1GSKA

Crystal structure of cota, an endospore coat protein from bacillus subtilis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Bacterial Endospore Coat Component: A Laccase with Enhanced Thermostability Properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
total genus 145
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA02
1L9SA 2AFNA 3AY2A 4HCFA 5I5IA 2EILB 5B1AB 2J55A 1BAWA 5I6PA 5I26A 3NSDA 1IBZA 2DWTA 2GC4C 3FU8A 2ZWNA 3WKQA 4BXSV 5I6OA 2HX9A 4X4KA 4A2FA 3SBQA 2FT8A 1ILSA 2IH8A 3ABMB 2XXGA 1E65A 3EH4B 2WSDA 2HXAA 1JZJA 5B7EA 3AG3B 4KOBA 5I28A 3WKPA 3IE9A 4YSDA 4HCIA 3ZIYA 1SF3A 1CUOA 4HAKA 4W9ZA 2MTAA 3ASOB 1HAUA 4YSRA 1SFHA 2PPDA 2JKWA 1SF5A 1KGYE 5PAZA 5I5JA 2ZOOA 3T6ZA 1OV8A 1SHWA 1AOZA 1WAEA 2YXVA 4KO9A 4NB7A 4AKPA 2IDTA 2GB2A 3QJVB 1NWOA 5EHFA 3RYMA 3X1NA 2HRGA 1CURA 1J9RA 1BXVA 4DPCX 4P5SA 5I6KA 1NINA 3NJKA 3UACA 1PZBA 4AKOA 3H4FA 4F2FA 4P5RA 1JZGA 2OCCB 1XB6A 3NP3A 2IDFA 4M4RB 5FC9A 2AZUA 1NTDA 2HRHA 1NIAA 4QLWA 1BXUA 1KV7A 2DYSB 1RZPA 2UXGA 1GY1A 4ENZA 4A2DA 1BXAA 3ZX1A 3FU7A 2P80D 1ID2A 1NPJA 2Q5BA 2XLLA 2GSMB 1CC3A 4QKTA 3UABA 1OCZB 4JHUA 1ET7A 2ZONA 3KW8A 3NSYA 1PCSA 1OE1A 4BXVA 7PAZA 4UAHA 3CDZB 3PXLA 2BP8A 4E9TA 3C75A 1RKRA 4E9YA 1HFUA 3ASNB 1HAWA 2XVBA 2IH9A 3TBCA 1E30A 1RZQA 2HX8A 5B1JA 2XV3A 4EF3A 2EIMB 4YSUA 4KNTA 3S3DB 1E67A 3T6VA 3AW5A 2DYRB 4YVNA 1QHQA 3NYKA 2QDWA 4DP4X 3PCYA 4DP0X 1MG3C 3FSAA 5AZUA 9PCYA 2VW6A 3FYIB 2QT6A 1JZHA 3GYRA 1AQ8A 1A8ZA 1M9WA 3FU9A 3IEAA 1VLXA 1AG6A 1AZNA 4A2GA 1OF0A 4AI7A 4G7SB 3QJTB 2Q9OA 5A7EA 2IWEA 3UGEA 4L0PB 2UX7A 3FQ2A 3FQ1A 2QPDB 4KNUA 2OJ1A 1JZEA 8PAZA 4YSQA 1ZDSA 3HEIB 2W88A 2BHFA 3SBRA 1AANA 3NJLA 1JZIA 1KYAA 3PAUA 1A4AA 3QQXA 2YAFA 5D4HA 3NJNA 2XV2A 3L45A 2GC7C 3JTBA 2CCWA 2A3TA 3NSFA 2VN3A 3JT2A 4A66A 3SBPA 4M3HA 3NP4A 4DP9X 2FJSA 2BW4A 4G72B 1DZ0A 3ERXA 4NERA 2DY2A 4G7RB 7PCYA 5TK2A 5AFAA 4UF7C 1AR1B 1WA0X 1OE2A 4YSTA 4HHGA 3T6XA 3WIAA 1A4BA 1IUZA 2R7EA 2XV0A 2CAKA 4E9SA 1KDIA 2BZ7A 3FSWA 4E9RA 1OOWA 5I6NA 3CVDA 1BYPA 2PPCA 1GS6X 3FYEB 2RACA 4AZUA 3V9CA 4GP5B 1XB3A 1CYWA 3D12B 3MX0B 4YSOA 5B1BB 4FA7B 3FU7B 5B3SB 1NZRA 6PAZA 1KCWA 1W6LA 2XWZA 1BQKA 3ABKB 3T71A 3X1FA 1PLBA 4AX3A 2J5WA 3PAVA 2WO3B 1SNRA 4YSEA 1JXDA 2XXFA 2XX1A 1NDTA 3T6WA 1URIA 3AG4B 4N8UA 2H47C 2YXWA 4G7QB 4TXVB 1WS8A 2X87A 1B3IA 1NICA 2HZHA 2BO0A 2X88A 3IBOA 4A67A 3HB3B 1ZPUA 1IKOP 2CALA 2DV6A 1PNCA 1TEGA 4PAZA 2BP8B 1AIZA 4WTQA 4DP1X 3NJFA 3CZUB 1ET5A 4DP6X 5ANHA 2ZXWB 1NWPA 1L9OA 2YAPA 4HCGA 2QDVA 4BDVB 1EHKB 3FT0A 3AG1B 1CYXA 5I6MA 3AG2B 4DP2X 1SJMA 2J57A 2PP9A 1L9PA 2H3XC 3AZUA 1L9RA 2AZAA 1XB8A 4PCYA 3S3CB 2BW5A 1ET8A 3SQRA 1QNIA 2BWDA 1A3ZA 5F7BA 1JXFA 2VW7A 3T9WA 1GS8A 2GI0A 1BQRA 3EH3B 1KBWA 4E9VA 1WS7A 2TSAA 4KO5A 1OCCB 2VSMB 1ETJA 2TSBA 3IN2A 4YSPA 1IC0A 2VSKB 4K9JA 3EH5B 1L9TA 1PLAA 1BQ5A 1ZV2A 1A4CA 2UX6A 3NJMA 1X9UA 3X1BA 1NIFA 3DIVA 3FPYA 4YL4A 1ILUA 3X1GA 4KOCA 4CSZA 1TKWA 2YAOA 1SDDB 4N4YB 4DP7X 1IBYA 2YAQA 1ADWA 2UXFA 2JXMA 1RCYA 3EF4A 3QJQB 3WNIA 3ABGA 2R7EB 1E5ZA 2PCFA 1ZIAA 3GDCA 1L9QA 1FA4A 1SDDA 3N2JA 2I7SA 1UATA 4A2HA 1XMEB 1AZCA 1T5KA 2BP0A 4HHWA 4A68A 3CDZA 1ZIBA 2HLEB 2XYBA 4HIPA 2N0MA 3BQVA 1OCOB 3WI9A 3N55A 2B08A 5D4JA 1MZZA 4JKNA 3NJIA 4E9QA 1F56A 2XU9A 1GR7A 3QJSB 2CJ3A 3FS9A 4GXFA 3OMAB 1R1CA 5B7FA 3UAEA 4DP8X 4BWUA 2E86A 2EIKB 3GXUB 3QPKA 2XUWA 1NIDA 2PCYA 2Y1AA 5B1JC 3S3BB 3FSZA 2PP8A 2YAHA 1PZCA 4BWWA 1W6WA 2I85A 2FQGA 3ZBMA 2PP7A 3IN0A 1PNDA 3QJUB 2BWIA 2FT6A 2FT7A 3QJRB 3UAAA 1PF3A 1EZLA 3ZDWA 2W8CA 4DP5X 4CSPA 3OM3B 5IY5B 2B3IA 1PY0A 3U25A 2PLTA 3FSVA 3NSCA 1I53A 3OMNB 3OMIB 2UXVA 4KO7A 1SHXA 3PAZA 4ZK8A 4BDVA 1N68A 3TASA 4F2EA 4GY4A 4KNSA 4E9WA 2PPFA 3G5WA 1BYOA 2YQBA 2GIMA 1AS7A 1ZDQA 4MFHA 4E9XA 2YARA 3CG8A 2EINB 1JVOA 3OD3A 2UXTA 4AKQA 1ASPA 1AS6A 1KDJA 2VMJA 2JFCA 2BZCA 1GYCA 3CVCA 1JERA 1J5CA 3PPSA 1AZRA 2IAAC 2QPEB 4W1TA 1QLEB 3DKHA 3WG7B 1TEFA 1OCRB 4BK5C 3S8GB 1ASOA 4Q89A 4HZ1A 2CUAA 1AZBA 3TA4D 4NAJA 3H56A 1MDAA 1ASQA 4YVUA 4GP8B 1AZUA 2VM3A 1J9TA 4YSAA 1JZFA 5B7MA 3CVBA 1J9SA 3TU6A 3H4HA 2MRYA 4Q8BA 4UANA 1M57B 5AKRA 4BWTA 1V55B 3BVDB 1OE3A 2H5UA 2P80A 5TK4A 3ABLB 3OQRA 1E5YA 2EIJB 4A2EA 6PCYA 3X2QB 2Y69B 2J56A 1AACA 5PCYA 5I5MA 5F7AA 2WO2B 1BEXA 1X9RA 3PLYA 1V54B 1GS7A 3NJGA 1N70A 2HX7A 1MZYA 3UADA 3X1EA 2NRDA 3MBWB 1M56B 4GYBA 4JHVA 4YSCA 4YSSA 3NT0A 2GHZA 4HALA 2FWLB 2CBPA 1PLCA 1W8EA 1FWXA 2IWFA 4WKXA 1TU2A 4DPAX 3DTUB 2IDQA 1PAZA 2OV0A 1AAJA 4RH4A 4G70B 2IWKA 1WA1X 1JVLA 2FQEA 3S8FB 1GW0A 1SFDA 5B1KA 1JOIA 1AS8A 3EHBB 5LDUA 3FQYA 3WNJA 1PZAA 5E9NA 2GBAA 1DYZA 1GY2A 2PPEA 2BP0B 2VW4A 2FQFA 1NIEA 4FAAB 5I6LA 3V9EA 5D4IA 3NJHA 2FTAA 1MG2C 4DPBX 3NJJA 2PPAA 2AANA 1JXGA 2FNWA 2FQDA 2I7OA 3KW7A 4GP4B 2VM4A 2XX0A 4F7KA 2IDUA 1YLBB 1PMYA 1GSKA 4G71B 1KCBA 1J9QA 1NIBA 2DWSA 1KBVA 2LLNA 4KO6A 1WA2X 2IDSA 1J5DA 1A65A 1NPNA 2YAMA 2AVFA 3TBBA 1AG0A 1FFTB 2YAEA 3FPXA 1V10A
chains in the Genus database with same CATH superfamily
3SDCA 3FU3A 1F4WL 2AFNA 5FR3A 3SPVB 4MJID 4W9CC 5GGRB 1S9WA 3WN5C 4Z7OE 1V7NL 2HPOA 5DVPA 3MZGB 4NZUH 1IBZA 1P84J 4LL9A 3KNBB 4PRPB 3R7RA 3S5YA 4Q9CA 3TT3H 3MLRH 4X5LA 4A2FA 1JPEA 4ORGA 4GBXD 3LQZB 3SBQA 3ULUD 1YEDB 1RL1A 4MJ6A 3VB9A 4LOEA 3Q05A 2JJVA 3VFTA 3AS3A 3HC3H 3Q8AA 4NUGH 3GLZA 2LVEA 3FO9A 1KSRA 4JGMA 3RTQD 4IU2B 3ZIYA 4BA8A 3R0MA 3ZSSA 3VG9B 1OO2A 4O02H 3TIDB 3VXSE 4OF7A 2NZIA 1NMAH 1D6EB 1KXTB 2WKLA 5CJ5A 2ITFA 5IOPB 3KJ6H 4GW5A 1JL8A 2HJLB 2ZPKL 3V0DA 3FCUB 4N87A 5E1HB 4WTXA 4NWTL 4UAOC 2FL5B 5DQDL 4HW6A 1JRHH 5ANMB 4ELKB 2YXVA 3MRMB 4NB7A 4Y8AA 5I18L 1XGTB 3AU0A 3TA3B 4YQXH 3IGUA 2I32A 2R2EB 3FUIA 4H0GA 4JE0A 3RYMA 1PGRB 1A3LL 1YJDL 1XDTT 1KLUA 1OZTG 2ZJSL 4X7DC 2AQ2A 4NC1C 2UZYA 2ICES 3NJKA 5CEXB 4LVNB 5BNXD 2E0PA 1MELA 3NAAH 3SPHA 3VRLF 4F24A 3R4DA 4UTBA 3HG1E 4BJLA 3JWNE 2VAAB 1JSYA 4RNRB 5IOKA 2AZUA 2F58L 1FCCA 1DBBH 1J0HA 3OG4B 3RIAF 2F5AL 1UZGA 2KERA 3NCWA 1FZOA 2VUKA 5C0AB 5K1VA 4XNYH 2XHNA 3VX0A 1ESOA 2HTLC 4P2OC 5D7KD 1EDYA 3CGTA 2IXQB 2YRBA 3ZRSA 4BSVB 5HGDA 1NUNB 3UABA 3M1BB 3F65A 3V0VA 3AB0B 5KYXA 2G5UA 1Z3GL 4ZW8A 5DJDB 5ABDE 3MTRA 2AHIA 1JDAA 5C0EB 1RIHH 1RP9A 3TJPA 1OK0A 4AUUA 3TWCL 4IRSA 2WBXA 4WHTA 1YY8A 5INDA 1JK9B 4NGHH 2EQDA 1FC2D 3ESOA 4FLRA 1JDCA 3WCYA 4OLYH 5CJOH 1WSST 4G8GA 1G6RA 1V7NH 2HT3D 4QHKI 2Q86A 3L3JB 3LXCA 5JPMA 3NYKA 5BZXA 2ZSVB 4I7ZC 2FD6L 1JMZA 4MJIA 2NNXA 1YQ2A 3FSAA 3HCVA 2XN9A 1JD7A 2GABA 3C5SA 3EJUA 3OAZH 3NCFB 4W81A 4MAUL 1TUPA 4IOSD 2EICA 3NFNA 1OARH 5MEOA 1DQLL 2H0PA 3IDGA 4CGUB 4FEIA 1U8CA 2JSFA 3HA0A 1RUKL 4FZEH 5ANMA 2Y07L 3CE1A 1AG6A 1NDMB 4MX7A 4Z5RA 1GA2A 1OW0C 2IPUG 2YD1A 3H6AA 4I48A 4JY6A 1FZMA 5DJ2A 1MY7A 4LLWA 2EEBA 2YKKA 4O51A 1A6ZB 1IM3B 1KGIA 2HA1A 5HY9B 1QSFB 5L88L 1JHTA 5C09A 4JE4B 4JPIB 3VGAB 3EDDA 2HKHL 1HCYA 3AT8A 1HOCA 3V7AG 1UWEL 3UJTH 2J88H 5ECJE 5CKGA 1MJ7H 2ZUYA 3QQXA 5C07E 2Y4SA 2LR4A 3QNXB 3QUXD 4YK4B 2J6WA 4FA6A 2ARJQ 5MERA 2GEQA 4LLVB 2XG4A 1A6PA 1AI1H 2ETWA 2XA8H 1FYTB 2E75C 3RU8H 1NBCA 1YNTB 4G7VL 1PZ3A 3V0EA 5KSBA 1HVXA 3WIHA 4KI5F 3BAKA 3GLAA 4XVTL 4UF7C 4BH8A 5KBKA 4NPJA 1FAIH 5DJZA 5ICZA 3NBNA 1I8IB 5I1HH 3O9WB 3FAWA 4E9SA 4NZRH 5EEXA 1P1VA 1XCQB 4K8RC 4IS6A 4QUOA 5E0FA 3IJSB 3KHQA 3BWUC 5FGCB 1JNJA 2AJUL 5E2UH 3GZOA 5BRQA 1JYVA 3VQ1C 2JKRM 1JNHA 3FT3A 3ROLB 3VH8B 3REVB 4XCEB 3ABKB 1YNLL 1CE1L 2WWNA 4N2DA 1YYLL 5G5DB 2AEPH 3MNZB 3ZGHA 2GVYA 3RHWK 5GZNC 2JI1A 4A55A 3W39A 1IQWL 2JELL 1D2PA 1EXUB 4X6CE 5AL0A 3ZT6A 4KBPA 2HKHH 2HLAA 1NGWB 4EDWL 1LLAA 5E00A 5DEGB 3TZVD 3GMNA 1T2QH 1YZZA 4CSSA 3EUDA 2NT1A 3HPLB 3RX8A 2OR8A 3QDJB 3HB3B 4LHUA 4NBXB 4QWWC 1ZPUA 3SYPA 4EEEA 4FP8L 1P69B 2HAZA 1NCWH 1QPXA 3E6HA 5TE7H 3QRLA 3STZB 3FHEA 2X4RB 5LBSA 1JV2B 1JFQL 4G3YH 4M62L 4O9HH 2J1ZA 3T3MF 4TVPE 5E6YA 2B8OT 4KRPC 4HCGA 2JIXD 5IJVB 5IW6B 3BT0A 2Y7QB 1FNSL 3THMH 1X7SA 4ZFFA 4IRSC 1NEPA 5T5FA 4F20A 1U8QB 2ZPKH 3PGCA 4XPGL 3AG2B 4HKBA 4XMLL 3BP5B 3PWNB 2H3XC 4PSRA 2WXRA 1PLGH 4F7MB 5ID1B 4R4ND 4DOHE 4XN4A 4NKIH 1YYLH 2Y72A 2CU9A 1GGBL 1RZGA 1XD0A 5FYKE 1RFDH 3IU4L 4W9GC 1ZLDA 4WWNA 5F21B 4HXAL 4RMQA 1NDGB 2VDQH 4J6RL 5F97E 2DQEH 1OGTB 1QEXA 3CSYB 2VERN 3IJSA 5FFLA 2TSBA 3IN2A 2ZOKA 3MU3A 4H88L 3N6YA 2YD3A 3IMUA 2YHGA 5GGQL 1BQ5A 4K9EC 4P9HC 1A4CA 4OZ4B 3ZRFC 1OW0A 3QWRA 4ZUWA 2R69L 4PJBB 4Z77A 2WV3A 4GXVL 4NIYE 4U1HB 4PJ6A 2FJHB 1RSFA 5CJ8A 3HMXL 3KPOB 1GCFA 5EU3B 1WISA 2IOIA 2WLYA 2P5PA 1L9QA 3JV0A 5F7KC 1BSIA 2D9CA 5E6IC 3Q1SH 4FQXA 3GI9L 5ACLA 5BRPA 1JYXA 4HMEA 4PN6A 2FJGA 4XN5A 2HLEB 4Z3TA 1U3HA 3WI9A 3N55A 3TP4A 1WGVA 3V0IA 3FC8A 5AVSB 1RPKA 1EUTA 3WN5B 4NUJA 3MV8A 3O6FC 3N1FC 4X6CA 4NJ9L 1OWWA 1EHAA 4XE0A 1X5ZA 2W9DL 2XACC 4APQC 1I3GL 4X98B 2E9WA 3HHRB 3GQFA 4BGLA 4UOW0 3SCMA 1IGFL 1XGRA 3MLSL 4YHKH 4DGYH 1FGVL 3ATAA 3ILEA 1IM9D 2FQGA 2A6DB 2CA4A 2VDOL 3VH8G 4MAYB 1NUGA 2K3TA 1T5XB 4DETA 2FO4B 2FT7A 1Q9LB 2NUPA 3H3BC 4NN5C 4YFDB 1T0NA 3M1CA 4MKTA 5D71H 1CDGA 5AYUH 3OM3B 4PJAB 1IEHA 4PLKC 1BQLH 3FMGL 1JPSH 1O7DC 3QHFL 2F7OA 1IT9H 1M4KA 1ZE3H 3EYUL 4LCIL 3VE0B 1ZVYA 5EO0A 1I8KB 1CQKA 3FT2A 3ME0B 3ZUNC 4ODVH 3IPEA 5K59F 1OZUA 2BSED 4KNSA 4L2YA 4E9WA 2EYTA 1FNGA 3ULUE 1BFOA 1HESA 4QHUB 4DEUA 5E08L 3U2SB 2VL5B 3X17A 4ZO7A 3RUGE 2QLYA 4PRDB 2QSCL 5EZLB 3ZU8A 1SY6L 4PG2A 2B2XH 3COOA 4Y5XA 3F85A 1U93B 1URLA 2JFCA 3FT4A 4GKZB 1FFRA 3MUHL 1ZGLB 5AOIA 3MRQA 2FLBT 3BUIA 4J1UA 4N5ED 3JWOH 3MLZH 4ZX6A 2B1HL 3KPOA 3VXRA 1TEFA 1FNAA 3WFZA 3ZMEA 1E5CA 3SKNB 2BFVH 3ZR6A 3GUTB 4UQEA 1WWBX 3B6SA 3QCUH 4CAGA 4X6FA 4X7EC 1NGXA 3SDDD 2VLMD 4NC1E 1A6VL 1HU8A 2QGCA 3OQ3B 5ENWB 2MCPL 3ZOAA 4YSAA 3LVTA 4NO3B 2CBMA 3L4CA 1XIWB 3RPBA 3SQOH 4Q8BA 4XBGA 4AQEA 2R29H 5C3LD 5HHPA 2FLRT 1WZMA 1A0QH 2FX7H 2WZAA 3FQXA 3I2CL 1OE3A 5C0JA 3QQ4A 3VVVA 1IBGL 1Q38A 3U0PB 2ZJSH 3UEQA 4ZFOB 2AEQL 4OCSL 2JCCB 5KVEL 2WQAA 4LLUB 3D05A 3VXUD 4KTEH 2ZNWA 2EUWA 4TUJB 2NY3B 3VRJB 4PJBE 2FUQA 2VDPL 5DVNA 2EEFA 2XIBA 5DHYA 3IJ8A 3SGJC 3RZCB 3D08A 1E8WA 3DECA 1N4XH 3VW3H 5CLWA 1YY9D 1CU4L 5C7XH 5LO7A 5C07B 2OSYA 2A73B 2DM7A 4AITA 3MBWB 5LNGA 4W9DC 5KW9L 2E5EA 3KYKH 4HALA 1WFUA 4XNXH 1XFPA 3HN5A 2DMGA 1UWGH 1XGYH 3ZRCC 5HHOA 1CYGA 3UTPE 3QO0B 2ZNXA 1SVBA 1IIKA 2NPLX 2W91A 4R96B 4M1CD 2CIKA 1JN6B 2IF7A 2DOCA 5ACZA 5IHZA 3GZKA 5I9QB 1L6PA 4HGWA 5BRZA 1IBGH 2FQEA 2RGSA 2VL5A 4MXQC 5GHWL 3DX3A 2IADB 2NXZB 5SX5H 4L4VE 1I7UB 1ZLSH 3A4AA 4KXZI 3TBSB 1RZ8A 4YFLI 4G6KH 3MGTA 3DX9A 2PCPA 1QFPA 2YSSB 3SPVA 1F4YH 1U8HB 5FDWA 3MKKA 1R3IL 4HS6A 5DZVA 4UNVA 2NNCA 3CLEL 2BVEA 1MCWM 1GJWA 2MPAH 4PRPA 6CGTA 5LBVA 4KRPB 3MCKB 2FTAA 1BOYA 1FGVH 2P52A 1LP9A 2B9BA 5IK3B 1JFQH 3H53A 4M62H 4Q9BA 1PTZA 3B2PA 3CWGA 4WY7H 2N56A 4YDVA 4PB0H 4XN8A 2WWKO 4F7KA 3WNLA 1YLBB 3DK0A 3RDTD 1PMYA 3VXTA 2XIDA 2ZYHA 4N20A 2LLNA 4AQEB 3BSZL 5K1NA 2BSDA 4YBLC 3KVDD 4Y4HA 2NXZC 5I30L 2G75B 4QRRA 2BHYA 4MBOA 4JFEA 4L9DA 4AQZA 3WNOA 4N6QA 4QOKE 1W80A 1EHXA 1S7VA 5IJKA 4FYTA 4QT5B 3O0RH 3T3MB 3LJ3A 1INDL 3JXAA 3BP6B 4MZIA 1KJVB 3O2VL 4N90D 4HWBA 1N3NB 5K93A 4LQFL 35C8H 1NFDE 3PL6D 5GGTL 2XWBA 4OJCA 4Z76A 2ODHA 4F92B 1QFUL 4H25A 4OZGB 5CEXA 1Y18B 1JZJA 1LO4H 5KANG 2P5WE 3NH7L 2K78A 2FRGP 3BVVA 3I9IA 3OLEA 4LFHG 3B7UX 3ZKXC 4IRZA 4Z3FA 4ES9A 3JTTA 5GGUB 1I3GH 3SE3A 3AREC 2P8PB 3SQOL 4OCRH 3G6AB 2F2HA 4G80A 4OU3A 1BLNB 1DN0B 1E3XA 1SHSA 5D7LD 3TO4D 5CGMA 1IAII 1U3HD 1FDLL 4PJCB 2VZTA 3V0WH 3BQUA 3SYCA 1ZTXL 4QD2E 1E4KC 1S7UA 1HYSD 5CGBA 5L2KA 4FABH 1T5WB 2DWEA 5DJYA 2XVKA 3ZKNC 3RWCB 3US9A 3CMGA 4M4RB 3QUYA 4Z0BH 2WXGA 1D7CA 3P0YL 4CC4A 4MMXB 4M1CC 2D7PA 1B0RA 4OCLC 1I1FB 5IEKB 5MEPA 5JDSA 2DYSB 3PDOB 1R24A 3KWVA 4R5VA 3U46A 1DCEA 1MCKA 2BRRH 3NA9H 1Q1PA 3VTAA 2R56L 3AGWA 2GSMB 2Y06H 4FLHA 4LEXL 2XPZA 4M7JL 4MXQD 3QJXA 5DD5H 5F7EH 5LJYH 2AV7B 1QSFD 2ISDA 4N2BA 4LARH 1NAMA 1KB3A 4U31A 1KCRH 3F7LA 4JKKA 4ZSOE 3CHQA 4E9LA 4UAHA 1RVFH 3LRMA 1K5NA 4S1QH 4KZEL 2EUZA 1CMOA 5KYWA 3HIZA 1K5WA 3CZGA 2CLRA 3L3KB 5FHAH 4OY9A 4PFEA 1ZVSA 3RKPA 5L8LB 3B1UA 4PWHA 2JKIS 1D5ZA 3SQBB 5EO1A 2ZG3A 1M7UA 5CZVL 2ZYIA 4YHNB 5C0GA 2VLLB 1E28B 3FQNA 5SWZB 4AE1A 2QDWA 3M8OL 2XJLA 2AKRA 5T1MB 3NCYS 5IQ9A 2IBBA 3OKLA 1J0YA 2J3SA 3NTCL 3AXLA 3ZZSA 1CXEA 3MRRA 2D3JA 2VN7A 1J5HA 2IIJA 2XG4B 2ENQA 4K23H 5D70L 1M9WA 1A7PH 1OD9A 1UHVA 4G80B 5E6RB 1B0GB 1GYVA 3ZE2B 1ZHBB 4QRQB 5KSBB 3ILQC 2NY3C 3PWLA 4QAWA 4WUKL 2C5DC 2PW1A 1OSZA 5IQ7H 4QIRA 3T8XA 4WCYL 3T3PF 1LE5A 1IKNA 3KYAA 4R7DB 2C1PB 3BUYB 3G3LA 3MOAL 3PV7A 4IBQA 4KX7A 3OMZA 1BVKA 2DH2A 1SMDA 2WYIA 3VO0A 3TA3D 4BKLA 3Q48A 4Y4FD 4JRLA 4FABL 1OM9A 2Q8BH 3WDIA 2OMZA 4RAHA 4XB7A 1TDQA 4LSVH 3GHBL 1IGJA 1DTUA 3BESR 3CSBA 4GLRH 3ARGB 4TNGA 3HNVH 3T3ME 3NACL 1LWJA 3P0YH 5EDXA 5I19H 2NXYC 4JO5A 3V5DA 2VSDA 2OW7A 1RERA 4N1HB 1XF4A 2CM5A 5C0BD 3I84A 4OB5L 3KXFA 2KS0A 2BNQA 3BUDA 2I24N 3DTXA 5BUAA 5BOZG 2VXSL 3F7PC 1MXGA 4GG6A 2Y7OA 2CJTA 1AE6H 2FJFB 3QIBD 3VXUA 3L2NA 4E9RA 1OOWA 2GIYA 5I6NA 1ZSHA 4FX5A 4E36A 2XPGA 2NY5C 3BP7A 4K3DH 2VIRB 1FNFA 1O9ZA 2QQKH 3V9CA 2WO4A 1MCFA 2J8UA 3GSUB 2VZ3A 1CYWA 1EAJA 1QSZA 1DR9A 5IJCC 5B3SB 4HC1H 1SMOA 3ARGD 3IPFA 3QUXA 1GZQA 1J0IA 4UNTA 1B0IA 1RJYB 4OZHA 3BPNB 4JM2A 2AGJL 2V2XA 5DS8B 5KVGL 5DURD 1KFAL 2YEZB 4LOVA 3MCLL 4PRNA 4Y2OB 1RHHA 2Z31A 1DN2A 2YK1L 1IEBB 1WS8A 5K9JH 1DQDH 2MNUA 4JKLA 3SIKA 1NICA 4KMQA 3NIDB 4TRPH 4W9KC 2Z9TA 4KDVA 1T1YB 3BEVB 1Y1UA 3OXRA 2NY1B 3J27A 1NAKH 1ORSA 3VXRE 2F7PA 4MNQE 2DV6A 1OPGH 2IO5A 2PW1B 2I07B 4OZFH 4NQDA 3MNDA 4WTQA 3L3GA 4AQ1C 4UT6A 1Q72H 5ANHA 5D5MA 3GXFA 4XBEL 5CSGA 1EZVY 2MCMA 3QCTL 1NGZB 1MNNA 5T3XH 1KGUA 1BA9A 3DIFB 2X12A 2CO4A 3EJZC 2EDKA 1N0LB 1DQQB 4ISVB 1JF6A 1LK2B 4KRNA 4U3HA 3FF8A 1UH2A 2HG0A 2R2CA 5KUMA 5SV4A 1GW6A 1E90A 1JZ8A 1YPZE 4TOYL 1T0MB 2GCYA 3L81A 2P28B 4G43A 2ICWA 5A3ID 1Q0YL 3MRHB 2IG2H 3NIGE 5GZOD 2VDNB 2R2HA 2QV4A 1NCOA 2Z4QB 3DGGA 3T0EB 2HKFL 2CRMA 1MCLA 4QRSA 4JREB 4AC4A 3H9HA 4Z3GA 1A3ZA 2LLGA 3CH1A 3FTYA 3JWDC 1M7DA 3U7WH 2G3MA 4AMKH 3DOHA 1YEKH 3KDPB 4M5YH 3U4EA 2WLKA 3HFMH 1E2VA 2GI0A 4TULL 4MJHA 2DEXX 2NY6B 4ZUVB 3AS0A 2DLFL 3OBAA 4ZXBB 3TC9A 3IFLL 2L4OA 2R1YA 3K5SA 4KQ3L 5F1IB 2LLLA 1OHQA 3DBSA 4GW1B 1FFPB 5INCB 4LHQB 5TDPB 3WN6A 3MGOA 3FPYA 4YL4A 4NIKB 5DSCB 1FL5B 4PP2B 3NJVA 4BSJA 2VAJA 2R7EB 1NLBL 5DQJB 5EZOH 1V3JA 2ZUWA 3HS0A 5I1KL 4YGVB 4ZPTA 5D7EA 5BCAA 2NTSP 3QCVH 3ZDXF 3ARPA 3DIDA 3V4VA 4TUKL 4W9JC 1QLEH 3CDZA 1KPVB 1ZIBA 4Y89A 5KYYB 1DJZA 4NRZB 4Q6IA 5GRWA 3MODL 4YXKL 5IMOB 4JRXA 3CCHB 3LQAH 5AVRB 3FS9A 4GXFA 1F1DA 2OMVA 4XHJD 4PJHA 1TQUA 4NWTH 1S7TB 5IBUG 5KS9F 2DL9A 2K1MA 3D4YA 1UA6L 1UD5A 5FIEA 5KSVB 3RA7L 1I3RB 2CLZB 1I9RH 5ICUA 2VQ1B 2ATAA 3FT9A 4PRDA 2OTWB 4GMTL 5LBGA 2EVIA 4Z7VA 1FDLH 1UACH 5BQ7A 4PCSA 3DVNB 3IN0A 3MMEA 5IMLB 2LTQC 5C0BB 1HIMH 2FR4B 4TTDC 2QVKA 1S9WB 1ZT7B 1B9KA 1F58H 5LKNA 3LKOB 1RFDL 2AJZB 4DUVA 1HQ4B 3GSVA 3MCLH 5DTFA 1E9QA 2WXLA 4P57A 4DW2H 5TQ2L 1WCBA 3KGTA 5J06A 2AK1H 4LCIH 4BDVA 4FKHA 1XF2A 1IC5L 4M9OA 5FKPB 3D33A 4QRPA 4MAUH 1MEXH 2Z31C 3FO9B 3K3QA 2KQMA 2QFRA 4H8PA 3KYNB 3SY0A 5KVDH 1IFGA 2UWEA 3SDXB 5C0JB 4OCNC 1VFAA 1SUJA 1QA9A 1UXWA 5KJRL 1DCLA 2O6CA 4EE2A 1WZAA 3FU0A 1KYUA 4N5UA 3RY4A 5DMGD 4NN6C 3ML8A 4Y19E 5FM4A 1DSYA 5CP7A 2P8MA 3WG7B 3TZVA 2VSCA 3S4SB 5IVXB 5JOFA 4UINL 3U9PL 5A40E 2VQUA 4TNWF 3KL5A 2AXFB 1YO4A 3TIEA 2BSTA 2ZG2A 5EWIH 5I0XA 2ZUUA 4F9LA 2DQDL 4AVHA 1J9SA 3TU6A 1KPRB 3CTTA 3ZL4H 4G6AD 2B1AL 4HJTA 1I1RA 5I8EB 4L3EA 4G8IB 1MFDH 5I8KH 1LP9F 2LAAA 1MJJB 2X6MA 3OZ9L 4LIQH 4R96A 2BS8A 5HYJE 5IHZB 3SGKC 4HAGA 2F7IA 1QABA 3FFCA 1F8TL 5PCYA 1CZ8H 1U4EA 1KCVH 5D7JD 3G08B 5IF0B 3V0VB 2DMCA 3EO9L 4J12A 3TBSA 4F9PA 1QFWI 2GYSA 2WSPA 5AVUB 3W3BA 3W9DA 2YSSA 1QW9A 3PS6A 1CR9H 2A83B 4QNPE 5HTSA 5JA8B 4BGDA 3RGVD 4WI9A 3FMGH 1YPZA 1M56B 1CFMA 4KHXL 5IGXH 4ETYA 1FVCA 1HI6B 1MFAL 2H26A 3MACL 3BPNC 4EDXA 5GGVL 1V3KA 3NZSA 4H8HA 3R7QA 3KBEA 1EO8H 3BH8A 1WDAA 4AVIA 5BJTB 2W81C 2XA8L 1KCSL 2ILLA 4KROC 1JPGA 4X80L 2EXTA 2WMPB 5FHBH 4F33B 3NCJH 4JRXE 4J39A 2VR9A 3HJEA 1SJHA 4G70B 1MPAL 5FHAL 3VFOA 3C5SB 3IVKB 4XMKL 3OB0H 1CDUA 1KCLA 4ZOAA 3NFNB 4N2LA 5C9JA 5CGYD 3OAYK 3LRSB 4I2XE 1DYZA 2PPEA 3GK8H 1MFUA 3PGFH 2VUOA 1NIEA 4U1KB 3ARFC 4U6VL 2WCSA 5T1KB 3MV7A 3RKDD 1KELL 2C4FU 1PCXA 1DQVA 4ZDHA 4GMTH 1VPOL 2WVSA 4HJJH 4DPBX 4PBDA 3O6ML 4UBDC 3P77A 1AO7B 4WY7L 2QKIC 3ZQ9A 2PKDA 4YE4L 4A7UA 1T6WA 1DUYA 5DT1L 1G7QA 2K8MA 4XOAA 2WB1A 4QJ3B 3T1FA 3M7FB 3IJ9A 3QUML 1KIPB 4W9FC 4DGVL 3G04A 4LVNC 1WFJA 4X4YA 1SOKA 4HCFA 1HWWA 2EDOA 4WJ5A 3B2XA 1IC1A 2V9TA 1A7QH 3UC0L 4Z7QB 5D72H 1JYNA 1IM9B 1AC6A 2FECL 2VDQL 4X4KA 3STLA 4YLBA 4G8FB 3GK8L 2H3KA 4K9EL 5EOTA 5ETUA 4FFYA 3FO2B 4KTGA 4OAWB 1IGCH 4NN6B 3VJ6A 1ZHKA 4LF3A 4RIRB 3KJ4C 4Z3HA 3MV7D 3N42B 4XNAA 5I1GH 4PGEA 5E6IA 4KQ3H 3IE9A 1BWWA 1F4XH 1J86A 4RVBA 4HH9B 2J73A 1GOGA 1TIUA 2YBRB 5DRZB 2PYEA 5BS0D 4UQCA 3MJ9A 4Z8FH 1FHNA 1UASA 4R3SA 3HMXA 4MS8C 4M6ML 5PAZA 5KN5A 4JFWA 4MQXD 2A6JA 1R9FA 4KKLD 2G2PA 1PD1A 5DYOB 1S8DA 4UQDA 2GT9A 2F9BT 4PY8J 2X4NB 3VFUB 3D51A 1VGEL 4GIAA 2WZ6A 3LRSA 1WFNA 5EUOB 1S2EA 5EV7A 2X2YA 4P5SA 5F1OB 2O61B 4HWNA 3GMOA 3RBSA 3ELQA 4N0CD 3K5RA 1NL0H 3L08A 4K8RH 4PS8A 4I88A 3W56A 2O5ZH 1PU0A 2KUTA 5I76B 1NTDA 2XQBL 5F1KC 2GSGB 2M2DA 1XGZA 1GTFA 3MUGB 3QPQC 1KB9K 4F9PC 4OUUB 5HYIA 5CJQL 4Y5YB 1V8HA 3TVMB 4GSUA 3FKUS 3LEXB 3TV8A 2YPVA 2YEVB 3MJGX 4JFVA 3OKLB 4JHUA 4HOXA 1ET7A 4PWJA 4YR6A 1EV2E 1NBYA 2X3AA 4NFDA 3K6SB 1ONQB 2R51A 4ESKA 4WJ5B 4TQIA 4HG4K 1CFTB 1YNKH 4NO0B 3PXLA 1IAKA 2PR4L 1RIVH 4NWUL 5AOKA 2XVGA 1PX3A 3RWFB 2ZICA 2N3JA 3C2SA 3FB6B 4GQPH 1IC5H 3JWDH 2K9UA 1LE5B 1P2CA 1U8KA 1E6OH 5J9PA 1ROWA 3QIBA 3IMVA 3ARFB 3BCDA 4RZCA 3LIUA 2A6IB 4XMTA 2Q8AL 4DP4X 4HK0A 2CPCA 1IGCL 1F11A 3OL2A 3C60C 4BZ1A 2YRLA 2RJMA 2BERA 3RNQB 1G7JB 3I9PA 2I25N 3ARGA 1AQ8A 3RIKA 1MJ8H 3U2IA 1FBIH 4JQIL 1CGXA 3HE6A 4LVOC 3WD5L 4YXHH 2QADB 3VRLE 2GT9B 1CFSA 1Z6JT 3KPMB 4OT1H 1KV3A 4O58L 1DQIA 3FH5A 4AQOA 4ZUSA 1MREL 2BOBA 1G1CA 1WD9A 3V8OA 4KK8C 4MCZB 1ZD6A 4ES8A 2JNZA 5AOMA 1MCOH 5T33L 1GVIA 2UX7A 2OR7A 4XMWA 2A77L 3ZE1E 1PZDA 5CWSB 1G7LB 3IFOA 3U1SL 2Y2TA 4PJIA 5C3TA 4P5KB 2AEQH 4OCSH 1TLKA 5GS0L 3HEIB 2Z1PA 1BG1A 1W16A 4ZMXA 3WFBL 1ZHNB 4XP4H 4NUJB 2HCZX 4ILDA 3V6OA 2CO6A 4ZOBA 3V6FA 1DQLH 2YD2A 4NO2B 5DMIH 2V2TB 2N1KA 4PIBA 3R8QA 5E4EC 3HRZC 1KLFB 5AUMA 3BFQG 3O9WC 3P3SA 3FHAA 4MQXC 1XGRB 2QVTA 3ILPA 4K07A 4EI5B 4K7FA 2FX9H 2EZ0D 3QULA 3QQ3A 1UB5B 1L3NA 3ZZ1A 5IWLA 1MHEB 1TJHH 3GXMA 4WUUA 2IH3B 2NY5H 4JM0A 1EUUA 4ODHH 3B3BA 2PPCA 5I18H 1M7IB 3NIGF 3FB6A 4XWGL 1QWNA 1C8PA 1M6OA 1CICA 2AQ3A 1ETZB 3ZTNH 2FCBA 4FA7B 1AYRA 4XPHH 4S1SH 4OQTH 5TH2B 3T0AA 3T71A 1HX0A 4XOCA 4AX3A 4PLNC 1AGEB 4PJ9B 12E8L 5MP6H 4S0SD 1DJHA 4U1GB 1IM3D 4NQUA 2WLLA 1F2QA 3SO3C 4MA3B 2XXFA 1XF1A 4Z78A 1QLRA 2IPKB 2P43B 3P9MB 4UYPA 3QI9A 4MB5A 4XPTH 5CBEB 3FB7B 3QJFA 2YRZA 3ULVH 1WP6A 2BO0A 1F90H 2BMKB 2F8VA 4GG8B 4JFZL 1EHLH 3KD4A 1WFIA 1N0XL 2JLLA 3SKNA 3GUTA 4DVBB 2AAAA 4MCZA 3UBHA 4OZFA 3BH9A 3CZUB 4WWKB 5E56A 5DU7A 1CGWA 1X5LA 2IV9A 4N2OA 2CNYA 4YFEA 3EFOA 5AW7B 5GZOA 4BZYA 4IMKA 2VZOA 5H35B 1MFBH 5AW6B 5IVZB 3IJHB 4Y1AB 4UQAA 5IVXF 5DHVH 1RZIB 4KXCA 2HFFB 3VD4A 3G6DL 3Q5TA 2JCCA 4JFHD 1BZQK 1O7DE 2VDLL 4OVVA 1SJMA 4IRJD 3RJOA 1R5WB 2A9DA 4JZJB 3DHJA 1KJ2H 4DT2A 4FDWA 1U58A 3U6XS 4N8CH 4OGXH 4JPVH 4BBWA 4OF8A 3SY6A 1NLDL 4R4FL 3CN3A 4AJWA 4L8CB 2BWDA 4Y19B 1T4KA 3L4ZA 5TE4L 2ZX8A 3PDDA 1TG8A 3MBWA 4HKXB 2BHUA 1QSVA 3KGRA 5KYYA 1GS8A 4POZC 1MI5A 1HWHB 4JRXB 4F5CA 3PHQA 4CMMA 4AYSA 4HMCA 2DN7A 4MBRA 4YHLL 2WY3B 1J18A 1IE5A 4XE5B 1TQBB 1RU9L 4ZUUB 1LK3H 3PJNA 4X8GA 4CSZA 5KZCD 4KK5D 1BVOA 1TKWA 4N0UB 4KUZL 1LVEA 4G2AA 2EEDA 2EADA 1I85A 1O6SA 2WLJA 2Y7NA 2VWEC 4JFUA 4WU7A 5AVYB 4NP4L 3ABGA 4Y16D 5EEYA 1Y7VA 4HZLB 3RL1B 4OW6A 1AZCA 1NEUA 3OTTA 1KJ2L 2XKSA 5T1KD 2KZBA 5IFHH 1TJIH 1GGTA 4IRSB 2D0GA 2ADFH 5DMKB 5T5NF 3JWOL 4TSAH 2N0MA 1K72A 2B08A 1XZ0A 5GJTL 3VTTA 1SOSA 4MSWB 1P84K 1CDIA 1A6WL 3OMAB 4S0TD 1OGAA 3HC4L 1DVFA 4A6YH 2IXQA 4BSVA 1TITA 4DP8X 3VXTB 1KFGA 5C6WH 3FOLA 2J4WH 2XUWA 3SE9L 2HFTA 3GJEB 3RTLA 3UL4A 2OXGA 3FSZA 3U0TB 3D39D 5DMGC 1XIWC 2WINB 3NZ8B 5CJOL 3CZEA 4ETQA 3QHZH 2PP7A 1FH5H 1J9CT 4XAWH 3GIZH 5EZIH 3O6FD 1EZLA 4QF1B 1GCYA 2ADIB 3HNTH 1E0OB 4JY6B 5GJSH 2ICEB 4I0PD 3FRPA 2EIBA 1DEEB 5EO9B 3IDIB 4LLWB 4ECNA 4O51B 3DX0A 4KO7A 3OZKA 4OD3H 4OKVB 1YEHL 5F9AC 5CR1A 5HPMA 1DLFL 4UM8B 3ZHFA 4PU2A 2BJML 1T0PB 3DYOA 3PFQA 2R4SH 4FQLL 4NT6A 3GJFH 4AJVA 1YC8A 4FFVC 3VVWA 5FGBC 4LKXA 3WXWH 4PJFE 2G60L 4K9EH 5K9QI 2I69A 1GSMA 4CRPA 3QNZA 1UJ3C 1WEJL 1KDJA 1TETL 1UXSB 3VSVA 1TVHB 2KKQA 1NBVH 2YXMA 3NIGB 3LYRA 4MASA 1WBYB 2XWCA 4M5ZL 1QLEB 1QSEE 4WKZB 1Y07A 3ZKMC 1KBBA 1K8IB 3OHXB 3W9DB 3FFOA 5C0BE 4JRFA 2QLVB 5EZIL 1BM3H 4POZD 1NGYA 2OJZL 3MRGB 5B7MA 3BKJL 1AJ7H 1S7SB 5AW2B 3LSOB 2APBA 2ADFL 2WQXA 1OP3K 2F19H 2EP6A 3BVXA 2IBZY 3ZYJA 4UDUB 4MDJB 5BZWA 3GS4A 1N59B 3QCUL 4CILA 2WTRB 5B3JE 2O72A 5C08A 3VRIB 2R69A 1N70A 2IANA 4UB0H 3C8HA 4GIOA 3IGAB 4Y4FC 2C9UA 4XX5A 3X1EA 5I1CL 5K59E 1X5HA 3LH2H 2NRDA 5FECB 1IZKA 1YNTF 1HDMB 1KBGL 2AJYL 2ICEA 4KHTH 4PJXA 1OM3L 2DDQL 5J6HB 1FGNL 2FWUA 5HPOA 3B2DC 5DRNB 2IWFA 5EO1B 1QQDB 4KJWD 4UM8A 1TU2A 1MHHB 3DTUB 5C0GB 3EDEA 2KC0A 3UROR 1TENA 4WFGE 1U8NA 4BZ2H 1S5HA 2XXCB 1SJEB 3GMNB 4AQ1A 4IGBC 5I1GL 1NJ9A 1D9KD 4HX1A 5LDUA 3H7LA 1ZAGA 3AXLB 4ATWA 4X4YB 1U91B 2H6PA 2P5ED 2DQ6A 5CEZD 2QV2A 4AH2B 4V1DE 2MCPH 2SEBA 2B0SH 3BISA 1TJGL 2R4RH 3TN0A 4B9PA 4OGXL 3BSZA 4ZTPL 2GJJA 1FPTL 5IJDC 1MWOA 1G7IA 5IQLA 2WAHA 1ZV5A 4UNIA 3FCTB 4AEHL 3NCBB 4RISL 4ENEC 2I7OA 3RVWD 2WZ5A 4HH8A 2DM2A 1N2RA 5K39A 4FD0A 2K3HA 4FNLL 3SYOA 3APFA 1MNUL 4WWOA 1GSKA 2NCMA 3A23A 1NIBA 2CH8A 1WA2X 2DQDH 4KK5C 3JWOC 4PJBF 1NPNA 5E03A 1UXMA 1W8NA 3B2UC 4XBPA 3OPUA 1BBJB 2ZKHL 4OZ4A 1LHZA 1PSKH 5D1QE 3BZ4B 3T2PA 4ODVL 3MJ9L 5D9SB 1Z7JA 1DDTA 1RZGB 5C97A 1KN4L 4FQ1H 1NCAL 4PMFA 5EB9A 3WJJC 4JN1H 2VR8A 5ESAA 2C26A 1DP0A 5LWYL 5KSBE 1NDGA 5ELIA 5D93C 2NXZD 3D2UA 4AK2A 5E94A 1BVZA 2X4QB 1E65A 3GMOB 2WSDA 1AKJA 5I1DA 1E3FA 5I15H 1SYVB 2RB8A 4KOBA 1AP2B 2D9QB 2HT4D 3BUQA 1G9HA 2B20A 4A2LA 4TUOA 5CD5C 4LSSH 3O0RL 2R1WA 1A1MB 5EU4B 4KTDH 4RGMC 1MHHA 1TQVA 3MRBB 5C09E 2WVTA 4WO4D 4KKRA 5TF1H 4OI7A 2I9LA 2OFQA 3N1MC 4P5TD 2LVCA 3UTPD 3LDBC 3MRCB 4N0UE 4XRCB 2RCSH 4ZSOB 2ZXCA 4YWGH 4MNGA 3WHXA 1FH5L 1CG9B 2AMGA 3QC6X 2WC7A 2VZSA 3S6CA 1I8MB 1ICTA 1NWOA 3LZLA 4P05A 4Y9GA 1QBLL 1QO3A 4NOBA 3IPBA 4R7NA 4H20H 4JFDB 2P42B 3IMWA 3BT2L 3K80A 5EUKA 3QFDA 4JFXB 3EGXA 3JUYA 1U4FA 4XXDA 1BD2A 5E8EB 3NMEA 5E1GA 4PG9B 2X53A 2CRZA 5A2LH 3KM2A 2EYRA 1BZEA 1QR4A 1WFMA 4PJ5D 1MJ7L 1NBZB 3VFWB 2OL3B 2WXIA 3OJDB 1JWUB 1A6TA 2X40A 3SDDB 5GS0H 1BBJA 4OGZA 1U8OB 2XN0A 1G7JA 4F8QA 2FSEB 3UO1H 2WXQA 2OMXA 2EH8L 2X1XR 2HLFC 2DYPD 3CDGA 2HT2D 4X7TA 4L4TA 3MLZL 1HHKB 4UQBA 3NQIA 2EDTA 4LAQH 2V7HA 1HXYB 4E41D 5B1JA 2XV3A 3SE6A 5DRXB 1EJ8A 4IGBA 1E67A 1FP5A 4KU1A 3RVWC 4XO5A 5AOLA 4APQB 2MHAB 4JRXD 2DLHA 1JPFA 2R0ZH 4L0YA 2BDNH 2YBGA 3IBEA 4NQDE 2G5BB 1MG3C 1GZHA 1UURA 4OIAA 4FFZA 3ZTCC 4R4FH 1FNSH 1EGJA 2XNAA 5DEJA 3MTXA 3N40P 2DQTL 5AAMA 4ZMTA 1JGVH 3AT9A 3LRKA 3LPGA 4XNBA 4PVMA 3EGDA 3NFPA 4OLWL 3DV6B 5L2KD 1H5BB 4J3OC 2CPUA 1WYJA 5E0QA 4ZAKA 1U36A 3HZMB 2R29L 4AI7A 4ZUTA 4WW2C 1LMKA 3FULA 4XGZA 4XAKE 2E7HA 3P4NB 2MCAA 1BGXH 1WZKA 1HS6A 5CMAA 2OJ1A 1MCCA 2DQJL 2NQ3A 2Y7SA 3S5LG 3ZDYE 1A7NL 4HHAB 4Z7VF 4LCYB 4S2SB 1MCEA 3V4LA 3V5HA 1S7TA 5G2NA 3MRMA 3VRJA 1AR1C 2ARJA 3EO0A 2EE0A 1QUNB 4MMZC 4TS6A 5A2IH 4DN4L 4TQ8A 2VXUH 4HUUB 3BGMB 1R17A 1L0PA 3CUPB 2B4CL 4ODBD 3OJDA 5DF0A 5T5FL 3SBPA 1I3RA 4Z23A 1KXTA 2FJSA 1FLTX 3FH7A 3IMTA 2KMWA 5ERWB 5HI4C 4ZQTA 4OLVH 4DJMA 1MRFL 1I7RA 5ISZB 1QR1A 2B14A 5I1KH 1WFTA 2ZWLT 5E1AA 4XXWA 4BFIA 2JH2A 1DVYA 1EEYB 2AF2A 4JAMB 2VDNL 4PYHA 2XWRA 5D5MF 4GP5B 5DLML 1RZ7H 5F72S 2DIAA 5B1BB 2GJZB 2DWXA 1SQ2N 1QSED 1U95A 5FKPA 2XWZA 3M1BA 1E2WA 2B1OA 1A2YA 4JREC 4F7CB 1JZ2A 5TTRA 2PO6D 2EDDA 4AL8L 3OKDB 4AC2A 3GLEA 1SDYA 4DGUA 3R1GL 4IRJC 5AVVB 3RZCC 5IFJB 1JK9A 4HIXH 4TXVB 5FM5O 5I1JH 1QPPA 2G9KA 3EJYD 2X87A 4XTRD 4ZD3L 2W60B 2AABH 5LCVA 2J43A 2KQNA 3K81A 5DJDA 3IBOA 4AGNA 2CIIA 5FYJU 4ADJA 1Q9KB 3BAEH 3CFJB 2E7DA 1JF5A 4PAZA 3LXUX 2Q8BL 3PE9A 3LNFA 4HWEH 3A6BH 5F0JB 3KWXA 1KJMB 2JKLA 2DI9A 4ANKA 4CMHC 1EX0A 4RGND 5AEAA 1W2KT 1MCPH 3LQAL 4UTAH 32C2A 3SDAD 2YK1H 4WI6A 2F7RA 4C8XA 2R8SL 3OJVC 4MKMA 1UYWL 4G6ML 3RKDC 2W0PA 4H44C 4NJAL 2WLIA 3UTOA 2XTJC 3FFCB 2F54A 4KVCH 4PRIE 3UZQA 4BD4A 4D7BA 4EPSA 4Z76B 5B39B 3HI1A 5JHDB 3RGVA 2Q6WB 2GBUA 1AH1A 3DX4A 4F2MB 2ALAA 5JPMC 4UQ2B 2X4UA 1MRCL 3QQDA 4YQXL 2NT0A 2BW5A 4TYUA 4U6XA 3QIUB 3ZO0A 4WJKB 1Z5HA 4LKCA 4MX7B 3WJLA 4B7LA 2YD9A 2GUOA 5E8OB 3WTXA 3GGWA 1IQWH 3QPQD 1A1OA 4LLDA 2EIZA 5ICYA 4HSAC 4ODHL 4WENB 4LNRB 1A6ZA 2Q20A 5EU6A 5FW7A 4EKJA 1INEH 1U95B 3ESNA 3KPLA 4HXBH 3PP4L 2QBWA 4K15A 4WI8A 3DIVA 2GBVA 3BIKA 5EC2A 3U46B 3E9UA 1FCGA 2WNXA 4GAFB 4W70A 5DLMH 2UXFA 2JXMA 3B9EA 3C08H 1RCYA 1OXYA 4PVLA 3GBDA 3UTQA 4L4VB 1I31A 1ZIAA 2WQ8A 4ONGH 3MV9E 1DVFD 1DBJL 1TTBA 5BQDA 3GHBH 4L8DA 2CBTA 3GO1H 1T5KA 2XOTA 1R3JB 3B8YA 3HLKA 4B5EA 5L2JA 5A2AA 4LLMB 3E3QC 5TE6H 2GW5A 5B22A 3U6XA 5CJQH 4U1GC 3SOBL 2H1LM 1M9SA 4QHKJ 4BFRA 4M8RA 3LKQA 3RWHB 1F6AB 1R1CA 3EJJX 4P9ML 2XZQL 2JV6A 2PO6C 1KJ3H 3DHUA 1EJ6A 2EIKB 3UJTL 3CFDA 2VDMH 2CUIA 4EBQL 4L4VD 4I18A 1UWXH 5HGBA 4G8GD 1TCRB 3QXTA 3MRRB 5I17B 2X0VA 2WLIB 3APMA 4P49A 5EF3A 2YWYA 2HT3C 4YNYB 2CR6A 3BHBB 4Z0XA 1PZSA 3P4LA 1GGUA 4XVUC 4Y1AD 4MJ4A 5C09D 1KEML 1IM9A 4Y9EA 2VB5A 4XPBH 2ITDA 5JIIA 2R1XB 1JG9A 4M00A 3F6LA 3SCMD 4AM0Q 1MWAA 3WKMH 1BZ9A 2PXYB 5HD8C 4E0RA 4LSUH 2ORBH 4LF3B 4NP9A 4A7QA 1FL6B 4GY4A 4FQHB 3M88A 2JI2A 3WEXA 3KLKA 4PGEB 1T83A 4HEMA 5DUBA 3WFDL 5B38B 3GMRA 2DQCL 3KHOA 1JWMB 5DD1L 5IG7B 5DEFA 4LBAA 4QPEA 1YEEL 1B0GA 4WI2A 4MXVF 2G2NA 2VDLB 2R0WL 4QRRD 4Y4HD 3P4OA 4GRLB 4EBQH 4LOUC 1FI8C 1OCRB 2XY2A 5DDHB 4V33A 4X4ZA 2EIEA 2CUAA 2XVLA 1N5AB 1A4KB 1SHMA 3CU7A 3K6NA 1NGPH 4W4OC 4Z7QE 3CPUA 2AXGB 2Y1VA 3IF1B 1J9TA 2FJFA 1JZFA 4MB3A 5MEQB 4M7LT 4CVXB 3BP7B 1G5AA 4TSAL 1MHCA 3S8WA 2XICA 4QHNA 1EGJL 2F1BA 4PW9A 4LP4A 2GSGA 4TLTA 2AC0A 4CVUA 3BDBA 6PCYA 1JGVL 3CFMA 4W9LC 4JFYA 2Y69B 1F3RB 1NCIA 4HLZH 4HPOH 4D3CL 1CICC 5HYJB 1CL7H 4M6NL 4YK4C 4PJBA 4Z77B 3P73A 3WKNA 1E6JH 1GS7A 3NJGA 1S3RA 2DLTA 1WIPA 5FOBA 1QFHA 4N9GB 3DSFL 2NZ9D 1QFWH 4G6AC 5DRWB 4LK4A 1TF4A 2YMOA 4Z3IA 2ED7A 2DW5A 3LXAA 2FWLB 1IGIH 1MUJA 4ZMPA 1QBML 3IU4H 4P4KA 3GBML 4NN7B 2LFGA 1LO3L 1NKGA 3MGAA 4ACPA 2B77A 3T4AB 3NCMA 4O00A 1RI8A 4MJJA 2OV0A 3I3DA 3D5OF 4Y2OA 2YN3A 1AHWC 1FL3B 2R23A 1XF3B 3BJ91 2E47A 2XTJD 4OJFH 4WHCA 4Y1AE 3I6GA 3U9UA 3VG0L 1AGDA 3W2DH 1MCJA 4UT9A 3GSRB 3N1QC 4IMKC 4FFWD 2W9EH 2HWZL 3KBFA 1N12A 1MLCA 3OC8A 4DKFL 3GXNA 3MC0A 3A24A 4DCQB 1QBBA 4TQHA 2Z34A 3ULVE 1P5VA 2HT4C 2F15A 3A6CL 1MCBA 4IBYA 1IV8A 3FH8A 1SEQL 1KG0B 3UTSE 4MA1C 3SCMC 5D7KE 4UT6H 3QIUC 4ANXA 3NQKA 1B4JH 1MCDA 1QBLH 5GGSB 1J9QA 1IL1B 4CSTA 3NIDF 5E5LA 3VGBA 3RY6C 3O4LE 5L8KB 5EOCJ 2YGVA 1E5BA 1PKQA 2BXZA 5D4QA 4A38A 2R1YB 5EPMA 4RDBA 1XCWA 1YHPA 5HYFA 5HI3D 3V52L 1DDHA 3RB7A 4HIXL 5CGYC 2PN5A 3DHPA 3NIFF 4Y2NA 5I1JL 1IGIL 3BUPA 3U2SA 5I1IL 5FV2A 4B6ZA 4XVSL 5I5IA 5KW9H 4MJ5B 4PJAF 5FYLL 3H3KA 4NHUB 1OGSA 3QXAB 3IFPA 5FPIA 5DJ6A 1FG2B 5H8DA 4C58B 5ISZE 1KUMA 1OTTD 4I2XB 3OKKB 5C0CA 1MHEA 1URZA 2YQ2A 4LRNH 2WP3O 2VLKA 4RRPM 3V10A 3V6OE 4HC1A 5BZZA 1A14L 1I9IL 2AQNA 4FL4C 3MV8E 3KPNB 4OH2A 1HHJA 2X6VA 4NZUL 4U0RB 4Z7OF 3K2UL 5HDOA 4WDIB 4LCVA 4JFQB 4DKEH 4H13C 4NI6A 4X42A 5FGRA 3EFFA 2DYPB 2B16A 1MLBA 3PHOB 3TA3A 1CDYA 4JLRB 3D25A 3ZYOA 1WH0A 1OV8A 1AOZA 3NABH 3TWCH 4PRPD 3UPAA 2BZDA 5IOPA 2VXTH 3QEGH 1JD9A 2OW6A 4NRZA 1R0AL 4MDIB 1A3RH 5FYLH 4OKDA 3X3FH 2DBLL 3HHMA 3BT2H 1B4RA 1BFVH 2YSTA 4F8PA 5HD8D 3BO8A 4FXGC 3H4FA 1I1AB 1AO7D 1NOLA 2GEEA 1JTTA 2NTFB 1F13A 2XWXA 4ZTPH 3V4UL 4P9MH 1HKLH 4QXUL 2ZXDA 4FI8A 1Z9LA 1J8RA 3G6JE 3ZTJH 43CAA 4AEIL 2WLMA 1NOFA 3IS0X 5HGDB 4MCYA 1E8XA 1A25A 4BFFA 1OY3B 4HP5A 5T8IA 2ZSWB 3ZX1A 4HBCL 2ZKWA 3QRBA 2G5BA 5ADOH 2P80D 3GSNH 1ID2A 4ZNCD 5CEZH 4F3FA 2HTKD 1FZOB 5C0AA 2JJSA 1K3IA 3TN0D 4Z7VE 3W0WB 5BOPA 3BLBA 3HAEB 3BIAX 4Y5YC 3ET9F 3FAXA 4QMEA 1J1PH 1PCSA 1O9WA 3ESUF 1T2QL 4BXVA 2PXYC 3BKML 2CDEB 5E70A 3WFCL 5KSAD 1L0QA 1P1ZB 3WLWD 3C75A 3GRWA 3HLAB 1I1AD 4G11A 5GSVA 4E9YA 1QI3A 4ZMZA 3CK0L 5ISZD 2BJMH 2WKOF 1UWYA 3IJYB 4JN1L 2CR0A 1AE6L 5D1QC 1T03L 4JRYD 3S3DB 4TL5A 4U3CA 4ZYKB 3CXFA 5J3HC 1FN4A 2WCPA 1I75A 3T6VA 1ML0A 5MENA 1YDPB 3M17B 2RHEA 3CZFA 2XBDA 4LCYA 3GWJA 4S2SA 3BEWB 3F7YA 4PJ7F 4WW1A 3GIZL 4XVJH 1BQUA 3PQYD 4JQVA 3IRCA 1MLBB 3PHOA 2X89A 4JO8A 4WSGA 5HDRA 3BZEA 1DSFH 1MI5D 2AXHA 3D07A 1OPOA 2K7QA 2JIXA 4WWID 1YCSA 4ABWA 3U4BH 4JGNA 1M1XA 1S5IL 3PFUA 4XNYL 4QEGA 4RMTA 5SWSB 1MXDA 4G7SB 2Q9OA 5A7EA 1S7QA 3L95A 3W38A 3KPQB 2XN9E 1I1CA 1TZIA 2PABA 4JCWA 3DK2A 4WNSA 4XCYB 3RWEA 3GNMH 1YPZB 3C08L 1RH8A 4RBPH 4AUYA 1I1AA 1ZDSA 4XO9A 4NO0D 2C1OA 4OZGA 1JZIA 1SN2A 2XTJE 4PJGE 1JHTB 1KTDA 3GO1L 5C09B 1NBVL 3L45A 3G7TA 1NCUA 3ROOA 5HYQA 1AZVA 5EEZA 4PJCE 1DN0A 1SY6A 3FTGA 1QTYT 3MJ8A 4P4RA 4JO4L 4C59B 4DP9X 1W72L 1S7WA 4G7RB 5AZEH 3VDBA 3C6SA 3CFKB 5BV7L 4ZTEA 2CO7B 1M2VB 1ZEAL 1KJ2B 3SJVE 4URTB 3S96A 1B0RB 4ZOEA 2GAZB 4YDZA 4N26A 5MEPB 4ZDHB 4S0HA 2DJMA 3DO4A 3NUKA 4OBSA 1E27B 1I8IA 2Q76A 2QVIA 1M1SA 4AMKL 4JKPH 4NZFA 5TPWH 1OP5H 4PJIF 1RZ7L 3OKNA 2CHNA 3DARA 4OLXH 1FN4B 3ARUA 3WIIL 1VJSA 3WTVA 1W0VB 3ARXA 2A5UA 5AW4B 4O4YL 4D0DA 1DJXA 1I1FA 3KWUA 2VXSH 4B53A 5AYUL 4DO5A 1K5NB 3O6MH 5FA3B 1S9XA 1NCDH 4OIBA 3KDMB 1PG7W 4KVNH 4CC4C 1OSPH 1T3FB 2ZD0A 1SM3H 3D39A 1Q0XH 5HHQA 2JTDA 3WFHA 2MOGA 4PS4H 5LXGH 4H8WH 4UTBH 1B4JL 1PDKB 1RP8A 3L9BA 4OAWA 5T1LA 2X2UA 4LKCB 5LGJB 1N6QH 3O4OC 3WJJA 4IJTA 4Z7UB 4KXAA 1VESA 4YFLF 4OUOA 4GUQA 1EDHA 4HKBB 3CFCH 5KVGE 4A6YB 4TRPL 4KZDL 3PWNA 3SOBH 3WSQL 1JNLH 1PQZB 3FQNB 5SWZA 4F8LA 4YDIL 3MJ6A 4K2UL 2AKRB 1NKRA 1GAFL 5D1QA 3X14A 2DKUA 1I3UA 5F3BA 2X2HA 3FTSA 1HXKA 4Y16A 3LZNA 1QACA 1U92A 3KPSB 2X4NA 1XB8A 4BCXA 4EZKA 4ZTOH 2HJKB 1ZHKB 3VFUA 3EYFA 2IGTA 1Z5LB 1DQKA 1QNIA 3WY2A 2X4SA 4J6IA 3ZTNL 5JPNC 3HZVA 1IU1A 5F7BA 2BSSA 2HUHA 5A16B 1GJIA 1NEZB 4HUWB 2TSAA 3T2NH 2W07B 4IEFB 4O02L 2X38A 3QFJA 4UTAA 3MBEB 5I1HL 2R2BA 4OGAD 1QRNB 1LQSR 4R97C 4IIQA 4WVRA 5D1ZA 3GRWH 1MFDL 4I4WB 2XPYA 3KVQA 3W1ZA 3ULUL 2XTJB 3RIFK 4UUJB 2G3ZA 2YAQA 4PH8A 5E2UL 1ADWA 3UMNA 2NY4C 4DFIA 2IFFL 1AXSB 2V4LA 2K6YA 3RWGA 2VLME 3QJQB 2KPNA 1MCHA 3MR9A 4WSJA 5AKSA 3VD5A 4JM4L 4YR6B 3GZPA 2EVFA 1ZS8B 4GJTB 3QRGL 4D0CB 5CJBA 4KRLB 1N4XL 3P3TA 4LCUB 3HI6H 3OX8A 2FHFA 3D8MA 4PRID 5EEUA 3B8SA 5E6UB 1NFKA 1JPTL 1T20B 4G1EB 2C7UB 4KVPA 4XPGH 3UGUA 4Z6AT 1NUFA 2KPWA 5M7QA 1P0SE 2GTZB 4QRPE 2F5AH 3MA9H 5AWNH 25C8L 1UFGA 3D0LB 3MOAH 2XA3A 4E0RB 5CEZE 3GSUA 3A6BL 4C56B 5D2NE 3NVQA 4AQ8A 4NYLB 1ACZA 2VE6B 4MAYA 1Q94A 4TNVF 1PZCA 1QP1A 2ITEA 4YMPA 3IDNA 4G1MB 5KVEE 3NTCH 4NEHB 4P2OD 3UAJA 4OQTL 3H2WA 5D1QB 1PNDA 1CXHA 5TE4H 2IVFC 2GFBB 2WWKT 4LFHD 3AWGA 4GOSA 4JFHE 4L3FA 5SWQA 3AB0C 3QB7C 3NEOA 2X7LA 1Z5LA 4CKVX 1GKOA 1NGZA 1LEIA 3LVEA 2VJXA 2YLKA 2WNGA 4F2EA 4KKCD 3W0WE 5F7UA 2NY0C 5B4MD 3EZ8A 4GT0A 5TDOA 2QPFA 4RFOH 4AT6B 3WY1A 3CMOL 2GIMA 3CZSA 3SDCB 4FYRA 5LBSH 1ES0A 5DYFA 4B3EA 1FVDB 3ZVVA 3DV4B 3HE6B 2VZ1A 2B39A 4NENB 5DC9B 1EBPA 5EU7C 3UO1L 1BQSA 1ECZA 2X1WL 5GGTH 1UD3A 1AS6A 4XZ4A 5DVLA 1SLUA 1IKFL 1KN2H 3B7RL 4ZUSB 3ARDA 1AXSA 4LPCA 4PBWD 3EF7A 3DKHA 3RE0A 1KC5H 5DEZA 4U0QB 1L4IA 4GRMB 1WD8A 3TA4D 3JTSB 5IHBA 2IPUK 4KY2A 3ZKXB 4IOSA 1PD0A 4HKZB 4A6YL 4N9GA 4LCCC 2BRQA 4APQD 2DEYX 2CJUL 2HWZH 5GRVL 5IW1A 2ZX7A 4ANUA 3L6FB 3AQZA 2W59A 4ZBJA 2MTPA 3WO4B 4TN9A 4ZO9A 4U2YA 1VCAA 3QDMD 2EIJB 3LB6C 4J3OD 2WM0A 1UUNA 3SDAA 3V0WL 2E3VA 4OCXL 5HHXL 5IKCA 4MZRA 4IJ3C 2ZUQC 3TWYA 4RGNB 1UB5A 4IU3B 3L5HA 2P48B 3UJIH 1JWUA 1FFPA 1K4DA 2YC1A 1G1YA 3TEZA 1A7OH 3O4LA 1KTLA 4JN2B 4GW5B 2UZYB 4AIZB 5IB1B 4JFEE 4UQ3B 1CFQA 2E6QA 2XY1A 1MN4A 4C4KT 3NIFE 3C09B 1PZ2A 4I0PB 2CGYA 3CVHH 4EZMA 3RZCA 3FTVA 3S3JA 5ADPL 1DHKA 3DMMB 4KKQA 2NR6C 4CNIA 1J11A 2CBPA 4LXFA 1T4WA 1CZ8L 2Y6TE 1J1PL 3S34H 4YBHA 4K8RD 2FYYA 4Z78B 1HNFA 4WZ9A 5D1ZD 1KOAA 2Q2LA 2Z91A 4J8RA 5GGQH 4Z7VB 5LAPA 1BZOA 2H0FA 4ZMAT 4Y1AA 1I4FA 3QEQA 5B1KA 2Y3AA 1OQXA 4A63A 3BX7C 4M6OL 5E9NA 3BAEL 2DQFA 4J7RA 4N2IA 3UJJL 4X5PA 3PG2A 3PUUA 3QAZC 2KBGA 3DVNA 5D4IA 3NJHA 1C5DA 5FDWB 1N9PA 1MF2L 3SSGA 4AQ8C 4XGZB 3BWAB 5ALCL 1UZ6F 4P2RB 1YY8B 2BC4B 2FNWA 1GPOL 2ZSVA 3MBXL 1DZBA 3VI3B 4QRRB 4PRAA 4NUPA 1R0AH 5I1EH 4N3TA 2HFFA 2ZXGA 2ENPA 2DWSA 2WOBA 4LPYA 3DVGB 1P4UA 5DHDA 1B2WH 1F42A 3L6FA 4XVOA 3OAUL 1MQKH 4LESA 1Q9OB 2DB8A 3VGGA 3PHQB 4CMMB 1A6VH 3OZLA 3QZOA 4IGBD 1E9OB 2YAMA 1SXCA 3WJLC 5JYMA 1TTFA 4GXVH 2CO2A 2L7EA 3B9VA 3KYNA 4WUKH 5DJ0A 3EO0B 5HHME 5MHSD 4Y5VC 2OL3H 4HS8H 2OP4L 2XWBB 2YFNA 3ALWA 2O5XH 4YN3A 3V0FA 2V5MA 1DE4A 3NESA 1UXWB 2X05A 3DROA 3C8DA 2D03L 3C9NA 3LTVA 1NLBH 3LZPA 4PJEB 3SZKC 1LO2H 1VDGA 3WGVB 2JI3A 4B9GA 3FB5A 2EYSB 2OQJA 2BSRA 4N8VB 4M5TA 1NMCC 3NFSH 3GBMH 3VXMB 1I1YB 4PLJC 5B7EA 1L9NA 2VNCA 3FZUD 4LLQA 3RPIB 5IMMB 3Q8EA 5LGHL 3EOBA 3K0YA 2ESVB 4OM1L 1WZLA 4GEJA 3WMSA 5TQ0H 4L4TD 3T2LA 4YHZL 2CJSA 4G9FE 4NNYA 1JI1A 1ZEAH 4AQAA 1T04B 1C12A 3ASOB 1A7NH 4HEPA 1AXTL 3FOLB 4BH8B 2ZSWA 1RUQL 2JKWA 1AJ7L 3K8MA 4G9DA 2HP4A 1F3JA 3JVGA 3A3YB 3Q2NA 1YMHB 1BVNT 1FYTE 4RMSA 3PXJA 4B60A 2WINA 2P8PA 3NZ8A 4ETQB 1BAGA 4X5RA 3AGVA 2X89D 1JXJA 4LP8A 4PJEF 3I02A 5JIKA 5ID0A 4GBXA 2BCKB 3A6CH 4M56A 4BV1A 3UACA 1SDAB 1JNHB 3ROLA 1A7OL 3AAZB 3NP3A 2IDFA 5H2BB 4NQCD 4M3KB 5EO9A 1EAPB 1DLHA 3U30B 5EWIL 3AMKA 2CUHA 4HJ0D 1XCQA 1TTUA 1U8JB 3N1PC 3MDJA 2XG5A 2Y36L 2YGOA 3QFJD 4OLEA 3LNHA 3N85H 1GY1A 4PRIA 1HSAB 1MAML 2MEJB 1EXUA 3D4ZA 3ZT7A 4ZS7L 5D2NA 1DLFH 4IQHA 3MRDA 2QMJA 5DHXB 4QKTA 3DUUB 5FO9A 2DS4A 3IAGC 3IKCB 1CI3M 3MNZA 4WWPA 1UENA 3L13A 1II4E 2N7BA 3VDCA 3FFDA 2G5RA 4BQ8A 2G60H 4OGYL 4PRBB 4Z7WE 4PJ8C 2NQDA 4EMZA 4PJCF 4R7LA 4E9TA 3NK3A 3BDYL 1RKRA 5B38G 2OJEA 4R8WH 4ZX3A 1S9YA 4PJEA 2GJ6D 2NXYD 4M7KH 2XVBA 2IH9A 1LE9B 2DWYA 2YS4A 3B2UD 3FDWA 4NT6B 3CFQA 3VX1A 4M7JH 3L5IA 3SKJH 4OLVL 2Y7QA 5FOJA 3ZDXB 2M8XA 1EXGA 1JBJA 4A7GF 1KT2A 3CDFA 1CD1B 3GGWB 1WRFA 4BH7A 5E4IA 1MCWW 5ICYB 1AO7A 2VWEE 1JV2A 2HLFD 1SEBB 2E27L 3BPLC 3FSOA 4M7ZC 2X9ZA 1OB1B 4ICWA 2W80C 3OLIA 4MA8L 5CS7A 3WO4C 7FABH 5IHUL 2ZOLA 1HHIA 5IVOA 4TLSA 4DQOL 1FNHA 2LE9A 2V7NB 3RP1A 2FBJL 3SYAA 3BFOA 1CF1A 1S7WB 4CVZB 2OMBA 4OSUH 4WEBL 2OAAA 4DOHB 4ZXBC 1GRWA 2IWEA 2WB7A 2DF3A 3BC9A 3UGEA 4GO6B 1ZMYA 3FQ2A 3AACA 3VFSA 4YDLC 4PGBB 2L8AA 1JCKA 5CHNB 5C0DB 2PYEB 4QHMB 2BHFA 4TQEH 1D7DA 5JZ7D 3ZHLA 2QTEA 1DQTA 1IEAB 3H55A 2ERJB 3MLWL 5KN5B 2DMHA 4F2ME 1X5MA 4KKBD 4U05A 5E6IB 3JTBA 1KXQE 2CCWA 4G6JL 5C08B 3HVDA 3S3SA 3JT2A 3MRDB 1RMFH 3NP4A 4TUUA 3MRFA 4BHUA 3L3IA 4I18B 1DZ0A 3ERXA 4NERA 4PCKA 4MYWB 3EJZD 1AR1B 3QDJE 1DVZA 2F53B 3GDBA 1VFUA 1R5IA 4NQDD 3T6XA 4LZKA 1SXBA 5C0FA 4IHBA 2JWYA 5ILTH 1UCBH 3OGCB 5EOQH 3MV8B 4NO5A 4I9WE 2E7MA 2R15A 5FUCE 2B2XL 4YWGL 1LE9A 2QADD 4LPVA 3QXDA 3VGHA 2FJGB 1YN6B 4M1DL 3HZKA 3JWNC 3P0VL 4U1MB 4YSOA 3D12B 5T1LB 1U3HB 3FU7B 3NN8B 3RWIB 4Z7WB 3VXQB 2XPGB 2BVUA 4GFXA 1BQKA 4C4UA 3T8MA 5J8OA 3BN9D 1CD1A 2YZ8A 4P3CL 3LHPH 3HOGA 1E4KA 4LEBA 5AW1B 5C6TH 4NPKA 1QTPA 5F93C 2V3DA 5CIPH 1URIA 1U3YA 4LVHC 4RZKA 1H0DA 3QUYC 2WBWB 1ZT1A 1M71A 4U1SB 5F0MB 2ZKHH 2V0AA 5GS2D 3LS5H 3HG0A 1ONQA 3DOIA 2NSQA 3QA3A 2I9TA 1S5IH 4NQXB 3U36B 2BNQD 2C9XA 5FUCC 2X4SB 4NKOA 1T0NB 3FCSB 2N1TE 4HIJA 4DFHA 4XNMB 4HUWA 3VXRD 2BS71 4Y5XB 4MB4A 3QFJB 3ULAB 4ELMA 1DO5A 5L4JA 4ELME 2F18A 2E4FA 5D96B 3ULVL 3QEUA 2FB4H 2QMKA 2DQUH 2EYTB 2QHRH 2WK2A 3MRBA 5JUEL 4LE8A 2VABA 3UG3A 3I9GH 3TS8A 4NM4H 3S36L 5FCSH 3KLSA 3GSOB 4F91B 3KZ8A 3BAJA 4AE0A 2ESVE 4CU8A 5CILL 3KS0H 1OCWH 4OR1A 5D5ME 1GGYA 4NUGL 3HKFA 5GS1A 4KZEH 4TNVK 5AZEL 5GSRA 5EUKB 3FQXB 1TEYA 1HL9A 3AUVA 4TUOB 3T9WA 5IW3A 2OZ4L 2K6ZA 1ZWIB 4NKIL 4I9WD 4KO5A 1PY4A 3GBEA 4P07A 3QXDB 1XR9B 5C8JB 2IG2L 1J8HA 5D2LE 3CFEA 2E6PA 4NN5B 4U1LB 4JVWA 1AKJD 2X42A 4P59L 5DJ8A 1JZDC 1MY5A 3VXQA 3KPRB 1MRDL 3MLYH 5EMYA 1X9UA 1SOXA 5DO8A 1YEFH 2CGRL 3EBGA 5ANME 4N28A 1UQSB 3VGEA 4C4KO 5I1LB 2E4TA 5F1IA 2ZCZA 3RX7A 3EF4A 5INCA 1JDDA 3RVUC 1XGPB 1AQDB 2YKLH 5BV7B 3L48A 1FL5A 4XXDB 2X1QA 3G5VB 5EBLA 4JFFB 3SN6N 4C57C 4OZIB 2BP0A 3II2A 1TNNA 3WIFA 1G7HA 4XMLH 4CC0A 1ITCA 4BZ1H 1M6OB 2BSBA 3CBKB 1OCOB 4JKNA 4KXDA 3S7GA 4LLYA 3UCQA 4E9QA 5G55A 2A77H 3RURA 1G1OA 2QADC 5H37G 1JZ6A 4ELDA 4JDEA 2DTML 3UAEA 5GGSA 1WGOA 1IL1A 1CDBA 5L6YL 4HIIB 1Y6NR 3QPKA 3DX9B 3BP4A 1HOEA 2PP8A 3CHRA 3AFLA 3L3OA 4DQOH 2ESVD 3FUKA 4XOEA 5HXMA 5CO1A 3P30L 3A47A 3ZBMA 1KWKA 5KSVA 3CK0H 2P5EE 3H85A 2AK4A 1J7VR 4X7TB 5IREA 2VQ1A 2Y0SA 4P3WA 3GT6A 5KS9E 3BH9B 3TBTB 1UWXK 3ELAT 2W8CA 3MUJA 5I0DA 5IMLA 1WIOA 1S78D 2MHAA 3PREA 2ZUQB 4NQQA 1L5GB 3OMNB 1HSBB 3QHFH 1QI4A 1SHXA 4G9FB 3WEBA 5CMAB 1INDH 2MSPA 4DVBA 1RAMA 1A5FH 1SJXA 2YD0A 3IMRA 5ADOL 3ZTDC 2BHZA 1K2DB 1PX8A 2XNAB 2QZQA 1BYOA 4WWKA 1QEWA 4GKSA 2HSIA 4POYA 3AU1A 3Q06A 1YEIH 3O6LL 1DBKH 4QLRA 1I1AC 5IVZA 4GUPA 2DPKA 3ARRA 4AW4A 5IBLC 2YD4A 3PPSA 1AZRA 4NSKB 4R83A 1GTNA 2Z7WA 3CC5A 4X8JA 2QGDA 1GMIA 2A9MH 1LTXA 4ZMLA 2R8SH 1NAKL 3S36X 2EDWA 1KXVA 3WIFB 3MNVA 3MV11 4GSQA 1N3NA 5ISZA 3S4SA 5AWNL 4DK5A 3LCYA 5JOFB 2YPKB 3H4HA 3LNGA 3MAWA 2D0FA 4GKLA 1GGIL 3GC3A 2XKNA 5E5RB 4I1PA 4TUKH 2X4TA 4ONHB 5DJAA 1A0QL 1XZWA 3PWPE 1E4WL 1P4LB 1S3KH 1VGEH 4JFOB 4E2OA 3VCLA 4X0KB 1A2YB 4F7CA 4JY4A 4KAQL 5CEYB 3QNXA 2P7TB 3MXVL 5EBMB 2EACA 1W91A 3RVUD 5E1AB 2LFEA 4YBLB 2HX7A 1G9ML 3UADA 1DANT 2H26B 2H9GA 2JQZA 4ZX5A 1CU4H 1JI2A 4YSCA 3QEGL 4J6RH 1R3LB 4CU6A 4XPFL 2FSDA 1YNLH 2EJ1A 3HB3C 1IGYA 4U7MA 4HC1L 4X99A 2YPVH 1T7WA 3QIWD 4M93C 4RDQF 5A2CA 2CWRA 2ZXQA 4HDIA 4WFED 2DTSA 4JO4H 5F1SA 4EDXB 4ODWB 4V1DB 1U33A 1YDPA 3RX9A 1HE7A 2IBGA 5BS0A 1HTYA 4QCIB 1OGAB 5C9JB 2A9AA 2BP5M 4QY8A 1GW0A 1ZOXA 3NRPA 4J8QA 1H3TA 2E9GA 4PD4J 3VXNA 4JRYA 3QAZB 4PJFA 4CDHA 1SOQA 2WWOA 3FL7A 4NQED 2MCG1 5CJXA 3H8NA 4PTTA 4AK1A 4XCCL 4IBWA 3CQQA 3WS3A 4FAAB 4WGWB 3SE4C 3GUFA 3VFMB 4UM9A 1D5ZB 3AREB 3QPXL 4IS6B 4KGLA 3VUAA 4A39A 3OPZH 5JQ6H 2VLLA 1I8LC 4Y16C 3RJQB 1IX2A 5TF0A 1AGFA 1B6UA 4FS0A 3WSQH 3TNNA 5ITBL 2YPKA 2X0UA 3LHPL 3GI8H 3WXVH 4B7IA 4BFJA 2Z92A 2AEIT 3BJLA 1MFNA 3RTQC 2BY3A 3L5WB 5EIVA 5L0QB 1N8OE 1G7QB 3H9SE 1RK1B 5JHDA 3Q3GA 3GZQA 4RFNB 1LK3L 1M05B 1RZJL 3MACH 1K8IA 4JX0A 5IHLB 3TOPA 3MJ8B 5CP3A 4U1JA 3KYOA 2EE3A 4YHMH 1A3LH 1FIEA 3RIFF 2XZZA 3UTQB 3P11H 4Z3EA 2CDFB 1PG7L 3FO1A 5E8OA 5E1QA 2P46B 1EA9C 1YEKL 3Q44A 2FT8A 4JKMA 4M5YL 1H3PL 3GJFA 1F4YL 4NBYB 2XXGA 2X4RA 4B9KC 1HE8A 1QFUH 3FO0L 3I02B 1GMEA 3ZHKA 1L3WA 4BK8A 2HXAA 3I50H 3BKYH 3PY9A 1FUNA 35C8L 4P2RE 4ZFZB 3B9KC 1X5IA 3GHEH 4UDUA 4W6WB 2C1PA 4I3RH 2C3XA 1XAUA 4YHZH 4DHLA 3MQIA 4PB9L 2G0LA 2XQYA 4H1LG 2JJUA 3SDYH 2XZQH 5EU6D 1G7MB 3MLXH 2D31B 3K2MC 2CHXA 3MLRL 2AJXH 2GB2A 3EFDH 4PIRF 1IMHC 1RPQA 1S8DB 4PV9B 3NIDE 4U2ZA 3OKMA 1FLRH 3VRIA 5HHQB 1A3QA 3VXPB 4L1HA 1OT1A 2CK0L 4D8OA 1LNUB 1NIAA 3TEXA 4D9LL 2HYMA 4LCWE 3VXUE 2AS5M 2OZNA 4N2EA 4EOWL 1DQDL 1FFOB 3FXIC 3KLHD 1OP9A 2XRAL 2K4AA 4TQPA 1YEFL 2CGRH 5CINH 5KVDE 4JFSA 2Z6FA 1AFVH 4LGSB 3ISYA 1B4LA 4DSYA 4YDLB 5IBLD 2NY1C 3GS7A 1CC3A 5AG8A 3QUXB 3H1ZA 3C60B 1IFHL 2ZOLB 3ZR5A 1C5BH 1F97A 1M05A 5LLIC 3QAQA 3QZWB 2P8LB 3VG9C 1BIHA 1QLFA 4PRNB 3E9TA 4NQDB 4ZD3H 2QQKL 5FM5M 4L1SA 2NOYA 4GAJH 4YS4A 3FUNA 1BV8A 1I9JH 3QIBB 3ARSA 3Q7JA 2EE2A 1KY7A 3A6OA 2AQQA 5DHEA 2AV1B 3GMQB 3BPLB 4CN6A 3HUJB 1NPUA 3I3EA 3FTWA 3TZVC 1IC4H 5HHOD 1NEZA 2QSCH 2VDLH 3NSXA 4WI7A 1FHGA 5BXFB 2EKJA 3BZ4A 3KCWA 5FYKH 3FO0H 2PXYD 1QRNA 3LRGA 4DP0X 5L7XL 3FT2B 4FFYL 4R90H 1MAKA 3ARFA 2AEOA 3ATBA 1XD1A 5JIMA 1XMWA 1FIGH 2RBLA 3MA7B 4LGPB 2FHCA 3DIFA 2R2HB 5MEND 5JHLL 2C3VA 1CLYH 4FXKA 3QDAA 1T22B 2UZIH 1CTOA 3QDGA 1VLXA 4FNSA 1XH0A 3KLDA 4K2UH 3P1VA 2ADGA 3QJTB 2AQSA 4D0CA 2BY2A 4WCYH 3VXSA 3ZE2E 5ESAB 2Z8SA 1WTLA 3SPIA 3QZPA 1TPXB 2X6AA 3DO3A 1Z9MA 2D3VA 3WTUA 1A64A 4HQQL 2GTZA 2X4QA 3F05A 5J1SC 4XP6L 4PJ5A 5AUMB 4P5KA 1OTSC 1AD9A 5KG9A 1MW0A 1DANU 2ZYSA 2GC7C 4ZSOA 5HYJA 2EO7A 4V11A 3WTTA 1ZANH 2DBJA 4N0RA 2VN3A 5F3HA 1UKSA 4TTGA 1MWAH 4YXLH 4FZ8L 4NQCB 5EFIB 2WUCH 4AYGA 2EDEA 4ELMF 4P2AA 4R7XA 4H0LC 2A0LC 1ZJAA 1H0DB 4KQ4L 5IQNA 3F6IA 3C6LC 1BBDH 1ZT1B 5DRWA 3B9KA 1XV8A 5GZND 2RTTA 4BELD 2P8LA 3L54A 5ENWA 2NNAA 2CAKA 4MD5A 4JRYE 4GRWH 3NH7H 3QQ3B 5EDSA 2W95A 3DETD 3N04A 3LB6D 5JW3L 3CXDL 1XCTB 3UBXI 1AGEA 2YJLA 3QFDB 4JFXA 4PJ7E 1KG0A 5DZJA 4MA3A 4OV5A 4D7PA 3ECBB 5E4OA 3L8QA 4GI6A 4I8DA 4JUTA 4JPWL 1LILA 1WICA 4B9IA 1ZXKA 1SXSA 1JHLL 1MLCB 5KJ7E 1T1XA 2EABA 1RZJH 3VFVB 4P99A 3WTWA 3ZL4L 1COBA 3OB8A 3NDZE 2IADA 4FZ8H 2HH0L 2VLKD 3QARA 5I19L 2PCXA 5FO8B 2BOCB 4Y4KD 2VISA 1SVZA 2GTQA 3WELA