1GSUA

An avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS-MU GLUTATHIONE S-TRANSFERASE
publication title The three-dimensional structure of an avian class-mu glutathione S-transferase, cGSTM1-1 at 1.94 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Detoxification enzyme
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gsuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gsuA01
1GSFA 5J41A 5DJMA 1XPVA 1WWJA 2NDOA 2FWHA 2CZ2A 4POBA 4YH2A 1OKTA 5KN3A 5F8BA 4F9ZA 5ECIB 2H70A 5EY6A 2O7KA 4HU9A 4IJIA 1XZOA 2YZUA 2E7PA 4BPYA 2VCQA 2GTUA 3GSTA 1G7EA 3IC4A 2VOCA 4KAEA 2FWGA 4GRFA 2C0FA 1A2JA 2BMXA 3EMXA 1SU9A 1UN2A 4ID0A 4L5LA 5GSTA 1SL1B 1SK2A 2JL4A 2CVKA 3GUSA 5E59A 2HSMB 3EVIA 1B4QA 3QFAC 3PR8A 2V6OA 2HZFA 4POLA 2CVDA 6GSVA 4KW6A 4ILFA 2QKEA 2PMTA 1G0TA 5DJLA 2IMKA 4K7NA 2M80A 3GKKA 5J3RA 1GTAA 1DE2A 4G2EA 3LXTA 3Q6OA 1M7TA 3ZTLA 3ZRDA 2YWOA 3CYNA 3QAWA 1F37A 3APQA 2LTKA 4L8EA 4MF6A 3HVXA 4ECIA 5DBQA 3GHAA 4GF0A 4EDYA 4F0BA 2GQKA 5C04A 3KCMA 4MJAA 1X5EA 2NBSA 2YOIA 2IN3A 1WIKA 4G0LA 5GSSA 1AQWA 1FAAA 1R4WA 1M9BA 3E9JB 1GSDA 12GSA 4N10A 1K0MA 2FHEA 1PL2A 1JLWA 3O6TA 3QAVA 3TKQA 4FO5A 3QOUA 2L6CA 3CTGA 4D73B 1XWGA 2DMMA 1EV9A 1PGTA 22GSA 4BWSA 4V1Ap 2C80A 4CHSA 2WS2A 1E2YA 2JADA 3BOAA 2VL2C 4HJMA 1B8XA 4XS1A 6GSUA 4P3YB 5IM9A 1XOBA 4IELA 1O85A 2GSSA 3GNJA 3GX0A 5IMAA 5HFKA 2GLRA 1N2AA 4IP1A 1B9YC 1OC9A 2MMNA 4K0NA 3D22A 16GSA 2YWMA 1GSYA 3W6GA 1I9DA 3UVHA 1KNGA 2V41A 4IW9A 4MJEA 4NAXA 5JCGA 4GLTA 3BCIA 3KP9A 4OO4A 1FG4A 3HVSA 5F0GA 3Q18A 3IAS2 3Q19A 2CX4A 5L71A 2PUKC 3E0UA 1GTUA 1VF4A 2F8FA 3IC8A 1JZDA 2HRFA 2WB9A 1TKDB 3LYKA 1YZXA 4ECJA 2ZUPA 1X5CA 4ZL7A 5ENUA 1R5PA 1HYUA 3KMOA 1SL0B 2LS5A 1A2MA 2A4VA 4WF5A 2NPBA 4JBBA 2PVQA 3DIEA 4K0GA 3HKRA 2I9HA 3TJJA 4KX4A 5ID2B 3DWVA 4HU7A 2WJUA 3M9KA 3MNGA 2N5BA 1ERUA 3U5RE 1VF3A 4N11A 3HJMA 17GSA 1UC7A 5COHA 1WPIA 3TKSA 3LJRA 4TN8A 3ERFA 2Z9SA 9GSSA 1PKZA 3D0ZA 1ERWA 13GSA 1KTEA 2RLIA 5HFGA 4OO5A 2XHFA 2C8UA 2MMAA 1WP0A 1Q4JA 5ELGA 4Q5RA 2VLVA 3A2VA 1CQHA 3D5JA 1ZOFA 1A24A 1R26A 3KZQA 4X0XA 5ECHB 1GTIA 3HZ4A 3S9FA 3KMNA 5H5SA 2KOKA 3M3MA 3UIWA 3DRNA 1ABAA 1BG5A 5F05A 1U3AA 1GH2A 3DVXA 2H66A 1EWXA 1XFLA 1LJRA 1TW9A 2WGRA 4MZCA 1GWCA 2IFQA 5ECLB 1X9WB 5BMUA 1PL1A 5ECMB 1VGLA 1K3YA 2DJ2A 4MLYA 1U6TA 4WEYA 3K8NA 4OFTA 1SK1A 3ED3A 2LNTA 3KXOA 3TRQA 4V2LA 4NHZA 3E3EA 5A4VA 2M46A 2HSHA 3O3TA 3DYRA 1J0FA 1XVWA 3CTFA 4EO3A 1PKWA 2H6ZA 3FZ9A 3LGCA 5G5EA 5HR1A 4CDOA 4KDXA 1BEDA 3P90A 5IIZA 2E2GA 2LJAA 4TR3A 20GSA 3UAPA 2F51A 2PPTA 3DVWA 1GSEA 3EWLA 2AB6A 4PQHA 5A4UA 3SBCA 1AQXA 3IBHA 3F9UA 4YQMA 1FO5A 1M9AA 1ACVA 4Q5NA 4ULXA 2GGTA 1QQ2A 2VD0A 1QFNA 1HD2A 2JZSA 2WZ9A 4GXZA 3WGXA 2FWEA 4KA0A 2R37A 1OKDA 4KDYA 3LFLA 4HUAA 2PU9C 5KN1A 3GIXA 1RQMA 3GH6A 3UBKA 2YN1A 1TK0B 4G19A 5J9BA 3IE3A 3CSHA 5D9WA 2CA8A 4HZ4A 1M2AA 3RHBA 3RPPA 4XIHA 2YJHA 1SKRB 2OJLA 4TW5A 1HNCA 2VM1A 2DMLA 5G30A 1ILOA 1XVQA 2K9FA 2R3XA 6GSXA 2AHEA 4RQRA 1KEBA 2O87A 4LMVA 4K7OA 3QD9A 4GSSA 1ZGNA 2XPEA 2NVLA 4YAVA 2OE1A 1M2DA 3KD0A 1T7PB 1Q98A 3GKXA 5CRHA 1OC8A 4WXTA 2F8AA 3I69A 4OD7A 4BL7B 1K0OA 1FVJA 3H4KA 2VL3A 1THXA 4IKHA 4XRAA 4RQXA 4EC0A 4F0CA 3A5WA 5D93A 2R4VA 5IPHA 1FVKA 1S3AA 5DALB 5CREA 4K7IA 2REMA 1YKAA 4PURA 3A3TA 3WGEA 3D21A 1PQNA 2OBIA 5LD0A 4KGIA 2B6MA 1PA3A 2KUCA 1QK8A 1ZZYA 3ZREA 1T4YA 1V98A 2HFDA 5D9VA 4YQVA 1EP8A 2ZCTA 3WD6A 1W89A 1M99A 5ECKB 4F03A 1SKSB 1RW1A 1GULA 1UA5A 4DSSB 1ERTA 4YAPA 1V58A 1TJDA 2GSTA 4IS0A 1A0FA 4E8HA 3MAKA 4KNDA 2YP6A 4EDZA 2H1AA 2PWJA 2HSMA 1ZYQB 2QC7A 3A2WA 4ML1A 4GQCA 4NV5A 3TJBA 5D96A 2DJKA 2IL3A 1ZYEA 4XCSA 1NW2A 3KIJA 2R5GA 5KN0A 1A2LA 3L4NA 3KH7A 3L9VA 4MK3A 1WJKA 2AUVA 4HDEA 2VCXA 3IAM2 2IWTA 2DJ0A 3GV1A 1XIYA 2P31A 5EPFA 1GP1A 3ZIJA 5ELAA 4AJ7A 5JWRB 1TI3A 3C1RA 5CP1A 2CQ9A 5JWQB 3ZVJA 1I5GA 1O8XA 3GTUA 3P7XA 4GCIA 4G10A 2GT6A 1FOVA 4OCFA 3VFIA 1X9MB 2WRTA 3HCZA 1USBA 2LQQA 3GSSA 2C1YA 2L59A 2MYGA 2IIYA 2GZZA 3ZIVA 3C8EA 4AJ6A 1EOHA 2R6KA 1T1VA 2TRCP 2V1MA 3BBYA 4L0WA 3DD3A 3TUEA 4GQFA 3F4TA 2C0DA 1GLPA 3WGDA 2N5AA 5D8IA 2L4QA 4KE3A 3HZ8A 4TR1B 4D73A 1MDKA 1DUGA 4BWQA 3NZNA 1HNAA 4L0UA 4EF0A 3ZITA 1GUMA 3TGZA 2JACA 3A2XA 2XBQA 3L9SA 4JEDA 1WOUA 3DGQA 1MD4A 2O89A 2CV4A 3C7MA 3QAGA 1GTBA 2HI7A 1E6BA 5ECOB 4GTUA 1OE7A 4IN0A 4ECBA 2H01A 4PXOA 4MMMA 10GSA 1EP7A 3HVVA 2L5OA 1X0RA 2HYXA 1T3BA 2I4AA 1A23A 4NV2A 3CBUA 2NTOA 1G7OA 2FA8A 2VIMA 3APSA 4JR6A 1K0BA 2VM2A 2LRNA 4PGTA 2IMFA 1PD21 4PTSA 2TRXA 1AC1A 2A2RA 1BYEA 3RBTA 5B6NA 4ZB9A 2ON5A 4FQUA 3J7Yk 2ON7A 2BTOT 4O32A 3VURA 2A2SA 1TRSA 3ME7A 3KP8A 4MF5A 1A8LA 1XW5A 1F3AA 1JLVA 3ZLPA 2VLUA 4XTSA 3FR6A 4EE0A 2LV3A 4HI7A 3ERWA 2JU5A 5EL8A 2GDRA 1ON4A 2GVPA 2I1UA 3TJKA 3GA4A 4V1Ag 4BVYB 4QL7A 1A0RP 3IOSA 4RI6A 4MPFA 2CZ3A 3FR9A 1F6MC 2HXKA 2O85A 2DC5A 1S3CA 2IPAA 2LRCA 4K1FA 2H72A 3F6DA 3DKSA 5A4WA 2HZEB 4EKZA 4IHUA 5ID2A 5H5QA 5KN2A 2B3SA 2KHPA 5DQYA 1PSQA 1TRWA 2H1DA 2CVBA 2YWIA 1YY7A 4PQIA 3IK7A 5JCUA 1UVZA 1GSQA 4MJBA 2HSYA 4HZ2A 4TXOA 4MH3A 2CX3A 3ISOA 2VLTA 2MMZA 3UARA 2FUG2 4ZB8A 1ZCPA 4J2FA 4WKWA 1V40A 1M2BA 1G6WA 4QQ7A 1EGRA 4TKYA 2J9HA 1YDKA 1ZMAA 2FNOA 1AUCA 4G0IA 5CAXA 3VPTA 4DSRA 1F3BA 2VL2A 2H74A 4JE1A 3O76A 2X8CA 3QPMA 3PH9A 4IP6A 3G9BA 1QUWA 4BA7A 3ZFLA 1B9XC 4OFNA 2GQLA 5IOXA 3IHQA 2VUPA 1X9SB 3TDGA 4GWRA 1TOFA 4LMWA 3EU3A 7GSSA 4N0VA 1MDIA 4L5OA 4DVCA 4I2TA 2MMOA 3GURA 1XW9A 2H0GA 2LRTA 3F63A 5IMZA 5IO2A 1K3LA 3UOMA 4TOPA 3CRTA 2H19A 5AIVA 2VCWA 1F2EA 3L78A 1K0CA 5J5NA 1DE1A 2O8VB 1GNEA 4XHMA 3GX8A 4V2NA 3ZZXA 3VWVA 1W4VA 1EOGA 2JSZA 1TTZA 2YJ7A 3RPNA 3D6IA 2EIQA 4IGJA 1OAZA 4O7HA 4MP4A 1S3DA 1OC3A 5KEJA 2GZPA 1M0UA 2L57A 1J08A 1K0AA 3FHKA 3L0HA 5DAKB 5F07A 1XBSA 1H4OA 5B8BA 4MZBA 2G2QA 2QGVA 3IR4A 2HRKB 3ZYWA 1DSBA 2JZTA 2IMIA 4BVXA 5CNWA 1GRXA 5GZZB 2ALBA 1Z6MA 2DJ1A 3VK9A 5B8AA 1SENA 4PNGA 2FY6A 2AJQB 1MDJA 4MDCA 4F2IA 3EU4A 2H6YA 2H75A 4MZWA 2B7JA 2F9SA 2XPDA 1FB0A 4CW9A 3P8WA 2P0GA 5LNKe 1YEPA 2PBJA 4BL7A 3G7YA 1Z3EA 4KSOA 1U3IA 1A8YA 2BJXA 5DALA 3UBLA 3TJFA 4JRRA 11GSA 3PGTA 1JZWA 1XWAA 1TXXA 1PMTA 1Z7PA 2JSYA 3VWUA 2CT6A 1PX6A 1AAZA 1JHBA 4N0ZA 2DIYA 3H79A 3CSIA 1IYHA 1GUKA 3F4RA 2JZRA 1O81A 3TB2A 2X8HA 5ECNB 3LQ7A 5DCGA 2L6DA 4I2UA 3I6AA 1V57A 3HA9A 2YANA 4FYCA 2OE0A 5IMFA 1EGOA 2I3YA 1VRSD 2PVOC 3IXRA 3M9JA 4K2DA 4HS1A 2YV9A 5B6MA 4ZL8A 3WT1A 1ST9A 1R7HA 3KEBA 4XS4B 1AXDA 5ECSA 2H1GA 2VO4A 2RM5A 2PN8A 3HYPA 3UJ1A 3W8JA 3GMFA 1XCCA 4TR4A 5ECPB 3EYTA 1THOA 5H5RA 4NPBA 3TOTA 3UEMA 5J9CA 4WF4A 2FA4A 3FZAA 2J23A 2HNLA 2GS3A 3FR3A 4ZXGA 4FIWA 5IMCA 3RHCA 3LWAA 4I8BA 2B5XA 2D2ZA 1T8EB 5IOWA 5D9TA 2AAWA 1TI1A 5CO3A 1CQGA 2FGXA 2H0HA 1H75A 1SYXA 2I81A 3KJYA 3GRXA 5G5FA 1SKWB 1WRYA 1XW6A 2QSIA 5CRDA 3EE2A 3HDCA 1MD3A 4MA9A 3AY8A 2VCZA 4FYUA 3H1NA 5J4UA 4PX1A 2WULA 3H93A 2YV7A 4AJ8A 2L4CA 4F82A 2YNXA 4Q5FA 1TRUA 3IV4A 1JZRA 2H0IA 2OACA 3IDVA 3G7IA 1SD9A 2KLXA 3EMPA 4O5RA 4I5QA 1C72A 1O73A 2WCIA 4ZB6A 5G31A 3FZ5A 4EL1A 1YJ6A 5C00A 3TJGA 4MPGA 1X5DA 4FYBA 1NHOA 3FW2A 4OFMA 2E2MA 4TR1A 3HJOA 5ABRA 4MJCA 4WETA 2YPMA 3LYPA 2OKAA 5INYA 4AGSA 2H6XA 1O7UA 3LG6A 3HD5A 1Y6EA 4NHWA 5CYYA 4EUYA 4LL4B 4MABA 2PGTA 3ZFBA 4G0KA 2GSQA 2LUSA 1OYJA 1BQ7A 1Z5YE 1GLQA 4K9ZA 3DEXA 3GKMA 4JR4A 2HT9A 2HQTA 2B5YA 2H71A 1MEKA 2XC2A 2GZYA 2V32A 2XBIA 2C4JA 5CRWA 5E4WA 5FWGA 1IYIA 3F6FA 3I9V2 3FK8A 1Z9HA 2H73A 2HE3A 5GAND 2AYTA 3LSZA 4HJ2A 3G7JA 4J56E 5DCHA 4KUNA 3VWWA 1ML6A 1SJIA 1JZOA 3H8QA 2ES7A 1B48A 3UL3A 2LKUA 3VI7A 2G0FA 2X99A 2OE3A 1EEMA 1QXHA 1SD8A 2L5LA 4OCEA 3R3EA 2FD3A 3TKPA 4E8EA 1JFUA 1GSUA 3F4SA 3M1GA 3N9JA 5G1LA 4BVYA 5ECRB 4PNFA 4ZILA 1J9BA 2RM6A 2WFCA 3GTUB 2DIZA 3CRUA 4H86A 1XXUA 5GAPD 4LL1B 1XWCA 2EIOA 1BJXA 4MF7A 3WYWA 1SYRA 4NMUA 2HZEA 2H30A 3TCOA 3KTLA 6GSSA 1FHEA 4DEJA 4O92A 5HFIA 5D73A 3F8UA 4OWYA 1SL2B 4PQ1A 2B5EA 2YZHA 3VWXA 4KSMA 5DQSA 3HHVA 1O8WA 1T4ZA 5A5KA 4EXJA 1PN9A 1BX9A 1TU8A 3C1SA 3U6VA 14GSA 1LU4A 4EVMA 2EC4A 3ERGA 2H76A 3FY7A 1U88A 5AISA 5D9XA 5IMDA 1V9WA 5EVOA 1MTCA 4IVFA 2K8SA 2LEGA 4POMA 2YWNA 4X1UA 1OVNA 4ZBAA 4Z7XA 3PINA 2FCHA 3GL3A 2RUFA 3NIVA 1RK4A 1NHYA 4RI7A 3I43A 3KM6A 4IQAA 3TKSC 3W8SA 2IMDA 1GNWA 1ERVA 1QGVA 4I6XA 1TP9A 3FRCA 4WR4A 2C3NA 3KH9A 5DDLA 3DMLA 3VI5A 2KP2A 3TKRA 2FLSA 4ZBBA 5IMVA 1PRXA 3V1WA 3JCML 3TRPA 1YQ1A 2C3TA 5AIXA 2OA7A 3BJ5A 2VCTA 2DLXA 3F0IA 2X8GA 3APOA 2IJYA 4LA1A 1BAYA 1QMVA 1U87A 8GSSA 2LJRA 1DBYA 3VLNA 2VAFA 3BCKA 5HR2A 3OR5A 3IA1A 1YF0A 4HQSA 3N5OA 3L9UA 4GSTA 4NWYA 1TK8B 2LJKA 1NM3A 2V6KA 3EC3A 1Z6NA 4ISDA 3PPUA 1TK5B 4RUVA 1F9MA 4Q5QA 5ECQB 1LBKA 1OC9B 2C0GA 5F06A 3EURA 3KTBA 3ZVJD 5DAKA 2P5RA 2DJJA 2X64A 4KF9A 1B4PA 1GSSA 3CMIA 3M0FA 5G2ZA 2HRKA 1SJ6A 3KGKA 4WBJA 1VF1A 2CAIA 4KH7A 2B1KA 1EEJA 3LEFA 1K0NA 5HQPA 1AIUA 4ZL9A 2RIIA 4IJ3A 3HXSA 4TXOB 3TRXA 5AGYA 1T00A 3C71A 2PERA 2EIRA 4ZIJA 3ZMLA 2AV4A 3UVTA 3ME8A 1SJZA 3QCPA 2OADA 5FT3A 2OBKA 3D4MA 1PX7A 4DSQA 4PUAA 4J57E 4K6XA 1HNBA 5B7CA 1ZL9A 1YEXA 3GL5A 5DVBA 2MBSA 3FZ4A 2HRAA 3IRAA 2K18A 3J7Yb 3QDNA 19GSA 3GYKA 2C3QA 3HJPA 4HQZA 4ZBDA 3MDKA 1TDIA 3NOFA 1FB6A 4GSNA 3TOUA 5G1KA 3MSZA 1AQVA 1YF1A 5HR3A 3D4TA 4YQUA 3LXZA 1EV4A 2H1BA 3FYGA 2DSAA 1XWKA 3VPQA 2VD1A 3ZL5A 3SWLA 1V2AA 2HLSA 1K3OA 2LNSA 4JU5A 4PUFC 4ACSA 4I97A 4XS6A 2C0EA 2LQOA 2HRNA 4LLRA 4MH2A 3FEUA 4K8MA 2GSRA 3RDWA 4XRDA 2B7KA 3TKSE 4HOJA 3US3A 3F3QA 4QL9A 1G6YA 3F3RA 2ZNMA 2CAQA 2P5QA 4XS4A 1SK0A 2WDUA 5IO0A 5CRGA 1R5AA 3CSJA 1Z7RA 1WE0A 1K0DA 1TRVA 2FWFA 2IMEA 3M8NA 3QFBC 4OMVA 3UMAA 2IFQB 3P2AA 4AF2A 1XWBA 3MWHA 1EZKA 4JZQA 3GKNA 3FKFA 2TIRA 1GL8A 1TU7A 6GSWA 2YCDA 4USSA 2GQMA 4ML6A 5IPGA 1XOAA 1FW1A 2GT5A 3R2QA 4BVXB 4DSSA 6GSYA 4KB3A 4HEA2 3QMXA 1HQOA 1Y25A 4X43A 3Q74A 3IPZA 3GH9A 3QR6A 4WR5A 4TR0A 1VF2A 1NSWA 3ZMKA 3IK9A 2F3MA 3CXGA 2DJ3A 4IQ1A 1GUHA 3GN3A 2H8LA 2E0QA 4ECCA 5IQYA 3RAZA 1KBNA 2B1LA 18GSA 2K6VA 2VL9A 2DBCA 4TVEA 4NXIA 2R2JA 4V2MA 2K8VA 4FH8A 3EINA 3WT2A 3C73A 4KDUA 3GFKA 4WBRD 3LORA 1OE8A 5JCWA 4KCEA 2HSNB 2M72A 2UZ8A 1URMA 1WMJA 2LSTA 5FHIA 2N5FA 1AW9A 1YKCA 4N30A 2KP1A 5HR0A 5LCZA 4G9HA 2VCVA 6GSTA 5JWOB 2MBTA 1N8JA 4TRXA 4TXVA 1O6JA 4IBPA 3DXBA 4KCAA 3HY2A 4POKA 4MCUA 2V2GA 5AN1A 2RUEA 3BD2A 2MZCA
chains in the Genus database with same CATH superfamily
1GSFA 5J41A 5DJMA 1XPVA 1WWJA 2NDOA 2FWHA 2CZ2A 4POBA 4YH2A 1OKTA 5KN3A 5F8BA 4F9ZA 5ECIB 2H70A 5EY6A 2O7KA 4AKXB 4HU9A 4IJIA 1XZOA 2YZUA 2E7PA 4BPYA 3CQFA 2VCQA 2GTUA 3GSTA 1G7EA 4G01A 3IC4A 2VOCA 4KAEA 2FWGA 4GRFA 2C0FA 1A2JA 2BMXA 1S4BP 3EMXA 1SU9A 1UN2A 4ID0A 4L5LA 4HSCX 5GSTA 1SL1B 1SK2A 2JL4A 2CVKA 3GUSA 5E59A 2HSMB 3EVIA 1B4QA 2VKZG 3QFAC 3PR8A 2V6OA 2HZFA 4POLA 2CVDA 6GSVA 4KW6A 4ILFA 2QKEA 4GDFA 2PMTA 1G0TA 5DJLA 4E68A 2IMKA 4K7NA 2M80A 3GKKA 5J3RA 1GTAA 1DE2A 4G2EA 3LXTA 3CHXC 3Q6OA 1M7TA 3ZTLA 3ZRDA 2YWOA 3CYNA 3QAWA 1F37A 3APQA 2LTKA 4L8EA 4MF6A 4PHZC 3HVXA 4ECIA 5DBQA 3GHAA 4GF0A 4EDYA 4F0BA 2GQKA 3LW9A 5C04A 3KCMA 4MJAA 2WW2A 1X5EA 2NBSA 2YOIA 2IN3A 1WIKA 4G0LA 5GSSA 1AQWA 1FAAA 1R4WA 5A34B 1M9BA 3E9JB 1GSDA 12GSA 4N10A 1K0MA 2FHEA 1PL2A 1JLWA 3O6TA 1BF5A 3QAVA 3TKQA 4FO5A 3QOUA 2L6CA 3CTGA 4D73B 1XWGA 2DMMA 1EV9A 1PGTA 22GSA 4BWSA 4V1Ap 2C80A 4CHSA 2WS2A 2R0PA 1E2YA 2JADA 3BOAA 2VL2C 4HJMA 1B8XA 2QA1A 4XS1A 6GSUA 4P3YB 5IM9A 1XOBA 4IELA 1O85A 5J40A 2GSSA 3GNJA 3GX0A 5IMAA 5HFKA 2GLRA 1N2AA 4IP1A 1B9YC 1OC9A 2MMNA 4K0NA 3D22A 3TU3B 16GSA 2YWMA 1GSYA 3W6GA 1I9DA 3UVHA 1KNGA 2V41A 4IW9A 4MJEA 4NAXA 5JCGA 4GLTA 2EFCA 3BCIA 3KP9A 4OO4A 1FG4A 3HVSA 5F0GA 3Q18A 3IAS2 3Q19A 2CX4A 5L71A 2PUKC 3E0UA 3MIXA 1GTUA 1VF4A 2F8FA 3IC8A 1JZDA 2HRFA 2WB9A 1TKDB 3LYKA 1YZXA 4ECJA 2ZUPA 1X5CA 4ZL7A 5ENUA 1R5PA 1HYUA 3KMOA 1SL0B 2LS5A 1A2MA 2A4VA 4WF5A 2NPBA 4JBBA 2PVQA 4FXYP 3DIEA 4K0GA 3HKRA 2I9HA 3TJJA 4KX4A 5ID2B 3DWVA 4HU7A 2WJUA 3M9KA 3MNGA 2N5BA 1ERUA 3U5RE 1VF3A 4N11A 3HJMA 17GSA 1UC7A 5COHA 1WPIA 3TKSA 3LJRA 4TN8A 3ERFA 2Z9SA 9GSSA 1PKZA 1ZYPA 3D0ZA 1ERWA 13GSA 2WVXA 1KTEA 2RLIA 5HFGA 4OO5A 2XHFA 2C8UA 2MMAA 1WP0A 1Q4JA 5ELGA 4Q5RA 2VLVA 3A2VA 1CQHA 3D5JA 1ZOFA 1A24A 1R26A 3KZQA 4X0XA 5ECHB 1GTIA 2O36A 3HZ4A 3S9FA 3KMNA 5H5SA 2KOKA 3M3MA 3UIWA 3DRNA 1ABAA 1BG5A 5F05A 1U3AA 1GH2A 3DVXA 2H66A 1EWXA 1XFLA 1LJRA 1TW9A 2WGRA 4MZCA 5A5HA 1GWCA 2IFQA 5ECLB 1X9WB 5BMUA 1PL1A 5ECMB 1VGLA 1K3YA 2DJ2A 4MLYA 1U6TA 4WEYA 3K8NA 4OFTA 2O5VA 1SK1A 3ED3A 2LNTA 3KXOA 4MNNA 3TRQA 4V2LA 4NHZA 1M3IA 3E3EA 5A4VA 2M46A 2HSHA 3O3TA 3DYRA 1J0FA 4EIQA 1XVWA 3CTFA 4EO3A 1PKWA 2H6ZA 3FZ9A 3LGCA 5G5EA 5HR1A 4CDOA 4KDXA 1BEDA 3P90A 5IIZA 2E2GA 2LJAA 4TR3A 20GSA 3UAPA 2F51A 2PPTA 3DVWA 1GSEA 1PFOA 3EWLA 2AB6A 4PQHA 5A4UA 3SBCA 1AQXA 3IBHA 3F9UA 4YQMA 1FO5A 1M9AA 1ACVA 4Q5NA 4ULXA 1I1IP 1YEWC 2GGTA 1QQ2A 2VD0A 1QFNA 1HD2A 2JZSA 2WZ9A 4GXZA 3WGXA 2FWEA 4KA0A 2R37A 1OKDA 4KDYA 3LFLA 4HUAA 2PU9C 5KN1A 3GIXA 1RQMA 3GH6A 3UBKA 2HSNA 2YN1A 1TK0B 4G19A 5J9BA 3IE3A 3CSHA 5D9WA 2CA8A 4HZ4A 1M2AA 3RHBA 3RPPA 4XIHA 1XG8A 2YJHA 1SKRB 2OJLA 4TW5A 1HNCA 2VM1A 2DMLA 5G30A 1ILOA 1XVQA 2K9FA 2R3XA 6GSXA 4N3ZA 2AHEA 4RQRA 1KEBA 2O87A 4LMVA 4K7OA 3QD9A 4GSSA 1ZGNA 2XPEA 2NVLA 4YAVA 2OE1A 1M2DA 3KD0A 1T7PB 1YVLA 1Q98A 3GKXA 5CRHA 1OC8A 4WXTA 2F8AA 3I69A 4OD7A 4BL7B 1K0OA 1FVJA 3H4KA 2VL3A 1THXA 4IKHA 4XRAA 4RQXA 4EC0A 4F0CA 3A5WA 5D93A 2R4VA 5IPHA 1FVKA 1S3AA 5DALB 5CREA 4K7IA 2REMA 1YKAA 4PURA 3A3TA 3WGEA 3D21A 1PQNA 2OBIA 5LD0A 4KGIA 2B6MA 1PA3A 2KUCA 1QK8A 1ZZYA 5J47A 3EPTA 3ZREA 1T4YA 1V98A 2HFDA 5D9VA 4YQVA 1EP8A 2ZCTA 3WD6A 1W89A 1M99A 5ECKB 4K5RA 4F03A 1SKSB 1RW1A 1GULA 1UA5A 4DSSB 1ERTA 4YAPA 1V58A 1Y1UA 1TJDA 2GSTA 4IS0A 1A0FA 4E8HA 3MAKA 2O3EA 4KNDA 2YP6A 4EDZA 2H1AA 2PWJA 1BG1A 2HSMA 1ZYQB 3A2WA 2QC7A 4ML1A 4GQCA 4X4JA 4NV5A 3TJBA 5D96A 2DJKA 2IL3A 1ZYEA 4O5UA 4XCSA 1NW2A 3KIJA 2R5GA 5KN0A 1A2LA 3L4NA 3KH7A 3L9VA 4MK3A 1WJKA 2AUVA 4HDEA 2VCXA 3IAM2 2IWTA 2DJ0A 3GV1A 1XIYA 2P31A 5EPFA 1GP1A 3ZIJA 5ELAA 4AJ7A 5JWRB 1TI3A 3C1RA 5CP1A 2CQ9A 5JWQB 3ZVJA 1I5GA 1O8XA 4CY6A 3GTUA 3P7XA 4GCIA 4G10A 2GT6A 1FOVA 4OCFA 3VFIA 1X9MB 2WRTA 3HCZA 1USBA 2LQQA 3GSSA 2C1YA 2L59A 2MYGA 2IIYA 2GZZA 3ZIVA 3C8EA 5A34A 4AJ6A 1EOHA 2R6KA 1T1VA 2TRCP 2V1MA 3BBYA 4L0WA 3DD3A 3TUEA 5J4YA 4GQFA 3F4TA 2C0DA 1GLPA 3WGDA 2N5AA 3A5IA 5D8IA 2L4QA 4PI2C 4KE3A 3HZ8A 4TR1B 4D73A 1MDKA 1DUGA 4BWQA 3NZNA 1HNAA 4L0UA 4YKFA 4EF0A 4CY8A 3ZITA 1GUMA 3TGZA 2JACA 3A2XA 2XBQA 4YKGA 3L9SA 4JEDA 1WOUA 3DGQA 1MD4A 2O89A 2CV4A 3C7MA 3QAGA 1GTBA 2HI7A 1E6BA 5ECOB 4GTUA 1OE7A 4IN0A 4ECBA 2H01A 4PXOA 4MMMA 10GSA 1EP7A 3HVVA 2L5OA 1X0RA 2HYXA 1T3BA 2I4AA 1A23A 4NV2A 3CBUA 2NTOA 1G7OA 2FA8A 2VIMA 3APSA 4JR6A 1K0BA 2VM2A 4AI6A 2LRNA 4PGTA 2IMFA 1PD21 3MYDA 4PTSA 2TRXA 1AC1A 2A2RA 1BYEA 3RBTA 5B6NA 4ZB9A 2ON5A 4FQUA 3J7Yk 2ON7A 2BTOT 4O32A 3VURA 2A2SA 1TRSA 3ME7A 3KP8A 4MF5A 1A8LA 1XW5A 1F3AA 1JLVA 3ZLPA 2VLUA 4XTSA 3FR6A 4EE0A 1TXUA 2LV3A 4HI7A 3ERWA 2JU5A 5EL8A 2GDRA 1ON4A 2GVPA 2I1UA 3TJKA 3GA4A 4V1Ag 4BVYB 4QL7A 1A0RP 3IOSA 4RI6A 4MPFA 2CZ3A 3FR9A 4QMKA 1F6MC 2HXKA 2O85A 2DC5A 1S3CA 2IPAA 2LRCA 4K1FA 2H72A 3F6DA 3DKSA 5A4WA 2HZEB 4EKZA 4IHUA 5ID2A 5H5QA 5KN2A 2B3SA 2KHPA 5DQYA 1PSQA 1TRWA 2H1DA 2CVBA 2YWIA 1YY7A 4PI0C 4PQIA 3IK7A 5JCUA 1UVZA 5J4VA 1GSQA 4MJBA 3HVNA 2HSYA 2QA2A 4HZ2A 4TXOA 4MH3A 2CX3A 3ISOA 2VLTA 2MMZA 3UARA 2FUG2 4ZB8A 1ZCPA 4J2FA 4WKWA 1V40A 1M2BA 1G6WA 4QQ7A 1EGRA 1FOHA 4TKYA 2J9HA 1YDKA 1ZMAA 2FNOA 1AUCA 4G0IA 2EFEA 4K5SA 5CAXA 3VPTA 4DSRA 1F3BA 2VL2A 2H74A 4JE1A 3O76A 2X8CA 3QPMA 3PH9A 4IP6A 3G9BA 1QUWA 4BA7A 3ZFLA 1B9XC 4OFNA 2GQLA 5IOXA 3IHQA 2VUPA 1X9SB 3TDGA 4GWRA 1TOFA 4LMWA 3EU3A 7GSSA 4N0VA 1MDIA 4L5OA 4DVCA 4I2TA 2MMOA 3GURA 1XW9A 2H0GA 2LRTA 3F63A 5IMZA 5IO2A 1K3LA 3UOMA 4TOPA 3CRTA 2H19A 5AIVA 2VCWA 1F2EA 3L78A 1K0CA 5J5NA 1DE1A 2O8VB 1GNEA 4XHMA 3GX8A 4V2NA 3ZZXA 3VWVA 1W4VA 1EOGA 2JSZA 1TTZA 2YJ7A 3RPNA 3D6IA 2EIQA 4IGJA 1OAZA 4O7HA 4MP4A 1S3DA 1OC3A 5KEJA 2GZPA 2WW1A 1M0UA 2L57A 1J08A 1K0AA 3FHKA 3L0HA 5DAKB 5F07A 1XBSA 1H4OA 5B8BA 4MZBA 2G2QA 2QGVA 3IHGA 3IR4A 2WVYA 2HRKB 3ZYWA 1DSBA 2JZTA 2IMIA 4BVXA 5CNWA 1GRXA 5GZZB 2ALBA 1Z6MA 2DJ1A 3VK9A 5B8AA 1SENA 4PNGA 2FY6A 2AJQB 5KOXA 1MDJA 4MDCA 4F2IA 3RGBC 3EU4A 2H6YA 2H75A 4MZWA 2B7JA 2F9SA 2XPDA 1FB0A 4CW9A 3P8WA 2P0GA 5LNKe 1YEPA 2PBJA 4BL7A 3G7YA 1Z3EA 4KSOA 1U3IA 1A8YA 2BJXA 1PN0A 5DALA 3UBLA 3TJFA 4JRRA 11GSA 3PGTA 1JZWA 1XWAA 1TXXA 1PMTA 1Z7PA 2JSYA 3VWUA 2CT6A 1PX6A 1AAZA 1JHBA 4N0ZA 2DIYA 3H79A 3FMWA 3CSIA 1IYHA 1GUKA 3CWGA 3F4RA 5A1NB 2JZRA 1O81A 3TB2A 2X8HA 5ECNB 2UV8G 3LQ7A 1S3RA 5DCGA 2L6DA 4I2UA 1N25A 3I6AA 1V57A 3HA9A 2YANA 4FYCA 2OE0A 5IMFA 1EGOA 2I3YA 1VRSD 2PVOC 3IXRA 3M9JA 4K2DA 4HS1A 2YV9A 5B6MA 4ZL8A 3WT1A 1ST9A 1R7HA 3KEBA 4XS4B 1AXDA 5ECSA 1SVLA 2H1GA 2VO4A 2RM5A 2PN8A 4W66A 1SVOA 3HYPA 3RFRC 3UJ1A 3W8JA 3GMFA 1XCCA 4TR4A 5ECPB 3EYTA 1THOA 5H5RA 4NPBA 3TOTA 3UEMA 5J9CA 4WF4A 2FA4A 3FZAA 2J23A 2HNLA 2GS3A 1SVMA 3FR3A 4ZXGA 4FIWA 5IMCA 3RHCA 3LWAA 4I8BA 2B5XA 2D2ZA 1T8EB 5IOWA 5D9TA 2AAWA 1TI1A 5CO3A 1CQGA 2FGXA 2H0HA 1H75A 1SYXA 2I81A 3KJYA 3GRXA 5G5FA 1SKWB 4AKIA 1XW6A 1WRYA 2QSIA 3EE2A 5CRDA 3HDCA 1MD3A 4MA9A 4Z2RA 3AY8A 2VCZA 4FYUA 3H1NA 5J4UA 4PX1A 2WULA 3H93A 2YV7A 4AJ8A 2L4CA 4F82A 2YNXA 4Q5FA 1TRUA 3IV4A 1JZRA 2H0IA 2OACA 3IDVA 3G7IA 1SD9A 2EFDA 2KLXA 3EMPA 4O5RA 4I5QA 1C72A 1O73A 2WCIA 4ZB6A 5G31A 3FZ5A 4EL1A 1YJ6A 5C00A 3TJGA 4MPGA 1X5DA 4FYBA 1NHOA 3FW2A 4OFMA 2E2MA 4TR1A 3HJOA 5ABRA 3HMJG 4MJCA 4WETA 2YPMA 3LYPA 2OKAA 5INYA 4AGSA 2H6XA 1O7UA 3LG6A 3HD5A 1Y6EA 4NHWA 5CYYA 4EUYA 4LL4B 4MABA 2PGTA 3ZFBA 4G0KA 2GSQA 2LUSA 1OYJA 1BQ7A 1Z5YE 1GLQA 4K9ZA 3DEXA 3GKMA 4JR4A 2HT9A 2HQTA 2B5YA 2H71A 1MEKA 2XC2A 2GZYA 2V32A 2XBIA 2C4JA 5CRWA 5E4WA 5FWGA 1IYIA 3F6FA 3I9V2 3FK8A 1Z9HA 2H73A 2HE3A 5GAND 2AYTA 3LSZA 4HJ2A 3G7JA 4J56E 5DCHA 4KUNA 3VWWA 1ML6A 1SJIA 1JZOA 3H8QA 2ES7A 1B48A 3UL3A 2LKUA 3VI7A 2G0FA 2X99A 2OE3A 2DKIA 1EEMA 1QXHA 1SD8A 2L5LA 4OCEA 3R3EA 2FD3A 3TKPA 4E8EA 1JFUA 1GSUA 3F4SA 3M1GA 3N9JA 5G1LA 4BVYA 5ECRB 4PNFA 4ZILA 1J9BA 4Z2UA 2RM6A 2WFCA 3GTUB 2DIZA 3CRUA 4H86A 1XXUA 5GAPD 4LL1B 1XWCA 2EIOA 1BJXA 4MF7A 3WYWA 1SYRA 4NMUA 2HZEA 2H30A 3TCOA 3KTLA 6GSSA 1FHEA 4DEJA 4O92A 4K2XA 2WW0A 5HFIA 5D73A 3F8UA 4OWYA 1SL2B 4PQ1A 2B5EA 2YZHA 3VWXA 4KSMA 5DQSA 3HHVA 2R0GA 2WW3A 1O8WA 1T4ZA 5A5KA 4EXJA 2A4HA 1PN9A 1BX9A 1TU8A 3C1SA 3U6VA 14GSA 1LU4A 4EVMA 2EC4A 3ERGA 4AKHA 2H76A 2R0CA 3FY7A 1U88A 5AISA 5D9XA 5IMDA 1V9WA 5EVOA 1MTCA 4IVFA 2K8SA 2LEGA 4POMA 2YWNA 4X1UA 1OVNA 4ZBAA 4Z7XA 3PINA 2FCHA 3GL3A 2RUFA 3NIVA 1RK4A 1NHYA 4RI7A 3I43A 3KM6A 4IQAA 3TKSC 3W8SA 2IMDA 1GNWA 1ERVA 1QGVA 4I6XA 1TP9A 3FRCA 4BIKA 4WR4A 2C3NA 3KH9A 5DDLA 4Z2TA 3DMLA 3VI5A 2KP2A 3TKRA 2FLSA 4ZBBA 5IMVA 1PRXA 3V1WA 3JCML 3TRPA 1YQ1A 2C3TA 5AIXA 2OA7A 3BJ5A 2VCTA 2DLXA 3F0IA 2X8GA 3APOA 2IJYA 4LA1A 1BAYA 1QMVA 1U87A 8GSSA 2LJRA 4A5PA 2DKHA 2X4AA 1DBYA 3VLNA 2VAFA 3BCKA 5HR2A 3OR5A 3IA1A 1YF0A 4HQSA 3N5OA 3L9UA 4GSTA 2A2PA 4NWYA 1TK8B 2LJKA 1NM3A 2V6KA 3EC3A 1Z6NA 4ISDA 3PPUA 1TK5B 4RUVA 1F9MA 4Q5QA 5ECQB 1LBKA 1OC9B 2C0GA 5F06A 3EURA 3KTBA 3ZVJD 5DAKA 2P5RA 2DJJA 2X64A 4KF9A 1B4PA 1GSSA 3CMIA 3M0FA 2H1LA 5G2ZA 2HRKA 1SJ6A 3KGKA 4WBJA 1VF1A 2CAIA 4KH7A 2B1KA 1EEJA 3LEFA 1K0NA 5HQPA 1AIUA 4ZL9A 2RIIA 4IJ3A 3HXSA 4TXOB 3TRXA 5AGYA 1T00A 3C71A 2PERA 2EIRA 4ZIJA 3ZMLA 2AV4A 3UVTA 3ME8A 1SJZA 3QCPA 2OADA 5FT3A 2OBKA 3D4MA 1PX7A 4DSQA 2OT3A 4PUAA 4J57E 4K6XA 1HNBA 5B7CA 1ZL9A 2EFHA 1YEXA 3GL5A 5DVBA 2MBSA 3FZ4A 2HRAA 3IRAA 2K18A 3J7Yb 3QDNA 19GSA 3GYKA 2C3QA 3HJPA 4HQZA 2WZSA 4ZBDA 3MDKA 1TDIA 3NOFA 1FB6A 4GSNA 3TOUA 5G1KA 3MSZA 1AQVA 1YF1A 5HR3A 3D4TA 4YQUA 3LXZA 1EV4A 2H1BA 3FYGA 2DSAA 1XWKA 3VPQA 2VD1A 3ZL5A 5A1NA 3SWLA 1V2AA 2HLSA 1K3OA 2LNSA 2WVXB 4JU5A 4PUFC 4ACSA 4I97A 4XS6A 2C0EA 2LQOA 2HRNA 4ZB7A 4LLRA 4MH2A 3FEUA 4K8MA 2GSRA 3RDWA 4XRDA 2B7KA 3TKSE 4HOJA 3US3A 3F3QA 4QL9A 1G6YA 3F3RA 2ZNMA 2CAQA 2P5QA 4XS4A 1M3JA 1SK0A 5KOWA 2WDUA 5IO0A 5CRGA 1R5AA 3CSJA 1Z7RA 1WE0A 1K0DA 1TRVA 4AKGA 1ZYNA 2FWFA 2IMEA 3M8NA 3QFBC 4OMVA 4ICYA 3UMAA 5A5HB 4EIPA 2IFQB 5BMUB 3P2AA 4AF2A 1XWBA 3MWHA 1EZKA 4JZQA 3GKNA 3FKFA 2TIRA 1GL8A 1TU7A 6GSWA 2YCDA 4USSA 2GQMA 4ML6A 5IPGA 1XOAA 1FW1A 2GT5A 3R2QA 4BVXB 4DSSA 6GSYA 4KB3A 4HEA2 3QMXA 1HQOA 1Y25A 4X43A 3Q74A 3IPZA 3GH9A 3QR6A 4WR5A 4TR0A 1VF2A 1NSWA 3ZMKA 3IK9A 2F3MA 3CXGA 2DJ3A 4IQ1A 1GUHA 3GN3A 5BRTA 2H8LA 2E0QA 4ECCA 5IQYA 3RAZA 1KBNA 2B1LA 18GSA 2K6VA 2VL9A 2DBCA 4TVEA 4NXIA 2R2JA 2WVZA 4V2MA 2K8VA 2X49A 4FH8A 3EINA 3WT2A 3C73A 4KDUA 3GFKA 4WBRD 3LORA 1OE8A 5JCWA 4KCEA 2HSNB 2M72A 2UZ8A 1URMA 1WMJA 2LSTA 5FHIA 2N5FA 1AW9A 1YKCA 4N30A 2KP1A 5HR0A 5LCZA 4G9HA 2VCVA 6GSTA 5JWOB 2MBTA 1N8JA 4TRXA 4TXVA 1O6JA 4IBPA 3DXBA 4KCAA 3HY2A 4POKA 4MCUA 2V2GA 4O5QA 5AN1A 2RUEA 3BD2A 2MZCA
chains in the Genus database with same CATH topology
1GSFA 5J41A 5DJMA 1XPVA 1WWJA 2NDOA 2FWHA 2CZ2A 4POBA 4YH2A 1OKTA 5KN3A 5F8BA 4F9ZA 5ECIB 2H70A 5EY6A 2O7KA 4AKXB 4HU9A 4IJIA 1XZOA 2YZUA 2E7PA 4BPYA 2VCQA 2GTUA 3GSTA 1G7EA 4G01A 3IC4A 2VOCA 4KAEA 2FWGA 4GRFA 2C0FA 1A2JA 2BMXA 3EMXA 1SU9A 1UN2A 4ID0A 4L5LA 5GSTA 1SL1B 1SK2A 2JL4A 2CVKA 3GUSA 5E59A 2HSMB 3EVIA 1B4QA 2VKZG 3QFAC 3PR8A 2V6OA 2HZFA 4POLA 2CVDA 6GSVA 4KW6A 4ILFA 2QKEA 4GDFA 2PMTA 1G0TA 5DJLA 4E68A 2IMKA 4K7NA 2M80A 3GKKA 5J3RA 1GTAA 1DE2A 4G2EA 3LXTA 3Q6OA 1M7TA 3ZTLA 3ZRDA 2YWOA 3CYNA 3QAWA 1F37A 3APQA 2LTKA 4L8EA 4MF6A 3HVXA 4ECIA 5DBQA 3GHAA 4GF0A 4EDYA 4F0BA 2GQKA 3LW9A 5C04A 3KCMA 4MJAA 1X5EA 2NBSA 2YOIA 2IN3A 1WIKA 4G0LA 5GSSA 1AQWA 1FAAA 1R4WA 5A34B 1M9BA 3E9JB 1GSDA 12GSA 4N10A 1K0MA 2FHEA 1PL2A 1JLWA 3O6TA 1BF5A 3QAVA 3TKQA 4FO5A 3QOUA 2L6CA 3CTGA 4D73B 1XWGA 2DMMA 1EV9A 1PGTA 22GSA 4BWSA 4V1Ap 2C80A 4CHSA 2WS2A 2R0PA 1E2YA 2JADA 3BOAA 2VL2C 4HJMA 1B8XA 2QA1A 4XS1A 6GSUA 4P3YB 5IM9A 1XOBA 4IELA 1O85A 5J40A 2GSSA 3GNJA 3GX0A 5IMAA 5HFKA 2GLRA 1N2AA 4IP1A 1B9YC 1OC9A 2MMNA 4K0NA 3D22A 3TU3B 16GSA 2YWMA 1GSYA 3W6GA 1I9DA 3UVHA 1KNGA 2V41A 4IW9A 4MJEA 4NAXA 5JCGA 4GLTA 2EFCA 3BCIA 3KP9A 4OO4A 1FG4A 3HVSA 5F0GA 3Q18A 3IAS2 3Q19A 2CX4A 5L71A 2PUKC 3E0UA 3MIXA 1GTUA 1VF4A 2F8FA 3IC8A 1JZDA 2HRFA 2WB9A 1TKDB 3LYKA 1YZXA 4ECJA 2ZUPA 1X5CA 4ZL7A 5ENUA 1R5PA 1HYUA 3KMOA 1SL0B 2LS5A 1A2MA 2A4VA 4WF5A 2NPBA 4JBBA 2PVQA 3DIEA 4K0GA 3HKRA 2I9HA 3TJJA 4KX4A 5ID2B 3DWVA 4HU7A 2WJUA 3M9KA 3MNGA 2N5BA 1ERUA 3U5RE 1VF3A 4N11A 3HJMA 17GSA 1UC7A 5COHA 1WPIA 3TKSA 3LJRA 4TN8A 3ERFA 2Z9SA 9GSSA 1PKZA 1ZYPA 3D0ZA 1ERWA 13GSA 1KTEA 2RLIA 5HFGA 4OO5A 2XHFA 2C8UA 2MMAA 1WP0A 1Q4JA 5ELGA 4Q5RA 2VLVA 3A2VA 1CQHA 3D5JA 1ZOFA 1A24A 1R26A 3KZQA 4X0XA 5ECHB 1GTIA 3HZ4A 3S9FA 3KMNA 5H5SA 2KOKA 3M3MA 3UIWA 3DRNA 1ABAA 1BG5A 5F05A 1U3AA 1GH2A 3DVXA 2H66A 1EWXA 1XFLA 1LJRA 1TW9A 2WGRA 4MZCA 5A5HA 1GWCA 2IFQA 5ECLB 1X9WB 5BMUA 1PL1A 5ECMB 1VGLA 1K3YA 2DJ2A 4MLYA 1U6TA 4WEYA 3K8NA 4OFTA 2O5VA 1SK1A 3ED3A 2LNTA 3KXOA 4MNNA 3TRQA 4V2LA 4NHZA 3E3EA 5A4VA 2M46A 2HSHA 3O3TA 3DYRA 1J0FA 4EIQA 1XVWA 3CTFA 4EO3A 1PKWA 2H6ZA 3FZ9A 3LGCA 5G5EA 5HR1A 4CDOA 4KDXA 1BEDA 3P90A 5IIZA 2E2GA 2LJAA 4TR3A 20GSA 3UAPA 2F51A 2PPTA 3DVWA 1GSEA 3EWLA 2AB6A 4PQHA 5A4UA 3SBCA 1AQXA 3IBHA 3F9UA 4YQMA 1FO5A 1M9AA 1ACVA 4Q5NA 4ULXA 2GGTA 1QQ2A 2VD0A 1QFNA 1HD2A 2JZSA 2WZ9A 4GXZA 3WGXA 2FWEA 4KA0A 2R37A 1OKDA 4KDYA 3LFLA 4HUAA 2PU9C 5KN1A 3GIXA 1RQMA 3GH6A 3UBKA 2HSNA 2YN1A 1TK0B 4G19A 5J9BA 3IE3A 3CSHA 5D9WA 2CA8A 4HZ4A 1M2AA 3RHBA 3RPPA 4XIHA 2YJHA 1SKRB 2OJLA 4TW5A 1HNCA 2VM1A 2DMLA 5G30A 1ILOA 1XVQA 2K9FA 2R3XA 6GSXA 4N3ZA 2AHEA 4RQRA 1KEBA 2O87A 4LMVA 4K7OA 3QD9A 4GSSA 1ZGNA 2XPEA 2NVLA 4YAVA 2OE1A 1M2DA 3KD0A 1T7PB 1YVLA 1Q98A 3GKXA 5CRHA 1OC8A 4WXTA 2F8AA 3I69A 4OD7A 4BL7B 1K0OA 1FVJA 3H4KA 2VL3A 1THXA 4IKHA 4XRAA 4RQXA 4EC0A 4F0CA 3A5WA 5D93A 2R4VA 5IPHA 1FVKA 1S3AA 5DALB 5CREA 4K7IA 2REMA 1YKAA 4PURA 3A3TA 3WGEA 3D21A 1PQNA 2OBIA 5LD0A 4KGIA 2B6MA 1PA3A 2KUCA 1QK8A 1ZZYA 5J47A 3EPTA 3ZREA 1T4YA 1V98A 2HFDA 5D9VA 4YQVA 1EP8A 2ZCTA 3WD6A 1W89A 1M99A 5ECKB 4K5RA 4F03A 1SKSB 1RW1A 1GULA 1UA5A 4DSSB 1ERTA 4YAPA 1V58A 1Y1UA 1TJDA 2GSTA 4IS0A 1A0FA 4E8HA 3MAKA 4KNDA 2YP6A 4EDZA 2H1AA 2PWJA 1BG1A 2HSMA 1ZYQB 3A2WA 2QC7A 4ML1A 4GQCA 4X4JA 4NV5A 3TJBA 5D96A 2DJKA 2IL3A 1ZYEA 4O5UA 4XCSA 1NW2A 3KIJA 2R5GA 5KN0A 1A2LA 3L4NA 3KH7A 3L9VA 4MK3A 1WJKA 2AUVA 4HDEA 2VCXA 3IAM2 2IWTA 2DJ0A 3GV1A 1XIYA 2P31A 5EPFA 1GP1A 3ZIJA 5ELAA 4AJ7A 5JWRB 1TI3A 3C1RA 5CP1A 2CQ9A 5JWQB 3ZVJA 1I5GA 1O8XA 4CY6A 3GTUA 3P7XA 4GCIA 4G10A 2GT6A 1FOVA 4OCFA 3VFIA 1X9MB 2WRTA 3HCZA 1USBA 2LQQA 3GSSA 2C1YA 2L59A 2MYGA 2IIYA 2GZZA 3ZIVA 3C8EA 5A34A 4AJ6A 1EOHA 2R6KA 1T1VA 2TRCP 2V1MA 3BBYA 4L0WA 3DD3A 3TUEA 5J4YA 4GQFA 3F4TA 2C0DA 1GLPA 3WGDA 2N5AA 3A5IA 5D8IA 2L4QA 4KE3A 3HZ8A 4TR1B 4D73A 1MDKA 1DUGA 4BWQA 3NZNA 1HNAA 4L0UA 4YKFA 4EF0A 4CY8A 3ZITA 1GUMA 3TGZA 2JACA 3A2XA 2XBQA 4YKGA 3L9SA 4JEDA 1WOUA 3DGQA 1MD4A 2O89A 2CV4A 3C7MA 3QAGA 1GTBA 2HI7A 1E6BA 5ECOB 4GTUA 1OE7A 4IN0A 4ECBA 2H01A 4PXOA 4MMMA 10GSA 1EP7A 3HVVA 2L5OA 1X0RA 2HYXA 1T3BA 2I4AA 1A23A 4NV2A 3CBUA 2NTOA 1G7OA 2FA8A 2VIMA 3APSA 4JR6A 1K0BA 2VM2A 4AI6A 2LRNA 4PGTA 2IMFA 1PD21 3MYDA 4PTSA 2TRXA 1AC1A 2A2RA 1BYEA 3RBTA 5B6NA 4ZB9A 2ON5A 4FQUA 3J7Yk 2ON7A 2BTOT 4O32A 3VURA 2A2SA 1TRSA 3ME7A 3KP8A 4MF5A 1A8LA 1XW5A 1F3AA 1JLVA 3ZLPA 2VLUA 4XTSA 3FR6A 4EE0A 1TXUA 2LV3A 4HI7A 3ERWA 2JU5A 5EL8A 2GDRA 1ON4A 2GVPA 2I1UA 3TJKA 3GA4A 4V1Ag 4BVYB 4QL7A 1A0RP 3IOSA 4RI6A 4MPFA 2CZ3A 3FR9A 4QMKA 1F6MC 2HXKA 2O85A 2DC5A 1S3CA 2IPAA 2LRCA 4K1FA 2H72A 3F6DA 3DKSA 5A4WA 2HZEB 4EKZA 4IHUA 5ID2A 5H5QA 5KN2A 2B3SA 2KHPA 5DQYA 1PSQA 1TRWA 2H1DA 2CVBA 2YWIA 1YY7A 4PQIA 3IK7A 5JCUA 1UVZA 5J4VA 1GSQA 4MJBA 2HSYA 2QA2A 4HZ2A 4TXOA 4MH3A 2CX3A 3ISOA 2VLTA 2MMZA 3UARA 2FUG2 4ZB8A 1ZCPA 4J2FA 4WKWA 1V40A 1M2BA 1G6WA 4QQ7A 1EGRA 1FOHA 4TKYA 2J9HA 1YDKA 1ZMAA 2FNOA 1AUCA 4G0IA 2EFEA 4K5SA 5CAXA 3VPTA 4DSRA 1F3BA 2VL2A 2H74A 4JE1A 3O76A 2X8CA 3QPMA 3PH9A 4IP6A 3G9BA 1QUWA 4BA7A 3ZFLA 1B9XC 4OFNA 2GQLA 5IOXA 3IHQA 2VUPA 1X9SB 3TDGA 4GWRA 1TOFA 4LMWA 3EU3A 7GSSA 4N0VA 1MDIA 4L5OA 4DVCA 4I2TA 2MMOA 3GURA 1XW9A 2H0GA 2LRTA 3F63A 5IMZA 5IO2A 1K3LA 3UOMA 4TOPA 3CRTA 2H19A 5AIVA 2VCWA 1F2EA 3L78A 1K0CA 5J5NA 1DE1A 2O8VB 1GNEA 4XHMA 3GX8A 4V2NA 3ZZXA 3VWVA 1W4VA 1EOGA 2JSZA 1TTZA 2YJ7A 3RPNA 3D6IA 2EIQA 4IGJA 1OAZA 4O7HA 4MP4A 1S3DA 1OC3A 5KEJA 2GZPA 1M0UA 2L57A 1J08A 1K0AA 3FHKA 3L0HA 5DAKB 5F07A 1XBSA 1H4OA 5B8BA 4MZBA 2G2QA 2QGVA 3IHGA 3IR4A 2HRKB 3ZYWA 1DSBA 2JZTA 2IMIA 4BVXA 5CNWA 1GRXA 5GZZB 2ALBA 1Z6MA 2DJ1A 3VK9A 5B8AA 1SENA 4PNGA 2FY6A 2AJQB 5KOXA 1MDJA 4MDCA 4F2IA 3EU4A 2H6YA 2H75A 4MZWA 2B7JA 2F9SA 2XPDA 1FB0A 4CW9A 3P8WA 2P0GA 5LNKe 1YEPA 2PBJA 4BL7A 3G7YA 1Z3EA 4KSOA 1U3IA 1A8YA 2BJXA 1PN0A 5DALA 3UBLA 3TJFA 4JRRA 11GSA 3PGTA 1JZWA 1XWAA 1TXXA 1PMTA 1Z7PA 2JSYA 3VWUA 2CT6A 1PX6A 1AAZA 1JHBA 4N0ZA 2DIYA 3H79A 3FMWA 3CSIA 1IYHA 1GUKA 3CWGA 3F4RA 5A1NB 2JZRA 1O81A 3TB2A 2X8HA 5ECNB 2UV8G 3LQ7A 5DCGA 2L6DA 4I2UA 1N25A 3I6AA 1V57A 3HA9A 2YANA 4FYCA 2OE0A 5IMFA 1EGOA 2I3YA 1VRSD 2PVOC 3IXRA 3M9JA 4K2DA 4HS1A 2YV9A 5B6MA 4ZL8A 3WT1A 1ST9A 1R7HA 3KEBA 4XS4B 1AXDA 5ECSA 1SVLA 2H1GA 2VO4A 2RM5A 2PN8A 4W66A 1SVOA 3HYPA 3UJ1A 3W8JA 3GMFA 1XCCA 4TR4A 5ECPB 3EYTA 1THOA 5H5RA 4NPBA 3TOTA 3UEMA 5J9CA 4WF4A 2FA4A 3FZAA 2J23A 2HNLA 2GS3A 1SVMA 3FR3A 4ZXGA 4FIWA 5IMCA 3RHCA 3LWAA 4I8BA 2B5XA 2D2ZA 1T8EB 5IOWA 5D9TA 2AAWA 1TI1A 5CO3A 1CQGA 2FGXA 2H0HA 1H75A 1SYXA 2I81A 3KJYA 3GRXA 5G5FA 1SKWB 4AKIA 1XW6A 1WRYA 2QSIA 3EE2A 5CRDA 3HDCA 1MD3A 4MA9A 4Z2RA 3AY8A 2VCZA 4FYUA 3H1NA 5J4UA 4PX1A 2WULA 3H93A 2YV7A 4AJ8A 2L4CA 4F82A 2YNXA 4Q5FA 1TRUA 3IV4A 1JZRA 2H0IA 2OACA 3IDVA 3G7IA 1SD9A 2EFDA 2KLXA 3EMPA 4O5RA 4I5QA 1C72A 1O73A 2WCIA 4ZB6A 5G31A 3FZ5A 4EL1A 1YJ6A 5C00A 3TJGA 4MPGA 1X5DA 4FYBA 1NHOA 3FW2A 4OFMA 2E2MA 4TR1A 3HJOA 5ABRA 3HMJG 4MJCA 4WETA 2YPMA 3LYPA 2OKAA 5INYA 4AGSA 2H6XA 1O7UA 3LG6A 3HD5A 1Y6EA 4NHWA 5CYYA 4EUYA 4LL4B 4MABA 2PGTA 3ZFBA 4G0KA 2GSQA 2LUSA 1OYJA 1BQ7A 1Z5YE 1GLQA 4K9ZA 3DEXA 3GKMA 4JR4A 2HT9A 2HQTA 2B5YA 2H71A 1MEKA 2XC2A 2GZYA 2V32A 2XBIA 2C4JA 5CRWA 5E4WA 5FWGA 1IYIA 3F6FA 3I9V2 3FK8A 1Z9HA 2H73A 2HE3A 5GAND 2AYTA 3LSZA 4HJ2A 3G7JA 4J56E 5DCHA 4KUNA 3VWWA 1ML6A 1SJIA 1JZOA 3H8QA 2ES7A 1B48A 3UL3A 2LKUA 3VI7A 2G0FA 2X99A 2OE3A 2DKIA 1EEMA 1QXHA 1SD8A 2L5LA 4OCEA 3R3EA 2FD3A 3TKPA 4E8EA 1JFUA 1GSUA 3F4SA 3M1GA 3N9JA 5G1LA 4BVYA 5ECRB 4PNFA 4ZILA 1J9BA 4Z2UA 2RM6A 2WFCA 3GTUB 2DIZA 3CRUA 4H86A 1XXUA 5GAPD 4LL1B 1XWCA 2EIOA 1BJXA 4MF7A 3WYWA 1SYRA 4NMUA 2HZEA 2H30A 3TCOA 3KTLA 6GSSA 1FHEA 4DEJA 4O92A 4K2XA 5HFIA 5D73A 3F8UA 4OWYA 1SL2B 4PQ1A 2B5EA 2YZHA 3VWXA 4KSMA 5DQSA 3HHVA 2R0GA 1O8WA 1T4ZA 5A5KA 4EXJA 2A4HA 1PN9A 1BX9A 1TU8A 3C1SA 3U6VA 14GSA 1LU4A 4EVMA 2EC4A 3ERGA 4AKHA 2H76A 2R0CA 3FY7A 1U88A 5AISA 5D9XA 5IMDA 1V9WA 5EVOA 1MTCA 4IVFA 2K8SA 2LEGA 4POMA 2YWNA 4X1UA 1OVNA 4ZBAA 4Z7XA 3PINA 2FCHA 3GL3A 2RUFA 3NIVA 1RK4A 1NHYA 4RI7A 3I43A 3KM6A 4IQAA 3TKSC 3W8SA 2IMDA 1GNWA 1ERVA 1QGVA 4I6XA 1TP9A 3FRCA 4WR4A 2C3NA 3KH9A 5DDLA 4Z2TA 3DMLA 3VI5A 2KP2A 3TKRA 2FLSA 4ZBBA 5IMVA 1PRXA 3V1WA 3JCML 3TRPA 1YQ1A 2C3TA 5AIXA 2OA7A 3BJ5A 2VCTA 2DLXA 3F0IA 2X8GA 3APOA 2IJYA 4LA1A 1BAYA 1QMVA 1U87A 8GSSA 2LJRA 4A5PA 2DKHA 2X4AA 1DBYA 3VLNA 2VAFA 3BCKA 5HR2A 3OR5A 3IA1A 1YF0A 4HQSA 3N5OA 3L9UA 4GSTA 2A2PA 4NWYA 1TK8B 2LJKA 1NM3A 2V6KA 3EC3A 1Z6NA 4ISDA 3PPUA 1TK5B 4RUVA 1F9MA 4Q5QA 5ECQB 1LBKA 1OC9B 2C0GA 5F06A 3EURA 3KTBA 3ZVJD 5DAKA 2P5RA 2DJJA 2X64A 4KF9A 1B4PA 1GSSA 3CMIA 3M0FA 2H1LA 5G2ZA 2HRKA 1SJ6A 3KGKA 4WBJA 1VF1A 2CAIA 4KH7A 2B1KA 1EEJA 3LEFA 1K0NA 5HQPA 1AIUA 4ZL9A 2RIIA 4IJ3A 3HXSA 4TXOB 3TRXA 5AGYA 1T00A 3C71A 2PERA 2EIRA 4ZIJA 3ZMLA 2AV4A 3UVTA 3ME8A 1SJZA 3QCPA 2OADA 5FT3A 2OBKA 3D4MA 1PX7A 4DSQA 2OT3A 4PUAA 4J57E 4K6XA 1HNBA 5B7CA 1ZL9A 2EFHA 1YEXA 3GL5A 5DVBA 2MBSA 3FZ4A 2HRAA 3IRAA 2K18A 3J7Yb 3QDNA 19GSA 3GYKA 2C3QA 3HJPA 4HQZA 4ZBDA 3MDKA 1TDIA 3NOFA 1FB6A 4GSNA 3TOUA 5G1KA 3MSZA 1AQVA 1YF1A 5HR3A 3D4TA 4YQUA 3LXZA 1EV4A 2H1BA 3FYGA 2DSAA 1XWKA 3VPQA 2VD1A 3ZL5A 5A1NA 3SWLA 1V2AA 2HLSA 1K3OA 2LNSA 4JU5A 4PUFC 4ACSA 4I97A 4XS6A 2C0EA 2LQOA 2HRNA 4ZB7A 4LLRA 4MH2A 3FEUA 4K8MA 2GSRA 3RDWA 4XRDA 2B7KA 3TKSE 4HOJA 3US3A 3F3QA 4QL9A 1G6YA 3F3RA 2ZNMA 2CAQA 2P5QA 4XS4A 5KOWA 1SK0A 2WDUA 5IO0A 5CRGA 1R5AA 3CSJA 1Z7RA 1WE0A 1K0DA 1TRVA 4AKGA 1ZYNA 2FWFA 2IMEA 3M8NA 3QFBC 4OMVA 4ICYA 3UMAA 5A5HB 4EIPA 2IFQB 5BMUB 3P2AA 4AF2A 1XWBA 3MWHA 1EZKA 4JZQA 3GKNA 3FKFA 2TIRA 1GL8A 1TU7A 6GSWA 2YCDA 4USSA 2GQMA 4ML6A 5IPGA 1XOAA 1FW1A 2GT5A 3R2QA 4BVXB 4DSSA 6GSYA 4KB3A 4HEA2 3QMXA 1HQOA 1Y25A 4X43A 3Q74A 3IPZA 3GH9A 3QR6A 4WR5A 4TR0A 1VF2A 1NSWA 3ZMKA 3IK9A 2F3MA 3CXGA 2DJ3A 4IQ1A 1GUHA 3GN3A 5BRTA 2H8LA 2E0QA 4ECCA 5IQYA 3RAZA 1KBNA 2B1LA 18GSA 2K6VA 2VL9A 2DBCA 4TVEA 4NXIA 2R2JA 4V2MA 2K8VA 2X49A 4FH8A 3EINA 3WT2A 3C73A 4KDUA 3GFKA 4WBRD 3LORA 1OE8A 5JCWA 4KCEA 2HSNB 2M72A 2UZ8A 1URMA 1WMJA 2LSTA 5FHIA 2N5FA 1AW9A 1YKCA 4N30A 2KP1A 5HR0A 5LCZA 4G9HA 2VCVA 6GSTA 5JWOB 2MBTA 1N8JA 4TRXA 4TXVA 1O6JA 4IBPA 3DXBA 4KCAA 3HY2A 4POKA 4MCUA 2V2GA 4O5QA 5AN1A 2RUEA 3BD2A 2MZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSF A;  5J41 A;  5DJM A;  1XPV A;  1WWJ A;  2NDO A;  2FWH A;  2CZ2 A;  4POB A;  4YH2 A;  1OKT A;  5KN3 A;  5F8B A;  4F9Z A;  5ECI B;  2H70 A;  5EY6 A;  2O7K A;  4HU9 A;  4IJI A;  1XZO A;  2YZU A;  2E7P A;  4BPY A;  2VCQ A;  2GTU A;  3GST A;  1G7E A;  3IC4 A;  2VOC A;  4KAE A;  2FWG A;  4GRF A;  2C0F A;  1A2J A;  2BMX A;  3EMX A;  1SU9 A;  1UN2 A;  4ID0 A;  4L5L A;  5GST A;  1SL1 B;  1SK2 A;  2JL4 A;  2CVK A;  3GUS A;  5E59 A;  2HSM B;  3EVI A;  1B4Q A;  3QFA C;  3PR8 A;  2V6O A;  2HZF A;  4POL A;  2CVD A;  6GSV A;  4KW6 A;  4ILF A;  2QKE A;  2PMT A;  1G0T A;  5DJL A;  2IMK A;  4K7N A;  2M80 A;  3GKK A;  5J3R A;  1GTA A;  1DE2 A;  4G2E A;  3LXT A;  3Q6O A;  1M7T A;  3ZTL A;  3ZRD A;  2YWO A;  3CYN A;  3QAW A;  1F37 A;  3APQ A;  2LTK A;  4L8E A;  4MF6 A;  3HVX A;  4ECI A;  5DBQ A;  3GHA A;  4GF0 A;  4EDY A;  4F0B A;  2GQK A;  5C04 A;  3KCM A;  4MJA A;  1X5E A;  2NBS A;  2YOI A;  2IN3 A;  1WIK A;  4G0L A;  5GSS A;  1AQW A;  1FAA A;  1R4W A;  1M9B A;  3E9J B;  1GSD A;  12GS A;  4N10 A;  1K0M A;  2FHE A;  1PL2 A;  1JLW A;  3O6T A;  3QAV A;  3TKQ A;  4FO5 A;  3QOU A;  2L6C A;  3CTG A;  4D73 B;  1XWG A;  2DMM A;  1EV9 A;  1PGT A;  22GS A;  4BWS A;  4V1A p;  2C80 A;  4CHS A;  2WS2 A;  1E2Y A;  2JAD A;  3BOA A;  2VL2 C;  4HJM A;  1B8X A;  4XS1 A;  6GSU A;  4P3Y B;  5IM9 A;  1XOB A;  4IEL A;  1O85 A;  2GSS A;  3GNJ A;  3GX0 A;  5IMA A;  5HFK A;  2GLR A;  1N2A A;  4IP1 A;  1B9Y C;  1OC9 A;  2MMN A;  4K0N A;  3D22 A;  16GS A;  2YWM A;  1GSY A;  3W6G A;  1I9D A;  3UVH A;  1KNG A;  2V41 A;  4IW9 A;  4MJE A;  4NAX A;  5JCG A;  4GLT A;  3BCI A;  3KP9 A;  4OO4 A;  1FG4 A;  3HVS A;  5F0G A;  3Q18 A;  3IAS 2;  3Q19 A;  2CX4 A;  5L71 A;  2PUK C;  3E0U A;  1GTU A;  1VF4 A;  2F8F A;  3IC8 A;  1JZD A;  2HRF A;  2WB9 A;  1TKD B;  3LYK A;  1YZX A;  4ECJ A;  2ZUP A;  1X5C A;  4ZL7 A;  5ENU A;  1R5P A;  1HYU A;  3KMO A;  1SL0 B;  2LS5 A;  1A2M A;  2A4V A;  4WF5 A;  2NPB A;  4JBB A;  2PVQ A;  3DIE A;  4K0G A;  3HKR A;  2I9H A;  3TJJ A;  4KX4 A;  5ID2 B;  3DWV A;  4HU7 A;  2WJU A;  3M9K A;  3MNG A;  2N5B A;  1ERU A;  3U5R E;  1VF3 A;  4N11 A;  3HJM A;  17GS A;  1UC7 A;  5COH A;  1WPI A;  3TKS A;  3LJR A;  4TN8 A;  3ERF A;  2Z9S A;  9GSS A;  1PKZ A;  3D0Z A;  1ERW A;  13GS A;  1KTE A;  2RLI A;  5HFG A;  4OO5 A;  2XHF A;  2C8U A;  2MMA A;  1WP0 A;  1Q4J A;  5ELG A;  4Q5R A;  2VLV A;  3A2V A;  1CQH A;  3D5J A;  1ZOF A;  1A24 A;  1R26 A;  3KZQ A;  4X0X A;  5ECH B;  1GTI A;  3HZ4 A;  3S9F A;  3KMN A;  5H5S A;  2KOK A;  3M3M A;  3UIW A;  3DRN A;  1ABA A;  1BG5 A;  5F05 A;  1U3A A;  1GH2 A;  3DVX A;  2H66 A;  1EWX A;  1XFL A;  1LJR A;  1TW9 A;  2WGR A;  4MZC A;  1GWC A;  2IFQ A;  5ECL B;  1X9W B;  5BMU A;  1PL1 A;  5ECM B;  1VGL A;  1K3Y A;  2DJ2 A;  4MLY A;  1U6T A;  4WEY A;  3K8N A;  4OFT A;  1SK1 A;  3ED3 A;  2LNT A;  3KXO A;  3TRQ A;  4V2L A;  4NHZ A;  3E3E A;  5A4V A;  2M46 A;  2HSH A;  3O3T A;  3DYR A;  1J0F A;  1XVW A;  3CTF A;  4EO3 A;  1PKW A;  2H6Z A;  3FZ9 A;  3LGC A;  5G5E A;  5HR1 A;  4CDO A;  4KDX A;  1BED A;  3P90 A;  5IIZ A;  2E2G A;  2LJA A;  4TR3 A;  20GS A;  3UAP A;  2F51 A;  2PPT A;  3DVW A;  1GSE A;  3EWL A;  2AB6 A;  4PQH A;  5A4U A;  3SBC A;  1AQX A;  3IBH A;  3F9U A;  4YQM A;  1FO5 A;  1M9A A;  1ACV A;  4Q5N A;  4ULX A;  2GGT A;  1QQ2 A;  2VD0 A;  1QFN A;  1HD2 A;  2JZS A;  2WZ9 A;  4GXZ A;  3WGX A;  2FWE A;  4KA0 A;  2R37 A;  1OKD A;  4KDY A;  3LFL A;  4HUA A;  2PU9 C;  5KN1 A;  3GIX A;  1RQM A;  3GH6 A;  3UBK A;  2YN1 A;  1TK0 B;  4G19 A;  5J9B A;  3IE3 A;  3CSH A;  5D9W A;  2CA8 A;  4HZ4 A;  1M2A A;  3RHB A;  3RPP A;  4XIH A;  2YJH A;  1SKR B;  2OJL A;  4TW5 A;  1HNC A;  2VM1 A;  2DML A;  5G30 A;  1ILO A;  1XVQ A;  2K9F A;  2R3X A;  6GSX A;  2AHE A;  4RQR A;  1KEB A;  2O87 A;  4LMV A;  4K7O A;  3QD9 A;  4GSS A;  1ZGN A;  2XPE A;  2NVL A;  4YAV A;  2OE1 A;  1M2D A;  3KD0 A;  1T7P B;  1Q98 A;  3GKX A;  5CRH A;  1OC8 A;  4WXT A;  2F8A A;  3I69 A;  4OD7 A;  4BL7 B;  1K0O A;  1FVJ A;  3H4K A;  2VL3 A;  1THX A;  4IKH A;  4XRA A;  4RQX A;  4EC0 A;  4F0C A;  3A5W A;  5D93 A;  2R4V A;  5IPH A;  1FVK A;  1S3A A;  5DAL B;  5CRE A;  4K7I A;  2REM A;  1YKA A;  4PUR A;  3A3T A;  3WGE A;  3D21 A;  1PQN A;  2OBI A;  5LD0 A;  4KGI A;  2B6M A;  1PA3 A;  2KUC A;  1QK8 A;  1ZZY A;  3ZRE A;  1T4Y A;  1V98 A;  2HFD A;  5D9V A;  4YQV A;  1EP8 A;  2ZCT A;  3WD6 A;  1W89 A;  1M99 A;  5ECK B;  4F03 A;  1SKS B;  1RW1 A;  1GUL A;  1UA5 A;  4DSS B;  1ERT A;  4YAP A;  1V58 A;  1TJD A;  2GST A;  4IS0 A;  1A0F A;  4E8H A;  3MAK A;  4KND A;  2YP6 A;  4EDZ A;  2H1A A;  2PWJ A;  2HSM A;  1ZYQ B;  2QC7 A;  3A2W A;  4ML1 A;  4GQC A;  4NV5 A;  3TJB A;  5D96 A;  2DJK A;  2IL3 A;  1ZYE A;  4XCS A;  1NW2 A;  3KIJ A;  2R5G A;  5KN0 A;  1A2L A;  3L4N A;  3KH7 A;  3L9V A;  4MK3 A;  1WJK A;  2AUV A;  4HDE A;  2VCX A;  3IAM 2;  2IWT A;  2DJ0 A;  3GV1 A;  1XIY A;  2P31 A;  5EPF A;  1GP1 A;  3ZIJ A;  5ELA A;  4AJ7 A;  5JWR B;  1TI3 A;  3C1R A;  5CP1 A;  2CQ9 A;  5JWQ B;  3ZVJ A;  1I5G A;  1O8X A;  3GTU A;  3P7X A;  4GCI A;  4G10 A;  2GT6 A;  1FOV A;  4OCF A;  3VFI A;  1X9M B;  2WRT A;  3HCZ A;  1USB A;  2LQQ A;  3GSS A;  2C1Y A;  2L59 A;  2MYG A;  2IIY A;  2GZZ A;  3ZIV A;  3C8E A;  4AJ6 A;  1EOH A;  2R6K A;  1T1V A;  2TRC P;  2V1M A;  3BBY A;  4L0W A;  3DD3 A;  3TUE A;  4GQF A;  3F4T A;  2C0D A;  1GLP A;  3WGD A;  2N5A A;  5D8I A;  2L4Q A;  4KE3 A;  3HZ8 A;  4TR1 B;  4D73 A;  1MDK A;  1DUG A;  4BWQ A;  3NZN A;  1HNA A;  4L0U A;  4EF0 A;  3ZIT A;  1GUM A;  3TGZ A;  2JAC A;  3A2X A;  2XBQ A;  3L9S A;  4JED A;  1WOU A;  3DGQ A;  1MD4 A;  2O89 A;  2CV4 A;  3C7M A;  3QAG A;  1GTB A;  2HI7 A;  1E6B A;  5ECO B;  4GTU A;  1OE7 A;  4IN0 A;  4ECB A;  2H01 A;  4PXO A;  4MMM A;  10GS A;  1EP7 A;  3HVV A;  2L5O A;  1X0R A;  2HYX A;  1T3B A;  2I4A A;  1A23 A;  4NV2 A;  3CBU A;  2NTO A;  1G7O A;  2FA8 A;  2VIM A;  3APS A;  4JR6 A;  1K0B A;  2VM2 A;  2LRN A;  4PGT A;  2IMF A;  1PD2 1;  4PTS A;  2TRX A;  1AC1 A;  2A2R A;  1BYE A;  3RBT A;  5B6N A;  4ZB9 A;  2ON5 A;  4FQU A;  3J7Y k;  2ON7 A;  2BTO T;  4O32 A;  3VUR A;  2A2S A;  1TRS A;  3ME7 A;  3KP8 A;  4MF5 A;  1A8L A;  1XW5 A;  1F3A A;  1JLV A;  3ZLP A;  2VLU A;  4XTS A;  3FR6 A;  4EE0 A;  2LV3 A;  4HI7 A;  3ERW A;  2JU5 A;  5EL8 A;  2GDR A;  1ON4 A;  2GVP A;  2I1U A;  3TJK A;  3GA4 A;  4V1A g;  4BVY B;  4QL7 A;  1A0R P;  3IOS A;  4RI6 A;  4MPF A;  2CZ3 A;  3FR9 A;  1F6M C;  2HXK A;  2O85 A;  2DC5 A;  1S3C A;  2IPA A;  2LRC A;  4K1F A;  2H72 A;  3F6D A;  3DKS A;  5A4W A;  2HZE B;  4EKZ A;  4IHU A;  5ID2 A;  5H5Q A;  5KN2 A;  2B3S A;  2KHP A;  5DQY A;  1PSQ A;  1TRW A;  2H1D A;  2CVB A;  2YWI A;  1YY7 A;  4PQI A;  3IK7 A;  5JCU A;  1UVZ A;  1GSQ A;  4MJB A;  2HSY A;  4HZ2 A;  4TXO A;  4MH3 A;  2CX3 A;  3ISO A;  2VLT A;  2MMZ A;  3UAR A;  2FUG 2;  4ZB8 A;  1ZCP A;  4J2F A;  4WKW A;  1V40 A;  1M2B A;  1G6W A;  4QQ7 A;  1EGR A;  4TKY A;  2J9H A;  1YDK A;  1ZMA A;  2FNO A;  1AUC A;  4G0I A;  5CAX A;  3VPT A;  4DSR A;  1F3B A;  2VL2 A;  2H74 A;  4JE1 A;  3O76 A;  2X8C A;  3QPM A;  3PH9 A;  4IP6 A;  3G9B A;  1QUW A;  4BA7 A;  3ZFL A;  1B9X C;  4OFN A;  2GQL A;  5IOX A;  3IHQ A;  2VUP A;  1X9S B;  3TDG A;  4GWR A;  1TOF A;  4LMW A;  3EU3 A;  7GSS A;  4N0V A;  1MDI A;  4L5O A;  4DVC A;  4I2T A;  2MMO A;  3GUR A;  1XW9 A;  2H0G A;  2LRT A;  3F63 A;  5IMZ A;  5IO2 A;  1K3L A;  3UOM A;  4TOP A;  3CRT A;  2H19 A;  5AIV A;  2VCW A;  1F2E A;  3L78 A;  1K0C A;  5J5N A;  1DE1 A;  2O8V B;  1GNE A;  4XHM A;  3GX8 A;  4V2N A;  3ZZX A;  3VWV A;  1W4V A;  1EOG A;  2JSZ A;  1TTZ A;  2YJ7 A;  3RPN A;  3D6I A;  2EIQ A;  4IGJ A;  1OAZ A;  4O7H A;  4MP4 A;  1S3D A;  1OC3 A;  5KEJ A;  2GZP A;  1M0U A;  2L57 A;  1J08 A;  1K0A A;  3FHK A;  3L0H A;  5DAK B;  5F07 A;  1XBS A;  1H4O A;  5B8B A;  4MZB A;  2G2Q A;  2QGV A;  3IR4 A;  2HRK B;  3ZYW A;  1DSB A;  2JZT A;  2IMI A;  4BVX A;  5CNW A;  1GRX A;  5GZZ B;  2ALB A;  1Z6M A;  2DJ1 A;  3VK9 A;  5B8A A;  1SEN A;  4PNG A;  2FY6 A;  2AJQ B;  1MDJ A;  4MDC A;  4F2I A;  3EU4 A;  2H6Y A;  2H75 A;  4MZW A;  2B7J A;  2F9S A;  2XPD A;  1FB0 A;  4CW9 A;  3P8W A;  2P0G A;  5LNK e;  1YEP A;  2PBJ A;  4BL7 A;  3G7Y A;  1Z3E A;  4KSO A;  1U3I A;  1A8Y A;  2BJX A;  5DAL A;  3UBL A;  3TJF A;  4JRR A;  11GS A;  3PGT A;  1JZW A;  1XWA A;  1TXX A;  1PMT A;  1Z7P A;  2JSY A;  3VWU A;  2CT6 A;  1PX6 A;  1AAZ A;  1JHB A;  4N0Z A;  2DIY A;  3H79 A;  3CSI A;  1IYH A;  1GUK A;  3F4R A;  2JZR A;  1O81 A;  3TB2 A;  2X8H A;  5ECN B;  3LQ7 A;  5DCG A;  2L6D A;  4I2U A;  3I6A A;  1V57 A;  3HA9 A;  2YAN A;  4FYC A;  2OE0 A;  5IMF A;  1EGO A;  2I3Y A;  1VRS D;  2PVO C;  3IXR A;  3M9J A;  4K2D A;  4HS1 A;  2YV9 A;  5B6M A;  4ZL8 A;  3WT1 A;  1ST9 A;  1R7H A;  3KEB A;  4XS4 B;  1AXD A;  5ECS A;  2H1G A;  2VO4 A;  2RM5 A;  2PN8 A;  3HYP A;  3UJ1 A;  3W8J A;  3GMF A;  1XCC A;  4TR4 A;  5ECP B;  3EYT A;  1THO A;  5H5R A;  4NPB A;  3TOT A;  3UEM A;  5J9C A;  4WF4 A;  2FA4 A;  3FZA A;  2J23 A;  2HNL A;  2GS3 A;  3FR3 A;  4ZXG A;  4FIW A;  5IMC A;  3RHC A;  3LWA A;  4I8B A;  2B5X A;  2D2Z A;  1T8E B;  5IOW A;  5D9T A;  2AAW A;  1TI1 A;  5CO3 A;  1CQG A;  2FGX A;  2H0H A;  1H75 A;  1SYX A;  2I81 A;  3KJY A;  3GRX A;  5G5F A;  1SKW B;  1WRY A;  1XW6 A;  2QSI A;  5CRD A;  3EE2 A;  3HDC A;  1MD3 A;  4MA9 A;  3AY8 A;  2VCZ A;  4FYU A;  3H1N A;  5J4U A;  4PX1 A;  2WUL A;  3H93 A;  2YV7 A;  4AJ8 A;  2L4C A;  4F82 A;  2YNX A;  4Q5F A;  1TRU A;  3IV4 A;  1JZR A;  2H0I A;  2OAC A;  3IDV A;  3G7I A;  1SD9 A;  2KLX A;  3EMP A;  4O5R A;  4I5Q A;  1C72 A;  1O73 A;  2WCI A;  4ZB6 A;  5G31 A;  3FZ5 A;  4EL1 A;  1YJ6 A;  5C00 A;  3TJG A;  4MPG A;  1X5D A;  4FYB A;  1NHO A;  3FW2 A;  4OFM A;  2E2M A;  4TR1 A;  3HJO A;  5ABR A;  4MJC A;  4WET A;  2YPM A;  3LYP A;  2OKA A;  5INY A;  4AGS A;  2H6X A;  1O7U A;  3LG6 A;  3HD5 A;  1Y6E A;  4NHW A;  5CYY A;  4EUY A;  4LL4 B;  4MAB A;  2PGT A;  3ZFB A;  4G0K A;  2GSQ A;  2LUS A;  1OYJ A;  1BQ7 A;  1Z5Y E;  1GLQ A;  4K9Z A;  3DEX A;  3GKM A;  4JR4 A;  2HT9 A;  2HQT A;  2B5Y A;  2H71 A;  1MEK A;  2XC2 A;  2GZY A;  2V32 A;  2XBI A;  2C4J A;  5CRW A;  5E4W A;  5FWG A;  1IYI A;  3F6F A;  3I9V 2;  3FK8 A;  1Z9H A;  2H73 A;  2HE3 A;  5GAN D;  2AYT A;  3LSZ A;  4HJ2 A;  3G7J A;  4J56 E;  5DCH A;  4KUN A;  3VWW A;  1ML6 A;  1SJI A;  1JZO A;  3H8Q A;  2ES7 A;  1B48 A;  3UL3 A;  2LKU A;  3VI7 A;  2G0F A;  2X99 A;  2OE3 A;  1EEM A;  1QXH A;  1SD8 A;  2L5L A;  4OCE A;  3R3E A;  2FD3 A;  3TKP A;  4E8E A;  1JFU A;  1GSU A;  3F4S A;  3M1G A;  3N9J A;  5G1L A;  4BVY A;  5ECR B;  4PNF A;  4ZIL A;  1J9B A;  2RM6 A;  2WFC A;  3GTU B;  2DIZ A;  3CRU A;  4H86 A;  1XXU A;  5GAP D;  4LL1 B;  1XWC A;  2EIO A;  1BJX A;  4MF7 A;  3WYW A;  1SYR A;  4NMU A;  2HZE A;  2H30 A;  3TCO A;  3KTL A;  6GSS A;  1FHE A;  4DEJ A;  4O92 A;  5HFI A;  5D73 A;  3F8U A;  4OWY A;  1SL2 B;  4PQ1 A;  2B5E A;  2YZH A;  3VWX A;  4KSM A;  5DQS A;  3HHV A;  1O8W A;  1T4Z A;  5A5K A;  4EXJ A;  1PN9 A;  1BX9 A;  1TU8 A;  3C1S A;  3U6V A;  14GS A;  1LU4 A;  4EVM A;  2EC4 A;  3ERG A;  2H76 A;  3FY7 A;  1U88 A;  5AIS A;  5D9X A;  5IMD A;  1V9W A;  5EVO A;  1MTC A;  4IVF A;  2K8S A;  2LEG A;  4POM A;  2YWN A;  4X1U A;  1OVN A;  4ZBA A;  4Z7X A;  3PIN A;  2FCH A;  3GL3 A;  2RUF A;  3NIV A;  1RK4 A;  1NHY A;  4RI7 A;  3I43 A;  3KM6 A;  4IQA A;  3TKS C;  3W8S A;  2IMD A;  1GNW A;  1ERV A;  1QGV A;  4I6X A;  1TP9 A;  3FRC A;  4WR4 A;  2C3N A;  3KH9 A;  5DDL A;  3DML A;  3VI5 A;  2KP2 A;  3TKR A;  2FLS A;  4ZBB A;  5IMV A;  1PRX A;  3V1W A;  3JCM L;  3TRP A;  1YQ1 A;  2C3T A;  5AIX A;  2OA7 A;  3BJ5 A;  2VCT A;  2DLX A;  3F0I A;  2X8G A;  3APO A;  2IJY A;  4LA1 A;  1BAY A;  1QMV A;  1U87 A;  8GSS A;  2LJR A;  1DBY A;  3VLN A;  2VAF A;  3BCK A;  5HR2 A;  3OR5 A;  3IA1 A;  1YF0 A;  4HQS A;  3N5O A;  3L9U A;  4GST A;  4NWY A;  1TK8 B;  2LJK A;  1NM3 A;  2V6K A;  3EC3 A;  1Z6N A;  4ISD A;  3PPU A;  1TK5 B;  4RUV A;  1F9M A;  4Q5Q A;  5ECQ B;  1LBK A;  1OC9 B;  2C0G A;  5F06 A;  3EUR A;  3KTB A;  3ZVJ D;  5DAK A;  2P5R A;  2DJJ A;  2X64 A;  4KF9 A;  1B4P A;  1GSS A;  3CMI A;  3M0F A;  5G2Z A;  2HRK A;  1SJ6 A;  3KGK A;  4WBJ A;  1VF1 A;  2CAI A;  4KH7 A;  2B1K A;  1EEJ A;  3LEF A;  1K0N A;  5HQP A;  1AIU A;  4ZL9 A;  2RII A;  4IJ3 A;  3HXS A;  4TXO B;  3TRX A;  5AGY A;  1T00 A;  3C71 A;  2PER A;  2EIR A;  4ZIJ A;  3ZML A;  2AV4 A;  3UVT A;  3ME8 A;  1SJZ A;  3QCP A;  2OAD A;  5FT3 A;  2OBK A;  3D4M A;  1PX7 A;  4DSQ A;  4PUA A;  4J57 E;  4K6X A;  1HNB A;  5B7C A;  1ZL9 A;  1YEX A;  3GL5 A;  5DVB A;  2MBS A;  3FZ4 A;  2HRA A;  3IRA A;  2K18 A;  3J7Y b;  3QDN A;  19GS A;  3GYK A;  2C3Q A;  3HJP A;  4HQZ A;  4ZBD A;  3MDK A;  1TDI A;  3NOF A;  1FB6 A;  4GSN A;  3TOU A;  5G1K A;  3MSZ A;  1AQV A;  1YF1 A;  5HR3 A;  3D4T A;  4YQU A;  3LXZ A;  1EV4 A;  2H1B A;  3FYG A;  2DSA A;  1XWK A;  3VPQ A;  2VD1 A;  3ZL5 A;  3SWL A;  1V2A A;  2HLS A;  1K3O A;  2LNS A;  4JU5 A;  4PUF C;  4ACS A;  4I97 A;  4XS6 A;  2C0E A;  2LQO A;  2HRN A;  4LLR A;  4MH2 A;  3FEU A;  4K8M A;  2GSR A;  3RDW A;  4XRD A;  2B7K A;  3TKS E;  4HOJ A;  3US3 A;  3F3Q A;  4QL9 A;  1G6Y A;  3F3R A;  2ZNM A;  2CAQ A;  2P5Q A;  4XS4 A;  1SK0 A;  2WDU A;  5IO0 A;  5CRG A;  1R5A A;  3CSJ A;  1Z7R A;  1WE0 A;  1K0D A;  1TRV A;  2FWF A;  2IME A;  3M8N A;  3QFB C;  4OMV A;  3UMA A;  2IFQ B;  3P2A A;  4AF2 A;  1XWB A;  3MWH A;  1EZK A;  4JZQ A;  3GKN A;  3FKF A;  2TIR A;  1GL8 A;  1TU7 A;  6GSW A;  2YCD A;  4USS A;  2GQM A;  4ML6 A;  5IPG A;  1XOA A;  1FW1 A;  2GT5 A;  3R2Q A;  4BVX B;  4DSS A;  6GSY A;  4KB3 A;  4HEA 2;  3QMX A;  1HQO A;  1Y25 A;  4X43 A;  3Q74 A;  3IPZ A;  3GH9 A;  3QR6 A;  4WR5 A;  4TR0 A;  1VF2 A;  1NSW A;  3ZMK A;  3IK9 A;  2F3M A;  3CXG A;  2DJ3 A;  4IQ1 A;  1GUH A;  3GN3 A;  2H8L A;  2E0Q A;  4ECC A;  5IQY A;  3RAZ A;  1KBN A;  2B1L A;  18GS A;  2K6V A;  2VL9 A;  2DBC A;  4TVE A;  4NXI A;  2R2J A;  4V2M A;  2K8V A;  4FH8 A;  3EIN A;  3WT2 A;  3C73 A;  4KDU A;  3GFK A;  4WBR D;  3LOR A;  1OE8 A;  5JCW A;  4KCE A;  2HSN B;  2M72 A;  2UZ8 A;  1URM A;  1WMJ A;  2LST A;  5FHI A;  2N5F A;  1AW9 A;  1YKC A;  4N30 A;  2KP1 A;  5HR0 A;  5LCZ A;  4G9H A;  2VCV A;  6GST A;  5JWO B;  2MBT A;  1N8J A;  4TRX A;  4TXV A;  1O6J A;  4IBP A;  3DXB A;  4KCA A;  3HY2 A;  4POK A;  4MCU A;  2V2G A;  5AN1 A;  2RUE A;  3BD2 A;  2MZC A; 
#chains in the Genus database with same CATH topology
 1GSF A;  5J41 A;  5DJM A;  1XPV A;  1WWJ A;  2NDO A;  2FWH A;  2CZ2 A;  4POB A;  4YH2 A;  1OKT A;  5KN3 A;  5F8B A;  4F9Z A;  5ECI B;  2H70 A;  5EY6 A;  2O7K A;  4AKX B;  4HU9 A;  4IJI A;  1XZO A;  2YZU A;  2E7P A;  4BPY A;  3CQF A;  2VCQ A;  2GTU A;  3GST A;  1G7E A;  4G01 A;  3IC4 A;  2VOC A;  4KAE A;  2FWG A;  4GRF A;  2C0F A;  1A2J A;  2BMX A;  1S4B P;  3EMX A;  1SU9 A;  1UN2 A;  4ID0 A;  4L5L A;  4HSC X;  5GST A;  1SL1 B;  1SK2 A;  2JL4 A;  2CVK A;  3GUS A;  5E59 A;  2HSM B;  3EVI A;  1B4Q A;  2VKZ G;  3QFA C;  3PR8 A;  2V6O A;  2HZF A;  4POL A;  2CVD A;  6GSV A;  4KW6 A;  4ILF A;  2QKE A;  4GDF A;  2PMT A;  1G0T A;  5DJL A;  4E68 A;  2IMK A;  4K7N A;  2M80 A;  3GKK A;  5J3R A;  1GTA A;  1DE2 A;  4G2E A;  3LXT A;  3CHX C;  3Q6O A;  1M7T A;  3ZTL A;  3ZRD A;  2YWO A;  3CYN A;  3QAW A;  1F37 A;  3APQ A;  2LTK A;  4L8E A;  4MF6 A;  4PHZ C;  3HVX A;  4ECI A;  5DBQ A;  3GHA A;  4GF0 A;  4EDY A;  4F0B A;  2GQK A;  3LW9 A;  5C04 A;  3KCM A;  4MJA A;  2WW2 A;  1X5E A;  2NBS A;  2YOI A;  2IN3 A;  1WIK A;  4G0L A;  5GSS A;  1AQW A;  1FAA A;  1R4W A;  5A34 B;  1M9B A;  3E9J B;  1GSD A;  12GS A;  4N10 A;  1K0M A;  2FHE A;  1PL2 A;  1JLW A;  3O6T A;  1BF5 A;  3QAV A;  3TKQ A;  4FO5 A;  3QOU A;  2L6C A;  3CTG A;  4D73 B;  1XWG A;  2DMM A;  1EV9 A;  1PGT A;  22GS A;  4BWS A;  4V1A p;  2C80 A;  4CHS A;  2WS2 A;  2R0P A;  1E2Y A;  2JAD A;  3BOA A;  2VL2 C;  4HJM A;  1B8X A;  2QA1 A;  4XS1 A;  6GSU A;  4P3Y B;  5IM9 A;  1XOB A;  4IEL A;  1O85 A;  5J40 A;  2GSS A;  3GNJ A;  3GX0 A;  5IMA A;  5HFK A;  2GLR A;  1N2A A;  4IP1 A;  1B9Y C;  1OC9 A;  2MMN A;  4K0N A;  3D22 A;  3TU3 B;  16GS A;  2YWM A;  1GSY A;  3W6G A;  1I9D A;  3UVH A;  1KNG A;  2V41 A;  4IW9 A;  4MJE A;  4NAX A;  5JCG A;  4GLT A;  2EFC A;  3BCI A;  3KP9 A;  4OO4 A;  1FG4 A;  3HVS A;  5F0G A;  3Q18 A;  3IAS 2;  3Q19 A;  2CX4 A;  5L71 A;  2PUK C;  3E0U A;  3MIX A;  1GTU A;  1VF4 A;  2F8F A;  3IC8 A;  1JZD A;  2HRF A;  2WB9 A;  1TKD B;  3LYK A;  1YZX A;  4ECJ A;  2ZUP A;  1X5C A;  4ZL7 A;  5ENU A;  1R5P A;  1HYU A;  3KMO A;  1SL0 B;  2LS5 A;  1A2M A;  2A4V A;  4WF5 A;  2NPB A;  4JBB A;  2PVQ A;  4FXY P;  3DIE A;  4K0G A;  3HKR A;  2I9H A;  3TJJ A;  4KX4 A;  5ID2 B;  3DWV A;  4HU7 A;  2WJU A;  3M9K A;  3MNG A;  2N5B A;  1ERU A;  3U5R E;  1VF3 A;  4N11 A;  3HJM A;  17GS A;  1UC7 A;  5COH A;  1WPI A;  3TKS A;  3LJR A;  4TN8 A;  3ERF A;  2Z9S A;  9GSS A;  1PKZ A;  1ZYP A;  3D0Z A;  1ERW A;  13GS A;  2WVX A;  1KTE A;  2RLI A;  5HFG A;  4OO5 A;  2XHF A;  2C8U A;  2MMA A;  1WP0 A;  1Q4J A;  5ELG A;  4Q5R A;  2VLV A;  3A2V A;  1CQH A;  3D5J A;  1ZOF A;  1A24 A;  1R26 A;  3KZQ A;  4X0X A;  5ECH B;  1GTI A;  2O36 A;  3HZ4 A;  3S9F A;  3KMN A;  5H5S A;  2KOK A;  3M3M A;  3UIW A;  3DRN A;  1ABA A;  1BG5 A;  5F05 A;  1U3A A;  1GH2 A;  3DVX A;  2H66 A;  1EWX A;  1XFL A;  1LJR A;  1TW9 A;  2WGR A;  4MZC A;  5A5H A;  1GWC A;  2IFQ A;  5ECL B;  1X9W B;  5BMU A;  1PL1 A;  5ECM B;  1VGL A;  1K3Y A;  2DJ2 A;  4MLY A;  1U6T A;  4WEY A;  3K8N A;  4OFT A;  2O5V A;  1SK1 A;  3ED3 A;  2LNT A;  3KXO A;  4MNN A;  3TRQ A;  4V2L A;  4NHZ A;  1M3I A;  3E3E A;  5A4V A;  2M46 A;  2HSH A;  3O3T A;  3DYR A;  1J0F A;  4EIQ A;  1XVW A;  3CTF A;  4EO3 A;  1PKW A;  2H6Z A;  3FZ9 A;  3LGC A;  5G5E A;  5HR1 A;  4CDO A;  4KDX A;  1BED A;  3P90 A;  5IIZ A;  2E2G A;  2LJA A;  4TR3 A;  20GS A;  3UAP A;  2F51 A;  2PPT A;  3DVW A;  1GSE A;  1PFO A;  3EWL A;  2AB6 A;  4PQH A;  5A4U A;  3SBC A;  1AQX A;  3IBH A;  3F9U A;  4YQM A;  1FO5 A;  1M9A A;  1ACV A;  4Q5N A;  4ULX A;  1I1I P;  1YEW C;  2GGT A;  1QQ2 A;  2VD0 A;  1QFN A;  1HD2 A;  2JZS A;  2WZ9 A;  4GXZ A;  3WGX A;  2FWE A;  4KA0 A;  2R37 A;  1OKD A;  4KDY A;  3LFL A;  4HUA A;  2PU9 C;  5KN1 A;  3GIX A;  1RQM A;  3GH6 A;  3UBK A;  2HSN A;  2YN1 A;  1TK0 B;  4G19 A;  5J9B A;  3IE3 A;  3CSH A;  5D9W A;  2CA8 A;  4HZ4 A;  1M2A A;  3RHB A;  3RPP A;  4XIH A;  1XG8 A;  2YJH A;  1SKR B;  2OJL A;  4TW5 A;  1HNC A;  2VM1 A;  2DML A;  5G30 A;  1ILO A;  1XVQ A;  2K9F A;  2R3X A;  6GSX A;  4N3Z A;  2AHE A;  4RQR A;  1KEB A;  2O87 A;  4LMV A;  4K7O A;  3QD9 A;  4GSS A;  1ZGN A;  2XPE A;  2NVL A;  4YAV A;  2OE1 A;  1M2D A;  3KD0 A;  1T7P B;  1YVL A;  1Q98 A;  3GKX A;  5CRH A;  1OC8 A;  4WXT A;  2F8A A;  3I69 A;  4OD7 A;  4BL7 B;  1K0O A;  1FVJ A;  3H4K A;  2VL3 A;  1THX A;  4IKH A;  4XRA A;  4RQX A;  4EC0 A;  4F0C A;  3A5W A;  5D93 A;  2R4V A;  5IPH A;  1FVK A;  1S3A A;  5DAL B;  5CRE A;  4K7I A;  2REM A;  1YKA A;  4PUR A;  3A3T A;  3WGE A;  3D21 A;  1PQN A;  2OBI A;  5LD0 A;  4KGI A;  2B6M A;  1PA3 A;  2KUC A;  1QK8 A;  1ZZY A;  5J47 A;  3EPT A;  3ZRE A;  1T4Y A;  1V98 A;  2HFD A;  5D9V A;  4YQV A;  1EP8 A;  2ZCT A;  3WD6 A;  1W89 A;  1M99 A;  5ECK B;  4K5R A;  4F03 A;  1SKS B;  1RW1 A;  1GUL A;  1UA5 A;  4DSS B;  1ERT A;  4YAP A;  1V58 A;  1Y1U A;  1TJD A;  2GST A;  4IS0 A;  1A0F A;  4E8H A;  3MAK A;  2O3E A;  4KND A;  2YP6 A;  4EDZ A;  2H1A A;  2PWJ A;  1BG1 A;  2HSM A;  1ZYQ B;  3A2W A;  2QC7 A;  4ML1 A;  4GQC A;  4X4J A;  4NV5 A;  3TJB A;  5D96 A;  2DJK A;  2IL3 A;  1ZYE A;  4O5U A;  4XCS A;  1NW2 A;  3KIJ A;  2R5G A;  5KN0 A;  1A2L A;  3L4N A;  3KH7 A;  3L9V A;  4MK3 A;  1WJK A;  2AUV A;  4HDE A;  2VCX A;  3IAM 2;  2IWT A;  2DJ0 A;  3GV1 A;  1XIY A;  2P31 A;  5EPF A;  1GP1 A;  3ZIJ A;  5ELA A;  4AJ7 A;  5JWR B;  1TI3 A;  3C1R A;  5CP1 A;  2CQ9 A;  5JWQ B;  3ZVJ A;  1I5G A;  1O8X A;  4CY6 A;  3GTU A;  3P7X A;  4GCI A;  4G10 A;  2GT6 A;  1FOV A;  4OCF A;  3VFI A;  1X9M B;  2WRT A;  3HCZ A;  1USB A;  2LQQ A;  3GSS A;  2C1Y A;  2L59 A;  2MYG A;  2IIY A;  2GZZ A;  3ZIV A;  3C8E A;  5A34 A;  4AJ6 A;  1EOH A;  2R6K A;  1T1V A;  2TRC P;  2V1M A;  3BBY A;  4L0W A;  3DD3 A;  3TUE A;  5J4Y A;  4GQF A;  3F4T A;  2C0D A;  1GLP A;  3WGD A;  2N5A A;  3A5I A;  5D8I A;  2L4Q A;  4PI2 C;  4KE3 A;  3HZ8 A;  4TR1 B;  4D73 A;  1MDK A;  1DUG A;  4BWQ A;  3NZN A;  1HNA A;  4L0U A;  4YKF A;  4EF0 A;  4CY8 A;  3ZIT A;  1GUM A;  3TGZ A;  2JAC A;  3A2X A;  2XBQ A;  4YKG A;  3L9S A;  4JED A;  1WOU A;  3DGQ A;  1MD4 A;  2O89 A;  2CV4 A;  3C7M A;  3QAG A;  1GTB A;  2HI7 A;  1E6B A;  5ECO B;  4GTU A;  1OE7 A;  4IN0 A;  4ECB A;  2H01 A;  4PXO A;  4MMM A;  10GS A;  1EP7 A;  3HVV A;  2L5O A;  1X0R A;  2HYX A;  1T3B A;  2I4A A;  1A23 A;  4NV2 A;  3CBU A;  2NTO A;  1G7O A;  2FA8 A;  2VIM A;  3APS A;  4JR6 A;  1K0B A;  2VM2 A;  4AI6 A;  2LRN A;  4PGT A;  2IMF A;  1PD2 1;  3MYD A;  4PTS A;  2TRX A;  1AC1 A;  2A2R A;  1BYE A;  3RBT A;  5B6N A;  4ZB9 A;  2ON5 A;  4FQU A;  3J7Y k;  2ON7 A;  2BTO T;  4O32 A;  3VUR A;  2A2S A;  1TRS A;  3ME7 A;  3KP8 A;  4MF5 A;  1A8L A;  1XW5 A;  1F3A A;  1JLV A;  3ZLP A;  2VLU A;  4XTS A;  3FR6 A;  4EE0 A;  1TXU A;  2LV3 A;  4HI7 A;  3ERW A;  2JU5 A;  5EL8 A;  2GDR A;  1ON4 A;  2GVP A;  2I1U A;  3TJK A;  3GA4 A;  4V1A g;  4BVY B;  4QL7 A;  1A0R P;  3IOS A;  4RI6 A;  4MPF A;  2CZ3 A;  3FR9 A;  4QMK A;  1F6M C;  2HXK A;  2O85 A;  2DC5 A;  1S3C A;  2IPA A;  2LRC A;  4K1F A;  2H72 A;  3F6D A;  3DKS A;  5A4W A;  2HZE B;  4EKZ A;  4IHU A;  5ID2 A;  5H5Q A;  5KN2 A;  2B3S A;  2KHP A;  5DQY A;  1PSQ A;  1TRW A;  2H1D A;  2CVB A;  2YWI A;  1YY7 A;  4PI0 C;  4PQI A;  3IK7 A;  5JCU A;  1UVZ A;  5J4V A;  1GSQ A;  4MJB A;  3HVN A;  2HSY A;  2QA2 A;  4HZ2 A;  4TXO A;  4MH3 A;  2CX3 A;  3ISO A;  2VLT A;  2MMZ A;  3UAR A;  2FUG 2;  4ZB8 A;  1ZCP A;  4J2F A;  4WKW A;  1V40 A;  1M2B A;  1G6W A;  4QQ7 A;  1EGR A;  1FOH A;  4TKY A;  2J9H A;  1YDK A;  1ZMA A;  2FNO A;  1AUC A;  4G0I A;  2EFE A;  4K5S A;  5CAX A;  3VPT A;  4DSR A;  1F3B A;  2VL2 A;  2H74 A;  4JE1 A;  3O76 A;  2X8C A;  3QPM A;  3PH9 A;  4IP6 A;  3G9B A;  1QUW A;  4BA7 A;  3ZFL A;  1B9X C;  4OFN A;  2GQL A;  5IOX A;  3IHQ A;  2VUP A;  1X9S B;  3TDG A;  4GWR A;  1TOF A;  4LMW A;  3EU3 A;  7GSS A;  4N0V A;  1MDI A;  4L5O A;  4DVC A;  4I2T A;  2MMO A;  3GUR A;  1XW9 A;  2H0G A;  2LRT A;  3F63 A;  5IMZ A;  5IO2 A;  1K3L A;  3UOM A;  4TOP A;  3CRT A;  2H19 A;  5AIV A;  2VCW A;  1F2E A;  3L78 A;  1K0C A;  5J5N A;  1DE1 A;  2O8V B;  1GNE A;  4XHM A;  3GX8 A;  4V2N A;  3ZZX A;  3VWV A;  1W4V A;  1EOG A;  2JSZ A;  1TTZ A;  2YJ7 A;  3RPN A;  3D6I A;  2EIQ A;  4IGJ A;  1OAZ A;  4O7H A;  4MP4 A;  1S3D A;  1OC3 A;  5KEJ A;  2GZP A;  2WW1 A;  1M0U A;  2L57 A;  1J08 A;  1K0A A;  3FHK A;  3L0H A;  5DAK B;  5F07 A;  1XBS A;  1H4O A;  5B8B A;  4MZB A;  2G2Q A;  2QGV A;  3IHG A;  3IR4 A;  2WVY A;  2HRK B;  3ZYW A;  1DSB A;  2JZT A;  2IMI A;  4BVX A;  5CNW A;  1GRX A;  5GZZ B;  2ALB A;  1Z6M A;  2DJ1 A;  3VK9 A;  5B8A A;  1SEN A;  4PNG A;  2FY6 A;  2AJQ B;  5KOX A;  1MDJ A;  4MDC A;  4F2I A;  3RGB C;  3EU4 A;  2H6Y A;  2H75 A;  4MZW A;  2B7J A;  2F9S A;  2XPD A;  1FB0 A;  4CW9 A;  3P8W A;  2P0G A;  5LNK e;  1YEP A;  2PBJ A;  4BL7 A;  3G7Y A;  1Z3E A;  4KSO A;  1U3I A;  1A8Y A;  2BJX A;  1PN0 A;  5DAL A;  3UBL A;  3TJF A;  4JRR A;  11GS A;  3PGT A;  1JZW A;  1XWA A;  1TXX A;  1PMT A;  1Z7P A;  2JSY A;  3VWU A;  2CT6 A;  1PX6 A;  1AAZ A;  1JHB A;  4N0Z A;  2DIY A;  3H79 A;  3FMW A;  3CSI A;  1IYH A;  1GUK A;  3CWG A;  3F4R A;  5A1N B;  2JZR A;  1O81 A;  3TB2 A;  2X8H A;  5ECN B;  2UV8 G;  3LQ7 A;  1S3R A;  5DCG A;  2L6D A;  4I2U A;  1N25 A;  3I6A A;  1V57 A;  3HA9 A;  2YAN A;  4FYC A;  2OE0 A;  5IMF A;  1EGO A;  2I3Y A;  1VRS D;  2PVO C;  3IXR A;  3M9J A;  4K2D A;  4HS1 A;  2YV9 A;  5B6M A;  4ZL8 A;  3WT1 A;  1ST9 A;  1R7H A;  3KEB A;  4XS4 B;  1AXD A;  5ECS A;  1SVL A;  2H1G A;  2VO4 A;  2RM5 A;  2PN8 A;  4W66 A;  1SVO A;  3HYP A;  3RFR C;  3UJ1 A;  3W8J A;  3GMF A;  1XCC A;  4TR4 A;  5ECP B;  3EYT A;  1THO A;  5H5R A;  4NPB A;  3TOT A;  3UEM A;  5J9C A;  4WF4 A;  2FA4 A;  3FZA A;  2J23 A;  2HNL A;  2GS3 A;  1SVM A;  3FR3 A;  4ZXG A;  4FIW A;  5IMC A;  3RHC A;  3LWA A;  4I8B A;  2B5X A;  2D2Z A;  1T8E B;  5IOW A;  5D9T A;  2AAW A;  1TI1 A;  5CO3 A;  1CQG A;  2FGX A;  2H0H A;  1H75 A;  1SYX A;  2I81 A;  3KJY A;  3GRX A;  5G5F A;  1SKW B;  4AKI A;  1XW6 A;  1WRY A;  2QSI A;  3EE2 A;  5CRD A;  3HDC A;  1MD3 A;  4MA9 A;  4Z2R A;  3AY8 A;  2VCZ A;  4FYU A;  3H1N A;  5J4U A;  4PX1 A;  2WUL A;  3H93 A;  2YV7 A;  4AJ8 A;  2L4C A;  4F82 A;  2YNX A;  4Q5F A;  1TRU A;  3IV4 A;  1JZR A;  2H0I A;  2OAC A;  3IDV A;  3G7I A;  1SD9 A;  2EFD A;  2KLX A;  3EMP A;  4O5R A;  4I5Q A;  1C72 A;  1O73 A;  2WCI A;  4ZB6 A;  5G31 A;  3FZ5 A;  4EL1 A;  1YJ6 A;  5C00 A;  3TJG A;  4MPG A;  1X5D A;  4FYB A;  1NHO A;  3FW2 A;  4OFM A;  2E2M A;  4TR1 A;  3HJO A;  5ABR A;  3HMJ G;  4MJC A;  4WET A;  2YPM A;  3LYP A;  2OKA A;  5INY A;  4AGS A;  2H6X A;  1O7U A;  3LG6 A;  3HD5 A;  1Y6E A;  4NHW A;  5CYY A;  4EUY A;  4LL4 B;  4MAB A;  2PGT A;  3ZFB A;  4G0K A;  2GSQ A;  2LUS A;  1OYJ A;  1BQ7 A;  1Z5Y E;  1GLQ A;  4K9Z A;  3DEX A;  3GKM A;  4JR4 A;  2HT9 A;  2HQT A;  2B5Y A;  2H71 A;  1MEK A;  2XC2 A;  2GZY A;  2V32 A;  2XBI A;  2C4J A;  5CRW A;  5E4W A;  5FWG A;  1IYI A;  3F6F A;  3I9V 2;  3FK8 A;  1Z9H A;  2H73 A;  2HE3 A;  5GAN D;  2AYT A;  3LSZ A;  4HJ2 A;  3G7J A;  4J56 E;  5DCH A;  4KUN A;  3VWW A;  1ML6 A;  1SJI A;  1JZO A;  3H8Q A;  2ES7 A;  1B48 A;  3UL3 A;  2LKU A;  3VI7 A;  2G0F A;  2X99 A;  2OE3 A;  2DKI A;  1EEM A;  1QXH A;  1SD8 A;  2L5L A;  4OCE A;  3R3E A;  2FD3 A;  3TKP A;  4E8E A;  1JFU A;  1GSU A;  3F4S A;  3M1G A;  3N9J A;  5G1L A;  4BVY A;  5ECR B;  4PNF A;  4ZIL A;  1J9B A;  4Z2U A;  2RM6 A;  2WFC A;  3GTU B;  2DIZ A;  3CRU A;  4H86 A;  1XXU A;  5GAP D;  4LL1 B;  1XWC A;  2EIO A;  1BJX A;  4MF7 A;  3WYW A;  1SYR A;  4NMU A;  2HZE A;  2H30 A;  3TCO A;  3KTL A;  6GSS A;  1FHE A;  4DEJ A;  4O92 A;  4K2X A;  2WW0 A;  5HFI A;  5D73 A;  3F8U A;  4OWY A;  1SL2 B;  4PQ1 A;  2B5E A;  2YZH A;  3VWX A;  4KSM A;  5DQS A;  3HHV A;  2R0G A;  2WW3 A;  1O8W A;  1T4Z A;  5A5K A;  4EXJ A;  2A4H A;  1PN9 A;  1BX9 A;  1TU8 A;  3C1S A;  3U6V A;  14GS A;  1LU4 A;  4EVM A;  2EC4 A;  3ERG A;  4AKH A;  2H76 A;  2R0C A;  3FY7 A;  1U88 A;  5AIS A;  5D9X A;  5IMD A;  1V9W A;  5EVO A;  1MTC A;  4IVF A;  2K8S A;  2LEG A;  4POM A;  2YWN A;  4X1U A;  1OVN A;  4ZBA A;  4Z7X A;  3PIN A;  2FCH A;  3GL3 A;  2RUF A;  3NIV A;  1RK4 A;  1NHY A;  4RI7 A;  3I43 A;  3KM6 A;  4IQA A;  3TKS C;  3W8S A;  2IMD A;  1GNW A;  1ERV A;  1QGV A;  4I6X A;  1TP9 A;  3FRC A;  4BIK A;  4WR4 A;  2C3N A;  3KH9 A;  5DDL A;  4Z2T A;  3DML A;  3VI5 A;  2KP2 A;  3TKR A;  2FLS A;  4ZBB A;  5IMV A;  1PRX A;  3V1W A;  3JCM L;  3TRP A;  1YQ1 A;  2C3T A;  5AIX A;  2OA7 A;  3BJ5 A;  2VCT A;  2DLX A;  3F0I A;  2X8G A;  3APO A;  2IJY A;  4LA1 A;  1BAY A;  1QMV A;  1U87 A;  8GSS A;  2LJR A;  4A5P A;  2DKH A;  2X4A A;  1DBY A;  3VLN A;  2VAF A;  3BCK A;  5HR2 A;  3OR5 A;  3IA1 A;  1YF0 A;  4HQS A;  3N5O A;  3L9U A;  4GST A;  2A2P A;  4NWY A;  1TK8 B;  2LJK A;  1NM3 A;  2V6K A;  3EC3 A;  1Z6N A;  4ISD A;  3PPU A;  1TK5 B;  4RUV A;  1F9M A;  4Q5Q A;  5ECQ B;  1LBK A;  1OC9 B;  2C0G A;  5F06 A;  3EUR A;  3KTB A;  3ZVJ D;  5DAK A;  2P5R A;  2DJJ A;  2X64 A;  4KF9 A;  1B4P A;  1GSS A;  3CMI A;  3M0F A;  2H1L A;  5G2Z A;  2HRK A;  1SJ6 A;  3KGK A;  4WBJ A;  1VF1 A;  2CAI A;  4KH7 A;  2B1K A;  1EEJ A;  3LEF A;  1K0N A;  5HQP A;  1AIU A;  4ZL9 A;  2RII A;  4IJ3 A;  3HXS A;  4TXO B;  3TRX A;  5AGY A;  1T00 A;  3C71 A;  2PER A;  2EIR A;  4ZIJ A;  3ZML A;  2AV4 A;  3UVT A;  3ME8 A;  1SJZ A;  3QCP A;  2OAD A;  5FT3 A;  2OBK A;  3D4M A;  1PX7 A;  4DSQ A;  2OT3 A;  4PUA A;  4J57 E;  4K6X A;  1HNB A;  5B7C A;  1ZL9 A;  2EFH A;  1YEX A;  3GL5 A;  5DVB A;  2MBS A;  3FZ4 A;  2HRA A;  3IRA A;  2K18 A;  3J7Y b;  3QDN A;  19GS A;  3GYK A;  2C3Q A;  3HJP A;  4HQZ A;  2WZS A;  4ZBD A;  3MDK A;  1TDI A;  3NOF A;  1FB6 A;  4GSN A;  3TOU A;  5G1K A;  3MSZ A;  1AQV A;  1YF1 A;  5HR3 A;  3D4T A;  4YQU A;  3LXZ A;  1EV4 A;  2H1B A;  3FYG A;  2DSA A;  1XWK A;  3VPQ A;  2VD1 A;  3ZL5 A;  5A1N A;  3SWL A;  1V2A A;  2HLS A;  1K3O A;  2LNS A;  2WVX B;  4JU5 A;  4PUF C;  4ACS A;  4I97 A;  4XS6 A;  2C0E A;  2LQO A;  2HRN A;  4ZB7 A;  4LLR A;  4MH2 A;  3FEU A;  4K8M A;  2GSR A;  3RDW A;  4XRD A;  2B7K A;  3TKS E;  4HOJ A;  3US3 A;  3F3Q A;  4QL9 A;  1G6Y A;  3F3R A;  2ZNM A;  2CAQ A;  2P5Q A;  4XS4 A;  1M3J A;  1SK0 A;  5KOW A;  2WDU A;  5IO0 A;  5CRG A;  1R5A A;  3CSJ A;  1Z7R A;  1WE0 A;  1K0D A;  1TRV A;  4AKG A;  1ZYN A;  2FWF A;  2IME A;  3M8N A;  3QFB C;  4OMV A;  4ICY A;  3UMA A;  5A5H B;  4EIP A;  2IFQ B;  5BMU B;  3P2A A;  4AF2 A;  1XWB A;  3MWH A;  1EZK A;  4JZQ A;  3GKN A;  3FKF A;  2TIR A;  1GL8 A;  1TU7 A;  6GSW A;  2YCD A;  4USS A;  2GQM A;  4ML6 A;  5IPG A;  1XOA A;  1FW1 A;  2GT5 A;  3R2Q A;  4BVX B;  4DSS A;  6GSY A;  4KB3 A;  4HEA 2;  3QMX A;  1HQO A;  1Y25 A;  4X43 A;  3Q74 A;  3IPZ A;  3GH9 A;  3QR6 A;  4WR5 A;  4TR0 A;  1VF2 A;  1NSW A;  3ZMK A;  3IK9 A;  2F3M A;  3CXG A;  2DJ3 A;  4IQ1 A;  1GUH A;  3GN3 A;  5BRT A;  2H8L A;  2E0Q A;  4ECC A;  5IQY A;  3RAZ A;  1KBN A;  2B1L A;  18GS A;  2K6V A;  2VL9 A;  2DBC A;  4TVE A;  4NXI A;  2R2J A;  2WVZ A;  4V2M A;  2K8V A;  2X49 A;  4FH8 A;  3EIN A;  3WT2 A;  3C73 A;  4KDU A;  3GFK A;  4WBR D;  3LOR A;  1OE8 A;  5JCW A;  4KCE A;  2HSN B;  2M72 A;  2UZ8 A;  1URM A;  1WMJ A;  2LST A;  5FHI A;  2N5F A;  1AW9 A;  1YKC A;  4N30 A;  2KP1 A;  5HR0 A;  5LCZ A;  4G9H A;  2VCV A;  6GST A;  5JWO B;  2MBT A;  1N8J A;  4TRX A;  4TXV A;  1O6J A;  4IBP A;  3DXB A;  4KCA A;  3HY2 A;  4POK A;  4MCU A;  2V2G A;  4O5Q A;  5AN1 A;  2RUE A;  3BD2 A;  2MZC A; 
#chains in the Genus database with same CATH homology
 1GSF A;  5J41 A;  5DJM A;  1XPV A;  1WWJ A;  2NDO A;  2FWH A;  2CZ2 A;  4POB A;  4YH2 A;  1OKT A;  5KN3 A;  5F8B A;  4F9Z A;  5ECI B;  2H70 A;  5EY6 A;  2O7K A;  4AKX B;  4HU9 A;  4IJI A;  1XZO A;  2YZU A;  2E7P A;  4BPY A;  2VCQ A;  2GTU A;  3GST A;  1G7E A;  4G01 A;  3IC4 A;  2VOC A;  4KAE A;  2FWG A;  4GRF A;  2C0F A;  1A2J A;  2BMX A;  3EMX A;  1SU9 A;  1UN2 A;  4ID0 A;  4L5L A;  5GST A;  1SL1 B;  1SK2 A;  2JL4 A;  2CVK A;  3GUS A;  5E59 A;  2HSM B;  3EVI A;  1B4Q A;  2VKZ G;  3QFA C;  3PR8 A;  2V6O A;  2HZF A;  4POL A;  2CVD A;  6GSV A;  4KW6 A;  4ILF A;  2QKE A;  4GDF A;  2PMT A;  1G0T A;  5DJL A;  4E68 A;  2IMK A;  4K7N A;  2M80 A;  3GKK A;  5J3R A;  1GTA A;  1DE2 A;  4G2E A;  3LXT A;  3Q6O A;  1M7T A;  3ZTL A;  3ZRD A;  2YWO A;  3CYN A;  3QAW A;  1F37 A;  3APQ A;  2LTK A;  4L8E A;  4MF6 A;  3HVX A;  4ECI A;  5DBQ A;  3GHA A;  4GF0 A;  4EDY A;  4F0B A;  2GQK A;  3LW9 A;  5C04 A;  3KCM A;  4MJA A;  1X5E A;  2NBS A;  2YOI A;  2IN3 A;  1WIK A;  4G0L A;  5GSS A;  1AQW A;  1FAA A;  1R4W A;  5A34 B;  1M9B A;  3E9J B;  1GSD A;  12GS A;  4N10 A;  1K0M A;  2FHE A;  1PL2 A;  1JLW A;  3O6T A;  1BF5 A;  3QAV A;  3TKQ A;  4FO5 A;  3QOU A;  2L6C A;  3CTG A;  4D73 B;  1XWG A;  2DMM A;  1EV9 A;  1PGT A;  22GS A;  4BWS A;  4V1A p;  2C80 A;  4CHS A;  2WS2 A;  2R0P A;  1E2Y A;  2JAD A;  3BOA A;  2VL2 C;  4HJM A;  1B8X A;  2QA1 A;  4XS1 A;  6GSU A;  4P3Y B;  5IM9 A;  1XOB A;  4IEL A;  1O85 A;  5J40 A;  2GSS A;  3GNJ A;  3GX0 A;  5IMA A;  5HFK A;  2GLR A;  1N2A A;  4IP1 A;  1B9Y C;  1OC9 A;  2MMN A;  4K0N A;  3D22 A;  3TU3 B;  16GS A;  2YWM A;  1GSY A;  3W6G A;  1I9D A;  3UVH A;  1KNG A;  2V41 A;  4IW9 A;  4MJE A;  4NAX A;  5JCG A;  4GLT A;  2EFC A;  3BCI A;  3KP9 A;  4OO4 A;  1FG4 A;  3HVS A;  5F0G A;  3Q18 A;  3IAS 2;  3Q19 A;  2CX4 A;  5L71 A;  2PUK C;  3E0U A;  3MIX A;  1GTU A;  1VF4 A;  2F8F A;  3IC8 A;  1JZD A;  2HRF A;  2WB9 A;  1TKD B;  3LYK A;  1YZX A;  4ECJ A;  2ZUP A;  1X5C A;  4ZL7 A;  5ENU A;  1R5P A;  1HYU A;  3KMO A;  1SL0 B;  2LS5 A;  1A2M A;  2A4V A;  4WF5 A;  2NPB A;  4JBB A;  2PVQ A;  3DIE A;  4K0G A;  3HKR A;  2I9H A;  3TJJ A;  4KX4 A;  5ID2 B;  3DWV A;  4HU7 A;  2WJU A;  3M9K A;  3MNG A;  2N5B A;  1ERU A;  3U5R E;  1VF3 A;  4N11 A;  3HJM A;  17GS A;  1UC7 A;  5COH A;  1WPI A;  3TKS A;  3LJR A;  4TN8 A;  3ERF A;  2Z9S A;  9GSS A;  1PKZ A;  1ZYP A;  3D0Z A;  1ERW A;  13GS A;  1KTE A;  2RLI A;  5HFG A;  4OO5 A;  2XHF A;  2C8U A;  2MMA A;  1WP0 A;  1Q4J A;  5ELG A;  4Q5R A;  2VLV A;  3A2V A;  1CQH A;  3D5J A;  1ZOF A;  1A24 A;  1R26 A;  3KZQ A;  4X0X A;  5ECH B;  1GTI A;  3HZ4 A;  3S9F A;  3KMN A;  5H5S A;  2KOK A;  3M3M A;  3UIW A;  3DRN A;  1ABA A;  1BG5 A;  5F05 A;  1U3A A;  1GH2 A;  3DVX A;  2H66 A;  1EWX A;  1XFL A;  1LJR A;  1TW9 A;  2WGR A;  4MZC A;  5A5H A;  1GWC A;  2IFQ A;  5ECL B;  1X9W B;  5BMU A;  1PL1 A;  5ECM B;  1VGL A;  1K3Y A;  2DJ2 A;  4MLY A;  1U6T A;  4WEY A;  3K8N A;  4OFT A;  2O5V A;  1SK1 A;  3ED3 A;  2LNT A;  3KXO A;  4MNN A;  3TRQ A;  4V2L A;  4NHZ A;  3E3E A;  5A4V A;  2M46 A;  2HSH A;  3O3T A;  3DYR A;  1J0F A;  4EIQ A;  1XVW A;  3CTF A;  4EO3 A;  1PKW A;  2H6Z A;  3FZ9 A;  3LGC A;  5G5E A;  5HR1 A;  4CDO A;  4KDX A;  1BED A;  3P90 A;  5IIZ A;  2E2G A;  2LJA A;  4TR3 A;  20GS A;  3UAP A;  2F51 A;  2PPT A;  3DVW A;  1GSE A;  3EWL A;  2AB6 A;  4PQH A;  5A4U A;  3SBC A;  1AQX A;  3IBH A;  3F9U A;  4YQM A;  1FO5 A;  1M9A A;  1ACV A;  4Q5N A;  4ULX A;  2GGT A;  1QQ2 A;  2VD0 A;  1QFN A;  1HD2 A;  2JZS A;  2WZ9 A;  4GXZ A;  3WGX A;  2FWE A;  4KA0 A;  2R37 A;  1OKD A;  4KDY A;  3LFL A;  4HUA A;  2PU9 C;  5KN1 A;  3GIX A;  1RQM A;  3GH6 A;  3UBK A;  2HSN A;  2YN1 A;  1TK0 B;  4G19 A;  5J9B A;  3IE3 A;  3CSH A;  5D9W A;  2CA8 A;  4HZ4 A;  1M2A A;  3RHB A;  3RPP A;  4XIH A;  2YJH A;  1SKR B;  2OJL A;  4TW5 A;  1HNC A;  2VM1 A;  2DML A;  5G30 A;  1ILO A;  1XVQ A;  2K9F A;  2R3X A;  6GSX A;  4N3Z A;  2AHE A;  4RQR A;  1KEB A;  2O87 A;  4LMV A;  4K7O A;  3QD9 A;  4GSS A;  1ZGN A;  2XPE A;  2NVL A;  4YAV A;  2OE1 A;  1M2D A;  3KD0 A;  1T7P B;  1YVL A;  1Q98 A;  3GKX A;  5CRH A;  1OC8 A;  4WXT A;  2F8A A;  3I69 A;  4OD7 A;  4BL7 B;  1K0O A;  1FVJ A;  3H4K A;  2VL3 A;  1THX A;  4IKH A;  4XRA A;  4RQX A;  4EC0 A;  4F0C A;  3A5W A;  5D93 A;  2R4V A;  5IPH A;  1FVK A;  1S3A A;  5DAL B;  5CRE A;  4K7I A;  2REM A;  1YKA A;  4PUR A;  3A3T A;  3WGE A;  3D21 A;  1PQN A;  2OBI A;  5LD0 A;  4KGI A;  2B6M A;  1PA3 A;  2KUC A;  1QK8 A;  1ZZY A;  5J47 A;  3EPT A;  3ZRE A;  1T4Y A;  1V98 A;  2HFD A;  5D9V A;  4YQV A;  1EP8 A;  2ZCT A;  3WD6 A;  1W89 A;  1M99 A;  5ECK B;  4K5R A;  4F03 A;  1SKS B;  1RW1 A;  1GUL A;  1UA5 A;  4DSS B;  1ERT A;  4YAP A;  1V58 A;  1Y1U A;  1TJD A;  2GST A;  4IS0 A;  1A0F A;  4E8H A;  3MAK A;  4KND A;  2YP6 A;  4EDZ A;  2H1A A;  2PWJ A;  1BG1 A;  2HSM A;  1ZYQ B;  3A2W A;  2QC7 A;  4ML1 A;  4GQC A;  4X4J A;  4NV5 A;  3TJB A;  5D96 A;  2DJK A;  2IL3 A;  1ZYE A;  4O5U A;  4XCS A;  1NW2 A;  3KIJ A;  2R5G A;  5KN0 A;  1A2L A;  3L4N A;  3KH7 A;  3L9V A;  4MK3 A;  1WJK A;  2AUV A;  4HDE A;  2VCX A;  3IAM 2;  2IWT A;  2DJ0 A;  3GV1 A;  1XIY A;  2P31 A;  5EPF A;  1GP1 A;  3ZIJ A;  5ELA A;  4AJ7 A;  5JWR B;  1TI3 A;  3C1R A;  5CP1 A;  2CQ9 A;  5JWQ B;  3ZVJ A;  1I5G A;  1O8X A;  4CY6 A;  3GTU A;  3P7X A;  4GCI A;  4G10 A;  2GT6 A;  1FOV A;  4OCF A;  3VFI A;  1X9M B;  2WRT A;  3HCZ A;  1USB A;  2LQQ A;  3GSS A;  2C1Y A;  2L59 A;  2MYG A;  2IIY A;  2GZZ A;  3ZIV A;  3C8E A;  5A34 A;  4AJ6 A;  1EOH A;  2R6K A;  1T1V A;  2TRC P;  2V1M A;  3BBY A;  4L0W A;  3DD3 A;  3TUE A;  5J4Y A;  4GQF A;  3F4T A;  2C0D A;  1GLP A;  3WGD A;  2N5A A;  3A5I A;  5D8I A;  2L4Q A;  4KE3 A;  3HZ8 A;  4TR1 B;  4D73 A;  1MDK A;  1DUG A;  4BWQ A;  3NZN A;  1HNA A;  4L0U A;  4YKF A;  4EF0 A;  4CY8 A;  3ZIT A;  1GUM A;  3TGZ A;  2JAC A;  3A2X A;  2XBQ A;  4YKG A;  3L9S A;  4JED A;  1WOU A;  3DGQ A;  1MD4 A;  2O89 A;  2CV4 A;  3C7M A;  3QAG A;  1GTB A;  2HI7 A;  1E6B A;  5ECO B;  4GTU A;  1OE7 A;  4IN0 A;  4ECB A;  2H01 A;  4PXO A;  4MMM A;  10GS A;  1EP7 A;  3HVV A;  2L5O A;  1X0R A;  2HYX A;  1T3B A;  2I4A A;  1A23 A;  4NV2 A;  3CBU A;  2NTO A;  1G7O A;  2FA8 A;  2VIM A;  3APS A;  4JR6 A;  1K0B A;  2VM2 A;  4AI6 A;  2LRN A;  4PGT A;  2IMF A;  1PD2 1;  3MYD A;  4PTS A;  2TRX A;  1AC1 A;  2A2R A;  1BYE A;  3RBT A;  5B6N A;  4ZB9 A;  2ON5 A;  4FQU A;  3J7Y k;  2ON7 A;  2BTO T;  4O32 A;  3VUR A;  2A2S A;  1TRS A;  3ME7 A;  3KP8 A;  4MF5 A;  1A8L A;  1XW5 A;  1F3A A;  1JLV A;  3ZLP A;  2VLU A;  4XTS A;  3FR6 A;  4EE0 A;  1TXU A;  2LV3 A;  4HI7 A;  3ERW A;  2JU5 A;  5EL8 A;  2GDR A;  1ON4 A;  2GVP A;  2I1U A;  3TJK A;  3GA4 A;  4V1A g;  4BVY B;  4QL7 A;  1A0R P;  3IOS A;  4RI6 A;  4MPF A;  2CZ3 A;  3FR9 A;  4QMK A;  1F6M C;  2HXK A;  2O85 A;  2DC5 A;  1S3C A;  2IPA A;  2LRC A;  4K1F A;  2H72 A;  3F6D A;  3DKS A;  5A4W A;  2HZE B;  4EKZ A;  4IHU A;  5ID2 A;  5H5Q A;  5KN2 A;  2B3S A;  2KHP A;  5DQY A;  1PSQ A;  1TRW A;  2H1D A;  2CVB A;  2YWI A;  1YY7 A;  4PQI A;  3IK7 A;  5JCU A;  1UVZ A;  5J4V A;  1GSQ A;  4MJB A;  2HSY A;  2QA2 A;  4HZ2 A;  4TXO A;  4MH3 A;  2CX3 A;  3ISO A;  2VLT A;  2MMZ A;  3UAR A;  2FUG 2;  4ZB8 A;  1ZCP A;  4J2F A;  4WKW A;  1V40 A;  1M2B A;  1G6W A;  4QQ7 A;  1EGR A;  1FOH A;  4TKY A;  2J9H A;  1YDK A;  1ZMA A;  2FNO A;  1AUC A;  4G0I A;  2EFE A;  4K5S A;  5CAX A;  3VPT A;  4DSR A;  1F3B A;  2VL2 A;  2H74 A;  4JE1 A;  3O76 A;  2X8C A;  3QPM A;  3PH9 A;  4IP6 A;  3G9B A;  1QUW A;  4BA7 A;  3ZFL A;  1B9X C;  4OFN A;  2GQL A;  5IOX A;  3IHQ A;  2VUP A;  1X9S B;  3TDG A;  4GWR A;  1TOF A;  4LMW A;  3EU3 A;  7GSS A;  4N0V A;  1MDI A;  4L5O A;  4DVC A;  4I2T A;  2MMO A;  3GUR A;  1XW9 A;  2H0G A;  2LRT A;  3F63 A;  5IMZ A;  5IO2 A;  1K3L A;  3UOM A;  4TOP A;  3CRT A;  2H19 A;  5AIV A;  2VCW A;  1F2E A;  3L78 A;  1K0C A;  5J5N A;  1DE1 A;  2O8V B;  1GNE A;  4XHM A;  3GX8 A;  4V2N A;  3ZZX A;  3VWV A;  1W4V A;  1EOG A;  2JSZ A;  1TTZ A;  2YJ7 A;  3RPN A;  3D6I A;  2EIQ A;  4IGJ A;  1OAZ A;  4O7H A;  4MP4 A;  1S3D A;  1OC3 A;  5KEJ A;  2GZP A;  1M0U A;  2L57 A;  1J08 A;  1K0A A;  3FHK A;  3L0H A;  5DAK B;  5F07 A;  1XBS A;  1H4O A;  5B8B A;  4MZB A;  2G2Q A;  2QGV A;  3IHG A;  3IR4 A;  2HRK B;  3ZYW A;  1DSB A;  2JZT A;  2IMI A;  4BVX A;  5CNW A;  1GRX A;  5GZZ B;  2ALB A;  1Z6M A;  2DJ1 A;  3VK9 A;  5B8A A;  1SEN A;  4PNG A;  2FY6 A;  2AJQ B;  5KOX A;  1MDJ A;  4MDC A;  4F2I A;  3EU4 A;  2H6Y A;  2H75 A;  4MZW A;  2B7J A;  2F9S A;  2XPD A;  1FB0 A;  4CW9 A;  3P8W A;  2P0G A;  5LNK e;  1YEP A;  2PBJ A;  4BL7 A;  3G7Y A;  1Z3E A;  4KSO A;  1U3I A;  1A8Y A;  2BJX A;  1PN0 A;  5DAL A;  3UBL A;  3TJF A;  4JRR A;  11GS A;  3PGT A;  1JZW A;  1XWA A;  1TXX A;  1PMT A;  1Z7P A;  2JSY A;  3VWU A;  2CT6 A;  1PX6 A;  1AAZ A;  1JHB A;  4N0Z A;  2DIY A;  3H79 A;  3FMW A;  3CSI A;  1IYH A;  1GUK A;  3CWG A;  3F4R A;  5A1N B;  2JZR A;  1O81 A;  3TB2 A;  2X8H A;  5ECN B;  2UV8 G;  3LQ7 A;  5DCG A;  2L6D A;  4I2U A;  1N25 A;  3I6A A;  1V57 A;  3HA9 A;  2YAN A;  4FYC A;  2OE0 A;  5IMF A;  1EGO A;  2I3Y A;  1VRS D;  2PVO C;  3IXR A;  3M9J A;  4K2D A;  4HS1 A;  2YV9 A;  5B6M A;  4ZL8 A;  3WT1 A;  1ST9 A;  1R7H A;  3KEB A;  4XS4 B;  1AXD A;  5ECS A;  1SVL A;  2H1G A;  2VO4 A;  2RM5 A;  2PN8 A;  4W66 A;  1SVO A;  3HYP A;  3UJ1 A;  3W8J A;  3GMF A;  1XCC A;  4TR4 A;  5ECP B;  3EYT A;  1THO A;  5H5R A;  4NPB A;  3TOT A;  3UEM A;  5J9C A;  4WF4 A;  2FA4 A;  3FZA A;  2J23 A;  2HNL A;  2GS3 A;  1SVM A;  3FR3 A;  4ZXG A;  4FIW A;  5IMC A;  3RHC A;  3LWA A;  4I8B A;  2B5X A;  2D2Z A;  1T8E B;  5IOW A;  5D9T A;  2AAW A;  1TI1 A;  5CO3 A;  1CQG A;  2FGX A;  2H0H A;  1H75 A;  1SYX A;  2I81 A;  3KJY A;  3GRX A;  5G5F A;  1SKW B;  4AKI A;  1XW6 A;  1WRY A;  2QSI A;  3EE2 A;  5CRD A;  3HDC A;  1MD3 A;  4MA9 A;  4Z2R A;  3AY8 A;  2VCZ A;  4FYU A;  3H1N A;  5J4U A;  4PX1 A;  2WUL A;  3H93 A;  2YV7 A;  4AJ8 A;  2L4C A;  4F82 A;  2YNX A;  4Q5F A;  1TRU A;  3IV4 A;  1JZR A;  2H0I A;  2OAC A;  3IDV A;  3G7I A;  1SD9 A;  2EFD A;  2KLX A;  3EMP A;  4O5R A;  4I5Q A;  1C72 A;  1O73 A;  2WCI A;  4ZB6 A;  5G31 A;  3FZ5 A;  4EL1 A;  1YJ6 A;  5C00 A;  3TJG A;  4MPG A;  1X5D A;  4FYB A;  1NHO A;  3FW2 A;  4OFM A;  2E2M A;  4TR1 A;  3HJO A;  5ABR A;  3HMJ G;  4MJC A;  4WET A;  2YPM A;  3LYP A;  2OKA A;  5INY A;  4AGS A;  2H6X A;  1O7U A;  3LG6 A;  3HD5 A;  1Y6E A;  4NHW A;  5CYY A;  4EUY A;  4LL4 B;  4MAB A;  2PGT A;  3ZFB A;  4G0K A;  2GSQ A;  2LUS A;  1OYJ A;  1BQ7 A;  1Z5Y E;  1GLQ A;  4K9Z A;  3DEX A;  3GKM A;  4JR4 A;  2HT9 A;  2HQT A;  2B5Y A;  2H71 A;  1MEK A;  2XC2 A;  2GZY A;  2V32 A;  2XBI A;  2C4J A;  5CRW A;  5E4W A;  5FWG A;  1IYI A;  3F6F A;  3I9V 2;  3FK8 A;  1Z9H A;  2H73 A;  2HE3 A;  5GAN D;  2AYT A;  3LSZ A;  4HJ2 A;  3G7J A;  4J56 E;  5DCH A;  4KUN A;  3VWW A;  1ML6 A;  1SJI A;  1JZO A;  3H8Q A;  2ES7 A;  1B48 A;  3UL3 A;  2LKU A;  3VI7 A;  2G0F A;  2X99 A;  2OE3 A;  2DKI A;  1EEM A;  1QXH A;  1SD8 A;  2L5L A;  4OCE A;  3R3E A;  2FD3 A;  3TKP A;  4E8E A;  1JFU A;  1GSU A;  3F4S A;  3M1G A;  3N9J A;  5G1L A;  4BVY A;  5ECR B;  4PNF A;  4ZIL A;  1J9B A;  4Z2U A;  2RM6 A;  2WFC A;  3GTU B;  2DIZ A;  3CRU A;  4H86 A;  1XXU A;  5GAP D;  4LL1 B;  1XWC A;  2EIO A;  1BJX A;  4MF7 A;  3WYW A;  1SYR A;  4NMU A;  2HZE A;  2H30 A;  3TCO A;  3KTL A;  6GSS A;  1FHE A;  4DEJ A;  4O92 A;  4K2X A;  5HFI A;  5D73 A;  3F8U A;  4OWY A;  1SL2 B;  4PQ1 A;  2B5E A;  2YZH A;  3VWX A;  4KSM A;  5DQS A;  3HHV A;  2R0G A;  1O8W A;  1T4Z A;  5A5K A;  4EXJ A;  2A4H A;  1PN9 A;  1BX9 A;  1TU8 A;  3C1S A;  3U6V A;  14GS A;  1LU4 A;  4EVM A;  2EC4 A;  3ERG A;  4AKH A;  2H76 A;  2R0C A;  3FY7 A;  1U88 A;  5AIS A;  5D9X A;  5IMD A;  1V9W A;  5EVO A;  1MTC A;  4IVF A;  2K8S A;  2LEG A;  4POM A;  2YWN A;  4X1U A;  1OVN A;  4ZBA A;  4Z7X A;  3PIN A;  2FCH A;  3GL3 A;  2RUF A;  3NIV A;  1RK4 A;  1NHY A;  4RI7 A;  3I43 A;  3KM6 A;  4IQA A;  3TKS C;  3W8S A;  2IMD A;  1GNW A;  1ERV A;  1QGV A;  4I6X A;  1TP9 A;  3FRC A;  4WR4 A;  2C3N A;  3KH9 A;  5DDL A;  4Z2T A;  3DML A;  3VI5 A;  2KP2 A;  3TKR A;  2FLS A;  4ZBB A;  5IMV A;  1PRX A;  3V1W A;  3JCM L;  3TRP A;  1YQ1 A;  2C3T A;  5AIX A;  2OA7 A;  3BJ5 A;  2VCT A;  2DLX A;  3F0I A;  2X8G A;  3APO A;  2IJY A;  4LA1 A;  1BAY A;  1QMV A;  1U87 A;  8GSS A;  2LJR A;  4A5P A;  2DKH A;  2X4A A;  1DBY A;  3VLN A;  2VAF A;  3BCK A;  5HR2 A;  3OR5 A;  3IA1 A;  1YF0 A;  4HQS A;  3N5O A;  3L9U A;  4GST A;  2A2P A;  4NWY A;  1TK8 B;  2LJK A;  1NM3 A;  2V6K A;  3EC3 A;  1Z6N A;  4ISD A;  3PPU A;  1TK5 B;  4RUV A;  1F9M A;  4Q5Q A;  5ECQ B;  1LBK A;  1OC9 B;  2C0G A;  5F06 A;  3EUR A;  3KTB A;  3ZVJ D;  5DAK A;  2P5R A;  2DJJ A;  2X64 A;  4KF9 A;  1B4P A;  1GSS A;  3CMI A;  3M0F A;  2H1L A;  5G2Z A;  2HRK A;  1SJ6 A;  3KGK A;  4WBJ A;  1VF1 A;  2CAI A;  4KH7 A;  2B1K A;  1EEJ A;  3LEF A;  1K0N A;  5HQP A;  1AIU A;  4ZL9 A;  2RII A;  4IJ3 A;  3HXS A;  4TXO B;  3TRX A;  5AGY A;  1T00 A;  3C71 A;  2PER A;  2EIR A;  4ZIJ A;  3ZML A;  2AV4 A;  3UVT A;  3ME8 A;  1SJZ A;  3QCP A;  2OAD A;  5FT3 A;  2OBK A;  3D4M A;  1PX7 A;  4DSQ A;  2OT3 A;  4PUA A;  4J57 E;  4K6X A;  1HNB A;  5B7C A;  1ZL9 A;  2EFH A;  1YEX A;  3GL5 A;  5DVB A;  2MBS A;  3FZ4 A;  2HRA A;  3IRA A;  2K18 A;  3J7Y b;  3QDN A;  19GS A;  3GYK A;  2C3Q A;  3HJP A;  4HQZ A;  4ZBD A;  3MDK A;  1TDI A;  3NOF A;  1FB6 A;  4GSN A;  3TOU A;  5G1K A;  3MSZ A;  1AQV A;  1YF1 A;  5HR3 A;  3D4T A;  4YQU A;  3LXZ A;  1EV4 A;  2H1B A;  3FYG A;  2DSA A;  1XWK A;  3VPQ A;  2VD1 A;  3ZL5 A;  5A1N A;  3SWL A;  1V2A A;  2HLS A;  1K3O A;  2LNS A;  4JU5 A;  4PUF C;  4ACS A;  4I97 A;  4XS6 A;  2C0E A;  2LQO A;  2HRN A;  4ZB7 A;  4LLR A;  4MH2 A;  3FEU A;  4K8M A;  2GSR A;  3RDW A;  4XRD A;  2B7K A;  3TKS E;  4HOJ A;  3US3 A;  3F3Q A;  4QL9 A;  1G6Y A;  3F3R A;  2ZNM A;  2CAQ A;  2P5Q A;  4XS4 A;  5KOW A;  1SK0 A;  2WDU A;  5IO0 A;  5CRG A;  1R5A A;  3CSJ A;  1Z7R A;  1WE0 A;  1K0D A;  1TRV A;  4AKG A;  1ZYN A;  2FWF A;  2IME A;  3M8N A;  3QFB C;  4OMV A;  4ICY A;  3UMA A;  5A5H B;  4EIP A;  2IFQ B;  5BMU B;  3P2A A;  4AF2 A;  1XWB A;  3MWH A;  1EZK A;  4JZQ A;  3GKN A;  3FKF A;  2TIR A;  1GL8 A;  1TU7 A;  6GSW A;  2YCD A;  4USS A;  2GQM A;  4ML6 A;  5IPG A;  1XOA A;  1FW1 A;  2GT5 A;  3R2Q A;  4BVX B;  4DSS A;  6GSY A;  4KB3 A;  4HEA 2;  3QMX A;  1HQO A;  1Y25 A;  4X43 A;  3Q74 A;  3IPZ A;  3GH9 A;  3QR6 A;  4WR5 A;  4TR0 A;  1VF2 A;  1NSW A;  3ZMK A;  3IK9 A;  2F3M A;  3CXG A;  2DJ3 A;  4IQ1 A;  1GUH A;  3GN3 A;  5BRT A;  2H8L A;  2E0Q A;  4ECC A;  5IQY A;  3RAZ A;  1KBN A;  2B1L A;  18GS A;  2K6V A;  2VL9 A;  2DBC A;  4TVE A;  4NXI A;  2R2J A;  4V2M A;  2K8V A;  2X49 A;  4FH8 A;  3EIN A;  3WT2 A;  3C73 A;  4KDU A;  3GFK A;  4WBR D;  3LOR A;  1OE8 A;  5JCW A;  4KCE A;  2HSN B;  2M72 A;  2UZ8 A;  1URM A;  1WMJ A;  2LST A;  5FHI A;  2N5F A;  1AW9 A;  1YKC A;  4N30 A;  2KP1 A;  5HR0 A;  5LCZ A;  4G9H A;  2VCV A;  6GST A;  5JWO B;  2MBT A;  1N8J A;  4TRX A;  4TXV A;  1O6J A;  4IBP A;  3DXB A;  4KCA A;  3HY2 A;  4POK A;  4MCU A;  2V2G A;  4O5Q A;  5AN1 A;  2RUE A;  3BD2 A;  2MZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...