 3QHTC 2H32A 1V7NL 5E23A 4PW9A 4UILH 4EI6B 4MA7H 1XTLA 4PRDA 3QCVH 5BO1L 1IZKA 5A3IC 1U8JB 2X6VA 5EORH 2B14A 5CN3A 3ABMB 3DHPA 4LSSH 4D7BA 5KSAB 2O4EA 2YBRB 43CAA 4L8SB 5GJTL 3KYKH 5E5UB 1T66C 35C8H 2BPBA 3BI9X 3M17A 1COBA 4DH2A 4GMSL 3L13A 5GGUA 1N5YL 1K5WA 4TS6A 4JM2D 2A77L 5F6IC 2RAMA 4LEXH 1Z1WA 1E40A 3MNZA 4F24A 1HFUA 4XNZB 1OEZW 5F89A 4TSAH 2A6KB 4LSQL 1F3DH 8FABB 2WYZA 1LK2B 1MI5B 1CQYA 2BZ7A 1TZIA 5FW6A 3K8KA 4KVNH 1AIZA 4TUUA 3DHJA 2R2CA 1U8PB 3V6OA 2VDQL 3BEVA 3KYNB 3RA7H 4ZI8A 1ETB1 2P52A 3QUMH 1YEEL 5I71B 4IOSD 4FTDA 5KZCD 4YLCA 2MPAH 2YUWA 1EGJL 3T8XB 5C0GA 1SBSH 2NY1B 3LZNA 4E5XA 1VPOL 2A9ML 1ACYH 4FXGB 3NJGA 5EDSA 3D4ZA 4RFNC 3HNSH 3HKZA 4PVNA 4YXKL 1PMYA 3B9KB 5DWUH 5C8JA 4MXQC 2KYIA 1IKOP 4JY6B 1ZHKB 4JVPA 2VZ1A 4XHJD 8CGTA 1FE8H 1FF5A 4P57B 1VF5C 2PABA 1IBDA 2JTYA 1OAXH 1V5JA 2BCKA 2Q7YA 5DRWA 4X98B 2CO6A 3OKNA 1LEKA 4MD0B 4S0TD 1FVEB 3L5JA 4PJ7B 2OJ1A 4PJHE 3LRLA 3CHQA 1AZNA 3QWRA 1XCWA 1PZAA 2FVNA 5T5NG 2G5BA 4NXSA 5DC4B 3QEGL 3VGGA 2GJRA 3FN9A 2N0MA 2V17L 3OKEA 3OZ9L 3UADA 4ONFL 5KVGE 4LVOC 3OD3A 3LS4H 1I1YA 5JPNA 2BXYA 1J1OL 2BP0A 2VMEA 4UYQA 1KCVH 4KJQD 4NQXB 2BP8B 1P5VA 1S7VA 1SEBA 2X9XA 3KM2A 1N0LA 3TVMC 2B39A 5ILTH 1NA8A 1UFGA 4M29A 1JDCA 3GJFB 4FLRA 1FN4A 4H88L 3QA3A 1NC2D 2LFGA 4CADA 1IFHL 3SIKA 2HG0A 2WBXA 5EF0A 5ICYA 3PP3H 4W9ZA 3W0WA 5CLYA 5IB5B 4KUZH 1BVKB 4ANVA 3FYEB 3OB0H 4FCAA 2YAMA 2OI9C 4XH2A 2VRAA 4FTVD 4UQ3A 4LHJB 2ARJB 4IJ3B 5AVVB 3AG4B 5HYSB 4MCMA 4YPGA 3S34H 3BE1H 3KWWA 2P3YA 3QXTA 3O6MH 2ED7A 4ZAKD 4HLEA 2A4CA 4NUPA 2ESVE 2ZCKL 3IFPB 2UZYB 5F3BB 1NH6A 3SDXA 3H9SB 2BJMH 4QCIB 1C5DB 1P53A 3PABA 3FO0H 1G7HB 4TVPE 3K6SA 3VXQA 2F53A 3ARQA 3HC2A 5IKCA 5T5FL 4JM2C 3VFSB 4MMZB 1I1RA 4MWFA 3H1ZA 5EMYA 2OCJA 3A5VA 3A22A 2K78A 2UXTA 4P9HH 1DVSA 4KI1A 3FUFA 1FCCA 1QBAA 3PL6B 1R3KA 2GUOA 3EDKA 3O4OB 1ZLWH 1LO3H 4HSAC 4NPYA 4UOQA 5DUBB 5HYEA 2H0JA 1F86A 4F2FA 4ZTOL 1GGUA 2VAJA 3WY1A 4GXVH 1UXWA 5CEYB 4PB0H 5DJXB 3GTTA 1QFUH 3QUMA 1B2YA 2E7HA 4W9EC 3CJJA 4PJDF 4CVZA 3W2DL 4XXDB 5EC1A 3CMOL 5FUOL 5TE7H 5DHVH 1EXUA 2D2OA 2OXGA 3CSBA 4OD1L 4ZBJA 4UT6L 5IQLA 3KS0J 4DK5A 1AC0A 1BBJB 1LXMA 3LEVH 1WAPA 4D9QD 4FQCH 2IXQB 3L6FB 3C6LB 2VMDA 4B50A 2IPUG 4C55A 3MJ9L 3PJLA 3T4YB 1T1YB 1JD7A 1TQBB 5LLIC 2AVGA 3D34A 2PWGA 1I9RH 1PX8A 1W8NA 4P0DA 5KVEH 2O61A 2Y24A 2PYEE 3WEAA 2NZ9D 4JMNA 1AACA 3V7MA 4DFHA 1OF2B 1SMDA 1P4LB 3S5LB 4P23A 4XE0A 5F96L 4NBYB 1WFUA 4OZGA 4LSRL 3X1FA 5CJBA 1KYFA 4I9WD 4IKNA 3EGDB 4EI5B 4KJQC 3K80A 3HE6A 3L3JB 2WJ5A 3PP4L 3UAFA 1N12A 2PCPB 3AAZB 2ICWJ 2V2WA 5FDWA 3CDGB 4OI9A 1T21A 5I24A 1D9KA 3DV4B 1OTTD 1LMIA 2J1XA 3VG0H 1K3ZA 2LOEA 4XBGB 2F74B 3ZU8A 2VXQL 4QHPA 3NJXA 4AYFA 3NFSH 1M4KA 1FNSL 4I1PA 2WSPA 5IW6B 3QDHA 3MHZA 2C4FU 2L7QA 3POHA 2J8HA 3ZK0A 4ABQA 3RWGB 3WAJA 2O6FA 4RISL 1LQSR 4ODHL 3MGTA 2B8OT 1FH5L 4MAUL 3NYKA 4YAQA 1P2CB 3UX9B 4NQCE 4PJFB 3SHSA 4GSRA 3RIFF 4NC2B 4EIZC 4ELMB 4ZAKC 1HZHH 1YNKH 4KV5E 4FQLH 1IARB 1TVBB 5I2IA 1S7TB 2PTUA 2OMVA 3MNWB 4KVCL 1AXSA 3WD5L 2PPAA 3PWJA 1FHNA 4IBLT 3BGFB 3WIFA 5JO5A 2W65B 1J05A 2CGYA 2EDFA 4DCQA 4QO1B 4XPTH 3MGAA 4OI7A 3W9DB 2IAAC 4TQHA 2VXTL 1ZLVK 4PR5A 4PRHD 1PJ9A 4BSWA 3MRGA 2ZYHA 4PJXE 4JVWA 2EKSB 1BFOB 1Z6JT 2IH1B 4QRQA 4X7SH 2ARWA 1EH9A 1UURA 5IMLB 5MENA 4J8RA 5K9OA 1HQ4A 1OD9A 2GFBA 2G75A 3CFCH 2JB5H 5T1LB 1KPVA 2IFGA 2KPNA 4AQAA 1WHPA 3K91A 4OZIB 1JPST 2AEQH 5A2LH 1KIPB 2SEBB 4DP5X 1CR9H 4OKVA 1DQDH 1D5BB 3QQ4B 4RIRB 3KPOA 3QDJB 1F3JA 2E7CA 4HPOL 3RWDA 3WFCH 3ZT5A 1EZSA 2K6YA 3OKMA 4IHBA 2O30A 2KI6A 4F7TB 5C0BE 2J6EH 2Y72A 3CN1A 4MA8L 4HSQA 4J3XA 2VLLB 5KSVA 1WFTA 2W94A 4HQQL 4TVUA 3BP7A 3PWNB 3QFDB 3NH7H 2K9FB 3WL9A 4MRBA 2Y1ZA 1W80A 2R39A 2J43A 3PQYD 2P8MB 2ZUVA 3GPSA 3UTPD 3EADA 2FIKA 2C3XA 3FO2A 4J6RH 4G43B 1UHVA 3GSUA 4X6BB 1HCVA 2DQJL 3PGDA 3SO3B 3WN5C 1ODUA 1BJ1H 4F7PB 4P3CH 4XR8C 1A8JH 3CHRA 2K4WA 2JQAA 5JHDA 1OAYL 4KHXH 1OAKL 1XR8A 2A74A 1UA3A 3ISYA 4O4YH 3MRKA 5B39G 3AM8A 4XPGL 3U4EA 3TLRA 3ZO0A 1YZZA 1OSPH 3Q13A 4H4NA 4RBPH 3L17A 3K3QA 4OD2B 1CCZA 2EINB 4AGMA 5IESH 2CRYA 4WK4B 4JBSA 5DUPH 3TESA 4GMTL 4CMHC 2W88A 1VB9A 1KJ3L 2Y5TA 2DZEA 2IH3B 4OT1L 3SDCB 4XP9L 3K6IA 2HKAA 4XPFH 3TL5A 1OAZL 3VJ6B 4BKLB 3RAJL 5CD3B 4YE4H 4PJBE 4JHAH 1YPZA 5F8RC 5J12C 2C26A 3S88L 1YECH 4IU3A 1U8KB 2QQKH 3APFA 4R7LA 2ZKHL 1RJCA 1P69B 3EH1A 5EBLB 2J4WL 5D70H 1IUZA 4H1LH 4J1UB 4K3JL 5AENA 5E08L 2X38A 4N9OB 2UX6A 5D1XD 4QHMA 2APWA 3FBKA 3LQAC 1MHHA 3GMMA 2WQ8A 4N90D 3FB8A 3IPBA 4LCUA 4OLZL 3B7UX 4RGNE 1M05B 3SY0B 2JKSA 3RILA 5LB1A 1GJWA 2WINB 2XWTA 3NCJH 1KWKA 4MYPA 4QRSA 4PJ7F 4NNPH 4ZSOA 4YWGL 4QRRB 1QI3A 3GKWH 2EECA 1U8QB 3KHOA 1NOAA 1ZHNA 3L16A 5I1LB 3PWUA 1SHSA 5H8DA 1VLXA 4JPSA 3DO7B 1FNGA 4PMFA 5F1SA 3UTTA 5K59F 1RUPL 4O5LH 4FL4B 5ACLA 4J8RB 3IF1A 3VX1A 5EG6C 2G2PA 3C5SA 4ZOEA 3LKPA 5GS2H 3FQTA 3LH8A 3ESMA 1RZJL 2ODHA 5AW4B 4DWHA 4LNVA 1JAEA 3L1GA 4LVHB 5DHVB 4CAGA 4NAJA 5E6IC 4EO5A 4NQEE 1HXMB 3VA6A 4AGOA 3S5YA 3VFPA 2G9KA 2N0KA 3L3DB 3CVBA 4NO3A 2J6EA 4KWUA 2RIKA 4QTHA 5FYJH 1TJMA 4OCSH 4M7ZB 2IDCA 2HLEB 1GZPA 1NCHA 4ABWA 2CHXA 1MEXL 2PP9A 4K3GA 2GITB 1FFNA 2D7OA 2Q86A 2BIHA 3S4SA 2GSGA 3H9HA 3X1GA 2KQNA 4KUCD 5G2NA 4O02H 1PFOA 3PWVA 1U4FA 5ESAA 4PEEA 3U2SA 3VFGL 4YSTA 4PRNA 2IAND 3TO2A 3IJYA 3VACA 4BK5C 4H25B 3F7YB 2NXYB 1S3KH 5KVGL 2Z92A 1ZGLP 1Q0EA 3KPLB 2DIAA 3SDYL 1A5FH 3S2CA 1QLFA 2HFTA 4LQFL 1RZFH 3H8NA 1BVNT 1VEMA 1W16A 1UM5L 3X1EA 4EZKA 5IEHB 5F7KC 1TZGH 2WCSA 1JZFA 2ILLA 4LCWA 3ATDA 4MVBD 5SWZA 5IIEA 3BQUD 1IGTB 1TYJA 2ERJC 4OJDH 1TCMA 2E56A 3GIZL 3CN4A 5IT2H 1E9QA 1I7TA 2UY7A 4XOCA 2WTOA 3KBFA 4Y4FA 5I8EA 3TBVA 5ESQB 5EF1A 1X5YA 5D2LB 1CWVA 3CZUB 3LIZL 4NKOA 4KZDH 2OL3H 1I9IL 1BBDL 4AVIA 3OV6A 3BIKB 1ZVYA 2QHRL 4HAKA 4G8AC 1GGIH 3HI6H 1GYVA 5DQDL 4Q9QL 1OB1A 5FW7A 3SYQA 2XY2A 1XH3B 3T8VA 1L6PA 3FS9A 2YIHA 4PWEA 1T0MA 2QZQA 5D96C 2XRAL 1G9MH 3K71B 3MLZL 4H1LA 4OFVA 1XQ4A 2NUPB 3BP5A 3V0WL 5I6XC 1RULH 6TAAA 5E4IA 3SD2A 3TA3D 1J9QA 3JUZA 1INEH 2R0LH 1UTDA 2DN7A 3D39A 4TVPL 2J1ZA 4JG1L 4M8QB 1W8OA 4QRFA 4U31A 1F4WL 3AXIA 3CDFA 2VERA 1DN2A 5ALCH 3O2VH 5IVNA 3L7FB 4TPRL 1N70A 1N64L 4LGSB 1TQCB 3HUJA 2WLJA 1Q0XH 5C6WH 4S10A 1RZKC 1FZKB 3IMVA 5MEOA 4X6FB 3HTLX 4IEFB 1KCSH 3VX0A 1FFTB 4A7UA 2NY6B 4L0PB 1A4BA 4CVWA 3DROB 3ZRFC 4WRLA 4UCFA 1OOAA 3K2UL 4YHKH 4U3SA 2JTDA 2EDRA 4QI3A 4BZ2A 2XBZA 1EBAA 3I84A 4OGYH 4UAHA 4WU7B 4F2MA 3WDJA 2NW2B 5I1IH 1RUML 4IRZL 4XN4A 1FVCA 5FKAB 1ZRUA 3UBHA 4A67A 2CPCA 2AQ3A 3N0AA 3QARA 1L7TL 1NLBH 4NJAL 1XGTA 5AW5B 3ZHNA 5HHXL 2P8PA 4FKEA 3OJDB 2BSRB 4PVMA 2JJVA 1KNOA 2VM9A 3MR9A 1YHPA 3MLUH 3MROA 4PJFF 1CD1A 5C7XH 2XUWA 3UJTL 4BFFA 4PPTA 4ELMF 1HVXA 5J9PB 3F04A 4YSCA 2QQLL 4Z0XB 1NCAH 4BELD 5JYLA 1EVUA 3BWUF 1XB8A 3PNWB 4IHOB 4JO5A 2BERA 2NQDA 3P9LA 3QQXA 4O02A 5HHMD 4M7LH 3WNNA 3D25A 1IBYA 2BHYA 3CFEB 3H85A 3E9UA 4K9JA 4YHPA 3A47A 4AIZA 5BV7H 1YJDL 3I3DA 4HKJB 2X2HA 3HZKB 5E56A 2HG5B 3MV7A 1Q9WB 2CMRH 1JJUA 4OLVL 5I1GL 1JOIA 4W68A 4HJ0D 1I3GH 4XPHH 1MJJA 4MVBC 4YDZA 1LD9B 3BQUC 4TSBH 2QFPA 3LKQA 5GS0L 5DVNA 1HAWA 5I30L 3UP6A 2L0DA 3HMXA 4TLUA 3GSVA 3L3IA 2C4FT 2FJHB 3SO5A 1QSZA 1MCPL 3FU5A 4OIIL 3K7UA 3HB3B 1VENA 5K33A 3PWPB 4HUWB 4ZUTA 4XVJH 4AWJC 4PCTA 5E1HB 2G4EA 1JI1A 3PE9A 3I85A 4GXUN 4U6YA 5I75C 4XNAA 4M5ZL 1FV1A 2VLKD 1KTRL 3E7JA 3O2DL 4ZW3A 1ZE3C 2J73A 3MV9E 4TL5A 3VA2C 1HZKA 1UM4L 1T03L 3VD0A 4UDUA 2BHZA 3VWKC 4LCIL 3QWQB 3QEQB 1AI1L 3ASNB 2VQ4A 5DJYB 3CVIH 4DO4A 1EV2E 5CN1A 1QKZH 5DSCA 4KOBA 1FGVH 4WUKL 5BW7A 5AVUB 1LO4H 5KWYC 4BGDA 4MJ2A 4MQ7A 2C3VA 3R0MA 2DDQL 1OARL 1MJ8H 4GRLC 4JB9L 1F97A 3FSAA 5CFHA 1HTYA 3GS7A 1MUJA 3AU1B 3GK8L 3WFBL 1NC4A 1SJHB 1JUFB 1KBGL 2P47B 2HN7B 3WNLA 3BO8B 1TVDA 1DSFH 2HCZX 2COVD 1CLZL 3RPIA 2BSSB 3TIEB 2G2NA 2O6EA 1E28A 1O7VA 5DC9B 2WBJB 4UIMB 2PWHA 1TYRA 4HOZA 3U0PA 4PJ8D 1R0AH 3PV6B 2QSCH 2YK1H 4PGCB 2X4PA 1W8EA 5F7DA 1LNUA 3ATBA 5CHNB 1NGPL 2FWOB 1MSPA 3IYLW 5DD1L 1CXHA 4JQVA 3MLXH 4L1LA 2P45B 3NZSA 3ARDB 4U1IB 5SX5H 2BMKB 5C0RH 3OX8A 3HR5B 3GBEA 3DBSA 5B4MD 2IBZY 1RPUA 3O3EA 3AWFA 1QRNB 1P4BL 2F5AH 1KIUB 4FXTA 4CU8A 1M6UA 4WY7H 4HWBL 3X1BA 4AIOA 2AJUH 4U05A 3VRIA 1XVSA 5E6SB 3WYRA 2ED6A 4I1RA 5F0JB 2Z7UA 1M9SA 4FERA 4NP4H 4P2RA 3TJHD 1J12A 1J8HE 4GJTB 3SQOH 4DIXA 3CSGA 3C6SA 1NFDA 4PGBB 4GRWB 4U1GB 1HH6B 1BP3B 1ZLEA 4G6JL 4K8RD 4HJ0C 1MRFL 3CN3A 1XF4A 3WFEL 2JNZA 1I8AA 1MCJA 1LP9A 4XT1C 1E43A 4GUPB 4Z7WA 2ZWYA 4XAKD 4A39A 5L7XH 5IB2B 4HS6A 2D2CC 5JOEA 2D03L 1PPIA 5CILH 3H0TA 3QIUD 2HH0L 3GMNA 1XAKA 4LMQI 3CLFH 3V10A 4R9HA 2V3FA 1A14L 3VRLF 5TE4L 1TEGA 1X7QA 2ZOOA 2OL3B 3D0VA 4ZPVA 1PLGH 2BSTB 3ZDZB 3L5XL 1DJZA 3ARBD 1MNUL 4QOKD 1LO0H 3QGVA 5ERWB 3S3JA 3LNGA 2EDYA 4AMKL 4I3RL 3GBDA 4KRLB 3SBRA 3BAJA 2CHNA 1KB3A 2KDGA 1M7DA 1BGXH 1ZV2A 3SDXF 4JFHE 3D2UB 1CTOA 3Q2NA 3BUQA 2EVHA 2YBGA 4WU5A 1CDUA 2DD8L 3C60C 3TH3T 3QO0B 4LBEA 2XIIA 5KYXA 3FQWA 2CU9A 3CZKA 2AI0H 2K70A 5EA0L 3QIWA 3KWXA 2XZZA 3BXNB 5DCCA 5IK3A 3BFWA 2GTWB 1ZHLA 1B4LA 1G0YR 2WD0A 4N0YH 3HRZA 2WXMA 4WO4D 1PG7H 3LQMA 5DRXB 4I7ZC 3N44B 2EDLA 2R23B 3NFPA 1EHAA 2GJ6A 5FECA 5GGSB 3ZHKA 3RJDA 3LTVA 4PJ8C 1WK0A 4U1NA 4WAFA 3C09B 2XTJE 3NQIA 1WJ3A 2A2QT 3REWA 1K4DA 4LHUA 3O3DB 4L4VD 4OJFH 4QHLB 3A21A 2LLGA 4JPIA 3AS0A 5AAWA 4IBVA 2GAZA 5AKSA 2YA0A 1IQDA 2W95A 3A4EA 4AYSA 5AYUL 2DLTA 5DJ0B 1OP3K 5IVOA 1S9YB 4JJOA 4NZ8A 5LGHL 3TJHC 1N3NB 3T08A 1MAMH 2BWIA 1IX2A 2QGEA 3DJRA 3QXDA 3IGKA 3L5IA 4AQ8A 3FTGB 1KYOJ 2R83A 5AVWB 5GSRB 1U3HD 1FFOA 2QGCA 3LRSB 4FFVD 2R69A 3G6AA 5BV7B 1SFDA 2CXKA 2AXJA 4HUKB 2V6HA 3UP1A 4HFWB 3CQPA 2WK2A 3SE4A 4CJ0A 4N68A 5DWPA 3QCUL 4WWKB 4EKXA 2GIXA 3SGKC 3HG1B 1I3UA 1YLBB 4FJYA 5B38A 2PO6A 1VFOA 3AVEA 3DO4A 3S35X 4LEBA 3QIUC 2H1PL 2ZWNA 1DBAH 1IBGH 1GZQB 2VL5B 3ZRCC 2L7JA 1A6TB 1F90H 1NDGA 4HFUH 4JFEE 3IVKA 3R4RA 3HZVB 5L2KA 1BFSA 3FU6A 2B1AL 3IKCA 5FYKE 3ARBC 1EHXA 1HL9A 5C07E 5AZEL 1VRSA 4WUUD 3EF4A 5EH1A 4LP8A 2DLIA 1JI2A 4TUJB 3BRGC 3OKLA 1IIIA 4M62L 1LDPH 4QXUH 3LPOA 2C4XA 1LTXA 4K23H 2WKOF 3P2TA 5IB4B 4LQ1A 1IAKB 1QMUA 1ACXA 5D1QA 4ISVA 1CFQB 4CGUB 3WJMB 1KXVC 2N56A 1MFAH 3SJVD 1A6UH 4XNMB 4P2OD 1JNNL 1HHKB 1N59A 5EUOA 1IRAY 4PS3A 3QEUB 4XC1H 5L8LB 5E4EC 4GAGL 4KZEH 3ZDXE 1M2OA 3FB5B 4RX4A 5EU5B 4MAYD 2ZXCA 4D2NA 3S36X 4NC1C 3IE9A 1WS7A 4JFSA 2EIZA 2XA8H 4F20A 3FQYA 3P69A 5I6NA 5TDNA 4WO4C 1L0XA 1QBML 4CC4A 3ZHDA 4GG6B 3L3KB 5EC2A 2H8PA 5C09E 3T6WA 3I02B 5MP6L 2XDHA 3UPRA 3MRHB 5DD3H 5AAPA 1XB6A 5JIKA 2UWEB 3G6JF 4CVXB 4AQOA 3OKYA 1KYUA 1IGJA 3UG5A 2X5PA 1TCRB 3K46A 1FRGL 1JZGA 1CD8A 1AS8A 3QQDB 4X6DB 1W0WB 1E5AA 1MRCH 5I74C 2BVQB 5KAQF 3IFLH 3WMSA 5GGTA 3TP4A 4FNRA 1X5FA 2IALB 2R4RL 1MY7A 4GLRI 3A4FA 3R7RA 4YSSA 3BEWB 3LD8C 4PJIE 4RRPM 4KQ0A 1P1VA 1CGTA 2DW5A 2VYRE 3EYVB 4YZFE 3TBTA 1G1YA 1SDDB 3HRPA 1J5OL 3GHBL 5ADPL 4JPKL 1OCZB 2G3XA 1BWWA 4MCNA 4QTIL 3RDTD 3EIFA 1NTDA 3L4ZA 4F7CA 1DJSA 4OF8A 4GSXA 3OAYH 5IEKA 2LR4A 1R3JA 1RJZB 4ES9A 1MCBA 3QUXD 4NNYA 1U3HC 4FFVC 4KK8D 4ZD3L 4GSDH 1OAQH 4JJ5A 4BCZA 3X1NA 4Y2LA 4NN7B 1U8OB 3H3PH 1KB5L 3SYOA 2H1LM 4UT9H 2VN6A 3Q6GH 3NK3A 4H0HB 1YEGL 2WLZA 4LIQE 5FUZL 4XAWL 4O58L 4QYOB 3W38A 5T3XD 4DQAA 2DQMA 4NENB 2VLJD 1FVDA 3IRZA 2L7UA 4WWPA 3TBYB 4Z3IA 3GRWL 4M48L 1AO7B 1BXXA 2A4ZA 3QRGL 4C4BA 5ABDE 3DX2A 3ZKMC 5I73B 2QQNH 2ZX7A 4Z95H 4DAGL 5EZJB 1GMEA 2ATPB 2WYHA 4MXWH 5FB8A 1PKQE 1MREL 1JZDC 4OUUA 1A9BB 3MMEB 1BAFH 1CFSB 5DU7A 1UOWA 3MJGX 4PY8I 2R1YB 4IW4C 3WFHB 2UUDK 4LDEB 1R3LB 4KX9A 2Y7MA 5D7IB 2NSXA 2ZUSA 3H9YA 1UASA 4FQHA 2OMUA 4BFKA 4B3VA 5C0IA 4H0IA 1PNDA 3NSFA 5BPPA 4ZPTB 2CDGB 2WXJA 3ETTA 4IRSA 3TT1L 3TCLA 2YOAA 3AW5A 3QFJD 2NT1A 1RK0B 1KJVB 1T5WA 3BOVA 1NAML 1RVFL 2NY2B 2Q3XA 2GIMA 1DVYA 1XH0A 1Y6MR 4LLUB 4I48B 3WS3B 1GYUA 2ROXA 3II2A 4G6KH 4ZT1A 3DX1A 3V5KB 4JO8A 4F37F 4ZX3A 4JZJB 5CP3H 5JOFB 3SCMB 1KWGA 2X40A 1AGCB 4HX1B 3TZVB 4NO5A 1J10A 5T33H 5DJ8B 3FTSA 4RDBA 2R2EB 4PGZA 1Y6NR 3MXVL 5C1MB 1CICA 2RMNA 3FMGH 3P3TA 4GRWF 1XBRA 2MSPA 1OSZB 1ZGLB 2EEXA 1HL8A 1O7SA 3V5HB 3BWAA 1WC7A 4FQXD 1NFIB 1DL7H 1IEAA 3IMWA 4NQDB 4NRXB 4WFHD 2KZBA 4NN5B 4LU5H 1DZ0A 4EN3D 3C2AL 5B8CB 5MEPB 1EZVY 2WLIB 2P8LA 3GM0A 1BD2A 1F56A 1DVUA 3F01A 4RGMC 4XTRD 3D3VE 5H2BB 6CGTA 3TBWA 2MRYA 2CWRA 3B5GA 1PZUB 3L7EA 4Z3GA 3ZDZF 3KJ4C 5C0CE 4ZMVA 2WPGA 3MFFB 1T2QH 4PJAA 5D8JL 4HBCH 3RDTC 5DT1L 1CTMA 4GAYA 1TZOA 3SKOA 3UTSE 5T3XE 1EHNA 4I8DA 4PWIA 5EOTA 2WNKA 5F6IB 2OMNA 5ALBH 4JRXB 1NAKH 5I8CB 2XY1A 1AG0A 2OMYB 1X5JA 3L2LA 1XBDA 4HHGA 1A9EB 3ZBMA 4NC0B 3BVDB 5CCKH 3VXRE 4L8CA 4BZ1L 1UG9A 1DN0B 1VFMA 3QDMD 4KROD 4X8JB 1MNNA 1P7KA 3L5WB 4FS0A 4JRYA 5ESVB 4ZMAT 5C86A 5K5YA 3IXAA 4PJEE 2WMPB 5TE6L 4XMVA 2C9QA 1Z5HA 4P5TD 5E2WL 5I6MA 5IB3A 4YUEL 4LSDA 1NEUA 2XXCB 3HZYB 2ESVD 5F70A 4RFNB 4W9DC 4BE5A 4YX2H 1E3FA 4RNRB 2ITFA 2Q7AA 1X5HA 3N44F 3T2LA 3V4VL 5KYNA 4WEEA 5C0DA 2VW7A 4AEIL 5ACZA 4S1DD 4XNDA 4M3JA 1KF9B 2AEWA 1SJEB 2G5UA 2J20A 3GHPA 4TVPD 5F1OB 2PXYD 1E7VA 1KEML 3N41B 3LN5B 5FWRA 1ZANH 2OR8A 1ULVA 2DQDH 2XQYG 1TU2B 3BH8B 4EDWL 4M5YL 2KMWA 3JWNE 2F7PA 5DJAA 3QQ9C 1NCBL 3AS1A 1ASQA 2Z0UA 5KBKA 1JZ4A 1JXKA 2HZHA 2YN3A 3ALWA 1KIRB 4ZTPL 2GVYA 4LKXB 1IE5A 1X3DA 1QSEB 3P73A 3F2LA 1I9JL 4NM8H 2JXMB 4S11A 1BREA 1YY9D 1MVFA 2Y06L 2DMBA 3CBJB 3HHRB 3MRNA 3S98A 3FHAA 5BRZB 3TN0C 2WQRA 4WW1A 2ZF8A 5DJDB 1CFMA 1KJMB 1I1AA 3S37L 1NC2A 6PAZA 2H6OA 1DLFH 1ZGLM 4MQSB 2AABL 2HXAA 3X3FH 1RK1B 3U0WL 1CE1H 3PAYA 4HZLA 5DR5L 5ITFB 5DJ6B 3QIBB 3EFOB 2PTTA 4KTEH 5A7EA 2Q3ZA 2BX5A 3LZRA 2OI9B 3BKYL 3S97C 4DKFH 3UTQB 5IVXA 1U6AH 4G7SB 1I1FA 4NHCH 1SBBA 4OCYL 1T1ZB 2FBJL 2G60L 5LCVL 4ZMPA 2JJWA 2XV2A 4IRJD 4Z78A 4APQC 4XTRC 1RERA 1YMHB 1GMIA 2VOTA 2ZAIA 4PJCA 4C54A 4C59B 4GKSA 2FX9H 3WUWA 4Z7QB 1GA2A 3K2IA 4AE1A 1NBZB 1VESA 5IQOA 2ID5A 2N7SA 1YY8B 2RH0A 3K1DA 1N68A 4KFZC 1KACB 2J1WA 4GP5B 2VAAB 5ANMA 1OGSA 1YYLH 4ZMQA 3V0DA 3O9WC 3B7TA 3UYPB 4AQ1C 1TT6A 4YHLH 4JM2B 5C0AE 2JCCA 1BJMA 1QFOA 3FT4A 4G5ZH 1UFUA 4K5NA 5IF0B 5I6OA 2F1EA 3OVUB 1KN4L 4AV0A 1TTCA 4KROC 1ZV5A 4PTUA 5EIIA 4M6OL 1A3QA 2DQFA 4HK3N 3H9SE 5KZCB 1NMCC 3BSZH 4P5TC 1GTFA 1N5AB 2P5ED 2P24B 3FONA 4NQCD 5DJCA 4BBWA 4B0MB 3W9EB 1G9NL 4ONOA 1D6VL 4ZXBD 1EZUA 1OLZA 2X2JA 4N8UA 4GG6F 1AKJA 3G3LA 4U3XA 4D0CA 4M5SA 4LNRB 4S1DC 4JHWH 1U2CA 2HJFA 5FCUL 2EIKB 2HJLA 4X80L 2A38A 5FYKL 1BZ9A 3DO3A 3F7PC 4J5VA 4PV9B 4HIIB 3CFBA 3QJXA 4QD2E 4QXGL 4GLRH 3QHZL 5F1KC 1G6RL 1QLEH 2B1HL 3IM1A 2FO4A 3V6OE 3ZX1A 4X6DF 4JDEA 3L9RB 4Q14A 3DURA 5GGRY 4WI2A 1OT2A 2EXYD 4N4YB 3V7AG 4NQTA 4YQXH 3VFVB 4OF6A 2DS4A 1OVZA 2B0SL 4N2MA 2VZ3A 4QRUA 4QXVA 1NDTA 1YY9C 2QLVB 4HF5H 1TO4A 5I9QC 2QKSA 4U1KB 5I26A 3V0AC 3JVFC 4WK2B 1HILB 5ADOL 4NKIL 2OPCA 1S9WA 3GSNL 3KJ6L 2AEOA 4NWUL 3WKNA 1Q9LA 3EO9H 6FABH 1SXBA 2VABA 1JN6B 4S2SB 1S5IL 4YBHA 3UDWA 1MF2H 2R29L 4M1GH 3GJFK 2R56L 1BJ1J 4PREA 4XCCH 5IWLC 1H3VA 4XCEA 4FNPA 3VQMA 4N0RA 4FRWA 2CRZA 1KCRH 3HZMA 4JANB 3IMBA 5C0BD 4G8IA 1C5BL 3RY6C 3AITA 1HHHB 5DK2A 3CWGA 4Q7DA 5JOPE 2YARA 4FTVB 1QZ1A 3O3BA 3U4AA 2WWKO 2KDYA 5EUKA 2HRPH 4HEPA 5HTSA 2VB5A 3U2IA 4IRJC 4C58B 1IM3D 1B0GB 3HG3A 3V52L 4JHVA 1JZEA 3OAZH 4HGWB 1L0YA 4ZAKB 1DLHB 2GY5A 5KYYA 4E9LA 1YJDC 1DFXA 4MXVF 5ISZA 4HK0B 3U46B 1TTAA 2XYCA 5C08A 3SOTA 3PUCA 1JZ6A 4OBSA 3CLEL 2G4GA 1PF3A 2WIMA 3F00A 5I1HH 2VO5A 4RLDA 2WSDA 3W0WE 2MQ3A 1E27A 2CIKB 4MJIA 3LKNB 4TNEA 1FIEA 1L6ZA 2FX7H 3J27A 4PFEA 4P4KD 2JWYA 3VH8G 4OZFB 2BNUB 2XZAH 5I1JL 4LF3A 5GS0C 3CN2A 3F7LA 2AQTA 1C8QA 4ZFQA 3TU6A 2XZQL 3OAUL 1RZKH 4AT6B 2BOBB 1URLA 2YPLA 3FRPA 5B39B 5CZVH 5EU7E 4NUQA 1GS7A 2HFEB 4F27A 5BUPA 1ETJA 1S7WA 3C8DA 2R8SH 1XH2A 1S7SB 4YXHL 3VW3H 1FZJB 5DHYA 3NOIA 1B0WA 4ZXBC 1ZHBB 5LNDA 4YIQB 2KZWA 2PPCA 3EHBD 2F53E 4DHLA 2E47A 1CD9B 5KTEL 1QZNA 1DDTA 2CLRB 2EZ0D 4DGVL 4E9YA 1JGLH 1CN4A 3VAEA 4KBPA 3WLWC 3FB6B 3FCTB 2WZAA 4FI8A 2I9LA 1WEJH 3GXIA 2JKTM 3L3OA 3VI3B 1UCTA 2DLHA 4NJ9L 2ZX5A 1CFTB 4GSQA 5EZOH 3PQYA 1FDLH 4QIRA 3CZFB 4MD4B 1WDAA 1ZLDA 3I74A 5DD0H 1JXGA 4ZW7A 4YHZH 2EXYC 1IBZA 3MBWA 2OYPA 1E0OB 4DGWC 4B9PA 3BCDA 3P3UA 1VEOA 1WT5C 3WN5B 4GBXD 2IC2A 1C8PA 1XGQA 3SQBA 5C0EA 2XV6B 2X4NB 1MVYA 3EO1B 4K94H 4DQOL 2BP5M 4JPVH 4OI8A 4YDKL 3WTSA 3VXMD 2V9QA 5IR1A 3O11B 1IM9D 1T5KA 2EIEA 3CVHH 3DMMD 1DVFC 4GKNA 3T0BA 3UTZB 4R7VA 5EOCH 4NRZB 3DUSA 3RIKA 1FGNH 5TD4A 1UM6H 4PWGA 5T5NF 3BESR 3JTSA 1MH5B 4N5ED 1YAIA 5DI8B 2VDRL 2XKNA 3T1FB 2KERA 1X7SA 1EXHA 3F5WA 2DYPB 3THML 1CK0L 3Q43A 3P11L 4IMKC 1BHGA 5E99L 1PEZA 4CMHB 3R8QA 3HHSB 5HVFB 1JXFA 3WSQL 4RMSA 4ZFZA 4FG4A 3MRIA 5E2TL 3GSQB 5A16A 2ZCLL