1GT1A

Complex of bovine odorant binding protein with aminoanthracene and pyrazine
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
b'QEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENENHPHPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ODORANT-BINDING PROTEIN
publication title Crystal Structures of Bovine Odorant-Binding Protein in Complex with Odorant Molecules.
pubmed doi rcsb
molecule tags Odorant-binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1gt1A00
4OS8A 4NLJA 3WJGA 1LNMA 2G79A 2AMMX 3DTQA 4MVLA 1JBHA 1IIUA 3C77X 3U9PC 4ZHFA 3O22A 4RUNA 3NX2A 1KT4A 4HFOA 1X8OA 2A0AA 1GT5A 3STNA 5EZ2A 3WVMA 1BLRA 4ZH6A 1SXXA 1ML7A 4AZRA 3DSZA 1LKEA 4NNTA 3BX7A 2K62A 1HQPA 3AKNA 4IAWA 4A60A 4I3DA 2HLVA 3PECA 5IO5A 2L67A 3P6HA 2R74A 4WBKA 1L6MA 3FA9A 3P6CA 4OS0A 1IFBA 4LKPA 1GXAA 1JV4A 4ZHHA 2GJ5A 1X71A 1YIVA 4I9RA 2AL0X 4ORSA 5EEEA 4K19A 1PBOA 5AQ6A 4YKOA 1ZNKA 1AQBA 5LJBA 1BSOA 2QO4A 3VG6A 4ZGUA 5LJCA 3QKGA 4AW8A 1B8EA 3PEDA 3B2KA 3BX8A 5BVQA 2WEXA 1LIEA 5LJDA 5HZ6A 1SY2A 5HZ5A 2RD7C 5HA1A 2BLGA 1IKJA 3EYCA 2JOZA 4ARHA 1BEBA 4ALBA 5L8IA 3CWKA 1BSYA 1T0VA 2ACPX 3NQ9A 2DM5A 2AT6X 5LKFA 2CBRA 3F8AA 3S26A 1EW3A 2NNDA 4XMGA 5HWZA 1CBRA 1DZPA 4A1YA 2FS6A 4ZCBA 4MVKA 1I06A 1Z24A 1A3YA 1GGLA 1FENA 2CZUA 2OFMX 1ZRYA 1VYGA 1BJ7A 5BVSA 2A2GA 2IFBA 1N0SA 5L8OA 2ACOA 5JR8A 2LKKA 1MVGA 4GH7A 4RUUA 4GE1A 4M6SA 3SAOA 2A2UA 5EDBA 2X46A 3RZYA 1MUPA 5D4AA 2Q2PA 1ERXA 1KZXA 3KFHA 3NADA 2ASNX 5HZ9A 3I17A 1JZUA 1IW2A 2MM3A 3ELZA 1GM6A 2NNQA 3FA7A 5BVTA 1GT4A 2AT5X 2QO6A 1EIIA 3ELXA 1ICMA 3VG2A 1P6PA 5HTEA 5B27A 2AH7X 2RCQA 1T8VA 4IAXA 5D8JA 1S7DA 3CBCA 1D3SA 1I05A 4AZNA 1U18A 3BY0A 1JYDA 3FMZA 1NP4A 4GRJA 4N7CA 4HPCA 5LJHA 2L68A 3NX1A 3D97A 4HPAA 2LFOA 2P8GA 4NYQA 3STMX 3HWDA 2RQ0A 4MVIA 1O1UA 2POAA 3RSWA 1ZNEA 1HMSA 1KXOA 4YBUA 4NNSA 1CRBA 3WJBA 1RBPA 3P6GA 4Y0PA 5HBSA 2AT3X 3B2JA 4D6AA 1O1VA 4ES7A 3ZUOA 2A13A 2OFRX 4D6BA 4XMFA 2FTBA 1DC9A 1I04A 3JSQA 1IKEA 1ZNGA 3FR2A 4LZVA 4CK4A 1HN2A 3B2IA 3BU1A 2Q39A 1OBPA 1FELA 4QZUA 4YGZA 4QGWA 1GT3A 3FR5A 4QYPA 1G74A 5DG4A 3UEWA 1E00A 1SY3A 5HCCC 2AT0X 2MO5A 3WBGA 5D47A 1O8VA 2R56A 2HZRA 3APVA 3B2LA 5HZQA 5KICA 1E06A 2CM9A 1U0XA 1KT7A 1OBQA 2HYSA 3PH5A 4EFGA 2E4JA 4BVMA 5F1EA 5F6BA 1OPAA 3OJYC 3KQ0A 2ANSA 1SXYA 1X8NA 1B56A 1FE3A 2LB6A 2GTFX 3NPOA 2HNXA 3GAQA 4QYNA 1BWYA 1E5PA 2JN3A 2OVEA 1S44A 5KIDA 4TLJA 4BQUA 4IB7A 1BRPA 4TKHA 4UU3A 3U0DA 2WQAE 1TOWA 2YG2A 1HBPA 3CQRA 4I9SA 4Y0RA 3PP6A 5EDCA 1MX7A 5K06A 1VYFA 1ACDA 3BRNA 2FR3A 3HWEA 4ZR2A 1U17A 4YKMA 5HTDA 3ZQ3A 5EEDA 4IB6A 1ICNA 5LKEA 4QAEA 4YH0A 4ZHGA 2GC9A 3TZSA 1DF3A 1QY2A 2QM9A 1PM1X 5KHPA 2FS7A 4PSQA 1B0OA 3PH6A 4TQ2A 2Q9SA 3I0AA 1EXSA 4A8ZA 3G7XA 5IO7A 3VG3A 4YCEA 3HK1A 1PEEA 2KTDA 1QG5A 2FWVA 3EBWA 4YFPA 2JU7A 1AB0A 1G7NA 2OZQA 1DZJA 1X89A 3JS1A 3ZUIA 4AZQA 2KT4B 1QY0A 2QO5A 1PMPA 2G78A 4IB9A 2XKLA 5H8TA 1HBQA 5EPQA 5DPQA 1CJ5A 3FA6A 1YUPA 5HAEA 4R0BA 5D45A 4EDEA 3HWGA 3CBSA 1KZWA 1B4MA 2AKQA 2NNEA 1XCAA 1LIFA 1A57A 1SXWA 1NGLA 1NP1A 1SA8A 1QWDA 3B2HA 1GX8A 1TXLA 1QY1A 2W2AA 4M7MA 4ORUA 2K23A 4TJZA 1ERBA 1BM5A 3C78X 3HWFA 1ZNHA 1TVQA 4ZH9A 1A2DA 5FFHA 4HPBA 4ORWA 5C0NA 4ODDA 4UU2A 1ALBA 1MX8A 3L4RA 3D96A 3IFBA 3WJEA 5LJGA 5F6ZA 1SXUA 3P6FA 3VG7A 1CBIA 5H9NA 5HZ8A 1EPBA 2L5PA 3FA8A 1EPAA 1S2PA 1X8PA 4GETA 1JYJA 1RLBE 4Y0QA 4A1HA 5LJEA 3CR6A 2WUTA 1KT6A 4XMHA 1VPRA 1OEJA 1ZNDA 1UREA 1JJJA 4QGVA 4YFQA 4N7DA 3TGBA 5H9LA 2RA6A 1LICA 4ORXA 3FW4A 2WEWA 3F9DA 4I3CA 4AYHA 2HZQA 2QOSC 4DQ4A 1LF7A 1BRQA 1XKIA 2X45A 2OVDA 1OEEA 1LFOA 1DZMA 3C76X 4HPDA 1AVGI 4WFUA 4IMNA 3P6EA 4OS3A 1OBUA 2W2BA 1FTPA 3IA8A 4OMWA 4ORRA 2EU7X 3U03A 4ZJ0A 1G85A 2AT8X 2R73A 1KOIA 3FEPA 3WJDA 4AZPA 1OPBA 5HA0A 3WXQA 2WQ9A 3FEKA 4YFRA 1GX9A 1JJXA 1E02A 1GT1A 1TW4A 3MBTA 1QFTA 2CM4A 5HCDC 4IMOA 5D48A 4XMDA 2CZTA 3O19A 1DFVA 1FEMA 1QFVA 3BDRA 3TGAA 3P6DA 2W2FA 2A3FX 3STKA 1KQXA 3EBKA 5F58A 3FENA 3UEVA 4IB8A 1R0UA 4EXZA 1DV9A 4WFVA 1BSQA 1LIDA 3EMMA 3FW5A 1FDQA 4XMEA 4AZMA 4NLIA 1EUOA 4TNNA 4ZHCA 1KT5A 1AELA 1EQDA 1SY0A 1YWCA 2NP1A 2ALLX 3AKMA 4YDBA 4O9SA 5IO6A 2HMBA 3APWA 3MVFA 3Q6LA 3NQ3A 1UZ2X 1YP6A 1KQWA 4TKJA 4LZUA 4ALOA 1CBSA 4QGXA 5B29A 4AZOA 5LJKA 1I4UA 3NP1A 5H9AA 1ZNLA 1YWAA 2LBAA 1HMRA 1DZKA 4YGHA 1SY1A 2FR2A 3TGCA 2JU8A 4Y0SA 5H9KA 2Q4NA 3BS2A 4GKCA 1YP7A 5F7GA 3CMPA 2WWPA 4GNYA 3APUA 2L9CA 1MDCA 1H91A 4YGGA 2Q2MA 4I3BA 3WJCA 3BLGA 1LIBA 3O2YA 1YWBA 3BU9A 4OMXA 2F73A 5FAZA 1QABE 1LPJA 1D2UA 2MJIA 2WSJA 4EEJA 1TOUA 4IBAA 3TF6A 1CBQA 2WR6A 5FENA 4NYRA 4DQ3A 5L8NA 3EM0A 2O62A 4YDAA 1QQSA 1YWDA 5HCEC 1X8QA 1A18A 3FR4A 3WJFA 2FLJA 1EIOA 4ORYA 1KGLA 3KFFA 2XSTA 3KFGA 5CE4A 1ADLA 4YBPA 3T1DA 2N93A 2G7BA 1KT3A 2JU3A 4YCHA 2CBSA 2LBVA 4KIIA 3FELA 3APXA 4LKTA 4XMCA 3VG5A 4ZHDA 3NR3A 1BBPA 3FLLA 3UEXA 1X8UA 2PY1A 1T68X 3FIQA 1G5WA 3K3LA 3KZAA 4YMYA 1OEKA 1GKAA 2RCTA 1GKAB 1EALA 4NP1A 3BSZE 3VG4A 1IFCA 4QZTA 3CQNA 2OVAA 4GNWA 4ZFXA 3D95A 3UEUA 4TKBA 3PPTA 2FRSA 3KFIA 2FT9A 4BOEA 1HMTA
chains in the Genus database with same CATH superfamily
4OS8A 5AJBA 3SOTA 3N91A 2RTBB 1LNMA 2G79A 3HOEA 2AMMX 2WPUA 3DTQA 2OF8A 4GDAA 4MVLA 2OL6O 2OYBO 1JBHA 1IIUA 3C77X 3U9PC 4ZHFA 3O22A 4RUNA 3RDSA 3NX2A 1SRIA 3RWXA 1KT4A 4HFOA 4ML7B 1X8OA 3RDUA 2A0AA 1GT5A 1N43A 5AJCA 3STNA 1W6FA 5EZ2A 4Z2OA 2I5VO 3WVMA 1BLRA 4ZH6A 1SXXA 1ML7A 2X8FA 4U9CA 4AZRA 1SLEB 3DSZA 1LKEA 1N7YA 1SRJA 3VHMA 4NNTA 3MX7A 3BX7A 1SRHA 2K62A 1HQPA 3AKNA 4IAWA 4A60A 1HY2A 4I3DA 2HLVA 3PECA 5IO5A 2L67A 3P6HA 2R74A 2OY1O 4Z28A 4BX6A 4WBKA 3WZNA 1KL3A 1L6MA 3FA9A 2UZ2A 5B10O 3P6CA 4OS0A 1IFBA 4LKPA 3X00A 1GXAA 1NBXA 1SWSA 1JV4A 4ZHHA 1HXLA 1PBYA 2GJ5A 3H3IA 1X71A 1YIVA 4I9RA 2AL0X 4ORSA 1SWPA 2C1QA 4K19A 1PBOA 5EEEA 5AQ6A 4YKOA 4EKVA 1ZNKA 1AQBA 2X56A 1BSOA 3MM0A 4GU8A 2IZLB 2OY5O 2QO4A 5LJBA 3VG6A 4ZGUA 1W5RA 5LJCA 3QKGA 4AW8A 1B8EA 3PEDA 3B2KA 4CPEA 2RTKA 3BX8A 3RY1A 5BVQA 2WEXA 3AUMO 1LIEA 2FKGA 4CPIA 5LJDA 5HZ6A 1SWOA 1SY2A 4O4OA 5HZ5A 2RD7C 5HA1A 2BLGA 1IKJA 1NQMA 3EYCA 1FJ1E 2JOZA 4ARHA 1BEBA 1MOYA 2PI3O 5L8IA 4ALBA 1VWAB 3CWKA 1BSYA 1T0VA 2ACPX 3NQ9A 3WOVA 2DM5A 2AT6X 5LKFA 4JNJA 2CBRA 3PK2A 3F8AA 4B55A 1LDQA 1SWBA 1EW3A 1VWFB 2KTSA 2NNDA 4XMGA 4O3ZA 1KFFA 1CBRA 1DZPA 5HWZA 4A1YA 4IABA 4FBRA 2FS6A 4GJVA 4MVKA 4PJ2A 1I06A 1Z24A 4ZCBA 3ZW0A 1A3YA 3ZW0B 1GGLA 1FENA 2CZUA 2RTRB 1Y55X 1ZRYA 2OFMX 1SREA 1VYGA 1BJ7A 2C4IA 2A2GA 5BVSA 5IRWA 2AF5A 2QMIA 1RSUB 2IFBA 1N0SA 3WYPA 5L8OA 5IRUA 2ACOA 5JR8A 2LKKA 2RTFB 1MVGA 4GH7A 4RUUA 2X34A 4GE1A 4M6SA 3CKGA 2A2UA 5EDBA 3SAOA 2X46A 3RZYA 1MUPA 1SWAA 5D4AA 4JGLA 2Q2PA 2ZAGA 1ERXA 5JD2A 1SWLA 2IZGB 3KFHA 3NADA 1KZXA 2ASNX 5HZ9A 1SLDB 3I17A 1JZUA 1IW2A 2MM3A 3D4RA 1GM6A 2NNQA 3ELZA 3FA7A 3V8UA 5BVTA 1MEPA 1GT4A 2AT5X 2QO6A 3SLJA 1EIIA 3S26A 3RE5A 3ELXA 1ICMA 3VG2A 3FIDA 1VWPB 1P6PA 5HTEA 5B27A 2RTDB 4O3XB 2QCBA 2AH7X 2RCQA 1I9HA 3P24A 1T8VA 4IAXA 1VWQB 1VWBB 1S7DA 3Q34A 3CBCA 1D3SA 1I05A 2X8SA 4GGZA 4OKAA 4AZNA 1U18A 3BY0A 1JYDA 3FMZA 1NP4A 4GRJA 4N7CA 2IZFB 3NBXX 4GK9A 4HPCA 4Y59A 3ZZVA 5LJHA 1MM9A 1STRB 2L68A 2RTEB 3D97A 1RAVA 2IZHB 3NX1A 4HPAA 4KH8A 2LFOA 2P8GA 4NYQA 3STMX 3HWDA 2RQ0A 4KCAA 3WZOA 2F01A 2Y32A 4MVIA 1O1UA 2POAA 3RSWA 3VE2A 1ZNEA 1VWNB 3CKFA 2OY8A 1NDJA 1HMSA 1KXOA 4YBUA 3S60A 4NNSA 1CRBA 3WJBA 4KC8A 1RBPA 3P6GA 4Y0PA 2BS6A 5HBSA 3RDXA 2AT3X 3B2JA 4D6AA 1I78A 1O1VA 4ES7A 1SLGB 2A13A 3ZUOA 2OF9A 2OFRX 1SWJA 3VPJE 4XMFA 4D6BA 3SZHA 2FTBA 1DC9A 4Z27A 1I04A 2X55A 3P02A 3JSQA 1IKEA 1LDOA 1ZNGA 1VWIB 3FR2A 3WZPA 2ZSCA 4LZVA 4EQAC 4CK4A 1PTSA 1HN2A 4GDZA 3B2IA 3BU1A 2Q39A 1OBPA 1FELA 4QZUA 4O3YA 4YGZA 4QGWA 1GT3A 3FR5A 4QYPA 1G74A 2LA7A 5DG4A 3UEWA 1E00A 1SY3A 1VWRB 5B3MO 5HCCC 1SWUA 1SWDA 2AT0X 1KL5A 2MO5A 4INNA 3VHIA 3WBGA 3ZUIA 5D47A 2IZKA 1O8VA 2R56A 2FHLA 1SWFA 2HZRA 3APVA 3B2LA 4BCSA 3PQUA 5HZQA 5KICA 1E06A 2CM9A 1U0XA 1KT7A 1N9MA 1OBQA 2HYSA 3PH5A 4EFGA 1VWJB 3ZI8A 1W4TA 2E4JA 2GTLO 4BVMA 5F1EA 1JJUA 5F6BA 1OPAA 1VWEB 1VWKB 1Y52X 3OJYC 3KQ0A 1RXKA 2ANSA 1JMZA 2UYWA 3ZW1A 1SXYA 1X8NA 3ZW1B 1B56A 4CDCA 1FE3A 2LB6A 2GTFX 4BX6B 3NPOA 2HNXA 3GAQA 1SLFB 4QYNA 4GGTA 2RTPB 1E5PA 1K3BA 2JN3A 4LQZA 1BWYA 2OVEA 1S44A 2MHDA 5KIDA 4TLJA 4BQUA 3PDFA 4IB7A 5B5GA 5CSEA 4Z2VA 3LV4A 1BRPA 1VWLB 4TKHA 4UU3A 2OL8O 3U0DA 2WQAE 4CPFA 1TOWA 3WJGA 2RN4A 3GE2A 4O3WA 2YG2A 5B5FA 4NV7A 4OELA 1HBPA 3CQRA 4I9SA 1JMXA 3PP6A 4Y0RA 1RXJA 2BC3A 5EDCA 1MX7A 5K06A 4JO6A 2KW1A 1VYFA 1ACDA 1STSB 2JGSA 2X4MA 2FR3A 3BRNA 3HWEA 4ZR2A 3WZQA 2GTLN 1VYOA 2OVSA 1SWKA 4QQ1A 2OFAA 2Z4HA 1U17A 2IZEB 4YKMA 2G5LA 5HTDA 3FDCA 3ZQ3A 2RTGB 5EEDA 4IB6A 3S5VA 1ICNA 3WYQA 5LKEA 2BHVA 4L1NA 3HOLA 4MIRA 3OBLA 4QAEA 2GC9A 4YH0A 4ZHGA 1SWNA 3TZSA 1DF3A 1QY2A 2OY7A 2QM9A 1PM1X 1SWGA 5KHPA 2FS7A 4PSQA 5IRAA 1B0OA 3PH6A 4U3QA 2RTAA 3EW2A 4TQ2A 2Q9SA 3I0AA 1EXSA 4A8ZA 3G7XA 5IO7A 3RKGA 3VG3A 4YCEA 3HK1A 3MG5A 3T2XA 2IZAA 1PEEA 1GX3A 2KTDA 1QG5A 4YVBA 3RDQA 2FWVA 3EBWA 4KC7A 2JU7A 1AB0A 4YFPA 1G7NA 1SMPI 1DZJA 1X89A 2OZQA 3HPEA 3JS1A 4IRWA 2KT4B 3RE6A 3ZW2A 4AZQA 1QY0A 4BJ8A 2QO5A 4GD9A 4BX7A 1PMPA 1UYOX 2G78A 2XKLA 4IB9A 1HBQA 5EPQA 5H8TA 4BX7B 1Y9TA 4DCBA 3JQOA 5DPQA 1CJ5A 2RTNB 2FHNX 4FBOA 3FA6A 2F09A 1YUPA 4NV8A 1IJ8A 5HAEA 1SWQA 4R0BA 5D45A 1AVEA 4FGIB 4EDEA 3HWGA 3T2WA 1SWRA 3CBSA 1KZWA 3NQKA 2X8TA 3HTYA 1B4MA 2AKQA 2NNEA 1XCAA 1LIFA 1HXZA 4QNIA 3VGWA 2VDFA 5IXGA 3RDOA 1A57A 1SXWA 1NGLA 2BS5A 4CSBA 1NP1A 1SRGA 1SA8A 4NLJA 1QWDA 2A5CA 3B2HA 3LTWA 1GX8A 1TXLA 1QY1A 2W2AA 4M7MA 4ORUA 2K23A 4TJZA 1ERBA 5B11O 1BM5A 3C78X 3FYFA 1ZNHA 3HWFA 1LUQA 1TVQA 4O4XA 4ZH9A 1A2DA 5FFHA 2IZCB 4HPBA 4ORWA 4FBVA 5C0NA 2BT9A 4FQBB 4MVEA 3LHNA 1ALBA 1MX8A 4ODDA 4UU2A 3L4RA 3D96A 3IFBA 1STPA 3KVNA 3WJEA 4DNEA 5LJGA 1Y53X 1SXUA 3P6FA 5F6ZA 1AVDA 3VG7A 1CBIA 4I95A 4MISA 4GJSA 1EPBA 2YMSA 5H9NA 4CDDA 5HZ8A 2HKDA 2L5PA 3FA8A 1EPAA 1S2PA 1SWHA 1X8PA 1WBIA 2Z4IA 2JW1A 4GETA 2VFCA 1JYJA 3T6LA 1RLBE 4Y0QA 4A1HA 2OL7A 5LJEA 2AVIA 3CR6A 2WUTA 1KT6A 4GZVA 4XMHA 1VPRA 1OEJA 1SWCA 1ZNDA 1UREA 1JJJA 4QGVA 1OSPO 4N7DA 4YFQA 3TGBA 4MEEA 4QRLA 5H9LA 1LCWA 1NQNA 2RA6A 5F2BA 1LICA 4ORXA 3OE3A 3FW4A 2VFBA 2WEWA 3F9DA 4ON1A 4I3CA 4AYHA 2HZQA 4BGFA 2QOSC 4DQ4A 1LF7A 4U8UN 1BRQA 1XKIA 3SLTA 2A5BA 2X45A 2OVDA 2IZDB 1OEEA 1LFOA 1DZMA 3C76X 4HPDA 4I60A 2OFBA 1AVGI 3AEHA 4JHQA 4OEMA 4IMNA 4WFUA 1DF8A 3P6EA 2C1SA 2IZBA 3OD9A 4O4UA 4OS3A 3QQ2A 4BBOA 1OBUA 2GTLM 4ZGFA 1RSTB 2W2BA 3EW1A 1FTPA 4U46A 3IA8A 4OMWA 4ORRA 2EU7X 3U03A 4ID2A 4NW4A 4Z6JA 1G85A 2AT8X 2R73A 1KOIA 3SZJA 4ZJ0A 4COTA 3FEPA 2M4LA 5CYBA 1N9YA 3VU1A 3WJDA 1OPBA 4AZPA 5HA0A 1E2TA 4CDEA 3WXQA 5BYPA 3E3CA 1SRFA 5K68A 3T6FA 2WQ9A 4CDFA 3FEKA 1RXHA 5CHKA 2CAMA 4YFRA 1JJXA 1GX9A 1MK5A 1E02A 1GT1A 1SWTA 1TW4A 4I6SA 3MBTA 1QFTA 2CM4A 5HCDC 2KD2A 4IMOA 2A8GA 5D48A 4XMDA 1HQQA 2CZTA 3RBYA 3O19A 1FEMA 1DFVA 4C5PA 1QFVA 2I5ZO 1N4JA 3BDRA 3TGAA 3P6DA 2W2FA 2A3FX 2RTMA 3STKA 1KQXA 3EBKA 2QOMA 5F58A 3FENA 1SWEA 3UEVA 4IB8A 1R0UA 4EXZA 1EI5A 3SZIA 4WFVA 1BSQA 1LIDA 3EMMA 3FW5A 1FDQA 4XMEA 1DV9A 4AZMA 4NLIA 1EUOA 4TNNA 4ZHCA 1KT5A 1VWOB 1AELA 5FQ6E 1EQDA 1SY0A 2X32A 1YWCA 1LELA 1JIWI 2ALLX 2NP1A 3AKMA 4YDBA 1VWGB 4O9SA 5IO6A 2HMBA 2RTLA 3APWA 3MVFA 3Q6LA 3NQ3A 1UZ2X 1YP6A 1KQWA 3RDMA 4TKJA 2DJGA 4LZUA 2FKJA 4ALOA 2IZIA 1CBSA 4QGXA 2DJFA 5B29A 4AZOA 5LJKA 2MWHA 1I4UA 3NP1A 5H9AA 2G8CO 1ZNLA 1YWAA 2LBAA 4CV7A 1HMRA 1DZKA 4YGHA 1SY1A 4WHIA 4BX5A 4BX5B 2FR2A 3TGCA 2JU8A 4Y0SA 5H9KA 2Q4NA 3BS2A 4GKCA 1YP7A 5F7GA 3CMPA 2WWPA 4GNYA 3S5XA 5K67A 3APUA 2L9CA 1MDCA 1LCVA 1WUBA 1Y0GA 2Y3FA 2RTIB 4KT5A 1H91A 4YGGA 2Q2MA 4I3BA 3D9WA 4HWMA 3WJCA 3BLGA 1LIBA 3O2YA 1YWBA 3BU9A 4OMXA 2F73A 2RTJA 5FAZA 2BSZA 1QABE 1LPJA 1D2UA 2MJIA 2WSJA 4EEJA 4L3RA 1TOUA 4IBAA 3TF6A 1CBQA 2WR6A 5FENA 3ZWEA 1VWHB 1VWDB 4NYRA 1Y9LA 4U8UO 1LCZA 4DQ3A 3EM0A 4O49A 4Z2PA 5L8NA 3SLOA 3VHHA 2O62A 3UAQA 4YDAA 1QQSA 1YWDA 4CPHA 5HCEC 1X8QA 4CPHB 1NC9A 1A18A 3FR4A 3WJFA 5L3YA 2FLJA 4GUZA 2RTCB 1EIOA 4ORYA 1KGLA 3KFFA 4U8UM 2XSTA 4GGRA 3KFGA 5CE4A 1ADLA 5D8JA 2FGSA 4YBPA 2ZAIA 3EC5A 3T1DA 2N93A 2G7BA 2IZJA 1KT3A 2JU3A 4YCHA 2CBSA 1VWMB 2LBVA 4KIIA 5FQ8E 3FELA 1JQPA 3APXA 4LKTA 2RTQB 4XMCA 5B2AO 3VG5A 4ZHDA 3NR3A 1K24A 5FQ7E 2Y3EA 1VWCB 1BBPA 3FLLA 2JMBA 1X8UA 4O4SA 3UEXA 2PY1A 1T68X 2RTHB 3FIQA 4Y5DA 1G5WA 5AEOA 3K3LA 3KZAA 4YMYA 1OEKA 3RY2A 1GKAA 1GKAB 2RCTA 1EALA 1KL4A 2GH7A 4NP1A 3BSZE 3VG4A 1IFCA 4QZTA 3CQNA 2RTOB 3PQSA 2OVAA 1UYNX 3VE1A 4GNWA 4ZFXA 3D95A 3UEUA 4TKBA 3PPTA 2FRSA 3KFIA 2FT9A 4BOEA 2MF6A 3F6ZB 1HMTA
chains in the Genus database with same CATH topology
4OS8A 5AJBA 3SOTA 3N91A 4NLJA 1LNMA 2G79A 3HOEA 2AMMX 3WJGA 3DTQA 4MVLA 1JBHA 1IIUA 3C77X 3U9PC 4ZHFA 3O22A 4RUNA 3NX2A 3RWXA 1KT4A 4HFOA 4ML7B 1X8OA 2A0AA 1GT5A 5AJCA 3STNA 5EZ2A 3WVMA 1BLRA 4ZH6A 1SXXA 1ML7A 2X8FA 4U9CA 4AZRA 3DSZA 1LKEA 4NNTA 3MX7A 3BX7A 2K62A 1HQPA 3AKNA 4IAWA 4A60A 4I3DA 2HLVA 3PECA 5IO5A 2L67A 3P6HA 2R74A 4WBKA 1L6MA 3FA9A 3P6CA 4OS0A 1IFBA 4LKPA 1GXAA 1JV4A 4ZHHA 2GJ5A 3H3IA 1X71A 1YIVA 4I9RA 2AL0X 4ORSA 5EEEA 4K19A 1PBOA 5AQ6A 4YKOA 1ZNKA 1AQBA 4GU8A 1BSOA 5LJBA 2QO4A 3VG6A 4ZGUA 5LJCA 3QKGA 4AW8A 1B8EA 3PEDA 3B2KA 3BX8A 5BVQA 2WEXA 1LIEA 5LJDA 5HZ6A 1SY2A 4O4OA 5HZ5A 2RD7C 5HA1A 2BLGA 1IKJA 3EYCA 2JOZA 4ARHA 1BEBA 4ALBA 5L8IA 3CWKA 1BSYA 1T0VA 2ACPX 3NQ9A 3WOVA 2DM5A 2AT6X 5LKFA 2CBRA 3F8AA 2KTSA 3S26A 1EW3A 2NNDA 4XMGA 4O3ZA 5HWZA 1CBRA 1DZPA 4A1YA 4IABA 4FBRA 2FS6A 4ZCBA 4MVKA 4PJ2A 1I06A 1Z24A 3ZW0A 1A3YA 3ZW0B 1GGLA 1FENA 2CZUA 2OFMX 1ZRYA 1VYGA 1BJ7A 5BVSA 2A2GA 2QMIA 2IFBA 1N0SA 5L8OA 2ACOA 5JR8A 2LKKA 1MVGA 4GH7A 4RUUA 4GE1A 4M6SA 3SAOA 2A2UA 5EDBA 2X46A 3RZYA 1MUPA 5D4AA 4JGLA 2Q2PA 2ZAGA 1ERXA 1KZXA 3KFHA 3NADA 2ASNX 5HZ9A 3I17A 1JZUA 1IW2A 2MM3A 3D4RA 1GM6A 2NNQA 3ELZA 3FA7A 3V8UA 5BVTA 1GT4A 2AT5X 2QO6A 1EIIA 3ELXA 1ICMA 3VG2A 1P6PA 5HTEA 5B27A 4O3XB 2AH7X 2RCQA 3P24A 1T8VA 4IAXA 5D8JA 1S7DA 3CBCA 1D3SA 1I05A 2X8SA 4AZNA 1U18A 3BY0A 1JYDA 3FMZA 1NP4A 4GRJA 4N7CA 3NBXX 4GK9A 4HPCA 3ZZVA 5LJHA 2L68A 3NX1A 3D97A 4KH8A 4HPAA 2LFOA 2P8GA 4NYQA 3STMX 3HWDA 2RQ0A 4KCAA 4MVIA 1O1UA 2POAA 3RSWA 3VE2A 1ZNEA 1HMSA 1KXOA 4YBUA 3S60A 4NNSA 1CRBA 3WJBA 4KC8A 1RBPA 3P6GA 4Y0PA 2BS6A 5HBSA 2AT3X 3B2JA 4D6AA 1O1VA 4ES7A 3ZUOA 2A13A 2OFRX 4D6BA 3VPJE 4XMFA 2FTBA 1DC9A 1I04A 3P02A 3JSQA 1IKEA 1ZNGA 3FR2A 4EQAC 4LZVA 4CK4A 1HN2A 4GDZA 3B2IA 3BU1A 2Q39A 1OBPA 1FELA 4QZUA 4O3YA 4YGZA 4QGWA 1GT3A 3FR5A 4QYPA 1G74A 2LA7A 5DG4A 3UEWA 1E00A 1SY3A 5HCCC 2AT0X 2MO5A 4INNA 3WBGA 5D47A 1O8VA 2R56A 2HZRA 3APVA 3B2LA 3PQUA 5HZQA 5KICA 1E06A 2CM9A 1U0XA 1KT7A 1OBQA 2HYSA 3PH5A 4EFGA 3ZI8A 2E4JA 2GTLO 4BVMA 5F1EA 5F6BA 1OPAA 3OJYC 3KQ0A 2ANSA 3ZW1A 1SXYA 1X8NA 3ZW1B 1B56A 1FE3A 2LB6A 2GTFX 3NPOA 2HNXA 3GAQA 4QYNA 1BWYA 4LQZA 1E5PA 2JN3A 2OVEA 1S44A 2MHDA 5KIDA 4TLJA 4BQUA 4IB7A 3LV4A 1BRPA 4TKHA 4UU3A 3U0DA 2WQAE 1TOWA 2RN4A 3GE2A 4O3WA 2YG2A 1HBPA 3CQRA 4I9SA 4Y0RA 3PP6A 5EDCA 1MX7A 5K06A 2KW1A 1VYFA 1ACDA 3BRNA 2FR3A 3HWEA 4ZR2A 2GTLN 2OVSA 4QQ1A 2Z4HA 1U17A 4YKMA 5HTDA 3ZQ3A 5EEDA 4IB6A 3S5VA 1ICNA 5LKEA 2BHVA 4L1NA 3HOLA 4MIRA 3OBLA 4QAEA 2GC9A 4YH0A 4ZHGA 3TZSA 1DF3A 1QY2A 2QM9A 1PM1X 5KHPA 2FS7A 4PSQA 1B0OA 3PH6A 4U3QA 4TQ2A 2Q9SA 3I0AA 1EXSA 4A8ZA 3G7XA 5IO7A 3RKGA 3VG3A 4YCEA 3HK1A 1PEEA 2KTDA 1QG5A 2FWVA 3EBWA 4KC7A 2JU7A 1AB0A 4YFPA 2OZQA 1G7NA 1DZJA 1SMPI 1X89A 3JS1A 3ZUIA 4AZQA 2KT4B 3ZW2A 1QY0A 2QO5A 1PMPA 2G78A 4IB9A 2XKLA 5H8TA 1HBQA 5EPQA 1Y9TA 3JQOA 5DPQA 1CJ5A 4FBOA 3FA6A 2F09A 1YUPA 5HAEA 4R0BA 5D45A 4FGIB 4EDEA 3HWGA 3CBSA 1KZWA 3NQKA 2X8TA 3HTYA 1B4MA 2AKQA 2NNEA 1XCAA 1LIFA 4QNIA 1A57A 1SXWA 1NGLA 2BS5A 4CSBA 1NP1A 1SA8A 1QWDA 3B2HA 1GX8A 1TXLA 1QY1A 2W2AA 4M7MA 4ORUA 2K23A 4TJZA 1ERBA 1BM5A 3C78X 3FYFA 1ZNHA 3HWFA 1TVQA 4O4XA 4ZH9A 1A2DA 5FFHA 4HPBA 4ORWA 4FBVA 5C0NA 2BT9A 4FQBB 4MVEA 3LHNA 1ALBA 1MX8A 4ODDA 4UU2A 3L4RA 3D96A 3IFBA 3WJEA 5LJGA 5F6ZA 1SXUA 3P6FA 3VG7A 1CBIA 4I95A 4MISA 5H9NA 1EPBA 2YMSA 5HZ8A 2L5PA 3FA8A 1EPAA 1S2PA 1X8PA 2Z4IA 2JW1A 4GETA 1JYJA 1RLBE 4Y0QA 4A1HA 5LJEA 3CR6A 2WUTA 1KT6A 4GZVA 4XMHA 1VPRA 1OEJA 1ZNDA 1UREA 1JJJA 4QGVA 4YFQA 4N7DA 3TGBA 4QRLA 5H9LA 2RA6A 1LICA 4ORXA 3OE3A 3FW4A 2WEWA 3F9DA 4ON1A 4I3CA 4AYHA 2HZQA 2QOSC 4DQ4A 1LF7A 4U8UN 1BRQA 1XKIA 2X45A 2OVDA 1OEEA 1LFOA 1DZMA 3C76X 4HPDA 1AVGI 4WFUA 4IMNA 3P6EA 4O4UA 3OD9A 4OS3A 1OBUA 2GTLM 4ZGFA 2W2BA 1FTPA 3IA8A 4OMWA 4ORRA 2EU7X 3U03A 4ID2A 4NW4A 4ZJ0A 1G85A 2AT8X 2R73A 1KOIA 4COTA 3FEPA 2M4LA 5CYBA 3VU1A 3WJDA 4AZPA 1OPBA 5HA0A 3WXQA 5BYPA 3E3CA 2WQ9A 3FEKA 4YFRA 1GX9A 1JJXA 1E02A 1GT1A 1TW4A 4I6SA 3MBTA 1QFTA 2CM4A 5HCDC 2KD2A 4IMOA 5D48A 4XMDA 2CZTA 3RBYA 3O19A 1FEMA 1DFVA 1QFVA 3BDRA 3TGAA 3P6DA 2W2FA 2A3FX 3STKA 1KQXA 3EBKA 5F58A 3FENA 3UEVA 4IB8A 1R0UA 4EXZA 1EI5A 1DV9A 4WFVA 1BSQA 1LIDA 3EMMA 3FW5A 1FDQA 4XMEA 4AZMA 4NLIA 1EUOA 4TNNA 4ZHCA 1KT5A 1AELA 5FQ6E 1EQDA 1SY0A 1YWCA 1JIWI 2ALLX 2NP1A 3AKMA 4YDBA 4O9SA 5IO6A 2HMBA 3APWA 3MVFA 3Q6LA 3NQ3A 1UZ2X 1YP6A 1KQWA 4TKJA 4LZUA 4ALOA 1CBSA 4QGXA 5B29A 4AZOA 5LJKA 2MWHA 1I4UA 3NP1A 5H9AA 4CV7A 1ZNLA 1YWAA 2LBAA 1HMRA 1DZKA 4YGHA 1SY1A 4WHIA 2FR2A 3TGCA 2JU8A 4Y0SA 5H9KA 2Q4NA 3BS2A 4GKCA 1YP7A 5F7GA 3CMPA 2WWPA 4GNYA 3S5XA 3APUA 2L9CA 1MDCA 4KT5A 1H91A 4YGGA 2Q2MA 4I3BA 4HWMA 3WJCA 3BLGA 1LIBA 3O2YA 1YWBA 3BU9A 4OMXA 2F73A 5FAZA 1QABE 1LPJA 1D2UA 2MJIA 2WSJA 4EEJA 4L3RA 1TOUA 4IBAA 3TF6A 1CBQA 2WR6A 5FENA 3ZWEA 4NYRA 1Y9LA 4U8UO 4DQ3A 5L8NA 3EM0A 4O49A 2O62A 3UAQA 4YDAA 1QQSA 1YWDA 5HCEC 1X8QA 1A18A 3FR4A 3WJFA 2FLJA 1EIOA 4ORYA 1KGLA 3KFFA 4U8UM 2XSTA 3KFGA 5CE4A 1ADLA 4YBPA 2ZAIA 3T1DA 2N93A 2G7BA 1KT3A 2JU3A 4YCHA 2CBSA 2LBVA 4KIIA 5FQ8E 3FELA 3APXA 4LKTA 4XMCA 3VG5A 4ZHDA 3NR3A 5FQ7E 1BBPA 3FLLA 2JMBA 1X8UA 4O4SA 3UEXA 2PY1A 1T68X 3FIQA 1G5WA 5AEOA 3K3LA 3KZAA 4YMYA 1OEKA 1GKAA 1GKAB 2RCTA 1EALA 4NP1A 3BSZE 3VG4A 1IFCA 4QZTA 3CQNA 3PQSA 2OVAA 3VE1A 4GNWA 4ZFXA 3D95A 3UEUA 4TKBA 3PPTA 2FRSA 3KFIA 2FT9A 4BOEA 3F6ZB 1HMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OS8 A;  4NLJ A;  3WJG A;  1LNM A;  2G79 A;  2AMM X;  3DTQ A;  4MVL A;  1JBH A;  1IIU A;  3C77 X;  3U9P C;  4ZHF A;  3O22 A;  4RUN A;  3NX2 A;  1KT4 A;  4HFO A;  1X8O A;  2A0A A;  1GT5 A;  3STN A;  5EZ2 A;  3WVM A;  1BLR A;  4ZH6 A;  1SXX A;  1ML7 A;  4AZR A;  3DSZ A;  1LKE A;  4NNT A;  3BX7 A;  2K62 A;  1HQP A;  3AKN A;  4IAW A;  4A60 A;  4I3D A;  2HLV A;  3PEC A;  5IO5 A;  2L67 A;  3P6H A;  2R74 A;  4WBK A;  1L6M A;  3FA9 A;  3P6C A;  4OS0 A;  1IFB A;  4LKP A;  1GXA A;  1JV4 A;  4ZHH A;  2GJ5 A;  1X71 A;  1YIV A;  4I9R A;  2AL0 X;  4ORS A;  5EEE A;  4K19 A;  1PBO A;  5AQ6 A;  4YKO A;  1ZNK A;  1AQB A;  5LJB A;  1BSO A;  2QO4 A;  3VG6 A;  4ZGU A;  5LJC A;  3QKG A;  4AW8 A;  1B8E A;  3PED A;  3B2K A;  3BX8 A;  5BVQ A;  2WEX A;  1LIE A;  5LJD A;  5HZ6 A;  1SY2 A;  5HZ5 A;  2RD7 C;  5HA1 A;  2BLG A;  1IKJ A;  3EYC A;  2JOZ A;  4ARH A;  1BEB A;  4ALB A;  5L8I A;  3CWK A;  1BSY A;  1T0V A;  2ACP X;  3NQ9 A;  2DM5 A;  2AT6 X;  5LKF A;  2CBR A;  3F8A A;  3S26 A;  1EW3 A;  2NND A;  4XMG A;  5HWZ A;  1CBR A;  1DZP A;  4A1Y A;  2FS6 A;  4ZCB A;  4MVK A;  1I06 A;  1Z24 A;  1A3Y A;  1GGL A;  1FEN A;  2CZU A;  2OFM X;  1ZRY A;  1VYG A;  1BJ7 A;  5BVS A;  2A2G A;  2IFB A;  1N0S A;  5L8O A;  2ACO A;  5JR8 A;  2LKK A;  1MVG A;  4GH7 A;  4RUU A;  4GE1 A;  4M6S A;  3SAO A;  2A2U A;  5EDB A;  2X46 A;  3RZY A;  1MUP A;  5D4A A;  2Q2P A;  1ERX A;  1KZX A;  3KFH A;  3NAD A;  2ASN X;  5HZ9 A;  3I17 A;  1JZU A;  1IW2 A;  2MM3 A;  3ELZ A;  1GM6 A;  2NNQ A;  3FA7 A;  5BVT A;  1GT4 A;  2AT5 X;  2QO6 A;  1EII A;  3ELX A;  1ICM A;  3VG2 A;  1P6P A;  5HTE A;  5B27 A;  2AH7 X;  2RCQ A;  1T8V A;  4IAX A;  5D8J A;  1S7D A;  3CBC A;  1D3S A;  1I05 A;  4AZN A;  1U18 A;  3BY0 A;  1JYD A;  3FMZ A;  1NP4 A;  4GRJ A;  4N7C A;  4HPC A;  5LJH A;  2L68 A;  3NX1 A;  3D97 A;  4HPA A;  2LFO A;  2P8G A;  4NYQ A;  3STM X;  3HWD A;  2RQ0 A;  4MVI A;  1O1U A;  2POA A;  3RSW A;  1ZNE A;  1HMS A;  1KXO A;  4YBU A;  4NNS A;  1CRB A;  3WJB A;  1RBP A;  3P6G A;  4Y0P A;  5HBS A;  2AT3 X;  3B2J A;  4D6A A;  1O1V A;  4ES7 A;  3ZUO A;  2A13 A;  2OFR X;  4D6B A;  4XMF A;  2FTB A;  1DC9 A;  1I04 A;  3JSQ A;  1IKE A;  1ZNG A;  3FR2 A;  4LZV A;  4CK4 A;  1HN2 A;  3B2I A;  3BU1 A;  2Q39 A;  1OBP A;  1FEL A;  4QZU A;  4YGZ A;  4QGW A;  1GT3 A;  3FR5 A;  4QYP A;  1G74 A;  5DG4 A;  3UEW A;  1E00 A;  1SY3 A;  5HCC C;  2AT0 X;  2MO5 A;  3WBG A;  5D47 A;  1O8V A;  2R56 A;  2HZR A;  3APV A;  3B2L A;  5HZQ A;  5KIC A;  1E06 A;  2CM9 A;  1U0X A;  1KT7 A;  1OBQ A;  2HYS A;  3PH5 A;  4EFG A;  2E4J A;  4BVM A;  5F1E A;  5F6B A;  1OPA A;  3OJY C;  3KQ0 A;  2ANS A;  1SXY A;  1X8N A;  1B56 A;  1FE3 A;  2LB6 A;  2GTF X;  3NPO A;  2HNX A;  3GAQ A;  4QYN A;  1BWY A;  1E5P A;  2JN3 A;  2OVE A;  1S44 A;  5KID A;  4TLJ A;  4BQU A;  4IB7 A;  1BRP A;  4TKH A;  4UU3 A;  3U0D A;  2WQA E;  1TOW A;  2YG2 A;  1HBP A;  3CQR A;  4I9S A;  4Y0R A;  3PP6 A;  5EDC A;  1MX7 A;  5K06 A;  1VYF A;  1ACD A;  3BRN A;  2FR3 A;  3HWE A;  4ZR2 A;  1U17 A;  4YKM A;  5HTD A;  3ZQ3 A;  5EED A;  4IB6 A;  1ICN A;  5LKE A;  4QAE A;  4YH0 A;  4ZHG A;  2GC9 A;  3TZS A;  1DF3 A;  1QY2 A;  2QM9 A;  1PM1 X;  5KHP A;  2FS7 A;  4PSQ A;  1B0O A;  3PH6 A;  4TQ2 A;  2Q9S A;  3I0A A;  1EXS A;  4A8Z A;  3G7X A;  5IO7 A;  3VG3 A;  4YCE A;  3HK1 A;  1PEE A;  2KTD A;  1QG5 A;  2FWV A;  3EBW A;  4YFP A;  2JU7 A;  1AB0 A;  1G7N A;  2OZQ A;  1DZJ A;  1X89 A;  3JS1 A;  3ZUI A;  4AZQ A;  2KT4 B;  1QY0 A;  2QO5 A;  1PMP A;  2G78 A;  4IB9 A;  2XKL A;  5H8T A;  1HBQ A;  5EPQ A;  5DPQ A;  1CJ5 A;  3FA6 A;  1YUP A;  5HAE A;  4R0B A;  5D45 A;  4EDE A;  3HWG A;  3CBS A;  1KZW A;  1B4M A;  2AKQ A;  2NNE A;  1XCA A;  1LIF A;  1A57 A;  1SXW A;  1NGL A;  1NP1 A;  1SA8 A;  1QWD A;  3B2H A;  1GX8 A;  1TXL A;  1QY1 A;  2W2A A;  4M7M A;  4ORU A;  2K23 A;  4TJZ A;  1ERB A;  1BM5 A;  3C78 X;  3HWF A;  1ZNH A;  1TVQ A;  4ZH9 A;  1A2D A;  5FFH A;  4HPB A;  4ORW A;  5C0N A;  4ODD A;  4UU2 A;  1ALB A;  1MX8 A;  3L4R A;  3D96 A;  3IFB A;  3WJE A;  5LJG A;  5F6Z A;  1SXU A;  3P6F A;  3VG7 A;  1CBI A;  5H9N A;  5HZ8 A;  1EPB A;  2L5P A;  3FA8 A;  1EPA A;  1S2P A;  1X8P A;  4GET A;  1JYJ A;  1RLB E;  4Y0Q A;  4A1H A;  5LJE A;  3CR6 A;  2WUT A;  1KT6 A;  4XMH A;  1VPR A;  1OEJ A;  1ZND A;  1URE A;  1JJJ A;  4QGV A;  4YFQ A;  4N7D A;  3TGB A;  5H9L A;  2RA6 A;  1LIC A;  4ORX A;  3FW4 A;  2WEW A;  3F9D A;  4I3C A;  4AYH A;  2HZQ A;  2QOS C;  4DQ4 A;  1LF7 A;  1BRQ A;  1XKI A;  2X45 A;  2OVD A;  1OEE A;  1LFO A;  1DZM A;  3C76 X;  4HPD A;  1AVG I;  4WFU A;  4IMN A;  3P6E A;  4OS3 A;  1OBU A;  2W2B A;  1FTP A;  3IA8 A;  4OMW A;  4ORR A;  2EU7 X;  3U03 A;  4ZJ0 A;  1G85 A;  2AT8 X;  2R73 A;  1KOI A;  3FEP A;  3WJD A;  4AZP A;  1OPB A;  5HA0 A;  3WXQ A;  2WQ9 A;  3FEK A;  4YFR A;  1GX9 A;  1JJX A;  1E02 A;  1GT1 A;  1TW4 A;  3MBT A;  1QFT A;  2CM4 A;  5HCD C;  4IMO A;  5D48 A;  4XMD A;  2CZT A;  3O19 A;  1DFV A;  1FEM A;  1QFV A;  3BDR A;  3TGA A;  3P6D A;  2W2F A;  2A3F X;  3STK A;  1KQX A;  3EBK A;  5F58 A;  3FEN A;  3UEV A;  4IB8 A;  1R0U A;  4EXZ A;  1DV9 A;  4WFV A;  1BSQ A;  1LID A;  3EMM A;  3FW5 A;  1FDQ A;  4XME A;  4AZM A;  4NLI A;  1EUO A;  4TNN A;  4ZHC A;  1KT5 A;  1AEL A;  1EQD A;  1SY0 A;  1YWC A;  2NP1 A;  2ALL X;  3AKM A;  4YDB A;  4O9S A;  5IO6 A;  2HMB A;  3APW A;  3MVF A;  3Q6L A;  3NQ3 A;  1UZ2 X;  1YP6 A;  1KQW A;  4TKJ A;  4LZU A;  4ALO A;  1CBS A;  4QGX A;  5B29 A;  4AZO A;  5LJK A;  1I4U A;  3NP1 A;  5H9A A;  1ZNL A;  1YWA A;  2LBA A;  1HMR A;  1DZK A;  4YGH A;  1SY1 A;  2FR2 A;  3TGC A;  2JU8 A;  4Y0S A;  5H9K A;  2Q4N A;  3BS2 A;  4GKC A;  1YP7 A;  5F7G A;  3CMP A;  2WWP A;  4GNY A;  3APU A;  2L9C A;  1MDC A;  1H91 A;  4YGG A;  2Q2M A;  4I3B A;  3WJC A;  3BLG A;  1LIB A;  3O2Y A;  1YWB A;  3BU9 A;  4OMX A;  2F73 A;  5FAZ A;  1QAB E;  1LPJ A;  1D2U A;  2MJI A;  2WSJ A;  4EEJ A;  1TOU A;  4IBA A;  3TF6 A;  1CBQ A;  2WR6 A;  5FEN A;  4NYR A;  4DQ3 A;  5L8N A;  3EM0 A;  2O62 A;  4YDA A;  1QQS A;  1YWD A;  5HCE C;  1X8Q A;  1A18 A;  3FR4 A;  3WJF A;  2FLJ A;  1EIO A;  4ORY A;  1KGL A;  3KFF A;  2XST A;  3KFG A;  5CE4 A;  1ADL A;  4YBP A;  3T1D A;  2N93 A;  2G7B A;  1KT3 A;  2JU3 A;  4YCH A;  2CBS A;  2LBV A;  4KII A;  3FEL A;  3APX A;  4LKT A;  4XMC A;  3VG5 A;  4ZHD A;  3NR3 A;  1BBP A;  3FLL A;  3UEX A;  1X8U A;  2PY1 A;  1T68 X;  3FIQ A;  1G5W A;  3K3L A;  3KZA A;  4YMY A;  1OEK A;  1GKA A;  2RCT A;  1GKA B;  1EAL A;  4NP1 A;  3BSZ E;  3VG4 A;  1IFC A;  4QZT A;  3CQN A;  2OVA A;  4GNW A;  4ZFX A;  3D95 A;  3UEU A;  4TKB A;  3PPT A;  2FRS A;  3KFI A;  2FT9 A;  4BOE A;  1HMT A; 
#chains in the Genus database with same CATH topology
 4OS8 A;  5AJB A;  3SOT A;  3N91 A;  2RTB B;  1LNM A;  2G79 A;  3HOE A;  2AMM X;  2WPU A;  3DTQ A;  2OF8 A;  4GDA A;  4MVL A;  2OL6 O;  2OYB O;  1JBH A;  1IIU A;  3C77 X;  3U9P C;  4ZHF A;  3O22 A;  4RUN A;  3RDS A;  3NX2 A;  1SRI A;  3RWX A;  1KT4 A;  4HFO A;  4ML7 B;  1X8O A;  3RDU A;  2A0A A;  1GT5 A;  1N43 A;  5AJC A;  3STN A;  1W6F A;  5EZ2 A;  4Z2O A;  2I5V O;  3WVM A;  1BLR A;  4ZH6 A;  1SXX A;  1ML7 A;  2X8F A;  4U9C A;  4AZR A;  1SLE B;  3DSZ A;  1LKE A;  1N7Y A;  1SRJ A;  3VHM A;  4NNT A;  3MX7 A;  3BX7 A;  1SRH A;  2K62 A;  1HQP A;  3AKN A;  4IAW A;  4A60 A;  1HY2 A;  4I3D A;  2HLV A;  3PEC A;  5IO5 A;  2L67 A;  3P6H A;  2R74 A;  2OY1 O;  4Z28 A;  4BX6 A;  4WBK A;  3WZN A;  1KL3 A;  1L6M A;  3FA9 A;  2UZ2 A;  5B10 O;  3P6C A;  4OS0 A;  1IFB A;  4LKP A;  3X00 A;  1GXA A;  1NBX A;  1SWS A;  1JV4 A;  4ZHH A;  1HXL A;  1PBY A;  2GJ5 A;  3H3I A;  1X71 A;  1YIV A;  4I9R A;  2AL0 X;  4ORS A;  1SWP A;  2C1Q A;  4K19 A;  1PBO A;  5EEE A;  5AQ6 A;  4YKO A;  4EKV A;  1ZNK A;  1AQB A;  2X56 A;  1BSO A;  3MM0 A;  4GU8 A;  2IZL B;  2OY5 O;  2QO4 A;  5LJB A;  3VG6 A;  4ZGU A;  1W5R A;  5LJC A;  3QKG A;  4AW8 A;  1B8E A;  3PED A;  3B2K A;  4CPE A;  2RTK A;  3BX8 A;  3RY1 A;  5BVQ A;  2WEX A;  3AUM O;  1LIE A;  2FKG A;  4CPI A;  5LJD A;  5HZ6 A;  1SWO A;  1SY2 A;  4O4O A;  5HZ5 A;  2RD7 C;  5HA1 A;  2BLG A;  1IKJ A;  1NQM A;  3EYC A;  1FJ1 E;  2JOZ A;  4ARH A;  1BEB A;  1MOY A;  2PI3 O;  5L8I A;  4ALB A;  1VWA B;  3CWK A;  1BSY A;  1T0V A;  2ACP X;  3NQ9 A;  3WOV A;  2DM5 A;  2AT6 X;  5LKF A;  4JNJ A;  2CBR A;  3PK2 A;  3F8A A;  4B55 A;  1LDQ A;  1SWB A;  1EW3 A;  1VWF B;  2KTS A;  2NND A;  4XMG A;  4O3Z A;  1KFF A;  1CBR A;  1DZP A;  5HWZ A;  4A1Y A;  4IAB A;  4FBR A;  2FS6 A;  4GJV A;  4MVK A;  4PJ2 A;  1I06 A;  1Z24 A;  4ZCB A;  3ZW0 A;  1A3Y A;  3ZW0 B;  1GGL A;  1FEN A;  2CZU A;  2RTR B;  1Y55 X;  1ZRY A;  2OFM X;  1SRE A;  1VYG A;  1BJ7 A;  2C4I A;  2A2G A;  5BVS A;  5IRW A;  2AF5 A;  2QMI A;  1RSU B;  2IFB A;  1N0S A;  3WYP A;  5L8O A;  5IRU A;  2ACO A;  5JR8 A;  2LKK A;  2RTF B;  1MVG A;  4GH7 A;  4RUU A;  2X34 A;  4GE1 A;  4M6S A;  3CKG A;  2A2U A;  5EDB A;  3SAO A;  2X46 A;  3RZY A;  1MUP A;  1SWA A;  5D4A A;  4JGL A;  2Q2P A;  2ZAG A;  1ERX A;  5JD2 A;  1SWL A;  2IZG B;  3KFH A;  3NAD A;  1KZX A;  2ASN X;  5HZ9 A;  1SLD B;  3I17 A;  1JZU A;  1IW2 A;  2MM3 A;  3D4R A;  1GM6 A;  2NNQ A;  3ELZ A;  3FA7 A;  3V8U A;  5BVT A;  1MEP A;  1GT4 A;  2AT5 X;  2QO6 A;  3SLJ A;  1EII A;  3S26 A;  3RE5 A;  3ELX A;  1ICM A;  3VG2 A;  3FID A;  1VWP B;  1P6P A;  5HTE A;  5B27 A;  2RTD B;  4O3X B;  2QCB A;  2AH7 X;  2RCQ A;  1I9H A;  3P24 A;  1T8V A;  4IAX A;  1VWQ B;  1VWB B;  1S7D A;  3Q34 A;  3CBC A;  1D3S A;  1I05 A;  2X8S A;  4GGZ A;  4OKA A;  4AZN A;  1U18 A;  3BY0 A;  1JYD A;  3FMZ A;  1NP4 A;  4GRJ A;  4N7C A;  2IZF B;  3NBX X;  4GK9 A;  4HPC A;  4Y59 A;  3ZZV A;  5LJH A;  1MM9 A;  1STR B;  2L68 A;  2RTE B;  3D97 A;  1RAV A;  2IZH B;  3NX1 A;  4HPA A;  4KH8 A;  2LFO A;  2P8G A;  4NYQ A;  3STM X;  3HWD A;  2RQ0 A;  4KCA A;  3WZO A;  2F01 A;  2Y32 A;  4MVI A;  1O1U A;  2POA A;  3RSW A;  3VE2 A;  1ZNE A;  1VWN B;  3CKF A;  2OY8 A;  1NDJ A;  1HMS A;  1KXO A;  4YBU A;  3S60 A;  4NNS A;  1CRB A;  3WJB A;  4KC8 A;  1RBP A;  3P6G A;  4Y0P A;  2BS6 A;  5HBS A;  3RDX A;  2AT3 X;  3B2J A;  4D6A A;  1I78 A;  1O1V A;  4ES7 A;  1SLG B;  2A13 A;  3ZUO A;  2OF9 A;  2OFR X;  1SWJ A;  3VPJ E;  4XMF A;  4D6B A;  3SZH A;  2FTB A;  1DC9 A;  4Z27 A;  1I04 A;  2X55 A;  3P02 A;  3JSQ A;  1IKE A;  1LDO A;  1ZNG A;  1VWI B;  3FR2 A;  3WZP A;  2ZSC A;  4LZV A;  4EQA C;  4CK4 A;  1PTS A;  1HN2 A;  4GDZ A;  3B2I A;  3BU1 A;  2Q39 A;  1OBP A;  1FEL A;  4QZU A;  4O3Y A;  4YGZ A;  4QGW A;  1GT3 A;  3FR5 A;  4QYP A;  1G74 A;  2LA7 A;  5DG4 A;  3UEW A;  1E00 A;  1SY3 A;  1VWR B;  5B3M O;  5HCC C;  1SWU A;  1SWD A;  2AT0 X;  1KL5 A;  2MO5 A;  4INN A;  3VHI A;  3WBG A;  3ZUI A;  5D47 A;  2IZK A;  1O8V A;  2R56 A;  2FHL A;  1SWF A;  2HZR A;  3APV A;  3B2L A;  4BCS A;  3PQU A;  5HZQ A;  5KIC A;  1E06 A;  2CM9 A;  1U0X A;  1KT7 A;  1N9M A;  1OBQ A;  2HYS A;  3PH5 A;  4EFG A;  1VWJ B;  3ZI8 A;  1W4T A;  2E4J A;  2GTL O;  4BVM A;  5F1E A;  1JJU A;  5F6B A;  1OPA A;  1VWE B;  1VWK B;  1Y52 X;  3OJY C;  3KQ0 A;  1RXK A;  2ANS A;  1JMZ A;  2UYW A;  3ZW1 A;  1SXY A;  1X8N A;  3ZW1 B;  1B56 A;  4CDC A;  1FE3 A;  2LB6 A;  2GTF X;  4BX6 B;  3NPO A;  2HNX A;  3GAQ A;  1SLF B;  4QYN A;  4GGT A;  2RTP B;  1E5P A;  1K3B A;  2JN3 A;  4LQZ A;  1BWY A;  2OVE A;  1S44 A;  2MHD A;  5KID A;  4TLJ A;  4BQU A;  3PDF A;  4IB7 A;  5B5G A;  5CSE A;  4Z2V A;  3LV4 A;  1BRP A;  1VWL B;  4TKH A;  4UU3 A;  2OL8 O;  3U0D A;  2WQA E;  4CPF A;  1TOW A;  3WJG A;  2RN4 A;  3GE2 A;  4O3W A;  2YG2 A;  5B5F A;  4NV7 A;  4OEL A;  1HBP A;  3CQR A;  4I9S A;  1JMX A;  3PP6 A;  4Y0R A;  1RXJ A;  2BC3 A;  5EDC A;  1MX7 A;  5K06 A;  4JO6 A;  2KW1 A;  1VYF A;  1ACD A;  1STS B;  2JGS A;  2X4M A;  2FR3 A;  3BRN A;  3HWE A;  4ZR2 A;  3WZQ A;  2GTL N;  1VYO A;  2OVS A;  1SWK A;  4QQ1 A;  2OFA A;  2Z4H A;  1U17 A;  2IZE B;  4YKM A;  2G5L A;  5HTD A;  3FDC A;  3ZQ3 A;  2RTG B;  5EED A;  4IB6 A;  3S5V A;  1ICN A;  3WYQ A;  5LKE A;  2BHV A;  4L1N A;  3HOL A;  4MIR A;  3OBL A;  4QAE A;  2GC9 A;  4YH0 A;  4ZHG A;  1SWN A;  3TZS A;  1DF3 A;  1QY2 A;  2OY7 A;  2QM9 A;  1PM1 X;  1SWG A;  5KHP A;  2FS7 A;  4PSQ A;  5IRA A;  1B0O A;  3PH6 A;  4U3Q A;  2RTA A;  3EW2 A;  4TQ2 A;  2Q9S A;  3I0A A;  1EXS A;  4A8Z A;  3G7X A;  5IO7 A;  3RKG A;  3VG3 A;  4YCE A;  3HK1 A;  3MG5 A;  3T2X A;  2IZA A;  1PEE A;  1GX3 A;  2KTD A;  1QG5 A;  4YVB A;  3RDQ A;  2FWV A;  3EBW A;  4KC7 A;  2JU7 A;  1AB0 A;  4YFP A;  1G7N A;  1SMP I;  1DZJ A;  1X89 A;  2OZQ A;  3HPE A;  3JS1 A;  4IRW A;  2KT4 B;  3RE6 A;  3ZW2 A;  4AZQ A;  1QY0 A;  4BJ8 A;  2QO5 A;  4GD9 A;  4BX7 A;  1PMP A;  1UYO X;  2G78 A;  2XKL A;  4IB9 A;  1HBQ A;  5EPQ A;  5H8T A;  4BX7 B;  1Y9T A;  4DCB A;  3JQO A;  5DPQ A;  1CJ5 A;  2RTN B;  2FHN X;  4FBO A;  3FA6 A;  2F09 A;  1YUP A;  4NV8 A;  1IJ8 A;  5HAE A;  1SWQ A;  4R0B A;  5D45 A;  1AVE A;  4FGI B;  4EDE A;  3HWG A;  3T2W A;  1SWR A;  3CBS A;  1KZW A;  3NQK A;  2X8T A;  3HTY A;  1B4M A;  2AKQ A;  2NNE A;  1XCA A;  1LIF A;  1HXZ A;  4QNI A;  3VGW A;  2VDF A;  5IXG A;  3RDO A;  1A57 A;  1SXW A;  1NGL A;  2BS5 A;  4CSB A;  1NP1 A;  1SRG A;  1SA8 A;  4NLJ A;  1QWD A;  2A5C A;  3B2H A;  3LTW A;  1GX8 A;  1TXL A;  1QY1 A;  2W2A A;  4M7M A;  4ORU A;  2K23 A;  4TJZ A;  1ERB A;  5B11 O;  1BM5 A;  3C78 X;  3FYF A;  1ZNH A;  3HWF A;  1LUQ A;  1TVQ A;  4O4X A;  4ZH9 A;  1A2D A;  5FFH A;  2IZC B;  4HPB A;  4ORW A;  4FBV A;  5C0N A;  2BT9 A;  4FQB B;  4MVE A;  3LHN A;  1ALB A;  1MX8 A;  4ODD A;  4UU2 A;  3L4R A;  3D96 A;  3IFB A;  1STP A;  3KVN A;  3WJE A;  4DNE A;  5LJG A;  1Y53 X;  1SXU A;  3P6F A;  5F6Z A;  1AVD A;  3VG7 A;  1CBI A;  4I95 A;  4MIS A;  4GJS A;  1EPB A;  2YMS A;  5H9N A;  4CDD A;  5HZ8 A;  2HKD A;  2L5P A;  3FA8 A;  1EPA A;  1S2P A;  1SWH A;  1X8P A;  1WBI A;  2Z4I A;  2JW1 A;  4GET A;  2VFC A;  1JYJ A;  3T6L A;  1RLB E;  4Y0Q A;  4A1H A;  2OL7 A;  5LJE A;  2AVI A;  3CR6 A;  2WUT A;  1KT6 A;  4GZV A;  4XMH A;  1VPR A;  1OEJ A;  1SWC A;  1ZND A;  1URE A;  1JJJ A;  4QGV A;  1OSP O;  4N7D A;  4YFQ A;  3TGB A;  4MEE A;  4QRL A;  5H9L A;  1LCW A;  1NQN A;  2RA6 A;  5F2B A;  1LIC A;  4ORX A;  3OE3 A;  3FW4 A;  2VFB A;  2WEW A;  3F9D A;  4ON1 A;  4I3C A;  4AYH A;  2HZQ A;  4BGF A;  2QOS C;  4DQ4 A;  1LF7 A;  4U8U N;  1BRQ A;  1XKI A;  3SLT A;  2A5B A;  2X45 A;  2OVD A;  2IZD B;  1OEE A;  1LFO A;  1DZM A;  3C76 X;  4HPD A;  4I60 A;  2OFB A;  1AVG I;  3AEH A;  4JHQ A;  4OEM A;  4IMN A;  4WFU A;  1DF8 A;  3P6E A;  2C1S A;  2IZB A;  3OD9 A;  4O4U A;  4OS3 A;  3QQ2 A;  4BBO A;  1OBU A;  2GTL M;  4ZGF A;  1RST B;  2W2B A;  3EW1 A;  1FTP A;  4U46 A;  3IA8 A;  4OMW A;  4ORR A;  2EU7 X;  3U03 A;  4ID2 A;  4NW4 A;  4Z6J A;  1G85 A;  2AT8 X;  2R73 A;  1KOI A;  3SZJ A;  4ZJ0 A;  4COT A;  3FEP A;  2M4L A;  5CYB A;  1N9Y A;  3VU1 A;  3WJD A;  1OPB A;  4AZP A;  5HA0 A;  1E2T A;  4CDE A;  3WXQ A;  5BYP A;  3E3C A;  1SRF A;  5K68 A;  3T6F A;  2WQ9 A;  4CDF A;  3FEK A;  1RXH A;  5CHK A;  2CAM A;  4YFR A;  1JJX A;  1GX9 A;  1MK5 A;  1E02 A;  1GT1 A;  1SWT A;  1TW4 A;  4I6S A;  3MBT A;  1QFT A;  2CM4 A;  5HCD C;  2KD2 A;  4IMO A;  2A8G A;  5D48 A;  4XMD A;  1HQQ A;  2CZT A;  3RBY A;  3O19 A;  1FEM A;  1DFV A;  4C5P A;  1QFV A;  2I5Z O;  1N4J A;  3BDR A;  3TGA A;  3P6D A;  2W2F A;  2A3F X;  2RTM A;  3STK A;  1KQX A;  3EBK A;  2QOM A;  5F58 A;  3FEN A;  1SWE A;  3UEV A;  4IB8 A;  1R0U A;  4EXZ A;  1EI5 A;  3SZI A;  4WFV A;  1BSQ A;  1LID A;  3EMM A;  3FW5 A;  1FDQ A;  4XME A;  1DV9 A;  4AZM A;  4NLI A;  1EUO A;  4TNN A;  4ZHC A;  1KT5 A;  1VWO B;  1AEL A;  5FQ6 E;  1EQD A;  1SY0 A;  2X32 A;  1YWC A;  1LEL A;  1JIW I;  2ALL X;  2NP1 A;  3AKM A;  4YDB A;  1VWG B;  4O9S A;  5IO6 A;  2HMB A;  2RTL A;  3APW A;  3MVF A;  3Q6L A;  3NQ3 A;  1UZ2 X;  1YP6 A;  1KQW A;  3RDM A;  4TKJ A;  2DJG A;  4LZU A;  2FKJ A;  4ALO A;  2IZI A;  1CBS A;  4QGX A;  2DJF A;  5B29 A;  4AZO A;  5LJK A;  2MWH A;  1I4U A;  3NP1 A;  5H9A A;  2G8C O;  1ZNL A;  1YWA A;  2LBA A;  4CV7 A;  1HMR A;  1DZK A;  4YGH A;  1SY1 A;  4WHI A;  4BX5 A;  4BX5 B;  2FR2 A;  3TGC A;  2JU8 A;  4Y0S A;  5H9K A;  2Q4N A;  3BS2 A;  4GKC A;  1YP7 A;  5F7G A;  3CMP A;  2WWP A;  4GNY A;  3S5X A;  5K67 A;  3APU A;  2L9C A;  1MDC A;  1LCV A;  1WUB A;  1Y0G A;  2Y3F A;  2RTI B;  4KT5 A;  1H91 A;  4YGG A;  2Q2M A;  4I3B A;  3D9W A;  4HWM A;  3WJC A;  3BLG A;  1LIB A;  3O2Y A;  1YWB A;  3BU9 A;  4OMX A;  2F73 A;  2RTJ A;  5FAZ A;  2BSZ A;  1QAB E;  1LPJ A;  1D2U A;  2MJI A;  2WSJ A;  4EEJ A;  4L3R A;  1TOU A;  4IBA A;  3TF6 A;  1CBQ A;  2WR6 A;  5FEN A;  3ZWE A;  1VWH B;  1VWD B;  4NYR A;  1Y9L A;  4U8U O;  1LCZ A;  4DQ3 A;  3EM0 A;  4O49 A;  4Z2P A;  5L8N A;  3SLO A;  3VHH A;  2O62 A;  3UAQ A;  4YDA A;  1QQS A;  1YWD A;  4CPH A;  5HCE C;  1X8Q A;  4CPH B;  1NC9 A;  1A18 A;  3FR4 A;  3WJF A;  5L3Y A;  2FLJ A;  4GUZ A;  2RTC B;  1EIO A;  4ORY A;  1KGL A;  3KFF A;  4U8U M;  2XST A;  4GGR A;  3KFG A;  5CE4 A;  1ADL A;  5D8J A;  2FGS A;  4YBP A;  2ZAI A;  3EC5 A;  3T1D A;  2N93 A;  2G7B A;  2IZJ A;  1KT3 A;  2JU3 A;  4YCH A;  2CBS A;  1VWM B;  2LBV A;  4KII A;  5FQ8 E;  3FEL A;  1JQP A;  3APX A;  4LKT A;  2RTQ B;  4XMC A;  5B2A O;  3VG5 A;  4ZHD A;  3NR3 A;  1K24 A;  5FQ7 E;  2Y3E A;  1VWC B;  1BBP A;  3FLL A;  2JMB A;  1X8U A;  4O4S A;  3UEX A;  2PY1 A;  1T68 X;  2RTH B;  3FIQ A;  4Y5D A;  1G5W A;  5AEO A;  3K3L A;  3KZA A;  4YMY A;  1OEK A;  3RY2 A;  1GKA A;  1GKA B;  2RCT A;  1EAL A;  1KL4 A;  2GH7 A;  4NP1 A;  3BSZ E;  3VG4 A;  1IFC A;  4QZT A;  3CQN A;  2RTO B;  3PQS A;  2OVA A;  1UYN X;  3VE1 A;  4GNW A;  4ZFX A;  3D95 A;  3UEU A;  4TKB A;  3PPT A;  2FRS A;  3KFI A;  2FT9 A;  4BOE A;  2MF6 A;  3F6Z B;  1HMT A; 
#chains in the Genus database with same CATH homology
 4OS8 A;  5AJB A;  3SOT A;  3N91 A;  4NLJ A;  1LNM A;  2G79 A;  3HOE A;  2AMM X;  3WJG A;  3DTQ A;  4MVL A;  1JBH A;  1IIU A;  3C77 X;  3U9P C;  4ZHF A;  3O22 A;  4RUN A;  3NX2 A;  3RWX A;  1KT4 A;  4HFO A;  4ML7 B;  1X8O A;  2A0A A;  1GT5 A;  5AJC A;  3STN A;  5EZ2 A;  3WVM A;  1BLR A;  4ZH6 A;  1SXX A;  1ML7 A;  2X8F A;  4U9C A;  4AZR A;  3DSZ A;  1LKE A;  4NNT A;  3MX7 A;  3BX7 A;  2K62 A;  1HQP A;  3AKN A;  4IAW A;  4A60 A;  4I3D A;  2HLV A;  3PEC A;  5IO5 A;  2L67 A;  3P6H A;  2R74 A;  4WBK A;  1L6M A;  3FA9 A;  3P6C A;  4OS0 A;  1IFB A;  4LKP A;  1GXA A;  1JV4 A;  4ZHH A;  2GJ5 A;  3H3I A;  1X71 A;  1YIV A;  4I9R A;  2AL0 X;  4ORS A;  5EEE A;  4K19 A;  1PBO A;  5AQ6 A;  4YKO A;  1ZNK A;  1AQB A;  4GU8 A;  1BSO A;  5LJB A;  2QO4 A;  3VG6 A;  4ZGU A;  5LJC A;  3QKG A;  4AW8 A;  1B8E A;  3PED A;  3B2K A;  3BX8 A;  5BVQ A;  2WEX A;  1LIE A;  5LJD A;  5HZ6 A;  1SY2 A;  4O4O A;  5HZ5 A;  2RD7 C;  5HA1 A;  2BLG A;  1IKJ A;  3EYC A;  2JOZ A;  4ARH A;  1BEB A;  4ALB A;  5L8I A;  3CWK A;  1BSY A;  1T0V A;  2ACP X;  3NQ9 A;  3WOV A;  2DM5 A;  2AT6 X;  5LKF A;  2CBR A;  3F8A A;  2KTS A;  3S26 A;  1EW3 A;  2NND A;  4XMG A;  4O3Z A;  5HWZ A;  1CBR A;  1DZP A;  4A1Y A;  4IAB A;  4FBR A;  2FS6 A;  4ZCB A;  4MVK A;  4PJ2 A;  1I06 A;  1Z24 A;  3ZW0 A;  1A3Y A;  3ZW0 B;  1GGL A;  1FEN A;  2CZU A;  2OFM X;  1ZRY A;  1VYG A;  1BJ7 A;  5BVS A;  2A2G A;  2QMI A;  2IFB A;  1N0S A;  5L8O A;  2ACO A;  5JR8 A;  2LKK A;  1MVG A;  4GH7 A;  4RUU A;  4GE1 A;  4M6S A;  3SAO A;  2A2U A;  5EDB A;  2X46 A;  3RZY A;  1MUP A;  5D4A A;  4JGL A;  2Q2P A;  2ZAG A;  1ERX A;  1KZX A;  3KFH A;  3NAD A;  2ASN X;  5HZ9 A;  3I17 A;  1JZU A;  1IW2 A;  2MM3 A;  3D4R A;  1GM6 A;  2NNQ A;  3ELZ A;  3FA7 A;  3V8U A;  5BVT A;  1GT4 A;  2AT5 X;  2QO6 A;  1EII A;  3ELX A;  1ICM A;  3VG2 A;  1P6P A;  5HTE A;  5B27 A;  4O3X B;  2AH7 X;  2RCQ A;  3P24 A;  1T8V A;  4IAX A;  5D8J A;  1S7D A;  3CBC A;  1D3S A;  1I05 A;  2X8S A;  4AZN A;  1U18 A;  3BY0 A;  1JYD A;  3FMZ A;  1NP4 A;  4GRJ A;  4N7C A;  3NBX X;  4GK9 A;  4HPC A;  3ZZV A;  5LJH A;  2L68 A;  3NX1 A;  3D97 A;  4KH8 A;  4HPA A;  2LFO A;  2P8G A;  4NYQ A;  3STM X;  3HWD A;  2RQ0 A;  4KCA A;  4MVI A;  1O1U A;  2POA A;  3RSW A;  3VE2 A;  1ZNE A;  1HMS A;  1KXO A;  4YBU A;  3S60 A;  4NNS A;  1CRB A;  3WJB A;  4KC8 A;  1RBP A;  3P6G A;  4Y0P A;  2BS6 A;  5HBS A;  2AT3 X;  3B2J A;  4D6A A;  1O1V A;  4ES7 A;  3ZUO A;  2A13 A;  2OFR X;  4D6B A;  3VPJ E;  4XMF A;  2FTB A;  1DC9 A;  1I04 A;  3P02 A;  3JSQ A;  1IKE A;  1ZNG A;  3FR2 A;  4EQA C;  4LZV A;  4CK4 A;  1HN2 A;  4GDZ A;  3B2I A;  3BU1 A;  2Q39 A;  1OBP A;  1FEL A;  4QZU A;  4O3Y A;  4YGZ A;  4QGW A;  1GT3 A;  3FR5 A;  4QYP A;  1G74 A;  2LA7 A;  5DG4 A;  3UEW A;  1E00 A;  1SY3 A;  5HCC C;  2AT0 X;  2MO5 A;  4INN A;  3WBG A;  5D47 A;  1O8V A;  2R56 A;  2HZR A;  3APV A;  3B2L A;  3PQU A;  5HZQ A;  5KIC A;  1E06 A;  2CM9 A;  1U0X A;  1KT7 A;  1OBQ A;  2HYS A;  3PH5 A;  4EFG A;  3ZI8 A;  2E4J A;  2GTL O;  4BVM A;  5F1E A;  5F6B A;  1OPA A;  3OJY C;  3KQ0 A;  2ANS A;  3ZW1 A;  1SXY A;  1X8N A;  3ZW1 B;  1B56 A;  1FE3 A;  2LB6 A;  2GTF X;  3NPO A;  2HNX A;  3GAQ A;  4QYN A;  1BWY A;  4LQZ A;  1E5P A;  2JN3 A;  2OVE A;  1S44 A;  2MHD A;  5KID A;  4TLJ A;  4BQU A;  4IB7 A;  3LV4 A;  1BRP A;  4TKH A;  4UU3 A;  3U0D A;  2WQA E;  1TOW A;  2RN4 A;  3GE2 A;  4O3W A;  2YG2 A;  1HBP A;  3CQR A;  4I9S A;  4Y0R A;  3PP6 A;  5EDC A;  1MX7 A;  5K06 A;  2KW1 A;  1VYF A;  1ACD A;  3BRN A;  2FR3 A;  3HWE A;  4ZR2 A;  2GTL N;  2OVS A;  4QQ1 A;  2Z4H A;  1U17 A;  4YKM A;  5HTD A;  3ZQ3 A;  5EED A;  4IB6 A;  3S5V A;  1ICN A;  5LKE A;  2BHV A;  4L1N A;  3HOL A;  4MIR A;  3OBL A;  4QAE A;  2GC9 A;  4YH0 A;  4ZHG A;  3TZS A;  1DF3 A;  1QY2 A;  2QM9 A;  1PM1 X;  5KHP A;  2FS7 A;  4PSQ A;  1B0O A;  3PH6 A;  4U3Q A;  4TQ2 A;  2Q9S A;  3I0A A;  1EXS A;  4A8Z A;  3G7X A;  5IO7 A;  3RKG A;  3VG3 A;  4YCE A;  3HK1 A;  1PEE A;  2KTD A;  1QG5 A;  2FWV A;  3EBW A;  4KC7 A;  2JU7 A;  1AB0 A;  4YFP A;  2OZQ A;  1G7N A;  1DZJ A;  1SMP I;  1X89 A;  3JS1 A;  3ZUI A;  4AZQ A;  2KT4 B;  3ZW2 A;  1QY0 A;  2QO5 A;  1PMP A;  2G78 A;  4IB9 A;  2XKL A;  5H8T A;  1HBQ A;  5EPQ A;  1Y9T A;  3JQO A;  5DPQ A;  1CJ5 A;  4FBO A;  3FA6 A;  2F09 A;  1YUP A;  5HAE A;  4R0B A;  5D45 A;  4FGI B;  4EDE A;  3HWG A;  3CBS A;  1KZW A;  3NQK A;  2X8T A;  3HTY A;  1B4M A;  2AKQ A;  2NNE A;  1XCA A;  1LIF A;  4QNI A;  1A57 A;  1SXW A;  1NGL A;  2BS5 A;  4CSB A;  1NP1 A;  1SA8 A;  1QWD A;  3B2H A;  1GX8 A;  1TXL A;  1QY1 A;  2W2A A;  4M7M A;  4ORU A;  2K23 A;  4TJZ A;  1ERB A;  1BM5 A;  3C78 X;  3FYF A;  1ZNH A;  3HWF A;  1TVQ A;  4O4X A;  4ZH9 A;  1A2D A;  5FFH A;  4HPB A;  4ORW A;  4FBV A;  5C0N A;  2BT9 A;  4FQB B;  4MVE A;  3LHN A;  1ALB A;  1MX8 A;  4ODD A;  4UU2 A;  3L4R A;  3D96 A;  3IFB A;  3WJE A;  5LJG A;  5F6Z A;  1SXU A;  3P6F A;  3VG7 A;  1CBI A;  4I95 A;  4MIS A;  5H9N A;  1EPB A;  2YMS A;  5HZ8 A;  2L5P A;  3FA8 A;  1EPA A;  1S2P A;  1X8P A;  2Z4I A;  2JW1 A;  4GET A;  1JYJ A;  1RLB E;  4Y0Q A;  4A1H A;  5LJE A;  3CR6 A;  2WUT A;  1KT6 A;  4GZV A;  4XMH A;  1VPR A;  1OEJ A;  1ZND A;  1URE A;  1JJJ A;  4QGV A;  4YFQ A;  4N7D A;  3TGB A;  4QRL A;  5H9L A;  2RA6 A;  1LIC A;  4ORX A;  3OE3 A;  3FW4 A;  2WEW A;  3F9D A;  4ON1 A;  4I3C A;  4AYH A;  2HZQ A;  2QOS C;  4DQ4 A;  1LF7 A;  4U8U N;  1BRQ A;  1XKI A;  2X45 A;  2OVD A;  1OEE A;  1LFO A;  1DZM A;  3C76 X;  4HPD A;  1AVG I;  4WFU A;  4IMN A;  3P6E A;  4O4U A;  3OD9 A;  4OS3 A;  1OBU A;  2GTL M;  4ZGF A;  2W2B A;  1FTP A;  3IA8 A;  4OMW A;  4ORR A;  2EU7 X;  3U03 A;  4ID2 A;  4NW4 A;  4ZJ0 A;  1G85 A;  2AT8 X;  2R73 A;  1KOI A;  4COT A;  3FEP A;  2M4L A;  5CYB A;  3VU1 A;  3WJD A;  4AZP A;  1OPB A;  5HA0 A;  3WXQ A;  5BYP A;  3E3C A;  2WQ9 A;  3FEK A;  4YFR A;  1GX9 A;  1JJX A;  1E02 A;  1GT1 A;  1TW4 A;  4I6S A;  3MBT A;  1QFT A;  2CM4 A;  5HCD C;  2KD2 A;  4IMO A;  5D48 A;  4XMD A;  2CZT A;  3RBY A;  3O19 A;  1FEM A;  1DFV A;  1QFV A;  3BDR A;  3TGA A;  3P6D A;  2W2F A;  2A3F X;  3STK A;  1KQX A;  3EBK A;  5F58 A;  3FEN A;  3UEV A;  4IB8 A;  1R0U A;  4EXZ A;  1EI5 A;  1DV9 A;  4WFV A;  1BSQ A;  1LID A;  3EMM A;  3FW5 A;  1FDQ A;  4XME A;  4AZM A;  4NLI A;  1EUO A;  4TNN A;  4ZHC A;  1KT5 A;  1AEL A;  5FQ6 E;  1EQD A;  1SY0 A;  1YWC A;  1JIW I;  2ALL X;  2NP1 A;  3AKM A;  4YDB A;  4O9S A;  5IO6 A;  2HMB A;  3APW A;  3MVF A;  3Q6L A;  3NQ3 A;  1UZ2 X;  1YP6 A;  1KQW A;  4TKJ A;  4LZU A;  4ALO A;  1CBS A;  4QGX A;  5B29 A;  4AZO A;  5LJK A;  2MWH A;  1I4U A;  3NP1 A;  5H9A A;  4CV7 A;  1ZNL A;  1YWA A;  2LBA A;  1HMR A;  1DZK A;  4YGH A;  1SY1 A;  4WHI A;  2FR2 A;  3TGC A;  2JU8 A;  4Y0S A;  5H9K A;  2Q4N A;  3BS2 A;  4GKC A;  1YP7 A;  5F7G A;  3CMP A;  2WWP A;  4GNY A;  3S5X A;  3APU A;  2L9C A;  1MDC A;  4KT5 A;  1H91 A;  4YGG A;  2Q2M A;  4I3B A;  4HWM A;  3WJC A;  3BLG A;  1LIB A;  3O2Y A;  1YWB A;  3BU9 A;  4OMX A;  2F73 A;  5FAZ A;  1QAB E;  1LPJ A;  1D2U A;  2MJI A;  2WSJ A;  4EEJ A;  4L3R A;  1TOU A;  4IBA A;  3TF6 A;  1CBQ A;  2WR6 A;  5FEN A;  3ZWE A;  4NYR A;  1Y9L A;  4U8U O;  4DQ3 A;  5L8N A;  3EM0 A;  4O49 A;  2O62 A;  3UAQ A;  4YDA A;  1QQS A;  1YWD A;  5HCE C;  1X8Q A;  1A18 A;  3FR4 A;  3WJF A;  2FLJ A;  1EIO A;  4ORY A;  1KGL A;  3KFF A;  4U8U M;  2XST A;  3KFG A;  5CE4 A;  1ADL A;  4YBP A;  2ZAI A;  3T1D A;  2N93 A;  2G7B A;  1KT3 A;  2JU3 A;  4YCH A;  2CBS A;  2LBV A;  4KII A;  5FQ8 E;  3FEL A;  3APX A;  4LKT A;  4XMC A;  3VG5 A;  4ZHD A;  3NR3 A;  5FQ7 E;  1BBP A;  3FLL A;  2JMB A;  1X8U A;  4O4S A;  3UEX A;  2PY1 A;  1T68 X;  3FIQ A;  1G5W A;  5AEO A;  3K3L A;  3KZA A;  4YMY A;  1OEK A;  1GKA A;  1GKA B;  2RCT A;  1EAL A;  4NP1 A;  3BSZ E;  3VG4 A;  1IFC A;  4QZT A;  3CQN A;  3PQS A;  2OVA A;  3VE1 A;  4GNW A;  4ZFX A;  3D95 A;  3UEU A;  4TKB A;  3PPT A;  2FRS A;  3KFI A;  2FT9 A;  4BOE A;  3F6Z B;  1HMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...