1GSKA

Crystal structure of cota, an endospore coat protein from bacillus subtilis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Crystal Structure of a Bacterial Endospore Coat Component: A Laccase with Enhanced Thermostability Properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 145
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA02
2H47C 4JHUA 2A3TA 5IY5B 2FTAA 1OE1A 3S8GB 4PAZA 4KO7A 2YQBA 2W88A 3S3DB 1BXUA 1QNIA 1TEGA 1SFDA 3OQRA 4HCGA 8PAZA 3FT0A 3QJSB 1ET5A 5I6MA 3FPXA 4DP0X 3PAUA 4YSRA 4DPAX 1L9TA 2VSMB 3FYIB 1CYXA 2RACA 1RCYA 4Q89A 3DKHA 4HAKA 3FQYA 2BO0A 4WKXA 3QPKA 4W9ZA 5B1JA 2PPFA 5TK4A 3UGEA 4GP4B 3S3CB 2QPEB 1CURA 2ZXWB 1HFUA 3CDZB 2HRGA 1WA0X 5B7MA 2HX9A 3FU7A 4G7QB 4CSPA 1E67A 7PAZA 1TKWA 2PPAA 2XLLA 1GY1A 1VLXA 3NSFA 4KOBA 3UAEA 3HB3B 5B1BB 2GI0A 1AZRA 5B3SB 3OM3B 4JHVA 3BVDB 4N8UA 1AZUA 3V9CA 2H3XC 4QKTA 1RZPA 3FSAA 1JZEA 1A4AA 1WS8A 2XV3A 1KDIA 3N2JA 2X87A 4GP5B 3ZX1A 3OMNB 4HCIA 2XXGA 1PZAA 5AKRA 1I53A 4DP1X 3AY2A 1DYZA 3ABLB 3NJMA 1NIAA 3PAVA 1L9OA 2IAAC 3AW5A 2VM4A 5I6NA 3T6VA 1IUZA 1IKOP 3NJFA 2OJ1A 2IDUA 2PPDA 3FU7B 4X4KA 1JVOA 2HX8A 4G71B 1W6WA 2VN3A 4BXSV 1BAWA 5PCYA 1WA2X 2DV6A 4KO9A 2GIMA 1E65A 2J5WA 3GYRA 1DZ0A 3RYMA 2YAFA 3JTBA 1AS8A 2CAKA 2FT8A 1BQKA 1OF0A 3ASNB 3PXLA 1QHQA 5B1AB 1NICA 2BP0B 3N55A 2FQDA 1N70A 3SBRA 4DP9X 2B08A 1SNRA 4BXVA 5I6LA 3ABGA 3ZBMA 4E9WA 4YL4A 1ET7A 1WA1X 1WS7A 4UANA 2JFCA 1J5CA 2DYRB 4F7KA 4G7RB 3FQ2A 2XXFA 1MG3C 3EHBB 1XB3A 3FSWA 4E9QA 2XYBA 2FWLB 3S8FB 1NWOA 4CSZA 1B3IA 2EIJB 3TASA 4EF3A 1RKRA 1RZQA 4YVUA 1URIA 1NWPA 4YSQA 4MFHA 1ZIBA 3NSDA 3TBCA 3CG8A 2HZHA 3FS9A 1OCOB 1J9SA 2FT7A 2GC4C 2XU9A 4K9JA 2FQFA 2ZWNA 1ID2A 2OCCB 2WO2B 1KYAA 1NIBA 3H4FA 2BZ7A 2PPCA 4UF7C 1NZRA 1X9RA 2XWZA 1OE2A 1OOWA 1A8ZA 3BQVA 1AG0A 1CYWA 5D4HA 1KCWA 2IH8A 2IDTA 2HRHA 3WNIA 1KBVA 5B7EA 4M3HA 1J9RA 4TXVB 1WAEA 4PCYA 1V10A 2XX0A 5E9NA 4YSOA 2P80D 3T6WA 1NDTA 3QJQB 3QJVB 3OD3A 1MZYA 2FJSA 3DIVA 4HHGA 2YARA 1ET8A 1PZCA 4L0PB 1IBZA 3AZUA 1ZDSA 2I85A 4DP6X 2CUAA 1JZHA 3OMIB 3TU6A 2BW4A 2BP8A 2IDSA 5D4IA 3X1EA 4AKQA 1GSKA 1NIEA 2EINB 2GHZA 2VM3A 3V9EA 3WKQA 1AQ8A 2IWFA 2Q9OA 1BYPA 1KDJA 4E9RA 2AZAA 1V54B 4DP7X 2UXTA 4KNUA 2GC7C 3HEIB 1NINA 3NJGA 1A65A 3ABMB 4HCFA 4ENZA 1M9WA 1JOIA 1AOZA 1MG2C 3CVDA 3FPYA 1F56A 3IBOA 3WIAA 2LLNA 2I7OA 3WI9A 3SBPA 2OV0A 4G70B 2GSMB 2FT6A 5B1JC 1A3ZA 2VMJA 4NERA 2X88A 3NJJA 3TA4D 2PP8A 3PCYA 5F7AA 1ASQA 2E86A 2BHFA 2H5UA 1YLBB 3ERXA 5B1KA 1AANA 1PNDA 5I6PA 5A7EA 3T71A 5LDUA 1ILUA 1SDDA 2IWEA 4WTQA 9PCYA 4A68A 7PCYA 1AZCA 2AFNA 3IE9A 4BK5C 2B3IA 1GYCA 1JZFA 1KCBA 5I6KA 2BP8B 1OE3A 2PPEA 1QLEB 1ASOA 2QT6A 4YSTA 4W1TA 2UX7A 4E9YA 2GBAA 2MRYA 5ANHA 3QJRB 1AZBA 1GW0A 1SJMA 2XV2A 4E9VA 3AG3B 1ETJA 1PZBA 2DWTA 1M56B 1TU2A 1KV7A 2YAHA 3IEAA 1JXGA 1L9SA 3WNJA 4A2FA 2YAPA 3AG2B 4KO5A 2YXWA 3L45A 3X1GA 4A67A 3QQXA 1CC3A 3NJNA 1SF5A 4BDVA 3TBBA 1J9TA 2AZUA 3UADA 2MTAA 3FU8A 5D4JA 4FA7B 1SDDB 3KW8A 1JVLA 2DWSA 1M57B 2QPDB 5I5JA 3NJKA 4DP8X 1MDAA 1PY0A 4YSSA 2VSKB 2R7EA 1KGYE 3QJTB 4HIPA 1W6LA 4KO6A 4M4RB 4A66A 1PCSA 3NT0A 3X2QB 2PCFA 1AR1B 4A2HA 2EIMB 3ZIYA 1E30A 1SF3A 3EH5B 1GY2A 3CZUB 6PCYA 3NJHA 1W8EA 3NYKA 1SHXA 2IDQA 1OCCB 5PAZA 1XMEB 4ZK8A 1AIZA 1PLCA 2YAEA 2BW5A 1ZDQA 4E9TA 2Q5BA 2VW4A 1NIFA 4AX3A 2GB2A 2WO3B 1AS7A 2TSAA 1FWXA 1XB8A 2HX7A 1JERA 2VW6A 1PMYA 2PLTA 1JZJA 2PCYA 2VW7A 2XX1A 3FYEB 3PPSA 4BWUA 1CUOA 5F7BA 4E9SA 3ABKB 3CDZA 3MBWB 1E5YA 3NJLA 4GYBA 3T6XA 2Y69B 4DP4X 1J9QA 1PF3A 3FQ1A 3FU9A 2PP9A 4KOCA 2UXFA 5TK2A 4DPCX 4HZ1A 1ZV2A 1GS7A 4YSAA 4YSUA 2JXMA 3IN2A 1A4BA 2J57A 3NP4A 4QLWA 3AG1B 3X1BA 2TSBA 1JXDA 1FFTB 1NPNA 4G72B 4F2FA 1TEFA 2I7SA 2NRDA 3KW7A 3U25A 4HHWA 5FC9A 4E9XA 2UXGA 1HAWA 1ZPUA 4DP2X 4UAHA 3UAAA 1FA4A 4RH4A 1ADWA 2QDWA 2XVBA 2CJ3A 4YSDA 1KBWA 1AACA 3PAZA 4A2EA 2DY2A 4G7SB 2ZONA 1BXVA 2YAOA 1L9QA 1L9RA 3SBQA 2XUWA 1T5KA 2YAQA 1NTDA 4A2GA 3FSZA 1BQ5A 1HAUA 2EILB 4GXFA 4BWWA 2CBPA 1GS8A 3ZDWA 2UX6A 1BXAA 1R1CA 2J56A 3EH3B 1EZLA 1SFHA 1OCZB 2HLEB 4KNTA 2UXVA 4AKPA 2BP0A 3G5WA 3GXUB 4AZUA 5I6OA 2AVFA 2BWDA 2W8CA 5B7FA 5I5MA 2HXAA 3DTUB 3QJUB 5AZUA 3EH4B 1L9PA 3MX0B 2BZCA 4NAJA 3X1NA 4N4YB 3CVBA 1BQRA 2P80A 3T6ZA 3ASOB 3D12B 4DPBX 1ZIAA 4DP5X 1PAZA 1JZIA 3SQRA 2QDVA 2EIKB 3NSYA 1IC0A 3NP3A 2CCWA 3EF4A 3X1FA 4JKNA 3PLYA 4A2DA 3JT2A 1GS6X 2BWIA 3WG7B 6PAZA 5I26A 3WKPA 3CVCA 1OV8A 1MZZA 3UABA 1JXFA 2FQGA 2IH9A 2WSDA 4BWTA 4AI7A 1AAJA 2FNWA 3T9WA 1E5ZA 1GR7A 1AG6A 1AZNA 4NB7A 1PLBA 5AFAA 3OMAB 1NIDA 1UATA 2YXVA 3NJIA 1ILSA 2AANA 2IWKA 3H56A 4HALA 3S3BB 1A4CA 4GP8B 1OCRB 1PNCA 1X9UA 2IDFA 4F2EA 1N68A 3C75A 2Y1AA 4GY4A 1IBYA 4AKOA 2JKWA 2YAMA 1BYOA 3IN0A 1EHKB 1SHWA 4Q8BA 4KNSA 2N0MA 1BEXA 1V55B 1JZGA 4BDVB 2ZOOA 3NSCA 3GDCA 5I5IA 2XV0A 1PLAA 2DYSB 2J55A 2CALA 2PP7A 4FAAB 1XB6A 3H4HA 5I28A 5EHFA 1J5DA 1ASPA 2FQEA 1NPJA 2R7EB 4YSCA 4P5SA 4YSEA 3AG4B 3UACA 1AS6A 4YSPA 3FSVA 4P5RA 4YVNA
chains in the Genus database with same CATH superfamily
1LO2H 4NM4H 1Z6JT 4FC3E 4H1LH 2VQ4A 3W82A 5KSVB 3OKOA 1GA2A 3IKCB 3B5TA 2X09A 2IGTA 2YQBA 4UNTA 5ACLA 3N04A 4ZQKA 1HIMH 2PKDA 1IC7L 5FKAA 5E1AA 5KVFL 4B50A 3PAUA 3ZHLA 4TSAH 3MTRA 4GRLA 1N8ZB 4LLYA 4A38A 3OKMA 3IAQA 2O1AA 4PD4K 1OAJA 1YY8B 1SJHA 3OR7B 4YDKL 4ZFOB 2Y07L 5C2UB 1GHFL 1AO7B 5DMGC 4CAGA 4EQ2A 4H0HB 5I76A 1W8NA 3UP6A 3OKKA 4GW1B 2J12B 2QL1A 2XLLA 4G6AD 4N0UB 3IMTA 5IFJA 1AZRA 4P2RD 3MBED 3L5WA 5HVFB 3MRCB 5IM7B 4LSUH 2Z9TA 3NFNA 4I2XB 4MD5B 1YEJH 1UJ3A 1IAOA 3D1MC 4L18A 3JV4A 4RMBA 3MU3A 4XI5C 3BIBX 5GS0C 2IPTH 4H8UA 1FJ1A 3ZTDC 1KCKA 1JZ3A 3HUJF 1AHKA 1ZLUH 2IBZY 3LKRB 5GS3A 1WC7B 3DARA 3HUJB 4LARH 1A7BA 4P48A 2GSGA 25C8L 2R23B 3DX3A 3ZE2F 2G5UA 3N0AA 4FTVB 2EDMA 4AY0A 3BQUC 3ZE2B 4NOBA 2B59A 2LU7A 1XX9C 3ULUD 1Q72L 5SX5K 1LD9B 1Y0LA 4APXB 3PREA 4ZTOL 1E8ZA 3PWJA 4Z3IA 1JZ8A 1KXTA 3TCTA 2E7BA 3RL2A 1TYRA 3HE6A 4J28A 1LO3H 3CDFA 3MGTB 4NXKA 2XN9B 5C08D 4ATTA 1FSKC 3J07A 1Q38A 2HCZX 2Z8WC 4G7YH 5CCJA 3VFPA 4JM2F 1S7UB 2F8VA 5B39G 3BVUA 4HXBH 3IF1B 1U91A 4JM2B 4PCKA 1A1NB 4KDTC 3MGAA 2VC2B 3CZLA 4K94C 4NKQB 3HMWL 5BQ7B 1ZS8A 1RHHA 3TF7C 4H44C 2HH0H 3SBRA 3QDJD 2MOVA 2I60L 4TQ8A 2EDOA 1VADA 1FIGL 3OAUL 4PBWD 5I6LA 3ABGA 4ZUTB 3I50L 1JN6B 2Q8AL 5I82A 1DCLA 1JPSH 3LPGA 3WEBA 4ZX5A 5SWZD 4AUJA 5E8OB 2XXFA 4J1UA 1ZHLA 3IFOA 5ICUA 5HVHC 1NGXA 4LLWB 3TBTB 1WZKA 4HIIB 3KYKH 4LDEB 2V2WB 3Q1SL 2WLLB 2Q86B 1KJ2A 1J1XL 4MJ6B 2IANB 2A73A 4YFLI 1JK8B 4HEMA 4YXLH 2FATH 2QGCA 4YHLL 3DVNA 1SXAA 4A04A 3BWAA 3RWJA 1MJJA 2ROYA 5IG7B 5F8RC 4KKQA 1YAIA 4ILDA 5D6CB 4D0DA 1SXCA 3RJOA 1BXXA 2Y1VA 4HETA 1KGWA 5KANI 2V7HB 5FCUH 3CH8A 3VXOB 5I15L 3UDWA 1D7BA 2IG2H 4DETA 2WWOA 3RZWA 1UB5A 4QDGA 2WZPD 4MA3A 1PZ5B 3SQOL 4JFFD 1RXLA 1T89A 4HIHA 1K6QL 1H3TA 5DI8A 3U0TA 2AJ3B 1LP9E 2X40A 2IAMC 2HTLC 5HHOD 3HE7B 4IKKA 2NDFA 1DQKA 3K6SB 5JORA 5I1HH 4MSWA 5I71C 4TUKL 1HL5A 1PS3A 3T8MA 4B9GA 5CSZA 5FECA 5K39A 1OZUA 3V0DA 1OF2A 2VZVA 2Z91A 5CO1A 5F7WC 2R1XB 4G7VL 2D3LA 3RKDD 1IAII 2Z3FA 3AZUA 1BLIA 2DTMH 5FUOH 5ID1B 3V7AG 1LO5B 4G6JL 1W91A 3RDTB 1JK9A 2CO6B 4N1EA 1C12B 3T04D 4S0TD 2IDSA 1XF4B 2Z8VC 4M7JH 1GSKA 4A7VA 4WY7L 3Q6FB 4P07A 3GSNB 1EANA 4LOFA 3D18A 1BVLB 2WLIB 1U21A 4K7PY 3O3BB 4L2YA 5FF6A 4FLQA 4FQHB 4PY7A 1G4MA 2B2XH 4QHLA 3HZMB 3MLRH 1GAFH 2AP2A 3ZU8A 4KXCA 1SQMA 5I66A 2YD3A 3QRGH 5DVMA 3MLYL 1KJMA 1ZK5A 4F9PC 4QHMB 2RQEA 3T3PE 5JXAL 3QUYA 4XVTH 3VQ1C 4ZQKB 1IMHC 1GMEA 2AQRA 1ROCA 2QLYA 5FKAB 3P0YL 5E1AB 5JDJA 1Z3GL 1CICC 2WNXA 2E86A 1IE5A 2J5LC 3NCYS 4FHKA 4GFTB 1KBGL 4JKPH 4ODHL 2CR6A 4CKQA 1FLRH 4HF5H 1M2VA 1RL1A 5A2FA 4GRLB 4LLYB 1IJ9A 1NAKL 9PCYA 3OKMB 1UJTA 2EYSA 2HTLD 3EYUL 5CHNA 1MWOA 4DK3A 2VXTL 2M8XA 5T1LA 4AM0A 1QKZH 4G5ZH 3QUZC 1TPXB 1UENA 3NOIA 3I2CL 5I76B 4JB9H 4PH8A 3OKKB 3ZGHA 4H8WH 2QT6A 5F1NA 2QKIB 1CDCA 5IFJB 4OGAD 3OG4B 2MRYA 4BKSC 2CJUL 4LDCA 5F9WC 5IF0A 2RD0A 3NFNB 3V6OE 4BFKA 3H9SB 2R8SL 1AHMA 2IBZX 5E5UB 1MOEA 1UJ3B 5IHHA 1IAOB 4QYOA 1KCVL 3IDXH 3JV4B 2YAHA 3L5XH 3UIYA 1NPUA 1S3RA 3F85A 3WNJA 1EXUA 4J4PC 3MLVH 1LXMA 1E27A 1XGZA 1W72L 2GSGB 4OLXL 3LZPA 4MXVE 3V55A 5E8EA 4K3DH 1U8JA 2YN5A 1KNOA 1UWEH 2WSKA 3VFSB 5CEZE 1XF2A 3BKCL 5IWLC 3QT2A 5FO7A 2B59B 2NY3C 2VSKB 4K4KA 5LXVA 1WE5A 1Y0LB 3QISA 3C6EA 3PWJB 1KXTB 3I6GA 3RL2B 1CICD 1PJ9A 5I8OH 5T33L 2NY4D 1G7LA 4RMTA 1P1VA 4W9FC 4Q52A 4YDNA 1WFIA 1WFMA 4U33A 4YLBA 5GGSA 2YGVA 4YBHA 3HAEA 5F3BA 4XWGH 5F0LB 1OVZA 1U91B 1W8EA 3VRLF 4NFBA 2O5YL 4K0OA 4WRLA 5EOCH 4I77L 4AJWA 1ZS8B 1RHHB 3VXRA 2OXHA 4LVEA 1DEEA 1VADB 2AJYH 1DLFH 4QXWA 3N44F 4Z3JA 4MMXA 4L4JA 3ZUNC 4ZMAT 3RVWC 5JOEA 3RPIA 3N44B 3FW6A 3W5MA 1T83A 4WI0A 1FCCA 2HFEA 4J1UB 3EBHA 1ZHLB 3IFOB 4GIAA 4YE4L 4DP4X 4P5TA 4J4PD 3MRMA 1NGXB 5D6DA 4WWPA 3QPQD 1HXKA 5TE6H 2O5XH 2EZ0D 1KJ2B 4OM0H 2A73B 1HSAA 3AUWB 3BYYA 3CFTA 3AGVA 1NCHA 2QQLH 1IEAA 3WKNA 1REIA 1GS7A 4YSUA 5JIQA 3BWAB 4N8VA 3RWJB 1MJJB 2J57A 2VC2H 3ZZQA 4QLWA 4LIQE 3ATBA 2JJVA 2BLFA 4D0DB 3IGKA 5BRZA 1QFUL 4B3VA 1N0XH 1FFTB 1UWGH 2C1OA 1RUKL 1MH5A 1RUAL 3Q5OA 5TD4A 3SYQA 4GOSA 3U25A 2BVOA 2C9UA 1UB5B 2GEQA 4MA3B 4ZBJA 5B1CA 1R17A 3FQXB 1DVQA 5TF1H 4HIHB 3WCYA 2Z34A 4JHZA 5DI8B 2WUCL 3RTQC 3U0TB 3DXAA 3T4AC 1RIHL 3ZYIA 5JORB 3WMPA 4MSWB 1URZA 1X7SA 4Z95L 3PL6D 1L9QA 1ZE3H 3WNMA 1EHNA 2DQ6A 4NX0A 2YUXA 1MIEH 5FECB 5K39B 4RNRA 1OF2B 2J8OA 4V2BA 4EI6A 2CXKA 2Z91B 3G5ZA 3QIUC 3CIQA 3E8VA 4Z23A 1BXAA 3CXHK 4F93B 3SDDD 3RVWD 3CPUA 2WINA 1G1OA 1RIUL 2XYCA 3MUGA 4LP8A 1JK9B 5FW6A 4FJYA 4K7PX 4P4KD 3VH8A 4WI4A 4KNTA 2CWRA 2B8OT 2X4RA 3H9YA 4HP5A 4JR9L 4NJAH 3IPFA 2O72A 4L8SC 4ZPVA 4X4YA 3E8UH 3HRPA 4N22A 5IZ7A 1U8MA 2W8CA 4E0RA 3D18B 2EQDA 5FF6B 1LDPH 4QHLB 4PY7B 3NCJH 4OTXH 4IOSD 1KSRA 1QW8A 4WFED 4UIMA 3L4XA 4IIQC 4OLUL 3VMOA 1IV8A 2XVKA 3LXAA 1KJMB 4JUSA 1CF1A 5EBWA 1IBFA 3QUYB 4Q4EA 1YYML 5DQJA 3WELA 5TE4L 2WKGA 2NW3A 1NBVH 3AQDA 4HAFA 3MNVA 2HFGL 4POYA 3LSOA 2OSLA 5EZPA 2VMCA 2YIHA 3PRZA 4A2DA 3QJFA 3ML9A 5JNYA 1IGJA 1M2VB 1EDHA 3TXAA 3RTQD 1JRHI 2EYSB 4L5FH 5TDOA 2CKBA 3GSNH 5B3JF 5CHNB 3OR6A 4G42A 4LSTL 3BPNC 3VWKD 5T1LB 5GGVL 4ZOEA 3S5LG 1ZHNA 3OMAB 2K45A 1ILSA 3GRWL 3LNEA 4JG9A 4Y2DA 3NPSC 5ESVA 5F1NB 2R56L 4FXKC 1IC5L 3I74A 1QD0A 3QIUD 4U1MA 4X5PA 5EORL 2NDGA 4UQDA 5IF0B 4F2EA 1RLWA 3EJSA 5MEND 4L29A 5I0XA 4HJ0C 3C75A 5F21B 5DLLA 1ACYH 4AGPA 3UO1L 4QYOB 1JDCA 4OZ4A 1ZK9A 1EXUB 1I85C 3KPRA 5AVQB 4OLVL 5DYFA 5LQBL 3FTYA 1IKFL 1E27B 1HKLL 4K3JH 1A0QL 2YA1A 2ZOOA 3ATDA 5ANME 5TE7L 1ROWA 4D9LL 2VZSA 5E8EB 4HJJL 1U8JB 5D1XE 1KNOB 1XF2B 2O93L 1S7RA 5FO7B 5I2IA 5IBTL 2G5RA 4OCLC 3QQ9C 1OM3L 5T3XE 1KBKA 1XV8A 5DJCA 1RJYA 3I6GB 4RGOH 4YSCA 2YUWA 3QIBD 2W95A 1T7XA 2WJ7A 1G7LB 4XNUL 1ODAA 1WDAA 5LN8A 2B1AL 5L88H 4GB9A 3SPIA 5GGSB 5K59E 1R9FA 5F3BB 5EV7A 2BC4B 2FBJH 2W88A 5E9AA 2G60L 4UQ2A 3IU4H 5DS8A 1GC1L 1SFDA 2G2PA 2JCCE 1H6EA 4C58B 2VR5A 2BHZA 1EDQA 3G9AB 3FTZA 1OQOA 4YOKA 3VXRB 1MCLA 2OXHB 3FYIB 3OAZH 3LQZB 1DEEB 1QI5A 3DKHA 4MMXB 3RPBA 3U7YL 5AZ2H 4HUNB 3RPIB 4WI0B 3K8LA 2HFEB 2Y2TA 2HX9A 3FU7A 2HLFC 4P5TB 2C3HA 3MRMB 3ZL4H 1FGNH 1VLXA 3ARDA 3LS5H 4B3EA 2F5AL 4MNQA 3HB3B 3FK3A 2CKNA 1IEAB 4ZUVB 1AZUA 4N8VB 4FYQA 1FLTX 1PU0A 3FQUA 5DD0L 4AV4A 1GTFA 2DMKA 4HJGA 5BRZB 3FSAA 5DHMC 1ZLUK 1DJYA 3I6SA 3I02A 2C1OB 1E28A 2WXIA 1MH5B 4XC3L 4TSCH 1PX4A 2NXZB 3HC4L 1SRDA 4M7LH 2XWBA 1U8PA 3KPSE 3Q2NA 3V0GA 2O5ZH 4Z0BL 2ZUQC 5E70A 2J1YA 3KL3A 5IHUH 4LPWA 3DXAB 3SPHA 5EH1A 4EI5A 3QEHA 3FH7A 1IRAY 4PWJA 4AUYA 2R29L 4DUXA 4OM1H 5CSGA 3ARGA 1PFCA 3V4VA 1ACZA 3S2CA 2EADA 5IQOA 2HTKC 2YLHA 4YN3A 3AXLA 4HCRA 4AW4A 1GVIA 5IJVA 4RNRB 3B9AA 4EI6B 4DKDC 2DMHA 3D4GA 5DCCA 4JDTH 3G5ZB 4U3CA 2VAJA 3IDUA 2X2YA 2X0UA 2CAKA 5I1EH 1TCRA 2WINB 3HG1A 3MUGB 4Q56A 5T1KA 4TNGA 1KPRA 3VH8B 3IRZA 1ZVHA 2X4RB 4ZPVB 3SKMA 4X4YB 1N70A 2FYYA 3P9LA 1U8MB 3BSZH 4E0RB 2CLZA 4OLWL 1OP5H 1E4HA 3GMOA 3VI4A 1WA1X 1MAMH 3QEGL 4UILL 4XP9L 4FP8H 4UIMB 5DLMH 5E7BA 4YHIA 3EHBB 4DOHB 1LO2L 4NM4L 3EFDH 1GJUA 1I7TA 2FWLB 3MYJB 4Z9KB 5EBWB 3KYNA 1U3HA 2DIEA 1XIWC 5DQJB 5GJTH 4IS6A 1URIA 1EZSA 2DLIA 1JXJA 2NW3B 4U05A 1HIML 5DJDA 3MNVB 4YSQA 3LSOB 2OSLB 1ITBB 2C4XA 1H8SA 1QQDB 5JNYB 4OI8A 1E2ZA 1IGJB 2J25A 5EU4A 4TSAL 4XMZA 5FLVA 4FKKA 5TDOB 5FCSH 2CKBB 3CZFA 2NYYC 3OR6B 4G42B 4LSVH 2E75C 5F6HI 1JCKA 1B0IA 4XN2A 1ZHNB 2HTKD 3BWSA 1ONQA 4PN6A 1T5XA 4HGMA 1AQMA 4Y2DB 5ESVB 2VO5A 4FQQA 5D1XD 2WP3O 1CPUA 4U1MB 1U8CB 1VB9A 1WISA 4MS8C 3RILA 4V1DE 1HQRB 5T3XD 3RA7H 2R0WH 4LSUL 4YDMA 4HOXA 1MAJA 1MCKA 3CCHA 4OZ4B 3AVEA 1YEJL 2AQQA 2UV3A 3UAJC 4DGWC 3KPRB 1NQBA 4PJ8C 3NG5A 2HUEA 4QRTA 4N2AA 1Q0XH 4OFYA 5JA8B 1JGLH 2IPTL 3TS8A 5DS2A 3QDGA 3APCA 3K81A 4FZEH 3MLPA 5C07E 5C1MB 4PBDA 4RFNC 1AC0A 1MEXH 4LARL 2M2DA 4NGHH 1S7RB 4JGJA 4KKBC 2KPNA 4R0LA 5CIPA 4MAYD 5I2IB 3CFIC 4PS8A 4Y4HC 1PD6A 2GHZA 3QJHA 1A21A 2VM3A 2CUHA 5D93B 3HG4A 1RJYB 5DJCB 4C56B 2QFPA 5C0AA 2CGRL 5B22A 1VZHA 2R1YA 3BWZA 4QGTA 5ITFA 2WLYA 1LO3L 1M7XA 5GGRA 3WI9A 1ES0A 1CQKA 4NLHA 4P2OC 1YEWA 4MHHI 4G7YL 4UQ2B 5DS8B 3Q05A 1DZBA 2VMJA 1H8OA 4AYBA 4HXBL 4K71C 4S1SH 5C0ND 2Z92A 4IOFD 4WTZG 5A7EA 1U42A 4N90D 5JXEC 2OMBA 3DVGA 2ZXAA 4PV9A 5LDUA 5BZWB 3TM6A 2HH0L 4MS8D 5EOTA 3GTNA 5ADPH 1UG9A 4NIYE 2EIEA 2AFNA 1DJIA 2HRPH 2P48B 4LRIC 3RBGA 5I1DA 2JB6A 2WYIA 2N4IA 1JPSL 4ZO9A 1V8HA 4AUUA 4GUOA 3KPSD 4FJ6A 2NQ3A 3ARDB 3M1OA 2UX7A 4MNQB 3UMNA 5CKAA 1CXKA 3NAAH 4PV1C 3KYKL 5KS9E 3QZBA 4DTGL 1AZBA 2WXOA 2XPZA 4JW3A 4HFWB 1PZBA 4FFYH 4KKBD 4YXLL 5D1ZC 2EDRA 2FATL 2HSIA 5LNEA 1CDUA 4UQ9A 4ZZFA 1EEZA 3AG2B 4HJGB 4H8VA 1BGXH 4H7VA 1TFPA 3I02B 1E28B 1BQLH 3U6RA 2XWDA 3ARFC 4P3DA 5LUMA 4QR7A 2F8XC 2XWBB 4P49A 1BLNB 5FCUL 4MS6A 2IG2L 1JXKA 3MCKA 4JZJA 4JFOA 4EI5B 3WY3A 1KJ3H 5AB2A 3VGAB 3HI1A 3QEHB 4Z77A 5B21A 3ARGB 2Y5EA 3V4VB 1YEIH 2LLLA 1L0YA 1W6LA 2NXYB 3B9KD 4KO6A 4ZO6A 1B2WH 4M6AA 5I1HL 3AXLB 3OZLA 3NT0A 5IJVB 4KV5E 4PU2A 3X2QB 4HKBA 1J8HE 2LAGB 1E30A 3VD9A 5DFAA 1G9NH 5A6IA 3L3OA 4X6DF 1EJFA 1QP1A 1CBJA 1TCRB 2FLMA 3HG1B 4NQEE 1WK0A 2X4NA 4X6DB 5T1KB 4Y8DC 1KPRB 1ULVA 2CO3A 5FUOL 5E1QA 5KVGE 4HU2A 5FYKL 4WGKA 2FYYB 3P9LB 1BBDL 1X5AA 1PZ2A 3VI4F 2CLZB 4UZSA 4M7JL 3GMOB 1N8OE 3INUH 3VI4B 2W5PA 1EO7A 4E9SA 5F7BA 5D1ZD 3ABKB 5CCKH 3SGKA 4Z7OF 3O81A 2B2XL 2MMXA 3MLRL 4JMNA 5F7HA 5JW4R 1GAFL 2R2HA 4Z7OB 4ZW3A 1I7TB 3KYNB 3QRGL 1U3HB 4NAMA 2DQGH 2DMGA 4W68A 4IS6B 2F5BH 4XVTL 4ADIA 1XF5A 12E8H 2VLKA 1MCIA 1WFUA 4MZIA 5DJDB 3BSHA 5H94A 1A3LH 2J20A 3R1GH 1OY3B 3CFDA 4V1DD 5EU4B 2W1NA 4JKPL 3FRPG 1FLRL 1NCNA 1QYGH 3CZFB 4HF5L 4XX1E 2H2PC 2J8UA 3TZVA 2VDKB 4PRHE 4JK0D 1D5BA 3T3MF 3SKJH 4JO2H 1ONQB 1T5XB 4PP2A 3T3MB 2APSA 3C60D 5C07D 4G5ZL 3GHBH 3N1QC 3DGGA 3P02A 4FQQB 2UXGA 4JB9L 5ICYA 1GCYA 2C9VA 1OHQA 4H8WL 4QUOA 5FYJE 3VSUA 4ANVA 3VWJC 2ZKHH 4H2CA 3CCHB 2WBJD 4N2EA 2LAAA 1QBBA 3FBKA 2X1OA 3IDXL 3L5XL 4QRTB 4B9CA 5IV2B 1HAUA 5CBEA 2WB1A 1YUHB 5ADOL 1F18A 5KVEE 4X42A 3H9ZA 3SPVA 2CKBH 3WN5C 3ZDWA 1FNGA 3QDGB 3MLVL 1CU4H 3QQDA 3GMNA 4ZSOA 4ZMPA 4JCWA 4ZFOL 3DDFA 4TPRH 5CIPB 1YN6B 4R0LB 3VFUA 4K3DL 4WEEA 1UWEL 4NQVA 3II3A 1GTNA 4NSKA 4P23C 3QJHB 2APBA 5F7FA 1KLGA 2X42A 1G4RA 3JWOH 1FQ9C 3KWXA 1JVKA 1NMCB 4B53A 5C0AB 2APTA 1X3DA 1CFVH 2R1YB 3RI5F 5I8OL 5LGHH 1Z0NA 3O45B 5ITFB 2QSQA 4RWYH 4MJ5A 4Y1SA 5HI5D 5GGRB 3ASOB 4DPBX 1ES0B 2H2PD 2BPBA 1E50A 3QE5A 4JE0A 4Y2OA 4XWGL 4PJ9A 4XNXH 3MRGA 1AKJD 5FAAA 2V8LA 3JTTA 5LNDA 2Z92B 2H1PH 4FHJA 3DVGB 5GXBB 4PV9B 3JT2A 1TQTA 5EOTB 5L2KA 1MZZA 1UACH 2IH9A 4FLRA 3VWJD 2AJYL 2WSDA 1DLFL 5I1DB 5C70A 2JB6B 3ZKSD 2W81C 1YMME 3L08A 2WNWA 1T6BX 2HPOA 3STBA 1GJIA 3B5GA 5SV3A 4HALA 3P54A 3MV7A 2FIRT 4LLAA 3NSJA 5TE6L 2O5XL 2A99A 1MHHA 4OM0L 4U6TA 3ILPA 1TR7A 3ZRFC 1LM8V 2QQLL 3BAJA 3CZNA 2WYHA 1FVEA 4UINH 1NCUA 4FF9A 5LHDA 1EEZB 2VC2L 2KQMA 35C8H 4PJ5E 2JNZA 1SHWA 4KX8A 3U6RB 3VI3A 4JAMA 1OGAE 1N0XL 1J8HD 3NCEB 4P3DB 3ZLQC 3H1ZA 5BW7C 2VN4A 3NTCH 3K71A 1F0LA 2ARJA 4NS0A 4LLUA 4NQED 1PLAA 4X6CE 4I9XA 4FNTA 4JFOB 4LNVA 1XEUA 2DLTA 3HNVH 5FGBA 3QO0A 4WHCA 5TF1L 5I28A 2CHNA 3HI1B 4Z77B 4GAFB 4QRPE 5ES4B 5EU3A 1J5DA 4QGYA 2WZ5A 4BIKA 4C83A 1DTUA 3TVMC 4NQTA 4PLKD 3UL4A 2OYPA 3CFCH 1K8IA 1R75A 1SY6A 2OR8A 4C4KT 4HKBB 4TSBH 2H47C 3ULVE 5FOBA 3T77A 1MIEL 2FTAA 3L3OB 1TVDA 4TQPA 1KTBA 5DK2A 5DZPA 1TEGA 2X4NB 4XAKE 3INOA 4QHKJ 2Y23A 3MI6A 4W9EC 3OAZK 1ICTA 1UKSA 1E9PA 1U6AH 3KDPB 4TNFA 3U0WH 4NJAL 1RCYA 3A21A 4JG5A 7FABH 2WLKA 2XKUA 5KJ4A 1L9NA 4AK2A 2XJKA 3IMRA 4L3CA 3VYPA 3SDAC 4LGRB 3V4VH 1LDPL 2ZXWB 1TLMA 2NY0C 1HK6A 2HRGA 3NCJL 1UWYA 4PRHD 1WGOA 2Y5TA 4DUWA 5B7MA 4OTXL 1SEBA 2DLEA 1N3NA 2R2HB 2RALA 3B2UD 4HCRH 1E67A 3WIIH 4UNIA 4KOBA 3SE4C 1BPLB 1XF5B 2VLKB 3KG5A 3BXNA 2CK2A 2F53E 5FYJD 4N2GA 4NO5A 5H94B 1CQYA 3RZCC 2K4WA 4M7KH 3ZHKA 3CFDB 1NBVL 3PJNA 5IVOA 4OIBA 2J8UF 3F8UB 5GS1A 4OF7A 5J11B 1JV5A 1CYGA 2J8UB 3TZVB 5JYMA 3N2JA 4XHQA 1ZT7A 2UYLA 4L5FL 3S35X 3ZX1A 3GSNL 1D5BB 3TVMD 3GXTA 1PZAA 4HZAA 4AQ1A 3RWCA 3DGGB 4WV1A 5ICYB 3R7RA 5KZCD 4YAQA 4D8OA 2F7RA 4TLKA 5EZJA 5I6NA 4MBOA 4DKTA 4KTEL 4MD0A 4KH9A 3O6FC 2YS4A 3PY9A 4IK7A 4JVPA 4BZ1A 1SPDA 1ACYL 2YGQA 4M4RA 4LCWE 4H88H 4IQHA 3CLWA 4EDWH 1UH2A 2GIMA 1PZDA 2X6CA 3SPVB 1FNGB 1P5UA 3QQDB 5EO9A 2VDKH 3GMNB 4AGNA 4JE4B 3SDAD 5FUCC 3X12A 2NY0D 1OTTD 2W38A 4XO3A 3ZQXA 2VDNB 3VFUB 2AJUH 3LOWA 3VU2A 4NQVB 2PWGA 5HYQA 1OP5K 1KLGB 1IBDA 4K2UH 2B08A 1OALA 4Z6AT 1UD8A 4N6QA 3NUKA 2PXYC 2C4FT 5DK3A 4ZFQA 4RGOL 3VG9B 1SMDA 1ZJAA 2Y7OA 4XR8C 3RZCD 3SGEH 4Y4KD 4MJ5B 4LRNH 5L7XH 3WTVA 4YDLC 1YMMD 2XYBA 5L88L 3N42F 4LCIH 3Q6GH 3LPFA 2X4OA 4PJ9B 3N42B 2VLRE 3MRGB 2FBJL 3ELAT 4X8JA 3JTTB 4RSYA 3IU4L 3KLAA 4ZW7A 2WQUA 4Z3HA 2OJZH 4MNGA 5CIPH 2W0KA 2Z7YA 4JFUA 1ZANH 1P7KB 4QRAA 1PX8A 3N40F 5L2KB 4GSRA 1ZCRA 4I0CC 1OGPA 3UBGA 4PJ5D 1S5IL 1N64H 2WO2B 1GGIH 5HVGB 3MRPA 2BIHA 1OGAD 4IRSC 5AZ2L 3CPLA 2QADB 2XWZA 2ZSWA 4X4MA 2VRKA 1N5YH 1BAFH 1A8ZA 1V7MH 3ECWA 3MV7B 2HFTA 3ZL4L 1WUNT 1WBXA 2YA2A 3AT8A 4L1HA 1OSZA 1FGNL 3LS5L 1FYTE 3LH2H 3W9DA 1MHHB 3RBSA 5EFIA 3ILPB 3TIEB 2QVIA 3R19A 4QRPD 1FVEB 1WAEA 3QB7C 5MEQA 3LXCA 5C09E 3VI3F 1F3JA 3VFGH 3DO7A 2P80D 4BHUA 1Z3RA 1WCBA 4OJYA 3VI3B 4JAMB 3ULVD 3MA9H 4AMKL 1RI8A 4BFBD 3B2PA 4TSCL 3K71B 2ADIA 1CBVH 4M7LL 5DZLA 4FD0A 2O5ZL 4XAKD 3OMIB 4J3XA 4X7SH 4EN3C 2BP8A 1OP4A 3QO0B 5IHUL 3WKQA 3UC2A 5E0QA 5EU3B 3DMMC 4MB4A 5JLZA 1F8TH 2AZAA 4C83B 5DZ9A 4KNUA 2GC7C 3GZKA 4G1EA 4OM1L 1K8IB 3MRFA 1T20A 3L4TA 1T1ZB 3CVDA 4NZUH 2FECL 3T77B 5IMLA 5D7EA 4ESKA 3EJUA 3O8XA 3D09A 2GSMB 3H42H 1KCRH 5DK2B 5B1JC 4IRSD 4OJFL 2GBVA 4RLDA 1IQWH 5F2FA 5BPPA 5I1EL 4PGDA 3K0YA 1E9PB 4P9HH 4ZOBA 2F53D 5AW3B 2PYEA 4RAUA 4KVNL 2JKXA 1P9MC 4A68A 3BSZL 3VFVA 4L3CB 4UV4H 1W80A 1KXHA 4MRCA 1GYCA 2Y5TB 1IQDB 1MAML 3EJZC 4G8IA 1SEBB 1N3NB 4F5CA 1OE3A 4FP8L 4KJPC 4OKDA 4Y4FC 5DLML 3LIUA 4HD9A 5AYQA 3CNKA 3EFDL 4KI5F 5AW7B 5HD8C 3IMBA 4HISA 2D31A 1TJHH 3DJSA 3BXNB 5GJTL 3CJJA 3PHQA 3JUYA 4UOJA 4EN3D 5GS1B 4HMEA 4DGYH 1JV5B 5DHYA 2WQSA 1ZT7B 3IDMA 5DRZA 2CGZA 1JHTA 1GKEA 4LSVL 2G3ZA 5JW4Q 2J7LA 4JKMA 2Y3NA 3S3PA 1GZHA 4AQ1B 4BRVA 3RWCB 4WV1B 4P9MH 1BD2A 4R7LA 1YRKA 5T3ZH 5KYYB 5EZJB 1UKQA 5AVWB 4KXBA 3OHXC 4MD0B 2E56A 3BAXA 4GINA 1CD9B 4HS8H 4JRXE 5F44A 1AY1H 1MXGA 4M4RB 3L17A 2R0WL 1FZKA 2EXSA 3RA7L 1N9PA 2XTJE 3U30B 3UJJH 3NCCB 3OSKA 1T0NA 2Y06L 2BOCA 5A40E 2ZD0A 3BGAA 1P5UB 3EDJA 5EO9B 4I0KA 2HLAB 1Q0XL 4OAWA 1JGLL 3MNZA 3X12B 1MVUA 4K9EH 3WNKA 3T65A 2B1HL 1Q9OA 4FRWA 1MQ8A 4FZEL 2VJ8A 3COOA 3EJZD 4K07A 1MEXL 4UZUA 2VLRD 4KJPD 4NGHL 1ZDQA 3BZ5A 4NDMA 2NY6D 3EDDA 3W1ZA 4Z8FH 4ZPTA 1QSVA 4OJEH 1E5UI 2NY1D 4KMTH 5FYLE 3RVVD 5CCGE 5IB2A 4AVKA 4KPHH 2VDPB 1ZTXH 4XNZB 4TMPA 3ZHFA 4GYBA 1X7QA 3BPLC 4R90H 3ZT5A 3VQMA 1PF3A 1KV3A 1G1CA 3C6LC 2PP9A 5EU7E 2X4OB 1TTGA 4X8JB 4P57A 4PJFA 2O6PA 3KLAB 3IFLH 4MNGB 1FYTD 4YSAA 3TEYA 2VDNH 2JV6A 4S1SL 1IKNC 4DO5A 2Z7WA 4QXVA 2DYPA 4BQ6A 1FYHB 1LL1A 3I6KA 1QACA 5GISH 5C09D 3ENEA 5ADPL 5AVYB 2PETA 4XZ4A 3NCXA 3D51A 1OARH 2HRPL 3MRPB 3H53A 3FFCB 3CPLB 2ZSWB 3VD7A 4X6BB 4E9XA 1GGCL 2BXZA 2X2HA 3FCSA 2V6HA 3ZTCC 1WBXB 1BWMA 2DQDH 1OSZB 3VAEA 3W9DB 1OAUH 5EFIB 3NAAL 3HBGA 4ELMA 2V2TA 1SN2A 3P4LA 3BH9B 2ALWA 5AL0A 3WGUB 4I1PA 5MEQB 4FFYL 1F3JB 3DO7B 1WCBB 3ZHDA 5BCAA 2EDTA 5DEGA 1BGXL 5L8JB 1BJMA 1MCQA 2BVYA 1BQLL 1F11A 2FCBA 1JFHA 4M93B 2ADIB 1EZLA 1TCMA 4FEIA 2ZWKA 3QYCA 3KNBA 5ISZE 5EUOE 5I6OA 3C6LD 1YEHH 1KZYA 3HI6H 3B8SA 2XTJC 5JLZB 4N3TA 4PTTA 4TTDD 3OVUB 4G8FA 5AOJA 3S6CA 4QEGA 3L5HA 4G1EB 4NEHB 1YEIL 3HHSA 3VO0A 5JHDD 3MRFB 1L9PA 1T20B 3MX0B 3DHMA 3ZE1F 1B2WL 4OVVA 5LGJA 3ZZLA 3S8WA 5IMLB 2EO1A 3S4SA 1OAKH 3O8XB 3ZE1B 2E74C 3I3DA 1DVXA 1G9NL 2A2QT 1HHIA 5KAQG 3PQYE 4GRWF 4Y89A 5C0FA 5TFSH 4PGDB 2ITEA 2Y5QA 3AS2A 5EIIG 5IGXL 4GRWB 3PLYA 3FQRA 4M3KB 2PYEB 2NR6C 3HC2A 4RAUB 3FT9A 5CMAA 3V0EA 4XAWH 1G43A 5AENA 1GRWA 5I26A 3VFVB 5GZOA 2N3JA 4M8QA 3OC5A 4HEPA 3INUL 2YD0A 4YBLB 2XWJA 4FXTA 4LPVA 4UTBH 3T9WA 2F61A 1AG6A 4HKXA 3SJVB 5CD5C 4G8IB 1I8MA 5CCKL 3RE0A 4IKJA 4ZXBA 2LLGA 1VEMA 4U1LA 2HPTA 3ZKXC 4C8XA 2ZPKH 4LSSH 5C0BA 1A4CA 1CDIA 4NHCL 5I0WA 5E2WH 4IJ3B 3IXTA 5DFTA 2IDFA 2DQGL 3U2IA 4FKHA 5EF1A 3PHQB 1BF5A 2F5BL 2NT1A 1C5DA 1ZKAA 2D9QB 2V5RA 4OCYH 4KK8C 1XCQA 4JNXA 3MUY1 3VXSE 1A3LL 1BM3H 1Q4NX 3R1GL 3GIVB 2MPAH 4JRXD 5BOZG 1TSHA 1UT2A 5DHYB 3S9DB 5EIQA 2XTJD 5H37G 3IDMB 2J3SA 4ETQA 3ALPA 3LZNA 4JFZH 1JHTB 1JZGA 4DSYA 1XBRA 5J3HD 3SKJL 4JO2L 1BD2B 1ADQH 2WXHA 4YPGA 3E3QE 3NA4A 3QZOA 4PGZA 3GHBL 3UG4A 2IEPA 4PCTA 1LLAA 1KXVC 3HE7C 2P5EE 4ORGA 2YRZA 2IOMA 4TVPE 3TBVB 1FZKB 2ZKHL 3T2OA 3VFNA 3DHUA 1FBIH 1T0NB 5G55A 3VD0A 4JKLA 5JQ6H 2BOCB 4IGBA 2KYIA 2XXMB 3R8BB 2A6DA 5D7IA 4NKDA 4OAWB 3MNZB 1IAMA 1MVUB 5GGTA 3T65B 2CKBL 1Q9OB 2UZIH 1CU4L 4RISH 1HYSD 1UXWA 3U9WA 3TWCL 1XSKA 3QS3A 3M45A 4AGMA 4W70A 4ZFGL 2EO9A 4YDIH 4X5RA 3MLWH 5CLYA 4TPRL 1T2QH 3KH3A 3P0VL 4NDMB 1A9EA 4ZPTB 5I0VA 2B20A 4URTB 5CR1A 3JWOL 1V05A 4TF4A 1IGCH 5CJBA 3UGEA 2BFGA 3FTVA 1I4FA 1HINH 4KK8D 4C47A 1X7QB 4XH2A 1CFVL 1JJUA 4JFSA 4QRQA 4DPRA 4N0CD 4D9QE 5LGHL 2B39A 7PAZA 4L3EA 3WJLC 4RWYL 4B96A 4PJFF 3UAEA 1Y6KR 4P57B 3GBDA 4PJFB 5DMJB 3A4AA 2E6QA 4XNXL 4JGMA 4LVHB 3QQ4A 5FR3A 2H1PL 3LZLA 2DYPB 3OJMB 5DEZA 2HT4C 1RZPA 2XOTA 3I6KB 4GRLC 4TN9A 2DBLH 4F8OA 2W0FA 2KLSA 5A2CA 1KDIA 2ENQA 4GP5B 5ERWB 1LQSR 1UACL 4X80H 2XXGA 2FECI 2VDPH 4BEIA 1II4E 4OBSA 2H32A 1TPXC 3PJLA 3MV8E 1UWFA 3AWEA 3FCSB 4JO8A 3FHAA 1F4AA 5E1HB 2FB4H 1QSFE 1L9OA 1O7DE 3VSTA 3OAYH 5ISZD 2OS7A 2EC9U 1U2CA 3DI2B 3VYNA 1GSMA 1OGSA 2ZICA 4GMTH 2V2TB 1DUYA 3QXTA 3TO4A 4NO2A 4N6RA 1BFOA 3VB8A 3SDCA 4UINL 2DV6A 2CBOA 35C8L 5DEGB 1DVZA 3B7YA 1DZ0A 1F11B 2IDCA 3JTBA 4XWOC 2P52A 2F7OA 5EBLA 1LHZA 4DESA 3QIWD 5CLTA 1OM9A 3U1QA 3IE4A 3U9PL 3KNBB 5DGRA 3NTCL 1YPZE 5CFAA 3KVQA 5B1AB 3PQYD 4C59B 2ARWA 3HNVL 4YZFF 4PTTB 1I7RA 4G8FB 5IJKA 2X89A 3A6CH 5I6XC 4OF5A 1GYVA 3UTZA 3DECA 2YGOA 3HHSB 3HE6C 1KYFA 3L95B 1WO2A 4OF8A 4OT1H 5CD3A 2A83A 1GYWA 4TULH 4P46A 1X6LA 2HT4D 3SKNA 2X3AA 4Q9QH 1MRDH 4TSBL 1XH0A 3AREC 3S4SB 3SE9H 1M05A 4OQ1A 4HS3A 1B3IA 4U4IA 1HHIB 5FV2A 4GO9A 4LPCA 3ARRA 3K2MC 3SD5A 3V6ZA 5C0FB 3HJEA 5DJZA 4QJ5B 1KB9J 3FQRB 4J2QA 5CMAB 3LPWA 2CDEA 1U6AL 3JYBA 4A2LA 5JPNC 3U0WL 3VXSD 4M8QB 1GGTA 7FABL 2EDFA 2XWJB 3G6DH 4HKXB 3V4VL 1HILA 1I8MB 3ARUA 2VR9A 1HCYA 5GGVY 2F68X 4Y9BA 4CC1A 1L7TH 3BUQA 4HCRL 5C0BB 4PJIA 2YD2A 4J6RL 2OZ4A 3IXTB 4AC4A 1HL9A 2DQIH 3UZEA 3SODB 1C5DB 1J9RA 3LTVA 3LV3A 1XCQB 3P3SA 4RX4D 2KS0A 5F71A 3QRFM 4LKXA 4M7KL 4GRWH 2P5ED 1FNAA 1PBYA 2VZUA 4OZIE 3I75A 4TVPD 8CGTA 4NI6A 4I0PD 3WE1A 4BK8A 2MQ0A 4ETQB 1WAAE 3DIVA 2O61A 3R06A 1O7DC 5AAWA 4PGEA 2DDQH 2BRQA 4YPGB 2JQMA 1JZHA 1EDYA 1E3XA 3ARED 4Y5XC 1T89C 2GJPA 1NIEA 5KSBA 1I9RH 4I7ZC 3P2TA 2KHAA 3QQNA 2H2SD 3B7UX 4OF0A 4O51A 2C7UA 3QSKB 1E0OB 4PJ7A 4ZS6C 3GSVA 2I26N 4UQEA 2RA1A 1KXQA 2CNZA 3VFNB 4IRJC 1DSWA 3ZKMC 5D7IF 3E1ZA 1ORSA 4JRLA 5KSAB 3GEWB 4IGBB 5JW4N 1J86A 4NP4H 1UA6H 4H88L 2A6DB 5D7IB 4NKDB 5FYKU 4D9QD 2J2ZA 1FFNA 3WJJA 2VDKL 3FT3A 1UXWB 4PTUA 4BJLA 3SO3B 3NIGE 3BAKA 5AB1A 2R69A 3CFJA 2KDGA 1G6RA 1T7YA 1Z9PA 2C5DC 4I5BA 1BVOA 3P9MA 1A9EB 1KTRL 4HYTB 2WZ0A 3FO2B 4K5LA 4BFOA 1PW3A 4P59L 4K2UL 3T0XA 4FQXA 5D7JC 4FADA 1IZJA 4LVNC 5E5MA 1I4FB 4UOW1 2N01B 5SWSE 4KX9A 4QRQB 4UTAA 1CK0H 3UP1A 5I6KA 1IM3D 4RA3A 3IGFA 4PRPB 4LRNL 3OKLA 3MV8D 5L7XL 4RWHA 2Z64C 4XN1A 3QHZL 2BSRA 3QUYC 4XXDA 3FF8A 4LCIL 3Q6GL 5FM5M 5D2NE 1QSFD 5DD1H 4TUOA 3QQ4B 1GXEA 2OJZL 3IEAA 1JXGA 3UGUA 5IBLD 2CHXA 2IPUG 4DKEH 2BSCA 1T7VA 1VFBA 5DSCB 2W0FB 1EFXA 3CV5A 4ZS6D 3VX1A 1WF5A 4C55A 1N64L 1GGIL 4WI2A 4IRJD 5I18H 3FU8A 3ARQA 1CXLA 4LHUG 1N5YL 1BAFL 2DWSA 2ZCHH 3QULA 2D03H 1AIFA 1AR1C 1QFWH 1HDMA 3LIZA 2Q1EA 4P2RA 3MBEA 4Z3EA 1MFDL 3TO4B 4NO2B 1ND0A 4N6RB 1BFOB 5CUSH 4DNLA 5KYUA 4F58L 3UROR 1SN5A 4GT7A 3SDCB 3CQFA 5FKPA 4PV8A 2K3TA 3VFGL 1KC5L 4CC4C 1JPFA 3CX2A 5D7JD 4M9PA 1JYXA 4WW2A 5EBLB 1SDYA 3MA9L 1QLFB 2ORBH 4DJMA 2CHDA 2XA8H 1MSPA 1CBVL 1FO0H 5M7QA 2J21A 3KWVA 2J72A 4X7SL 3K7UA 4N87A 2GW5A 1S3KH 4CMMA 1I7RB 3GHEH 1IT9H 4G6MH 5BVPH 4R4BB 3FYEB 3UTZB 1F8TL 2WD0A 1FE8L 3O2WH 1F97A 1WTGT 3QORD 2QHRH 4YO0A 3W39A 4XO9A 2A83B 5CD3B 3QZPA 4P46B 3AS0A 2HMID 1CTOA 3SKNB 5C0RH 2E9WA 2WTRA 1M05B 4NZUL 4HS3B 4J8RB 4KOCA 1NM4A 3ECVA 4Y1AE 1XCTA 3ZKNC 3AT0A 3WO4B 4NN5C 5IJBC 2GITA 4TQIA 3H42L 4UQCA 1TTFA 5DJZB 5GGUA 3NGBB 2AW2A 2LGNA 1IQWL 3UZQA 1LILA 1A4BA 3B1UA 4BM7A 3EYOA 3WDJA 2CDEB 1AR1D 3BN3B 4P9HL 3MLSH 4MQTB 5DFVC 3QXDA 3QDJA 5EZOH 1QPKA 4FFTA 4MMXC 2DJUA 3GKZA 2FL5A 3I9AA 3IK2A 1IVTA 1TZAA 4FNRA 2ZOUA 4UV4L 1HILB 2WQRA 4PJIF 1R3LA 1AQHA 2B4CC 4P5TC 2WVTA 5D2NC 5SWZA 1OEZW 4PJIB 5EDXA 5F3HA 1FUNA 5CP7B 1NAMB 3CZEA 3BUBA 5EPMA 5B4MC 2D3NA 1M6UA 1VKXA 2CRYA 1SOSA 3MZTA 2J6EA 1PIFA 3LV3B 4R5XA 3HCVA 3P4OA 4JDVA 4LKXB 3VSQA 3GO1H 3I75B 2XUWA 3MLTA 4DN4H 4Z7UE 1GPOH 1N18A 4KQ3H 4DGYL 1ML0A 5KBMA 4BSVA 4MMYA 3V7MA 4OD1L 3R06B 2O61B 1UVQA 4DQOH 3CVHA 1XL6A 2NXZC 3BPOB 1N19A 3HN8A 2I9TA 4PGEB 5HYSG 4MYWB 2O6FA 5KSBF 1XWVA 2DMCA 4P9ML 2WZPA 3P4NA 5T3ZL 4JFFA 1MIMH 5KSBB 1X5IA 4PJ7F 2BWDA 4YK4C 3K6DA 4FABH 4XB3A 2C7UB 4PJ7B 3RUGE 1TJIH 4LMQI 3GSVB 3V8CA 2JJSC 2BY1A 1N67A 3NDZE 4MJJA 4HS8L 1ORSB 1HNYA 1N2RA 4ZMLA 2BZCA 2XQYK 4MCZA 2YK1L 4K55A 3V9FA 3VA6A 5SWSD 4YLQT 5DFVD 2WB7A 3T6ZA 3UJJL 1G5AA 1QPPA 2A6IA 3BFOA 3B2DC 1NFDE 2J2ZB 3FT3B 2EIKB 4K9EL 3N85H 4JFQA 3CFJB 4OCSH 1G6RB 1QWNA 3PWVA 5FHBL 3BKJH 3VTAA 2TRHA 3P9MB 4PRIE 2H1LM 4Z18A 3ET9F 3K8KA 3WBDA 5B4MD 5IROC 3D2UD 3WKPA 4ANKA 2E6PA 4FQXB 1JXFA 2AQSA 1EXHA 5FGCE 5AG9A 5E5MB 4KMTL 1GR7A 5FFOA 2W9EH 4KPHL 5H2BA 2W9LA 1ZTXL 4Z7QF 3X14A 4R90L 3EHBC 2BIOA 2QVMA 3OKLB 4Z7QB 5DJ8A 2IADA 1D6VH 2WXNA 2BSRB 2R1WA 5IHWA 4MMZA 4F33A 3NA9H 2CRIA 3GBEA 4PJBE 2VABB 2YGPA 1E90A 3FJTA 4JZOA 1YNLH 4TUOB 1CI5A 1TG8A 2G9HA 1SDAB 4FNLH 3IFLL 4YWGH 3D25A 5K33A 1H5BB 2VDNL 1YHPA 3K4DA 3EBIA 1VFBB 4TNEA 1DVFD 1P2CA 2VRAA 1EFXB 4W9IC 2N0MA 2P5PA 4BSJA 1BEXA 5GISL 2X38A 1K85A 2NZ9C 3WTUA 4UT7H 1OARL 5L0QB 1E6JH 4Y2DC 4PJXE 1AIFB 2VUYA 4N2HA 5DUPH 3A4EA 1HDMB 5I74B 2D3VA 2DQDL 4P2RB 3MBEB 2DICA 5JO5A 1OAUL 4IHOA 4ZYKA 1OWRM 1ND0B 5KYUB 2DM2A 3UACA 3K46A 2F6AA 1HH9A 2BOLA 3TPKA 5FKPB 1P6FA 5IROD 4PV8B 4WW2F 1G9EA 3VXME 5F3FA 3KMDA 1JPFB 3QNYA 3R0NA 1MY5A 3CX5K 4WW2B 3SYPA 5AVXB 5EZIH 4OLEA 4QIRA 1ECZA 1KLFA 5D72H 1L9MA 5IBUB 3K80A 4FNPA 3MJ8A 3ULUF 2WYZA 5CJQH 3BJLA 4FQCH 4CMMB 1YEHL 3L9BA 3HI6L 5HYEA 2CLRA 4WEUD 3ZTJG 1CURA 2D4DA 1CICA 4YO0B 3OG6B 3W39B 4F8TA 3KLKA 3BVXA 2JELL 1X5YA 2WTRB 4N2CA 3FHQA 1SBBA 3NSFA 1HN1A 1FF5A 3NCFB 1OAKL 1X5FA 2GITB 2NZ9D 4NC2B 4ES9A 4ZS7H 2XV6B 4ABQA 3QUZA 3UZQB 1FN4A 3EYOB 1P4UA 5TFSL 5BS0E 2G2RA 3GUTA 1J87A 4QKTA 5AUMA 3QDJB 5HGGS 4ACPA 4U0QB 5H4ZA 1WS8A 2V37A 4XAWL 3X17A 1I1AD 2FL5B 1BMWA 1RZGA 4P2QE 4XPTH 1R3LB 5AKRA 2EH8H 2FLRT 1P4IH 4FFZH 4UTBL 4HH9A 5SWZB 3S34H 4M1CD 3TCXA 1NEPA 1JNHA 5F3HB 1VDGA 4RRPA 3OAYK 3LEVH 4J4PA 5AVVB 2MQCA 4CN4A 5EPMB 2ZPKL 3AW5A 4LSSL 5E9DE 5E2WL 4JN1H 3C6SA 1S9WA 2AQ1A 3NFPA 2ENSA 2OA9A 3HCVB 5FK9A 2DIBA 3P4OB 4JDVB 1LP9A 1G7HA 1DL7L 2ADFH 3H9HA 4OCYL 5IWLA 1KELH 3MLTB 3ARVA 1M71B 1BM3L 5CM1A 5KUMA 2MPAL 1I7ZA 4MMYB 2DQMA 1UVQB 2YAFA 3CVHB 4WUKL 2I27N 3SGEI 4JFZL 2J1XA 2I9TB 3WFZA 3JWNG 4BA8A 5CN3A 2JKNA 4JG0H 2C3XA 2PUQT 1U3JA 2MCMA 4NFCA 5IEKA 1DP0A 4UV7H 1F58H 3EYFA 1ADQL 1FSKB 3P4NB 4LQ1A 1F3RB 4JFFB 3ZN6A 4DP9X 3TA3D 1NAMH 2YEVB 4EI5C 2QPSA 3VGAC 3VRJB 4PRID 1KJVA 3ARGC 5I1CH 3FUDA 1N2RB 4D9RE 4MCZB 3BRDA 1MG3C 1OSPH 4FG6D 1OK0A 1QOKA 1RULH 1FBIL 2A6IB 4FFWC 4I9WE 5DT1H 3SDXF 5C86A 2VOTA 3SB3A 2D73A 4CSZA 1RH8A 3ZDZE 3MNWA 3SDXB 2Q7NA 3L2NA 3QEQE 3KE0A 4JFQB 2UZIL 4RISL 3PWVB 1NMAH 5EMYA 4P4KA 3MA7A 3MLWL 2XZZA 2DS4A 4YDIL 4UUJA 5HVHB 4E68A 1T2QL 2XN0A 1XSOA 3OJVC 4MLSA 2RAMA 4W4OA 4AQ8C 1L0XA 1WP6A 1VPOH 4PIRF 1L3WA 1UKTA 1W9XA 1IGCL 3H4FA 2VITA 5H2BB 1MHPH 1HINL 4IOSA 4BZ1L 1NZRA 3X14B 2YUZA 4BSWA 3JWDH 3KS0H 2IADB 5DJ8B 1IEBA 3KJ6H 2R1WB 1U0QA 4MVBC 4MMZB 4M6NH 4F33B 1TMCB 1UYWH 2YR3A 2ZOKA 1KZQA 4JZOB 2SODB 3FAXA 3FQWB 5B7EA 2NQCA 4OKVA 2OMUA 2R69H 3WV0A 2G9KA 1G6RH 1AGCA 2NYKA 1MWAA 1V10A 5JIKA 1A2YA 1V7NH 3V6OA 5F96H 3P69A 4CU8A 2GIXA 4JFVA 1P2CB 3RTQA 3T4AA 2DBLL 1M4KA 3U79A 3VXMD 3AXIA 1TQCC 5DD6A 3VD4A 2UY6A 4BE5A 4X80L 3VWKA 5I71B 4U1NB 2MJWA 4KK6C 4UTAH 3MRBA 2Y22A 1UOKA 2VDPL 5LWYH 2X9YA 2P5WE 4JQIA 4DK6A 3NEXA 3NIFE 4FFWD 4QRBA 5D4IA 2E7HA 2CIIA 3P30H 3QIUA 4LE8A 1I82A 5JO5B 3T0WA 4E9RA 1N5AB 5GZNC 3NESA 4OGQC 1RAMA 4BA0A 4GMTL 2A4CA 4HT1H 1QBAA 4EBQH 3ULSA 1HH9B 4OFPA 4PEEA 5HYJE 5FGSA 3O11A 3QNYB 4FQPA 2EDXA 2LLNA 3MLUH 2MCG1 4N2BA 5D7KD 3B37A 4KY1H 2X88A 1EVTC 4ZODA 3UYRH 1KLFB 3QNZA 4MDIA 4R0LC 4U7KA 2V17H 2VDRB 3MJ8B 3SYOA 1T0MA 2ZYRA 3FKUS 4MVBD 1BPVA 4WTQA 3P9WB 5BS0D 5DVKA 3TN0C 1H3VA 4MDJB 2CLRB 1B4TA 1NMCC 3UEQA 4W9JC 3QIBA 1CICB 2B3IA 1VJSA 2J5LB 3A6CL 3V4PH 2NY4B 3CZSA 3TBWA 3WNPA 5I1GH 5MEOA 3RY6A 1I1RA 3HC3L 4KRPC 5I1LA 4P2QD 4OT1L 3MRHA 4TULL 2EKSA 4IBUA 3AS3A 2ZE0A 4R96A 1MRDL 3MSPA 4Q9QL 4HWBA 2AAAA 3SE9L 3GFUA 1A7OH 5HJ3B 3PE9A 4HGWA 1GZPA 4E9VA 4KK6D 5E9DD 3S7GA 2MOGA 1RK7A 3QUZB 1M56B 3BW9A 1FN4B 3SKOA 2G2RB 1TJGL 4U6XA 1A5FH 4J3OC 3GUTB 1S4IA 4FXKA 5BQDA 2P8LB 1AJ7H 4A67A 5F9WB 3QQXA 4KKCC 5GZND 1RZGB 2UUDH 4X9GA 4XN8A 2Y1ZA 3ZE0E 1T2JA 1JF1A 2E4TA 4HH9B 1JNHB 4PY8I 1BYNA 1FL5B 2AERT 5CU9A 1L7TL 2WTPA 2LFEA 3DOIA 4JRYE 3N9GL 3T0BA 2BNRE 3C6SB 1S9WB 3HFFA 1LP9F 4JPVH 2DQIL 3NFPB 2NOYA 5FK9B 1KGYE 1G0DA 4PWFA 1PEWA 1LP9B 4HIPA 1G7HB 3H9HB 1BMGA 1NOLA 1WFNA 2OSYA 3GSRA 4NKOA 4E5XA 4AYID 1I7ZB 1LGVA 4D9RD 3HKFA 4GI9A 4X6EA 3TN0D 4AC2A 1SF3A 3F12A 4LEEA 4I9WD 2P43B 3BGMA 3CZUB 1KWKA 1RFDH 2P9RA 1CD8A 3NYKA 2HJFA 1MW0A 5IT2H 2ICES 5PAZA 3FB5B 4KRPD 4Z3FA 5IEKB 1YNKH 1VESA 2DDQL 3D52A 3EYFB 3QEQD 5HXMA 3OXSA 4JZJC 3ARTA 5GS0H 4P2CG 4Y2LA 2WO3B 3KCWA 2R0ZH 1KJVB 1I9RL 2HVJA 4D0BA 1J11A 2J6EH 2ZAIA 5CEYA 5C0JA 3MQIA 1ZLWH 4A63A 1NSNH 5ITBH 3VU1A 1NBYA 5KSUA 4Z7NE 2Z7UA 1NCBH 5B3NA 4NP4L 1UA6L 1XO8A 3L3OC 4C54A 1ZRUA 3MNWB 3ECQA 4UMSA 3T3PF 2ZG2A 3CVHH 3ZSTA 2MFNA 5IR1A 3GMLA 2UZYA 4XPGH 3T3PB 3VNYA 2JXMA 4P4KB 2ITDA 1P69B 3MA7B 2WLMA 3AB0B 4N9GA 4WEMB 2WLJA 2IIJA 1LK2A 5IHBA 5E6UB 3FMGH 2DLHA 4HWUA 3F01A 4EAEA 2EABA 4XCEA 1JXDA 3BDXA 1OGTA 5DJ6A 1V5JA 4PJDE 2VITB 5E2VH 3SGKC 4K94H 3SO5A 3SPCA 1CK0L 3KPQA 1IEBB 3BVWA 2ED8A 1J0JA 1EPFA 2P5WD 3Q48A 4POUB 2ZOKB 4WO0A 4ZO8A 3VXPA 1OTSC 2XVBA 3O6ML 2OMUB 2NNAA 4OKVB 4TYUA 1AGCB 5DD1L 4OR1A 1A2YB 2XZAL 1BX2A 2NX5D 3PHOB 3NQIA 4P04A 1A6TA 5LJYH 3FSZA 4DKEL 1YYLL 1IGIL 2EYTA 3F05A 3H3PH 1JWUA 3RTQB 3T4AB 3TZVC 2VH5H 5HYJD 3KWWA 4GMSH 3IU3A 1MJ8H 1CVSC 5DD6B 1R1CA 2UY6B 3BIKA 3DSNA 3VWKB 4ZNEE 5IQLA 4ONFH 2J71A 3MRBB 1OLZA 4KVPA 4XRCA 3ZOAA 5C8JB 1I75A 5I18L 1EEUA 5ANMA 2WWNA 2CIIB 3TFKC 2IJ0C 5D1XA 2ZCHL 3QIUB 2DQJH 2D03L 1BVNT 5EU6D 3WSQH 3UTPE 5B7FA 1QFWL 1MJUH 4UOQA 5K69A 3DYPA 5AVZB 4KK9C 3ULSB 4Z78A 5CUSL 3I9IA 3O11B 1NGWB 3FB6A 3QZMA 3PV6A 3TCLA 1EVUA 2F54D 4ABVA 3HJ0A 4XOBA 4TVSa 1OLLA 3HAEG 2JF1A 3B34A 3QNZB 4MDIB 2ORBL 2Y25A 4KXAA 5GRJH 1WFTA 1E9QB 2XA8L 1X44A 4M5TA 2JCCA 4MAYA 1FO0L 1T0MB 3ATEA 4O02A 1TQVA 2CJTA 4F8LA 1OV8A 3UABA 2LHAA 1XIWA 5CN1A 5HHXH 1S3KL 1OTSD 1UGKA 2IF7A 3GHEL 4IJTA 4S10A 2P42B 4GBXC 5BVPL 1YCSA 4OCMC 2FNWA 5CCHE 5IFAH 5EG6C 3TURA 5JOFA 5MEOB 3O2WL 5I1LB 2FUQA 2QHRL 1ZA6B 3TBYA 3MRHB 3C9NA 1FNSH 2EKSB 2IWKA 3D07A 5C0RL 4R96B 2D2CC 2NSMA 4NRZA 4X8CA 1RIVH 4GAGH 3LRSA 4AYFB 1EUTA 3MCLH 2IVFC 4WVRA 4HGWB 3BPNB 1H19A 4PJ9C 3TO2A 4HFUH 4JRYD 4WWID 3BW9B 2BNRD 3SKOB 5EO1A 1IBYA 3C8KA 4OH2A 4U6XB 2VDRH 3NPSB 3ROOA 1I8KA 2JI1A 3CZKA 4N8VG 3RIAK 5KJRH 4FXKB 2ZYIA 1TXKA 5E23A 2FZ3A 1KEGH 3MLSL 1HZLA 3MKKA 4KNSA 4XPHH 3WE6A 1J7VR 2WJ5A 1E4WH 4V11A 5T1MB 5C3LD 3EO0A 4NUPA 5IVXE 3T08A 3RVUC 1JF1B 3TPUA 4FI8A 2EIZB 3WLBA 2G3NA 1BMZA 4JHAH 2VIRA 3KPSA 2VR7A 1DO6A 4KJWC 1USZA 3H4HA 4EJ1C 1MI5E 2FQEA 1RJCA 4B97A 1NPJA 3KR3H 2FD6H 3GSRB 4NKOB 5DHVA 5AVSB 3UTSE 4E5XB 4O2EB 3FC8A 3GO1L 4NUMA 4X6EB 4DN4L 2X0WA 3F12B 1GPOL 2VLJE 3BGMB 1R46A 2PTTA 4KQ3L 4DQOL 2HJFB 3FT0A 3PP4L 3LH9A 2ZKMX 1XZWA 4QRRE 1U3ZA 4XP1H 3FUEA 3OXSB 4WU5A 2V9UA 1OB0A 5FGBC 3VH8G 2Q76A 3IKKA 1VA9A 3KVDD 1MIML 2E76C 4WKXA 1NEZA 2HVJB 3GM0A 4D0BB 4GQQA 5TK4A 2XCMC 3FUHA 3NRFA 4FABL 5CEYB 1BZ7A 4H0GA 5C0JB 1TJIL 4KDVA 3B5HA 3B9KA 4HUCA 5E7FA 1NBYB 4G3YH 5JXEA 3G5XA 4L0ZA 5KSUB 3UYOD 3V4LA 2P46B 2EDHA 2WOYA 4YHPB 4DEPB 2JKLA 3BWUC 5IR1B 3RVUD 4W93A 1B0GA 2UZYB 3CXDH 4QXGH 4I48A 3N85L 2G0KA 2JXMB 5I9QC 2ITDB 4N9GB 3D3VE 3OLEA 2ZX5A 3AM8C 4OCSL 4XO8A 1LK2B 3BKJL 1EJOH 3WTXA 1PZUB 1EWHA 2CCVA 2Z8RA 1JZEA 5DJ6B 1OGTB 2GI7A 5HGHA 3L3HB 2GJJA 2Q10A 1QNZH 4JANA 3X13A 3QI9D 1OSEA 5E2UH 2BNQE 5D1ZA 1RY7B 2W9EL 4WUUE 2Y0SA 1R3KA 2IAAC 4N0UE 1D6VL 1IUZA 1HI6A 3VXPB 2IDUA 4WWKC 5GGSY 2NNAB 3KHOA 3NA9L 4KI5C 4X4KA 3UTPD 1G9MC 1YNLL 2VDQH 1BP3B 5E95B 4ACTA 2ZUQB 1WBYA 2RTTA 5TQ0H 4FNLL 2VN3A 3LH8A 5GS1C 3ZYOA 1A6TB 4V1DA 4YWGL 3UXFA 2EYTB 4N2KA 2HT3C 1XDTT 1JWUB 5PCYA 3RWFA 4AEEA 3KWWB 3FU5A 3BIKB 3DSNB 3BN9C 4HV8B 2QKSA 4UT7L 4XRCB 5K9KB 2OL3A 2VXQH 5C07A 5ANMB 5KJ7E 1E6JL 4J3TA 4L1BA 5D1XB 2D7NA 5DUPL 1I7UA 4U0RC 3D06A 4LK4A 5KYWA 2GSIA 4E9WA 2FVNA 1CMOA 2C9SA 3O4OC 1HE7A 1C5CH 3OAWA 4Z78B 4X8XA 4WI3A 1QFPA 2WBJA 5ILTH 4YDVA 1NBQA 2C3WA 4B95C 3FB6B 4N5EC 3TONA 3PV6B 3O2DA 3TCLB 4E9QA 4XN9A 1P5UC 2P1YA 4AG4H 5D2LE 5K59F 1YC8A 8FABA 1XXDC 2DRUA 3FXIC 5GHWH 4X5QA 1M7UA 2JCCF 4YHKL 4JQIH 5EZIL 1BQHA 1I9JH 2JCCB 1GMIA 4MAYB 4O02B 5D72L 1Z5LA 3CU1A 2XN1A 3HR5A 1OCOB 4R4FH 1MLCA 3DJTA 1E4KC 1XIWB 2F7QA 5CJQL 4FQCL 4WWKD 5CEZH 4RA0C 2ZWNA 4IIZA 2QSTA 5DVPA 1DBJH 1NM9A 2J4WH 3LQAC 4QMEA 4XNZC 5JOFB 3DUUA 3IPEA 5KW9H 3TBYB 4X9FA 3GPEA 1OE2A 3C9NB 4FQ1H 5ENWA 2HT3D 4PRBA 4KJQC 4FQ2H 2ZWSA 4NRZB 5D4HA 4Q9RH 5IP4A 5INCA 2ZUXA 3TO2B 4KRMB 5L4IA 4NRXA 1AKJA 1R34A 3BEWA 4ZS7L 1IIIA 3C8KB 5KS9A 2BCMA 2J88H 4DGIH 2P7TB 5MP6H 1I8KB 4JQXA 3ROOB 3BESR 5C9KA 3OPZL 2FZ3B 3RG1C 1MXDA 4JRWA 3P73A 5DUBA 4I1NB 3UTSD 3WE6B 1SVBA 3UCQA 1FVDA 2FJSA 3VWJA 1BVZA 1LYQA 2YARA 3EO0B 2DPKA 4U7MA 2BY3A 1E40A 1K4CB 3TPUB 2VLJD 4LL1A 3V0FA 1IL1A 2GTWA 3KPOA 3WLBB 2ZUWA 2WTOA 2VIRB 4XPTL 2EH8L 4FFZL 1P4IL 3S34L 4PJ8B 3KPSB 4QRRD 4AKQA 1T3FA 1H8LA 3LEVL 4JPSA 3VXTA 4ES8A 3N5AA 4RFNB 4JN1L 4DP7X 2UXTA 2E27H 2A0LD 1TENA 3UBXA 1EIBA 2ADFL 4LEOA 4X50A 3WMSA 1BVKA 1KELL 4P23A 4DZ8A 2K9FB 3ZGIA 2HG0A 4U3SA 2PTTB 2H1XA 3MV9E 3KEHA 5D7SH 3APMA 1J8HA 4M93C 2SEBA 4NERA 3EJJX 4IBTA 3TA4D 2E9IA 1KYUA 1WD8A 3S96A 5IJDC 2WXQA 5K1VA 1AXIB 4JG0L 1NLDH 4WU5B 1O9ZA 1BJ8A 1YLBB 4KJQD 1PNDA 4NQEA 4XT1C 1F3DJ 4JM0A 4EKJA 2WY3B 1F58L 4UV7L 1UTDA 1YMHA 1Z2KA 2Q76B 3CX5J 3D3VD 4HJSA 3HZYA 4NNXA 3L6FA 1NAML 1A6AB 2EYRA 2OZ4L 2CMRL 2LABA 1NCCL 3EGSA 3OXRA 5JIMA 1NCGA 5CFHA 1BZ7B 3S88H 4K71B 5I1CL 1PGRB 3ZUCA 3B9KB 1A6UL 4M3JA 1RPQA 5IREA 2FH6A 3L3GA 3G5XB 3OZ9H 2BNQD 3DLQR 4XPAL 1E5AA 1OSPL 4V33A 1RULL 5DT1L 4X9BA 1X7TA 3W56A 3CXFA 4ZTPH 4BFNA 1RZJC 1GHFH 1B0GB 2GEEA 1MELA 4I48B 3AG3B 1ZY9A 4D2NA 1E4XH 5FGRA 5ECJE 1NMAL 2WKOA 1QFWI 4KROC 3QFGA 3KXFE 2B9AA 1KYOJ 3K6IA 4NZJA 5HGHB 5GRXG 3ILQC 5CLWA 2UUDK 4ZMZA 4JANB 3NJNA 4FS0A 3X13B 3L16A 4YBLC 4FE9A 1DQTA 1VPOL 3RNKA 3TBBA 1XL4A 3LYRA 5D1ZB 4PRHA 1MHPL 2ATPA 2PWEA 4JKWA 1SDDB 2BNUA 3PJSB 4XMLL 1JVLA 1R3KB 1C1EH 1DVUA 1FFRA 2VTFA 4UB0H 3JWDL 4DP8X 3UG5A 1HI6B 3KJ6L 1YYCA 4M6NL 3H9SE 2GABA 1PY9A 3C2AL 3FTWA 1WBYB 2R69L 1G6RL 4V1DB 1A4JA 1LO0L 3RWFB 3LNHA 1TO4A 1V7NL 3B7RL 3FT1A 5F96L 3WEMA 3J27A 1SXNA 3MJWA 3EH5B 2KPWA 2XG5A 2EO7A 4S1DC 3TVMA 2FYVA 1AI1H 4GXVL 2WAHA 2D3JA 2OL3B 3HMXA 4UTAL 1KFGA 4FG4A 4JM2D 5C07B 3UPAA 5DHXB 5LB1A 5LWYL 1KIPA 1PKOA 1QRKA 2CA4A 1I7UB 2R51A 2WCSA 3WEAA 5KYWB 2YJLA 3P30L 2C9RA 1UZ8A 1ZT1B 1JZJA 2PCYA 1ZLWK 1R24A 4A6YA 2WBJB 1I3UA 4KROD 4YDVB 2OW6A 4HT1L 2I60H 3WY2A 4EBQL 5FO2A 4JO1H 5KOMC 4HJTA 3KWTA 4GUQA 3TJEH 1CGVA 4MD4B 4M5SA 3ILQD 3LRGA 8FABB 2PNDA 2EEDA 3MLUL 3SY6A 4YEEA 3SDAA 4GO6B 5T5NF 4HZ1A 1Y18A 1IO4C 4LBEA 1BQHB 4ICWA 3UYRL 3N3EA 1Z5LB 2V17L 1W8OA 2H6OA 3HR5B 2BVQA 1MLCB 1V3MA 2X53A 4D8PA 4KTGA 4KC3B 2FO4A 3MJ9A 2XETA 3RZCA 4FTDA 3DUUB 3V4PL 4NT6A 1CFNA 1NL0H 4Y4KA 5ENWB 5I1GL 4PRBB 1WHOA 1U33A 3FUNA 4OUUB 3WUWA 1YMMA 5E56A 4F9LC 1SM3H 5FWRA 5INCB 4AQEA 3LB6C 1DE4A 3LRKA 5I15H 4G80A 1A7OL 1AKJB 1Z5YD 3U36A 3BEWB 3HLKA 1JSYA 2DY2A 2XBZA 5E4OA 4LVHC 3SQOH 4BGLA 3SBQA 1J5HA 2KZBA 1A5FL 2R4RH 3P73B 3PDGA 5DUBB 3WNLA 2EILB 4GXFA 3ME0A 2F58H 1FVDB 3CN3A 3VWJB 1AJ7L 3LKOA 1O6VA 1T0OA 3NH7H 2J56A 4AXWA 1NANH 3EH3B 4TUKH 3LPOA 1IL1B 1JTOA 2GTWB 3KPOB 1OGAA 2VLLB 2JMRA 3MV9D 4UAOC 5FXCH 4JFHE 1I3RA 4ANWA 4PWHA 2XPGA 4L05A 1T3FB 2OULB 3VXTB 3QRBA 4X6CA 5J9PA 4TQEH 2H3KA 1AGDA 1YNTA 4G6JH 3G04A 5A2BA 4JPVL 5C7XH 5AVRB 3UBXB 3QJUB 4OIIH 1VZIA 4QRPA 2WW8A 3V0IA 4LEOB 2TRYA 1QRNB 3HNTL 3MCG1 5DUJA 5I1IH 1BVKB 4KV5F 4P23B 4DZ8B 2P80A 4MXQC 5DVNA 3D12B 1XF3A 5B8CC 2PXYA 5J1TC 1T6VN 2SEBB 4X4ZA 5AKVA 1PIGA 3S96B 5AZEL 3CE1A 3J8F7 5D5ME 2D2OA 2CCWA 5IT2L 4NQEB 2DI7A 3MLYH 2HT2D 4KKAC 3ISWA 2WWKT 3AACA 1YNKL 4CA4A 1YMHB 5GS0L 2EUWA 3U6XA 1F5WA 2WZ6A 3HZYB 3F64A 3L6FB 3LB6D 1FDLH 1RPUA 3EGSB 1G0XA 2JKIS 4MCYA 3OXRB 1KGIA 4CU7A 3KXFD 2R0ZL 4ZFFA 5GRVK 4WAFA 2J6EL 4MJ4A 3QXVA 3L3GB 4XTRC 3DOSA 5FS5A 4F7MA 1DJXA 2ENJA 2M83A 1NAKH 2D8KA 1NSNL 1KMGA 5ITBL 4FMFA 2QQNH 4NQCB 1DFBH 4I87A 1NCBL 2OP4H 4NQSA 2AITA 1NFKA 3UIZA 4JPIA 3WFCL 1YO4A 5FW8A 3CVHL 3GXPA 4IRSA 2ZJSH 4XPGL 4Q2ZB 3H9SD 4H26A 3MOQA 4O58H 2F53A 4Y7MA 2AJVH 3GHPA 3VM5A 3FMGL 5GZOC 3B6SA 4HC1H 4M6MH 3ARBD 1U30A 3N43F 5E99H 2PMZA 5E6IC 2H0FA 2X41A 1KCVH 3N43B 1NCWH 4PRHB 1T4KA 3IAPA 1IAIM 5E2VL 3IS0X 4RMVA 4ZXBC 5IMKA 4CMHC 4K94L 2BNUB 4BCXA 3R18A 4HWEH 2QQKH 2AS5M 1XB6A 4TNWF 1W72H 1TYJA 1NGPH 4Y5YC 3LHPL 2R15A 3KPTA 4G8GE 1A4JB 4XBEH 4YVNA 3GI9H 4EN3A 3EZ8A 4P0DA 4GRMA 5DC9B 4M4PA 5IY5B 3H3PL 1SUHA 3S8GB 5T1DL 4LCWA 1VCAA 2FEEL 2VH5L 1ZWIA 2XG5B 3E9TA 4GMSL 3TVMB 1TZGH 4ODWA 1MJ8L 43CAA 4XTRD 3NVQA 1OB1A 4ONFL 4H2AA 1A3QA 1KIPB 5KZCB 2GVYA 3D8MA 4QF1A 5DURD 2ICWJ 4AE0A 2RQ8A 2VMEA 3WSQL 4IMKA 2DQJL 3ZZSA 5B1JA 1UZ8B 2PPFA 2O5YH 3DX2A 1RJZA 4KUZL 4A6YB 1MJUL 1R24B 4I77H 3UBFA 2CU9A 5D1QE 1HFUA 1RHFA 3G5YA 4NBZB 2PW2A 2ZYSA 4Z7VE 2OR7A 2EXYD 2RMNA 2XICA 4IGBC 1N0LA 5EN2A 1P9MA 3T8VA 2QTVA 5AW2B 5I8EA 4D0CA 5E6ID 3LPPA 3ZJAA 3SDAB 1OD7A 2VMDA 3O3AA 2NY0B 3VCLA 1Y18B 4LBEB 1WFOA 2KC0A 4HOZA 5AAPA 1U3NA 2OL3H 3KLQA 4XP4L 2Z8SA 3K2UH 2VLRA 1UD5A 5GRJL 1TVBA 4PP1C 2CO4A 2BVQB 3RIFF 3O3UN 5I73B 5F7YC 1N59A 2NYZA 4Z3GA 4PJHE 5HHXL 1BJ1H 2IFFH 2FO4B 4HK0A 4HHAA 1PYWA 1M6OA 3RZCB 2VR6A 1CFNB 3B9EA 5IFAL 4Y4KB 5JMOC 4R97C 5HDLA 3AY2A 5J12C 2OMZB 3WUWB 1YMMB 1FNSL 1Y1UA 3NCWA 3HLAA 1HL4A 1DE4B 4JFHD 2FHBA 5M94B 4G80B 1RIVL 4GAGL 4JPKH 3REWA 3MCLL 4WI7A 1RUQH 5HI3C 3U36B 4X0NA 3VFOA 3F6JA 5LCVA 1FYTA 3ECUA 5A1AA 1HEZA 3SPJA 3GZPA 2WBKA 4YLCA 2VDRL 4QWWD 3OHXA 5KJRL 3L9EA 4LFHG 3ME0B 4OGYH 3KGRA 1QR1A 2EUVA 5C09A 5IB4A 3LKOB 1KEGL 4AXWB 1AS8A 1E4WL 1OGAB 3CSFA 1CFQA 1OW0C 3RHWK 3SD2A 1I3RB 4X6CF 4XVUD 3QDME 1N10A 2DB8A 4JHAL 3HN5A 1YNTF 2KDYA 3M86A 1A1MA 3QA3A 5DC4B 5ALBH 4X6CB 4EOWL 4NNYA 3P40A 2PCPA 1YNTB 3TJPA 3G04B 3P2BA 5JHLA 3TEWA 3VNZA 4FCAA 4UANA 3KR3L 4JL1A 4QRPB 2FWOA 3ZTNH 1XD1A 2FD6L 4L4VE 2P28B 3OF6D 4LOUD 1F86A 1XF3B 3NIDE 1QUPA 2PXYB 4J3BA 5IOKA 1OL0A 5IUSA 3F04A 1UHVA 3QR1A 4OCNC 2VQ1A 3IM1A 4CDGC 5H37H 3VFTA 1CL7H 1X5KA 5ESAA 4XP1L 3CFUA 5D1QC 3DGCR 3C6LA 4LLQA 1YYMH 2AGJL 1HX0A 2Y24A 5IJKC 4ZFFB 1NBZA 4GKNA 3DOSB 3MAWA 4F7MB 4U2ZA 3CDCA 4G3YL 3O6LH 3RY4A 2ZZUT 4LSTH 4NQSB 1D5RA 5CINL 2IPKA 4JPIB 3ZY7A 2E7LC 1UCTA 1MW2A 3TJHC 4IRSB 4D3CH 3NGBC 2YXFA 4TXVB 3CXDL 4QXGL 2YPKA 4U6YA 4H26B 2XX0A 3JZYA 2QHLA 4YSOA 3GMRA 3N1MC 4G8GD 4L2LA 4HA1A 1FHNA 5KVGH 4EZLA 5HHQA 1EJOL 4DVRL 2ZOWA 1MZYA 4HHGA 1KY7A 2KH2B 5LGKA 1QNZL 4HGKC 3ZQWA