1GT5A

Complexe of bovine odorant binding protein with benzophenone
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
159
Chain Sequence
b'AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENENHPHPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ODORANT-BINDING PROTEIN
publication title Crystal Structures of Bovine Odorant-Binding Protein in Complex with Odorant Molecules.
pubmed doi rcsb
molecule tags Lipocalin
total genus 36
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1gt5A00
4WFVA 1JV4A 1FE3A 3AKMA 3FA7A 5H9LA 1SXYA 2A2GA 2GJ5A 5L8OA 1XCAA 1I06A 4ARHA 4OS3A 2W2BA 1X8QA 3C76X 4QYPA 4A1HA 4TNNA 2GTFX 2E4JA 5HA0A 4N7CA 1SY3A 2FS7A 2ASNX 3BY0A 1EIIA 3C77X 2NP1A 1S44A 1LPJA 1NGLA 1PBOA 1TOWA 3BS2A 1LIDA 4IB6A 1U18A 5H9KA 5B27A 1I04A 4EFGA 4TLJA 3FA9A 2K62A 1GT4A 3TGAA 1YUPA 4HPCA 4OMXA 3TZSA 1CBQA 1X8OA 3KQ0A 3NQ9A 1FENA 4I9SA 1DZJA 1GXAA 4XMHA 2L5PA 5HTEA 1DFVA 3B2IA 1IW2A 1AVGI 1DZMA 4QGXA 4CK4A 4ES7A 3FEKA 1BJ7A 1QABE 1CRBA 1EW3A 1KQXA 5HZ9A 1AB0A 4M6SA 1KGLA 2POAA 3F8AA 4HPDA 4TKJA 2JU8A 1HMSA 5EDBA 4NP1A 5D48A 1P6PA 2HYSA 3KFIA 5F7GA 4XMEA 1T8VA 2Q2PA 4Y0SA 5DPQA 3BLGA 1EUOA 2LFOA 3EBKA 4EDEA 3DSZA 2CBRA 1EXSA 2HZQA 5KIDA 3DTQA 4ALBA 3FR2A 5IO5A 2QO4A 3PPTA 2JOZA 3BDRA 3NX1A 3ZUOA 3FR4A 4AZQA 3MVFA 2ANSA 4GNWA 1FEMA 3JSQA 1TVQA 1BLRA 2N93A 3FLLA 3VG5A 1N0SA 5BVQA 4UU2A 3D96A 1VYGA 3VG4A 1O1VA 4MVKA 4ZHCA 2AKQA 2JU3A 5HTDA 4DQ3A 1GX9A 4RUUA 1TW4A 1QY1A 3STMX 4ZH6A 5LJKA 1DC9A 2A0AA 1KT7A 4MVIA 3S26A 1PEEA 5LKEA 3I0AA 3WJCA 4EXZA 3P6FA 1QFVA 4YMYA 2RA6A 3UEXA 4M7MA 1VPRA 4BOEA 4YH0A 3U9PC 1B56A 1U17A 2R74A 3UEUA 3WJDA 5FFHA 5LJHA 5L8IA 2QO5A 4YDAA 5HCEC 1E06A 3HWDA 1JYDA 4NYRA 4D6BA 1NP4A 1VYFA 1X89A 2FTBA 3FA6A 2FLJA 4IAXA 4ODDA 1E00A 4IMNA 3B2LA 2R73A 5L8NA 4EEJA 4TKBA 2OVDA 5BVSA 1LNMA 2FRSA 1SA8A 1BSYA 3FR5A 1SXXA 1BWYA 4YCHA 4QGWA 5D47A 1LIBA 1AQBA 3OJYC 4ORYA 3BRNA 1MVGA 1UZ2X 4PSQA 4ZFXA 4GRJA 3EM0A 2AT6X 4ORUA 4AZMA 4ZHGA 2QO6A 3TF6A 3NADA 1AELA 1ZNEA 3CBCA 1G5WA 4ZHDA 1DZKA 5FAZA 4ZCBA 2RD7C 2AT0X 1FDQA 2ACPX 2FWVA 3PP6A 1O1UA 3FMZA 4AYHA 1LICA 2KT4B 2GC9A 2WR6A 5HZQA 1RBPA 3UEWA 4RUNA 1JYJA 1JJJA 1YP7A 3NP1A 4XMFA 1G85A 1RLBE 1OBPA 1KQWA 1S7DA 1EPBA 3HWGA 4TKHA 1EQDA 3PH6A 4ORRA 1HMRA 1IKEA 3NX2A 1BSQA 4QZUA 1YIVA 1CBIA 1GT1A 5D8JA 3WJEA 4XMDA 1TOUA 3F9DA 2JN3A 4IB9A 2EU7X 2XKLA 5C0NA 3U0DA 1BSOA 1A18A 1ERBA 1ICNA 4UU3A 2OZQA 1IFBA 4QAEA 2ALLX 3APXA 1BRPA 2KTDA 4OS8A 4NYQA 2CBSA 1BBPA 1X8PA 5IO6A 4KIIA 1KT3A 5IO7A 4MVLA 3EYCA 3ZQ3A 4OS0A 5CE4A 4ZR2A 2WQAE 4O9SA 2AH7X 4QYNA 3NR3A 5F6ZA 5HA1A 2XSTA 1X8NA 2F73A 4TQ2A 2R56A 1DF3A 3L4RA 1ERXA 1JZUA 1MUPA 1QY0A 1EALA 4ZJ0A 4I3DA 4ZH9A 2YG2A 2WQ9A 1DV9A 2AT5X 1QQSA 4XMGA 1T0VA 3FIQA 2WUTA 3VG7A 1QY2A 2K23A 5EDCA 1S2PA 4GNYA 1EPAA 1IKJA 4QGVA 3BSZE 1R0UA 4AZOA 1SY0A 4ORWA 4Y0QA 4A60A 2QOSC 1HBQA 2DM5A 1YWBA 5FENA 5K06A 1YP6A 3PECA 3NQ3A 3QKGA 1PM1X 2OFMX 4Y0PA 1OEJA 2X45A 5EEEA 1OBUA 2L9CA 2X46A 1KT4A 4TJZA 1QFTA 1GKAA 1X71A 1OPAA 1MDCA 3KFGA 3KFHA 2NNEA 1OBQA 3STKA 3VG6A 2P8GA 3ELXA 3WVMA 2AT3X 3WXQA 4HFOA 4YBPA 4QZTA 3HK1A 3FELA 3TGBA 2A13A 3WBGA 5HCDC 2G7BA 3MBTA 4A8ZA 5D4AA 2LBAA 2PY1A 5HZ8A 1LIEA 3IA8A 1KZWA 1PMPA 5KHPA 1KXOA 1OPBA 1MX7A 2WEXA 3FEPA 3RZYA 2Q39A 5BVTA 4YDBA 3FW5A 5HZ6A 5EPQA 1B4MA 1QG5A 2L68A 1KT5A 1LFOA 5LKFA 4BQUA 2O62A 4YKMA 4LZVA 2HZRA 1HN2A 1MX8A 2AT8X 3JS1A 2CZUA 4YGHA 1G7NA 1SXWA 3GAQA 2HNXA 2NNDA 1BEBA 3WJGA 3P6EA 1L6MA 4LZUA 2CZTA 4A1YA 2W2AA 4YFRA 2ACOA 2MJIA 3BX7A 1LKEA 3HWFA 4HPBA 1LIFA 2AL0X 3G7XA 1IFCA 1H91A 5D45A 1YWCA 4YGGA 1ZRYA 2HLVA 3HWEA 1YWAA 4GKCA 3B2KA 4LKPA 3APWA 3O2YA 3O22A 1A57A 1ZNHA 1ZNLA 1YWDA 3FENA 1OEEA 1I05A 1SY2A 1JBHA 3T1DA 2LKKA 3APUA 4IBAA 3PH5A 3BX8A 4WBKA 4NLIA 4I9RA 3D95A 4DQ4A 3P6GA 1GGLA 2G78A 2G79A 3BU1A 3NPOA 3IFBA 3U03A 3CBSA 4K19A 1GM6A 2OVEA 1ALBA 2OVAA 3K3LA 2IFBA 1NP1A 2OFRX 3ZUIA 5JR8A 2RQ0A 3STNA 1HMTA 3C78X 1U0XA 3PEDA 1LF7A 3CWKA 5EZ2A 4AZPA 1OEKA 3Q6LA 4D6AA 1GKAB 1ML7A 3EBWA 1ZNKA 4GETA 2WSJA 2WEWA 1IIUA 5HZ5A 2RCQA 4YFPA 4BVMA 3KZAA 2A2UA 1A2DA 4YGZA 2L67A 1B0OA 1FTPA 3EMMA 4ORSA 3CR6A 3RSWA 1T68X 2MO5A 4AZRA 4NLJA 3WJBA 5B29A 4AZNA 4ORXA 4ALOA 2CM4A 2FT9A 5LJCA 4YBUA 3CQRA 2FS6A 3FA8A 4N7DA 3BU9A 1UREA 4NNSA 1BM5A 2LBVA 1KZXA 5H9AA 1GT5A 5KICA 5HWZA 3WJFA 4IB7A 4AW8A 3AKNA 2AMMX 4YCEA 4I3BA 1ZNDA 1SXUA 3VG2A 2NNQA 1B8EA 3D97A 1ACDA 5LJBA 1KOIA 2LB6A 1FELA 1D3SA 3UEVA 1SY1A 1DZPA 4R0BA 5H9NA 1E02A 5HCCC 3FW4A 1G74A 1Z24A 4HPAA 4I3CA 2Q2MA 1GT3A 4WFUA 2RCTA 1X8UA 4YKOA 5H8TA 1TXLA 5HBSA 5F6BA 3P6HA 3P6CA 4IAWA 1CJ5A 1HQPA 1E5PA 1GX8A 4XMCA 3SAOA 1BRQA 2A3FX 3B2JA 1ICMA 4OMWA 3ELZA 2HMBA 1XKIA 2BLGA 5F1EA 5LJDA 4YFQA 1ADLA 3O19A 4NNTA 2WWPA 2MM3A 4IB8A 4Y0RA 3VG3A 3CQNA 5DG4A 1CBRA 4ZGUA 3B2HA 5F58A 2JU7A 3I17A 4LKTA 1I4UA 4ZHHA 1ZNGA 5LJGA 3TGCA 1JJXA 5AQ6A 1A3YA 1D2UA 2QM9A 2W2FA 4GH7A 2Q9SA 3KFFA 4GE1A 1HBPA 1EIOA 1CBSA 5LJEA 3CMPA 3P6DA 1KT6A 5HAEA 3APVA 2Q4NA 4IMOA 4ZHFA 2CM9A 2FR2A 2FR3A 1QWDA 1O8VA 5EEDA
chains in the Genus database with same CATH superfamily
4WFVA 4BX7A 1JV4A 1FE3A 3H3IA 2C1SA 3AKMA 3FA7A 3HPEA 5H9LA 1SXYA 2A2GA 2GJ5A 2YMSA 1SWOA 3PQUA 1XCAA 1I06A 5L8OA 1SWRA 4ARHA 4OS3A 3VE1A 2W2BA 4GJVA 2VDFA 1W5RA 5F2BA 1N9MA 1X8QA 3C76X 4QYPA 4A1HA 4TNNA 2GTFX 2E4JA 5HA0A 4L3RA 4N7CA 1SY3A 3ZW1B 2FS7A 1WUBA 2ASNX 3BY0A 4Y5DA 1EIIA 3C77X 1K3BA 1S44A 2IZAA 2NP1A 1LPJA 1NGLA 1PBOA 1TOWA 3BS2A 1LIDA 4IB6A 1U18A 4O4OA 4PJ2A 1I04A 2ZAIA 5H9KA 4TLJA 3FA9A 3NQKA 4EFGA 2K62A 1GT4A 3TGAA 1YUPA 3F6ZB 1VWMB 4HPCA 1N4JA 4OMXA 3TZSA 1CBQA 1X8OA 3KQ0A 3HOLA 2OY5O 3NQ9A 1FENA 2GH7A 4I9SA 1DZJA 1VWKB 1GXAA 4XMHA 2L5PA 3CKFA 5HTEA 1DFVA 1VWLB 1RXKA 2OF9A 3B2IA 1IW2A 3EW1A 1AVGI 1DZMA 4QGXA 4CK4A 3FYFA 4ES7A 2C1QA 1BJ7A 1QABE 3FEKA 1CRBA 1EW3A 1KQXA 1Y0GA 2RTMA 5HZ9A 1AB0A 4M6SA 4FGIB 1SWKA 1KGLA 2POAA 3F8AA 3D4RA 2X8FA 4HPDA 4TKJA 1E2TA 3SLOA 2X55A 4CSBA 2A5BA 1HMSA 2JU8A 4NP1A 5D48A 5EDBA 1P6PA 2HYSA 3KFIA 5F7GA 4XMEA 4OKAA 2Z4IA 1T8VA 2Q2PA 4Y0SA 5DPQA 3BLGA 3ZW2A 2IZBA 1EUOA 2LFOA 4MISA 3EBKA 4EDEA 3DSZA 2CBRA 1EXSA 2HZQA 3RBYA 3DTQA 5BYPA 5KIDA 3T6LA 3PQSA 4IABA 4ALBA 3FR2A 3NBXX 5IO5A 2QO4A 3PPTA 3RE5A 2JOZA 3BDRA 3NX1A 3ZUOA 3FR4A 4AZQA 3RDXA 3MVFA 2ANSA 4GNWA 1FEMA 1UYNX 3JSQA 3ZZVA 2X56A 1TVQA 1BLRA 2UYWA 2N93A 4U8UO 4FBRA 3FLLA 3VG5A 1N0SA 5AEOA 3VHMA 5BVQA 3RDSA 2RTJA 4CPIA 4EQAC 4UU2A 3D96A 1VYGA 3VG4A 1N9YA 1O1VA 4MVKA 4ZHCA 4CDEA 2AKQA 2JU3A 5HTDA 4DQ3A 1VWIB 3SOTA 1GX9A 4RUUA 1TW4A 1QY1A 3STMX 1RSUB 2X4MA 4ZH6A 5LJKA 1DC9A 2A0AA 1KT7A 4MVIA 4L1NA 3S26A 1SWJA 5B2AO 1PEEA 5LKEA 3I0AA 3WJCA 2QOMA 4EXZA 3P6FA 1QFVA 4YMYA 4NV8A 3WYQA 2RA6A 3UEXA 4M7MA 1VPRA 1STRB 5B3MO 5K68A 2F01A 4BOEA 1VWAB 4YH0A 3U9PC 1B56A 1U17A 2R74A 3UEUA 3WJDA 5FFHA 2JW1A 5LJHA 5L8IA 2QO5A 4YDAA 5HCEC 1E06A 3HWDA 1JYDA 4BX7B 4NYRA 4D6BA 1NP4A 1VYFA 1X89A 2FTBA 2C4IA 3FA6A 2FLJA 3OE3A 4IAXA 2G8CO 4ODDA 1E00A 4IMNA 3B2LA 2R73A 5L8NA 4EEJA 4TKBA 3SLJA 2RTNB 1JZUA 2OVDA 4KCAA 1SRGA 5BVSA 1LNMA 2FRSA 1VWNB 1SA8A 1BSYA 3FR5A 1MOYA 2IZEB 2UZ2A 1SXXA 2FKGA 1BWYA 4YCHA 4QGWA 2BS6A 3KVNA 2Z4HA 5D47A 1LIBA 2I5ZO 1AQBA 2GTLO 3OJYC 4ORYA 2RTIB 1MVGA 1UZ2X 3BRNA 4PSQA 1STSB 3RY2A 4GRJA 3EM0A 2RTRB 4MEEA 2AT6X 4ORUA 4AZMA 4ZHGA 2QO6A 4INNA 1KL5A 2IZCB 3TF6A 1VWDB 3NADA 4O4XA 5AJCA 3Q34A 2OL7A 1AELA 1ZNEA 3CBCA 4ZFXA 1G5WA 1KFFA 4ZHDA 1DZKA 5FAZA 4ZCBA 2RD7C 3SLTA 2AT0X 4CDCA 1FDQA 2ACPX 2FWVA 1VWPB 3PP6A 1O1UA 3FMZA 4QRLA 4AYHA 1LICA 2KT4B 2GC9A 2WR6A 4GD9A 1RBPA 5HZQA 2AF5A 3UEWA 4RUNA 1AVDA 1JYJA 4NV7A 1VWHB 4B55A 1JJJA 1YP7A 4ID2A 3NP1A 2BC3A 4XMFA 4QQ1A 4GU8A 1G85A 1RLBE 2BT9A 1OBPA 3UAQA 1KQWA 1S7DA 1SWQA 2GTLM 1GX3A 1EPBA 5CYBA 3HWGA 4Z28A 2DJFA 4TKHA 1EQDA 3PH6A 4I95A 4ORRA 1HMRA 1IKEA 3NX2A 1BSQA 4QZUA 3RDUA 1YIVA 1CBIA 2OF8A 5FQ7E 1VWRB 1GT1A 3VGWA 5D8JA 3WJEA 4XMDA 3LV4A 4CPFA 4Z2OA 2AVIA 2IZDB 1TOUA 3F9DA 2JN3A 4GDZA 4IB9A 2EU7X 2KTSA 4C5PA 1SRIA 2XKLA 3MM0A 3SZJA 5C0NA 3U0DA 1BSOA 2MWHA 3P02A 1A18A 1ERBA 1I78A 1ICNA 3V8UA 4BGFA 2JMBA 4UU3A 2G5LA 1N7YA 2OZQA 4O4SA 2OYBO 1IFBA 1VWOB 2ALLX 3APXA 1BRPA 4NW4A 1JMXA 4QAEA 3WZOA 5K67A 2QMIA 4GUZA 2BS5A 2KTDA 4OS8A 4NYQA 2CBSA 1VWGB 1BBPA 1X8PA 3EW2A 5IO6A 4KIIA 4I6SA 1KT3A 3RDQA 3SZIA 1Y9TA 5IO7A 4MVLA 5FQ8E 3EYCA 1NQNA 3ZQ3A 4OS0A 5CE4A 2OL6O 4ZR2A 1SMPI 2WQAE 3VPJE 4O9SA 2AH7X 4QYNA 3NR3A 5F6ZA 5HA1A 2XSTA 5HCCC 1X8NA 2F73A 2IZGB 2R56A 4HWMA 3L4RA 1ERXA 4TQ2A 4IRWA 1DF3A 1MUPA 1QY0A 1EALA 4ZJ0A 4I3DA 4ZH9A 3X00A 2YG2A 2WQ9A 2IZHB 4JNJA 4KH8A 2AT5X 1DV9A 2X34A 1QQSA 4XMGA 4JO6A 1T0VA 5L3YA 1NDJA 3FIQA 4MIRA 2MF6A 2PI3O 2WUTA 2A5CA 3VG7A 1QY2A 2K23A 5EDCA 2RN4A 1S2PA 4GNYA 2CAMA 1KL3A 1OSPO 3WOVA 3LHNA 1EPAA 1IKJA 4QGVA 3BSZE 4BX5B 1R0UA 4AZOA 1SY0A 4ORWA 1AVEA 3AEHA 4Y0QA 4A60A 2QOSC 1HBQA 4ON1A 2A8GA 2DM5A 1SWGA 3WZPA 1YWBA 1RAVA 3WZNA 1YP6A 3PECA 3NQ3A 3QKGA 5FENA 5K06A 1PM1X 2OFMX 2RTDB 3MX7A 4Y0PA 1VWQB 1OEJA 2X45A 3E3CA 5EEEA 4U8UM 1OBUA 2L9CA 2X46A 1KT4A 5JD2A 4TJZA 1QFTA 1GKAA 1X71A 2KD2A 3WYPA 4Z2VA 1OPAA 5IXGA 3RY1A 1MDCA 3KFGA 4GK9A 3KFHA 1NQMA 1OBQA 2NNEA 4ML7B 3STKA 4U9CA 3VG6A 2LA7A 1MM9A 2P8GA 3ELXA 3WVMA 2AT3X 3WXQA 4HFOA 5B5FA 4YBPA 2IZLB 4QZTA 3RWXA 1VWJB 3FELA 2OY1O 3HK1A 4GGTA 4BBOA 3TGBA 2A13A 1SWFA 2RTLA 4Z2PA 3WBGA 4BX5A 5HCDC 4GJSA 3ZW0A 2G7BA 3MBTA 3HTYA 5D4AA 4A8ZA 2RTGB 2LBAA 1PTSA 2PY1A 5HZ8A 2RTCB 4KC8A 1LIEA 1Y55X 3IA8A 1RXHA 2BHVA 4Y59A 1KZWA 2RTKA 1PMPA 5KHPA 1JIWI 1KXOA 1MX7A 1OPBA 1DF8A 1RXJA 1MK5A 2WEXA 3FEPA 3RZYA 2Q39A 5IRUA 4WHIA 4O4UA 4U46A 5BVTA 1SWDA 2X32A 3GE2A 1Y52X 4YDBA 3FW5A 5HZ6A 2RTFB 4JGLA 5EPQA 1B4MA 1QG5A 2L68A 1KT5A 1SRJA 1LFOA 5LKFA 3MG5A 4BQUA 4ZGFA 2O62A 4YKMA 4LZVA 3T6FA 2HZRA 1HN2A 1MX8A 1SWEA 2AT8X 2CZUA 3JS1A 4OELA 2VFBA 4YGHA 1G7NA 1SXWA 3T2WA 3GAQA 2HNXA 2NNDA 1BEBA 3RDMA 3WJGA 3P6EA 1L6MA 4LZUA 2CZTA 3WZQA 4A1YA 4DNEA 2W2AA 4YFRA 2ACOA 2MJIA 3BX7A 5CSEA 1LKEA 3HWFA 4HPBA 4Z27A 1LIFA 2AL0X 4U3QA 3G7XA 1IFCA 1VWCB 5AJBA 2BSZA 2RTHB 1H91A 1SWTA 2RTBB 5D45A 5B27A 1YWCA 4YGGA 2RTPB 1SWBA 1ZRYA 2HLVA 4O49A 3HWEA 1YWAA 5B5GA 3S5VA 4GKCA 4O3XB 2Y3EA 3B2KA 4LKPA 1HXLA 3APWA 1I9HA 3O2YA 3O22A 1ZNHA 1ZNLA 1YWDA 3FENA 1A57A 1OEEA 3HOEA 1I05A 1W6FA 2DJGA 2OFAA 1JJUA 1SY2A 1JMZA 2WPUA 1JBHA 3T1DA 2LKKA 3APUA 4IBAA 3OD9A 3PH5A 3BX8A 4BCSA 4WBKA 4NLIA 1SRFA 2FHLA 3N91A 1SWPA 3P24A 4I9RA 3D95A 4O3ZA 3P6GA 3RKGA 1GGLA 3VE2A 2G78A 4DQ4A 2G79A 2JGSA 3BU1A 3NPOA 3IFBA 2RTAA 4GDAA 3S60A 3U03A 4BX6B 3CBSA 4K19A 1GM6A 2OVEA 1ALBA 2OVSA 2OVAA 2FKJA 3K3LA 1HQQA 2IFBA 2VFCA 1NP1A 2OFRX 3VU1A 3ZUIA 5IRAA 2IZFB 5JR8A 2RQ0A 3STNA 1HY2A 1HMTA 1LELA 3C78X 1U0XA 3PEDA 1LF7A 3CWKA 5EZ2A 4AZPA 1OEKA 3PDFA 3Q6LA 4D6AA 1GKAB 1ML7A 2F09A 4FQBB 3EBWA 1ZNKA 4GETA 1FJ1E 2WSJA 2WEWA 3T2XA 1IIUA 5HZ5A 5B11O 2FHNX 2RCQA 4YFPA 1NBXA 3PK2A 4BVMA 3KZAA 1SLEB 2A2UA 1A2DA 4YGZA 2L67A 3ZW1A 5IRWA 4DCBA 4CDDA 1SWNA 2HKDA 1B0OA 1FTPA 3EMMA 4ORSA 3CR6A 1LDQA 3RSWA 1T68X 2MO5A 1VWBB 2RTEB 4GGZA 2OY7A 2IZIA 4AZRA 4CPEA 4NLJA 3WJBA 5B29A 1MEPA 4AZNA 4ORXA 4ALOA 2CM4A 2ZAGA 3FDCA 2FT9A 3VHIA 4EKVA 2OY8A 4YBUA 5LJCA 3CQRA 3ZW0B 2FS6A 3FA8A 4BX6A 3JQOA 4N7DA 2RTOB 4LQZA 3BU9A 1UREA 4NNSA 1BM5A 2IZKA 4QNIA 2Y32A 2LBVA 4CPHB 2QCBA 2RTQB 5B10O 1KZXA 1KL4A 5H9AA 4JHQA 1GT5A 5KICA 5HWZA 2KW1A 3RE6A 3WJFA 4IB7A 4AW8A 3AKNA 4Z6JA 2AMMX 4YCEA 3RDOA 1W4TA 2ZSCA 1K24A 4I3BA 2MHDA 1ZNDA 1SXUA 3VG2A 1WBIA 4U8UN 1SRHA 2NNQA 1B8EA 1NC9A 1Y53X 3D97A 3EC5A 4O3WA 1ACDA 1UYOX 5LJBA 1KOIA 2LB6A 1FELA 3S5XA 1HXZA 1D3SA 1LUQA 3UEVA 1SY1A 1DZPA 1STPA 4R0BA 1E02A 4KT5A 3FW4A 1G74A 1Z24A 4HPAA 5H9NA 4I3CA 2Q2MA 4CV7A 1GT3A 4WFUA 2RCTA 1X8UA 4YKOA 5H8TA 1TXLA 1SWUA 5HBSA 4O3YA 5F6BA 3P6HA 3P6CA 1IJ8A 4IAWA 1CJ5A 1HQPA 1PBYA 1E5PA 3QQ2A 1GX8A 4XMCA 2OL8O 2FGSA 1VYOA 2Y3FA 3CKGA 1BRQA 3SAOA 2A3FX 2OFBA 4BJ8A 4CPHA 3B2JA 1EI5A 2M4LA 1ICMA 4OMWA 1N43A 1SLGB 3AUMO 3ELZA 2HMBA 1XKIA 2BLGA 5F1EA 5FQ6E 4FBOA 5LJDA 1SWHA 1SREA 1VWFB 4YFQA 4COTA 1ADLA 3O19A 4NNTA 2WWPA 1LCZA 2I5VO 3D9WA 1SLFB 2MM3A 4KC7A 4GZVA 1LCVA 1JQPA 2IZJA 4IB8A 4Y0RA 3CQNA 5DG4A 3VG3A 1Y9LA 4YVBA 1CBRA 4ZGUA 3B2HA 4MVEA 2JU7A 5F58A 3I17A 3VHHA 4LKTA 1I4UA 4ZHHA 1ZNGA 5LJGA 3TGCA 1LDOA 1JJXA 5AQ6A 1A3YA 1D2UA 1LCWA 4OEMA 2QM9A 2W2FA 3LTWA 4GH7A 2Q9SA 1SWAA 2X8SA 1HBPA 3KFFA 4GE1A 1SWSA 1EIOA 4GGRA 3ZWEA 1SLDB 3FIDA 1CBSA 4I60A 5LJEA 3CMPA 3P6DA 1KT6A 5HAEA 2X8TA 3APVA 5CHKA 3SZHA 2Q4NA 4IMOA 3ZI8A 4ZHFA 2CM9A 1SWCA 1VWEB 2GTLN 3OBLA 2FR2A 4FBVA 2FR3A 4CDFA 1QWDA 1RSTB 1O8VA 1SWLA 5EEDA
chains in the Genus database with same CATH topology
4WFVA 1JV4A 1FE3A 3H3IA 3AKMA 3FA7A 5H9LA 1SXYA 2A2GA 2GJ5A 2YMSA 1O8VA 3PQUA 1XCAA 1I06A 5L8OA 4ARHA 4OS3A 3VE1A 2W2BA 1X8QA 3C76X 4QYPA 4A1HA 4TNNA 2GTFX 2E4JA 5HA0A 4L3RA 4N7CA 1SY3A 3ZW1B 2FS7A 2ASNX 3BY0A 1EIIA 3C77X 2NP1A 1S44A 1LPJA 1NGLA 1PBOA 1TOWA 3BS2A 1LIDA 4IB6A 1U18A 4O4OA 4PJ2A 1I04A 2ZAIA 5H9KA 4TLJA 3FA9A 3NQKA 4EFGA 2K62A 1GT4A 3TGAA 1YUPA 3F6ZB 4HPCA 4OMXA 3TZSA 1CBQA 1X8OA 3KQ0A 3HOLA 3NQ9A 1FENA 4I9SA 1DZJA 1GXAA 4XMHA 2L5PA 5HTEA 1DFVA 3B2IA 1IW2A 1AVGI 1DZMA 4QGXA 4CK4A 3FYFA 4ES7A 3FEKA 1BJ7A 1QABE 1CRBA 1EW3A 1KQXA 5HZ9A 1AB0A 4M6SA 4FGIB 1KGLA 2POAA 3F8AA 3D4RA 2X8FA 4HPDA 4TKJA 4CSBA 2JU8A 1HMSA 5EDBA 4NP1A 5D48A 1P6PA 2HYSA 3KFIA 5F7GA 4XMEA 2Z4IA 1T8VA 2Q2PA 4Y0SA 5DPQA 3BLGA 3ZW2A 1EUOA 2LFOA 4MISA 3EBKA 4EDEA 3DSZA 2CBRA 1EXSA 2HZQA 3RBYA 3DTQA 5BYPA 5KIDA 3PQSA 4IABA 4ALBA 3FR2A 3NBXX 5IO5A 2QO4A 3PPTA 2JOZA 3BDRA 3NX1A 3ZUOA 3FR4A 4AZQA 3MVFA 2ANSA 4GNWA 1FEMA 3JSQA 3ZZVA 1TVQA 1BLRA 2N93A 4U8UO 4FBRA 3FLLA 3VG5A 1N0SA 5AEOA 5BVQA 4EQAC 4UU2A 3D96A 1VYGA 3VG4A 1O1VA 4MVKA 4ZHCA 2AKQA 2JU3A 5HTDA 4DQ3A 3SOTA 1GX9A 4RUUA 1TW4A 1QY1A 3STMX 4ZH6A 5LJKA 1DC9A 2A0AA 1KT7A 4MVIA 4L1NA 3S26A 1PEEA 5LKEA 3I0AA 3WJCA 4EXZA 3P6FA 1QFVA 4YMYA 2RA6A 3UEXA 4M7MA 1VPRA 4BOEA 4YH0A 3U9PC 1B56A 1U17A 2R74A 3UEUA 3WJDA 5FFHA 2JW1A 5LJHA 5L8IA 2QO5A 4YDAA 5HCEC 1E06A 3HWDA 1JYDA 4NYRA 4D6BA 1NP4A 1VYFA 1X89A 2FTBA 3FA6A 2FLJA 3OE3A 4IAXA 4ODDA 1E00A 4IMNA 3B2LA 2R73A 5L8NA 4EEJA 4TKBA 2OVDA 4KCAA 5BVSA 1LNMA 2FRSA 1SA8A 1BSYA 3FR5A 1SXXA 1BWYA 4YCHA 4QGWA 2BS6A 2Z4HA 5D47A 1LIBA 1AQBA 2GTLO 3OJYC 4ORYA 3BRNA 1MVGA 1UZ2X 4PSQA 4ZFXA 4GRJA 3EM0A 2AT6X 4ORUA 4AZMA 4ZHGA 2QO6A 4INNA 3TF6A 3NADA 4O4XA 5AJCA 1AELA 1ZNEA 3CBCA 1G5WA 4ZHDA 1DZKA 5FAZA 4ZCBA 2RD7C 2AT0X 1FDQA 2ACPX 2FWVA 3PP6A 1O1UA 3FMZA 4QRLA 4AYHA 1LICA 2KT4B 2GC9A 2WR6A 5HZQA 1RBPA 3UEWA 4RUNA 1JYJA 1JJJA 1YP7A 4ID2A 3NP1A 4XMFA 4QQ1A 4GU8A 1G85A 1RLBE 2BT9A 1OBPA 3UAQA 1KQWA 1S7DA 2GTLM 1EPBA 5CYBA 3HWGA 4TKHA 1EQDA 3PH6A 4I95A 4ORRA 1HMRA 1IKEA 3NX2A 1BSQA 4QZUA 1YIVA 1CBIA 5FQ7E 1GT1A 5D8JA 3WJEA 4XMDA 3LV4A 1TOUA 3F9DA 2JN3A 4GDZA 4IB9A 2EU7X 2KTSA 2XKLA 5C0NA 3U0DA 1BSOA 2MWHA 3P02A 1A18A 1ERBA 3V8UA 1ICNA 2JMBA 4UU3A 2OZQA 4O4SA 1IFBA 4QAEA 2ALLX 3APXA 1BRPA 4NW4A 2QMIA 2BS5A 2KTDA 4OS8A 4NYQA 2CBSA 1BBPA 1X8PA 5IO6A 4KIIA 4I6SA 1KT3A 1Y9TA 5IO7A 4MVLA 5FQ8E 3EYCA 3ZQ3A 4OS0A 5CE4A 4ZR2A 1SMPI 2WQAE 3VPJE 4O9SA 2AH7X 4QYNA 3NR3A 5F6ZA 5HA1A 2XSTA 1X8NA 2F73A 4HWMA 2R56A 4TQ2A 3L4RA 1ERXA 1DF3A 1JZUA 1MUPA 1QY0A 1EALA 4ZJ0A 4I3DA 4ZH9A 2YG2A 2WQ9A 4KH8A 2AT5X 1DV9A 1QQSA 4XMGA 1T0VA 3FIQA 4MIRA 2WUTA 3VG7A 1QY2A 2K23A 5EDCA 2RN4A 1S2PA 4GNYA 3WOVA 3LHNA 1EPAA 1IKJA 4QGVA 3BSZE 1R0UA 4AZOA 1SY0A 4ORWA 4Y0QA 4A60A 2QOSC 1HBQA 4ON1A 2DM5A 1YWBA 5FENA 5K06A 1YP6A 3PECA 3NQ3A 3QKGA 1PM1X 2OFMX 3MX7A 4Y0PA 1OEJA 2X45A 3E3CA 5EEEA 4U8UM 1OBUA 2L9CA 2X46A 1KT4A 4TJZA 1QFTA 1GKAA 1X71A 1OPAA 1MDCA 3KFGA 4GK9A 3KFHA 2NNEA 1OBQA 4ML7B 3STKA 4U9CA 3VG6A 2LA7A 2P8GA 3ELXA 3WVMA 2AT3X 3WXQA 4HFOA 4YBPA 4QZTA 3RWXA 3HK1A 3FELA 3TGBA 2A13A 3WBGA 5HCDC 3ZW0A 2G7BA 3MBTA 3HTYA 5D4AA 4A8ZA 2LBAA 2PY1A 5HZ8A 4KC8A 1LIEA 3IA8A 2BHVA 1KZWA 1PMPA 5KHPA 1JIWI 1KXOA 1MX7A 1OPBA 2WEXA 3FEPA 3RZYA 2Q39A 4WHIA 4O4UA 5BVTA 3GE2A 4YDBA 3FW5A 5HZ6A 4JGLA 5EPQA 1B4MA 1QG5A 2L68A 1KT5A 1LFOA 5LKFA 4BQUA 4ZGFA 2O62A 4YKMA 4LZVA 2HZRA 1HN2A 1MX8A 2AT8X 3JS1A 2CZUA 4YGHA 1G7NA 1SXWA 3GAQA 2HNXA 2NNDA 1BEBA 3WJGA 3P6EA 1L6MA 4LZUA 2CZTA 4A1YA 2W2AA 4YFRA 2ACOA 2MJIA 3BX7A 1LKEA 3HWFA 4HPBA 1LIFA 2AL0X 4U3QA 3G7XA 1IFCA 5AJBA 1H91A 5D45A 5B27A 1YWCA 4YGGA 4O49A 1ZRYA 2HLVA 3S5VA 3HWEA 1YWAA 4GKCA 4O3XB 3B2KA 4LKPA 3APWA 3O2YA 3O22A 1A57A 1ZNHA 1ZNLA 1YWDA 3FENA 1OEEA 3HOEA 1I05A 1SY2A 1JBHA 3T1DA 2LKKA 3APUA 4IBAA 3OD9A 3PH5A 3BX8A 4WBKA 4NLIA 3N91A 4I9RA 3RKGA 3P24A 4O3ZA 3D95A 4DQ4A 3P6GA 3VE2A 1GGLA 2G78A 2G79A 3BU1A 3NPOA 3IFBA 3S60A 3U03A 3CBSA 4K19A 1GM6A 2OVEA 1ALBA 2OVSA 2OVAA 3K3LA 2IFBA 1NP1A 2OFRX 3VU1A 3ZUIA 5JR8A 2RQ0A 3STNA 1HMTA 3C78X 1U0XA 3PEDA 1LF7A 3CWKA 5EZ2A 4AZPA 1OEKA 3Q6LA 4D6AA 1GKAB 1ML7A 2F09A 4FQBB 3EBWA 1ZNKA 4GETA 2WSJA 2WEWA 1IIUA 5HZ5A 2RCQA 4YFPA 4BVMA 3KZAA 2A2UA 3ZW1A 1A2DA 4YGZA 2L67A 1B0OA 1FTPA 3EMMA 4ORSA 3CR6A 3RSWA 1T68X 2MO5A 4AZRA 4NLJA 3WJBA 5B29A 4AZNA 4ORXA 4ALOA 2CM4A 2ZAGA 2FT9A 5LJCA 4YBUA 3CQRA 3ZW0B 2FS6A 3FA8A 3JQOA 4N7DA 4LQZA 3BU9A 1UREA 4NNSA 1BM5A 4QNIA 2LBVA 1KZXA 5H9AA 1GT5A 5KICA 5HWZA 2KW1A 3WJFA 4IB7A 4AW8A 3AKNA 2AMMX 4YCEA 4I3BA 2MHDA 1ZNDA 1SXUA 3VG2A 4U8UN 2NNQA 1B8EA 3D97A 4O3WA 1ACDA 5LJBA 1KOIA 2LB6A 1FELA 3S5XA 1D3SA 3UEVA 1SY1A 1DZPA 4R0BA 5H9NA 1E02A 4KT5A 3FW4A 1G74A 1Z24A 4HPAA 5HCCC 4I3CA 2Q2MA 4CV7A 1GT3A 4WFUA 2RCTA 1X8UA 4YKOA 5H8TA 1TXLA 5HBSA 4O3YA 5F6BA 3P6HA 3P6CA 4IAWA 1CJ5A 1HQPA 1E5PA 1GX8A 4XMCA 3SAOA 1BRQA 2A3FX 3B2JA 1EI5A 2M4LA 1ICMA 4OMWA 3ELZA 2HMBA 1XKIA 2BLGA 5F1EA 5FQ6E 4FBOA 5LJDA 4YFQA 4COTA 1ADLA 3O19A 4NNTA 2WWPA 2MM3A 4KC7A 4GZVA 4IB8A 4Y0RA 3VG3A 3CQNA 5DG4A 1Y9LA 1CBRA 4ZGUA 3B2HA 4MVEA 2JU7A 5F58A 3I17A 4LKTA 1I4UA 4ZHHA 1ZNGA 5LJGA 3TGCA 1JJXA 5AQ6A 1A3YA 1D2UA 2QM9A 2W2FA 4GH7A 2Q9SA 3KFFA 2X8SA 1HBPA 4GE1A 1EIOA 3ZWEA 1CBSA 5LJEA 3CMPA 3P6DA 1KT6A 5HAEA 2X8TA 3APVA 2Q4NA 4IMOA 3ZI8A 4ZHFA 2CM9A 2GTLN 3OBLA 2FR2A 4FBVA 2FR3A 1QWDA 2KD2A 5EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFV A;  1JV4 A;  1FE3 A;  3AKM A;  3FA7 A;  5H9L A;  1SXY A;  2A2G A;  2GJ5 A;  5L8O A;  1XCA A;  1I06 A;  4ARH A;  4OS3 A;  2W2B A;  1X8Q A;  3C76 X;  4QYP A;  4A1H A;  4TNN A;  2GTF X;  2E4J A;  5HA0 A;  4N7C A;  1SY3 A;  2FS7 A;  2ASN X;  3BY0 A;  1EII A;  3C77 X;  2NP1 A;  1S44 A;  1LPJ A;  1NGL A;  1PBO A;  1TOW A;  3BS2 A;  1LID A;  4IB6 A;  1U18 A;  5H9K A;  5B27 A;  1I04 A;  4EFG A;  4TLJ A;  3FA9 A;  2K62 A;  1GT4 A;  3TGA A;  1YUP A;  4HPC A;  4OMX A;  3TZS A;  1CBQ A;  1X8O A;  3KQ0 A;  3NQ9 A;  1FEN A;  4I9S A;  1DZJ A;  1GXA A;  4XMH A;  2L5P A;  5HTE A;  1DFV A;  3B2I A;  1IW2 A;  1AVG I;  1DZM A;  4QGX A;  4CK4 A;  4ES7 A;  3FEK A;  1BJ7 A;  1QAB E;  1CRB A;  1EW3 A;  1KQX A;  5HZ9 A;  1AB0 A;  4M6S A;  1KGL A;  2POA A;  3F8A A;  4HPD A;  4TKJ A;  2JU8 A;  1HMS A;  5EDB A;  4NP1 A;  5D48 A;  1P6P A;  2HYS A;  3KFI A;  5F7G A;  4XME A;  1T8V A;  2Q2P A;  4Y0S A;  5DPQ A;  3BLG A;  1EUO A;  2LFO A;  3EBK A;  4EDE A;  3DSZ A;  2CBR A;  1EXS A;  2HZQ A;  5KID A;  3DTQ A;  4ALB A;  3FR2 A;  5IO5 A;  2QO4 A;  3PPT A;  2JOZ A;  3BDR A;  3NX1 A;  3ZUO A;  3FR4 A;  4AZQ A;  3MVF A;  2ANS A;  4GNW A;  1FEM A;  3JSQ A;  1TVQ A;  1BLR A;  2N93 A;  3FLL A;  3VG5 A;  1N0S A;  5BVQ A;  4UU2 A;  3D96 A;  1VYG A;  3VG4 A;  1O1V A;  4MVK A;  4ZHC A;  2AKQ A;  2JU3 A;  5HTD A;  4DQ3 A;  1GX9 A;  4RUU A;  1TW4 A;  1QY1 A;  3STM X;  4ZH6 A;  5LJK A;  1DC9 A;  2A0A A;  1KT7 A;  4MVI A;  3S26 A;  1PEE A;  5LKE A;  3I0A A;  3WJC A;  4EXZ A;  3P6F A;  1QFV A;  4YMY A;  2RA6 A;  3UEX A;  4M7M A;  1VPR A;  4BOE A;  4YH0 A;  3U9P C;  1B56 A;  1U17 A;  2R74 A;  3UEU A;  3WJD A;  5FFH A;  5LJH A;  5L8I A;  2QO5 A;  4YDA A;  5HCE C;  1E06 A;  3HWD A;  1JYD A;  4NYR A;  4D6B A;  1NP4 A;  1VYF A;  1X89 A;  2FTB A;  3FA6 A;  2FLJ A;  4IAX A;  4ODD A;  1E00 A;  4IMN A;  3B2L A;  2R73 A;  5L8N A;  4EEJ A;  4TKB A;  2OVD A;  5BVS A;  1LNM A;  2FRS A;  1SA8 A;  1BSY A;  3FR5 A;  1SXX A;  1BWY A;  4YCH A;  4QGW A;  5D47 A;  1LIB A;  1AQB A;  3OJY C;  4ORY A;  3BRN A;  1MVG A;  1UZ2 X;  4PSQ A;  4ZFX A;  4GRJ A;  3EM0 A;  2AT6 X;  4ORU A;  4AZM A;  4ZHG A;  2QO6 A;  3TF6 A;  3NAD A;  1AEL A;  1ZNE A;  3CBC A;  1G5W A;  4ZHD A;  1DZK A;  5FAZ A;  4ZCB A;  2RD7 C;  2AT0 X;  1FDQ A;  2ACP X;  2FWV A;  3PP6 A;  1O1U A;  3FMZ A;  4AYH A;  1LIC A;  2KT4 B;  2GC9 A;  2WR6 A;  5HZQ A;  1RBP A;  3UEW A;  4RUN A;  1JYJ A;  1JJJ A;  1YP7 A;  3NP1 A;  4XMF A;  1G85 A;  1RLB E;  1OBP A;  1KQW A;  1S7D A;  1EPB A;  3HWG A;  4TKH A;  1EQD A;  3PH6 A;  4ORR A;  1HMR A;  1IKE A;  3NX2 A;  1BSQ A;  4QZU A;  1YIV A;  1CBI A;  1GT1 A;  5D8J A;  3WJE A;  4XMD A;  1TOU A;  3F9D A;  2JN3 A;  4IB9 A;  2EU7 X;  2XKL A;  5C0N A;  3U0D A;  1BSO A;  1A18 A;  1ERB A;  1ICN A;  4UU3 A;  2OZQ A;  1IFB A;  4QAE A;  2ALL X;  3APX A;  1BRP A;  2KTD A;  4OS8 A;  4NYQ A;  2CBS A;  1BBP A;  1X8P A;  5IO6 A;  4KII A;  1KT3 A;  5IO7 A;  4MVL A;  3EYC A;  3ZQ3 A;  4OS0 A;  5CE4 A;  4ZR2 A;  2WQA E;  4O9S A;  2AH7 X;  4QYN A;  3NR3 A;  5F6Z A;  5HA1 A;  2XST A;  1X8N A;  2F73 A;  4TQ2 A;  2R56 A;  1DF3 A;  3L4R A;  1ERX A;  1JZU A;  1MUP A;  1QY0 A;  1EAL A;  4ZJ0 A;  4I3D A;  4ZH9 A;  2YG2 A;  2WQ9 A;  1DV9 A;  2AT5 X;  1QQS A;  4XMG A;  1T0V A;  3FIQ A;  2WUT A;  3VG7 A;  1QY2 A;  2K23 A;  5EDC A;  1S2P A;  4GNY A;  1EPA A;  1IKJ A;  4QGV A;  3BSZ E;  1R0U A;  4AZO A;  1SY0 A;  4ORW A;  4Y0Q A;  4A60 A;  2QOS C;  1HBQ A;  2DM5 A;  1YWB A;  5FEN A;  5K06 A;  1YP6 A;  3PEC A;  3NQ3 A;  3QKG A;  1PM1 X;  2OFM X;  4Y0P A;  1OEJ A;  2X45 A;  5EEE A;  1OBU A;  2L9C A;  2X46 A;  1KT4 A;  4TJZ A;  1QFT A;  1GKA A;  1X71 A;  1OPA A;  1MDC A;  3KFG A;  3KFH A;  2NNE A;  1OBQ A;  3STK A;  3VG6 A;  2P8G A;  3ELX A;  3WVM A;  2AT3 X;  3WXQ A;  4HFO A;  4YBP A;  4QZT A;  3HK1 A;  3FEL A;  3TGB A;  2A13 A;  3WBG A;  5HCD C;  2G7B A;  3MBT A;  4A8Z A;  5D4A A;  2LBA A;  2PY1 A;  5HZ8 A;  1LIE A;  3IA8 A;  1KZW A;  1PMP A;  5KHP A;  1KXO A;  1OPB A;  1MX7 A;  2WEX A;  3FEP A;  3RZY A;  2Q39 A;  5BVT A;  4YDB A;  3FW5 A;  5HZ6 A;  5EPQ A;  1B4M A;  1QG5 A;  2L68 A;  1KT5 A;  1LFO A;  5LKF A;  4BQU A;  2O62 A;  4YKM A;  4LZV A;  2HZR A;  1HN2 A;  1MX8 A;  2AT8 X;  3JS1 A;  2CZU A;  4YGH A;  1G7N A;  1SXW A;  3GAQ A;  2HNX A;  2NND A;  1BEB A;  3WJG A;  3P6E A;  1L6M A;  4LZU A;  2CZT A;  4A1Y A;  2W2A A;  4YFR A;  2ACO A;  2MJI A;  3BX7 A;  1LKE A;  3HWF A;  4HPB A;  1LIF A;  2AL0 X;  3G7X A;  1IFC A;  1H91 A;  5D45 A;  1YWC A;  4YGG A;  1ZRY A;  2HLV A;  3HWE A;  1YWA A;  4GKC A;  3B2K A;  4LKP A;  3APW A;  3O2Y A;  3O22 A;  1A57 A;  1ZNH A;  1ZNL A;  1YWD A;  3FEN A;  1OEE A;  1I05 A;  1SY2 A;  1JBH A;  3T1D A;  2LKK A;  3APU A;  4IBA A;  3PH5 A;  3BX8 A;  4WBK A;  4NLI A;  4I9R A;  3D95 A;  4DQ4 A;  3P6G A;  1GGL A;  2G78 A;  2G79 A;  3BU1 A;  3NPO A;  3IFB A;  3U03 A;  3CBS A;  4K19 A;  1GM6 A;  2OVE A;  1ALB A;  2OVA A;  3K3L A;  2IFB A;  1NP1 A;  2OFR X;  3ZUI A;  5JR8 A;  2RQ0 A;  3STN A;  1HMT A;  3C78 X;  1U0X A;  3PED A;  1LF7 A;  3CWK A;  5EZ2 A;  4AZP A;  1OEK A;  3Q6L A;  4D6A A;  1GKA B;  1ML7 A;  3EBW A;  1ZNK A;  4GET A;  2WSJ A;  2WEW A;  1IIU A;  5HZ5 A;  2RCQ A;  4YFP A;  4BVM A;  3KZA A;  2A2U A;  1A2D A;  4YGZ A;  2L67 A;  1B0O A;  1FTP A;  3EMM A;  4ORS A;  3CR6 A;  3RSW A;  1T68 X;  2MO5 A;  4AZR A;  4NLJ A;  3WJB A;  5B29 A;  4AZN A;  4ORX A;  4ALO A;  2CM4 A;  2FT9 A;  5LJC A;  4YBU A;  3CQR A;  2FS6 A;  3FA8 A;  4N7D A;  3BU9 A;  1URE A;  4NNS A;  1BM5 A;  2LBV A;  1KZX A;  5H9A A;  1GT5 A;  5KIC A;  5HWZ A;  3WJF A;  4IB7 A;  4AW8 A;  3AKN A;  2AMM X;  4YCE A;  4I3B A;  1ZND A;  1SXU A;  3VG2 A;  2NNQ A;  1B8E A;  3D97 A;  1ACD A;  5LJB A;  1KOI A;  2LB6 A;  1FEL A;  1D3S A;  3UEV A;  1SY1 A;  1DZP A;  4R0B A;  5H9N A;  1E02 A;  5HCC C;  3FW4 A;  1G74 A;  1Z24 A;  4HPA A;  4I3C A;  2Q2M A;  1GT3 A;  4WFU A;  2RCT A;  1X8U A;  4YKO A;  5H8T A;  1TXL A;  5HBS A;  5F6B A;  3P6H A;  3P6C A;  4IAW A;  1CJ5 A;  1HQP A;  1E5P A;  1GX8 A;  4XMC A;  3SAO A;  1BRQ A;  2A3F X;  3B2J A;  1ICM A;  4OMW A;  3ELZ A;  2HMB A;  1XKI A;  2BLG A;  5F1E A;  5LJD A;  4YFQ A;  1ADL A;  3O19 A;  4NNT A;  2WWP A;  2MM3 A;  4IB8 A;  4Y0R A;  3VG3 A;  3CQN A;  5DG4 A;  1CBR A;  4ZGU A;  3B2H A;  5F58 A;  2JU7 A;  3I17 A;  4LKT A;  1I4U A;  4ZHH A;  1ZNG A;  5LJG A;  3TGC A;  1JJX A;  5AQ6 A;  1A3Y A;  1D2U A;  2QM9 A;  2W2F A;  4GH7 A;  2Q9S A;  3KFF A;  4GE1 A;  1HBP A;  1EIO A;  1CBS A;  5LJE A;  3CMP A;  3P6D A;  1KT6 A;  5HAE A;  3APV A;  2Q4N A;  4IMO A;  4ZHF A;  2CM9 A;  2FR2 A;  2FR3 A;  1QWD A;  1O8V A;  5EED A; 
#chains in the Genus database with same CATH topology
 4WFV A;  4BX7 A;  1JV4 A;  1FE3 A;  3H3I A;  2C1S A;  3AKM A;  3FA7 A;  3HPE A;  5H9L A;  1SXY A;  2A2G A;  2GJ5 A;  2YMS A;  1SWO A;  3PQU A;  1XCA A;  1I06 A;  5L8O A;  1SWR A;  4ARH A;  4OS3 A;  3VE1 A;  2W2B A;  4GJV A;  2VDF A;  1W5R A;  5F2B A;  1N9M A;  1X8Q A;  3C76 X;  4QYP A;  4A1H A;  4TNN A;  2GTF X;  2E4J A;  5HA0 A;  4L3R A;  4N7C A;  1SY3 A;  3ZW1 B;  2FS7 A;  1WUB A;  2ASN X;  3BY0 A;  4Y5D A;  1EII A;  3C77 X;  1K3B A;  1S44 A;  2IZA A;  2NP1 A;  1LPJ A;  1NGL A;  1PBO A;  1TOW A;  3BS2 A;  1LID A;  4IB6 A;  1U18 A;  4O4O A;  4PJ2 A;  1I04 A;  2ZAI A;  5H9K A;  4TLJ A;  3FA9 A;  3NQK A;  4EFG A;  2K62 A;  1GT4 A;  3TGA A;  1YUP A;  3F6Z B;  1VWM B;  4HPC A;  1N4J A;  4OMX A;  3TZS A;  1CBQ A;  1X8O A;  3KQ0 A;  3HOL A;  2OY5 O;  3NQ9 A;  1FEN A;  2GH7 A;  4I9S A;  1DZJ A;  1VWK B;  1GXA A;  4XMH A;  2L5P A;  3CKF A;  5HTE A;  1DFV A;  1VWL B;  1RXK A;  2OF9 A;  3B2I A;  1IW2 A;  3EW1 A;  1AVG I;  1DZM A;  4QGX A;  4CK4 A;  3FYF A;  4ES7 A;  2C1Q A;  1BJ7 A;  1QAB E;  3FEK A;  1CRB A;  1EW3 A;  1KQX A;  1Y0G A;  2RTM A;  5HZ9 A;  1AB0 A;  4M6S A;  4FGI B;  1SWK A;  1KGL A;  2POA A;  3F8A A;  3D4R A;  2X8F A;  4HPD A;  4TKJ A;  1E2T A;  3SLO A;  2X55 A;  4CSB A;  2A5B A;  1HMS A;  2JU8 A;  4NP1 A;  5D48 A;  5EDB A;  1P6P A;  2HYS A;  3KFI A;  5F7G A;  4XME A;  4OKA A;  2Z4I A;  1T8V A;  2Q2P A;  4Y0S A;  5DPQ A;  3BLG A;  3ZW2 A;  2IZB A;  1EUO A;  2LFO A;  4MIS A;  3EBK A;  4EDE A;  3DSZ A;  2CBR A;  1EXS A;  2HZQ A;  3RBY A;  3DTQ A;  5BYP A;  5KID A;  3T6L A;  3PQS A;  4IAB A;  4ALB A;  3FR2 A;  3NBX X;  5IO5 A;  2QO4 A;  3PPT A;  3RE5 A;  2JOZ A;  3BDR A;  3NX1 A;  3ZUO A;  3FR4 A;  4AZQ A;  3RDX A;  3MVF A;  2ANS A;  4GNW A;  1FEM A;  1UYN X;  3JSQ A;  3ZZV A;  2X56 A;  1TVQ A;  1BLR A;  2UYW A;  2N93 A;  4U8U O;  4FBR A;  3FLL A;  3VG5 A;  1N0S A;  5AEO A;  3VHM A;  5BVQ A;  3RDS A;  2RTJ A;  4CPI A;  4EQA C;  4UU2 A;  3D96 A;  1VYG A;  3VG4 A;  1N9Y A;  1O1V A;  4MVK A;  4ZHC A;  4CDE A;  2AKQ A;  2JU3 A;  5HTD A;  4DQ3 A;  1VWI B;  3SOT A;  1GX9 A;  4RUU A;  1TW4 A;  1QY1 A;  3STM X;  1RSU B;  2X4M A;  4ZH6 A;  5LJK A;  1DC9 A;  2A0A A;  1KT7 A;  4MVI A;  4L1N A;  3S26 A;  1SWJ A;  5B2A O;  1PEE A;  5LKE A;  3I0A A;  3WJC A;  2QOM A;  4EXZ A;  3P6F A;  1QFV A;  4YMY A;  4NV8 A;  3WYQ A;  2RA6 A;  3UEX A;  4M7M A;  1VPR A;  1STR B;  5B3M O;  5K68 A;  2F01 A;  4BOE A;  1VWA B;  4YH0 A;  3U9P C;  1B56 A;  1U17 A;  2R74 A;  3UEU A;  3WJD A;  5FFH A;  2JW1 A;  5LJH A;  5L8I A;  2QO5 A;  4YDA A;  5HCE C;  1E06 A;  3HWD A;  1JYD A;  4BX7 B;  4NYR A;  4D6B A;  1NP4 A;  1VYF A;  1X89 A;  2FTB A;  2C4I A;  3FA6 A;  2FLJ A;  3OE3 A;  4IAX A;  2G8C O;  4ODD A;  1E00 A;  4IMN A;  3B2L A;  2R73 A;  5L8N A;  4EEJ A;  4TKB A;  3SLJ A;  2RTN B;  1JZU A;  2OVD A;  4KCA A;  1SRG A;  5BVS A;  1LNM A;  2FRS A;  1VWN B;  1SA8 A;  1BSY A;  3FR5 A;  1MOY A;  2IZE B;  2UZ2 A;  1SXX A;  2FKG A;  1BWY A;  4YCH A;  4QGW A;  2BS6 A;  3KVN A;  2Z4H A;  5D47 A;  1LIB A;  2I5Z O;  1AQB A;  2GTL O;  3OJY C;  4ORY A;  2RTI B;  1MVG A;  1UZ2 X;  3BRN A;  4PSQ A;  1STS B;  3RY2 A;  4GRJ A;  3EM0 A;  2RTR B;  4MEE A;  2AT6 X;  4ORU A;  4AZM A;  4ZHG A;  2QO6 A;  4INN A;  1KL5 A;  2IZC B;  3TF6 A;  1VWD B;  3NAD A;  4O4X A;  5AJC A;  3Q34 A;  2OL7 A;  1AEL A;  1ZNE A;  3CBC A;  4ZFX A;  1G5W A;  1KFF A;  4ZHD A;  1DZK A;  5FAZ A;  4ZCB A;  2RD7 C;  3SLT A;  2AT0 X;  4CDC A;  1FDQ A;  2ACP X;  2FWV A;  1VWP B;  3PP6 A;  1O1U A;  3FMZ A;  4QRL A;  4AYH A;  1LIC A;  2KT4 B;  2GC9 A;  2WR6 A;  4GD9 A;  1RBP A;  5HZQ A;  2AF5 A;  3UEW A;  4RUN A;  1AVD A;  1JYJ A;  4NV7 A;  1VWH B;  4B55 A;  1JJJ A;  1YP7 A;  4ID2 A;  3NP1 A;  2BC3 A;  4XMF A;  4QQ1 A;  4GU8 A;  1G85 A;  1RLB E;  2BT9 A;  1OBP A;  3UAQ A;  1KQW A;  1S7D A;  1SWQ A;  2GTL M;  1GX3 A;  1EPB A;  5CYB A;  3HWG A;  4Z28 A;  2DJF A;  4TKH A;  1EQD A;  3PH6 A;  4I95 A;  4ORR A;  1HMR A;  1IKE A;  3NX2 A;  1BSQ A;  4QZU A;  3RDU A;  1YIV A;  1CBI A;  2OF8 A;  5FQ7 E;  1VWR B;  1GT1 A;  3VGW A;  5D8J A;  3WJE A;  4XMD A;  3LV4 A;  4CPF A;  4Z2O A;  2AVI A;  2IZD B;  1TOU A;  3F9D A;  2JN3 A;  4GDZ A;  4IB9 A;  2EU7 X;  2KTS A;  4C5P A;  1SRI A;  2XKL A;  3MM0 A;  3SZJ A;  5C0N A;  3U0D A;  1BSO A;  2MWH A;  3P02 A;  1A18 A;  1ERB A;  1I78 A;  1ICN A;  3V8U A;  4BGF A;  2JMB A;  4UU3 A;  2G5L A;  1N7Y A;  2OZQ A;  4O4S A;  2OYB O;  1IFB A;  1VWO B;  2ALL X;  3APX A;  1BRP A;  4NW4 A;  1JMX A;  4QAE A;  3WZO A;  5K67 A;  2QMI A;  4GUZ A;  2BS5 A;  2KTD A;  4OS8 A;  4NYQ A;  2CBS A;  1VWG B;  1BBP A;  1X8P A;  3EW2 A;  5IO6 A;  4KII A;  4I6S A;  1KT3 A;  3RDQ A;  3SZI A;  1Y9T A;  5IO7 A;  4MVL A;  5FQ8 E;  3EYC A;  1NQN A;  3ZQ3 A;  4OS0 A;  5CE4 A;  2OL6 O;  4ZR2 A;  1SMP I;  2WQA E;  3VPJ E;  4O9S A;  2AH7 X;  4QYN A;  3NR3 A;  5F6Z A;  5HA1 A;  2XST A;  5HCC C;  1X8N A;  2F73 A;  2IZG B;  2R56 A;  4HWM A;  3L4R A;  1ERX A;  4TQ2 A;  4IRW A;  1DF3 A;  1MUP A;  1QY0 A;  1EAL A;  4ZJ0 A;  4I3D A;  4ZH9 A;  3X00 A;  2YG2 A;  2WQ9 A;  2IZH B;  4JNJ A;  4KH8 A;  2AT5 X;  1DV9 A;  2X34 A;  1QQS A;  4XMG A;  4JO6 A;  1T0V A;  5L3Y A;  1NDJ A;  3FIQ A;  4MIR A;  2MF6 A;  2PI3 O;  2WUT A;  2A5C A;  3VG7 A;  1QY2 A;  2K23 A;  5EDC A;  2RN4 A;  1S2P A;  4GNY A;  2CAM A;  1KL3 A;  1OSP O;  3WOV A;  3LHN A;  1EPA A;  1IKJ A;  4QGV A;  3BSZ E;  4BX5 B;  1R0U A;  4AZO A;  1SY0 A;  4ORW A;  1AVE A;  3AEH A;  4Y0Q A;  4A60 A;  2QOS C;  1HBQ A;  4ON1 A;  2A8G A;  2DM5 A;  1SWG A;  3WZP A;  1YWB A;  1RAV A;  3WZN A;  1YP6 A;  3PEC A;  3NQ3 A;  3QKG A;  5FEN A;  5K06 A;  1PM1 X;  2OFM X;  2RTD B;  3MX7 A;  4Y0P A;  1VWQ B;  1OEJ A;  2X45 A;  3E3C A;  5EEE A;  4U8U M;  1OBU A;  2L9C A;  2X46 A;  1KT4 A;  5JD2 A;  4TJZ A;  1QFT A;  1GKA A;  1X71 A;  2KD2 A;  3WYP A;  4Z2V A;  1OPA A;  5IXG A;  3RY1 A;  1MDC A;  3KFG A;  4GK9 A;  3KFH A;  1NQM A;  1OBQ A;  2NNE A;  4ML7 B;  3STK A;  4U9C A;  3VG6 A;  2LA7 A;  1MM9 A;  2P8G A;  3ELX A;  3WVM A;  2AT3 X;  3WXQ A;  4HFO A;  5B5F A;  4YBP A;  2IZL B;  4QZT A;  3RWX A;  1VWJ B;  3FEL A;  2OY1 O;  3HK1 A;  4GGT A;  4BBO A;  3TGB A;  2A13 A;  1SWF A;  2RTL A;  4Z2P A;  3WBG A;  4BX5 A;  5HCD C;  4GJS A;  3ZW0 A;  2G7B A;  3MBT A;  3HTY A;  5D4A A;  4A8Z A;  2RTG B;  2LBA A;  1PTS A;  2PY1 A;  5HZ8 A;  2RTC B;  4KC8 A;  1LIE A;  1Y55 X;  3IA8 A;  1RXH A;  2BHV A;  4Y59 A;  1KZW A;  2RTK A;  1PMP A;  5KHP A;  1JIW I;  1KXO A;  1MX7 A;  1OPB A;  1DF8 A;  1RXJ A;  1MK5 A;  2WEX A;  3FEP A;  3RZY A;  2Q39 A;  5IRU A;  4WHI A;  4O4U A;  4U46 A;  5BVT A;  1SWD A;  2X32 A;  3GE2 A;  1Y52 X;  4YDB A;  3FW5 A;  5HZ6 A;  2RTF B;  4JGL A;  5EPQ A;  1B4M A;  1QG5 A;  2L68 A;  1KT5 A;  1SRJ A;  1LFO A;  5LKF A;  3MG5 A;  4BQU A;  4ZGF A;  2O62 A;  4YKM A;  4LZV A;  3T6F A;  2HZR A;  1HN2 A;  1MX8 A;  1SWE A;  2AT8 X;  2CZU A;  3JS1 A;  4OEL A;  2VFB A;  4YGH A;  1G7N A;  1SXW A;  3T2W A;  3GAQ A;  2HNX A;  2NND A;  1BEB A;  3RDM A;  3WJG A;  3P6E A;  1L6M A;  4LZU A;  2CZT A;  3WZQ A;  4A1Y A;  4DNE A;  2W2A A;  4YFR A;  2ACO A;  2MJI A;  3BX7 A;  5CSE A;  1LKE A;  3HWF A;  4HPB A;  4Z27 A;  1LIF A;  2AL0 X;  4U3Q A;  3G7X A;  1IFC A;  1VWC B;  5AJB A;  2BSZ A;  2RTH B;  1H91 A;  1SWT A;  2RTB B;  5D45 A;  5B27 A;  1YWC A;  4YGG A;  2RTP B;  1SWB A;  1ZRY A;  2HLV A;  4O49 A;  3HWE A;  1YWA A;  5B5G A;  3S5V A;  4GKC A;  4O3X B;  2Y3E A;  3B2K A;  4LKP A;  1HXL A;  3APW A;  1I9H A;  3O2Y A;  3O22 A;  1ZNH A;  1ZNL A;  1YWD A;  3FEN A;  1A57 A;  1OEE A;  3HOE A;  1I05 A;  1W6F A;  2DJG A;  2OFA A;  1JJU A;  1SY2 A;  1JMZ A;  2WPU A;  1JBH A;  3T1D A;  2LKK A;  3APU A;  4IBA A;  3OD9 A;  3PH5 A;  3BX8 A;  4BCS A;  4WBK A;  4NLI A;  1SRF A;  2FHL A;  3N91 A;  1SWP A;  3P24 A;  4I9R A;  3D95 A;  4O3Z A;  3P6G A;  3RKG A;  1GGL A;  3VE2 A;  2G78 A;  4DQ4 A;  2G79 A;  2JGS A;  3BU1 A;  3NPO A;  3IFB A;  2RTA A;  4GDA A;  3S60 A;  3U03 A;  4BX6 B;  3CBS A;  4K19 A;  1GM6 A;  2OVE A;  1ALB A;  2OVS A;  2OVA A;  2FKJ A;  3K3L A;  1HQQ A;  2IFB A;  2VFC A;  1NP1 A;  2OFR X;  3VU1 A;  3ZUI A;  5IRA A;  2IZF B;  5JR8 A;  2RQ0 A;  3STN A;  1HY2 A;  1HMT A;  1LEL A;  3C78 X;  1U0X A;  3PED A;  1LF7 A;  3CWK A;  5EZ2 A;  4AZP A;  1OEK A;  3PDF A;  3Q6L A;  4D6A A;  1GKA B;  1ML7 A;  2F09 A;  4FQB B;  3EBW A;  1ZNK A;  4GET A;  1FJ1 E;  2WSJ A;  2WEW A;  3T2X A;  1IIU A;  5HZ5 A;  5B11 O;  2FHN X;  2RCQ A;  4YFP A;  1NBX A;  3PK2 A;  4BVM A;  3KZA A;  1SLE B;  2A2U A;  1A2D A;  4YGZ A;  2L67 A;  3ZW1 A;  5IRW A;  4DCB A;  4CDD A;  1SWN A;  2HKD A;  1B0O A;  1FTP A;  3EMM A;  4ORS A;  3CR6 A;  1LDQ A;  3RSW A;  1T68 X;  2MO5 A;  1VWB B;  2RTE B;  4GGZ A;  2OY7 A;  2IZI A;  4AZR A;  4CPE A;  4NLJ A;  3WJB A;  5B29 A;  1MEP A;  4AZN A;  4ORX A;  4ALO A;  2CM4 A;  2ZAG A;  3FDC A;  2FT9 A;  3VHI A;  4EKV A;  2OY8 A;  4YBU A;  5LJC A;  3CQR A;  3ZW0 B;  2FS6 A;  3FA8 A;  4BX6 A;  3JQO A;  4N7D A;  2RTO B;  4LQZ A;  3BU9 A;  1URE A;  4NNS A;  1BM5 A;  2IZK A;  4QNI A;  2Y32 A;  2LBV A;  4CPH B;  2QCB A;  2RTQ B;  5B10 O;  1KZX A;  1KL4 A;  5H9A A;  4JHQ A;  1GT5 A;  5KIC A;  5HWZ A;  2KW1 A;  3RE6 A;  3WJF A;  4IB7 A;  4AW8 A;  3AKN A;  4Z6J A;  2AMM X;  4YCE A;  3RDO A;  1W4T A;  2ZSC A;  1K24 A;  4I3B A;  2MHD A;  1ZND A;  1SXU A;  3VG2 A;  1WBI A;  4U8U N;  1SRH A;  2NNQ A;  1B8E A;  1NC9 A;  1Y53 X;  3D97 A;  3EC5 A;  4O3W A;  1ACD A;  1UYO X;  5LJB A;  1KOI A;  2LB6 A;  1FEL A;  3S5X A;  1HXZ A;  1D3S A;  1LUQ A;  3UEV A;  1SY1 A;  1DZP A;  1STP A;  4R0B A;  1E02 A;  4KT5 A;  3FW4 A;  1G74 A;  1Z24 A;  4HPA A;  5H9N A;  4I3C A;  2Q2M A;  4CV7 A;  1GT3 A;  4WFU A;  2RCT A;  1X8U A;  4YKO A;  5H8T A;  1TXL A;  1SWU A;  5HBS A;  4O3Y A;  5F6B A;  3P6H A;  3P6C A;  1IJ8 A;  4IAW A;  1CJ5 A;  1HQP A;  1PBY A;  1E5P A;  3QQ2 A;  1GX8 A;  4XMC A;  2OL8 O;  2FGS A;  1VYO A;  2Y3F A;  3CKG A;  1BRQ A;  3SAO A;  2A3F X;  2OFB A;  4BJ8 A;  4CPH A;  3B2J A;  1EI5 A;  2M4L A;  1ICM A;  4OMW A;  1N43 A;  1SLG B;  3AUM O;  3ELZ A;  2HMB A;  1XKI A;  2BLG A;  5F1E A;  5FQ6 E;  4FBO A;  5LJD A;  1SWH A;  1SRE A;  1VWF B;  4YFQ A;  4COT A;  1ADL A;  3O19 A;  4NNT A;  2WWP A;  1LCZ A;  2I5V O;  3D9W A;  1SLF B;  2MM3 A;  4KC7 A;  4GZV A;  1LCV A;  1JQP A;  2IZJ A;  4IB8 A;  4Y0R A;  3CQN A;  5DG4 A;  3VG3 A;  1Y9L A;  4YVB A;  1CBR A;  4ZGU A;  3B2H A;  4MVE A;  2JU7 A;  5F58 A;  3I17 A;  3VHH A;  4LKT A;  1I4U A;  4ZHH A;  1ZNG A;  5LJG A;  3TGC A;  1LDO A;  1JJX A;  5AQ6 A;  1A3Y A;  1D2U A;  1LCW A;  4OEM A;  2QM9 A;  2W2F A;  3LTW A;  4GH7 A;  2Q9S A;  1SWA A;  2X8S A;  1HBP A;  3KFF A;  4GE1 A;  1SWS A;  1EIO A;  4GGR A;  3ZWE A;  1SLD B;  3FID A;  1CBS A;  4I60 A;  5LJE A;  3CMP A;  3P6D A;  1KT6 A;  5HAE A;  2X8T A;  3APV A;  5CHK A;  3SZH A;  2Q4N A;  4IMO A;  3ZI8 A;  4ZHF A;  2CM9 A;  1SWC A;  1VWE B;  2GTL N;  3OBL A;  2FR2 A;  4FBV A;  2FR3 A;  4CDF A;  1QWD A;  1RST B;  1O8V A;  1SWL A;  5EED A; 
#chains in the Genus database with same CATH homology
 4WFV A;  1JV4 A;  1FE3 A;  3H3I A;  3AKM A;  3FA7 A;  5H9L A;  1SXY A;  2A2G A;  2GJ5 A;  2YMS A;  1O8V A;  3PQU A;  1XCA A;  1I06 A;  5L8O A;  4ARH A;  4OS3 A;  3VE1 A;  2W2B A;  1X8Q A;  3C76 X;  4QYP A;  4A1H A;  4TNN A;  2GTF X;  2E4J A;  5HA0 A;  4L3R A;  4N7C A;  1SY3 A;  3ZW1 B;  2FS7 A;  2ASN X;  3BY0 A;  1EII A;  3C77 X;  2NP1 A;  1S44 A;  1LPJ A;  1NGL A;  1PBO A;  1TOW A;  3BS2 A;  1LID A;  4IB6 A;  1U18 A;  4O4O A;  4PJ2 A;  1I04 A;  2ZAI A;  5H9K A;  4TLJ A;  3FA9 A;  3NQK A;  4EFG A;  2K62 A;  1GT4 A;  3TGA A;  1YUP A;  3F6Z B;  4HPC A;  4OMX A;  3TZS A;  1CBQ A;  1X8O A;  3KQ0 A;  3HOL A;  3NQ9 A;  1FEN A;  4I9S A;  1DZJ A;  1GXA A;  4XMH A;  2L5P A;  5HTE A;  1DFV A;  3B2I A;  1IW2 A;  1AVG I;  1DZM A;  4QGX A;  4CK4 A;  3FYF A;  4ES7 A;  3FEK A;  1BJ7 A;  1QAB E;  1CRB A;  1EW3 A;  1KQX A;  5HZ9 A;  1AB0 A;  4M6S A;  4FGI B;  1KGL A;  2POA A;  3F8A A;  3D4R A;  2X8F A;  4HPD A;  4TKJ A;  4CSB A;  2JU8 A;  1HMS A;  5EDB A;  4NP1 A;  5D48 A;  1P6P A;  2HYS A;  3KFI A;  5F7G A;  4XME A;  2Z4I A;  1T8V A;  2Q2P A;  4Y0S A;  5DPQ A;  3BLG A;  3ZW2 A;  1EUO A;  2LFO A;  4MIS A;  3EBK A;  4EDE A;  3DSZ A;  2CBR A;  1EXS A;  2HZQ A;  3RBY A;  3DTQ A;  5BYP A;  5KID A;  3PQS A;  4IAB A;  4ALB A;  3FR2 A;  3NBX X;  5IO5 A;  2QO4 A;  3PPT A;  2JOZ A;  3BDR A;  3NX1 A;  3ZUO A;  3FR4 A;  4AZQ A;  3MVF A;  2ANS A;  4GNW A;  1FEM A;  3JSQ A;  3ZZV A;  1TVQ A;  1BLR A;  2N93 A;  4U8U O;  4FBR A;  3FLL A;  3VG5 A;  1N0S A;  5AEO A;  5BVQ A;  4EQA C;  4UU2 A;  3D96 A;  1VYG A;  3VG4 A;  1O1V A;  4MVK A;  4ZHC A;  2AKQ A;  2JU3 A;  5HTD A;  4DQ3 A;  3SOT A;  1GX9 A;  4RUU A;  1TW4 A;  1QY1 A;  3STM X;  4ZH6 A;  5LJK A;  1DC9 A;  2A0A A;  1KT7 A;  4MVI A;  4L1N A;  3S26 A;  1PEE A;  5LKE A;  3I0A A;  3WJC A;  4EXZ A;  3P6F A;  1QFV A;  4YMY A;  2RA6 A;  3UEX A;  4M7M A;  1VPR A;  4BOE A;  4YH0 A;  3U9P C;  1B56 A;  1U17 A;  2R74 A;  3UEU A;  3WJD A;  5FFH A;  2JW1 A;  5LJH A;  5L8I A;  2QO5 A;  4YDA A;  5HCE C;  1E06 A;  3HWD A;  1JYD A;  4NYR A;  4D6B A;  1NP4 A;  1VYF A;  1X89 A;  2FTB A;  3FA6 A;  2FLJ A;  3OE3 A;  4IAX A;  4ODD A;  1E00 A;  4IMN A;  3B2L A;  2R73 A;  5L8N A;  4EEJ A;  4TKB A;  2OVD A;  4KCA A;  5BVS A;  1LNM A;  2FRS A;  1SA8 A;  1BSY A;  3FR5 A;  1SXX A;  1BWY A;  4YCH A;  4QGW A;  2BS6 A;  2Z4H A;  5D47 A;  1LIB A;  1AQB A;  2GTL O;  3OJY C;  4ORY A;  3BRN A;  1MVG A;  1UZ2 X;  4PSQ A;  4ZFX A;  4GRJ A;  3EM0 A;  2AT6 X;  4ORU A;  4AZM A;  4ZHG A;  2QO6 A;  4INN A;  3TF6 A;  3NAD A;  4O4X A;  5AJC A;  1AEL A;  1ZNE A;  3CBC A;  1G5W A;  4ZHD A;  1DZK A;  5FAZ A;  4ZCB A;  2RD7 C;  2AT0 X;  1FDQ A;  2ACP X;  2FWV A;  3PP6 A;  1O1U A;  3FMZ A;  4QRL A;  4AYH A;  1LIC A;  2KT4 B;  2GC9 A;  2WR6 A;  5HZQ A;  1RBP A;  3UEW A;  4RUN A;  1JYJ A;  1JJJ A;  1YP7 A;  4ID2 A;  3NP1 A;  4XMF A;  4QQ1 A;  4GU8 A;  1G85 A;  1RLB E;  2BT9 A;  1OBP A;  3UAQ A;  1KQW A;  1S7D A;  2GTL M;  1EPB A;  5CYB A;  3HWG A;  4TKH A;  1EQD A;  3PH6 A;  4I95 A;  4ORR A;  1HMR A;  1IKE A;  3NX2 A;  1BSQ A;  4QZU A;  1YIV A;  1CBI A;  5FQ7 E;  1GT1 A;  5D8J A;  3WJE A;  4XMD A;  3LV4 A;  1TOU A;  3F9D A;  2JN3 A;  4GDZ A;  4IB9 A;  2EU7 X;  2KTS A;  2XKL A;  5C0N A;  3U0D A;  1BSO A;  2MWH A;  3P02 A;  1A18 A;  1ERB A;  3V8U A;  1ICN A;  2JMB A;  4UU3 A;  2OZQ A;  4O4S A;  1IFB A;  4QAE A;  2ALL X;  3APX A;  1BRP A;  4NW4 A;  2QMI A;  2BS5 A;  2KTD A;  4OS8 A;  4NYQ A;  2CBS A;  1BBP A;  1X8P A;  5IO6 A;  4KII A;  4I6S A;  1KT3 A;  1Y9T A;  5IO7 A;  4MVL A;  5FQ8 E;  3EYC A;  3ZQ3 A;  4OS0 A;  5CE4 A;  4ZR2 A;  1SMP I;  2WQA E;  3VPJ E;  4O9S A;  2AH7 X;  4QYN A;  3NR3 A;  5F6Z A;  5HA1 A;  2XST A;  1X8N A;  2F73 A;  4HWM A;  2R56 A;  4TQ2 A;  3L4R A;  1ERX A;  1DF3 A;  1JZU A;  1MUP A;  1QY0 A;  1EAL A;  4ZJ0 A;  4I3D A;  4ZH9 A;  2YG2 A;  2WQ9 A;  4KH8 A;  2AT5 X;  1DV9 A;  1QQS A;  4XMG A;  1T0V A;  3FIQ A;  4MIR A;  2WUT A;  3VG7 A;  1QY2 A;  2K23 A;  5EDC A;  2RN4 A;  1S2P A;  4GNY A;  3WOV A;  3LHN A;  1EPA A;  1IKJ A;  4QGV A;  3BSZ E;  1R0U A;  4AZO A;  1SY0 A;  4ORW A;  4Y0Q A;  4A60 A;  2QOS C;  1HBQ A;  4ON1 A;  2DM5 A;  1YWB A;  5FEN A;  5K06 A;  1YP6 A;  3PEC A;  3NQ3 A;  3QKG A;  1PM1 X;  2OFM X;  3MX7 A;  4Y0P A;  1OEJ A;  2X45 A;  3E3C A;  5EEE A;  4U8U M;  1OBU A;  2L9C A;  2X46 A;  1KT4 A;  4TJZ A;  1QFT A;  1GKA A;  1X71 A;  1OPA A;  1MDC A;  3KFG A;  4GK9 A;  3KFH A;  2NNE A;  1OBQ A;  4ML7 B;  3STK A;  4U9C A;  3VG6 A;  2LA7 A;  2P8G A;  3ELX A;  3WVM A;  2AT3 X;  3WXQ A;  4HFO A;  4YBP A;  4QZT A;  3RWX A;  3HK1 A;  3FEL A;  3TGB A;  2A13 A;  3WBG A;  5HCD C;  3ZW0 A;  2G7B A;  3MBT A;  3HTY A;  5D4A A;  4A8Z A;  2LBA A;  2PY1 A;  5HZ8 A;  4KC8 A;  1LIE A;  3IA8 A;  2BHV A;  1KZW A;  1PMP A;  5KHP A;  1JIW I;  1KXO A;  1MX7 A;  1OPB A;  2WEX A;  3FEP A;  3RZY A;  2Q39 A;  4WHI A;  4O4U A;  5BVT A;  3GE2 A;  4YDB A;  3FW5 A;  5HZ6 A;  4JGL A;  5EPQ A;  1B4M A;  1QG5 A;  2L68 A;  1KT5 A;  1LFO A;  5LKF A;  4BQU A;  4ZGF A;  2O62 A;  4YKM A;  4LZV A;  2HZR A;  1HN2 A;  1MX8 A;  2AT8 X;  3JS1 A;  2CZU A;  4YGH A;  1G7N A;  1SXW A;  3GAQ A;  2HNX A;  2NND A;  1BEB A;  3WJG A;  3P6E A;  1L6M A;  4LZU A;  2CZT A;  4A1Y A;  2W2A A;  4YFR A;  2ACO A;  2MJI A;  3BX7 A;  1LKE A;  3HWF A;  4HPB A;  1LIF A;  2AL0 X;  4U3Q A;  3G7X A;  1IFC A;  5AJB A;  1H91 A;  5D45 A;  5B27 A;  1YWC A;  4YGG A;  4O49 A;  1ZRY A;  2HLV A;  3S5V A;  3HWE A;  1YWA A;  4GKC A;  4O3X B;  3B2K A;  4LKP A;  3APW A;  3O2Y A;  3O22 A;  1A57 A;  1ZNH A;  1ZNL A;  1YWD A;  3FEN A;  1OEE A;  3HOE A;  1I05 A;  1SY2 A;  1JBH A;  3T1D A;  2LKK A;  3APU A;  4IBA A;  3OD9 A;  3PH5 A;  3BX8 A;  4WBK A;  4NLI A;  3N91 A;  4I9R A;  3RKG A;  3P24 A;  4O3Z A;  3D95 A;  4DQ4 A;  3P6G A;  3VE2 A;  1GGL A;  2G78 A;  2G79 A;  3BU1 A;  3NPO A;  3IFB A;  3S60 A;  3U03 A;  3CBS A;  4K19 A;  1GM6 A;  2OVE A;  1ALB A;  2OVS A;  2OVA A;  3K3L A;  2IFB A;  1NP1 A;  2OFR X;  3VU1 A;  3ZUI A;  5JR8 A;  2RQ0 A;  3STN A;  1HMT A;  3C78 X;  1U0X A;  3PED A;  1LF7 A;  3CWK A;  5EZ2 A;  4AZP A;  1OEK A;  3Q6L A;  4D6A A;  1GKA B;  1ML7 A;  2F09 A;  4FQB B;  3EBW A;  1ZNK A;  4GET A;  2WSJ A;  2WEW A;  1IIU A;  5HZ5 A;  2RCQ A;  4YFP A;  4BVM A;  3KZA A;  2A2U A;  3ZW1 A;  1A2D A;  4YGZ A;  2L67 A;  1B0O A;  1FTP A;  3EMM A;  4ORS A;  3CR6 A;  3RSW A;  1T68 X;  2MO5 A;  4AZR A;  4NLJ A;  3WJB A;  5B29 A;  4AZN A;  4ORX A;  4ALO A;  2CM4 A;  2ZAG A;  2FT9 A;  5LJC A;  4YBU A;  3CQR A;  3ZW0 B;  2FS6 A;  3FA8 A;  3JQO A;  4N7D A;  4LQZ A;  3BU9 A;  1URE A;  4NNS A;  1BM5 A;  4QNI A;  2LBV A;  1KZX A;  5H9A A;  1GT5 A;  5KIC A;  5HWZ A;  2KW1 A;  3WJF A;  4IB7 A;  4AW8 A;  3AKN A;  2AMM X;  4YCE A;  4I3B A;  2MHD A;  1ZND A;  1SXU A;  3VG2 A;  4U8U N;  2NNQ A;  1B8E A;  3D97 A;  4O3W A;  1ACD A;  5LJB A;  1KOI A;  2LB6 A;  1FEL A;  3S5X A;  1D3S A;  3UEV A;  1SY1 A;  1DZP A;  4R0B A;  5H9N A;  1E02 A;  4KT5 A;  3FW4 A;  1G74 A;  1Z24 A;  4HPA A;  5HCC C;  4I3C A;  2Q2M A;  4CV7 A;  1GT3 A;  4WFU A;  2RCT A;  1X8U A;  4YKO A;  5H8T A;  1TXL A;  5HBS A;  4O3Y A;  5F6B A;  3P6H A;  3P6C A;  4IAW A;  1CJ5 A;  1HQP A;  1E5P A;  1GX8 A;  4XMC A;  3SAO A;  1BRQ A;  2A3F X;  3B2J A;  1EI5 A;  2M4L A;  1ICM A;  4OMW A;  3ELZ A;  2HMB A;  1XKI A;  2BLG A;  5F1E A;  5FQ6 E;  4FBO A;  5LJD A;  4YFQ A;  4COT A;  1ADL A;  3O19 A;  4NNT A;  2WWP A;  2MM3 A;  4KC7 A;  4GZV A;  4IB8 A;  4Y0R A;  3VG3 A;  3CQN A;  5DG4 A;  1Y9L A;  1CBR A;  4ZGU A;  3B2H A;  4MVE A;  2JU7 A;  5F58 A;  3I17 A;  4LKT A;  1I4U A;  4ZHH A;  1ZNG A;  5LJG A;  3TGC A;  1JJX A;  5AQ6 A;  1A3Y A;  1D2U A;  2QM9 A;  2W2F A;  4GH7 A;  2Q9S A;  3KFF A;  2X8S A;  1HBP A;  4GE1 A;  1EIO A;  3ZWE A;  1CBS A;  5LJE A;  3CMP A;  3P6D A;  1KT6 A;  5HAE A;  2X8T A;  3APV A;  2Q4N A;  4IMO A;  3ZI8 A;  4ZHF A;  2CM9 A;  2GTL N;  3OBL A;  2FR2 A;  4FBV A;  2FR3 A;  1QWD A;  2KD2 A;  5EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...