1GSKA

Crystal structure of cota, an endospore coat protein from bacillus subtilis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Bacterial Endospore Coat Component: A Laccase with Enhanced Thermostability Properties
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
total genus 145
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gskA02
4JHVA 4F7KA 4X4KA 1JVOA 2J56A 2WO2B 4ENZA 3PAUA 3IE9A 4PAZA 3TU6A 5IY5B 3PAZA 1ID2A 4YSRA 1GW0A 2PP9A 2YXVA 3BVDB 1RKRA 1JZGA 2H5UA 3KW8A 5F7AA 1NIFA 4E9YA 4YSAA 1EHKB 1W6LA 3FSZA 1E65A 3FPXA 2XUWA 2WSDA 4KOBA 5E9NA 3DIVA 1HAWA 1OF0A 4E9TA 2QPDB 3EH4B 3FSWA 1SFHA 2MTAA 1AQ8A 5D4HA 3HEIB 4KNSA 3ABGA 4UF7C 3WG7B 4AI7A 4E9XA 4YSDA 2EIMB 3S3DB 3SBPA 4YSEA 1BQKA 2YARA 3NP4A 3FQ1A 1TKWA 3NSFA 2UX7A 1JXGA 2YAPA 1ASPA 2J57A 3X1NA 3FU9A 4BWWA 5F7BA 2LLNA 2CALA 4DPBX 4YSQA 1PCSA 2B08A 2AZAA 1AG6A 1ZPUA 1ZDSA 4GP5B 1GS6X 5B1AB 2GSMB 2VW6A 4DP0X 1CUOA 4QKTA 2FQDA 1MG3C 2FTAA 1I53A 3ABLB 5AFAA 3FU7B 1ILSA 3C75A 3SBQA 7PCYA 1WA1X 3PCYA 3QJVB 1FA4A 4K9JA 1JXDA 2DWTA 5D4IA 1AS6A 1NWPA 2YAOA 3PXLA 1KGYE 3WKPA 1V55B 4BDVB 5PAZA 3NJGA 4GY4A 2BHFA 2PLTA 2FNWA 4HCIA 1DZ0A 1MG2C 2UXVA 5TK4A 2OCCB 4KO6A 1RCYA 2OJ1A 2DY2A 2W8CA 4AX3A 2YQBA 4YSTA 4A2FA 4DPCX 3MBWB 5TK2A 2CJ3A 2OV0A 3TASA 5I6OA 2J5WA 3IBOA 4QLWA 3FPYA 3HB3B 4HHGA 5EHFA 3BQVA 3N2JA 3NJHA 2IDFA 3NT0A 1AZBA 4KO7A 2X88A 2HRHA 1A3ZA 2BP0B 1SNRA 1AAJA 3FU8A 5B7FA 1A4AA 3AZUA 2E86A 1YLBB 2FQGA 2IDQA 2PCYA 4GXFA 2FJSA 4YVNA 4YVUA 1IUZA 2PPCA 5AZUA 4DP8X 3QPKA 6PAZA 1NTDA 4E9WA 2AVFA 3UGEA 5I6KA 2BWIA 1OCOB 1OE3A 3ASOB 3PAVA 4EF3A 1CC3A 3UAEA 2DWSA 1KDJA 1EZLA 4RH4A 1E67A 2VM3A 3NJLA 2HX8A 1V54B 1UATA 1KYAA 1GSKA 1RZQA 4A67A 3NSDA 2IAAC 2UXGA 4GP8B 4CSPA 3AG4B 2IWFA 2FQFA 4AKPA 3CDZB 4DP9X 4G72B 4HCFA 2BP0A 2DYSB 4KNUA 1X9UA 6PCYA 4JKNA 2Q5BA 3H4HA 1J9TA 2N0MA 1GYCA 4YL4A 1JOIA 2IH8A 5I5IA 3AG2B 1OCRB 5D4JA 5PCYA 3PLYA 3FSVA 1E5YA 1PLAA 2W88A 4NERA 4YSUA 5B7EA 1TU2A 3TBBA 1JZIA 1XB8A 1XMEB 2GIMA 1PF3A 3TBCA 3OMAB 4WKXA 5B1JC 3WI9A 2TSBA 1ZIAA 3T9WA 1GY1A 2YAQA 2A3TA 1MZYA 3AW5A 3NJIA 2WO3B 1BQRA 2AANA 5ANHA 1L9SA 3AG1B 1ASQA 4BXVA 4DPAX 2BP8A 1GY2A 4MFHA 4AKOA 3H56A 1M57B 3IN2A 2H3XC 1L9RA 2FT7A 1ZV2A 2QT6A 3UABA 3WNJA 1A4CA 4KO9A 1RZPA 3X1BA 3OMIB 2BO0A 2BZ7A 1NINA 1NZRA 2XXGA 2YXWA 1XB6A 1TEFA 1ET5A 2QDWA 2QDVA 1OCCB 1T5KA 2IDSA 3OQRA 5I6LA 4WTQA 1E5ZA 2BP8B 2UXTA 1ILUA 1VLXA 3S3CB 1ZIBA 3GDCA 4A2HA 1PLBA 2HLEB 2XLLA 2HRGA 1MDAA 1NWOA 1AS7A 5I26A 2VN3A 1W8EA 3U25A 4BDVA 2I7SA 1HAUA 1BXAA 4G7RB 1IBZA 9PCYA 1IKOP 4L0PB 3ZBMA 1GS8A 2Y1AA 3SBRA 3NJKA 2P80D 1A8ZA 1KCBA 1CYWA 2JFCA 3DTUB 3NYKA 2ZOOA 4W9ZA 3CDZA 3S8FB 1AZNA 3T6VA 3QJRB 5I6MA 3S8GB 2XX1A 3T6XA 1CURA 4W1TA 3RYMA 1KCWA 2NRDA 1NICA 1BXVA 2XU9A 1XB3A 2YAHA 4M4RB 1SFDA 1BQ5A 3JT2A 1L9PA 3CVDA 4N4YB 4TXVB 1AS8A 5LDUA 1HFUA 1AANA 3MX0B 4DP6X 1FFTB 3CVCA 1PZCA 1A4BA 1JZHA 5I6NA 1X9RA 2VM4A 4AKQA 1AG0A 1B3IA 1SDDB 3EHBB 2DV6A 4DP2X 2TSAA 3FS9A 2R7EA 2YAMA 4M3HA 1J5DA 1OE2A 2DYRB 2P80A 3FQ2A 3X1FA 1BYPA 1QHQA 2JXMA 3ASNB 1R1CA 1L9OA 5B3SB 3EH3B 2ZONA 3UADA 3UACA 3X2QB 4E9VA 2EINB 1J5CA 1SF3A 2GI0A 3EF4A 5B7MA 3ABMB 4DP7X 3AY2A 3CZUB 1OE1A 2FWLB 4Q8BA 1A65A 2CCWA 2VMJA 4NAJA 1J9QA 1WS7A 3CG8A 4F2EA 4JHUA 2ZXWB 1SHXA 2JKWA 1WA0X 2EIKB 3WKQA 2IWKA 2I85A 2XYBA 5B1KA 5AKRA 4FAAB 3OD3A 1AACA 3T6WA 2BZCA 3WIAA 1ADWA 2MRYA 5I5JA 1M56B 1PNCA 1NIEA 3NJJA 1WAEA 2PPAA 1JZFA 1IC0A 1L9QA 1AZUA 1W6WA 2FQEA 3QQXA 4UANA 1QLEB 3ABKB 2GB2A 3ZX1A 5I5MA 1OCZB 1NDTA 1FWXA 3ZIYA 2PPEA 3GYRA 1WS8A 2GC7C 4P5RA 2QPEB 1M9WA 1PZAA 2XV0A 3NJFA 3TA4D 1N70A 2AZUA 3D12B 1E30A 3FSAA 1ET8A 4Q89A 8PAZA 1SHWA 3ZDWA 2HX9A 4HHWA 4BK5C 1JERA 1ASOA 3ERXA 2VSKB 1BEXA 1J9SA 1MZZA 2I7OA 3PPSA 4P5SA 3DKHA 4KNTA 4UAHA 1N68A 1JXFA 2CAKA 7PAZA 1ZDQA 2YAFA 1URIA 3NJMA 1DYZA 1F56A 1NPJA 3T71A 5FC9A 4A68A 2XWZA 3X1EA 4GYBA 3OM3B 1TEGA 2XVBA 1PMYA 1QNIA 3G5WA 1WA2X 2J55A 4YSOA 5I28A 1ET7A 1KBWA 1SDDA 1KDIA 2XV2A 1JVLA 1JZEA 5B1BB 4A2GA 2UX6A 1SJMA 4A2DA 4HIPA 3FYIB 4DP1X 4ZK8A 1PNDA 3NJNA 2XV3A 3KW7A 2H47C 1NIBA 2FT6A 3WNIA 2BWDA 3IEAA 3V9CA 1NIDA 2BW5A 2CBPA 2PPFA 1BXUA 4G70B 4HALA 3L45A 4YSSA 3X1GA 4F2FA 2AFNA 3QJUB 1KBVA 2PP7A 1GR7A 2XXFA 4FA7B 2EIJB 3FU7A 3UAAA 3SQRA 3T6ZA 2IDUA 1OV8A 4GP4B 1AOZA 3AG3B 1V10A 3FQYA 1L9TA 4HAKA 5B1JA 1PZBA 3OMNB 4G71B 1PAZA 2RACA 2HZHA 4CSZA 2IH9A 3NP3A 1BAWA 5I6PA 3N55A 4YSCA 3S3BB 3IN0A 3QJSB 2PP8A 4HZ1A 1KV7A 1OOWA 2GHZA 4KO5A 2VW7A 2X87A 4G7SB 4N8UA 5A7EA 1AIZA 1CYXA 2YAEA 3QJTB 2FT8A 2ZWNA 3NSYA 1JZJA 3JTBA 3FYEB 2EILB 4HCGA 1BYOA 4NB7A 4E9RA 3V9EA 4BWTA 3EH5B 1NIAA 3QJQB 2CUAA 1AR1B 1ETJA 2R7EB 2UXFA 2BW4A 1GS7A 2Y69B 4E9SA 2HX7A 1IBYA 4PCYA 2VW4A 4KOCA 4E9QA 1PY0A 4BXSV 2PCFA 1NPNA 2GBAA 3NSCA 2B3IA 1PLCA 1AZRA 2PPDA 2Q9OA 3GXUB 2GC4C 4A66A 2IDTA 2IWEA 2HXAA 4G7QB 4BWUA 2XX0A 1J9RA 1AZCA 3CVBA 4DP4X 1SF5A 4DP5X 4AZUA 3FT0A 3H4FA 4YSPA 4A2EA 2VSMB
chains in the Genus database with same CATH superfamily
3UJIL 1JVOA 3CJJA 1UM5L 2HT2C 2BSRA 4J28A 5SWZA 4HUNB 1MI5A 5IJVB 1TQTA 2X0VA 1MJ8H 4YFLF 3PAZA 3WTTA 1VFAB 5TH2A 3WTVA 1DBML 1GW0A 3VI4F 1RUAH 1Y6KR 2DMGA 3A67L 1J8KA 4WSJA 2ZXEB 1OW0A 2Q8AH 2H5UA 3QR0A 2KZ1B 1QASA 3M17B 4H5SB 1CBJA 3BP4B 4PSPA 4ZFZB 1E65A 4NENA 2YSTA 4RGNB 5BQ7A 3ARZA 2OTUB 5J13B 3SDCA 3S8WA 3QFDB 1KTKE 3QH3A 4L9LC 3AAZA 5CZXC 3W11D 4P5TD 2VQ1B 3ZLQC 4OD3H 2NW3B 1XGZA 3AY4A 5A2AA 2NR6C 4E9LA 4GEIA 3ABGA 4HC1L 4PY7A 4BFIA 3KMDA 2EDMA 2EIMB 2ZWLT 2HVJB 1H3TA 2FEJA 3PWPE 1CBVL 2CKBB 3BUIA 2YPVL 3E8VA 2OA9A 4Y2DB 2NZ9D 3HHSA 5DZ9A 4GKSA 1JPFA 4K7FA 4QLRA 1I31A 1ASPA 5IJKC 2DQEH 4QXGL 3EGDB 3T0AA 3BPNB 2LLNA 4YSQA 1ZTXH 3UAJA 3Q6FB 3O41B 2CR3A 2NMSA 4TQ8A 3X13B 2VXSH 2BSDA 2QSQA 3UH8A 5K59F 2G60L 2XWEA 3VWKD 4NJ9L 4DP0X 5IQLA 2G9HA 5EA0H 1A6AB 4QKTA 2PWFA 3L6FB 2ICWI 4NKIL 4KZDH 3RY5A 3EXJA 4PWFA 3L3KA 4HWZA 2ARWA 2V5SA 1SOXA 2VDOL 3VI4E 3LNGA 3V4UH 3K7UA 3PXLA 1F41A 3CSYA 1V55B 2OMUA 3DTXB 3MOAL 2HRPL 1UGNA 1MH5A 2Z4TA 3BVNA 3V7AE 4B9IA 4RAUA 3VGGA 4DK6A 3QIWC 4S0SD 1BJ8A 1WSST 5E1AB 4A38A 4C8XA 2CJ3A 1KY6A 3VWKB 2UYLA 4K2UH 3N0PB 1AR1C 1LO4H 3FUKA 4QRTA 5AW1B 1AZBA 4AT6A 3CN4A 3W2DH 3MUZ1 2BP0B 4JKPH 2P3YA 5D7IE 3DBSA 3EGDA 2VXQL 3DX7B 1Y6MR 3U46A 3MRDA 4P4KA 3FRPB 1TF4A 5I1KH 1WAAE 1JHLL 4WF7A 3QNFA 1WZLA 2CKBA 2I32A 2XN9B 4HIXH 4L8CA 2FNBA 4Y16C 1F1AA 5LXGH 4MJ4A 2J7LA 3UAEA 3LYRA 4PRPB 1WLHA 2JI2A 4XXWC 3QH3B 4R7NA 2YD5A 4G6MH 4G9FE 2IWFA 4ZRGA 1V7NL 2BVOB 4FNTA 2FBOJ 3ASWA 1IM9D 1RJYB 3CDZB 3R8QA 1IKNC 4MQXD 2C7UB 2D31B 4P48A 4PGBB 2IC2A 2Z34A 1T1YB 3M17A 3CSTA 3SODB 3HN5A 1CWVA 3NGBB 4B97A 1Z9NA 3QQ4B 5DQJB 1J9TA 2EDFA 4F9PA 4O9HH 2QMJA 1KTDA 1SOSA 4LHUB 4I48B 3U2JA 3KPNB 3WHXA 5LGHH 1ECYA 1T1XB 1XR8A 1D7BA 3UBXI 5IJVA 4PJCF 1MI5B 4ELMF 5DQ9B 3WU1A 1E5YA 4CUCA 2VT0A 1RERA 3RFZA 5AAMC 4MMYA 3GK8L 1PIFA 4JO5A 4ODHH 3JZ7A 3I3BA 4YE4L 1XTLA 2GKIA 4ZAKB 2BIMA 3HS9A 2ICES 1Y1DA 3IRPX 5T3ZL 2EUZA 3FFCB 5HY9B 2QQQA 5F1SA 4CMMA 4BINA 3IKKA 4KRLB 3FUIA 4OGAC 4X7SL 4RDBA 1NFAA 1QYGH 2YD3A 3BIKA 1ZK9A 1HZLA 1L9NA 3ZDXE 4X7TA 5I1KL 4LLMB 3GSUA 3UYPA 3M88A 3PWJB 3IN2A 3B83A 2FB4H 3ZL1A 1TETL 4H1LG 2HYMA 2Y24A 1ZV2A 2VDPH 3UABA 1WVZA 5FPIA 1MPAL 3NIFE 4G9FA 3RWIA 2BPBA 3LQZA 4F37F 3ARBD 3FT4A 5EU5A 5F7HA 5TDNB 4FRWA 3ZKND 4Q74A 3ULVE 4JFUA 5IMKA 5MERB 4PJ8B 1AIFA 2AV7A 3OR6A 5C3IA 4XP5L 1YZZA 1UA6H 5I0ZA 4D9RE 1GYUA 3O8XA 3SKMB 2HTKC 4JDEB 5LWYH 1IC1A 4N86A 2OMZA 4PRHA 4HS6A 1P5UA 2COQA 4FYTA 2RHEA 2EDOA 2GJ6E 2NCEA 5TPWH 3MRRA 4UWQB 4NN7B 4X4ZA 5KVEE 4ABQA 4ZQKB 1FVDB 4V1DD 2WP3T 4EN2A 1G7LB 2A1WL 2XQYK 3IJHA 4K94C 4PMEA 5IW1B 4NNYB 3SKNB 5J9PB 3S96A 4JFEE 1HHKA 1BXAA 5AKSA 3RUGE 1RIUL 1EHLL 5CN2A 3ZBMA 4DKTA 5C0JB 3L5XH 4E41D 2KBGA 5IQ7L 2K8MA 5GJTL 1DN0B 4XH2A 3IMWA 3G04A 1Y6NR 1F4HA 3SKJL 5JQHC 1ZPLA 4FLHA 1GOGA 5AG9A 1KPUB 5DDHB 4BSVB 2G2RA 4KXDA 1L6ZA 1BBJB 1X5AA 4NKMB 5I6MA 4RZCB 4AJWA 3BE1L 5E6RB 1A6VL 1K9TA 1KCSL 2JB6A 4W1TA 2APVA 4LCIL 2ADFH 2WV3A 1NQBA 4OV5A 4OUUA 1EFXB 4P59L 1V8HA 3HPJA 3IXAB 4JGUA 2YEZA 5JQIB 1C5BH 2X2YA 3H2WA 5LDUA 1GOFA 1HSBA 1NEPA 1SDAB 3EUDA 4WZ9A 3BOVA 5AOLA 2YGPA 2B8OT 1VACB 2WJ7A 3CLFL 3MODL 1PS3A 5FKAB 5JHLA 1BA9A 4JG1L 1LQBC 5BUPA 5HHQB 3P40A 1U8IA 1U93A 4M3HA 4JPWH 3MV7B 1OP4A 1I9RH 2DICA 5CEZL 5E2VH 3UPCA 4YDKL 5L7XL 3MDJA 4OZGB 3WN5B 5KJRH 4E41A 1S9YB 5B3SB 2F1AA 1GH7A 2ROXA 4LCWA 5AVZB 4Z7VB 4HK3N 1SF3A 4L1TA 4NM8H 4QTFA 4EZJA 1G9MC 1MCOH 1N18A 5IHBA 4JRXA 4ABUA 1IZJA 5FYLE 3H53A 4HUWA 1ZV5A 3MBXL 3IF1B 1R4XA 1OQOA 2R2EA 3EJZD 3O4LB 3LNFA 2ZXWB 3IPFA 2EUVA 3VRIA 3BWSA 2IANE 3WKQA 1GGYA 4C4UA 3HW7A 4MMZB 2HKAA 3BH8A 4JHZA 4WI0A 4HUXA 1SM3H 3GXDA 3N50A 4ACTA 5BZDB 1DFBL 2FX7H 3QO1A 4AJYV 3X17A 4WEEA 3NJJA 5A2IH 4XX5A 1JZFA 3ILQD 2EYRA 4OLXH 3VFUB 3UGXA 3T3PB 5E8DL 2CHWA 1RMFL 3C5JB 3I6KB 1OCZB 5DMJB 3MMEA 4HK3J 4W6XB 1NDTA 4FMKA 2QKIC 4Y4HB 4LEBA 2AQPA 3QHZL 5IB5B 3EADA 1ZANL 5SWZD 5CCJA 4LP8A 5ACMA 5C0CA 4GW4B 5D7JD 1CLYH 1HT6A 4IDJL 3QRFM 2H1PH 2XY1A 3QAZB 5DJ8B 3ZDWA 1HHJB 4NN5C 3GTTA 2W9EL 2SODB 1JGLH 3EGXA 3LPOA 1LK3H 3FBQA 3VVWA 4XC3H 2CRZA 1U58A 5GGVY 2QELA 3Q48A 4JRXE 3PXHA 4PJFF 1DYZA 4WW2F 4BSWA 2MQCA 1WIOA 1EZVX 5I9QB 3EH1A 3RWGB 4PRIA 3TN0A 4GSRA 3NH7H 4UTBA 5I9QC 1XCXA 2DL2A 4GI6A 4A1RA 4X9YA 5JPMA 2B59A 1S7VA 3AABA 2CDGA 5DD6B 5LLIC 3GI8H 5AZEL 4JVPA 1CDJA 4HZAA 4OIBA 4PIRF 3FCGA 3O9WD 1X4YA 5D7HA 4NRXB 4TUJB 2A4EA 1ZWIA 3MRIA 4YR6A 1NH6A 4KI5E 1DANT 1DQJA 1BQHB 2DS4A 1DFBH 3VD3A 3DETC 2X9ZA 4JFPB 3WS3A 2WQSA 5AOIA 2FWOA 4HALA 4KPHH 4LE8A 1J18A 2IOOA 4HEPG 1QQDB 1BVNT 1X5LA 3RBSA 2EQDA 2F8IA 3MLYH 3U9PH 2CKNA 1A7PH 4PV8B 1HHGA 5ECJE 1HQRB 1RIVH 5KG9A 1R3IL 1VSCA 3MYJA 1ACYL 2YD7A 1UWFA 2E27L 1HKLH 4PSRA 3AUWB 3B3BA 4NM8L 1TR7A 4O02L 5EC1B 3VTTA 3WMSA 4C83B 3BCDA 4YSCA 1H19A 3N06B 3LPFA 2WXIA 4M7JL 2FYYB 2KS0A 1ADQL 4HUVB 5BZWB 4PJFB 1AIZA 1Q0EA 3BFOA 3EG9A 4DOHE 1EK3A 4JY4B 5E94A 1Z5HA 5ES4B 4ONGH 4L3EB 3VXPA 2FD6L 2ZOKA 3HS0B 2DH3A 4UM9D 1FL5B 2J71A 3EJUA 1CB4A 4Y5YA 5JORB 1OAXL 3CZEA 3CZFA 5ITFA 1KG0B 1QSFD 2XBTA 1KELL 3U79A 2EC9T 3NA9H 2LFEA 4MA8L 2F5BL 5F7DA 5CLWA 1ORQA 5DJ0A 3GBMH 4XPTL 3FUHA 1ZK5A 1RZJL 1T22B 4EE2A 4LO9A 1OAUL 1GC1H 1JK8B 3WXWH 4J4PC 1EFXA 3CFCH 1QBBA 5JOPD 5DR5H 3QULA 4JEGB 2JB6B 5GS0D 1X5JA 1E2VA 4RZCA 5EN3A 3M46A 4XRCA 2YHGA 4CVXB 2V3DA 1YQ2A 1M6OA 3VXSB 2BY2A 1TQCB 1AD0B 3ARPA 1TJMA 5TFSH 3L4WA 3S96B 2PP9A 5EUKA 3T2QA 3VFPA 1TJIL 5AAMA 3HMXL 2CO6A 1A6TA 5HI3C 3ZTJH 2X1PA 2PWHA 3L3GB 2BSTA 1UA6L 2P7TA 4IRZL 1IGYB 1J0HA 4KJPC 4APQC 5K9KB 4R7DA 3B1UA 1WTGT 4M8QB 1N9PA 4OCYH 1N4XL 2W60A 4GW5A 1DBKL 1NAKH 2P43B 2CIIA 5D4HA 2P5EA 1GJWA 1KIQA 3EFOA 1SLWA 1UD4A 2FWSA 4J2XA 1OB0A 4J39A 3LZPA 4KK6D 5DT1L 4JO2L 3RWIB 3S3DB 2NY1C 2ZYRA 4XI5C 3WXVH 1TMQA 1JV2B 2BDNH 4XAKD 1AY1L 3U0WL 3CN3A 4HUKB 4OF0A 1KBGH 2UX7A 1SN5A 4MA3B 4ERSL 1KTCA 3LXCA 3IU3B 2J57A 2QADB 2GY5A 3Q05A 4BWWA 1Z7JA 1QPXA 2O6DA 4MS8C 1CD9B 3SKOB 1N7ML 1KIUB 3ML9A 4ISVB 1AGDA 4KHTH 3OZLA 4O2EB 4AGNA 4R83A 3GS0A 4OUOA 2I9TA 3LKQB 3PHAA 3V5DB 2BNQB 1LQSR 2OTPA 4IOFC 3ENEA 4TTDD 4XNXH 4Y19E 3MA7B 4HD9A 5KYWB 1QBLL 2A4ZA 4KK5D 4R90H 2WXLA 1HHIB 3GSXA 7PCYA 5K93A 1KEGL 2X1OA 3ARED 3VFOB 1SXZA 1MNUL 4KAQL 4M00A 1OVZA 4QD2E 4KKQA 4OLXL 2FIKA 2F1EA 5KYUB 1U92A 2AQ2A 1YMHA 4KV5F 4AYGA 4GY4A 4DERA 3HZVB 4BFGA 1CG9B 2K8QA 4PJAF 4GSUA 2VJXA 1HCFX 4MAUH 4RMUA 2Y6TE 5KSBA 5FKPA 4PHXA 3SE9L 1CXIA 5AOJA 2WHVA 1E4XH 2EEDA 4EOWL 1FPTH 1NDGB 5ALBL 4EDWH 2ZNXA 2DQCL 2DQJH 1YSOA 1OPGH 3CFMA 3P1VA 1MFCL 2BC4A 3D5OF 5I76A 2EXTA 3C5ZC 4KUZH 3EYSL 4WJ5A 3LKOA 4AL8L 2HRHA 4KJYA 4ZOBA 5FLVA 2AAVA 4ZOAA 4BQBA 3KG5A 3BKYL 3CFKA 3I50L 5E99H 4OLZH 3KEDA 1AH1A 2HAZA 3D07A 4QOKE 3FBKA 3O3EA 5AEAA 2PPCA 3MHZA 1G7JB 3FU6A 3KVDD 4UDTA 1EEZB 1UJ3B 2AC0A 3D2UB 2NSMA 2XXCB 2FO1A 3BO8A 2KERA 1B3JA 2BM3A 4N25A 2VDLL 1ZOXA 2DRUA 3VXRE 1L4IA 1UOLA 3PGDB 4ZFFA 4H20L 4AQEA 2F7PA 1BECA 4FF9A 4XTRD 5FM5O 1BZQK 4ZPTB 5E1AA 2EH7H 4KJQD 4GIAA 4WHDA 2XHNA 4PS7A 4OJYA 3HVNA 4Z95L 3GSNB 1HK6A 1CT8B 4ZW6A 3DRQA 3QUHA 5DK2A 2Q2LA 3VA2C 1JD7A 3B6SB 1X9UA 4YL9A 2YMXH 4MJID 4YDVA 3RVVD 5KVFH 5EMYA 3CSYB 5AW6B 5LXVA 4R90L 3UXFA 4H1LH 1XH1A 3D25B 3LVEA 4NFBA 3ZE1E 2K6WA 3AG2B 3MNZB 4QRPA 3PLYA 3U9PL 4F24A 1IGFH 3GMNA 2JJSC 4MCZA 3ARSA 3PV6B 1KLFA 1FCCA 1JZ6A 5TF0A 3ROOB 2HG5A 4F7MB 3GSNA 3RL1A 2XA8H 3P73B 4N9OB 4NQTA 4ELMB 4N6RB 5B1JC 1DVZA 4KDWA 2B0SL 4F93B 2GUOB 1NM4A 3CHXA 2AVGA 3QSKB 3GKZA 1Z6JT 1EDHA 2VZOA 5IB2A 3IJEB 1FH5H 1U3ZA 3H54A 4ADGA 4G7VH 5ANHA 5D5MF 4DPAX 2EADA 3QHFL 3NZUA 4NPKA 1KYDA 2PF6A 4YAQA 4GQ9H 1Q72H 1KGCE 3SDXB 3TO2A 4FNQA 2E47A 2NY4C 4X6BB 4Y2DA 5HI3D 2VDML 4PV9B 4Y1AE 1AYOA 3MJGX 3MRFB 4BM7A 4HHAA 1IV8A 1RZPA 3JWOL 4K0OA 5GS0L 4ELME 4CU6A 2ZUSA 1QFWL 2ATPB 3KS0J 2Z3FA 5AVVB 1Q8MA 2VL5B 3GFUA 5EIIB 2EKJA 5D2NE 3VFVA 2ZX5A 1YCSA 1OCCB 3O11A 1EMTH 1GGIL 4HBQA 2RQEA 4MHHI 3LEYH 1BVLA 3CHQA 5I1GL 5I6LA 5FGRA 2BERA 2NXZD 4ZFGH 3BP4A 2NQCA 4NWUH 4KMQA 3T1WA 3COOA 3KCPA 4TTGA 2VN3A 2MQGA 4K07A 3TNMB 5IBLD 1BFOA 3O6KH 4M56A 1MFVA 4K23L 5LG6A 4G7RB 1J5OL 3QEQD 1IBZA 2OQJB 3ZR6A 3VFOA 4ZO6A 4G1EB 3DMMD 5D93B 5L7XH 1JPTL 3CAFA 4OI7A 3HFMH 1C5CH 1MAMH 4DUWA 1CYWA 2RJMA 3NYKA 5LVEA 1NMBL 3FH7A 3S8FB 3K6OA 5FWRA 4Q14A 5F2FA 4YJZL 1YNLH 4QHNB 4IK6A 3IMBA 3S8GB 2A38A 4TL4A 1QEWB 2XX1A 3VFSB 5IWLC 3HZKB 2SEBB 5C2BH 3MLRL 3RYMA 2WMPA 5AW5B 2WQVA 3N1MC 1VEPA 2J5LC 2YAHA 5FYKD 1DEDA 1NFIB 5C7ZA 3UO1L 4IOIB 1SFDA 2BSCA 3AC0A 4CU8A 3QORA 2OZ4H 3TO4B 2FEEI 2XIDA 1Q4NX 4G43A 3F01A 3ARUA 3DJZA 3NA4A 1BFTA 2AF2A 2D9CA 2YGVA 1OAZL 1P9MC 4JFXA 4FNUA 2OSLB 3DGGA 2TRHA 4H8UA 4EI6A 4LDLB 5L2KB 2WGNB 2W1NA 1NBYA 2KC0A 1ZVYA 4S1DD 1JXKA 1ZJAA 3LS5L 1ULVA 2ZXAA 3MR9B 1UKQA 4P46D 5JNYB 2R0ZL 2BY3A 4JHWL 4JPWL 3ZSTA 1ZHLB 2XFXB 4OCWL 4HQQL 1DUZA 4YK4C 2AJUH 4FFWC 3UACA 4LLUB 3FO0L 2QLYA 2HVBA 4YNYB 5I1JH 2LAGB 1Q0XL 1JDDA 2R9HC 4PP1D 1HILA 4R3SB 4YK4B 1OY3B 4ADJA 3II1A 4AQAA 5IR1A 3MFFA 1X5YA 2HMIC 1KUMA 1MCRA 5I82A 1C5DB 4BFRA 2X38A 4JQIA 3DJRA 3G6AA 4MXVF 5I2IB 1Y7VA 1E27A 2R0LL 5K1VA 4JVUA 3D30A 5DZJA 1TVDA 1WS7A 4OZHA 4JQIH 2DI7A 2TRYA 1KENL 1DEEA 1JI2A 3FTGB 4U4BA 4CSTA 5FM8A 1H6FA 3MRCA 3MLYL 1H5BB 4MXQD 3GSWB 2C3HA 4G8EA 2I85A 5E2TH 3TBVA 3RDJA 4JGMA 3VXSA 1EAOA 4IBUA 2NY2B 4F37K 1IGTB 1AZVA 5TDPB 1K8IA 3GC3A 1ZD6A 1A1MB 5CGTA 1FZOB 4J3OH 2VUYA 2AJVL 2ZG1A 3ZRFC 1P4UA 3GBDA 4F5CE 1JPGA 3QQXA 3ZN6A 3ES6B 1QLEB 4HWNA 4JJOA 1Q1JL 4DO4A 3TEUA 4JHBA 1ZGLA 1ML0A 3Q8AA 3UJTL 4ZNCD 3WLBA 2C3WA 1KXHA 3NSXA 6FABL 4AXWB 1PG7H 4LBAA 2BJML 4BE6A 1PZAA 5AZ2H 5ACZB 3NJFA 3DX2A 3NN8B 4PRNB 1E27B 3F05A 4NWUL 5FO8B 4ZUSB 3PPSA 3HG1E 2AXWA 3GXMA 1MHEA 2NY0B 2ZPKL 3I02A 4L29A 1IEAB 2HT4C 3MLWH 1KG0A 3VD9A 1CGTA 1TKWB 2CAKA 4HH8A 4XP1H 4F15B 4U1GB 1A1OB 4R97C 4YDJB 2WXHA 1X4ZA 4QXGH 1F56A 2ZCKH 1UASA 2Z8RA 3K6NA 2ORBH 5E94B 1C12A 4GYBA 4ZMNA 5KVDH 5KBMA 3N41F 4U6YB 2X4RB 2QPUA 4L05A 5LBSL 1ET7A 1U8LB 3BRFA 1KDIA 4P5MA 1T2XA 2D4DA 2AMUA 2IPKB 3JUYA 1YN6B 1BM3L 1FHGA 3EKCA 4JZOA 4HYTB 5D4QA 4DP1X 5A3ID 3CPLB 1YYCA 4Z7WA 3TJEL 1ADQH 4TYUA 4IOIA 1U3HA 1WBXA 4L3AA 2O5NA 4WFHE 4A04A 3QIBC 2O61A 1UA7A 2O1AA 3EUUA 4K3HA 2PPFA 4ICXA 3FUMA 3BWAB 4OKVB 4J3SA 4QTHB 5K69A 2AFNA 5C6TL 5IHUL 2AJXH 2XXFA 1GA2A 5C0NC 4JAMA 3ARFA 4YHYC 1DQQB 3EO9H 4FFTA 3UAAA 3V0VB 1GGCL 2IDUA 1OV8A 3MU3A 4J3XA 5DC4B 3WKML 4BQ6A 2Q7YB 3APNA 5DMIL 2PO6C 4OD1L 5AYQA 2B5IB 2W0FB 3S6CA 3TJHD 4X6FA 3TBWA 3FHQA 3PWNA 4U0QB 3RI5K 1PX8A 3KDPB 2ZIDA 2IBZX 4YQXL 5DD6A 5GGTA 3WFEL 2ERJB 3OAUH 4A2LA 4LVHB 3NRFA 4P2OA 3UAJC 3K71B 4C4BA 4EN3B 4OIFA 4XNYH 1CYXA 4JG1H 4U1MA 4L3ED 2YN5A 4G2AA 4E9RA 1UKTA 5DD1H 1XZ0A 1AXIB 1BOGA 1F11B 5F9WB 3F6IA 1UVQA 1UD3A 1ZMYA 4UUJB 1SLVA 1T7VA 1BAGA 2VQ4A 3QC6X 1UZ8A 1I1AA 5JW4Q 2HX7A 5EEYA 3KD4A 3T0ED 2VWEE 5IK3B 4PJIF 4ZMTA 4E9QA 2WBXA 3BAEH 2CUIA 4NYLB 3V0GA 2ZD0A 4DUVA 1PY0A 2AEPH 2Q8BL 4GW4A 5DO2C 4MZ3A 5F3BA 4NN7C 1FAIL 1X5ZA 2N3JA 2R0KL 1ETA1 1YPZB 1MFBH 3L4TA 2DBLH 2NY5L 1W80A 3PGFL 3RKDC 4IRJD 4E2OA 1QMUA 3AU1A 5AVXB 1OM3H 1IL1B 4A6YL 2HA1A 2ICWA 2LU4A 3MZGB 4OKVA 4B96A 1MCJA 3VI3B 5IHHA 1CYGA 1JPSH 2JCWA 3L2LA 4JZNA 1R75A 5F8QC 1OSEA 4BZ1L 1NKRA 4GIPD 2A9CA 3U6XA 3PWLA 3DVGB 3EJTA 1F4WH 5DMYA 3G08A 3QJHA 4WFGE 1VFOA 3CIAA 1Y1UA 1PLGH 3RFRA 1O6VA 4ODXA 4G3YL 2N59A 3VCLA 3O4LA 5DFVD 2Z7YA 4L37B 2ESVA 4YHLL 3BKCH 4P5MB 4X6DE 1W8OA 1HOCA 1LO2L 1JZGA 3FB8B 4JRXB 3MQIA 5HJDA 4YHIB 4GQPH 1CVRA 3WMPA 5L8KB 4XXDB 4NFDA 3FQNA 1GTFA 4Z7VA 3FPXA 4H44C 5ESAB 3WFDH 4KOBA 3VH8B 2JIXD 1DFXA 3NFNB 3C09C 5JPNC 1TZAA 3PDOB 3K2KA 4HUCA 4IRSA 3BQUC 1ES0B 4AI7A 3BPOC 2E9GA 2VSDA 1MOEA 1XIWB 3D2UA 1AKJA 1NBQA 4FLSA 1BG1A 4ODTH 5MI0B 3LN4B 1AQKL 5SWSA 3KGTA 5EN2B 1HSBB 1MXDA 2OX5A 5T1MB 4DGIH 1GGCH 1MCSA 5E6IB 2N7BA 3ZKXB 4YE4H 3UBXB 5D96B 1QA9A 3Q5TA 3VXME 1Q9KA 2OI9B 1FLTX 4GRLC 5J5EA 2ZCLL 1P6WA 4XODA 5ABZA 1CN4A 3B7SA 5D1XA 4EKJA 1NDGA 2A6IB 3BAKA 1KPUA 5DDHA 4BSVA 3O4LE 2HWZH 5DXWA 2NDGA 1TQUA 2Q76A 2BHYA 2H0PA 4Y4FB 7CGTA 5AAWA 4XH2B 1MVYA 2V9RA 3GSWA 4LCCB 4LLAA 2LABA 2NXZC 5CD3B 2NZ9C 2J1ZA 1LE9B 4OIIL 3PCYA 4ZMPA 4L4TD 3ARDC 4N0CD 3TX4A 4OZHB 4WNJA 4HBCH 5GRXG 3MVSA 1N64H 1LDPL 1C5DA 2BHFA 5AW9B 1FVEB 1CL7I 4RFEB 1MG2C 4IM8A 4TPRH 4TUOA 5MEQA 1KIPB 1JZ3A 1S9XA 2GEQA 4X0KB 2D3LA 4F9LC 4D2NA 4QGYA 3V5DA 1E0OB 4MLIA 3LKQA 4U1LB 5TK2A 4NHCH 4DEUA 1RZKL 2GAZA 3GLDA 3TYFA 3WN6A 1DDHB 1TPXB 3GI9H 4HKZB 4ZTEA 4RX4D 3SKOA 1B0IA 4POZD 5SWSE 5JLZA 2W07B 5DJCA 1T21A 3WCYA 3LQZB 4RAVB 4PU2A 1XGTA 2QQNL 4R9HA 4HKXB 3OLDA 5E1IA 3KPRA 1YLBB 3QXDA 4LSTL 4MA3A 1WP6A 4PJ8D 4X5QA 5EU4A 2AW2A 5I6KA 5D5MB 3C60B 1VJSA 1RD6A 1CICC 1KTRL 3QEQB 5IOPB 2M26A 1NCBL 4KK9C 1E4WL 2R15A 5AWNH 2W07A 2MCAA 1IX2A 4HJSA 3DDGA 2NUPA 2Q7AA 1JGEA 3UTQA 2IAAC 3FFCA 5HY9A 4GP8B 4YGVA 2E9WA 1P9MA 2I60L 4WEBL 2AGJH 2B16A 3B1TA 3MTRA 2F53B 3MRBA 4AV4A 5ESVA 2P7TB 1H0DA 1K3IA 4HCFA 5GPRA 2DJ4A 3IJSB 1XGRA 3SZ6A 4U1JB 3GNML 4RCAA 5AVRB 4NEHB 5FOBB 4TNVF 5C0GA 4G1EA 2ESVD 5KVEL 5F88A 1YDPA 4J12A 5JUEL 3TEZA 2Y2WA 5KVFL 1FZMB 5FHBL 1OWWA 5BV7H 3QJOA 4P2QB 5PCYA 1RP9A 2GG1A 3CUPA 2R4RL 3OGCB 3PL6D 1TU2A 1QTYT 3QNYB 2VDQL 2C7UA 2D31A 3TBBA 3PXJA 1VF5C 4NHCL 3TO4C 3TWCL 4OM0H 1KB5H 3QCVL 2OYMA 4RGNC 4ES8A 3NIFB 1F45A 1FG9C 2EDLA 3T3MB 3VFVB 2ZX7A 1VEMA 1YY9C 3EOTL 1G6RA 1FIGL 1J1PL 3HE6C 5EO9A 2ATPA 3BAYA 3L95B 5AKTA 1ZAGA 1ASQA 3V6FA 3QXAB 1ODUA 2A99A 5HJ3A 1C08B 3I9IA 4FP8L 4EN3C 1JGIA 2MKLC 3V4PL 1R5WA 2PTUA 4G59C 4DQOL 1Q0YH 3FT3B 2QQNH 3BUYA 1T04B 3LN4A 3WNJA 2OCJA 2CMRH 4YAQB 1UURA 4CVUA 1M71A 1E6OL 5DHVB 1MCFA 4PCKA 1DJHA 5LB1A 2CG9X 2QQLL 3CZFB 3LH8A 5GQBA 2H26B 2O5YH 3ETSA 4BZ1A 1TJXA 1UQSB 4L3EA 5J06A 1MI5E 4MCMA 3WUWG 3GGWB 1G1YA 5C70A 5ESQB 3GZKA 5IQ7H 4PJAB 3IJ9A 4YIQB 5IM7A 3RY6A 3ZKMD 2XLLA 1KLFB 4YHIA 2WLKA 3QXUA 1KCVL 1TJGL 4TRPL 3FRUB 3V95A 3VB9A 3ZHFA 4LLWA 1S78D 4G6KL 1OO2A 2J6EL 3SDDC 4YHML 3L17A 3O4OC 4U6HA 3CZJA 4KKCC 3MCG1 2AJVH 4AIOA 5DVKA 2I5YH 2W9LA 3BVTA 5E2WL 3IDIB 4HWBA 4XNYL 1S5HB 4PV8A 5DK2B 4PJBE 2JFCA 4KY2A 3IYLW 3NCBB 3SD5A 2G9HB 1YYML 4ZPTA 2K6ZA 2EUWA 5LG1A 2WVUA 2GK0A 3BPLB 3AXLA 2LAAA 4IBQA 4KH9A 3T6XA 2CO7B 1R3IH 5H2BB 2DLFL 3AU1B 3EYUL 1HXKA 4WU5B 4YDLC 1NBVH 2W91A 3RPIB 1QSZA 2B2XL 3SDXE 1R3KB 1T5XB 2F7IA 2H6PB 5F89B 4N0CC 4BQCA 4RAHA 4J3UA 1U9KA 2EIBA 1G7JA 3BKYH 4UDTB 2MNUA 5JOPE 2G5BA 1MQ8A 4MD0B 4AKQA 3MGAA 1RLBA 4TKWA 3RTQC 2JKTM 1XF5A 4HH9A 4LLVB 3ULVF 2RALA 4XBPA 4XO9A 3TN0B 1H9VA 2XPGA 3OKOA 1NANH 2G3MA 4HFWA 4WUUE 3UP1A 4LGRB 4Q9RH 1DN2A 1YEWA 3FCTA 3ZE1B 4NENB 5BZZA 4EN3A 4TSAL 2VZ1A 3BP5B 3D9AL 5DMKB 4JQVA 1OSPL 4N0YL 2V6HA 4AV5A 5CN3A 2CO4A 1CE6A 2JSFA 4KHXH 2CCWA 2VMJA 1Z66A 2MOQA 4FCAA 4I0PC 2VC2H 4IRSD 5JMRA 3O3DA 3MCLH 1MUJA 4Y4HA 1PPIA 2IWKA 1ZLUK 1P5VB 3QR2A 3L54A 1J0YA 3DK2A 3PL6A 4Y4KD 5GZOD 3MSPA 3ARFB 1U8CB 2UY6B 3PP4L 1JUFB 2W9DL 3P4NB 4R96A 4KDTA 5D7IA 1PNCA 4POZC 4C56A 4S1RL 2KUTA 3DNKA 4ETYA 4QOKB 2GB2A 2DQFB 4LKXA 1CFVH 2YIHA 4NFCA 1MVUB 3UIYA 3I9AA 3EDEA 1PYWA 4YHOH 1WFIA 3CX2A 1HSAB 2E7MA 3TT3H 4G7VL 2UUDH 2HKHH 3VXUA 4MAYA 1Q9OA 1N70A 2C4FU 3S0PA 3BH4A 3F7LA 1OGPA 4P9ML 3FAXA 4ELDA 1RFDH 1FUNA 2EXYC 3AM8A 4UU9A 4WUUA 3BP7B 3VXNB 1J8RA 3A6CL 1NAKL 3N1PC 2I7OA 3K4DA 3VG9B 5AB2A 1DVTA 4JO8A 3GRWH 2CIIB 4HEME 1NM9A 1QI4A 5LDSA 4JFWA 1Z5YD 4OZGA 2P45B 3WN5A 1E28B 4P23A 3OKLA 4TSBH 5E4OA 2Z7ZA 4NNPH 1PX4A 5KSAC 1IGYA 1LO0L 4J4PD 3NZHH 5FFLA 1GCYA 2FATH 1U93B 3HR5A 1Z3RA 2ID5A 4L29B 5HHQA 4FE9A 5E4EC 2G3NA 4WWNA 4K5PA 1FJ1A 2XV2A 1JVLA 1JZEA 3T0XA 3HG2A 5C0RH 1GL4B 4Y19B 2CDEA 1JPSL 3IDMB 4I0CC 5E9DE 1MY5A 2MJWA 4KY1L 3MLUL 4UB0L 4AXWA 4BZ1H 2Q87A 3FYIB 3QYMA 4P0DA 2G0LA 2IOIA 1LWJA 2Z91B 1X7TA 5FCSH 1ZLSL 4Z78A 1ACZA 2FBJH 1JIBA 4FG4A 4WI4A 1F42A 4WKZA 5EO1A 3QJUB 3UROR 4UYQA 4P2OD 5GRJL 3RIFF 2QGDA 4LMQI 5CEXA 3GBEA 3B9KA 1CGWA 1AHWA 4G8EB 4NLHA 1H5BA 2Z91A 1L9TA 1GC1C 4JN1L 5F71A 3NVQA 5DJ0B 3EBAA 3WE6B 2X6CA 3STZA 5IQNA 3OKYA 4HEMA 3GRBA 5CSBA 3U0TA 5D2LF 1BAWA 3WD5L 1I3RA 1G1OA 3U7YL 2PP8A 5C08B 3WIFB 3A24A 2D2OA 2X87A 3GMMA 3SY6A 2FT8A 3AU0A 3LS5H 1JNLL 3UIZA 5GGSA 4KFMA 1T7ZA 2Y22A 1CPUA 3A6BL 1B4RA 3TIDA 2GT9B 4UOW1 2YXMA 3WEMA 3FQXA 2ZXQA 4NRZA 1KEGH 4F2ME 4HD5A 1Y0LB 2UWEF 3IWVA 4L9LA 4ETQA 2X6VA 1RZGA 1IBFA 3QNXA 1JNJA 4EI6B 5JZ7D 2FATL 3QUGA 2OMYB 1DVFA 2VAAB 2X9XA 3ILQC 3PIQB 4HPYH 4PW4A 4RWYH 4K9EL 3V0JA 2VIRB 1JZ7A 1KCSH 3CDFA 4OIAA 5KG9B 3VXUB 4H8WH 1DLFH 2NY0D 4P46B 1HHGB 4BFFA 3QORB 3FQWB 2H0JA 2IPTL 5KBDA 3T0EC 1RUML 2VLJD 1KLGB 3BIKB 1YECH 2IDTA 2FX7L 4G8GD 2Y1VA 4FQLH 4ZSOB 5K9QG 4KXBA 5E4AA 3FHAA 4QRQB 5TQ0L 4JFPA 1DZBA 3CVBA 5E8EB 2UY6A 2FSEB 4BUQA 2YPLA 3H4FA 3T77A 4A2EA 1DQJB 2EDWA 4ZG1A 4F7KA 4DUXA 5JXAH 1IM3B 3MV9E 2WOBA 4JVWA 4IMLA 3ULUH 3IE9A 4X0NA 1A7NL 1QG3A 3O3BA 1LO0H 2BVPB 2PW2A 3WHXB 2XICA 2PO6A 4I48A 5E0FA 1D5IL 3BVDB 4OH2A 4UTAL 5C3LD 5B38A 1C8QA 3KLHD 5GRUH 5HHMD 2B3RA 3AITA 4E41E 1G7PA 5DMKA 3IB4A 3P9MA 3RVTC 2CO3A 2VLRE 3P54A 1JNLH 1HI6A 4WU7A 4HGMA 4Z9KB 4NDMA 3A4DA 3EH4B 4JM2B 4GAJH 4BZ2L 2CJSA 2RCSH 3JWOH 3QEUA 1ZA6A 4D8OA 3P2DA 4X6EA 3MRQA 1FRGL 4PRPA 2NDFA 4GKNB 2R1WB 4ALAC 3BZFA 2IANA 5IROC 5HD8D 2ZWZA 3G3LA 4YSDA 3MRFA 5AZEH 1R34A 4YSEA 1H3XA 4Z76A 2UZIL 2G5BB 3UTSB 2WVTA 3QEGL 4I3RH 3ZTDC 4XOAA 2DQDL 3P0GB 4N3UA 4JN2B 4M8UA 2HUHA 3G7TA 4AYEC 1HQ4B 1CLCA 4C58B 4R2GC 3ZKNC 4XNUL 5F7BA 3QQNA 5C0DA 4QY8B 4WU5A 3X14A 2F8XC 3WBDA 2B08A 5I75C 4OF6A 4D94A 5CU9A 3AXLB 2ZCLH 1HESA 2PNDA 3B2UC 2VE6A 2VC2L 3MV9A 3QUMB 5DVMA 2DAVA 3X3FL 5IUCA 1KCRH 1O7DC 5CEZD 5LBVA 2FQDA 3HFML 3FOLB 4U2YA 3VFWA 2ARJB 3HC0B 4XP9L 5GGQH 4E36A 2A74A 3BUDA 5AL8A 3BEVB 2DQTH 2XWXA 3D3VB 3DTXA 3LIUA 5D7JA 1Q0XH 5EG6C 4OFKA 2HTKD 4M7ZC 1XQ4A 4A7VA 1OPGL 1FFRA 1MCWM 4NT6B 5E6IC 3WKPA 4E0RA 1XWVA 4BDVB 4XR8C 3NH7L 4NXSA 1FL3A 4EOWH 4JG0H 1AP2A 4MQ7B 4P05A 3L3KB 2OCCB 4KO6A 4RDQF 1PIGA 3TBYA 2LR4A 2PXYC 3DRQB 2GJRA 1M05B 1EMTL 2A73B 4JM0A 1KJVB 2BRRH 3CDCA 3OSKA 2ZX9A 1EAPB 5BO0D 2DMCA 4JREB 3CVHL 3WEBA 2WUCL 1MEXH 3QP3A 3QDGA 4BKLB 1A3ZA 1SHSA 1ZVSA 2AJZA 4B3VA 4K71B 4ACPA 1VACA 2ZJSH 2GBUA 3L9BA 3QPQC 3D3VE 3K1KC 4GXFA 4I77H 4HOMA 1UXWA 3FO0H 1RHFA 1NTDA 1WWBX 2ADFL 1IGML 2DYPA 1A8JH 1XH0A 3KPSE 4OGXH 1U8HA 4QKXB 3GMRA 4QRRE 5I8EB 1CC3A 3LH2L 3GSOA 3U4AA 4DN3L 2J8OA 4R0LC 4XNUH 1E4WH 1NFKA 4J3BA 2HMID 3RWFB 1ZS2A 1GMIA 3FAWA 1OGSA 3SDCB 3C9NA 2VLMD 4YUEH 2R69H 2K4WA 4AKPA 3QZWG 4GUOA 4H2AA 1NCGA 1EANA 3VX1A 4CMHB 3CLFH 3SDAA 4TOYL 3KPSD 4D3CH 5IV2B 3VFGL 3M45A 1YJDC 4R4FL 5KJ7E 4Y2OA 3F00A 5INCA 3VSVA 3WIHA 4ADIA 2H9GB 1N3NA 1NJ9B 1SBSL 4OD2A 5G5DB 5BO1L 4ZX4A 2H1LM 2EE2A 1I7RB 2VKXA 2AXGB 4W9GC 1BFVL 5I5IA 4MYPA 2A73A 1OCRB 5BRZA 4YS4A 2Z65C 2BSRB 1XR9B 1XGRB 2IOMA 3W9EB 1FL3B 2W9EH 2DM7A 1RJLB 3I74A 2F74B 1XMEB 2BNQA 2G30A 3MRBB 2X2JA 3CBKB 5CHNA 3TBCA 4EBQH 1MCPL 1QWNA 3WI9A 1E8WA 2VDMH 4QHPA 1JGEB 1AIFB 3UTQB 1RH8A 3NJIA 3CQQA 1N8ZA 3U7YH 5JHLL 3IVKA 1R5IA 2CUHA 5J0BA 2NY6B 5J7CC 4NP9A 3FT4B 3B2VL 2Z8WC 4PV1C 4NGHL 5JDJA 1KPRA 4HJ0D 4IEFA 4MFHA 4PJDA 3WJMB 4I77L 1Z0NA 3P3YA 4J23A 1M57B 4MX7A 5ALCL 5E8DH 5LNEA 3SYQA 5IJKA 3F58L 3MV9B 3IWUA 1KJMB 5F6HJ 3RZCA 4CNIA 5BQDA 3VDCA 3CFBA 5IW6B 4ZXBD 3MBEA 5B4MD 2DD8L 3X14B 1M9SA 4HWBH 1H6EA 4Y2LA 4YZFE 4YXLL 2Y2TA 5CEZE 3FO9B 5BOZG 1MY7A 3UZVB 4JM2D 4CMMB 1Q94A 2IIJA 5DCCA 3PWPD 2VDKL 2Y25A 1NL0L 4GKZB 1MRFL 4P2QE 4FNSA 4NQCD 2AXJA 4P3CH 3U7WH 1Q1PA 3A3YB 3GXNA 3Q13A 3RFZB 2P42B 2HRGA 1PZ5A 1UM5H 3M7FB 4LB8A 4ONFL 4Y9CA 12E8L 3S98A 3BJLA 2KMWA 3MC0A 1HKFA 3SE8L 5EUKB 1UB5B 1XR8B 1S4IA 3K8LA 2J2ZA 4GIOA 3MNWB 5JDSA 2GJ6B 3F6LA 4NDMB 5HGBA 1I7RA 1UXLA 4PRAB 2DQHL 4ZBJA 1GS8A 3QT2A 4ZZFA 4Y2OB 4TL5A 3SBRA 3OHMB 4FFYA 4HGWA 4NSKB 2EDJA 4PGBA 1HIMH 4L0ZA 2G60H 5AD0A 1L0QA 2IBZY 2XWJB 3O6FC 1LNUB 4FHBD 3GHBH 4JPQA 4PJBF 5TF1L 4LSUL 1MCWW 4GQZA 3O3BB 4YFDB 2DEXX 4P2RD 3WSQL 3AT0A 3LXAA 2NY7H 5HP5A 5AUMB 2VOTA 3DVFA 5F7LB 4P57A 43C9B 1TSHA 1MFDH 2JJSA 1BM7A 2E7LA 2MNWA 1T1WB 1A14L 3REWA 3UYRH 5I1CL 1T22A 1B9ZA 1A4KA 1FIEA 4IIZA 2DYPB 4N4YB 4P5TC 5E8EA 4TXVB 4QRQA 5E6IA 3WKYA 2NYKA 5I8OH 5C0AB 3CHRA 1SVBA 5SWSB 3EZ8A 4HZLB 3HPLA 3VFGH 3GBNH 4ZMAT 3TYGH 1B3IA 4KXZI 1P4LA 3EHBB 5KJ4A 4J5VA 3S36H 5JR1H 4XXWA 4N2BA 4K8RD 1HXMB 5DS8B 3N1FC 1KJ3L 4QHUA 5I71B 1RQ5A 5FGCE 5LCVA 1FG2A 2XC8A 4U6XA 2BP5M 3FCBA 2WTOA 1LTXA 3VH8A 1A3LH 3EH3B 4HGKC 5GRWA 3SGDI 1KMGA 3DX6B 5IESH 5IHZB 2ZKYA 4MB5A 2GI0A 1YY9D 4DP7X 2ADIB 1Z3GH 4RZKA 3OXRB 5ICXA 4UV4L 3BDYL 3Q8FA 1T3FA 1WV7T 5I1EH 3ARBB 1E5CA 4Y16B 1WA0X 1EAJA 4V2BA 5GIRA 2NXZB 4UT6L 3NIFF 1FFPB 3BWZA 2YPLD 3PWLB 4KU1A 3VFWB 4LSRH 1UXMA 4PRDB 1HYSD 2BFVH 3HMWL 2ZAHA 3STZB 3IU4L 2VDLB 2VE6B 3BKCL 4AK1A 1IC0A 2FQEA 3WS3B 3WKNA 5C0BD 5KUKA 1VAHA 1DBJL 4XO3A 1INQB 4DW2H 4MZ2A 1U91B 2Z4QB 3VRLF 1SMAA 5B39B 4YXHL 1QFWI 1Z5LA 1FGNL 4OGZA 1KJ2H 4TNWK 5I0XA 2GC7C 2KPWA 4LZKA 3RRQA 4K94L 4MNGA 1JAEA 3T65B 4F7CA 1DSWA 1WO2A 4XB8A 2YC1A 4B7LA 3ZKMC 4Y2NA 5IK3A 3MRPA 1OM3L 4BK5C 1F58L 1XH3B 1BEXA 3LD8C 5GS0C 1I3GH 4X6EB 1TTFA 4I85A 3HMXH 3MAWA 1BVNP 3I9PA 5AW0B 1KCLA 4NKOB 1FNHA 1OAQL 4X6DB 4I8DA 4F58L 2W38A 4S1SL 4U0RB 2W0KA 3BLPX 1HXYB 3OC8A 4U0RC 3BKJH 3KBEA 5FW6A 3QCUL 32C2B 3L3JB 5E0QA 5I74C 3Q6GL 4HDIA 4QRSB 3FK3A 3MX0A 3TCLB 2FZ3A 3HOGA 1QATA 4A2DA 3ZT6A 4FXTA 3B9KD 3ZZ1A 4P5TA 1J7VR 3NJNA 3WNMA 4UU9B 4WUUB 4UM9A 3T2LA 2FX9H 2X4SB 1JGUH 2FSEA 3K81A 4KTGA 3IEAA 3U82B 5JXEA 2F58L 3F12B 3TYGL 3KYNB 4HIXL 3W38A 5IIEB 2ZP9A 3DOIA 5ID0A 1OTUD 2GIYA 1KBVA 1PJ9A 1GR7A 1DQMH 5GS0H 4ANUA 3QS3A 3QB7C 4HUXB 2DQUH 4AYDC 5F93C 1MRDL 1R33A 3CPLA 2UUDK 1V10A 1D5RA 1MW3A 25C8L 4R5TA 3BEWA 5CGBA 2YO3A 3IKCA 1ZA3B 1YN6A 2H0FA 2RACA 4L8SC 3DLQR 3HLKA 5IFHH 1DVFB 2VAAA 2H2SD 3NCMA 2IH9A 3F7RA 5KOVC 2I9LA 4BH7A 1M1XA 3NMEA 3S3BB 4PB0H 1PEWA 3QJSB 1P5VA 4HZ1A 3VNZA 5IW3A 3DIDA 3HAEG 3WFBL 3D06A 4N8UA 3C5ZA 3NUKA 1Q38A 1KB5A 2MTPA 3TCLA 4E41B 4GO9A 1XEDA 2CLRA 3OJDA 2VDQH 1A1OA 4GI8A 5JW4R 4MVBC 1GGTA 2IJ0C 2VLKA 2YMOA 3IDGA 1QR1A 1UUSA 4A6YA 3WIFA 1D6EB 1MAJA 5C08A 4AMXA 1UGKA 1L7TH 1E42A 1EERB 1N26A 5TD4A 3BZDA 4EI5B 5KYYB 2IAND 1C8PA 4R7VA 4BXSV 3WTUA 3DECA 2PYFA 4O58L 3L81A 5DMGC 4PJAE 2XQYA 5AVUB 5FA3A 3QFJA 2VITA 4PJGF 5IB4A 1IVTA 2JJVA 1AZRA 2WQ8A 3OB8A 4UQ3A 1RZKH 2F58H 2VXUL 3ES6A 3PQYD 4WUUD 5DFAA 4XN9A 4A66A 2MFNA 2AJSH 1CF1A 2CM5A 4ZNEE 4U7SA 5BV7C 3HRZC 5GSRA 3PJSA 1DQVA 1M7DA 1NGPL 5BV7B 5BXFB 5EEWA 1MFUA 4AM0A 3TBVB 1INQA 4UMSA 5KVFE 4HK0A 1CFVL 5FW7A 3DA0A 4OFDA 3TU6A 4R7LA 2OJEA 3D52A 4MAYC 3UFIA 2YPKA 4YLQT 3IJHB 4MQTB 1G7LA 3ESNA 1RKRA 1I7UB 2FJHB 2X2HA 2X4PB 2Y1YA 4M48H 4QWWC 5DEJA 3KJ6H 4XB7A 1QRND 4YBLB 4NM4H 4K71C 4GBXC 5HDQL 4YX2H 3O9WB 5C08E 4MA1C 3O3UN 2EE9A 1ZHLA 2XFXA 4HIEB 5ICXB 3FONA 3WNNA 2BNUB 5DLLA 2MTAA 3CFTA 4PJ8A 4DQOH 4JMXA 1GHFL 4PCSA 3HEIB 3IJ7A 4QTIL 4G5AA 3BDXA 3P77B 3KPPA 5L2KA 1U8NB 4GT0A 4X9FA 3D39E 2WBJA 1AQDA 5BVJA 1PJWA 1SGKA 2X4UB 4NI3A 4Y5YC 5IOKA 1QWUA 4NQSB 5FYKU 2R69L 3PWJA 2YAPA 3RX9A 4X7TB 2Z31A 4FZ8H 1HZKA 1SOQA 2F53E 4UT6A 1AGFA 3H9HB 1NUNB 4M93C 3HPLB 4HZLA 1PKOA 2WLJA 5C0EB 1HHHA 3PP3H 4OM1L 2EH8H 3DOSA 1FNGA 2Z0BA 4QHNA 1QZNA 1KYOK 2VERA 4RSYA 2WVVA 3UZEA 1RUAL 5E9DB 4AOFA 2R4SH 4JM4H 5D5ME 1T1WA 4H88H 3REWB 3PL6B 3I75A 4P57B 4ZMYA 3V4VH 1KBGL 4ERSH 1B2WH 3FTUA 4WI7A 1AQKH 2QKSA 3UX9B 4M5ZL 5CP3H 1T1XA 5T3ZD 1AS6A 1NAMH 3JVFC 4BK8A 2DLHA 4PGEB 4EPSA 4X7FC 3CSBA 1EEUA 2OTWB 3JWDC 4JRYD 4A7UA 5HD8C 2QZQA 3BKMH 4PD4J 4D7BA 4LVHC 2BOBB 3P4LA 4HX1B 3QZWA 5JIIA 3F8UB 1FLRL 1JRHI 2C9VA 3WN5C 1GSMA 1K3ZA 1MFEL 3HB3B 5C7XL 3CFJB 4H2CA 3Q2WA 1TJGH 2ADGA 3VG9C 4PBDA 5CBEB 2CK2A 2GTZA 1Z3GL 5FDYA 5L4IA 4CU7A 1AAJA 4GXUN 3RUGA 3BVUA 3KPQA 4EZMA 3EDJA 4MD0A 3CMOH 4OB5H 4K7PH 4LAQL 5C09E 3M8OH 5HHMB 3FRPA 3ARGD 3PP3K 3WJJA 1SUHA 2IH1B 1RUPH 4J4PA 3EJZC 4Y89A 1W72A 4L2LA 4LIQH 3ZRCC 4CGUB 1TZOA 2DQCH 2DQJL 4WHTB 1F4YL 3K72A 1O9WA 4ZO8A 4YZFF 1E67A 3NJLA 5ICZB 3AUVA 4YFLI 4A6YH 4A67A 1KJMA 4FL4B 3D48R 2CWRA 3AG4B 4DKEL 4HXAH 4QRRB 1XV8A 1KBPA 4IEFB 4QAMB 1T0MA 5C07B 1YEGL 5DJCB 4I89A 5TDOB 1R5IB 1FCGA 1S5HA 3BVVA 4HC1H 3MJWA 3IDIA 1ZT4B 4KKBD 5JLZB 1DTUA 4P59H 3O2DL 4Z0XA 2JJTC 1DDHA 3L13A 4U6HB 3U4EA 3WGVB 1JOIA 2H41A 3HFFA 4HS8L 5CM1A 4RMSA 4UV7L 2WZPA 4B50A 3CFUA 4I4WA 1F2XK 5CS7A 1T89A 4K3GA 1BIIB 1FPTL 3HG0A 4HWZB 1EHAA 3DUHA 4Y4FD 3FTSA 4M43L 4H8HA 3BSZL 2R59A 2YFOA 2VDKH 2GIMA 3GKWL 3O45A 3QDMD 3PRZA 4DGUA 1A6AA 2I60H 4WEBH 1CDUA 4W9EC 1A9EB 1E6JL 4P04A 3K5RA 3LN5A 5FFGA 1T0NB 3JV4A 4Y1AB 1KGIA 2A7BA 4J7RA 3X13A 4IBZA 3ECWA 2WXNA 3MRLB 3QG7L 4ZUVB 2L7EA 3T0EA 1TZHB 3A47A 4BXVA 3B2XA 5TJWK 3KPMA 1E9OA 1KXTB 5AW8B 3SGDH 3V4UL 1EEZA 3ZE2F 4JRWA 3EBHA 4K7FB 2V7NB 1AYRA 2HCZX 3C9NB 2VR4A 4GEJA 5GXBB 2QT6A 3CHPA 2O4EA 3BSGA 4NIYE 4XCEB 4Z3FA 3GSOB 3CFKB 2E56A 1LGVA 3QXAA 5IMMA 1BPVA 1DSFL 3U6RB 1NINA 1PW3A 2XXGA 2GFBA 4WJ5B 5L8LB 4OM0L 2H8PB 4W70A 3D85A 1RHHA 1QNZH 2E7HA 3HB3D 1HS6A 1U6AH 5AB1A 2MEJB 2ZPKH 5L4JA 1KXTA 2QQKL 5LGHL 1F3JB 2YD6A 3GSNL 1VCBC 5E2WH 4A7SA 1SJHA 5T1DL 1DJIA 1OZTG 2ESVE 4G8IA 4A2HA 3MRLA 2IGFH 3PDOA 4NZTL 3U25A 3CD4A 2X42A 1INDH 2NLJB 2J73A 1EO8H 3ARFD 3OKEA 4LF3B 4CC0A 1GJUA 5F88B 1UM4L 4NKDB 5CD5D 4PD4K 4QJ3B 3ZTJG 4XXDA 1B2YA 4WWID 3TBYB 2Y1AA 2WZ0A 4MQ7A 4BBWA 1V7NH 1OP5K 4ZMZA 1RUQH 4PTTA 3HRZA 1LEGB 4XC3L 1EA9C 2ZKMX 5F9OH 4ODXB 5JXED 4FJZA 4WWKD 4FGMA 4PYGA 4ZOEA 4MXQC 3TOPA 3F84A 4B9PA 3FB7B 4XE5B 3BX7C 1BXVA 2C3XA 4GSXA 4K3JH 5CJQL 4M4RB 2XTLA 3JT2A 4QHLA 4OAWA 1DBMH 1J86A 4XBGA 2CRYA 3C60A 3VXMA 3DIFA 3BIAX 4URKA 1S9KC 4KQ4L 4YBQD 1JN6A 4FFZH 4HKXA 2Y2YA 1M2VB 3IFOA 5H94A 3VI3F 5ISZB 2DV6A 3CV5A 4PP2B 2EO1A 2Y3AA 4FDWA 3IAPA 2CNZA 4NO0D 2XTJC 2AEWA 1VDGA 2IBBA 3V10A 5G4NA 2Y07H 2NY5H 5HYSB 2X40A 2XACC 3BPCB 1N67A 1OE2A 1UWYA 2DQGH 3HNSH 3MI6A 4QWWD 2DPKA 1E90A 3OWEA 3LKSA 1QI3A 3B4NA 2BSTB 4NXKA 1OAZH 2E9IA 5DWUL 1ZA6B 2H1XA 5DZPA 4U4IA 2D7QA 4I18A 3TH2T 3MREA 4MD5A 3QPXL 1XZ0B 5JUEH 4R97B 1IJNA 2Y7QB 3M1BA 3EF7A 3VMNA 2CU9A 4JHUA 4F2MB 2DTMH 2VR6A 4B7IA 4PBVC 1OKEA 2QLVB 4FQCL 1S9VB 4M7LH 2ZSWA 1IFRA 2Q76B 4Y4FA 3C6SA 3B34A 3VD5A 4PBWD 2O26U 4IHOA 4MJJA 2VWEC 4ZTOL 3O6MH 2A6IA 3C2AH 4HSAC 2ETWA 5IJBC 4H8PA 3QUYA 1RK0A 4K3EL 2WLHA 1IM3A 3VDAA 1Q9KB 5CCHE 3KGSA 3ML8A 3MNDA 5F0MB 5DK3A 5E5MB 4JAMB 1F3RB 1BGXH 1UENA 3QIUC 4HCRL 4UQDA 1Z2KA 5HHXH 2ZUUA 2WVVB 4WSGA 3RPKA 1CD8A 4GG6A 5D1QD 4QI3A 3H42L 1VCAA 3B7YA 5C0EA 3CU1A 3D12B 5F9DC 1M7IB 4HFUL 4XMKL 5GRVL 2YJQA 1S8DB 1U3HB 1WBXB 2V17H 1ES0A 4KI5F 8PAZA 3ARYA 4GAJL 5E6SB 2DI9A 4W9FC 2JWYA 1DQML 3RWCB 3TBSA 4BZ2H 1XF3A 4QNPE 4NPYA 4JZOB 3FFCD 4ZUUA 4ALAH 1CXKA 4Z23A 1JD9A 3S35X 2E8ZA 4NUGL 2IPKA 2JF1A 4IBTA 3VXPB 3PIQA 2X4UA 1NMAL 3T71A 1RJZA 3GF8A 2XWZA 1NGXB 3TEWA 2OS7A 1RZGB 4PJFA 4L9LB 1S2EA 4HULB 3R1GL 2J3SA 2J55A 4K8RL 2WYTA 3OAYK 1QFPA 2UY7A 3CZSA 3BKJL 5CKGA 2C8NA 3RI5F 2NSXA 3WIIL 4Y5XB 4M02A 5I17A 4IBWA 2LVEA 5EIVA 3SE8H 3S5ZA 1WZKA 3GRGA 5BS0B 3O3AB 2BVUA 1OLZA 3A4EA 4LLDB 2VDQB 3GXPA 4M5SA 4NBYB 4R4NC 4N90E 1PNDA 1TYEB 5CCKL 2X4PA 2YD0A 1W91A 4LQ1A 1GGIH 1XGQB 3L5HA 5IEHB 2OMBA 4XCNA 1J1OL 2XKUA 5KEZA 4ZUTB 3EDKA 4N24A 2GTQA 3DO7B 2YRPA 5CR8A 2X41A 1QWHA 2JKSA 4IDJH 4TS6A 3UG4A 5ISZE 3SPCA 3WLBB 5JOEA 2CXGA 3UMNA 5L88H 1YEJH 1MPAH 1SLXA 5AW3B 2Q10A 1AOZA 3VMPA 4IU2B 3SQOL 3QXWA 5HSFA 3JXAA 3NEXA 4XGZA 2XQYG 2HKFH 4F15C 1PAZA 1WD9A 3PDDA 1F4XL 1SXAA 5DT1H 5IVOA 3HHRB 1UJ3C 2A9DA 5E9AA 5ELIA 4L3EE 2D3NA 5IB4B 3IFNH 1SXNA 3QFJB 4ZJ9A 5LUMA 4JK0D 3D4YA 1SY6A 2CDEB 3FUFA 2C5DC 4HCGA 2I5YL 3U4KA 1KEML 2X1XR 4N9GB 3EDFA 5DHDA 2P47B 4LQFL 5SX4I 4U1MB 3C8DA 4FC3E 2RIKA 5FECA 4K9EH 4JO3L 1UWGL 4W9LC 2ITEA 2DQTL 3EGXB 4CDGC 5IR1B 5JA9A 4AQAB 5L2KD 2CBQA 2E7BA 3OF6D 1FO0A 2ZUXA 3BMVA 1G0XA 4PJXA 2AQSA 2P46B 3SYCA 1DUZB 1NCIA 1WT5A 4KOCA 3ZE0F 3V0HA 4WTZA 1YEFL 4UT9H 3SGJA 1G1CA 3BAIA 5AW7B 1P84J 2A9NH 4D3CL 1F97A 1AFVH 1A6VH 5CZVH 1H6UA 1E43A 4KTDH 4LL9A 3TS8A 1NCDL 2GSGB 3KLSA 1F1DA 3JWDL 4Z5RB 1JN6B 1XIWC 2X6UA 3QG6A 4PY8J 1CLOH 2EYRB 4WHYG 5LGKA 4G7QB 3P30H 2WKGA 1MQKH 4LOFA 1JWMB 2Y5TA 1TJHL 4ZFOA 1CF8H 4ZX3A 3G6DH 1AZCA 1NGYB 4G43B 1SF5A 1YEIH 3SOBH 4KUCD 3E8UH 3U36B 4PGDA 5DK0A 1A6WL 4PLKC 4QOKA 3O6FB 5AAWC 3R7QA 4Z7WB 1IO4C 1FHNA 4BZ2A 1ZT7A 3VQ2C 4DTGL 1R3JA 2VMFA 2X12A 2B1HL 4KRPC 1KF9B 1FNSL 3FFDA 3NRQA 2WZ6A 4KJPD 3QZOA 1X7SA 4MSWA 5I1IL 3HE7B 5L6YH 4W9IC 1U8LA 5F7AA 4P5TB 2WN2A 1DBBL 4PJCA 4YSAA 1BLNB 3FO1A 3FSZA 1RZ8B 5C9JA 2HVKB 3WFHB 4H25A 4HJ0C 2Z7UA 4HF5H 4OW6A 1BFOB 2MOVA 2NLJA 2WAHA 1M42A 3H3PH 2HTLD 1NAMB 3EJSA 3I02B 2EDQA 1EPFA 3LQAC 3WEAA 4O02H 4NZFA 1CICA 3BQUD 3SBPA 2UWEA 4GS7B 1BQKA 1B4JH 3D0LB 4LSPL 4XC1L 3ISRA 1XH2A 4HFWB 1EHNA 2D7TL 4DGWC 4DKEH 4Y9FA 2EXSA 5T1LB 3ARDD 1SHMA 2YEZB 4ZUWB 4XBPB 1XH3A 4P9HL 4G8FA 1IAOA 3QDGD 5IMMB 4IU3A 4NI6A 4OV5B 1MCPH 2QSCH 3TFBA 3F6JA 3T2PA 4X4YA 4F7CB 2JCCA 1MREH 1GS6X 1IIIA 5KOMC 3WIHH 4XPFL 4IU2A 4K7PL 2GSIA 1N6UA 2AXFA 2F54B 3QIBA 4W6YB 4BGLA 4GRLD 3RPIA 1PVHA 3PUUA 4W9DC 3C2SA 4ODVH 2K3HA 3KHOA 5CUSH 1MCOL 1JRHL 2ZAGA 4LSSH 3QHFH 3VGBA 3EBGA 2ZUTA 2BJMH 3BD4A 1LK2A 3QJVB 4I2XA 3LN5B 3RVWC 1TQWA 3DO3A 2RTTA 4ELMA 1E50A 3SKNA 5IW1A 1L0YA 2C3GA 4KITB 4XMVA 1R9FA 2A9MH 3FUDA 2HG5B 3Q1EA 4NAMA 4OZGE 3FHEA 4XPBH 5J57B 2OJ1A 4A7GA 4N2IA 3Q1SL 3MNZA 4QRPB 3HG1B 1T3FB 4H13C 3RAJL 3U4EB 1LLAA 2J5WA 4Y2DC 3IBOA 1YMMD 2JJWA 3L9YA 3ARTA 3MLWL 3PJNA 4N2DA 3FRUA 3OR6B 4Z77B 5FO7A 1RURL 4ZOCA 3MUY1 4PRBA 1ZT4A 3V0EA 2XTJD 4XPAL 2XA3A 3KWXA 1J0ZA 3FU8A 5GGRY 5ESQA 2IAMB 3DX6A 2AQ3A 1YYLL 1OSPH 5E56A 1UKSA 3V4VB 2OSLA 3S3JA 1ZANH 4LDEB 3NAAH 4HV8A 4YVUA 4MJIE 4ZODA 5IESL 3RQ3A 4E9WA 5E95B 3VGAB 2CHZA 1IBHA 1XF3B 4LLYB 4KV5E 1HWGB 3BGFC 4W9HC 3IGFA 4FZEL 1F4YH 3R06A 4JB9H 5CILL 1NMBH 1WZ1L 1O7SA 3NCEB 3FN0H 3FT3A 2HJLB 1L7IH 3EOYG 3NSDA 3Q8EA 4MJ2A 4U1NB 4CSPA 3T6QC 1II4E 1BEYL 3HB3C 3QEQE 4AH2B 1WFMA 5HJ3B 2IO5A 3TZVD 3W39B 4KJYB 4WFFD 3FU3A 3THMH 1D3CA 3CZNA 4PW3A 5IJDC 1G6RB 4H1LA 3WS6C 1QKZL 5B3NA 4Z8FL 5EC2A 4E5XG 4YEFA 4TNVK 4Z7QF 3M86A 4WVRA 4NC1C 4DVRL 1EJOH 5CR1A 3E6HB 2VDNB 4O02A 1BVKA 2JCCF 2QFPA 3FQUB 1OAXH 3FRPG 3HJEA 2VLLA 5A2LH 3TIEA 3HZVA 4NN5B 3WUWB 4M43H 4FLOA 3ZPDA 3O2VH 1RJYA 4ODWA 2EVIA 3SE6A 3NCCB 3LPWA 4Y1AD 1UB5A 2IPUK 4WI3A 4Q9BA 4R7NB 1KJ2B 2QTEA 1CCZA 5FOBA 4Z0BH 5IZ7A 5EIIA 4YHNA 1MNUH 4KAQH 2YZ1A 2DF3A 2Z1PA 1BZ9B 1OM9A 1V3LA 3AY4C 3GB7A 4OZHE 4AUYA 2E27H 2Z9TA 2RFXA 2WP3O 5FUCE 4DCQA 1L3NA 1AJ7H 4EDXB 5C8JA 3R18A 1L9RA 4GRWF 1UHVA 5HYSA 3VXSE 2AQ1A 3IBEA 2F54E 2BFGA 5GJSL 4H8QA 3AMLA 1EVUA 3X1BA 2QL1A 4AGMA 3MUHL 1BZ7A 3JV6B 1BCIA 2DBLL 3PGFH 5H94B 2QR0B 3IU3A 3IAGC 3N44B 2XZQH 4CNIB 3VXMB 2OBGA 3V2AR 2ZKWA 1QEXA 4MX7B 4WENB 3WJMA 1CQKA 3OJVC 5EDXA 3V4VA 2IAMD 4QHLB 5E6ID 3BQUB 3OL2A 1VFUA 3KPPB 4U6VH 1SZNA 3H7BB 1N6QL 3S5YA 4IJ3B 1MDAA 1D7CA 1ZVNA 5KSAA 4WFFE 7FABH 3KEHA 3FONB 1QBMH 3BW9B 4AYFB 2VLRA 3T0BA 1HAUA 1D5ZB 3L4CA 2H4EA 3ZYIA 3VDBA 4PTTB 4OCXL 5DD5H 1FRGH 3TJHC 2D7MA 1KB5L 2YA2A 5L8JB 2VJ8A 4Z7OE 2OJZL 3S2AA 3V9FA 1Z9OA 5IP4A 1KXQE 4IKNA 1WGVA 3U7AA 1AMXA 3HI6L 2DMBA 3WJLC 3T09A 4Y7MA 3PGDA 1PY9A 4N0UA 3TH4T 4AEHH 2FL5B 4DWHA 4ZFFB 3A4AA 2Z1KA 3Q6FA 1JZ2A 2BP3A 1OAYL 3GLAA 4PJ9A 1U3HC 3QC5X 3FN3A 1R24A 1U8QB 4UQ2A 3DHUA 3V0FA 2MKWA 4DGVL 5IROD 4LNRB 2DKUA 2XTJE 3BLBA 2VO5A 4MDRA 4Z7WE 5CN1A 5HGDA 1YQVL 4M3JA 1R5VA 4LSQL 4AJ0A 5IHLB 1UZ6F 1DQIA 2V3EA 4Z7NB 1NEZB 3VI3E 4BGDA 1HL4A 2FWUA 3PHSA 4FEIA 5E4EB 1DBKH 3AAZB 1SOKA 2DMKA 1OAUH 5EN2A 5T1MA 2P80A 1UFGA 1TPXC 3RWHA 5KYYA 3ZTCC 1F6AA 1QHQA 4LL1A 3ZW3A 1A6UH 4K23H 2FO4A 1E7UA 1CGXA 3D1MC 3KS0H 2VQUA 1J5OH 5JPMC 2GBTA 5JHAA 2WZPD 1RSYA 1JZ5A 2DWYA 3ABZA 1UT9A 3VD7A 4Q6IB 4J3WA 4R26L 3NPSC 1U92B 2CHXA 1HC1A 5DRWB 4EUPG 2YQ2A 1IM3D 3NPSB 4H25B 4YHKH 5K39B 1EJ6A 1SQ2N 3MGTB 5H35A 4Y1SA 3GSXB 1SN0A 4DH2A 1P7QA 3E9TA 3QE5A 1MFCH 4JUTA 5FV1L 1KTLA 1AQHA 4RFNB 5DA0B 5B1KA 5AKRA 4Q9RL 4PP1C 3QDGE 4JFSA 3HI1B 3OKDB 4JPKH 1K5WA 4JHAH 1R3JB 1A6ZB 1HQRA 3F04A 5EU6E 1OHZA 3I3EA 3KLAA 3HC0A 3B2DC 1GZPA 3RTQB 4B9KC 4X5WA 5ENWA 4U31A 3UJIH 3KPSA 4LSPH 4XC1H 4NQQA 2EAEA 4JZNB 3PV7A 2CLVA 3ZTNL 2KL6A 4TVPH 3QQ9D 1RPKA 4LCWD 1JV2A 4GKOA 5KN5B 1ET8A 2NNRA 3EJQA 3MJ7B 5LAXA 1BQHA 4PJ7F 4YLBA 3IDUA 1MLCA 1ZWIB 3MRIB 3PWUA 3EFOB 1KIQB 1MREL 1N68A 3S35H 1AZZC 2D3VA 3LKPA 2X4TA 2H2SC 4P4KC 1E4XL 1M7XA 5IQ9A 1JPST 1PKQA 2W60B 4HMEA 4NYLA 3TBTB 5J13C 4Z76B 4M8QA 1D5IH 4HDIB 4QRSA 2C9QA 5FC9A 3V0DA 4UTAH 1WFNA 4L1SA 4RGMB 4RWYL 3OM3B 1HXYA 3L5XL 3GUTA 4UUJA 3HTLX 3MRQB 4GUPA 4QT5B 3VFPB 1SDDA 4AQ1A 4M6AA 4S11A 4NKOA 4MJ6A 3Q3GA 3LZFH 1U58B 1AHKA 4A2GA 2DDQL 5IBLC 2BOBA 5FYJL 5GGUB 1AO7E 4Z7VE 3E8UL 4JHWH 4I0PD 4IRSC 1AD0A 4P2OB 3LAFA 3MA9H 2B15A 4NUJA 4UOQA 4PGEA 4L9DA 3WNIA 3VWJD 4XP5H 1QAWA 1GOHA 2XYCA 3FQ4A 3GPSA 2JB5L 5FGCB 1J1OH 3SGEI 1LEKB 5IFHL 2W0FA 1O6TA 1FFOA 4TQEH 1Z5LB 4AL8C 5IBTH 25C8H 1A7RH 4N2FA 2A9NL 3RVVC 2JTYA 1X9LA 4Q56A 1DQQA 1U4FA 2RA1A 1MCBA 5DVNA 1D9KD 5AENA 5BZXA 4GBXB 2GCYB 5B8CA 3VGHA 1ZLVK 4B41A 2MWCA 4HMCA 3BHBB 4ZUTA 3QO1B 4GXVH 4HC1A 2O61B 4MS6A 1F00I 2R2CA 1XGQA 2CGYA 2XZZA 4XVJH 5E2VL 4M9OA 4NQCE 2WYZA 1KJ3H 3HBGA 1AXTL 1G9HA 2XNAA 2BVEA 1KB9J 4N1CA 4UIKH 4Y5YB 5JORA 1D5MB 1MWAL 2VIRA 3ULVL 1ZRUA 4LRIC 1GZHA 3NQIA 3W9DA 3SGKA 1EGJL 1RUPL 4XWGL 4HUWB 1MLBA 2P5WE 3O6KL 1ETJA 3EG9B 4NQEB 5MEND 3GZPA 2EACA 4MRCA 4U6YA 3GXTA 5CZXD 5JIQA 2VZ3A 1FNFA 1NGXA 4WW1A 4F7PA 4HJ1A 1E4KC 1U8JB 5AZ2L 2DN7A 3GMLA 4XP6H 4C4KT 4F8QA 5CZKA 1MW1A 2VRAA 2GBAA 4QHUB 2VN6A 5HI4D 5JO5A 4NPYB 1NGPH 3PGCB 3QDAA 5DJAA 2NNAB 3IFPA 2VR5A 1I3RB 2HUEA 4R5XA 4ZUSA 4QEGA 5AQ0A 2GC4C 1J05B 3DUSA 2YR3A 3FH5A 4JFZH 1WFTA 3MO1B 4NQED 5F44A 3L5WB 2GCYA 4OGXL 3F7YB 1ZHNB 3MNVA 4DO6A 3B9KC 3JV0A 3B2VH 2WO2B 4UM8A 2ZQKA 1UB6A 4PPTA 5AOZA 4ENZA 4L4VD 1FH5L 1RK0B 1WWWX 3AT8A 1UYWL 1MAKA 2E59A 2B2XH 3ATEA 5CXPA 3MROA 4OCSL 1AMYA 4LPXA 2O5XH 1A7PL 3HE7C 4UQEA 2QHRL 1OAYH 1S7VB 2YBGA 4NSKA 1K4DA 3KW8A 1NIFA 2CJTA 3FFCE 2W0PA 1UH4A 4KJWD 3OXSB 1DBBH 1OZUA 2ZOTA 3JWNG 3T3MF 2WBKA 1MWAA 3LQMA 5K59E 4POYA 3DJSA 5ILTH 4F9PC 1RUQL 3MREB 3RTQD 1ZSHA 1FVDA 5D7LA 5DEZA 1NCAH 3DX4A 2R29A 3AS0A 5E2JA 2K70A 3O2DH 1S6NA 3IDGB 2IMNA 2VLKB 1OALA 4UF7C 4B27A 5EF3A 4HS6B 3AWEA 4ONFH 4QMEA 5DJZA 3OKLB 5J12B 2CLRB 3H6JA 3OJDB 5EUOA 1PKQB 2J43A 2VDOH 4RIRA 1Q94B 4X8JB 2WIMA 1KCKA 5GS3A 2OP4H 5B8CC 3BZEA 1NCHA 2GJ6D 4OLUH 2FGZA 2MNJB 4LCIH 3B2MA 1M2VA 1U95A 3HE6A 4PUBL 5C3TA 5D2NB 5IW6A 1Q9OB 3MLXH 2WQUA 4NIKB 3LEXB 5IFJA 3RGHA 3IPEA 5BZDA 1ZTXL 4WNQA 3G6JA 3KPSB 3IPBA 4G1MB 3IMTA 2XN9E 1O9ZA 1GZPB 1REIA 2L7UA 4WI0B 4GLRH 4MS8D 5DVOA 4OI8A 3ARVA 1DE4B 4R0LB 5I0DA 3VRIB 2AI0H 1GVIA 4ILDA 1QEWA 3KPTA 3VFSA 2CJUL 3LKRB 3UZQA 1FIGH 1CIDA 1ORSB 1WJ3A 3HI1A 4ZAKA 2YAOA 1U8CA 4AQ1C 4MMYB 3A22A 4FFVC 5DEFA 1JNHB 3O3DB 5KVGL 3CFNA 4Y0GA 3W0WD 3FN0L 4DT2A 1FZKA 3MRHA 4DPCX 2N1TE 3MOAH 2HJFA 3N43F 3MGOB 1KTDB 2A0LC 4FX5A 2DH2A 4QLWA 1OTSD 4X7CC 2H9GA 4NBXB 4HHGA 2ZKHL 3UJJH 2R4RH 5KANG 4GNKB 5INCB 5EBWB 4MA8H 4KQ4H 3QARA 4Y9BA 1UC6A 1L0PA 3QRLA 4Y7OC 4YHLH 3FCTB 2OYKA 3SDAB 3H1ZA 3OG6B 2JKRM 1K2DB 3O2WH 3ZDXF 3PG2A 2FJSA 5DD3H 4CGTA 1KV3A 3VGAC 3UGEA 4JANA 4XMZA 3QFGA 2GFBB 2VCOA 3ASOB 4DK5A 2J1YA 2L7JA 3L1OH 3U1SL 4EF3A 4X8CA 3U6RA 3KPOA 4Y5VA 2Y72A 1R5VB 2AJYL 2DWSA 2K6YA 3RFZC 1OB1A 4Y5XC 5HHOD 2FGWL 3GZOA 3HG5A 3VXRB 1GSKA 2D7NA 3OHXB 3T8MA 5CEZH 3ULSA 3HUJE 1JDCA 1EO7A 1V7MH 4P5KB 4ZFOL 3MRDB 4ELKA 2A77H 1ZXKA 1F13A 1H8NA 4PBXA 2PWEA 3DRTA 3S97C 5JIMA 3S36L 1K5NA 2ZWKA 3E1F1 1TZHA 4OJCA 5DUBA 2ODIA 5F0LB 5D1ZI 5HHME 4CC4A 2IVFC 2CO7A 5L4MA 4LAQH 3PWPB 2F0CA 1H15A 3MRKA 2ATKB 1T0NA 3JV4B 4HIQA 3BAJA 4KFZC 3LSOA 4N6RA 2BIHA 1RU9H 4M6NL 3MV9D 4AYBA 5CLXA 1L3WA 3IDXH 3KJ4C 1OOAA 2NSQA 3WY2A 5E00B 4GW1A 1I82A 1JZIA 4L5FE 4N8VB 4E0RB 4WGKA 4JDTL 4KK9D 2VLRB 1JPTH 4G8GE 3APDA 4HFUH 1FP5A 4JUSA 1GY1A 4LLWB 1KLUB 4UTBL