1GSUA

An avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS-MU GLUTATHIONE S-TRANSFERASE
publication title The three-dimensional structure of an avian class-mu glutathione S-transferase, cGSTM1-1 at 1.94 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Detoxification enzyme
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gsuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gsuA01
2NDOA 1GTUA 3APOA 1U3AA 3D4TA 4MABA 1W89A 5DBQA 2PVQA 3ZMKA 2R37A 4N11A 2DJJA 3GUSA 3GURA 3QFBC 3CXGA 1UVZA 4ECJA 3QFAC 2HI7A 4ZIJA 3F8UA 3UOMA 2GZYA 5B8BA 1MD4A 4MA9A 1V9WA 3QPMA 4HDEA 4AF2A 5ID2A 2VD1A 3DMLA 1O73A 5LNKe 3P90A 2K8VA 2H1DA 2ZNMA 2FNOA 2V1MA 3UIWA 2VLVA 4E8EA 2L6DA 5ECMB 2VLUA 5C00A 3QAWA 4EE0A 1U88A 2DJ2A 2HRAA 3KEBA 2L5LA 3F4TA 1QK8A 1VF3A 5J4UA 2PGTA 2IJYA 3ZRDA 5KEJA 1J0FA 3DIEA 4XHMA 2LEGA 1K0MA 3ERGA 1PMTA 3CBUA 3ZFLA 1FOVA 1K0NA 1N8JA 1GTAA 2XPDA 1G0TA 4BVXB 4IW9A 1ACVA 1S3DA 3MNGA 2RLIA 22GSA 2QKEA 5A4VA 5J41A 4HQSA 3ZVJA 4PGTA 5C04A 4XS6A 4ZB8A 4K7OA 1V58A 3L78A 1QFNA 4EUYA 1GSYA 5DQYA 5G31A 2CX3A 4GSTA 4OCFA 1Y6EA 1AW9A 3J7Yk 2CVDA 4LL4B 2H70A 1QQ2A 6GSTA 4KW6A 5D96A 1GTBA 5IMFA 3FZ9A 4ZL8A 1BYEA 4RI7A 4IELA 1GSEA 1XZOA 1ZYQB 4O7HA 1TOFA 2H0GA 1EOHA 3IA1A 4LMWA 3VWWA 3KM6A 1G6YA 1XWAA 2ES7A 1HYUA 4L0UA 2CAIA 2AYTA 3D6IA 1O8WA 2ON7A 3CSIA 4PQIA 3H93A 2VAFA 5A4UA 4OFTA 2O7KA 2FWHA 1HNCA 1O8XA 1SJ6A 3V1WA 3KH9A 1WRYA 3RAZA 2ZUPA 4OO4A 1GWCA 2LS5A 1ERUA 1TP9A 1WJKA 1GL8A 4EKZA 1BQ7A 5B7CA 3GSSA 2OA7A 3PINA 3I43A 3TRPA 1XCCA 16GSA 4NAXA 3FRCA 1M2AA 3DWVA 4PTSA 3TKRA 1CQGA 3C73A 2H6YA 3TB2A 2DMMA 3HY2A 2HSYA 1TTZA 2DJ1A 2YP6A 4G10A 1XXUA 5KN0A 5CO3A 4J57E 1B4PA 3ZIJA 3F63A 1O7UA 1XOBA 3G7JA 4MJAA 5IQYA 3C1SA 3D21A 1YF1A 2C3QA 3PPUA 4K2DA 4TRXA 4L5LA 2TIRA 1PD21 1PL2A 4I97A 3TGZA 3FZ5A 2H1BA 2L6CA 5DJLA 3R3EA 5IO2A 2M80A 1R5AA 4IHUA 2IIYA 5FHIA 2WULA 4DSSA 2RM5A 3HYPA 3NZNA 2CT6A 1TRWA 2K8SA 4OFMA 4XS4B 3TRQA 1FVKA 1GSQA 1QUWA 1FHEA 4RQXA 1M99A 4MPFA 3QD9A 1T7PB 1EV4A 4NPBA 3WGDA 1TI1A 1X9SB 3ZITA 2VUPA 5DAKA 1GNEA 4KSOA 2WGRA 2B7JA 3ZMLA 2OADA 2HRKA 3LGCA 1USBA 3TJKA 1J9BA 2LRCA 5G30A 2ON5A 5AGYA 2UZ8A 4OFNA 4F2IA 2PMTA 3C8EA 3GKKA 6GSUA 1YY7A 3E9JB 1NSWA 3A3TA 2K9FA 4J56E 1YJ6A 4NWYA 4FH8A 1XWKA 1E6BA 1PA3A 3VWUA 4BWSA 1GSSA 3CTFA 4EF0A 4WKWA 1MTCA 2VCWA 2RUFA 4O92A 5HR1A 6GSSA 4POBA 1A0FA 1EEJA 4O5RA 4F9ZA 3GX8A 2R2JA 2CAQA 1WE0A 3VURA 4V1Ag 1F9MA 2FD3A 2C4JA 2RM6A 1T1VA 5JCUA 4KUNA 3L9VA 3FY7A 2DBCA 4OWYA 3EVIA 1SK2A 2L4QA 2H30A 5B6MA 2N5FA 1Z9HA 1A24A 1CQHA 2CV4A 2VIMA 4EXJA 3E3EA 4KH7A 3W6GA 2LJKA 4ULXA 1ERTA 2C1YA 4O32A 2F3MA 1YF0A 5IMAA 2GSTA 1Z6MA 3L9SA 4GQFA 1GNWA 4MJEA 3KIJA 1TRSA 3U5RE 1HNAA 3MDKA 4HU9A 3K8NA 3FYGA 4K9ZA 5IOWA 2AV4A 3KP9A 5LCZA 4NHWA 4H86A 3EMXA 5ECIB 4N10A 5L71A 1O6JA 3Q19A 4TR1B 2R3XA 1TU7A 4USSA 2GT6A 1SD8A 2VL3A 2M72A 2OE0A 1AQWA 5G1KA 5A4WA 4AJ6A 3ZL5A 5F05A 3LFLA 1K0BA 1TJDA 3IDVA 1ON4A 4HOJA 2Z9SA 2IFQA 3KD0A 3FR6A 2MYGA 5CAXA 5G1LA 2VLTA 1DE2A 4POLA 1GP1A 4HEA2 1EZKA 5ECRB 2YV9A 3KCMA 1Z7PA 4EVMA 4ML1A 3CSJA 1ZYEA 4PX1A 4V2MA 5H5RA 1K0CA 1C72A 2DJKA 4MH2A 5DCHA 2PWJA 4WEYA 4TN8A 1ILOA 4KX4A 2H76A 4ZB9A 3KZQA 2FCHA 1EWXA 6GSXA 2X8CA 3F4SA 2E2MA 1NHYA 2JADA 1XPVA 4K7IA 3UJ1A 2YCDA 1T3BA 4RUVA 1SKSB 5ABRA 3APSA 1K0AA 4YAPA 4XCSA 4GTUA 2AUVA 1O81A 3RDWA 4WR5A 5DALA 5EL8A 2GVPA 4HU7A 2MBSA 5EPFA 3GKNA 2HRFA 3ME8A 1F2EA 2YANA 4MZBA 3HJMA 3RHCA 1GSFA 1SKWB 1TRVA 4ZL7A 4GWRA 4L0WA 2LSTA 3R2QA 1SYXA 3ZLPA 5IPGA 2R4VA 2O8VB 2OE1A 4I2TA 4IVFA 3RPNA 1TW9A 2H0HA 4AJ8A 5E4WA 4KSMA 4I8BA 1KBNA 2C0EA 3KP8A 3VPTA 3QAVA 4BVYB 4WETA 3WD6A 4BL7B 1GLQA 1G7EA 3ED3A 2GGTA 3UVTA 3APQA 4KGIA 1SU9A 1PSQA 10GSA 4GLTA 2GSSA 4YQMA 2JACA 5E59A 4BVXA 2H6ZA 4OCEA 1AIUA 5JWOB 1SK0A 2DJ0A 2YJ7A 5HR3A 4L8EA 2HT9A 3DGQA 2LQQA 3ISOA 3HHVA 3I9V2 3KMOA 5F06A 4FYCA 4MF7A 1WIKA 2VL2A 2O85A 4KE3A 2HSNB 2WRTA 2HYXA 5ECHB 1RK4A 3WYWA 4GRFA 2VCVA 1TI3A 3A2WA 2BJXA 4TXOA 2G0FA 4ACSA 3JCML 5FT3A 1SYRA 3IHQA 1U87A 1NM3A 1X5DA 4HJ2A 3TKSA 3HKRA 4X0XA 3DXBA 3UEMA 4I2UA 2DJ3A 4TOPA 3TJBA 4XS1A 3MSZA 4KAEA 5D73A 5IPHA 4YQVA 2JU5A 4GQCA 3FKFA 5G2ZA 3M9JA 1JLVA 2B3SA 5INYA 1Q98A 4EDYA 3IR4A 3HA9A 4NV5A 5CRDA 3VWVA 2F51A 5CYYA 3ZIVA 2HFDA 3FW2A 3L4NA 5IIZA 2CA8A 3RHBA 4IP6A 1SKRB 2XBIA 2IMKA 3UL3A 5G5EA 1NHOA 5ECNB 4N0VA 2I1UA 1OE8A 3LYKA 4TVEA 2B5EA 1GUKA 2B5YA 4V2NA 2YOIA 2DIYA 1M2BA 1A2LA 1UN2A 3DVWA 3QR6A 13GSA 1V40A 1QMVA 2I9HA 4GXZA 2HLSA 3IRAA 1MDKA 1OC3A 1VGLA 1KNGA 1F3AA 3G9BA 4FQUA 1FG4A 1YDKA 2LJRA 5IMCA 3QCPA 1EOGA 3GKMA 4MJBA 3DEXA 4WBRD 2I3YA 1VF4A 17GSA 2HRNA 1YZXA 1LJRA 1A2MA 1JZWA 4ECBA 3HZ8A 2J9HA 4HS1A 5ELGA 2HXKA 4MMMA 1B8XA 5AN1A 1GUMA 4FYUA 4G0IA 2V41A 4HZ2A 2ALBA 2R6KA 4KDYA 5F0GA 2JL4A 4I5QA 2JSYA 5IMDA 5IMZA 1GUHA 2KP2A 4EC0A 3CTGA 5HFKA 3PH9A 2RIIA 3FZAA 1H4OA 1S3AA 3MAKA 1XBSA 3UBLA 3LXZA 2QC7A 1XWCA 2LTKA 2JZSA 2GTUA 11GSA 2NVLA 3EWLA 2F8FA 2CZ2A 1PX6A 1OKTA 2DLXA 2GT5A 4KF9A 3KH7A 4MCUA 5J3RA 1TK8B 2OJLA 5CRHA 2OKAA 3WT1A 3C7MA 3CRUA 2H72A 3GFKA 4PURA 2HZEA 3DRNA 4KDUA 3O3TA 2FLSA 4ECIA 5H5QA 1XW6A 3M0FA 2EIOA 3DVXA 2NPBA 3IK7A 1AQVA 1MEKA 4QL9A 1OKDA 2WZ9A 3EC3A 5GAND 3HVXA 2K18A 1V57A 1Q4JA 2PN8A 2WS2A 2H71A 2H19A 2LQOA 3GRXA 2KUCA 2A4VA 4IJ3A 4DEJA 4Z7XA 4IQAA 4D73A 2VO4A 3TRXA 4X43A 3VLNA 5D9TA 4AGSA 3GIXA 3G7IA 4G19A 2MMZA 3VI7A 4PNGA 2HQTA 4K8MA 5AISA 4MPGA 3TCOA 5B6NA 1WP0A 2QSIA 4WBJA 2AJQB 1ML6A 3GX0A 5F07A 3ZTLA 1I5GA 3IOSA 4V1Ap 2YWNA 4TR4A 2KHPA 4L5OA 3CYNA 1RQMA 2C0FA 2E0QA 3GYKA 4ZXGA 4EL1A 2PPTA 4K1FA 2B1LA 3BCIA 4V2LA 3M3MA 5BMUA 5JWRB 2GZZA 2MBTA 18GSA 2PERA 1EV9A 2MMOA 4DSSB 4CW9A 1B9YC 3E0UA 1GTIA 5J9CA 2C3TA 2YWOA 2WB9A 5ECSA 2NTOA 2IL3A 2HE3A 2ZCTA 1QXHA 2A2SA 2GDRA 3AY8A 5DAKB 4XIHA 4GSNA 5J9BA 2XHFA 3UVHA 1T00A 1EP7A 2HRKB 2REMA 3H8QA 4JR6A 2KOKA 3F6FA 4NHZA 2H6XA 1HNBA 2HNLA 1XW5A 1ZOFA 1AAZA 1Y25A 4F03A 5B8AA 1A2JA 2DIZA 2KLXA 2X8GA 2YWMA 4YH2A 1A8YA 5D93A 2C80A 1K3YA 1EP8A 1X9WB 1THOA 4JR4A 1I9DA 3IC8A 1NW2A 3D5JA 1TKDB 3WGEA 3SWLA 2JSZA 4TR1A 3GL5A 4MH3A 4FO5A 2BMXA 1YEXA 2GQLA 5CRGA 2HSMA 4Q5RA 2L59A 1M9AA 2WFCA 1ZMAA 2N5AA 4ZB6A 3VI5A 2BTOT 3F4RA 1JZRA 1R26A 1BX9A 1K3OA 3F3RA 5LD0A 2CX4A 2GZPA 4TR3A 4WR4A 2GQKA 1YKAA 3GTUB 6GSVA 4MF5A 4JU5A 4HZ4A 3GSTA 1A23A 2WJUA 1M2DA 5A5KA 1EEMA 3EU3A 2AHEA 3NIVA 4QQ7A 3PR8A 1GULA 5HR0A 2I81A 3GMFA 1S3CA 2VCXA 3BCKA 1XVWA 5IO0A 3FEUA 2YZHA 4HJMA 4G0LA 1ZCPA 1T4ZA 3LSZA 4XTSA 1GRXA 2JZTA 3KMNA 14GSA 3HDCA 2FA4A 2CQ9A 1VRSD 2B6MA 3EE2A 1ZGNA 2CVBA 2EIRA 5JCGA 5G5FA 3IC4A 3TOTA 3Q74A 4ECCA 5KN3A 5GSTA 1DE1A 4JEDA 2YJHA 4IBPA 1LU4A 3M1GA 4IP1A 4MF6A 4PUAA 1PL1A 1ZZYA 2XBQA 3M9KA 5KN1A 20GSA 1JLWA 1B9XC 2GQMA 3GTUA 1F37A 1EGRA 1Z7RA 2GLRA 2IN3A 1OC9A 3LQ7A 1R4WA 3A2VA 5ECQB 4POMA 3EURA 3FZ4A 1B4QA 2GSRA 4MDCA 5CP1A 1EGOA 2OBIA 4HI7A 5DVBA 4ZBDA 3D4MA 3BD2A 2LRNA 1XWBA 3HCZA 1GSDA 9GSSA 4ZL9A 4BVYA 3IAM2 3EU4A 3GN3A 2OE3A 1Z5YE 2L4CA 3PGTA 2H01A 1JZDA 2MMAA 3KXOA 1MD3A 2H8LA 1SD9A 2YZUA 1FW1A 1RW1A 1WOUA 1ST9A 2X99A 1SL2B 3IBHA 2H1GA 1XIYA 4GCIA 2V6OA 2IWTA 3BOAA 1GSUA 5DJMA 2MZCA 3W8SA 1JFUA 1THXA 2V2GA 5HQPA 6GSYA 2P31A 3QAGA 3H79A 3LEFA 5DCGA 2PU9C 3TJFA 3IE3A 3IPZA 1WMJA 2FWGA 2HSHA 2AAWA 1BG5A 3KGKA 4KA0A 2WDUA 1ERWA 5GZZB 2K6VA 4ZILA 3WT2A 5DALB 5CRWA 4OMVA 1PGTA 1BAYA 4N0ZA 4IQ1A 2WCIA 2H73A 2C0DA 2F9SA 1O85A 2EIQA 1N2AA 1JZOA 2YV7A 2PUKC 2P0GA 2QGVA 2YN1A 6GSWA 2DSAA 3A2XA 5HFGA 5AIXA 4AJ7A 5ECPB 5ELAA 3IAS2 4GF0A 5GAPD 1DUGA 1PKWA 1DBYA 3FR9A 1UC7A 1B48A 4I6XA 3TKQA 2J23A 5ID2B 5D9WA 3EYTA 2CVKA 2DC5A 2LRTA 1BEDA 3GNJA 3ZVJD 1OYJA 2AB6A 3KTBA 2E2GA 2LKUA 3P2AA 1SJZA 4MLYA 2VD0A 4PNFA 4EDZA 1PN9A 2VCTA 1WPIA 1R7HA 4G2EA 3GA4A 4LL1B 3OR5A 1V98A 2CZ3A 2HZFA 4K6XA 1IYHA 5JCWA 1UA5A 1SL0B 1XW9A 3QDNA 4TXOB 2VCQA 3F0IA 3VFIA 3DYRA 4ZBAA 1SL1B 1ZL9A 4Q5NA 3HVSA 3GH9A 2VM1A 1ERVA 4XRAA 3QMXA 2C8UA 1TU8A 1KEBA 1VF2A 1X5EA 1SJIA 2XC2A 3O6TA 3ZYWA 4CDOA 2V32A 1MDIA 2X64A 5EVOA 3DKSA 1PQNA 3RPPA 3W8JA 3P8WA 3NOFA 2M46A 4JRRA 5EY6A 3ZREA 4BA7A 3L9UA 3LYPA 3RBTA 1M7TA 4F82A 2VM2A 4P3YB 4XRDA 4JBBA 2KP1A 5DDLA 2LV3A 2P5RA 1A0RP 3EMPA 1OAZA 2PBJA 3O76A 1FVJA 1TXXA 2OBKA 4IGJA 3ZFBA 4KCAA 3IV4A 1F3BA 4KB3A 1PKZA 3GL3A 1TK5B 2VL2C 4QL7A 5CNWA 2F8AA 1U3IA 1M9BA 4TW5A 3CRTA 1Z6NA 2OACA 3GHAA 2FY6A 2H75A 1FB6A 2JZRA 3UARA 1FB0A 4HQZA 3TKSC 4KNDA 1YKCA 3MWHA 3HJPA 1ABAA 1K0DA 4KCEA 19GSA 4EO3A 3CSHA 4XS4A 5ECLB 2B1KA 1X5CA 5IMVA 3N9JA 3HZ4A 4TXVA 1PX7A 1K0OA 5FWGA 4G9HA 2L57A 1OE7A 4HUAA 1TDIA 4DVCA 5CREA 5F8BA 1A8LA 3TUEA 5GSSA 3IXRA 5KN2A 1LBKA 1T8EB 1AC1A 4CHSA 4MZWA 5AIVA 3WGXA 2TRXA 1OC8A 1XFLA 3TKPA 3US3A 3H4KA 5H5SA 1JHBA 3J7Yb 4IKHA 1AXDA 1AUCA 2A2RA 4Q5QA 1XVQA 2H0IA 2HZEB 3M8NA 2B5XA 2P5QA 2GS3A 1V2AA 3LJRA 3HVVA 3CMIA 2YNXA 4POKA 3D0ZA 1J08A 4IN0A 1Z3EA 3Q18A 3D22A 12GSA 3P7XA 3F3QA 5DQSA 4D73B 1BJXA 2C0GA 1KTEA 5IOXA 2C3NA 4OD7A 1XOAA 2IMIA 2GSQA 1HD2A 3ME7A 2FA8A 1PRXA 3I6AA 5D9XA 3ERFA 4WXTA 4OO5A 4NXIA 5D8IA 2FHEA 3BJ5A 1GLPA 2L5OA 4JZQA 3DD3A 4MZCA 1SENA 4PQ1A 2FGXA 2TRCP 1M0UA 2IMFA 4YQUA 5HR2A 7GSSA 3F6DA 1HQOA 2NBSA 4F0CA 4E8HA 3KJYA 3G7YA 4ML6A 3ZZXA 2LNTA 1QGVA 3GV1A 3KTLA 1URMA 2VOCA 4PQHA 2FWFA 5ECKB 4K7NA 1E2YA 1AQXA 4J2FA 3HXSA 3U6VA 1YQ1A 3UMAA 3SBCA 3LWAA 5J5NA 4K0NA 2YWIA 1R5PA 1G6WA 3BBYA 4BWQA 3GKXA 3A5WA 2DMLA 2R5GA 3ERWA 4MJCA 1WWJA 4JE1A 3TJGA 4DSRA 1FO5A 1YEPA 2EC4A 4YAVA 3H1NA 2XPEA 4K0GA 3C1RA 2H66A 4IJIA 4ISDA 4TR0A 3TOUA 4FIWA 2O89A 1H75A 3HD5A 4Q5FA 4X1UA 3VWXA 4NMUA 2VCZA 2H74A 3VPQA 1W4VA 1GH2A 4TKYA 4RQRA 3S9FA 3FK8A 2LNSA 4LLRA 4ID0A 2N5BA 2B7KA 3N5OA 4PXOA 1XWGA 2FUG2 5JWQB 8GSSA 3GH6A 3IK9A 4ILFA 1K3LA 3I69A 1DSBA 2HSMB 3UBKA 1VF1A 1IYIA 2X8HA 2O87A 5IM9A 4G0KA 4BPYA 1X9MB 4ZBBA 3LORA 5COHA 3FHKA 1OVNA 4LA1A 4KDXA 2D2ZA 1TK0B 2PVOC 4FYBA 1G7OA 3C71A 4WF5A 2LJAA 3FR3A 1F6MC 2RUEA 2I4AA 3EINA 5ECOB 2IPAA 4F0BA 2VL9A 3HJOA 2YPMA 1U6TA 4MP4A 2LUSA 3TKSE 2FWEA 4LMVA 2IFQB 3QOUA 4WF4A 3TDGA 1TRUA 1FAAA 3L0HA 4BL7A 1MDJA 4MK3A 1X0RA 2E7PA 2IMEA 3LG6A 5D9VA 1SK1A 2IMDA 3F9UA 4N30A 4NV2A 4GSSA 4RI6A 4DSQA 2V6KA 3VK9A 3TJJA 3UAPA 4PUFC 5HFIA 2MMNA 3LXTA 4IS0A 5ENUA 2H1AA 2G2QA 3Q6OA 1T4YA 1OC9B
chains in the Genus database with same CATH superfamily
2NDOA 1GTUA 3APOA 1U3AA 3D4TA 4MABA 2HSNA 5A1NA 1W89A 5DBQA 2PVQA 3ZMKA 4YKGA 2R37A 4N11A 2DJJA 3GUSA 3GURA 3QFBC 3CXGA 1UVZA 4ECJA 3QFAC 2HI7A 4ZIJA 3F8UA 3UOMA 2GZYA 5B8BA 1MD4A 4MA9A 1V9WA 3QPMA 4HDEA 4AF2A 5ID2A 2VD1A 3DMLA 1O73A 5LNKe 3P90A 2K8VA 2H1DA 2ZNMA 2FNOA 2V1MA 3UIWA 2VLVA 4E8EA 2L6DA 5ECMB 2VLUA 3EPTA 5C00A 3QAWA 4EE0A 1U88A 2DJ2A 2HRAA 3KEBA 2L5LA 3F4TA 4Z2RA 1QK8A 1VF3A 5J4UA 2PGTA 2IJYA 3ZRDA 5KEJA 1J0FA 3DIEA 4XHMA 1YVLA 2LEGA 1K0MA 4Z2TA 4E68A 3ERGA 1PMTA 3CBUA 2EFCA 3ZFLA 1FOVA 1K0NA 1N8JA 1GTAA 2XPDA 1G0TA 4BVXB 4IW9A 1ACVA 2R0GA 1S3DA 3MNGA 2RLIA 22GSA 2QKEA 5A4VA 5J41A 4HQSA 3ZVJA 4PGTA 5C04A 4XS6A 4ZB8A 4K7OA 1V58A 3L78A 1QFNA 4EUYA 1GSYA 5DQYA 5G31A 2CX3A 4CY6A 4GSTA 4OCFA 1Y6EA 1AW9A 3J7Yk 2CVDA 4LL4B 2H70A 1QQ2A 6GSTA 2X4AA 4W66A 4KW6A 5D96A 1GTBA 5IMFA 3FZ9A 4ZL8A 1BYEA 4RI7A 4IELA 1GSEA 1XZOA 1ZYQB 4O7HA 1TOFA 2H0GA 1EOHA 3IA1A 4LMWA 1FOHA 3VWWA 3Q6OA 3KM6A 1G6YA 1XWAA 2ES7A 1HYUA 4L0UA 2CAIA 2AYTA 3D6IA 1O8WA 2ON7A 3CSIA 4PQIA 1ZYPA 3H93A 2VAFA 5A4UA 4OFTA 2O7KA 2FWHA 1I1IP 1HNCA 1O8XA 1SJ6A 3V1WA 3KH9A 1WRYA 3RAZA 2ZUPA 4OO4A 1GWCA 2LS5A 1ERUA 1TP9A 1WJKA 1GL8A 4EKZA 1BQ7A 5B7CA 3GSSA 2OA7A 3MIXA 3PINA 3I43A 3TRPA 1XCCA 16GSA 4NAXA 3FRCA 1M2AA 3DWVA 4PTSA 3TKRA 1CQGA 3C73A 2H6YA 3TB2A 2DMMA 3HY2A 2HSYA 1TTZA 2DJ1A 2YP6A 2UV8G 4G10A 1XXUA 5KN0A 5CO3A 4J57E 1B4PA 3ZIJA 3F63A 1O7UA 1XOBA 3G7JA 4MJAA 5IQYA 2QA2A 4GDFA 3C1SA 3D21A 1YF1A 3A5IA 3HMJG 2C3QA 3PPUA 4K2DA 4TRXA 4L5LA 2TIRA 1PD21 1PL2A 4I97A 3TGZA 3FZ5A 2H1BA 2L6CA 5DJLA 3R3EA 5IO2A 2M80A 1R5AA 4IHUA 2IIYA 5FHIA 2WULA 4DSSA 2RM5A 3HYPA 3NZNA 2CT6A 1TRWA 2K8SA 4OFMA 4XS4B 3TRQA 1FVKA 1GSQA 1QUWA 1FHEA 4RQXA 1M99A 4MPFA 3QD9A 1T7PB 1EV4A 4NPBA 3WGDA 1TI1A 1X9SB 3ZITA 2VUPA 5DAKA 1GNEA 4KSOA 2WGRA 2B7JA 3ZMLA 2OADA 2HRKA 3LGCA 1USBA 3TJKA 1J9BA 2VKZG 2LRCA 5G30A 2ON5A 5AGYA 2UZ8A 4OFNA 4F2IA 2PMTA 3C8EA 3GKKA 2O5VA 6GSUA 1YY7A 3E9JB 1NSWA 3A3TA 2K9FA 4J56E 5BRTA 1YJ6A 4NWYA 4FH8A 1XWKA 1E6BA 1PA3A 3VWUA 4BWSA 1GSSA 1SVLA 3CTFA 4EF0A 4WKWA 1MTCA 2VCWA 2RUFA 4O92A 5HR1A 6GSSA 4POBA 1A0FA 4FXYP 1EEJA 4O5RA 4QMKA 4F9ZA 3GX8A 2R2JA 2CAQA 1WE0A 2EFEA 3VURA 4V1Ag 1F9MA 2FD3A 2C4JA 3RGBC 2RM6A 1T1VA 5JCUA 2WW3A 4KUNA 3L9VA 3FY7A 2DBCA 4OWYA 3EVIA 1SK2A 2L4QA 2H30A 5B6MA 2N5FA 1Z9HA 1A24A 1CQHA 2CV4A 2VIMA 4EXJA 3E3EA 4KH7A 3W6GA 2LJKA 4ULXA 1ERTA 2C1YA 4O32A 2F3MA 1YF0A 5IMAA 2GSTA 1Z6MA 4BIKA 3L9SA 4GQFA 1GNWA 4MJEA 3KIJA 1TRSA 3U5RE 1HNAA 3MDKA 4HU9A 3K8NA 5KOXA 3FYGA 4K9ZA 5IOWA 2AV4A 3KP9A 5LCZA 4NHWA 4H86A 3EMXA 5ECIB 4N10A 5L71A 1O6JA 3Q19A 4TR1B 2R3XA 1TU7A 4USSA 2GT6A 1SD8A 2VL3A 2M72A 2OE0A 1AQWA 5G1KA 5A4WA 4AJ6A 3ZL5A 5F05A 3LFLA 1K0BA 1TJDA 3IDVA 1ON4A 4HOJA 2Z9SA 2IFQA 3KD0A 4K5SA 3FR6A 2MYGA 5CAXA 5G1LA 2VLTA 1DE2A 4POLA 1GP1A 4HEA2 1EZKA 5ECRB 3FMWA 2YV9A 3KCMA 1Z7PA 4EVMA 4ML1A 3CSJA 1ZYEA 4PX1A 4V2MA 5H5RA 1K0CA 1C72A 2DJKA 4MH2A 5DCHA 2PWJA 4WEYA 4TN8A 1ILOA 4KX4A 5A34B 2H76A 1M3JA 4ZB9A 3KZQA 4PI2C 2FCHA 1EWXA 6GSXA 2X8CA 3F4SA 2E2MA 1NHYA 2JADA 1XPVA 4K7IA 3UJ1A 2YCDA 1T3BA 4RUVA 3CHXC 1SKSB 5ABRA 3APSA 1K0AA 4YAPA 4XCSA 4GTUA 2AUVA 1O81A 3RDWA 4WR5A 5DALA 5EL8A 2GVPA 4HU7A 2MBSA 5EPFA 3GKNA 2WW0A 2HRFA 3ME8A 1F2EA 2YANA 4MZBA 3HJMA 3RHCA 1GSFA 1SKWB 1TRVA 4ZL7A 4GWRA 4L0WA 2LSTA 3R2QA 5A5HB 1SYXA 3ZLPA 5IPGA 2R4VA 2O8VB 2OE1A 4I2TA 4IVFA 3RPNA 1TW9A 2H0HA 4AJ8A 5E4WA 4KSMA 4I8BA 1SVOA 1KBNA 2C0EA 3KP8A 3VPTA 3QAVA 1S4BP 4BVYB 4WETA 3WD6A 4BL7B 1GLQA 1G7EA 3ED3A 2GGTA 3UVTA 3APQA 4KGIA 1SU9A 1PSQA 10GSA 4GLTA 2GSSA 4YQMA 2JACA 5E59A 4BVXA 2H6ZA 4OCEA 1AIUA 5JWOB 1SK0A 2DJ0A 2YJ7A 5HR3A 4L8EA 2HT9A 3DGQA 2LQQA 3ISOA 3HHVA 3I9V2 3KMOA 5F06A 4FYCA 4MF7A 1WIKA 2VL2A 2O85A 4KE3A 2HSNB 4AKIA 2WRTA 2HYXA 5ECHB 1RK4A 3WYWA 4GRFA 2VCVA 1TI3A 3A2WA 2BJXA 4TXOA 4A5PA 2G0FA 4ACSA 3JCML 5FT3A 3HVNA 1SYRA 3IHQA 1U87A 1NM3A 1X5DA 4HJ2A 2WVXA 3TKSA 3HKRA 4X0XA 3DXBA 5J4YA 3UEMA 4I2UA 2DJ3A 4TOPA 3TJBA 4XS1A 3MSZA 4KAEA 5D73A 5IPHA 4YQVA 2JU5A 4GQCA 3FKFA 5G2ZA 3M9JA 1JLVA 2B3SA 5INYA 1Q98A 4EDYA 3IR4A 3HA9A 4NV5A 5CRDA 3VWVA 2F51A 5CYYA 3ZIVA 2HFDA 3FW2A 4O5UA 3L4NA 5IIZA 2CA8A 3RHBA 4IP6A 1SKRB 2XBIA 2IMKA 3UL3A 5G5EA 1NHOA 5ECNB 2I1UA 4X4JA 1OE8A 3LYKA 4TVEA 2B5EA 1GUKA 2B5YA 4V2NA 2YOIA 2DIYA 1M2BA 1A2LA 1UN2A 3DVWA 3QR6A 13GSA 1V40A 1QMVA 2I9HA 4GXZA 2HLSA 3IRAA 1MDKA 1OC3A 1VGLA 1KNGA 1F3AA 3G9BA 4FQUA 1FG4A 1YDKA 2LJRA 5IMCA 3QCPA 1EOGA 3GKMA 4MJBA 3DEXA 4WBRD 2I3YA 1VF4A 17GSA 2HRNA 1YZXA 1LJRA 1A2MA 1JZWA 4ECBA 3HZ8A 2J9HA 4HS1A 5ELGA 2HXKA 4MMMA 1B8XA 5AN1A 1GUMA 4FYUA 4G0IA 2V41A 4HZ2A 2ALBA 2R6KA 4KDYA 5F0GA 2JL4A 4I5QA 2JSYA 5IMDA 1M3IA 2A4HA 5IMZA 1GUHA 2KP2A 4EC0A 3CTGA 5HFKA 3PH9A 2RIIA 3FZAA 1H4OA 1S3AA 3MAKA 1XBSA 3UBLA 3LXZA 2QC7A 1XWCA 2LTKA 2JZSA 2GTUA 11GSA 2NVLA 3EWLA 2F8FA 2CZ2A 1PX6A 1OKTA 2DLXA 2GT5A 4KF9A 3KH7A 4MCUA 5J3RA 1TK8B 2OJLA 5CRHA 2OKAA 3WT1A 3C7MA 3GFKA 3CRUA 2H72A 4PURA 2HZEA 3DRNA 4KDUA 3O3TA 4PI0C 2FLSA 4ECIA 5H5QA 1XW6A 3M0FA 2EIOA 3DVXA 2NPBA 3IK7A 1AQVA 1MEKA 4QL9A 1OKDA 2WZ9A 3LW9A 3EC3A 5GAND 3HVXA 2K18A 1V57A 1Q4JA 2PN8A 1N25A 2WS2A 2H71A 2H19A 2LQOA 3GRXA 2KUCA 2A4VA 4IJ3A 4DEJA 4Z7XA 4IQAA 4D73A 2VO4A 3TRXA 4X43A 3VLNA 5D9TA 4AGSA 3GIXA 3G7IA 3TU3B 4G19A 2MMZA 3VI7A 4PNGA 2HQTA 4K8MA 5AISA 4MPGA 3TCOA 5B6NA 1WP0A 4ICYA 2QSIA 4WBJA 2AJQB 1ML6A 3GX0A 5F07A 3ZTLA 4YKFA 1I5GA 3IOSA 4V1Ap 2YWNA 4TR4A 2KHPA 4L5OA 3CYNA 1RQMA 2C0FA 2E0QA 3GYKA 4ZXGA 4EL1A 2PPTA 4K1FA 2B1LA 3BCIA 4V2LA 3M3MA 5BMUA 5JWRB 2GZZA 2MBTA 18GSA 2PERA 1EV9A 2MMOA 4DSSB 4CW9A 1B9YC 3E0UA 1GTIA 5J9CA 2C3TA 2YWOA 2WB9A 5ECSA 2NTOA 2IL3A 2HE3A 2ZCTA 2X49A 1QXHA 2A2SA 2GDRA 3AY8A 5DAKB 4XIHA 4GSNA 5J9BA 2XHFA 3UVHA 1T00A 1EP7A 2HRKB 2REMA 3H8QA 4JR6A 2KOKA 3F6FA 2A2PA 4NHZA 2H6XA 1HNBA 2HNLA 1XW5A 5KOWA 1ZOFA 1AAZA 1Y25A 4F03A 5B8AA 1A2JA 2DIZA 2KLXA 2X8GA 2YWMA 4YH2A 1A8YA 5D93A 2C80A 1K3YA 1EP8A 1X9WB 1THOA 4JR4A 1I9DA 3IC8A 1NW2A 3D5JA 1TKDB 3WGEA 3SWLA 2JSZA 4TR1A 3GL5A 4MH3A 4FO5A 2BMXA 1YEXA 2GQLA 5CRGA 2HSMA 4Q5RA 2L59A 1M9AA 2WFCA 1ZMAA 2N5AA 4ZB6A 3VI5A 2BTOT 3F4RA 1JZRA 1R26A 1BX9A 1K3OA 3F3RA 5LD0A 2CX4A 2GZPA 4TR3A 4WR4A 2GQKA 1YKAA 3GTUB 6GSVA 4MF5A 4JU5A 4HZ4A 3GSTA 1A23A 2WJUA 1M2DA 5A5KA 1EEMA 3EU3A 2AHEA 3NIVA 4QQ7A 3PR8A 1GULA 5HR0A 2I81A 3GMFA 1S3CA 2VCXA 3BCKA 1XVWA 1YEWC 1TXUA 5IO0A 3FEUA 2YZHA 4HJMA 4G0LA 1ZCPA 1T4ZA 3LSZA 4XTSA 1GRXA 2JZTA 1S3RA 3KMNA 14GSA 3HDCA 2FA4A 2CQ9A 1VRSD 2B6MA 3EE2A 1ZGNA 2CVBA 2EIRA 5JCGA 5G5FA 3IC4A 2R0CA 3TOTA 3Q74A 4ECCA 5KN3A 4K2XA 5GSTA 1DE1A 4JEDA 2YJHA 4IBPA 4N3ZA 3M1GA 1LU4A 4IP1A 4MF6A 4PUAA 1PL1A 1ZZYA 2XBQA 3M9KA 5KN1A 20GSA 1JLWA 1B9XC 2GQMA 3GTUA 1F37A 1EGRA 1Z7RA 2GLRA 2IN3A 1OC9A 3LQ7A 1R4WA 3A2VA 5ECQB 4POMA 3EURA 5A5HA 3FZ4A 1B4QA 2GSRA 4MDCA 5CP1A 1EGOA 2OBIA 4HI7A 5DVBA 2DKIA 4ZBDA 3D4MA 3BD2A 2LRNA 1XWBA 3HCZA 1GSDA 9GSSA 4ZL9A 4BVYA 3IAM2 3EU4A 3GN3A 2R0PA 2WW2A 2OE3A 1Z5YE 2L4CA 3PGTA 2H01A 1JZDA 2MMAA 3KXOA 4AKHA 1MD3A 2H8LA 1SD9A 2YZUA 1FW1A 1RW1A 1WOUA 1ST9A 2X99A 1SL2B 3IBHA 2H1GA 1XIYA 4GCIA 2V6OA 2IWTA 3BOAA 4G01A 1GSUA 5DJMA 2H1LA 1SVMA 2MZCA 3W8SA 1JFUA 1THXA 2V2GA 5J4VA 5HQPA 6GSYA 2P31A 3QAGA 5J47A 3H79A 3LEFA 5DCGA 2PU9C 3TJFA 3IE3A 4O5QA 3IPZA 1WMJA 2FWGA 2HSHA 2AAWA 1BG5A 3KGKA 4KA0A 2WDUA 1ERWA 5GZZB 2K6VA 4ZILA 3WT2A 5DALB 5CRWA 4OMVA 1PGTA 1BAYA 4N0ZA 4IQ1A 2WCIA 2H73A 2C0DA 2F9SA 1O85A 2EIQA 1N2AA 1JZOA 2YV7A 2PUKC 2P0GA 2QGVA 2YN1A 6GSWA 2DSAA 5A1NB 3A2XA 5HFGA 5AIXA 4AJ7A 5ECPB 5ELAA 3IAS2 4GF0A 5GAPD 1DUGA 1PKWA 1DBYA 3FR9A 2EFHA 1UC7A 1B48A 4I6XA 3TKQA 2J23A 5ID2B 5D9WA 3EYTA 2CVKA 2DC5A 2LRTA 1BEDA 3GNJA 3ZVJD 1OYJA 2AB6A 3KTBA 2E2GA 2LKUA 3P2AA 1SJZA 4MLYA 2VD0A 4PNFA 4EDZA 1PN9A 2VCTA 1WPIA 1R7HA 4G2EA 3GA4A 4LL1B 3OR5A 1V98A 2CZ3A 2HZFA 4K6XA 1IYHA 5JCWA 1UA5A 1SL0B 1XW9A 3QDNA 4TXOB 2VCQA 3F0IA 2O3EA 3VFIA 3DYRA 4ZBAA 1SL1B 1ZL9A 2WVXB 4Q5NA 1PFOA 3HVSA 3GH9A 2DKHA 2VM1A 1ERVA 4XRAA 3QMXA 2C8UA 1TU8A 1KEBA 1VF2A 1X5EA 1SJIA 2XC2A 3O6TA 3ZYWA 4CDOA 2V32A 2WVYA 1MDIA 2X64A 5EVOA 3DKSA 1PQNA 3RPPA 3W8JA 3P8WA 3NOFA 2M46A 4JRRA 5EY6A 3ZREA 4BA7A 3L9UA 3LYPA 3RBTA 1M7TA 4F82A 2VM2A 4EIPA 4P3YB 4XRDA 4JBBA 2KP1A 5DDLA 2LV3A 2P5RA 1A0RP 3EMPA 1OAZA 2WVZA 2PBJA 3O76A 1FVJA 1TXXA 2OBKA 3IHGA 4IGJA 3ZFBA 4KCAA 4EIQA 3IV4A 1F3BA 4KB3A 1PKZA 3GL3A 1TK5B 2VL2C 4QL7A 5CNWA 2F8AA 4HSCX 1U3IA 1M9BA 4TW5A 3CRTA 1Z6NA 2OACA 3CWGA 3GHAA 2FY6A 1XG8A 2H75A 1FB6A 2JZRA 3UARA 1FB0A 4HQZA 3TKSC 4KNDA 1YKCA 3MWHA 3HJPA 1ABAA 1K0DA 4KCEA 19GSA 4EO3A 3CSHA 4XS4A 5ECLB 2B1KA 1X5CA 5IMVA 3N9JA 3HZ4A 4TXVA 4CY8A 4K5RA 1PX7A 1K0OA 5FWGA 4G9HA 2L57A 1OE7A 4HUAA 1TDIA 4DVCA 5CREA 5F8BA 1PN0A 1A8LA 3CQFA 3TUEA 5GSSA 3IXRA 5KN2A 1LBKA 1T8EB 1AC1A 4CHSA 4MZWA 5AIVA 3WGXA 2TRXA 1OC8A 1XFLA 3TKPA 3US3A 3H4KA 5H5SA 1JHBA 3J7Yb 4IKHA 1AXDA 2WW1A 1AUCA 2EFDA 2A2RA 4Q5QA 1XVQA 2H0IA 2HZEB 3M8NA 2B5XA 2P5QA 2GS3A 1V2AA 3LJRA 3HVVA 3CMIA 2YNXA 4POKA 3D0ZA 1J08A 4IN0A 1Z3EA 3Q18A 3D22A 12GSA 3P7XA 2O36A 3F3QA 5DQSA 4D73B 1BJXA 2C0GA 2OT3A 1KTEA 5IOXA 2C3NA 4OD7A 1XOAA 2IMIA 2GSQA 1HD2A 3ME7A 2FA8A 1PRXA 3I6AA 5D9XA 3ERFA 4WXTA 4OO5A 4NXIA 5D8IA 2FHEA 3BJ5A 1GLPA 2L5OA 4JZQA 3DD3A 4MZCA 1SENA 4PQ1A 2FGXA 1BF5A 2TRCP 1M0UA 2IMFA 4YQUA 5HR2A 1ZYNA 7GSSA 4AKXB 3F6DA 1HQOA 2NBSA 4F0CA 4E8HA 3KJYA 4ZB7A 3G7YA 4ML6A 2WZSA 3ZZXA 2LNTA 1QGVA 1Y1UA 5BMUB 3GV1A 3KTLA 1URMA 2VOCA 4PQHA 2FWFA 5ECKB 4K7NA 1E2YA 1AQXA 4PHZC 4J2FA 3HXSA 3U6VA 1YQ1A 3UMAA 3SBCA 3LWAA 5J5NA 4K0NA 2YWIA 1R5PA 1G6WA 3BBYA 4BWQA 3GKXA 3A5WA 2DMLA 2R5GA 3ERWA 4MJCA 1WWJA 4JE1A 3TJGA 4DSRA 1FO5A 1YEPA 2EC4A 4YAVA 3H1NA 2XPEA 4K0GA 3C1RA 2H66A 4IJIA 4ISDA 4TR0A 3TOUA 4FIWA 2O89A 1H75A 3RFRC 3HD5A 4Q5FA 4X1UA 3VWXA 4NMUA 2VCZA 2H74A 3VPQA 1W4VA 1GH2A 4TKYA 4RQRA 3S9FA 3FK8A 2LNSA 4LLRA 4ID0A 2N5BA 2B7KA 3N5OA 4PXOA 5A34A 1XWGA 2FUG2 5JWQB 8GSSA 3GH6A 3IK9A 4Z2UA 4ILFA 1K3LA 3I69A 1DSBA 2HSMB 3UBKA 1VF1A 1IYIA 2X8HA 2O87A 5IM9A 4G0KA 4BPYA 1X9MB 4ZBBA 3LORA 5COHA 3FHKA 1OVNA 4MNNA 4LA1A 3MYDA 4KDXA 2D2ZA 1TK0B 2PVOC 4FYBA 1G7OA 3C71A 4WF5A 2LJAA 3FR3A 1F6MC 2RUEA 5J40A 2I4AA 3EINA 5ECOB 2IPAA 4F0BA 2VL9A 3HJOA 2YPMA 1U6TA 4MP4A 1BG1A 2LUSA 3TKSE 2FWEA 4LMVA 2IFQB 3QOUA 4WF4A 3TDGA 1TRUA 1FAAA 3L0HA 4BL7A 4AKGA 1MDJA 4MK3A 4AI6A 1X0RA 2E7PA 2IMEA 3LG6A 5D9VA 1SK1A 2IMDA 3F9UA 4N30A 4NV2A 4GSSA 4RI6A 4DSQA 2V6KA 3VK9A 3TJJA 3UAPA 4PUFC 5HFIA 2MMNA 2QA1A 3LXTA 4IS0A 5ENUA 2H1AA 2G2QA 4N0VA 1T4YA 1OC9B
chains in the Genus database with same CATH topology
2NDOA 1GTUA 3APOA 1U3AA 3D4TA 4MABA 2HSNA 5A1NA 1W89A 5DBQA 2PVQA 3ZMKA 4YKGA 2R37A 4N11A 2DJJA 3GUSA 3GURA 3QFBC 3CXGA 1UVZA 4ECJA 3QFAC 2HI7A 4ZIJA 3F8UA 3UOMA 2GZYA 5B8BA 1MD4A 4MA9A 1V9WA 3QPMA 4HDEA 4AF2A 5ID2A 2VD1A 3DMLA 1O73A 5LNKe 3P90A 2K8VA 2H1DA 2ZNMA 2FNOA 2V1MA 3UIWA 2VLVA 4E8EA 2L6DA 5ECMB 2VLUA 3EPTA 5C00A 3QAWA 4EE0A 1U88A 2DJ2A 2HRAA 3KEBA 2L5LA 3F4TA 4Z2RA 1QK8A 1VF3A 5J4UA 2PGTA 2IJYA 3ZRDA 5KEJA 1J0FA 3DIEA 4XHMA 1YVLA 2LEGA 1K0MA 4Z2TA 4E68A 3ERGA 1PMTA 3CBUA 2EFCA 3ZFLA 1FOVA 1K0NA 1N8JA 1GTAA 2XPDA 1G0TA 4BVXB 4IW9A 1ACVA 2R0GA 1S3DA 3MNGA 2RLIA 22GSA 2QKEA 5A4VA 5J41A 4HQSA 3ZVJA 4PGTA 5C04A 4XS6A 4ZB8A 4K7OA 1V58A 3L78A 1QFNA 4EUYA 1GSYA 5DQYA 5G31A 2CX3A 4CY6A 4GSTA 4OCFA 1Y6EA 1AW9A 3J7Yk 2CVDA 4LL4B 2H70A 1QQ2A 6GSTA 2X4AA 4W66A 4KW6A 5D96A 1GTBA 5IMFA 3FZ9A 4ZL8A 1BYEA 4RI7A 4IELA 1GSEA 1XZOA 1ZYQB 4O7HA 1TOFA 2H0GA 1EOHA 3IA1A 4LMWA 1FOHA 3VWWA 3Q6OA 3KM6A 1G6YA 1XWAA 2ES7A 1HYUA 4L0UA 2CAIA 2AYTA 3D6IA 1O8WA 2ON7A 3CSIA 4PQIA 1ZYPA 3H93A 2VAFA 5A4UA 4OFTA 2O7KA 2FWHA 1HNCA 1O8XA 1SJ6A 3V1WA 3KH9A 1WRYA 3RAZA 2ZUPA 4OO4A 1GWCA 2LS5A 1ERUA 1TP9A 1WJKA 1GL8A 4EKZA 1BQ7A 5B7CA 3GSSA 2OA7A 3MIXA 3PINA 3I43A 3TRPA 1XCCA 16GSA 4NAXA 3FRCA 1M2AA 3DWVA 4PTSA 3TKRA 1CQGA 3C73A 2H6YA 3TB2A 2DMMA 3HY2A 2HSYA 1TTZA 2DJ1A 2YP6A 2UV8G 4G10A 1XXUA 5KN0A 5CO3A 4J57E 1B4PA 3ZIJA 3F63A 1O7UA 1XOBA 3G7JA 4MJAA 5IQYA 2QA2A 4GDFA 3C1SA 3D21A 1YF1A 3A5IA 3HMJG 2C3QA 3PPUA 4K2DA 4TRXA 4L5LA 2TIRA 1PD21 1PL2A 4I97A 3TGZA 3FZ5A 2H1BA 2L6CA 5DJLA 3R3EA 5IO2A 2M80A 1R5AA 4IHUA 2IIYA 5FHIA 2WULA 4DSSA 2RM5A 3HYPA 3NZNA 2CT6A 1TRWA 2K8SA 4OFMA 4XS4B 3TRQA 1FVKA 1GSQA 1QUWA 1FHEA 4RQXA 1M99A 4MPFA 3QD9A 1T7PB 1EV4A 4NPBA 3WGDA 1TI1A 1X9SB 3ZITA 2VUPA 5DAKA 1GNEA 4KSOA 2WGRA 2B7JA 3ZMLA 2OADA 2HRKA 3LGCA 1USBA 3TJKA 1J9BA 2VKZG 2LRCA 5G30A 2ON5A 5AGYA 2UZ8A 4OFNA 4F2IA 2PMTA 3C8EA 3GKKA 2O5VA 6GSUA 1YY7A 3E9JB 1NSWA 3A3TA 2K9FA 4J56E 5BRTA 1YJ6A 4NWYA 4FH8A 1XWKA 1E6BA 1PA3A 3VWUA 4BWSA 1GSSA 1SVLA 3CTFA 4EF0A 4WKWA 1MTCA 2VCWA 2RUFA 4O92A 5HR1A 6GSSA 4POBA 1A0FA 1EEJA 4O5RA 4QMKA 4F9ZA 3GX8A 2R2JA 2CAQA 1WE0A 2EFEA 3VURA 4V1Ag 1F9MA 2FD3A 2C4JA 2RM6A 1T1VA 5JCUA 4KUNA 3L9VA 3FY7A 2DBCA 4OWYA 3EVIA 1SK2A 2L4QA 2H30A 5B6MA 2N5FA 1Z9HA 1A24A 1CQHA 2CV4A 2VIMA 4EXJA 3E3EA 4KH7A 3W6GA 2LJKA 4ULXA 1ERTA 2C1YA 4O32A 2F3MA 1YF0A 5IMAA 2GSTA 1Z6MA 3L9SA 4GQFA 1GNWA 4MJEA 3KIJA 1TRSA 3U5RE 1HNAA 3MDKA 4HU9A 3K8NA 5KOXA 3FYGA 4K9ZA 5IOWA 2AV4A 3KP9A 5LCZA 4NHWA 4H86A 3EMXA 5ECIB 4N10A 5L71A 1O6JA 3Q19A 4TR1B 2R3XA 1TU7A 4USSA 2GT6A 1SD8A 2VL3A 2M72A 2OE0A 1AQWA 5G1KA 5A4WA 4AJ6A 3ZL5A 5F05A 3LFLA 1K0BA 1TJDA 3IDVA 1ON4A 4HOJA 2Z9SA 2IFQA 3KD0A 4K5SA 3FR6A 2MYGA 5CAXA 5G1LA 2VLTA 1DE2A 4POLA 1GP1A 4HEA2 1EZKA 5ECRB 3FMWA 2YV9A 3KCMA 1Z7PA 4EVMA 4ML1A 3CSJA 1ZYEA 4PX1A 4V2MA 5H5RA 1K0CA 1C72A 2DJKA 4MH2A 5DCHA 2PWJA 4WEYA 4TN8A 1ILOA 4KX4A 5A34B 2H76A 4ZB9A 3KZQA 2FCHA 1EWXA 6GSXA 2X8CA 3F4SA 2E2MA 1NHYA 2JADA 1XPVA 4K7IA 3UJ1A 2YCDA 1T3BA 4RUVA 1SKSB 5ABRA 3APSA 1K0AA 4YAPA 4XCSA 4GTUA 2AUVA 1O81A 3RDWA 4WR5A 5DALA 5EL8A 2GVPA 4HU7A 2MBSA 5EPFA 3GKNA 2HRFA 3ME8A 1F2EA 2YANA 4MZBA 3HJMA 3RHCA 1GSFA 1SKWB 1TRVA 4ZL7A 4GWRA 4L0WA 2LSTA 3R2QA 5A5HB 1SYXA 3ZLPA 5IPGA 2R4VA 2O8VB 2OE1A 4I2TA 4IVFA 3RPNA 1TW9A 2H0HA 4AJ8A 5E4WA 4KSMA 4I8BA 1SVOA 1KBNA 2C0EA 3KP8A 3VPTA 3QAVA 4BVYB 4WETA 3WD6A 4BL7B 1GLQA 1G7EA 3ED3A 2GGTA 3UVTA 3APQA 4KGIA 1SU9A 1PSQA 10GSA 4GLTA 2GSSA 4YQMA 2JACA 5E59A 4BVXA 2H6ZA 4OCEA 1AIUA 5JWOB 1SK0A 2DJ0A 2YJ7A 5HR3A 4L8EA 2HT9A 3DGQA 2LQQA 3ISOA 3HHVA 3I9V2 3KMOA 5F06A 4FYCA 4MF7A 1WIKA 2VL2A 2O85A 4KE3A 2HSNB 4AKIA 2WRTA 2HYXA 5ECHB 1RK4A 3WYWA 4GRFA 2VCVA 1TI3A 3A2WA 2BJXA 4TXOA 4A5PA 2G0FA 4ACSA 3JCML 5FT3A 1SYRA 3IHQA 1U87A 1NM3A 1X5DA 4HJ2A 3TKSA 3HKRA 4X0XA 3DXBA 5J4YA 3UEMA 4I2UA 2DJ3A 4TOPA 3TJBA 4XS1A 3MSZA 4KAEA 5D73A 5IPHA 4YQVA 2JU5A 4GQCA 3FKFA 5G2ZA 3M9JA 1JLVA 2B3SA 5INYA 1Q98A 4EDYA 3IR4A 3HA9A 4NV5A 5CRDA 3VWVA 2F51A 5CYYA 3ZIVA 2HFDA 3FW2A 4O5UA 3L4NA 5IIZA 2CA8A 3RHBA 4IP6A 1SKRB 2XBIA 2IMKA 3UL3A 5G5EA 1NHOA 5ECNB 2I1UA 4X4JA 1OE8A 3LYKA 4TVEA 2B5EA 1GUKA 2B5YA 4V2NA 2YOIA 2DIYA 1M2BA 1A2LA 1UN2A 3DVWA 3QR6A 13GSA 1V40A 1QMVA 2I9HA 4GXZA 2HLSA 3IRAA 1MDKA 1OC3A 1VGLA 1KNGA 1F3AA 3G9BA 4FQUA 1FG4A 1YDKA 2LJRA 5IMCA 3QCPA 1EOGA 3GKMA 4MJBA 3DEXA 4WBRD 2I3YA 1VF4A 17GSA 2HRNA 1YZXA 1LJRA 1A2MA 1JZWA 4ECBA 3HZ8A 2J9HA 4HS1A 5ELGA 2HXKA 4MMMA 1B8XA 5AN1A 1GUMA 4FYUA 4G0IA 2V41A 4HZ2A 2ALBA 2R6KA 4KDYA 5F0GA 2JL4A 4I5QA 2JSYA 5IMDA 5IMZA 2A4HA 1GUHA 2KP2A 4EC0A 3CTGA 5HFKA 3PH9A 2RIIA 3FZAA 1H4OA 1S3AA 3MAKA 1XBSA 3UBLA 3LXZA 2QC7A 1XWCA 2LTKA 2JZSA 2GTUA 11GSA 2NVLA 3EWLA 2F8FA 2CZ2A 1PX6A 1OKTA 2DLXA 2GT5A 4KF9A 3KH7A 4MCUA 5J3RA 1TK8B 2OJLA 5CRHA 2OKAA 3WT1A 3C7MA 3GFKA 3CRUA 2H72A 4PURA 2HZEA 3DRNA 4KDUA 3O3TA 2FLSA 4ECIA 5H5QA 1XW6A 3M0FA 2EIOA 3DVXA 2NPBA 3IK7A 1AQVA 1MEKA 4QL9A 1OKDA 2WZ9A 3LW9A 3EC3A 5GAND 3HVXA 2K18A 1V57A 1Q4JA 2PN8A 1N25A 2WS2A 2H71A 2H19A 2LQOA 3GRXA 2KUCA 2A4VA 4IJ3A 4DEJA 4Z7XA 4IQAA 4D73A 2VO4A 3TRXA 4X43A 3VLNA 5D9TA 4AGSA 3GIXA 3G7IA 3TU3B 4G19A 2MMZA 3VI7A 4PNGA 2HQTA 4K8MA 5AISA 4MPGA 3TCOA 5B6NA 1WP0A 4ICYA 2QSIA 4WBJA 2AJQB 1ML6A 3GX0A 5F07A 3ZTLA 4YKFA 1I5GA 3IOSA 4V1Ap 2YWNA 4TR4A 2KHPA 4L5OA 3CYNA 1RQMA 2C0FA 2E0QA 3GYKA 4ZXGA 4EL1A 2PPTA 4K1FA 2B1LA 3BCIA 4V2LA 3M3MA 5BMUA 5JWRB 2GZZA 2MBTA 18GSA 2PERA 1EV9A 2MMOA 4DSSB 4CW9A 1B9YC 3E0UA 1GTIA 5J9CA 2C3TA 2YWOA 2WB9A 5ECSA 2NTOA 2IL3A 2HE3A 2ZCTA 2X49A 1QXHA 2A2SA 2GDRA 3AY8A 5DAKB 4XIHA 4GSNA 5J9BA 2XHFA 3UVHA 1T00A 1EP7A 2HRKB 2REMA 3H8QA 4JR6A 2KOKA 3F6FA 2A2PA 4NHZA 2H6XA 1HNBA 2HNLA 1XW5A 5KOWA 1ZOFA 1AAZA 1Y25A 4F03A 5B8AA 1A2JA 2DIZA 2KLXA 2X8GA 2YWMA 4YH2A 1A8YA 5D93A 2C80A 1K3YA 1EP8A 1X9WB 1THOA 4JR4A 1I9DA 3IC8A 1NW2A 3D5JA 1TKDB 3WGEA 3SWLA 2JSZA 4TR1A 3GL5A 4MH3A 4FO5A 2BMXA 1YEXA 2GQLA 5CRGA 2HSMA 4Q5RA 2L59A 1M9AA 2WFCA 1ZMAA 2N5AA 4ZB6A 3VI5A 2BTOT 3F4RA 1JZRA 1R26A 1BX9A 1K3OA 3F3RA 5LD0A 2CX4A 2GZPA 4TR3A 4WR4A 2GQKA 1YKAA 3GTUB 6GSVA 4MF5A 4JU5A 4HZ4A 3GSTA 1A23A 2WJUA 1M2DA 5A5KA 1EEMA 3EU3A 2AHEA 3NIVA 4QQ7A 3PR8A 1GULA 5HR0A 2I81A 3GMFA 1S3CA 2VCXA 3BCKA 1XVWA 1TXUA 5IO0A 3FEUA 2YZHA 4HJMA 4G0LA 1ZCPA 1T4ZA 3LSZA 4XTSA 1GRXA 2JZTA 3KMNA 14GSA 3HDCA 2FA4A 2CQ9A 1VRSD 2B6MA 3EE2A 1ZGNA 2CVBA 2EIRA 5JCGA 5G5FA 3IC4A 2R0CA 3TOTA 3Q74A 4ECCA 5KN3A 4K2XA 5GSTA 1DE1A 4JEDA 2YJHA 4IBPA 4N3ZA 3M1GA 1LU4A 4IP1A 4MF6A 4PUAA 1PL1A 1ZZYA 2XBQA 3M9KA 5KN1A 20GSA 1JLWA 1B9XC 2GQMA 3GTUA 1F37A 1EGRA 1Z7RA 2GLRA 2IN3A 1OC9A 3LQ7A 1R4WA 3A2VA 5ECQB 4POMA 3EURA 5A5HA 3FZ4A 1B4QA 2GSRA 4MDCA 5CP1A 1EGOA 2OBIA 4HI7A 5DVBA 2DKIA 4ZBDA 3D4MA 3BD2A 2LRNA 1XWBA 3HCZA 1GSDA 9GSSA 4ZL9A 4BVYA 3IAM2 3EU4A 3GN3A 2R0PA 2OE3A 1Z5YE 2L4CA 3PGTA 2H01A 1JZDA 2MMAA 3KXOA 4AKHA 1MD3A 2H8LA 1SD9A 2YZUA 1FW1A 1RW1A 1WOUA 1ST9A 2X99A 1SL2B 3IBHA 2H1GA 1XIYA 4GCIA 2V6OA 2IWTA 3BOAA 4G01A 1GSUA 5DJMA 2H1LA 1SVMA 2MZCA 3W8SA 1JFUA 1THXA 2V2GA 5J4VA 5HQPA 6GSYA 2P31A 3QAGA 5J47A 3H79A 3LEFA 5DCGA 2PU9C 3TJFA 3IE3A 4O5QA 3IPZA 1WMJA 2FWGA 2HSHA 2AAWA 1BG5A 3KGKA 4KA0A 2WDUA 1ERWA 5GZZB 2K6VA 4ZILA 3WT2A 5DALB 5CRWA 4OMVA 1PGTA 1BAYA 4N0ZA 4IQ1A 2WCIA 2H73A 2C0DA 2F9SA 1O85A 2EIQA 1N2AA 1JZOA 2YV7A 2PUKC 2P0GA 2QGVA 2YN1A 6GSWA 2DSAA 5A1NB 3A2XA 5HFGA 5AIXA 4AJ7A 5ECPB 5ELAA 3IAS2 4GF0A 5GAPD 1DUGA 1PKWA 1DBYA 3FR9A 2EFHA 1UC7A 1B48A 4I6XA 3TKQA 2J23A 5ID2B 5D9WA 3EYTA 2CVKA 2DC5A 2LRTA 1BEDA 3GNJA 3ZVJD 1OYJA 2AB6A 3KTBA 2E2GA 2LKUA 3P2AA 1SJZA 4MLYA 2VD0A 4PNFA 4EDZA 1PN9A 2VCTA 1WPIA 1R7HA 4G2EA 3GA4A 4LL1B 3OR5A 1V98A 2CZ3A 2HZFA 4K6XA 1IYHA 5JCWA 1UA5A 1SL0B 1XW9A 3QDNA 4TXOB 2VCQA 3F0IA 3VFIA 3DYRA 4ZBAA 1SL1B 1ZL9A 4Q5NA 3HVSA 3GH9A 2DKHA 2VM1A 1ERVA 4XRAA 3QMXA 2C8UA 1TU8A 1KEBA 1VF2A 1X5EA 1SJIA 2XC2A 3O6TA 3ZYWA 4CDOA 2V32A 1MDIA 2X64A 5EVOA 3DKSA 1PQNA 3RPPA 3W8JA 3P8WA 3NOFA 2M46A 4JRRA 5EY6A 3ZREA 4BA7A 3L9UA 3LYPA 3RBTA 1M7TA 4F82A 2VM2A 4EIPA 4P3YB 4XRDA 4JBBA 2KP1A 5DDLA 2LV3A 2P5RA 1A0RP 3EMPA 1OAZA 2PBJA 3O76A 1FVJA 1TXXA 2OBKA 3IHGA 4IGJA 3ZFBA 4KCAA 4EIQA 3IV4A 1F3BA 4KB3A 1PKZA 3GL3A 1TK5B 2VL2C 4QL7A 5CNWA 2F8AA 1U3IA 1M9BA 4TW5A 3CRTA 1Z6NA 2OACA 3CWGA 3GHAA 2FY6A 2H75A 1FB6A 2JZRA 3UARA 1FB0A 4HQZA 3TKSC 4KNDA 1YKCA 3MWHA 3HJPA 1ABAA 1K0DA 4KCEA 19GSA 4EO3A 3CSHA 4XS4A 5ECLB 2B1KA 1X5CA 5IMVA 3N9JA 3HZ4A 4TXVA 4CY8A 4K5RA 1PX7A 1K0OA 5FWGA 4G9HA 2L57A 1OE7A 4HUAA 1TDIA 4DVCA 5CREA 5F8BA 1PN0A 1A8LA 3TUEA 5GSSA 3IXRA 5KN2A 1LBKA 1T8EB 1AC1A 4CHSA 4MZWA 5AIVA 3WGXA 2TRXA 1OC8A 1XFLA 3TKPA 3US3A 3H4KA 5H5SA 1JHBA 3J7Yb 4IKHA 1AXDA 1AUCA 2EFDA 2A2RA 4Q5QA 1XVQA 2H0IA 2HZEB 3M8NA 2B5XA 2P5QA 2GS3A 1V2AA 3LJRA 3HVVA 3CMIA 2YNXA 4POKA 3D0ZA 1J08A 4IN0A 1Z3EA 3Q18A 3D22A 12GSA 3P7XA 3F3QA 5DQSA 4D73B 1BJXA 2C0GA 2OT3A 1KTEA 5IOXA 2C3NA 4OD7A 1XOAA 2IMIA 2GSQA 1HD2A 3ME7A 2FA8A 1PRXA 3I6AA 5D9XA 3ERFA 4WXTA 4OO5A 4NXIA 5D8IA 2FHEA 3BJ5A 1GLPA 2L5OA 4JZQA 3DD3A 4MZCA 1SENA 4PQ1A 2FGXA 1BF5A 2TRCP 1M0UA 2IMFA 4YQUA 5HR2A 1ZYNA 7GSSA 4AKXB 3F6DA 1HQOA 2NBSA 4F0CA 4E8HA 3KJYA 4ZB7A 3G7YA 4ML6A 3ZZXA 2LNTA 1QGVA 1Y1UA 5BMUB 3GV1A 3KTLA 1URMA 2VOCA 4PQHA 2FWFA 5ECKB 4K7NA 1E2YA 1AQXA 4J2FA 3HXSA 3U6VA 1YQ1A 3UMAA 3SBCA 3LWAA 5J5NA 4K0NA 2YWIA 1R5PA 1G6WA 3BBYA 4BWQA 3GKXA 3A5WA 2DMLA 2R5GA 3ERWA 4MJCA 1WWJA 4JE1A 3TJGA 4DSRA 1FO5A 1YEPA 2EC4A 4YAVA 3H1NA 2XPEA 4K0GA 3C1RA 2H66A 4IJIA 4ISDA 4TR0A 3TOUA 4FIWA 2O89A 1H75A 3HD5A 4Q5FA 4X1UA 3VWXA 4NMUA 2VCZA 2H74A 3VPQA 1W4VA 1GH2A 4TKYA 4RQRA 3S9FA 3FK8A 2LNSA 4LLRA 4ID0A 2N5BA 2B7KA 3N5OA 4PXOA 5A34A 1XWGA 2FUG2 5JWQB 8GSSA 3GH6A 3IK9A 4Z2UA 4ILFA 1K3LA 3I69A 1DSBA 2HSMB 3UBKA 1VF1A 1IYIA 2X8HA 2O87A 5IM9A 4G0KA 4BPYA 1X9MB 4ZBBA 3LORA 5COHA 3FHKA 1OVNA 4MNNA 4LA1A 3MYDA 4KDXA 2D2ZA 1TK0B 2PVOC 4FYBA 1G7OA 3C71A 4WF5A 2LJAA 3FR3A 1F6MC 2RUEA 5J40A 2I4AA 3EINA 5ECOB 2IPAA 4F0BA 2VL9A 3HJOA 2YPMA 1U6TA 4MP4A 1BG1A 2LUSA 3TKSE 2FWEA 4LMVA 2IFQB 3QOUA 4WF4A 3TDGA 1TRUA 1FAAA 3L0HA 4BL7A 4AKGA 1MDJA 4MK3A 4AI6A 1X0RA 2E7PA 2IMEA 3LG6A 5D9VA 1SK1A 2IMDA 3F9UA 4N30A 4NV2A 4GSSA 4RI6A 4DSQA 2V6KA 3VK9A 3TJJA 3UAPA 4PUFC 5HFIA 2MMNA 2QA1A 3LXTA 4IS0A 5ENUA 2H1AA 2G2QA 4N0VA 1T4YA 1OC9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NDO A;  1GTU A;  3APO A;  1U3A A;  3D4T A;  4MAB A;  1W89 A;  5DBQ A;  2PVQ A;  3ZMK A;  2R37 A;  4N11 A;  2DJJ A;  3GUS A;  3GUR A;  3QFB C;  3CXG A;  1UVZ A;  4ECJ A;  3QFA C;  2HI7 A;  4ZIJ A;  3F8U A;  3UOM A;  2GZY A;  5B8B A;  1MD4 A;  4MA9 A;  1V9W A;  3QPM A;  4HDE A;  4AF2 A;  5ID2 A;  2VD1 A;  3DML A;  1O73 A;  5LNK e;  3P90 A;  2K8V A;  2H1D A;  2ZNM A;  2FNO A;  2V1M A;  3UIW A;  2VLV A;  4E8E A;  2L6D A;  5ECM B;  2VLU A;  5C00 A;  3QAW A;  4EE0 A;  1U88 A;  2DJ2 A;  2HRA A;  3KEB A;  2L5L A;  3F4T A;  1QK8 A;  1VF3 A;  5J4U A;  2PGT A;  2IJY A;  3ZRD A;  5KEJ A;  1J0F A;  3DIE A;  4XHM A;  2LEG A;  1K0M A;  3ERG A;  1PMT A;  3CBU A;  3ZFL A;  1FOV A;  1K0N A;  1N8J A;  1GTA A;  2XPD A;  1G0T A;  4BVX B;  4IW9 A;  1ACV A;  1S3D A;  3MNG A;  2RLI A;  22GS A;  2QKE A;  5A4V A;  5J41 A;  4HQS A;  3ZVJ A;  4PGT A;  5C04 A;  4XS6 A;  4ZB8 A;  4K7O A;  1V58 A;  3L78 A;  1QFN A;  4EUY A;  1GSY A;  5DQY A;  5G31 A;  2CX3 A;  4GST A;  4OCF A;  1Y6E A;  1AW9 A;  3J7Y k;  2CVD A;  4LL4 B;  2H70 A;  1QQ2 A;  6GST A;  4KW6 A;  5D96 A;  1GTB A;  5IMF A;  3FZ9 A;  4ZL8 A;  1BYE A;  4RI7 A;  4IEL A;  1GSE A;  1XZO A;  1ZYQ B;  4O7H A;  1TOF A;  2H0G A;  1EOH A;  3IA1 A;  4LMW A;  3VWW A;  3KM6 A;  1G6Y A;  1XWA A;  2ES7 A;  1HYU A;  4L0U A;  2CAI A;  2AYT A;  3D6I A;  1O8W A;  2ON7 A;  3CSI A;  4PQI A;  3H93 A;  2VAF A;  5A4U A;  4OFT A;  2O7K A;  2FWH A;  1HNC A;  1O8X A;  1SJ6 A;  3V1W A;  3KH9 A;  1WRY A;  3RAZ A;  2ZUP A;  4OO4 A;  1GWC A;  2LS5 A;  1ERU A;  1TP9 A;  1WJK A;  1GL8 A;  4EKZ A;  1BQ7 A;  5B7C A;  3GSS A;  2OA7 A;  3PIN A;  3I43 A;  3TRP A;  1XCC A;  16GS A;  4NAX A;  3FRC A;  1M2A A;  3DWV A;  4PTS A;  3TKR A;  1CQG A;  3C73 A;  2H6Y A;  3TB2 A;  2DMM A;  3HY2 A;  2HSY A;  1TTZ A;  2DJ1 A;  2YP6 A;  4G10 A;  1XXU A;  5KN0 A;  5CO3 A;  4J57 E;  1B4P A;  3ZIJ A;  3F63 A;  1O7U A;  1XOB A;  3G7J A;  4MJA A;  5IQY A;  3C1S A;  3D21 A;  1YF1 A;  2C3Q A;  3PPU A;  4K2D A;  4TRX A;  4L5L A;  2TIR A;  1PD2 1;  1PL2 A;  4I97 A;  3TGZ A;  3FZ5 A;  2H1B A;  2L6C A;  5DJL A;  3R3E A;  5IO2 A;  2M80 A;  1R5A A;  4IHU A;  2IIY A;  5FHI A;  2WUL A;  4DSS A;  2RM5 A;  3HYP A;  3NZN A;  2CT6 A;  1TRW A;  2K8S A;  4OFM A;  4XS4 B;  3TRQ A;  1FVK A;  1GSQ A;  1QUW A;  1FHE A;  4RQX A;  1M99 A;  4MPF A;  3QD9 A;  1T7P B;  1EV4 A;  4NPB A;  3WGD A;  1TI1 A;  1X9S B;  3ZIT A;  2VUP A;  5DAK A;  1GNE A;  4KSO A;  2WGR A;  2B7J A;  3ZML A;  2OAD A;  2HRK A;  3LGC A;  1USB A;  3TJK A;  1J9B A;  2LRC A;  5G30 A;  2ON5 A;  5AGY A;  2UZ8 A;  4OFN A;  4F2I A;  2PMT A;  3C8E A;  3GKK A;  6GSU A;  1YY7 A;  3E9J B;  1NSW A;  3A3T A;  2K9F A;  4J56 E;  1YJ6 A;  4NWY A;  4FH8 A;  1XWK A;  1E6B A;  1PA3 A;  3VWU A;  4BWS A;  1GSS A;  3CTF A;  4EF0 A;  4WKW A;  1MTC A;  2VCW A;  2RUF A;  4O92 A;  5HR1 A;  6GSS A;  4POB A;  1A0F A;  1EEJ A;  4O5R A;  4F9Z A;  3GX8 A;  2R2J A;  2CAQ A;  1WE0 A;  3VUR A;  4V1A g;  1F9M A;  2FD3 A;  2C4J A;  2RM6 A;  1T1V A;  5JCU A;  4KUN A;  3L9V A;  3FY7 A;  2DBC A;  4OWY A;  3EVI A;  1SK2 A;  2L4Q A;  2H30 A;  5B6M A;  2N5F A;  1Z9H A;  1A24 A;  1CQH A;  2CV4 A;  2VIM A;  4EXJ A;  3E3E A;  4KH7 A;  3W6G A;  2LJK A;  4ULX A;  1ERT A;  2C1Y A;  4O32 A;  2F3M A;  1YF0 A;  5IMA A;  2GST A;  1Z6M A;  3L9S A;  4GQF A;  1GNW A;  4MJE A;  3KIJ A;  1TRS A;  3U5R E;  1HNA A;  3MDK A;  4HU9 A;  3K8N A;  3FYG A;  4K9Z A;  5IOW A;  2AV4 A;  3KP9 A;  5LCZ A;  4NHW A;  4H86 A;  3EMX A;  5ECI B;  4N10 A;  5L71 A;  1O6J A;  3Q19 A;  4TR1 B;  2R3X A;  1TU7 A;  4USS A;  2GT6 A;  1SD8 A;  2VL3 A;  2M72 A;  2OE0 A;  1AQW A;  5G1K A;  5A4W A;  4AJ6 A;  3ZL5 A;  5F05 A;  3LFL A;  1K0B A;  1TJD A;  3IDV A;  1ON4 A;  4HOJ A;  2Z9S A;  2IFQ A;  3KD0 A;  3FR6 A;  2MYG A;  5CAX A;  5G1L A;  2VLT A;  1DE2 A;  4POL A;  1GP1 A;  4HEA 2;  1EZK A;  5ECR B;  2YV9 A;  3KCM A;  1Z7P A;  4EVM A;  4ML1 A;  3CSJ A;  1ZYE A;  4PX1 A;  4V2M A;  5H5R A;  1K0C A;  1C72 A;  2DJK A;  4MH2 A;  5DCH A;  2PWJ A;  4WEY A;  4TN8 A;  1ILO A;  4KX4 A;  2H76 A;  4ZB9 A;  3KZQ A;  2FCH A;  1EWX A;  6GSX A;  2X8C A;  3F4S A;  2E2M A;  1NHY A;  2JAD A;  1XPV A;  4K7I A;  3UJ1 A;  2YCD A;  1T3B A;  4RUV A;  1SKS B;  5ABR A;  3APS A;  1K0A A;  4YAP A;  4XCS A;  4GTU A;  2AUV A;  1O81 A;  3RDW A;  4WR5 A;  5DAL A;  5EL8 A;  2GVP A;  4HU7 A;  2MBS A;  5EPF A;  3GKN A;  2HRF A;  3ME8 A;  1F2E A;  2YAN A;  4MZB A;  3HJM A;  3RHC A;  1GSF A;  1SKW B;  1TRV A;  4ZL7 A;  4GWR A;  4L0W A;  2LST A;  3R2Q A;  1SYX A;  3ZLP A;  5IPG A;  2R4V A;  2O8V B;  2OE1 A;  4I2T A;  4IVF A;  3RPN A;  1TW9 A;  2H0H A;  4AJ8 A;  5E4W A;  4KSM A;  4I8B A;  1KBN A;  2C0E A;  3KP8 A;  3VPT A;  3QAV A;  4BVY B;  4WET A;  3WD6 A;  4BL7 B;  1GLQ A;  1G7E A;  3ED3 A;  2GGT A;  3UVT A;  3APQ A;  4KGI A;  1SU9 A;  1PSQ A;  10GS A;  4GLT A;  2GSS A;  4YQM A;  2JAC A;  5E59 A;  4BVX A;  2H6Z A;  4OCE A;  1AIU A;  5JWO B;  1SK0 A;  2DJ0 A;  2YJ7 A;  5HR3 A;  4L8E A;  2HT9 A;  3DGQ A;  2LQQ A;  3ISO A;  3HHV A;  3I9V 2;  3KMO A;  5F06 A;  4FYC A;  4MF7 A;  1WIK A;  2VL2 A;  2O85 A;  4KE3 A;  2HSN B;  2WRT A;  2HYX A;  5ECH B;  1RK4 A;  3WYW A;  4GRF A;  2VCV A;  1TI3 A;  3A2W A;  2BJX A;  4TXO A;  2G0F A;  4ACS A;  3JCM L;  5FT3 A;  1SYR A;  3IHQ A;  1U87 A;  1NM3 A;  1X5D A;  4HJ2 A;  3TKS A;  3HKR A;  4X0X A;  3DXB A;  3UEM A;  4I2U A;  2DJ3 A;  4TOP A;  3TJB A;  4XS1 A;  3MSZ A;  4KAE A;  5D73 A;  5IPH A;  4YQV A;  2JU5 A;  4GQC A;  3FKF A;  5G2Z A;  3M9J A;  1JLV A;  2B3S A;  5INY A;  1Q98 A;  4EDY A;  3IR4 A;  3HA9 A;  4NV5 A;  5CRD A;  3VWV A;  2F51 A;  5CYY A;  3ZIV A;  2HFD A;  3FW2 A;  3L4N A;  5IIZ A;  2CA8 A;  3RHB A;  4IP6 A;  1SKR B;  2XBI A;  2IMK A;  3UL3 A;  5G5E A;  1NHO A;  5ECN B;  4N0V A;  2I1U A;  1OE8 A;  3LYK A;  4TVE A;  2B5E A;  1GUK A;  2B5Y A;  4V2N A;  2YOI A;  2DIY A;  1M2B A;  1A2L A;  1UN2 A;  3DVW A;  3QR6 A;  13GS A;  1V40 A;  1QMV A;  2I9H A;  4GXZ A;  2HLS A;  3IRA A;  1MDK A;  1OC3 A;  1VGL A;  1KNG A;  1F3A A;  3G9B A;  4FQU A;  1FG4 A;  1YDK A;  2LJR A;  5IMC A;  3QCP A;  1EOG A;  3GKM A;  4MJB A;  3DEX A;  4WBR D;  2I3Y A;  1VF4 A;  17GS A;  2HRN A;  1YZX A;  1LJR A;  1A2M A;  1JZW A;  4ECB A;  3HZ8 A;  2J9H A;  4HS1 A;  5ELG A;  2HXK A;  4MMM A;  1B8X A;  5AN1 A;  1GUM A;  4FYU A;  4G0I A;  2V41 A;  4HZ2 A;  2ALB A;  2R6K A;  4KDY A;  5F0G A;  2JL4 A;  4I5Q A;  2JSY A;  5IMD A;  5IMZ A;  1GUH A;  2KP2 A;  4EC0 A;  3CTG A;  5HFK A;  3PH9 A;  2RII A;  3FZA A;  1H4O A;  1S3A A;  3MAK A;  1XBS A;  3UBL A;  3LXZ A;  2QC7 A;  1XWC A;  2LTK A;  2JZS A;  2GTU A;  11GS A;  2NVL A;  3EWL A;  2F8F A;  2CZ2 A;  1PX6 A;  1OKT A;  2DLX A;  2GT5 A;  4KF9 A;  3KH7 A;  4MCU A;  5J3R A;  1TK8 B;  2OJL A;  5CRH A;  2OKA A;  3WT1 A;  3C7M A;  3CRU A;  2H72 A;  3GFK A;  4PUR A;  2HZE A;  3DRN A;  4KDU A;  3O3T A;  2FLS A;  4ECI A;  5H5Q A;  1XW6 A;  3M0F A;  2EIO A;  3DVX A;  2NPB A;  3IK7 A;  1AQV A;  1MEK A;  4QL9 A;  1OKD A;  2WZ9 A;  3EC3 A;  5GAN D;  3HVX A;  2K18 A;  1V57 A;  1Q4J A;  2PN8 A;  2WS2 A;  2H71 A;  2H19 A;  2LQO A;  3GRX A;  2KUC A;  2A4V A;  4IJ3 A;  4DEJ A;  4Z7X A;  4IQA A;  4D73 A;  2VO4 A;  3TRX A;  4X43 A;  3VLN A;  5D9T A;  4AGS A;  3GIX A;  3G7I A;  4G19 A;  2MMZ A;  3VI7 A;  4PNG A;  2HQT A;  4K8M A;  5AIS A;  4MPG A;  3TCO A;  5B6N A;  1WP0 A;  2QSI A;  4WBJ A;  2AJQ B;  1ML6 A;  3GX0 A;  5F07 A;  3ZTL A;  1I5G A;  3IOS A;  4V1A p;  2YWN A;  4TR4 A;  2KHP A;  4L5O A;  3CYN A;  1RQM A;  2C0F A;  2E0Q A;  3GYK A;  4ZXG A;  4EL1 A;  2PPT A;  4K1F A;  2B1L A;  3BCI A;  4V2L A;  3M3M A;  5BMU A;  5JWR B;  2GZZ A;  2MBT A;  18GS A;  2PER A;  1EV9 A;  2MMO A;  4DSS B;  4CW9 A;  1B9Y C;  3E0U A;  1GTI A;  5J9C A;  2C3T A;  2YWO A;  2WB9 A;  5ECS A;  2NTO A;  2IL3 A;  2HE3 A;  2ZCT A;  1QXH A;  2A2S A;  2GDR A;  3AY8 A;  5DAK B;  4XIH A;  4GSN A;  5J9B A;  2XHF A;  3UVH A;  1T00 A;  1EP7 A;  2HRK B;  2REM A;  3H8Q A;  4JR6 A;  2KOK A;  3F6F A;  4NHZ A;  2H6X A;  1HNB A;  2HNL A;  1XW5 A;  1ZOF A;  1AAZ A;  1Y25 A;  4F03 A;  5B8A A;  1A2J A;  2DIZ A;  2KLX A;  2X8G A;  2YWM A;  4YH2 A;  1A8Y A;  5D93 A;  2C80 A;  1K3Y A;  1EP8 A;  1X9W B;  1THO A;  4JR4 A;  1I9D A;  3IC8 A;  1NW2 A;  3D5J A;  1TKD B;  3WGE A;  3SWL A;  2JSZ A;  4TR1 A;  3GL5 A;  4MH3 A;  4FO5 A;  2BMX A;  1YEX A;  2GQL A;  5CRG A;  2HSM A;  4Q5R A;  2L59 A;  1M9A A;  2WFC A;  1ZMA A;  2N5A A;  4ZB6 A;  3VI5 A;  2BTO T;  3F4R A;  1JZR A;  1R26 A;  1BX9 A;  1K3O A;  3F3R A;  5LD0 A;  2CX4 A;  2GZP A;  4TR3 A;  4WR4 A;  2GQK A;  1YKA A;  3GTU B;  6GSV A;  4MF5 A;  4JU5 A;  4HZ4 A;  3GST A;  1A23 A;  2WJU A;  1M2D A;  5A5K A;  1EEM A;  3EU3 A;  2AHE A;  3NIV A;  4QQ7 A;  3PR8 A;  1GUL A;  5HR0 A;  2I81 A;  3GMF A;  1S3C A;  2VCX A;  3BCK A;  1XVW A;  5IO0 A;  3FEU A;  2YZH A;  4HJM A;  4G0L A;  1ZCP A;  1T4Z A;  3LSZ A;  4XTS A;  1GRX A;  2JZT A;  3KMN A;  14GS A;  3HDC A;  2FA4 A;  2CQ9 A;  1VRS D;  2B6M A;  3EE2 A;  1ZGN A;  2CVB A;  2EIR A;  5JCG A;  5G5F A;  3IC4 A;  3TOT A;  3Q74 A;  4ECC A;  5KN3 A;  5GST A;  1DE1 A;  4JED A;  2YJH A;  4IBP A;  1LU4 A;  3M1G A;  4IP1 A;  4MF6 A;  4PUA A;  1PL1 A;  1ZZY A;  2XBQ A;  3M9K A;  5KN1 A;  20GS A;  1JLW A;  1B9X C;  2GQM A;  3GTU A;  1F37 A;  1EGR A;  1Z7R A;  2GLR A;  2IN3 A;  1OC9 A;  3LQ7 A;  1R4W A;  3A2V A;  5ECQ B;  4POM A;  3EUR A;  3FZ4 A;  1B4Q A;  2GSR A;  4MDC A;  5CP1 A;  1EGO A;  2OBI A;  4HI7 A;  5DVB A;  4ZBD A;  3D4M A;  3BD2 A;  2LRN A;  1XWB A;  3HCZ A;  1GSD A;  9GSS A;  4ZL9 A;  4BVY A;  3IAM 2;  3EU4 A;  3GN3 A;  2OE3 A;  1Z5Y E;  2L4C A;  3PGT A;  2H01 A;  1JZD A;  2MMA A;  3KXO A;  1MD3 A;  2H8L A;  1SD9 A;  2YZU A;  1FW1 A;  1RW1 A;  1WOU A;  1ST9 A;  2X99 A;  1SL2 B;  3IBH A;  2H1G A;  1XIY A;  4GCI A;  2V6O A;  2IWT A;  3BOA A;  1GSU A;  5DJM A;  2MZC A;  3W8S A;  1JFU A;  1THX A;  2V2G A;  5HQP A;  6GSY A;  2P31 A;  3QAG A;  3H79 A;  3LEF A;  5DCG A;  2PU9 C;  3TJF A;  3IE3 A;  3IPZ A;  1WMJ A;  2FWG A;  2HSH A;  2AAW A;  1BG5 A;  3KGK A;  4KA0 A;  2WDU A;  1ERW A;  5GZZ B;  2K6V A;  4ZIL A;  3WT2 A;  5DAL B;  5CRW A;  4OMV A;  1PGT A;  1BAY A;  4N0Z A;  4IQ1 A;  2WCI A;  2H73 A;  2C0D A;  2F9S A;  1O85 A;  2EIQ A;  1N2A A;  1JZO A;  2YV7 A;  2PUK C;  2P0G A;  2QGV A;  2YN1 A;  6GSW A;  2DSA A;  3A2X A;  5HFG A;  5AIX A;  4AJ7 A;  5ECP B;  5ELA A;  3IAS 2;  4GF0 A;  5GAP D;  1DUG A;  1PKW A;  1DBY A;  3FR9 A;  1UC7 A;  1B48 A;  4I6X A;  3TKQ A;  2J23 A;  5ID2 B;  5D9W A;  3EYT A;  2CVK A;  2DC5 A;  2LRT A;  1BED A;  3GNJ A;  3ZVJ D;  1OYJ A;  2AB6 A;  3KTB A;  2E2G A;  2LKU A;  3P2A A;  1SJZ A;  4MLY A;  2VD0 A;  4PNF A;  4EDZ A;  1PN9 A;  2VCT A;  1WPI A;  1R7H A;  4G2E A;  3GA4 A;  4LL1 B;  3OR5 A;  1V98 A;  2CZ3 A;  2HZF A;  4K6X A;  1IYH A;  5JCW A;  1UA5 A;  1SL0 B;  1XW9 A;  3QDN A;  4TXO B;  2VCQ A;  3F0I A;  3VFI A;  3DYR A;  4ZBA A;  1SL1 B;  1ZL9 A;  4Q5N A;  3HVS A;  3GH9 A;  2VM1 A;  1ERV A;  4XRA A;  3QMX A;  2C8U A;  1TU8 A;  1KEB A;  1VF2 A;  1X5E A;  1SJI A;  2XC2 A;  3O6T A;  3ZYW A;  4CDO A;  2V32 A;  1MDI A;  2X64 A;  5EVO A;  3DKS A;  1PQN A;  3RPP A;  3W8J A;  3P8W A;  3NOF A;  2M46 A;  4JRR A;  5EY6 A;  3ZRE A;  4BA7 A;  3L9U A;  3LYP A;  3RBT A;  1M7T A;  4F82 A;  2VM2 A;  4P3Y B;  4XRD A;  4JBB A;  2KP1 A;  5DDL A;  2LV3 A;  2P5R A;  1A0R P;  3EMP A;  1OAZ A;  2PBJ A;  3O76 A;  1FVJ A;  1TXX A;  2OBK A;  4IGJ A;  3ZFB A;  4KCA A;  3IV4 A;  1F3B A;  4KB3 A;  1PKZ A;  3GL3 A;  1TK5 B;  2VL2 C;  4QL7 A;  5CNW A;  2F8A A;  1U3I A;  1M9B A;  4TW5 A;  3CRT A;  1Z6N A;  2OAC A;  3GHA A;  2FY6 A;  2H75 A;  1FB6 A;  2JZR A;  3UAR A;  1FB0 A;  4HQZ A;  3TKS C;  4KND A;  1YKC A;  3MWH A;  3HJP A;  1ABA A;  1K0D A;  4KCE A;  19GS A;  4EO3 A;  3CSH A;  4XS4 A;  5ECL B;  2B1K A;  1X5C A;  5IMV A;  3N9J A;  3HZ4 A;  4TXV A;  1PX7 A;  1K0O A;  5FWG A;  4G9H A;  2L57 A;  1OE7 A;  4HUA A;  1TDI A;  4DVC A;  5CRE A;  5F8B A;  1A8L A;  3TUE A;  5GSS A;  3IXR A;  5KN2 A;  1LBK A;  1T8E B;  1AC1 A;  4CHS A;  4MZW A;  5AIV A;  3WGX A;  2TRX A;  1OC8 A;  1XFL A;  3TKP A;  3US3 A;  3H4K A;  5H5S A;  1JHB A;  3J7Y b;  4IKH A;  1AXD A;  1AUC A;  2A2R A;  4Q5Q A;  1XVQ A;  2H0I A;  2HZE B;  3M8N A;  2B5X A;  2P5Q A;  2GS3 A;  1V2A A;  3LJR A;  3HVV A;  3CMI A;  2YNX A;  4POK A;  3D0Z A;  1J08 A;  4IN0 A;  1Z3E A;  3Q18 A;  3D22 A;  12GS A;  3P7X A;  3F3Q A;  5DQS A;  4D73 B;  1BJX A;  2C0G A;  1KTE A;  5IOX A;  2C3N A;  4OD7 A;  1XOA A;  2IMI A;  2GSQ A;  1HD2 A;  3ME7 A;  2FA8 A;  1PRX A;  3I6A A;  5D9X A;  3ERF A;  4WXT A;  4OO5 A;  4NXI A;  5D8I A;  2FHE A;  3BJ5 A;  1GLP A;  2L5O A;  4JZQ A;  3DD3 A;  4MZC A;  1SEN A;  4PQ1 A;  2FGX A;  2TRC P;  1M0U A;  2IMF A;  4YQU A;  5HR2 A;  7GSS A;  3F6D A;  1HQO A;  2NBS A;  4F0C A;  4E8H A;  3KJY A;  3G7Y A;  4ML6 A;  3ZZX A;  2LNT A;  1QGV A;  3GV1 A;  3KTL A;  1URM A;  2VOC A;  4PQH A;  2FWF A;  5ECK B;  4K7N A;  1E2Y A;  1AQX A;  4J2F A;  3HXS A;  3U6V A;  1YQ1 A;  3UMA A;  3SBC A;  3LWA A;  5J5N A;  4K0N A;  2YWI A;  1R5P A;  1G6W A;  3BBY A;  4BWQ A;  3GKX A;  3A5W A;  2DML A;  2R5G A;  3ERW A;  4MJC A;  1WWJ A;  4JE1 A;  3TJG A;  4DSR A;  1FO5 A;  1YEP A;  2EC4 A;  4YAV A;  3H1N A;  2XPE A;  4K0G A;  3C1R A;  2H66 A;  4IJI A;  4ISD A;  4TR0 A;  3TOU A;  4FIW A;  2O89 A;  1H75 A;  3HD5 A;  4Q5F A;  4X1U A;  3VWX A;  4NMU A;  2VCZ A;  2H74 A;  3VPQ A;  1W4V A;  1GH2 A;  4TKY A;  4RQR A;  3S9F A;  3FK8 A;  2LNS A;  4LLR A;  4ID0 A;  2N5B A;  2B7K A;  3N5O A;  4PXO A;  1XWG A;  2FUG 2;  5JWQ B;  8GSS A;  3GH6 A;  3IK9 A;  4ILF A;  1K3L A;  3I69 A;  1DSB A;  2HSM B;  3UBK A;  1VF1 A;  1IYI A;  2X8H A;  2O87 A;  5IM9 A;  4G0K A;  4BPY A;  1X9M B;  4ZBB A;  3LOR A;  5COH A;  3FHK A;  1OVN A;  4LA1 A;  4KDX A;  2D2Z A;  1TK0 B;  2PVO C;  4FYB A;  1G7O A;  3C71 A;  4WF5 A;  2LJA A;  3FR3 A;  1F6M C;  2RUE A;  2I4A A;  3EIN A;  5ECO B;  2IPA A;  4F0B A;  2VL9 A;  3HJO A;  2YPM A;  1U6T A;  4MP4 A;  2LUS A;  3TKS E;  2FWE A;  4LMV A;  2IFQ B;  3QOU A;  4WF4 A;  3TDG A;  1TRU A;  1FAA A;  3L0H A;  4BL7 A;  1MDJ A;  4MK3 A;  1X0R A;  2E7P A;  2IME A;  3LG6 A;  5D9V A;  1SK1 A;  2IMD A;  3F9U A;  4N30 A;  4NV2 A;  4GSS A;  4RI6 A;  4DSQ A;  2V6K A;  3VK9 A;  3TJJ A;  3UAP A;  4PUF C;  5HFI A;  2MMN A;  3LXT A;  4IS0 A;  5ENU A;  2H1A A;  2G2Q A;  3Q6O A;  1T4Y A;  1OC9 B; 
#chains in the Genus database with same CATH topology
 2NDO A;  1GTU A;  3APO A;  1U3A A;  3D4T A;  4MAB A;  2HSN A;  5A1N A;  1W89 A;  5DBQ A;  2PVQ A;  3ZMK A;  4YKG A;  2R37 A;  4N11 A;  2DJJ A;  3GUS A;  3GUR A;  3QFB C;  3CXG A;  1UVZ A;  4ECJ A;  3QFA C;  2HI7 A;  4ZIJ A;  3F8U A;  3UOM A;  2GZY A;  5B8B A;  1MD4 A;  4MA9 A;  1V9W A;  3QPM A;  4HDE A;  4AF2 A;  5ID2 A;  2VD1 A;  3DML A;  1O73 A;  5LNK e;  3P90 A;  2K8V A;  2H1D A;  2ZNM A;  2FNO A;  2V1M A;  3UIW A;  2VLV A;  4E8E A;  2L6D A;  5ECM B;  2VLU A;  3EPT A;  5C00 A;  3QAW A;  4EE0 A;  1U88 A;  2DJ2 A;  2HRA A;  3KEB A;  2L5L A;  3F4T A;  4Z2R A;  1QK8 A;  1VF3 A;  5J4U A;  2PGT A;  2IJY A;  3ZRD A;  5KEJ A;  1J0F A;  3DIE A;  4XHM A;  1YVL A;  2LEG A;  1K0M A;  4Z2T A;  4E68 A;  3ERG A;  1PMT A;  3CBU A;  2EFC A;  3ZFL A;  1FOV A;  1K0N A;  1N8J A;  1GTA A;  2XPD A;  1G0T A;  4BVX B;  4IW9 A;  1ACV A;  2R0G A;  1S3D A;  3MNG A;  2RLI A;  22GS A;  2QKE A;  5A4V A;  5J41 A;  4HQS A;  3ZVJ A;  4PGT A;  5C04 A;  4XS6 A;  4ZB8 A;  4K7O A;  1V58 A;  3L78 A;  1QFN A;  4EUY A;  1GSY A;  5DQY A;  5G31 A;  2CX3 A;  4CY6 A;  4GST A;  4OCF A;  1Y6E A;  1AW9 A;  3J7Y k;  2CVD A;  4LL4 B;  2H70 A;  1QQ2 A;  6GST A;  2X4A A;  4W66 A;  4KW6 A;  5D96 A;  1GTB A;  5IMF A;  3FZ9 A;  4ZL8 A;  1BYE A;  4RI7 A;  4IEL A;  1GSE A;  1XZO A;  1ZYQ B;  4O7H A;  1TOF A;  2H0G A;  1EOH A;  3IA1 A;  4LMW A;  1FOH A;  3VWW A;  3Q6O A;  3KM6 A;  1G6Y A;  1XWA A;  2ES7 A;  1HYU A;  4L0U A;  2CAI A;  2AYT A;  3D6I A;  1O8W A;  2ON7 A;  3CSI A;  4PQI A;  1ZYP A;  3H93 A;  2VAF A;  5A4U A;  4OFT A;  2O7K A;  2FWH A;  1I1I P;  1HNC A;  1O8X A;  1SJ6 A;  3V1W A;  3KH9 A;  1WRY A;  3RAZ A;  2ZUP A;  4OO4 A;  1GWC A;  2LS5 A;  1ERU A;  1TP9 A;  1WJK A;  1GL8 A;  4EKZ A;  1BQ7 A;  5B7C A;  3GSS A;  2OA7 A;  3MIX A;  3PIN A;  3I43 A;  3TRP A;  1XCC A;  16GS A;  4NAX A;  3FRC A;  1M2A A;  3DWV A;  4PTS A;  3TKR A;  1CQG A;  3C73 A;  2H6Y A;  3TB2 A;  2DMM A;  3HY2 A;  2HSY A;  1TTZ A;  2DJ1 A;  2YP6 A;  2UV8 G;  4G10 A;  1XXU A;  5KN0 A;  5CO3 A;  4J57 E;  1B4P A;  3ZIJ A;  3F63 A;  1O7U A;  1XOB A;  3G7J A;  4MJA A;  5IQY A;  2QA2 A;  4GDF A;  3C1S A;  3D21 A;  1YF1 A;  3A5I A;  3HMJ G;  2C3Q A;  3PPU A;  4K2D A;  4TRX A;  4L5L A;  2TIR A;  1PD2 1;  1PL2 A;  4I97 A;  3TGZ A;  3FZ5 A;  2H1B A;  2L6C A;  5DJL A;  3R3E A;  5IO2 A;  2M80 A;  1R5A A;  4IHU A;  2IIY A;  5FHI A;  2WUL A;  4DSS A;  2RM5 A;  3HYP A;  3NZN A;  2CT6 A;  1TRW A;  2K8S A;  4OFM A;  4XS4 B;  3TRQ A;  1FVK A;  1GSQ A;  1QUW A;  1FHE A;  4RQX A;  1M99 A;  4MPF A;  3QD9 A;  1T7P B;  1EV4 A;  4NPB A;  3WGD A;  1TI1 A;  1X9S B;  3ZIT A;  2VUP A;  5DAK A;  1GNE A;  4KSO A;  2WGR A;  2B7J A;  3ZML A;  2OAD A;  2HRK A;  3LGC A;  1USB A;  3TJK A;  1J9B A;  2VKZ G;  2LRC A;  5G30 A;  2ON5 A;  5AGY A;  2UZ8 A;  4OFN A;  4F2I A;  2PMT A;  3C8E A;  3GKK A;  2O5V A;  6GSU A;  1YY7 A;  3E9J B;  1NSW A;  3A3T A;  2K9F A;  4J56 E;  5BRT A;  1YJ6 A;  4NWY A;  4FH8 A;  1XWK A;  1E6B A;  1PA3 A;  3VWU A;  4BWS A;  1GSS A;  1SVL A;  3CTF A;  4EF0 A;  4WKW A;  1MTC A;  2VCW A;  2RUF A;  4O92 A;  5HR1 A;  6GSS A;  4POB A;  1A0F A;  4FXY P;  1EEJ A;  4O5R A;  4QMK A;  4F9Z A;  3GX8 A;  2R2J A;  2CAQ A;  1WE0 A;  2EFE A;  3VUR A;  4V1A g;  1F9M A;  2FD3 A;  2C4J A;  3RGB C;  2RM6 A;  1T1V A;  5JCU A;  2WW3 A;  4KUN A;  3L9V A;  3FY7 A;  2DBC A;  4OWY A;  3EVI A;  1SK2 A;  2L4Q A;  2H30 A;  5B6M A;  2N5F A;  1Z9H A;  1A24 A;  1CQH A;  2CV4 A;  2VIM A;  4EXJ A;  3E3E A;  4KH7 A;  3W6G A;  2LJK A;  4ULX A;  1ERT A;  2C1Y A;  4O32 A;  2F3M A;  1YF0 A;  5IMA A;  2GST A;  1Z6M A;  4BIK A;  3L9S A;  4GQF A;  1GNW A;  4MJE A;  3KIJ A;  1TRS A;  3U5R E;  1HNA A;  3MDK A;  4HU9 A;  3K8N A;  5KOX A;  3FYG A;  4K9Z A;  5IOW A;  2AV4 A;  3KP9 A;  5LCZ A;  4NHW A;  4H86 A;  3EMX A;  5ECI B;  4N10 A;  5L71 A;  1O6J A;  3Q19 A;  4TR1 B;  2R3X A;  1TU7 A;  4USS A;  2GT6 A;  1SD8 A;  2VL3 A;  2M72 A;  2OE0 A;  1AQW A;  5G1K A;  5A4W A;  4AJ6 A;  3ZL5 A;  5F05 A;  3LFL A;  1K0B A;  1TJD A;  3IDV A;  1ON4 A;  4HOJ A;  2Z9S A;  2IFQ A;  3KD0 A;  4K5S A;  3FR6 A;  2MYG A;  5CAX A;  5G1L A;  2VLT A;  1DE2 A;  4POL A;  1GP1 A;  4HEA 2;  1EZK A;  5ECR B;  3FMW A;  2YV9 A;  3KCM A;  1Z7P A;  4EVM A;  4ML1 A;  3CSJ A;  1ZYE A;  4PX1 A;  4V2M A;  5H5R A;  1K0C A;  1C72 A;  2DJK A;  4MH2 A;  5DCH A;  2PWJ A;  4WEY A;  4TN8 A;  1ILO A;  4KX4 A;  5A34 B;  2H76 A;  1M3J A;  4ZB9 A;  3KZQ A;  4PI2 C;  2FCH A;  1EWX A;  6GSX A;  2X8C A;  3F4S A;  2E2M A;  1NHY A;  2JAD A;  1XPV A;  4K7I A;  3UJ1 A;  2YCD A;  1T3B A;  4RUV A;  3CHX C;  1SKS B;  5ABR A;  3APS A;  1K0A A;  4YAP A;  4XCS A;  4GTU A;  2AUV A;  1O81 A;  3RDW A;  4WR5 A;  5DAL A;  5EL8 A;  2GVP A;  4HU7 A;  2MBS A;  5EPF A;  3GKN A;  2WW0 A;  2HRF A;  3ME8 A;  1F2E A;  2YAN A;  4MZB A;  3HJM A;  3RHC A;  1GSF A;  1SKW B;  1TRV A;  4ZL7 A;  4GWR A;  4L0W A;  2LST A;  3R2Q A;  5A5H B;  1SYX A;  3ZLP A;  5IPG A;  2R4V A;  2O8V B;  2OE1 A;  4I2T A;  4IVF A;  3RPN A;  1TW9 A;  2H0H A;  4AJ8 A;  5E4W A;  4KSM A;  4I8B A;  1SVO A;  1KBN A;  2C0E A;  3KP8 A;  3VPT A;  3QAV A;  1S4B P;  4BVY B;  4WET A;  3WD6 A;  4BL7 B;  1GLQ A;  1G7E A;  3ED3 A;  2GGT A;  3UVT A;  3APQ A;  4KGI A;  1SU9 A;  1PSQ A;  10GS A;  4GLT A;  2GSS A;  4YQM A;  2JAC A;  5E59 A;  4BVX A;  2H6Z A;  4OCE A;  1AIU A;  5JWO B;  1SK0 A;  2DJ0 A;  2YJ7 A;  5HR3 A;  4L8E A;  2HT9 A;  3DGQ A;  2LQQ A;  3ISO A;  3HHV A;  3I9V 2;  3KMO A;  5F06 A;  4FYC A;  4MF7 A;  1WIK A;  2VL2 A;  2O85 A;  4KE3 A;  2HSN B;  4AKI A;  2WRT A;  2HYX A;  5ECH B;  1RK4 A;  3WYW A;  4GRF A;  2VCV A;  1TI3 A;  3A2W A;  2BJX A;  4TXO A;  4A5P A;  2G0F A;  4ACS A;  3JCM L;  5FT3 A;  3HVN A;  1SYR A;  3IHQ A;  1U87 A;  1NM3 A;  1X5D A;  4HJ2 A;  2WVX A;  3TKS A;  3HKR A;  4X0X A;  3DXB A;  5J4Y A;  3UEM A;  4I2U A;  2DJ3 A;  4TOP A;  3TJB A;  4XS1 A;  3MSZ A;  4KAE A;  5D73 A;  5IPH A;  4YQV A;  2JU5 A;  4GQC A;  3FKF A;  5G2Z A;  3M9J A;  1JLV A;  2B3S A;  5INY A;  1Q98 A;  4EDY A;  3IR4 A;  3HA9 A;  4NV5 A;  5CRD A;  3VWV A;  2F51 A;  5CYY A;  3ZIV A;  2HFD A;  3FW2 A;  4O5U A;  3L4N A;  5IIZ A;  2CA8 A;  3RHB A;  4IP6 A;  1SKR B;  2XBI A;  2IMK A;  3UL3 A;  5G5E A;  1NHO A;  5ECN B;  2I1U A;  4X4J A;  1OE8 A;  3LYK A;  4TVE A;  2B5E A;  1GUK A;  2B5Y A;  4V2N A;  2YOI A;  2DIY A;  1M2B A;  1A2L A;  1UN2 A;  3DVW A;  3QR6 A;  13GS A;  1V40 A;  1QMV A;  2I9H A;  4GXZ A;  2HLS A;  3IRA A;  1MDK A;  1OC3 A;  1VGL A;  1KNG A;  1F3A A;  3G9B A;  4FQU A;  1FG4 A;  1YDK A;  2LJR A;  5IMC A;  3QCP A;  1EOG A;  3GKM A;  4MJB A;  3DEX A;  4WBR D;  2I3Y A;  1VF4 A;  17GS A;  2HRN A;  1YZX A;  1LJR A;  1A2M A;  1JZW A;  4ECB A;  3HZ8 A;  2J9H A;  4HS1 A;  5ELG A;  2HXK A;  4MMM A;  1B8X A;  5AN1 A;  1GUM A;  4FYU A;  4G0I A;  2V41 A;  4HZ2 A;  2ALB A;  2R6K A;  4KDY A;  5F0G A;  2JL4 A;  4I5Q A;  2JSY A;  5IMD A;  1M3I A;  2A4H A;  5IMZ A;  1GUH A;  2KP2 A;  4EC0 A;  3CTG A;  5HFK A;  3PH9 A;  2RII A;  3FZA A;  1H4O A;  1S3A A;  3MAK A;  1XBS A;  3UBL A;  3LXZ A;  2QC7 A;  1XWC A;  2LTK A;  2JZS A;  2GTU A;  11GS A;  2NVL A;  3EWL A;  2F8F A;  2CZ2 A;  1PX6 A;  1OKT A;  2DLX A;  2GT5 A;  4KF9 A;  3KH7 A;  4MCU A;  5J3R A;  1TK8 B;  2OJL A;  5CRH A;  2OKA A;  3WT1 A;  3C7M A;  3GFK A;  3CRU A;  2H72 A;  4PUR A;  2HZE A;  3DRN A;  4KDU A;  3O3T A;  4PI0 C;  2FLS A;  4ECI A;  5H5Q A;  1XW6 A;  3M0F A;  2EIO A;  3DVX A;  2NPB A;  3IK7 A;  1AQV A;  1MEK A;  4QL9 A;  1OKD A;  2WZ9 A;  3LW9 A;  3EC3 A;  5GAN D;  3HVX A;  2K18 A;  1V57 A;  1Q4J A;  2PN8 A;  1N25 A;  2WS2 A;  2H71 A;  2H19 A;  2LQO A;  3GRX A;  2KUC A;  2A4V A;  4IJ3 A;  4DEJ A;  4Z7X A;  4IQA A;  4D73 A;  2VO4 A;  3TRX A;  4X43 A;  3VLN A;  5D9T A;  4AGS A;  3GIX A;  3G7I A;  3TU3 B;  4G19 A;  2MMZ A;  3VI7 A;  4PNG A;  2HQT A;  4K8M A;  5AIS A;  4MPG A;  3TCO A;  5B6N A;  1WP0 A;  4ICY A;  2QSI A;  4WBJ A;  2AJQ B;  1ML6 A;  3GX0 A;  5F07 A;  3ZTL A;  4YKF A;  1I5G A;  3IOS A;  4V1A p;  2YWN A;  4TR4 A;  2KHP A;  4L5O A;  3CYN A;  1RQM A;  2C0F A;  2E0Q A;  3GYK A;  4ZXG A;  4EL1 A;  2PPT A;  4K1F A;  2B1L A;  3BCI A;  4V2L A;  3M3M A;  5BMU A;  5JWR B;  2GZZ A;  2MBT A;  18GS A;  2PER A;  1EV9 A;  2MMO A;  4DSS B;  4CW9 A;  1B9Y C;  3E0U A;  1GTI A;  5J9C A;  2C3T A;  2YWO A;  2WB9 A;  5ECS A;  2NTO A;  2IL3 A;  2HE3 A;  2ZCT A;  2X49 A;  1QXH A;  2A2S A;  2GDR A;  3AY8 A;  5DAK B;  4XIH A;  4GSN A;  5J9B A;  2XHF A;  3UVH A;  1T00 A;  1EP7 A;  2HRK B;  2REM A;  3H8Q A;  4JR6 A;  2KOK A;  3F6F A;  2A2P A;  4NHZ A;  2H6X A;  1HNB A;  2HNL A;  1XW5 A;  5KOW A;  1ZOF A;  1AAZ A;  1Y25 A;  4F03 A;  5B8A A;  1A2J A;  2DIZ A;  2KLX A;  2X8G A;  2YWM A;  4YH2 A;  1A8Y A;  5D93 A;  2C80 A;  1K3Y A;  1EP8 A;  1X9W B;  1THO A;  4JR4 A;  1I9D A;  3IC8 A;  1NW2 A;  3D5J A;  1TKD B;  3WGE A;  3SWL A;  2JSZ A;  4TR1 A;  3GL5 A;  4MH3 A;  4FO5 A;  2BMX A;  1YEX A;  2GQL A;  5CRG A;  2HSM A;  4Q5R A;  2L59 A;  1M9A A;  2WFC A;  1ZMA A;  2N5A A;  4ZB6 A;  3VI5 A;  2BTO T;  3F4R A;  1JZR A;  1R26 A;  1BX9 A;  1K3O A;  3F3R A;  5LD0 A;  2CX4 A;  2GZP A;  4TR3 A;  4WR4 A;  2GQK A;  1YKA A;  3GTU B;  6GSV A;  4MF5 A;  4JU5 A;  4HZ4 A;  3GST A;  1A23 A;  2WJU A;  1M2D A;  5A5K A;  1EEM A;  3EU3 A;  2AHE A;  3NIV A;  4QQ7 A;  3PR8 A;  1GUL A;  5HR0 A;  2I81 A;  3GMF A;  1S3C A;  2VCX A;  3BCK A;  1XVW A;  1YEW C;  1TXU A;  5IO0 A;  3FEU A;  2YZH A;  4HJM A;  4G0L A;  1ZCP A;  1T4Z A;  3LSZ A;  4XTS A;  1GRX A;  2JZT A;  1S3R A;  3KMN A;  14GS A;  3HDC A;  2FA4 A;  2CQ9 A;  1VRS D;  2B6M A;  3EE2 A;  1ZGN A;  2CVB A;  2EIR A;  5JCG A;  5G5F A;  3IC4 A;  2R0C A;  3TOT A;  3Q74 A;  4ECC A;  5KN3 A;  4K2X A;  5GST A;  1DE1 A;  4JED A;  2YJH A;  4IBP A;  4N3Z A;  3M1G A;  1LU4 A;  4IP1 A;  4MF6 A;  4PUA A;  1PL1 A;  1ZZY A;  2XBQ A;  3M9K A;  5KN1 A;  20GS A;  1JLW A;  1B9X C;  2GQM A;  3GTU A;  1F37 A;  1EGR A;  1Z7R A;  2GLR A;  2IN3 A;  1OC9 A;  3LQ7 A;  1R4W A;  3A2V A;  5ECQ B;  4POM A;  3EUR A;  5A5H A;  3FZ4 A;  1B4Q A;  2GSR A;  4MDC A;  5CP1 A;  1EGO A;  2OBI A;  4HI7 A;  5DVB A;  2DKI A;  4ZBD A;  3D4M A;  3BD2 A;  2LRN A;  1XWB A;  3HCZ A;  1GSD A;  9GSS A;  4ZL9 A;  4BVY A;  3IAM 2;  3EU4 A;  3GN3 A;  2R0P A;  2WW2 A;  2OE3 A;  1Z5Y E;  2L4C A;  3PGT A;  2H01 A;  1JZD A;  2MMA A;  3KXO A;  4AKH A;  1MD3 A;  2H8L A;  1SD9 A;  2YZU A;  1FW1 A;  1RW1 A;  1WOU A;  1ST9 A;  2X99 A;  1SL2 B;  3IBH A;  2H1G A;  1XIY A;  4GCI A;  2V6O A;  2IWT A;  3BOA A;  4G01 A;  1GSU A;  5DJM A;  2H1L A;  1SVM A;  2MZC A;  3W8S A;  1JFU A;  1THX A;  2V2G A;  5J4V A;  5HQP A;  6GSY A;  2P31 A;  3QAG A;  5J47 A;  3H79 A;  3LEF A;  5DCG A;  2PU9 C;  3TJF A;  3IE3 A;  4O5Q A;  3IPZ A;  1WMJ A;  2FWG A;  2HSH A;  2AAW A;  1BG5 A;  3KGK A;  4KA0 A;  2WDU A;  1ERW A;  5GZZ B;  2K6V A;  4ZIL A;  3WT2 A;  5DAL B;  5CRW A;  4OMV A;  1PGT A;  1BAY A;  4N0Z A;  4IQ1 A;  2WCI A;  2H73 A;  2C0D A;  2F9S A;  1O85 A;  2EIQ A;  1N2A A;  1JZO A;  2YV7 A;  2PUK C;  2P0G A;  2QGV A;  2YN1 A;  6GSW A;  2DSA A;  5A1N B;  3A2X A;  5HFG A;  5AIX A;  4AJ7 A;  5ECP B;  5ELA A;  3IAS 2;  4GF0 A;  5GAP D;  1DUG A;  1PKW A;  1DBY A;  3FR9 A;  2EFH A;  1UC7 A;  1B48 A;  4I6X A;  3TKQ A;  2J23 A;  5ID2 B;  5D9W A;  3EYT A;  2CVK A;  2DC5 A;  2LRT A;  1BED A;  3GNJ A;  3ZVJ D;  1OYJ A;  2AB6 A;  3KTB A;  2E2G A;  2LKU A;  3P2A A;  1SJZ A;  4MLY A;  2VD0 A;  4PNF A;  4EDZ A;  1PN9 A;  2VCT A;  1WPI A;  1R7H A;  4G2E A;  3GA4 A;  4LL1 B;  3OR5 A;  1V98 A;  2CZ3 A;  2HZF A;  4K6X A;  1IYH A;  5JCW A;  1UA5 A;  1SL0 B;  1XW9 A;  3QDN A;  4TXO B;  2VCQ A;  3F0I A;  2O3E A;  3VFI A;  3DYR A;  4ZBA A;  1SL1 B;  1ZL9 A;  2WVX B;  4Q5N A;  1PFO A;  3HVS A;  3GH9 A;  2DKH A;  2VM1 A;  1ERV A;  4XRA A;  3QMX A;  2C8U A;  1TU8 A;  1KEB A;  1VF2 A;  1X5E A;  1SJI A;  2XC2 A;  3O6T A;  3ZYW A;  4CDO A;  2V32 A;  2WVY A;  1MDI A;  2X64 A;  5EVO A;  3DKS A;  1PQN A;  3RPP A;  3W8J A;  3P8W A;  3NOF A;  2M46 A;  4JRR A;  5EY6 A;  3ZRE A;  4BA7 A;  3L9U A;  3LYP A;  3RBT A;  1M7T A;  4F82 A;  2VM2 A;  4EIP A;  4P3Y B;  4XRD A;  4JBB A;  2KP1 A;  5DDL A;  2LV3 A;  2P5R A;  1A0R P;  3EMP A;  1OAZ A;  2WVZ A;  2PBJ A;  3O76 A;  1FVJ A;  1TXX A;  2OBK A;  3IHG A;  4IGJ A;  3ZFB A;  4KCA A;  4EIQ A;  3IV4 A;  1F3B A;  4KB3 A;  1PKZ A;  3GL3 A;  1TK5 B;  2VL2 C;  4QL7 A;  5CNW A;  2F8A A;  4HSC X;  1U3I A;  1M9B A;  4TW5 A;  3CRT A;  1Z6N A;  2OAC A;  3CWG A;  3GHA A;  2FY6 A;  1XG8 A;  2H75 A;  1FB6 A;  2JZR A;  3UAR A;  1FB0 A;  4HQZ A;  3TKS C;  4KND A;  1YKC A;  3MWH A;  3HJP A;  1ABA A;  1K0D A;  4KCE A;  19GS A;  4EO3 A;  3CSH A;  4XS4 A;  5ECL B;  2B1K A;  1X5C A;  5IMV A;  3N9J A;  3HZ4 A;  4TXV A;  4CY8 A;  4K5R A;  1PX7 A;  1K0O A;  5FWG A;  4G9H A;  2L57 A;  1OE7 A;  4HUA A;  1TDI A;  4DVC A;  5CRE A;  5F8B A;  1PN0 A;  1A8L A;  3CQF A;  3TUE A;  5GSS A;  3IXR A;  5KN2 A;  1LBK A;  1T8E B;  1AC1 A;  4CHS A;  4MZW A;  5AIV A;  3WGX A;  2TRX A;  1OC8 A;  1XFL A;  3TKP A;  3US3 A;  3H4K A;  5H5S A;  1JHB A;  3J7Y b;  4IKH A;  1AXD A;  2WW1 A;  1AUC A;  2EFD A;  2A2R A;  4Q5Q A;  1XVQ A;  2H0I A;  2HZE B;  3M8N A;  2B5X A;  2P5Q A;  2GS3 A;  1V2A A;  3LJR A;  3HVV A;  3CMI A;  2YNX A;  4POK A;  3D0Z A;  1J08 A;  4IN0 A;  1Z3E A;  3Q18 A;  3D22 A;  12GS A;  3P7X A;  2O36 A;  3F3Q A;  5DQS A;  4D73 B;  1BJX A;  2C0G A;  2OT3 A;  1KTE A;  5IOX A;  2C3N A;  4OD7 A;  1XOA A;  2IMI A;  2GSQ A;  1HD2 A;  3ME7 A;  2FA8 A;  1PRX A;  3I6A A;  5D9X A;  3ERF A;  4WXT A;  4OO5 A;  4NXI A;  5D8I A;  2FHE A;  3BJ5 A;  1GLP A;  2L5O A;  4JZQ A;  3DD3 A;  4MZC A;  1SEN A;  4PQ1 A;  2FGX A;  1BF5 A;  2TRC P;  1M0U A;  2IMF A;  4YQU A;  5HR2 A;  1ZYN A;  7GSS A;  4AKX B;  3F6D A;  1HQO A;  2NBS A;  4F0C A;  4E8H A;  3KJY A;  4ZB7 A;  3G7Y A;  4ML6 A;  2WZS A;  3ZZX A;  2LNT A;  1QGV A;  1Y1U A;  5BMU B;  3GV1 A;  3KTL A;  1URM A;  2VOC A;  4PQH A;  2FWF A;  5ECK B;  4K7N A;  1E2Y A;  1AQX A;  4PHZ C;  4J2F A;  3HXS A;  3U6V A;  1YQ1 A;  3UMA A;  3SBC A;  3LWA A;  5J5N A;  4K0N A;  2YWI A;  1R5P A;  1G6W A;  3BBY A;  4BWQ A;  3GKX A;  3A5W A;  2DML A;  2R5G A;  3ERW A;  4MJC A;  1WWJ A;  4JE1 A;  3TJG A;  4DSR A;  1FO5 A;  1YEP A;  2EC4 A;  4YAV A;  3H1N A;  2XPE A;  4K0G A;  3C1R A;  2H66 A;  4IJI A;  4ISD A;  4TR0 A;  3TOU A;  4FIW A;  2O89 A;  1H75 A;  3RFR C;  3HD5 A;  4Q5F A;  4X1U A;  3VWX A;  4NMU A;  2VCZ A;  2H74 A;  3VPQ A;  1W4V A;  1GH2 A;  4TKY A;  4RQR A;  3S9F A;  3FK8 A;  2LNS A;  4LLR A;  4ID0 A;  2N5B A;  2B7K A;  3N5O A;  4PXO A;  5A34 A;  1XWG A;  2FUG 2;  5JWQ B;  8GSS A;  3GH6 A;  3IK9 A;  4Z2U A;  4ILF A;  1K3L A;  3I69 A;  1DSB A;  2HSM B;  3UBK A;  1VF1 A;  1IYI A;  2X8H A;  2O87 A;  5IM9 A;  4G0K A;  4BPY A;  1X9M B;  4ZBB A;  3LOR A;  5COH A;  3FHK A;  1OVN A;  4MNN A;  4LA1 A;  3MYD A;  4KDX A;  2D2Z A;  1TK0 B;  2PVO C;  4FYB A;  1G7O A;  3C71 A;  4WF5 A;  2LJA A;  3FR3 A;  1F6M C;  2RUE A;  5J40 A;  2I4A A;  3EIN A;  5ECO B;  2IPA A;  4F0B A;  2VL9 A;  3HJO A;  2YPM A;  1U6T A;  4MP4 A;  1BG1 A;  2LUS A;  3TKS E;  2FWE A;  4LMV A;  2IFQ B;  3QOU A;  4WF4 A;  3TDG A;  1TRU A;  1FAA A;  3L0H A;  4BL7 A;  4AKG A;  1MDJ A;  4MK3 A;  4AI6 A;  1X0R A;  2E7P A;  2IME A;  3LG6 A;  5D9V A;  1SK1 A;  2IMD A;  3F9U A;  4N30 A;  4NV2 A;  4GSS A;  4RI6 A;  4DSQ A;  2V6K A;  3VK9 A;  3TJJ A;  3UAP A;  4PUF C;  5HFI A;  2MMN A;  2QA1 A;  3LXT A;  4IS0 A;  5ENU A;  2H1A A;  2G2Q A;  4N0V A;  1T4Y A;  1OC9 B; 
#chains in the Genus database with same CATH homology
 2NDO A;  1GTU A;  3APO A;  1U3A A;  3D4T A;  4MAB A;  2HSN A;  5A1N A;  1W89 A;  5DBQ A;  2PVQ A;  3ZMK A;  4YKG A;  2R37 A;  4N11 A;  2DJJ A;  3GUS A;  3GUR A;  3QFB C;  3CXG A;  1UVZ A;  4ECJ A;  3QFA C;  2HI7 A;  4ZIJ A;  3F8U A;  3UOM A;  2GZY A;  5B8B A;  1MD4 A;  4MA9 A;  1V9W A;  3QPM A;  4HDE A;  4AF2 A;  5ID2 A;  2VD1 A;  3DML A;  1O73 A;  5LNK e;  3P90 A;  2K8V A;  2H1D A;  2ZNM A;  2FNO A;  2V1M A;  3UIW A;  2VLV A;  4E8E A;  2L6D A;  5ECM B;  2VLU A;  3EPT A;  5C00 A;  3QAW A;  4EE0 A;  1U88 A;  2DJ2 A;  2HRA A;  3KEB A;  2L5L A;  3F4T A;  4Z2R A;  1QK8 A;  1VF3 A;  5J4U A;  2PGT A;  2IJY A;  3ZRD A;  5KEJ A;  1J0F A;  3DIE A;  4XHM A;  1YVL A;  2LEG A;  1K0M A;  4Z2T A;  4E68 A;  3ERG A;  1PMT A;  3CBU A;  2EFC A;  3ZFL A;  1FOV A;  1K0N A;  1N8J A;  1GTA A;  2XPD A;  1G0T A;  4BVX B;  4IW9 A;  1ACV A;  2R0G A;  1S3D A;  3MNG A;  2RLI A;  22GS A;  2QKE A;  5A4V A;  5J41 A;  4HQS A;  3ZVJ A;  4PGT A;  5C04 A;  4XS6 A;  4ZB8 A;  4K7O A;  1V58 A;  3L78 A;  1QFN A;  4EUY A;  1GSY A;  5DQY A;  5G31 A;  2CX3 A;  4CY6 A;  4GST A;  4OCF A;  1Y6E A;  1AW9 A;  3J7Y k;  2CVD A;  4LL4 B;  2H70 A;  1QQ2 A;  6GST A;  2X4A A;  4W66 A;  4KW6 A;  5D96 A;  1GTB A;  5IMF A;  3FZ9 A;  4ZL8 A;  1BYE A;  4RI7 A;  4IEL A;  1GSE A;  1XZO A;  1ZYQ B;  4O7H A;  1TOF A;  2H0G A;  1EOH A;  3IA1 A;  4LMW A;  1FOH A;  3VWW A;  3Q6O A;  3KM6 A;  1G6Y A;  1XWA A;  2ES7 A;  1HYU A;  4L0U A;  2CAI A;  2AYT A;  3D6I A;  1O8W A;  2ON7 A;  3CSI A;  4PQI A;  1ZYP A;  3H93 A;  2VAF A;  5A4U A;  4OFT A;  2O7K A;  2FWH A;  1HNC A;  1O8X A;  1SJ6 A;  3V1W A;  3KH9 A;  1WRY A;  3RAZ A;  2ZUP A;  4OO4 A;  1GWC A;  2LS5 A;  1ERU A;  1TP9 A;  1WJK A;  1GL8 A;  4EKZ A;  1BQ7 A;  5B7C A;  3GSS A;  2OA7 A;  3MIX A;  3PIN A;  3I43 A;  3TRP A;  1XCC A;  16GS A;  4NAX A;  3FRC A;  1M2A A;  3DWV A;  4PTS A;  3TKR A;  1CQG A;  3C73 A;  2H6Y A;  3TB2 A;  2DMM A;  3HY2 A;  2HSY A;  1TTZ A;  2DJ1 A;  2YP6 A;  2UV8 G;  4G10 A;  1XXU A;  5KN0 A;  5CO3 A;  4J57 E;  1B4P A;  3ZIJ A;  3F63 A;  1O7U A;  1XOB A;  3G7J A;  4MJA A;  5IQY A;  2QA2 A;  4GDF A;  3C1S A;  3D21 A;  1YF1 A;  3A5I A;  3HMJ G;  2C3Q A;  3PPU A;  4K2D A;  4TRX A;  4L5L A;  2TIR A;  1PD2 1;  1PL2 A;  4I97 A;  3TGZ A;  3FZ5 A;  2H1B A;  2L6C A;  5DJL A;  3R3E A;  5IO2 A;  2M80 A;  1R5A A;  4IHU A;  2IIY A;  5FHI A;  2WUL A;  4DSS A;  2RM5 A;  3HYP A;  3NZN A;  2CT6 A;  1TRW A;  2K8S A;  4OFM A;  4XS4 B;  3TRQ A;  1FVK A;  1GSQ A;  1QUW A;  1FHE A;  4RQX A;  1M99 A;  4MPF A;  3QD9 A;  1T7P B;  1EV4 A;  4NPB A;  3WGD A;  1TI1 A;  1X9S B;  3ZIT A;  2VUP A;  5DAK A;  1GNE A;  4KSO A;  2WGR A;  2B7J A;  3ZML A;  2OAD A;  2HRK A;  3LGC A;  1USB A;  3TJK A;  1J9B A;  2VKZ G;  2LRC A;  5G30 A;  2ON5 A;  5AGY A;  2UZ8 A;  4OFN A;  4F2I A;  2PMT A;  3C8E A;  3GKK A;  2O5V A;  6GSU A;  1YY7 A;  3E9J B;  1NSW A;  3A3T A;  2K9F A;  4J56 E;  5BRT A;  1YJ6 A;  4NWY A;  4FH8 A;  1XWK A;  1E6B A;  1PA3 A;  3VWU A;  4BWS A;  1GSS A;  1SVL A;  3CTF A;  4EF0 A;  4WKW A;  1MTC A;  2VCW A;  2RUF A;  4O92 A;  5HR1 A;  6GSS A;  4POB A;  1A0F A;  1EEJ A;  4O5R A;  4QMK A;  4F9Z A;  3GX8 A;  2R2J A;  2CAQ A;  1WE0 A;  2EFE A;  3VUR A;  4V1A g;  1F9M A;  2FD3 A;  2C4J A;  2RM6 A;  1T1V A;  5JCU A;  4KUN A;  3L9V A;  3FY7 A;  2DBC A;  4OWY A;  3EVI A;  1SK2 A;  2L4Q A;  2H30 A;  5B6M A;  2N5F A;  1Z9H A;  1A24 A;  1CQH A;  2CV4 A;  2VIM A;  4EXJ A;  3E3E A;  4KH7 A;  3W6G A;  2LJK A;  4ULX A;  1ERT A;  2C1Y A;  4O32 A;  2F3M A;  1YF0 A;  5IMA A;  2GST A;  1Z6M A;  3L9S A;  4GQF A;  1GNW A;  4MJE A;  3KIJ A;  1TRS A;  3U5R E;  1HNA A;  3MDK A;  4HU9 A;  3K8N A;  5KOX A;  3FYG A;  4K9Z A;  5IOW A;  2AV4 A;  3KP9 A;  5LCZ A;  4NHW A;  4H86 A;  3EMX A;  5ECI B;  4N10 A;  5L71 A;  1O6J A;  3Q19 A;  4TR1 B;  2R3X A;  1TU7 A;  4USS A;  2GT6 A;  1SD8 A;  2VL3 A;  2M72 A;  2OE0 A;  1AQW A;  5G1K A;  5A4W A;  4AJ6 A;  3ZL5 A;  5F05 A;  3LFL A;  1K0B A;  1TJD A;  3IDV A;  1ON4 A;  4HOJ A;  2Z9S A;  2IFQ A;  3KD0 A;  4K5S A;  3FR6 A;  2MYG A;  5CAX A;  5G1L A;  2VLT A;  1DE2 A;  4POL A;  1GP1 A;  4HEA 2;  1EZK A;  5ECR B;  3FMW A;  2YV9 A;  3KCM A;  1Z7P A;  4EVM A;  4ML1 A;  3CSJ A;  1ZYE A;  4PX1 A;  4V2M A;  5H5R A;  1K0C A;  1C72 A;  2DJK A;  4MH2 A;  5DCH A;  2PWJ A;  4WEY A;  4TN8 A;  1ILO A;  4KX4 A;  5A34 B;  2H76 A;  4ZB9 A;  3KZQ A;  2FCH A;  1EWX A;  6GSX A;  2X8C A;  3F4S A;  2E2M A;  1NHY A;  2JAD A;  1XPV A;  4K7I A;  3UJ1 A;  2YCD A;  1T3B A;  4RUV A;  1SKS B;  5ABR A;  3APS A;  1K0A A;  4YAP A;  4XCS A;  4GTU A;  2AUV A;  1O81 A;  3RDW A;  4WR5 A;  5DAL A;  5EL8 A;  2GVP A;  4HU7 A;  2MBS A;  5EPF A;  3GKN A;  2HRF A;  3ME8 A;  1F2E A;  2YAN A;  4MZB A;  3HJM A;  3RHC A;  1GSF A;  1SKW B;  1TRV A;  4ZL7 A;  4GWR A;  4L0W A;  2LST A;  3R2Q A;  5A5H B;  1SYX A;  3ZLP A;  5IPG A;  2R4V A;  2O8V B;  2OE1 A;  4I2T A;  4IVF A;  3RPN A;  1TW9 A;  2H0H A;  4AJ8 A;  5E4W A;  4KSM A;  4I8B A;  1SVO A;  1KBN A;  2C0E A;  3KP8 A;  3VPT A;  3QAV A;  4BVY B;  4WET A;  3WD6 A;  4BL7 B;  1GLQ A;  1G7E A;  3ED3 A;  2GGT A;  3UVT A;  3APQ A;  4KGI A;  1SU9 A;  1PSQ A;  10GS A;  4GLT A;  2GSS A;  4YQM A;  2JAC A;  5E59 A;  4BVX A;  2H6Z A;  4OCE A;  1AIU A;  5JWO B;  1SK0 A;  2DJ0 A;  2YJ7 A;  5HR3 A;  4L8E A;  2HT9 A;  3DGQ A;  2LQQ A;  3ISO A;  3HHV A;  3I9V 2;  3KMO A;  5F06 A;  4FYC A;  4MF7 A;  1WIK A;  2VL2 A;  2O85 A;  4KE3 A;  2HSN B;  4AKI A;  2WRT A;  2HYX A;  5ECH B;  1RK4 A;  3WYW A;  4GRF A;  2VCV A;  1TI3 A;  3A2W A;  2BJX A;  4TXO A;  4A5P A;  2G0F A;  4ACS A;  3JCM L;  5FT3 A;  1SYR A;  3IHQ A;  1U87 A;  1NM3 A;  1X5D A;  4HJ2 A;  3TKS A;  3HKR A;  4X0X A;  3DXB A;  5J4Y A;  3UEM A;  4I2U A;  2DJ3 A;  4TOP A;  3TJB A;  4XS1 A;  3MSZ A;  4KAE A;  5D73 A;  5IPH A;  4YQV A;  2JU5 A;  4GQC A;  3FKF A;  5G2Z A;  3M9J A;  1JLV A;  2B3S A;  5INY A;  1Q98 A;  4EDY A;  3IR4 A;  3HA9 A;  4NV5 A;  5CRD A;  3VWV A;  2F51 A;  5CYY A;  3ZIV A;  2HFD A;  3FW2 A;  4O5U A;  3L4N A;  5IIZ A;  2CA8 A;  3RHB A;  4IP6 A;  1SKR B;  2XBI A;  2IMK A;  3UL3 A;  5G5E A;  1NHO A;  5ECN B;  2I1U A;  4X4J A;  1OE8 A;  3LYK A;  4TVE A;  2B5E A;  1GUK A;  2B5Y A;  4V2N A;  2YOI A;  2DIY A;  1M2B A;  1A2L A;  1UN2 A;  3DVW A;  3QR6 A;  13GS A;  1V40 A;  1QMV A;  2I9H A;  4GXZ A;  2HLS A;  3IRA A;  1MDK A;  1OC3 A;  1VGL A;  1KNG A;  1F3A A;  3G9B A;  4FQU A;  1FG4 A;  1YDK A;  2LJR A;  5IMC A;  3QCP A;  1EOG A;  3GKM A;  4MJB A;  3DEX A;  4WBR D;  2I3Y A;  1VF4 A;  17GS A;  2HRN A;  1YZX A;  1LJR A;  1A2M A;  1JZW A;  4ECB A;  3HZ8 A;  2J9H A;  4HS1 A;  5ELG A;  2HXK A;  4MMM A;  1B8X A;  5AN1 A;  1GUM A;  4FYU A;  4G0I A;  2V41 A;  4HZ2 A;  2ALB A;  2R6K A;  4KDY A;  5F0G A;  2JL4 A;  4I5Q A;  2JSY A;  5IMD A;  5IMZ A;  2A4H A;  1GUH A;  2KP2 A;  4EC0 A;  3CTG A;  5HFK A;  3PH9 A;  2RII A;  3FZA A;  1H4O A;  1S3A A;  3MAK A;  1XBS A;  3UBL A;  3LXZ A;  2QC7 A;  1XWC A;  2LTK A;  2JZS A;  2GTU A;  11GS A;  2NVL A;  3EWL A;  2F8F A;  2CZ2 A;  1PX6 A;  1OKT A;  2DLX A;  2GT5 A;  4KF9 A;  3KH7 A;  4MCU A;  5J3R A;  1TK8 B;  2OJL A;  5CRH A;  2OKA A;  3WT1 A;  3C7M A;  3GFK A;  3CRU A;  2H72 A;  4PUR A;  2HZE A;  3DRN A;  4KDU A;  3O3T A;  2FLS A;  4ECI A;  5H5Q A;  1XW6 A;  3M0F A;  2EIO A;  3DVX A;  2NPB A;  3IK7 A;  1AQV A;  1MEK A;  4QL9 A;  1OKD A;  2WZ9 A;  3LW9 A;  3EC3 A;  5GAN D;  3HVX A;  2K18 A;  1V57 A;  1Q4J A;  2PN8 A;  1N25 A;  2WS2 A;  2H71 A;  2H19 A;  2LQO A;  3GRX A;  2KUC A;  2A4V A;  4IJ3 A;  4DEJ A;  4Z7X A;  4IQA A;  4D73 A;  2VO4 A;  3TRX A;  4X43 A;  3VLN A;  5D9T A;  4AGS A;  3GIX A;  3G7I A;  3TU3 B;  4G19 A;  2MMZ A;  3VI7 A;  4PNG A;  2HQT A;  4K8M A;  5AIS A;  4MPG A;  3TCO A;  5B6N A;  1WP0 A;  4ICY A;  2QSI A;  4WBJ A;  2AJQ B;  1ML6 A;  3GX0 A;  5F07 A;  3ZTL A;  4YKF A;  1I5G A;  3IOS A;  4V1A p;  2YWN A;  4TR4 A;  2KHP A;  4L5O A;  3CYN A;  1RQM A;  2C0F A;  2E0Q A;  3GYK A;  4ZXG A;  4EL1 A;  2PPT A;  4K1F A;  2B1L A;  3BCI A;  4V2L A;  3M3M A;  5BMU A;  5JWR B;  2GZZ A;  2MBT A;  18GS A;  2PER A;  1EV9 A;  2MMO A;  4DSS B;  4CW9 A;  1B9Y C;  3E0U A;  1GTI A;  5J9C A;  2C3T A;  2YWO A;  2WB9 A;  5ECS A;  2NTO A;  2IL3 A;  2HE3 A;  2ZCT A;  2X49 A;  1QXH A;  2A2S A;  2GDR A;  3AY8 A;  5DAK B;  4XIH A;  4GSN A;  5J9B A;  2XHF A;  3UVH A;  1T00 A;  1EP7 A;  2HRK B;  2REM A;  3H8Q A;  4JR6 A;  2KOK A;  3F6F A;  2A2P A;  4NHZ A;  2H6X A;  1HNB A;  2HNL A;  1XW5 A;  5KOW A;  1ZOF A;  1AAZ A;  1Y25 A;  4F03 A;  5B8A A;  1A2J A;  2DIZ A;  2KLX A;  2X8G A;  2YWM A;  4YH2 A;  1A8Y A;  5D93 A;  2C80 A;  1K3Y A;  1EP8 A;  1X9W B;  1THO A;  4JR4 A;  1I9D A;  3IC8 A;  1NW2 A;  3D5J A;  1TKD B;  3WGE A;  3SWL A;  2JSZ A;  4TR1 A;  3GL5 A;  4MH3 A;  4FO5 A;  2BMX A;  1YEX A;  2GQL A;  5CRG A;  2HSM A;  4Q5R A;  2L59 A;  1M9A A;  2WFC A;  1ZMA A;  2N5A A;  4ZB6 A;  3VI5 A;  2BTO T;  3F4R A;  1JZR A;  1R26 A;  1BX9 A;  1K3O A;  3F3R A;  5LD0 A;  2CX4 A;  2GZP A;  4TR3 A;  4WR4 A;  2GQK A;  1YKA A;  3GTU B;  6GSV A;  4MF5 A;  4JU5 A;  4HZ4 A;  3GST A;  1A23 A;  2WJU A;  1M2D A;  5A5K A;  1EEM A;  3EU3 A;  2AHE A;  3NIV A;  4QQ7 A;  3PR8 A;  1GUL A;  5HR0 A;  2I81 A;  3GMF A;  1S3C A;  2VCX A;  3BCK A;  1XVW A;  1TXU A;  5IO0 A;  3FEU A;  2YZH A;  4HJM A;  4G0L A;  1ZCP A;  1T4Z A;  3LSZ A;  4XTS A;  1GRX A;  2JZT A;  3KMN A;  14GS A;  3HDC A;  2FA4 A;  2CQ9 A;  1VRS D;  2B6M A;  3EE2 A;  1ZGN A;  2CVB A;  2EIR A;  5JCG A;  5G5F A;  3IC4 A;  2R0C A;  3TOT A;  3Q74 A;  4ECC A;  5KN3 A;  4K2X A;  5GST A;  1DE1 A;  4JED A;  2YJH A;  4IBP A;  4N3Z A;  3M1G A;  1LU4 A;  4IP1 A;  4MF6 A;  4PUA A;  1PL1 A;  1ZZY A;  2XBQ A;  3M9K A;  5KN1 A;  20GS A;  1JLW A;  1B9X C;  2GQM A;  3GTU A;  1F37 A;  1EGR A;  1Z7R A;  2GLR A;  2IN3 A;  1OC9 A;  3LQ7 A;  1R4W A;  3A2V A;  5ECQ B;  4POM A;  3EUR A;  5A5H A;  3FZ4 A;  1B4Q A;  2GSR A;  4MDC A;  5CP1 A;  1EGO A;  2OBI A;  4HI7 A;  5DVB A;  2DKI A;  4ZBD A;  3D4M A;  3BD2 A;  2LRN A;  1XWB A;  3HCZ A;  1GSD A;  9GSS A;  4ZL9 A;  4BVY A;  3IAM 2;  3EU4 A;  3GN3 A;  2R0P A;  2OE3 A;  1Z5Y E;  2L4C A;  3PGT A;  2H01 A;  1JZD A;  2MMA A;  3KXO A;  4AKH A;  1MD3 A;  2H8L A;  1SD9 A;  2YZU A;  1FW1 A;  1RW1 A;  1WOU A;  1ST9 A;  2X99 A;  1SL2 B;  3IBH A;  2H1G A;  1XIY A;  4GCI A;  2V6O A;  2IWT A;  3BOA A;  4G01 A;  1GSU A;  5DJM A;  2H1L A;  1SVM A;  2MZC A;  3W8S A;  1JFU A;  1THX A;  2V2G A;  5J4V A;  5HQP A;  6GSY A;  2P31 A;  3QAG A;  5J47 A;  3H79 A;  3LEF A;  5DCG A;  2PU9 C;  3TJF A;  3IE3 A;  4O5Q A;  3IPZ A;  1WMJ A;  2FWG A;  2HSH A;  2AAW A;  1BG5 A;  3KGK A;  4KA0 A;  2WDU A;  1ERW A;  5GZZ B;  2K6V A;  4ZIL A;  3WT2 A;  5DAL B;  5CRW A;  4OMV A;  1PGT A;  1BAY A;  4N0Z A;  4IQ1 A;  2WCI A;  2H73 A;  2C0D A;  2F9S A;  1O85 A;  2EIQ A;  1N2A A;  1JZO A;  2YV7 A;  2PUK C;  2P0G A;  2QGV A;  2YN1 A;  6GSW A;  2DSA A;  5A1N B;  3A2X A;  5HFG A;  5AIX A;  4AJ7 A;  5ECP B;  5ELA A;  3IAS 2;  4GF0 A;  5GAP D;  1DUG A;  1PKW A;  1DBY A;  3FR9 A;  2EFH A;  1UC7 A;  1B48 A;  4I6X A;  3TKQ A;  2J23 A;  5ID2 B;  5D9W A;  3EYT A;  2CVK A;  2DC5 A;  2LRT A;  1BED A;  3GNJ A;  3ZVJ D;  1OYJ A;  2AB6 A;  3KTB A;  2E2G A;  2LKU A;  3P2A A;  1SJZ A;  4MLY A;  2VD0 A;  4PNF A;  4EDZ A;  1PN9 A;  2VCT A;  1WPI A;  1R7H A;  4G2E A;  3GA4 A;  4LL1 B;  3OR5 A;  1V98 A;  2CZ3 A;  2HZF A;  4K6X A;  1IYH A;  5JCW A;  1UA5 A;  1SL0 B;  1XW9 A;  3QDN A;  4TXO B;  2VCQ A;  3F0I A;  3VFI A;  3DYR A;  4ZBA A;  1SL1 B;  1ZL9 A;  4Q5N A;  3HVS A;  3GH9 A;  2DKH A;  2VM1 A;  1ERV A;  4XRA A;  3QMX A;  2C8U A;  1TU8 A;  1KEB A;  1VF2 A;  1X5E A;  1SJI A;  2XC2 A;  3O6T A;  3ZYW A;  4CDO A;  2V32 A;  1MDI A;  2X64 A;  5EVO A;  3DKS A;  1PQN A;  3RPP A;  3W8J A;  3P8W A;  3NOF A;  2M46 A;  4JRR A;  5EY6 A;  3ZRE A;  4BA7 A;  3L9U A;  3LYP A;  3RBT A;  1M7T A;  4F82 A;  2VM2 A;  4EIP A;  4P3Y B;  4XRD A;  4JBB A;  2KP1 A;  5DDL A;  2LV3 A;  2P5R A;  1A0R P;  3EMP A;  1OAZ A;  2PBJ A;  3O76 A;  1FVJ A;  1TXX A;  2OBK A;  3IHG A;  4IGJ A;  3ZFB A;  4KCA A;  4EIQ A;  3IV4 A;  1F3B A;  4KB3 A;  1PKZ A;  3GL3 A;  1TK5 B;  2VL2 C;  4QL7 A;  5CNW A;  2F8A A;  1U3I A;  1M9B A;  4TW5 A;  3CRT A;  1Z6N A;  2OAC A;  3CWG A;  3GHA A;  2FY6 A;  2H75 A;  1FB6 A;  2JZR A;  3UAR A;  1FB0 A;  4HQZ A;  3TKS C;  4KND A;  1YKC A;  3MWH A;  3HJP A;  1ABA A;  1K0D A;  4KCE A;  19GS A;  4EO3 A;  3CSH A;  4XS4 A;  5ECL B;  2B1K A;  1X5C A;  5IMV A;  3N9J A;  3HZ4 A;  4TXV A;  4CY8 A;  4K5R A;  1PX7 A;  1K0O A;  5FWG A;  4G9H A;  2L57 A;  1OE7 A;  4HUA A;  1TDI A;  4DVC A;  5CRE A;  5F8B A;  1PN0 A;  1A8L A;  3TUE A;  5GSS A;  3IXR A;  5KN2 A;  1LBK A;  1T8E B;  1AC1 A;  4CHS A;  4MZW A;  5AIV A;  3WGX A;  2TRX A;  1OC8 A;  1XFL A;  3TKP A;  3US3 A;  3H4K A;  5H5S A;  1JHB A;  3J7Y b;  4IKH A;  1AXD A;  1AUC A;  2EFD A;  2A2R A;  4Q5Q A;  1XVQ A;  2H0I A;  2HZE B;  3M8N A;  2B5X A;  2P5Q A;  2GS3 A;  1V2A A;  3LJR A;  3HVV A;  3CMI A;  2YNX A;  4POK A;  3D0Z A;  1J08 A;  4IN0 A;  1Z3E A;  3Q18 A;  3D22 A;  12GS A;  3P7X A;  3F3Q A;  5DQS A;  4D73 B;  1BJX A;  2C0G A;  2OT3 A;  1KTE A;  5IOX A;  2C3N A;  4OD7 A;  1XOA A;  2IMI A;  2GSQ A;  1HD2 A;  3ME7 A;  2FA8 A;  1PRX A;  3I6A A;  5D9X A;  3ERF A;  4WXT A;  4OO5 A;  4NXI A;  5D8I A;  2FHE A;  3BJ5 A;  1GLP A;  2L5O A;  4JZQ A;  3DD3 A;  4MZC A;  1SEN A;  4PQ1 A;  2FGX A;  1BF5 A;  2TRC P;  1M0U A;  2IMF A;  4YQU A;  5HR2 A;  1ZYN A;  7GSS A;  4AKX B;  3F6D A;  1HQO A;  2NBS A;  4F0C A;  4E8H A;  3KJY A;  4ZB7 A;  3G7Y A;  4ML6 A;  3ZZX A;  2LNT A;  1QGV A;  1Y1U A;  5BMU B;  3GV1 A;  3KTL A;  1URM A;  2VOC A;  4PQH A;  2FWF A;  5ECK B;  4K7N A;  1E2Y A;  1AQX A;  4J2F A;  3HXS A;  3U6V A;  1YQ1 A;  3UMA A;  3SBC A;  3LWA A;  5J5N A;  4K0N A;  2YWI A;  1R5P A;  1G6W A;  3BBY A;  4BWQ A;  3GKX A;  3A5W A;  2DML A;  2R5G A;  3ERW A;  4MJC A;  1WWJ A;  4JE1 A;  3TJG A;  4DSR A;  1FO5 A;  1YEP A;  2EC4 A;  4YAV A;  3H1N A;  2XPE A;  4K0G A;  3C1R A;  2H66 A;  4IJI A;  4ISD A;  4TR0 A;  3TOU A;  4FIW A;  2O89 A;  1H75 A;  3HD5 A;  4Q5F A;  4X1U A;  3VWX A;  4NMU A;  2VCZ A;  2H74 A;  3VPQ A;  1W4V A;  1GH2 A;  4TKY A;  4RQR A;  3S9F A;  3FK8 A;  2LNS A;  4LLR A;  4ID0 A;  2N5B A;  2B7K A;  3N5O A;  4PXO A;  5A34 A;  1XWG A;  2FUG 2;  5JWQ B;  8GSS A;  3GH6 A;  3IK9 A;  4Z2U A;  4ILF A;  1K3L A;  3I69 A;  1DSB A;  2HSM B;  3UBK A;  1VF1 A;  1IYI A;  2X8H A;  2O87 A;  5IM9 A;  4G0K A;  4BPY A;  1X9M B;  4ZBB A;  3LOR A;  5COH A;  3FHK A;  1OVN A;  4MNN A;  4LA1 A;  3MYD A;  4KDX A;  2D2Z A;  1TK0 B;  2PVO C;  4FYB A;  1G7O A;  3C71 A;  4WF5 A;  2LJA A;  3FR3 A;  1F6M C;  2RUE A;  5J40 A;  2I4A A;  3EIN A;  5ECO B;  2IPA A;  4F0B A;  2VL9 A;  3HJO A;  2YPM A;  1U6T A;  4MP4 A;  1BG1 A;  2LUS A;  3TKS E;  2FWE A;  4LMV A;  2IFQ B;  3QOU A;  4WF4 A;  3TDG A;  1TRU A;  1FAA A;  3L0H A;  4BL7 A;  4AKG A;  1MDJ A;  4MK3 A;  4AI6 A;  1X0R A;  2E7P A;  2IME A;  3LG6 A;  5D9V A;  1SK1 A;  2IMD A;  3F9U A;  4N30 A;  4NV2 A;  4GSS A;  4RI6 A;  4DSQ A;  2V6K A;  3VK9 A;  3TJJ A;  3UAP A;  4PUF C;  5HFI A;  2MMN A;  2QA1 A;  3LXT A;  4IS0 A;  5ENU A;  2H1A A;  2G2Q A;  4N0V A;  1T4Y A;  1OC9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...