1GTVA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gtvA00
1I4TD 1CIPA 1UAAA 2ZE7A 1E9EA 2CBZA 1YJ5A 4GFDA 3GEHA 1E99A 1P72A 1MO3A 4QM6A 1PZNA 1G6OA 3PUVA 2ZJOA 4HUTA 4TSFA 1XEWY 3T35A 1VCNA 3AGQA 3AVPA 1A2KC 1CTQA 5EP1A 5BN5A 4B3DA 1KZGB 5L3SB 2OV2A 3AV0B 2QENA 4XWKA 1DOAA 4ASUD 5HZKA 2C9YA 1E2NA 3AF3A 2J7KA 2JLUA 3THWA 4X8OA 2OBNA 1XMJA 3SFZA 4KLNA 4XD7A 1J90A 2VP2A 3SI7A 1ZCAA 3KX2A 5JEEA 3KTAA 3H86A 1N6RA 5CM9C 2XSZD 3QJYA 3W6PA 3AKCA 3V9PA 2XOKA 3IILA 1JR6A 3A6PC 1OIXA 2QA5A 2XB2A 2O8DA 4EPVA 2AK3A 4KCGA 2PJRA 4Y0VA 1T0HB 3DMDA 3D8BA 2Q3HA 1NMXA 4I99A 1XTJA 4TYPA 4URZR 4BLQA 1U90A 4AKGA 5EZ6B 3X2SA 2GK6A 2WAYA 5HCNA 4CEHA 4GOXA 3QPVA 4CEJB 4OI2A 4TL7A 2SHKA 3MLEA 1KDTA 2CL0X 4JVLA 4IDNA 4P4SB 1KSJA 5C2JB 5KUTA 3QF7A 2BIFA 1ZU5A 3UANA 2REXB 2V8OA 2ZEJA 1R2QA 1XEXB 2FSFA 4JLDA 1OH6A 1NG1A 4KODA 1P75A 3TQCA 2IC5A 5GJWC 5CITA 3BH6A 1OXXK 1S4QA 3PCRB 3U7EB 4A8JC 1ZUNB 2QPTA 5BYKA 5DLQC 1NN3A 1E6CA 1FPMA 4IDQA 4EQ6B 1MKYA 5B2ZA 5FOXA 1NBMD 4B44A 3AM1A 4AKHA 2I1VB 2ZRPA 3SYNA 2F6RA 2A5YB 4ITRC 2EFGA 4Q21A 4MA4A 2RKOA 1XCMA 5DE3A 3B2EA 4BLTA 2HT1A 2WJJA 1P9RA 5AJXA 2VF8A 3RAPR 3TIFA 1KMHA 2XTZA 4AY2A 4B2IA 2J0UB 3MWJA 1G7CA 3AP1A 4GPTA 1QRAA 4HB0A 5DGXA 4Q5IA 3ADBA 3MRSA 1G17A 1IHUA 1CJKC 1DO2A 3SYLA 4CT4B 3OHMA 1TU4A 2R6AA 2GCNA 2W0MA 3RSOA 1US8A 2A5GA 4AYXA 2F1IA 4PXAA 5DHFA 3GLIB 3VHLB 1OW3B 3B1VA 3R7WB 3L0IB 4XSGA 3H4MA 1FW6A 3C5CA 3B60A 5TARA 4DEXA 4TYYA 1K5GA 3TVTA 1OT3A 3EA0A 1Z5ZA 2IEYA 2Q9BA 5P21A 3U4QB 1Z83A 3CPEA 3JVVA 3K70D 3DM5A 2QM7A 1KGDA 3QG5A 4P4UA 1E2PA 1P7CA 1UBGA 4TMTA 3T5DA 4EKDA 3NH6A 2W58A 5CB8A 5AJVB 1BYIA 1XBTA 1FNMA 1QBKC 3PUZA 5DYIA 3NG1A 1F48A 4JLMA 4JLPA 3W8RA 2WWWA 4O25A 5FR2A 2DHRA 2HCJB 2EW1A 2R44A 8OHMA 4IDPA 3SNHA 2DPXA 5CM8B 5L3RA 1WQ1R 4ABYA 3B1WA 5JECA 1T8UA 5JCZA 1I2DA 1KTVA 3OIYA 3EASA 3E2IA 3DZ8A 3AVVA 2P5TB 1FQKA 3HR8A 1WE2A 1TADA 2EFEB 4HDQB 4JKYA 4ON9A 3RLFA 3EIQA 4ZCLA 3S1AB 1U99A 2H7VA 3EZFA 1SVOA 1X8LA 1ZJ6A 2G9NA 3ZZUA 1RPZA 1DTSA 2OHFA 3DOFA 1YZUA 1AKYA 3OAAD 5KOYA 3BFVA 2VL7A 2OFOA 1CU1A 4QFMA 1SXJA 4ZKEA 3QIAA 3MWYW 2C8VA 1AZTA 1IXRC 2GESA 2PT5A 5KDDA 4BFTA 5GJCA 4ESHA 2GXAA 3CZQA 2NQ2C 4A1FA 1W4BA 1VDZA 4LCBA 3GPLA 3AB3A 5EXTA 4M1OA 1MRSA 5KTYA 4Z8XA 3KTAB 1Z22A 2X19A 3C8UA 2ORIA 3CZPA 3GJ0A 2GAOA 2IYXA 4DZZA 2VBCA 3CX6A 5KHOC 4M4SA 1G3IA 3LX5A 4LV5B 4BEBA 1UPTA 1NBME 3ICEA 3H0KA 2O8DB 3CH5A 1PLJA 2OZEA 4LHYA 4PX9A 5KNDA 3K0AA 2ZREA 2G77B 4CEHB 4OJQA 2B7BA 2O5VA 4NYMQ 4PSAA 2IYLD 2WSSD 4RD3A 4W5JA 3MCAA 3OEHD 1W0JD 1NN0A 2XZPA 3QENA 3OFND 4OHXA 1BMFD 1YZLA 4I1SA 4UXJA 4Q01A 2RGNC 3K53A 1MO6A 2GWHA 3W3ZB 4LJYA 2YOHA 3CRMA 1JNYA 4UNQA 5EUMA 2XZOA 3K09A 3ND8A 3ASZA 4B33A 4DT1B 1XNJA 1A2BA 2R8RA 3AP2A 3CF6R 4N0EA 5AR1A 4IXNA 1XPOA 4F38A 3RS2A 1E4VA 4NCHA 4DSUA 1OKKA 2XJ4A 2O8CA 2V7QD 1EFRD 3B1XA 2FG5A 2FMXA 4JLOA 2FH5B 2FPLA 5JRZA 1X1SA 4LHVA 1WRBA 4OQMA 3QVVA 5TV2A 2AR7A 4DB4A 2H8KA 2QG6A 4MGIR 4G5GA 2NTYC 3AKEA 5JSZA 2EYQA 3GLHB 3KDSE 4TYWA 5CJ2A 2BJWA 2GXSA 2CEAA 2JJ1D 3KXLA 1TQDA 4HDCA 4IOLA 1ZMXA 2CCKA 2HJVA 2P6RA 1JJVA 5EE9A 2ZSEA 1HT1E 2NOAA 2OFWA 4M1WA 4MYHA 4QOSA 4B3XA 1D5CA 1US8B 3QXXA 4GT1A 4GRAA 2C5LA 3QSYA 2GBLC 2FFAA 3A58B 3R9XA 3CR7A 4QGHA 1W7AA 2YOGA 1VG1A 2I1QA 5L3QA 4D80A 4JIMA 4Q9KA 5HE9A 2QN6A 2QROA 4YC7A 1II8B 4OHZA 2RGBA 3VFDA 1D2NA 3WNDA 3HWSA 4ARZA 2ANBA 4NKRA 4K46A 4TN1A 1K5DA 3QXSA 1A4RA 1RRGA 4EAQA 2C9CA 4JLJA 4A6XA 1QG2A 4DSOA 1CF4A 3BJIC 2GHIA 4CRWB 1RIFA 1XX6A 2AFHE 4KHZA 2J46A 1T91A 1RRPA 1E79D 4IVPA 3NHBA 4I1UA 1W4RA 3I73A 1ZU4A 3OE7A 2IXFA 3I32A 4LC0A 4KU4A 4DCSA 1HQCA 1GRRA 1OJLA 4N1AA 5HKKD 2VSOA 3VAAA 4PO8A 1N6OA 4ZI3A 2F7SA 2CDNA 1LF5A 1KNQA 2OEPA 2ATXA 2J0QA 4YXWA 4QGGA 2NO7A 3NH9A 4BFSA 5J4LA 1G3RA 2RMKA 3LY5A 2REBA 2PLFA 4Q47A 1RRFA 4KJZA 1FTNA 4LI0A 1WB9A 5K8TA 3NTUA 4US2R 3LNCA 1IOZA 5JJIA 1T3HA 1C4OA 1S0UA 3SE0A 1ZM2A 3JZMA 1GG2A 2R6GA 4Q03A 5IK2A 5SZJA 4MKHA 1SXJB 5F9FA 2D62A 1BH2A 3CUEF 3KKMA 4LJ6A 3O47A 2GTPA 3IQWA 4FI3C 4TQAA 1VKJA 4OQLA 1WBBA 4C0KA 1FMJA 2IS4A 1NKTA 1W4CA 5JRJA 3AVYA 4HATA 4ZCIA 1G8PA 1RYFA 2RCNA 3KUDA 4NYJQ 2HXYA 1NN5A 2X2FA 5TMPA 3TSOA 4D2IA 2JLSA 3UG6A 3ZVNA 3L82B 4NTZA 4JMPA 1G3QA 4TMKA 1NF3A 4B6EA 1KKMA 1G8HA 1U0HC 3D31A 1VHLA 5FUVA 3K0AB 3DVLA 3K0CA 4W5WA 3W5IA 4D0NA 4L8GA 2ZYTX 5FFMA 4Q4AA 1SKQA 1G8YA 1XZQA 5L8VA 4ZDJA 1IXZA 2LWIA 3EPJA 2FSIA 4EDHA 3X1DA 1Y63A 3MMPA 3KJHA 4IEEA 1AJEA 4QBFA 4N3NA 1PUIA 2CMKA 3EC1A 3NDBB 5CK5A 1KOFA 4A15A 4Q1CA 3GJ8A 1AA9A 2PT7A 1ZM9A 4MDFA 1GKUB 2XZLA 4RKEA 1NJGA 4HB2A 2CLSA 3THXB 4WOPA 4RD0A 2O8CB 1IN6A 3BFXA 1R5OA 3NEYA 4L4UA 1RC8A 3JZAA 2OO7A 2DY1A 1R10A 3KL4A 4MYTA 4RD6A 1MABB 1Q1ZA 3LQRA 1E2FA 5HPYB 3A4NA 3KQLA 1ONBA 4V0NA 2CK3D 2GKSA 2Z83A 5JSZB 1EFUA 2QBYB 1GTVA 3Q8XB 2QL6A 4B3GA 1VMAA 5JLJA 1JQLB 2JCSA 3FHOA 3PV0A 4NBSA 3VR6A 1KI9A 1S3SA 2R9VA 5FI1B 1Y3AA 3ZQ6A 1F6BA 1IN5A 1GOTA 4JL5A 1SVIA 1WCV1 4XOIA 3FFAA 4FXPA 5FTNA 2BBWA 2WSMA 3ZIAD 4NONA 2JLZA 1Q12A 4TWZA 2VLIA 3SFVA 1GRNA 4MRNA 3W90A 1D2MA 2JASA 2Q9CA 5EE1A 4B3FX 5L3QB 1FQJA 2JIZA 4ARZB 2FFHA 2C03A 2BCJQ 4NYIR 4XWAA 1F2TA 4E09A 3QBTA 4QKQA 4QRHA 2VHTA 1HEIA 2AD5A 4LJ7A 4EPYA 3N2EA 4Q19A 2NO6A 3DKVA 3GJ4A 2I4IA 1VIAA 5D3QA 1H65A 421PA 4RY2A 2ERXA 1D8TA 1G6HA 5H8WA 3SBDA 1PV4A 5FTJA 2IS6A 2WJYA 1SULA 1E0SA 4XVUA 4TLAA 2BM1A 2YINC 3IO3A 4E03A 1GL6A 2Q3MA 2QORA 2ZRCA 3TR0A 1OSNA 1KAGA 2VYFA 2J5XA 3A36A 3QQ5A 3KZ1E 4KBFA 3RWOA 3UMFA 4KFUA 4D0LB 4C0SA 1A5TA 4LBWA 1T5LA 1J8YF 4FINA 1RJ9A 1KO4A 4DLUA 1P2SA 5J4HA 2JLRA 1UKVY 3GCGA 1W5SA 2ZJBA 4MQBA 2QRZA 1IONA 4LHWA 1FP7A 1W36B 5AWFC 3BORA 2QQEA 1FL9A 4JLAA 1XP8A 2QGZA 4RCZA 1JXMA 3E1SA 2VH5R 3QF4B 3QUSA 1JR3D 4PZYA 2A30A 2K5UA 1KK0A 4OQNA 1T8TA 2QPAA 4V02A 2W0SA 3W3AA 3ZYCA 2ZRDA 2D74A 1KNXA 2A5DA 4CW7A 3J81k 1HE8B 4R98A 3VX3A 4BPBA 3Q72A 1Z06A 2IUTA 3M0EA 4E5UA 3AVTA 3IKJA 5KSOA 2ZJZA 1O3YA 4CZ2A 3W6NA 3UKDA 4FN5A 3Q5DA 2FFQA 1E0AA 2O52A 2GK7A 3FFBA 4PR0A 5DI9A 2FF7A 4C0HA 2OSBA 4H1VA 1QVRA 1X8JA 5J47A 4HAWA 3AKDA 1D6JA 1Q1BA 1Z28A 2HLDD 3ZZTA 2ZITA 2P67A 1NLFA 1Z08A 4FCTA 4E22A 2R65A 4D4LA 2IBMA 1KHTA 2EFHB 2HCBA 3U3KA 5JMTA 1YRAA 3B6EA 3KKQA 2AWNA 2EWVA 2RGDA 4MITA 4DBLC 3ADCA 1D2EA 2ZRMA 821PA 4QBIA 4WZBE 3P20A 4LBYA 4XSHA 2PZFA 3FKSA 2LKDA 1UKEA 2WPDD 3CX8A 3I92A 1OXUA 1TUEA 3CPJB 4HLQB 2RH5A 2WIAA 4HLCA 4KFSA 2IW3A 2P3SA 5FL7D 1VHTA 5HCIA 2LCFA 1P60A 2VPPA 4HDOB 3ZVLA 1Z0JA 2ZRKA 4KFRA 2FDCA 4TLBA 2O0JA 3WYFA 4A0GA 4KSCA 3IEUA 4PAQA 4DDUA 4A92A 3LV8A 3CBQA 4LJ9A 3UWKA 1ESNA 4KYUA 4Z51A 1SVSA 3B7GA 1KAOA 4M1SA 1P4SA 1CR1A 2KB0A 2O0KA 1LW7A 3GP8A 4MH0R 4YONB 1WMSA 5C4MA 1LS1A 3KB2A 1Q21A 1SHKA 1EK0A 2ZIAA 1M74A 5AUNB 1Q3TA 1LTQA 3CW2A 3PUYA 4OQXA 4UNSA 3T1OA 1XEXA 4DUGA 1E2LA 1H8HD 2ECKA 1LNZA 1TX4B 2IXEA 2F1HA 2L0XA 3M6AA 4URYR 5FBLB 4ZO4A 2GJSA 3FPAA 1XMSA 1MT0A 4JBYA 2ERYA 4H1UA 1N5IA 4LOAA 4IKEA 4EQ6A 2ZSAA 5DNYB 3BBPA 2NG1A 3CWQA 4B2PA 3IHLA 3O8DA 5DHAA 4HLDA 3FMFA 4LGMA 1F2TB 2O8FB 1Q57A 3GJ3A 1I4DD 1KY3A 1OXTA 2J0UA 2PZEA 5G3YA 1Z6TA 1R5NA 3REFA 5EXXA 1JR3E 2YWGA 5FUWA 1E2JA 5IDVA 2QUZA 3QPWA 3LAWA 5KO2A 4A9AA 1OH8A 3BB3A 1B23P 4F4IA 3VKHA 5FPSA 4LYHA 3U3MA 1ZUIA 5JHGB 4F4CA 1VYTA 3FDIA 2BM0A 2RHMA 1N0UA 5TY0A 5IRCD 5AK0A 1WXQA 1WF3A 2FZ4A 1G4UR 2GXQA 2BKEA 1FTSA 2ODBA 3WP1B 3KXIA 5B58C 5KNBA 1HH4A 2BMDA 5ELXA 1E1QA 2WZQA 3GEIA 4U02A 1ZRHA 4WXRA 5UKDA 1NG9A 4D81A 1P62B 2FFBA 3DM9B 2NZ8A 4URVR 1EFHA 2IUSA 2ZM5A 3U4QA 1T0JB 1RJ9B 4JBXA 4ASUA 3KQKA 2DR3A 2MMCA 1N6HA 3MJRA 1UBFA 1AK2A 2D7CA 4IXMA 3AVXA 4ACAA 4JLKA 2VIIA 4RKFA 3PEWA 1NMYA 1DE0A 2CHVA 4H9GA 3B9QA 1OXVA 1PLKA 2ZJ2A 3DKPA 4BE7B 1EESA 2XSZA 2JJ2D 4BZPA 1COWD 2HYDA 4LUCA 2W2TA 4DCTA 1W47A 4XTCS 4Q9JA 3TSZA 2J7PD 3BH7A 2OAP1 1SVMA 2UKDA 1QDEA 3LXXA 3MFYA 4KITB 3VKWA 2ZYVX 5BWMA 1UEJA 3Q7QA 1E2GA 2G6BA 1G41A 4HLUA 3SU8A 3T1VA 2BMJA 3W9YA 1G19A 3IUYA 2TMKA 3S1AA 3TNFA 4TTQA 1NSFA 4TMVA 3RS5A 3ZQJA 5L3VA 2GETA 4B75A 4HI0E 4DSNA 2WWIA 3NBFA 2YV5A 1VPLA 4DIDA 1XTRA 1X3SA 4UQOA 2GZHA 3GJ6A 2YOFA 2GJKA 4JL8A 3SS8A 4P32A 1RRCA 1IAQA 4HAVA 3I72A 4ILEA 3HP1A 3U7HB 5GJBA 3D7MA 3SJBA 1N5LA 4DB2A 1Q22A 3CF0A 4QJ4A 1RZ3A 5FOWA 2RGGA 4EFNA 1NBMA 4AK9A 1VYUA 4M9ZA 1A82A 1AN0A 4M22A 2ZROA 1E9SA 4GDFA 4GOJA 5LD2C 1R0ZA 3RSLA 2OCBA 1XRJA 2VO1A 3NBXX 4FMCF 3NEJA 4Q1EA 1SVWA 4DRZA 5CDFE 1XXHE 4AURA 2J0VA 1M7GA 3TMKA 2GVZC 4PC3A 1MH1A 4JVNA 2D7DA 4RCYA 5G53C 2FGKA 4P0TA 3FYHA 1SQ5A 2ZJAA 3A8TA 4QHSA 2WAXA 1G21E 1XJ0A 5EE3A 2C96A 4R2HA 2IX3A 2ZJ8A 3WBKA 2DFLA 3K9NA 2UZIR 4HZUA 5LB2A 1OFHA 3DPUA 1WBDA 4DT1A 2GF0A 4BFVA 1S2MA 2KBEA 3HJNA 4UXHA 1CS4C 3WMEA 2WJVA 4LJ5A 4HZIA 2ZU6A 2JLYA 4IW3B 2ZSFA 1YE8A 3EZ6A 3BOSA 4US0R 3BFKA 4TSFD 4OHVA 4ZPXA 4LX0A 4DLZA 4KFTA 1ZNXA 1G9XA 4RZ2A 1CBUA 3UG7A 1KSGA 1YR8A 3A4MA 1OB2A 3GLHA 2A9KA 3CB4A 3MAAC 4PZLA 1YZQA 3RRNA 2V55B 4ERNA 4QBHA 2VHQA 2ZJYA 5AUPB 1K8RA 2AD1A 5CJPA 1L8QA 2WICA 2VRWA 4XIGS 2IYUA 2A3RA 1OV4A 4QGAA 3OZXA 2HDNB 2I3BA 3PFIA 1P6XA 2QE7D 2NPIA 1BKDR 3K9GA 1YHNA 1QZXA 3OAAA 1NIJA 2GCPA 1XWIA 2BMEA 3WHLA 2CE2X 3U3JA 2C99A 4GZMA 1NLZA 3DDCA 1II8A 3CKLA 1DADA 4OL0A 521PA 3LQQA 1UKZA 5SZIA 1M34E 4GNKA 3ZGXA 1E2EA 1MV5A 1ZYUA 1KMQA 2Z43A 3ETLA 4NYIQ 2GZDA 2A2ZA 5JBQA 2FJUA 1G7TA 4BLOA 4D82A 3K0EA 4V03A 4KXFB 3GFPA 2ZPTX 1MO4A 1T4GA 3SN6A 2DCUA 4DLRA 4NCKA 1F2UA 3GFTA 2WBLC 4G0NA 3EC2A 2QMEA 1TTTA 5CIWA 1OE0A 2WSSA 3HDTA 4KSBA 2IYYA 2NIPA 3OEHA 4OK5A 2UVQA 2ONJA 1W0JA 3SQXA 2CL7X 4M0LA 3GLGE 3KQHA 1LS6A 3LD9A 3M1IA 1BMFA 2A78A 2VP4A 4G1UC 4JJKA 4MRPA 2ZI6A 4DWJA 3K9HA 3WMGA 5CLQA 4UJ3A 5A0FA 1VIYA 3NBZC 4M1YA 3KFVA 2RAPA 4WZAE 4KI0A 4NP6A 4DDVA 1NY5A 5TDHA 2H18A 1G5TA 1T5IA 1VECA 4LRWA 1GRQA 4C9BA 3IGFA 2AL7A 2OESA 2OCPA 3NXSA 4V0ME 3RYTC 4L9WA 4ZDKA 1NNEA 2WVJA 2PCJA 4Q7KA 2V7QA 2D3WA 4OI1A 4QG7A 4ZIRA 2XGJA 3RS4A 2W83A 2GF9A 4FWTA 3L0SA 1E2DA 2VA8A 1GL9B 1R7RA 4PSKA 3PEUA 2JA1A 1ZW6A 1AZSC 1FZQA 3U2QA 1FOEB 1L4UA 2ZQ5A 2JJ1A 1ZM4A 1X86B 2V1XA 1FP6A 3HYTA 3LH5A 2JLXA 3Q9LA 2ZJ5A 5KSPA 4TZ6A 3LRPA 3LW7A 4HAZA 1S1MA 3RHFA 4GMXA 4TZ0A 2BMFA 1CXZA 3VR3A 4HYYA 3KXKA 5DN6D 2YHSA 1YRBA 2O8EA 1DAMA 4HZUB 5J4YA 2BBOA 2OCAA 3AQ4A 1U8AA 3KFXA 3RS0A 1TF5A 3A1VA 2E87A 3W6OA 4L5BA 2FN4A 2OBLA 3B8HA 3K0CC 5EP3A 2Q0HA 3CRW1 2WWHA 1ZNZA 2XJ9A 4M1KA 3RANA 1KSHA 4BASA 2QNRA 4IJMA 4YMSA 3THXA 3K70B 2Z5FA 2WJHA 2JATA 5E7IA 2IYTA 2CE7A 1SZPA 1CRPA 2JDID 5A5GA 1E2IA 2CVHA 4TL8A 2ZAMA 5G41A 2FNAA 2CLDX 1E69A 2UZ3A 4K8OA 3T1QA 5C18A 1G4AE 1HA3A 1MABA 3DO6A 3IPYA 5EP2A 1Q20A 1CEEA 3QBVA 1E79A 4BFZA 3U7FB 5KDLA 2REOA 4DDWA 5GJVC 3WY9A 3EIEA 2QBYA 2V3CC 4R71A 4P33A 3AVUA 4HAXA 1JBKA 1LV7A 1KDRA 1NVUQ 1BO6A 5HKKA 4LDJA 2F9MA 2ZU0C 5J4KA 4JVMA 3OIUA 1OH5A 4LHXA 1YKSA 4TTRA 4EFLA 2AKYA 4M21A 2ZI4A 1DS6A 4Q48A 4JLNA 1KK3A 3V4RA 3ZS9A 2ZVQX 3VNVA 2FEOA 4URWR 1I4LD 4PPNA 4P3YA 1VG9B 2ODNA 5TB5A 1TPZA 3R8CA 1ZD9A 4EJSC 2DFNA 3C14C 4A4DA 3VHXA 2OFXA 4PHFA 4DEYA 2DWPA 3E5HA 2CCGA 1GDDA 2OUKA 4Q9IA 4B2LA 3TBKA 5FUYA 3DEFA 3F3YA 2QTVB 1PUJA 4PPQA 4GP7A 4NHOA 1P2UA 3L8ZA 3QEOA 1E9RA 1JI0A 1UBCA 2PMKA 3NVAA 1NVXQ 3CNNA 4OYHA 1C1YA 3SYKA 4EPTA 1XPRA 4LSGA 3WXMA 1NKSA 3W8NA 6Q21A 2GA8A 3TQFA 4LK2A 4LJAA 1NVVR 3LDAA 2VSFA 2YWEA 5FI0B 1F2UB 2GCOB 2QP9X 4CF7A 2EQBA 2EVWX 1EWQA 4IEIA 2F1RA 3CM0A 1SKYE 2QAGC 3IHWA 4W9MC 1AIPA 1NP6A 2ZRGA 2GJ9A 4C0JA 2R6CA 1AKEA 2DB3A 1IJFA 2AX4A 4ZI2A 1HUQA 2FOLA 5HR5A 1Z6AA 2DYKA 3BS4A 4J0QA 2B8WA 4PC2A 5H70A 3QF4A 3WBJA 2WJGA 5FPTA 2Z4SA 5AUQA 3D6TB 1DO0A 1TF2A 3LBIA 3TW4A 3RVBA 3SJCA 4D25A 4Q4HA 2WKPA 2A7QA 2G0TA 3LW8A 3SOPA 2IF2A 2QTFA 5BYJA 4DCVA 3O8CA 4ZIRB 3AF2A 3LLMA 1YR7A 5FBRB 3FGNA 4MUBA 3GQBA 2PJZA 2D06A 4X8MA 5JS8A 1XB2A 2G1JA 2B8TA 4OK3A 2Q6TA 4LJ8A 1Z2CA 5F3WB 4MGZR 1DARA 1XU4A 3OIWA 4F92B 5FBWB 1QF9A 3BAFA 1IY2A 3BRWD 1KO5A 2WOOA 2D2EA 2XX3A 3E70C 5EP4A 1R0YA 1Q1EA 3TVDA 1IY0A 1W0KD 2HJGA 3QE0A 4G3XA 1VCIA 5JS7A 2NMVA 2X1VA 1U8YA 1KI7A 3DOEA 4HAYA 2X77A 4JYBA 2RGNA 2DFKB 3FMPB 4C3ZA 2O8EB 1N2CE 1OXSC 5B30A 5JCPA 4BQSA 5JWHA 1P61B 4LY6A 5IHPA 3Q3JB 4NDZA 1NVWQ 3RRZA 2HXSA 2EWWA 3QKSA 2HT6A 1GNRA 1ZINA 3R20A 1IXSB 4A8JB 1GAJA 2ZSDA 3NWJA 4JLVA 3TR5A 1JEEA 4YXWD 1G8FA 1M7HA 2AFIE 5E95A 2AK2A 5BW8A 4TYNA 2H1LA 3IO5A 4M9XA 1NLYA 3LBHA 1GILA 2F43A 1ZBDA 2HF9A 3TAUA 4I1VA 3WHKA 1R0WA 5LB4A 2G1KA 3EA5A 2QMHA 4Q66C 4DXAA 3ND9A 2FWRA 1N6KA 2ZRBA 5FTLA 3OEED 2JGNA 2QMOA 3RDPA 1NL3A 1N0WA 3BIFA 3WMFA 5G40A 4BFUA 4PHTA 4EPRA 4MRRA 1M8PA 1W2GA 1W49A 3TH5A 4M1MA 1J70A 2W00A 4TL6A 3BWDD 3VR1A 2NO1A 2FU5C 2W6ID 2Q9AA 3PG5A 4RZUA 1QHHA 5GADl 4QNRA 4PFSA 3CNOA 2H92A 1Z8FA 1D9ZA 4MGYR 1RKBA 2OG2A 4LYAA 5BN4A 2YYZA 2VF7A 5D3MA 5JJKA 1JPNA 2OM2A 3BGWA 4D26A 5BQ5A 1OB5A 1JR3A 1XEWX 3QKUA 4AG5A 4IOKA 4QHTA 5CYPA 4AD8A 4DDTA 1PVOA 5H68A 2O8FA 2JJ8A 1VG0B 2D4HA 2W2XA 4AG6A 4O3MA 2E1RA 2HF8A 4Z1MD 4Q1FA 2IS1A 1JB1A 1G16A 1SGWA 1U8ZA 5G3ZA 2E9SA 3H84A 1U9IC 1E2MA 3I5YA 1DAEA 2ASEA 3I61A 2XNSA 5LDDC 4JS0A 1NRJB 2MSEB 3UMRA 2QU8A 5DIFA 1ZD8A 4Q7JB 4KBGA 4P4TA 2HLDA 2WHXA 3DZDA 3TKLA 3TAHA 1EGAA 4XWOA 4DLYA 3MWKA 3FHCB 1E98A 4GSYA 3T12A 1X6VA 3I4LA 2C2HA 2DFTA 2NGRA 3ZVRA 2OBMA 1P9WA 4HB3A 3SDZA 1UJ2A 4EUNA 3O8RA 4GZLA 5CYOA 1M1YE 1DAKA 3BB4A 3U6BA 3THOA 1H8ED 3U3RA 2WPDA 2QPOA 3C4JA 1BS1A 5JWRA 4HUQA 1OIWA 5SZHB 2GVDC 2V4ZA 4LWZA 5FL7A 2AXPA 3PITA 3I1FA 2C04A 1AS0A 3VX4A 1TAGA 3HPRA 2QTHA 1IM2A 2ZYUX 4Q4HB 3U7GA 3NHAA 4Q4JB 2NPFA 1Z29A 5EZ5A 1NI3A 2ZE6A 1XMVA 2DWQA 4LZZA 2NO9A 2XNDD 2ODEA 4YMUA 2QZ4A 4BLRA 3RS7A 4U5XA 1EFTA 2PH1A 3RNLA 1GM5A 3VR4A 2ZS9A 2IWHA 3GLFE 5IT5A 4PZZA 1QG4A 2YKGA 3WP0A 2GJAA 3UIEA 1H8HA 3I3SR 1E9AA 3FWYA 1E9FA 3LXRA 3AP3A 4DVGA 3IBGA 2BVNA 4NPHA 1XTSA 4MKIA 4XH9B 5E7JA 1E96A 2JEOA 2FZLA 1ZNYA 4V0KA 4X8LA 1J8MF 2CVFA 4LYFA 2P5SA 5KDOA 4L9SA 2N1BA 3EARA 2HYIC 4C0QC 1CULC 2HUPA 4S2EA 5CDFA 2H16A 1XXHA 3I8XA 3QKSB 4NYMR 2RHDA 4TMXA 2JLWA 5JHHB 3G0HA 2GDJA 1IBRA 4DHEA 2ZR7A 1JPJA 4MDEA 4DJTA 4PC1A 5DYGA 3PEVA 4Q1DA 4QC2A 4I81A 1G64A 2F43B 3A1TA 1TNDA 4FWIB 4Q1AA 1KDOA 2P2LA 3QKRA 4AYTA 1Z0IA 4O2RA 1DBSA 4Z54A 1G20E 4GMDA 5C46F 1PJRA 1VCMA 4G5OA 4IFBA 4UNNA 2WTUA 2A5JA 3PENA 3FHTA 2IA5A 4MYCA 4UNPA 3SJAA 5F9HA 2KE5A 1M6NA 5DO9A 1Z3IX 4PAOA 1QHHB 4V0OA 2DWOA 2QEQA 4A2QA 3B82A 3SQWA 1GFIA 3SJZA 4NH0A 4FW9A 3CO5A 4Y0AA 3KQUA 2B6HA 2LKCA 5D3MB 3GFOA 5DI3A 3RC3A 3EWAA 3FMOB 1AQYA 2Q21A 4LV6A 5GVRA 5EQTA 3R9WA 1COWA 2VQSA 4DC9A 1NY6A 2WIBA 1FUKA 4HB4A 1UF9A 5FPYA 4LBZA 1N6LA 4KYIB 3VQTA 1YZTA 4AC9A 1OH7A 3MUFA 4TLDA 4B43A 2IWRA 5BXQC 2YZ2A 1DAFA 2B21A 2WWFA 4EIWA 4TMWA 2GZAA 1DAIA 2YVUA 3R8FA 2P6UA 1QHIA 3K0FA 1M2OB 4PANA 1KJWA 2DBYA 4JBWA 3BC1A 3CRRA 3D3QA 3VU9A 4MRVA 4IVQA 2QP3A 4WZ6A 1R4AA 2OCYC 2ORVA 3GJ7A 1IQPA 4O0MA 5B57C 2HV8A 2CLCX 2Q3FA 3IIJA 1DPFA 2VP0A 4G5RA 1GKYA 4DLVA 1TF7A 1OFTA 4BRUA 1MR3F 3AUYA 2CHGA 4C4PA 3SHFA 4C0LA 5KSZA 4WAUA 3UATA 1U0LA 1GNQA 2BDTA 3FTQA 4QL3A 3RABA 4D6PA 1OFUX 4NU0A 3C16C 4PHGA 4IFEA 2H57A 1EX7A 3WNBA 3LX8A 2MMGA 2ZANA 3NBYC 4HUQB 2ZRIA 4YMWA 4BFYA 1ZM3A 1HTWA 1L7VC 4MKGA 4WA7A 3BERA 3GD7A 4QJ3A 3HR7A 2VHJA 3VTKA 3GLGA 1YZGA 5EE5B 2CXXA 1EX6A 3UMSA 4OHWA 1KI1A 1XD2A 2F1JA 2R6DA 3OIVA 3P1JA 4G5QA 4JKIA 3SHWA 4XJXA 3T1TA 2IL1A 3MJHA 1KJZA 2ZUBA 3LA6A 3QEJA 4AYWA 2OE2A 4TYQA 1O87A 4V0MA 3I5XA 1G5PA 1X1RA 1E1RD 1CR2A 5KPDA 1LF0A 1WP9A 5FUXA 1Z6XA 3QG1A 1U98A 3KKOA 3P32A 2WKQA 2ZXUA 4NYJR 4Q7MB 1P2VA 4CGZA 2IS2A 2BV3A 2OXCA 2BEJA 1G7SA 1W4AA 3CIOA 2CJWA 4BFXA 3RC8A 4YDHB 4NE2A 3TW8B 4FMDB 1Z6YA 3CRVA 1G7RA 1SXJC 2RGEA 1XXHB 4LPSA 1YU9A 4D4MA 1E1QD 2MSDB 4AIIA 4TT3D 1SVLA 3GEEA 1Z0FA 3IIKA 2W6JD 1S9DA 3AGPA 4PTLA 2ZI5A 4QHYA 2QRNA 4RVCA 1TQ4A 3SC3A 3FOZA 1AS3A 2J41A 1G18A 2CNWD 3BB1A 2GEDA 5AUOB 2AXNA 4B35A 1OHHD 2J87A 2XTMA 3QKRB 1Z0KA 3PUWA 4Z8YA 4F4JA 3U6KA 2ZI9A 2QQ0A 2QE7A 3IBYA 4GL2A 2Z6VA 3AVOA 2ZUDA 3DHWC 2V1UA 3AF1A 3AF4A 3ZS8A 3PJRA 3JVUA 4DLXA 4C2TA 4F93B 3QI2A 3B5JA 4A0HA 3THYB 1Q3HA 2ZS7A 3TUZC 2ZE5A 4B34A 4HAUA 4Q18A 4URXR 1WA5A 1GP2A 1G5RA 1KSFX 1P9NA 2IUUA 1A7JA 2G3YA 4Q1BA 3LVRE 4BECA 4PAMA 1KYIA 1OIVA 4XVQA 1F3OA 1UKYA 2QI9C 4OJKA 1TMKA 5DI3B 3NC1C 3CONA 3EIHA 1Z0DA 4B48A 3AVQA 1N5JA 2PEZA 2ZSBA 3K09C 5DH9A 1GUAA 1KI3A 4NCNA 3EPKA 1JECA 4F7WA 4C0AC 4TQUS 2ATVA 2QP4A 3ONWA 1ZAKA 3EXAA 3PEYA 4PQFA 1P5ZB 2KWIA 5KNCA 1MO5A 1S96A 2A5FA 1ZIOA 1Z6GA 5FBQB 1Q1QA 5SZKB 4XD7D 5LPNA 3PR1A 1ZC4A 1V43A 4WVFA 3OF5A 1ODFA 1U81A 2OLKA 2WJIA 1UBEA 3K0FB 2YC2C 4Q02A 1E9CA 3VU9B 4ESVA 1TEVA 2XOKD 5CK4A 4X8HA 1FX0A 4L15A 1DAHA 4ZDIA 1YR6A 1UADA 3AEZA 3K9LA 5FL3A 3EPHA 4A2PA 2ZS8A 3N70A 2QGNA 1XD9A 2IT1A 1N6PA 1QHNA 2QSYA 1JXOA 3K0SA 1SVKA 1E0KA 1N6NA 4JSTA 1RE0A 1KIMA 5HTKA 4PPGA 2ZTSA 3TGPA 1E3MA 2JLVA 2BBSA 3CF2A 5H1YA 4B3BA 4LV8B 1E0JA 1UEIA 4B73A 2GEVA 1ZUHA 3GLIE 5J40A 5FOSA 3GLGB 1BOFA 1EG7A 2GCOA 2VEDA 1KK1A 721PA 3K1JA 1P2TA 3PXGA 1XD2B 2XEXA 1HT2E 3KQNA 3C7KA 5JZVA 3OFNA 5J5CA 1UM8A 2BWJA 5LBIA 1KJYA 3MD0A 5J4VA 1XMIA 3EWSA 4A0RA 5DN6A 1T6NA 4BUJA 3RWMB 1OFIA 2F9LA 4WW0A 3TK1A 1NIPA 4JL6A 1ZC3A 4BLSA 4XTRA 1OPXA 5K8IA 4QM7A 4C30A 3TE6A 3U60B 1RYHA 1VCOA 2ZRNA 2JLQA 5CB6A 3ADKA 5GVSA 4IHQA 1CKEA 4D0GA 2JDIA 1EFRA 2CJWB 3B1YA 3EX7C 3B1ZA 3BE4A 5KU1A 4S35A 1W36C 1QHGA 4PQYA 4PC7A 3C41J 3I8SA 4M9SA 3EZ7A 4DCUA 2IF0A 2C95A 1ZM7A 2IYVA 2VP9A 3U61B 4EPXA 2IYRA 2R2AA 1R5BA 4DLWA 3L0OA 1ZNWA 4E07A 4OI4A 2J1LA 3THWB 1KK2A 3Q7PA 2YJTD 3FE2A 221PA 3UXMA 1V5WA 3MG9A 4MUAA 4ACBA 5JJLA 1TUIA 4DLTA 3EZ9A 2X8AA 4TL9A 2PL3A 2B92A 2Z0MA 2ZE8A 4UNRA 2PLRA 2O8BA 5FTKA 2QT0A 4RD4A 1P3JA 2MSCB 2PCLA 4NZYA 3WYAA 2FE4A 1XTIA 4FMDF 4Q4LA 1XDBA 4IVRA 5B64A 2G88A 1EFCA 5FPKA 4JYCA 4QJ5A 5TXGA 3GMTA 3B9PA 4M53A 3RS3A 2J9RA 2IYWA 3V4FA 3Q85A 2OAQ1 3LO5A 4IOJA 5FPHA 3TUIC 3MGCA 5E7MA 4B6FA 621PA 4A8JA 1L2TA 3BD9A 4R7ZA 1GITA 1W44A 4RZXA 3B85A 121PA 4CT5A 4AKEA 2FPMA 3F5FA 4NCJA 4B74A 4BGDA 1XCPA 5EE0A 4JT2A 1SXJD 2C78A 3EW9A 2FA9A 3P4YA 2CL6X 4KAXA 2KSQA 2ORWA 2BKUA 1CR0A 1IN8A 3TUJC 3T15A 2XXAA 2QY9A 2BOVA 3QPUA 4PSVA 2J45A 1ZIPA 1FUUA 1RVDA 2BCGY 1L4YA 2XTNA 4G5SA 2QAJA 4GBMA 4ZV4A 2O0HA 5C1BA 4POAA 1HYQA 5JEDA 4JZKA 1CP2A 1HURA 1ZP6A 3QVUA 3P26A 3PUXA 2ZRHA 1AGPA 2CHQA 4WIAA 1FX0B 1KMHB 2C77A 3LLUA 4IDOA 3ICQB 2ZRAA 3KKNA 4BFWA 3QXJA 1GKIA 3TLXA 3CR8A 4A36A 4W7SA 1CJUC 2PX3A 3DL0A 2QSZA 4M1TA 3GLHE 1E9DA 4BZXA 4AI6A 1HE1C 1ZVQA 4D4JA 2B7CA 3AH8A 5HE8A 2V9PA 2F55A 2WWXA 3KUCA 2XITA 3REGA 3KJIA 3FKQA 1G3MA 2PMDA 4Q9HA 3FMIA 2N46A 4OQFA 3IIMA 1SKYB 1XJQA 3BH0A 1JEDA 1S1CA 3ZVMA 2IHBA 1KY2A 4KO8A 1OKKD 2PX0A 3CRQA 2FSHA 4LC1A 1U2RA 2JAQA 4GOKA 3WYGA 1TQ2A 2C9OA 2G0NA 4DSTA 1N5KA 2YWFA 3ASYA 4RJLA 1W0KA 4K81B 5HZHA 3G5UA 3ZLJA 3C15C 3T06B 1T3SA 3X1WA 2ZRJA 2IEZA 2OILA 3ZZ0A 4Q00A 2EFCB 1QHSA 2ZVPX 2FEMA 3A1UA 3RRMA 2J0SA 1OLOA 3X1YA 4QNMA 1W5TA 1YQTA 4Q7LA 3L43A 1N25A 2PBRA 1E2HA 4TMZA 3L0PA 1JALA 2R62A 4Q4JA 2ODWA 1ELOA 3DMNA 1FFHA 1J2JA 2IHYA 3ZD7A 1U94A 4M9QA 1F5NA 4HSEA 2GAAA 4TTPA 3A4LA 4US1R 3B78A 2XAUA 1XTQA 4A6PA 2CK3A 3R9IA 3GLFA 4KVAA 3KKPA 4ZDWA 4C0BA 2RGXA 2W2VA 1CJVC 3ADDA 4P31A 1YR9A 4JLBA 4OI0A 3OEEA 1DG1G 1KDPA 5LD2B 3QXCA 4CIDA 4MRSA 1KI6A 5AJWA 3UPUA 3CH4B 1JJ7A 4I1OA 1SXJE 2YWHA 2VP5A 1GL7A 2QT1A 1Z63A 4QGFA 1XF9A 2KI5A 1QVAA 4TLCA 2W6IA 4TLEA 4PPFA 1PLLA 1KI2A 3ZIAA 1WDTA 1MRNA 5EXPA 2O8BB 1SHZA 3SBEA 2YC4C 5EXSA 4A0FA 3I62A 4FCVA 3OE7D 2AN9A 2F3RA 4JJZA 1JAHA 3TRFA 2GRJA 1GNPA 3QXHA 1Z0AA 4EFMA 3ZH9B 1OYYA 2GXUA 4JT4A 1IN4A 3U5ZB 1Q0UA 1XZPA 4QXAA 5AJZA 1F60A 1AM4D 2KJQA 4CVNA 3KJGA 5CIQA 5FBVB 5KPJA 1DAGA 4Z1MA 2AHOA 1E4YA 5JWOA 4C7OA 4L16A 1W36D 4AKIA 4G01B 1GZSA 3TSWA 2V6JA 5F2EA 4HEJA 5IK2D 1JQJC 2AWOA 5DSZA 3G82C 4GI7A 2YNMA 2EFDB 1G291 1CJMA 4FD2A 4YMTA 2XXAB 2BC9A 3CNLA 1DG3A 2BJVA 3NIBA 3LFUA 2FGJA 3PQCA 4LYJA 4QBGB 1NJFA 1W46A 4Q9LA 5K8UA 2J59A 4YLGA 5EUQB 3U3OA 1R8QA 4B3CA 3WRYC 1FNNA 4CDGA 4R2IA 4TQ9A 3QY0A 3PVSA 1DELA 2GBLA 1KO8A 4N0DA 1XTKA 4FMBB 1II9A 2IYZA 1ESMA 1KO7A 1AGRA 1EWRA 5C4GB 1HY3A 2G83A 3T61A 1W48A 1H8EA 2ZI7A 1DVRA 3EG5A 1RW4A 2WV9A 3VR2A 4U00A 1M7BA 5CLLA 5KSYA 2VP6A 3ZDQA 4EJSA 1MOZA 3P27A 3F8TA 3UWOA 4BLPA 4KLZA 1C9KA 1LB1B 1XJCA 2VHCA 1ETUA 2ZETA 2F3TA 4CYMA 3K8YA 1TEXA 3U44A 1J7KA 2HEIA 2IYSA 2XNDA 3A1WA 4W5HA 3FB4A 3ZD6A 1AQUA 2R6FA 2NO0A 4PO1A 4RFSA 3V00A 1LFDB 3WRXC 4RD1A 2Y8EA 1W1WA 3CX7A 4MKFA 3IDQA 1HQYE 1XEFA 3EZ2A 2VTKA 1N0VC 1FMLA 3IPXA 2RGCA 5FOTA 2FSGA 1VYVA 3Q5EA 2QAGA 3MSXA 2H5EA 1IN7A 1G3UA 4NMMA 4BEJA 1G8GA 4DKXA 3NKVA 4UJ5A 5IF9A 4RZ3A 4LHZA 2GNOA 1D9XA 2V6IA 2WMNB 3GJXC 1TU3A 4OK6A 1KI8A 4CEIA 4RFVA 5EJEA 1LY1A 2OT3B 4B71A 1IJEA 5FH9A 2FPKA 5F98A 3VR5A 1S9HA 4B76A 3VNUA 3VKGA 1W2HA 2H17A 4XVRA 2WMOB 1J99A 4RD2A 3GLFB 2IK8A 1UFQA 1BYUA 1OYWA 3HU1A 1T9HA 4IOMA 3QKTA 3SZRA 1S3GA 3BXZA 4FCWA 4II7A 2P0EA 4LPKA 3HU3A 2JIZD 2FX3A 4R9UC 3HYRA 3B13B 3LWNA 1YZNA 1KI6B 1HV8A 1LVGA 1Q44A 1XFAA 1Z07A 2J3EA 3IQXA 3C5HA 5BN3A 1A1VA 4OHYA 2ZR9A 3L8YA 4RSGA 5JI2E 4MGKR 3X1ZA 2WM9B 2D2FA 1NMZA 4DLSA 4HLUC 3O8BA 1R8SA 4WBSA 1E9BA 4V0LA 2RGAA 2C98A 3LVQE 3SR0A 3RRYA 1ZD1A 1GSIA 1II0A 3A1SA 5L3SA 4FMCB 4Q4AB 5M04A 1XD8A 1B0UA 1TL7C 4I4LA 2FV8A 3F0TA 4YDSA 3EPLA 4EPWA 1E94E 2RB4A 4C7OB 5FTMA 3T5GA 2NZJA 5DISB 2OLJA 4WXPA 2ANCA 3L2OB 3HPQA 1KI4A 4MYUA 1NN1A 1GVNB 1R0XA 2XB4A 1U0JA 1RFLA 3PIRA 4AWXA 1YVDA 1R6BX 2WOJA 4IDHA 1EXMA 1CR4A 4O2LA 3SEAA 2ZAOA 4B32A 2ZUCA 2EYUA 1IY1A 3AKYA 1BIFA 1E2QA 2CCJA 3OESA 5ANRB 5A4JA 4PQRA 3MWLA 4F91B 3THYA 5E3HA 4UXIA 4PO9A 1CRQA 1YZKA 4M2LA 5JI3E 1UDWA 4OKSA 3FVQA 3NDPA 4A2WA 4CEJA 5AJYA 4C2UA 3X1XA 2VHUA 2BHRA 3NC0C 3AVWA 3HU2A 2JJ2A 4P4SA 4PC6A 4A82A 2WWYA 3A37A 1VG8A 2QM8A 1N6IA 1TQ6A 2EU8A 3QNUA 4EJSB 4KVGA 4NL4H 3LBNA 2GEUA 2OXRA 2BEKA 5E4FA 3QOFA 1XCGB 2J7PA 4IRUB 3K70C 3KB1A 3H2YA 4BZQA 1XPUA 2GILA 1S8FA 1QHXA 2P6NA 1CLUA 4NCIA 4LJ4A 4KV9A 4DIEA 1Z47A 2ZR0A 3U44B 4ZKDA 1Z2AA 1ANKA 1U9IA 1KO1A 2AKAB 1ZCBA 3BK7A 3FKSD 1N3BA 4GP6A 3CPHA 1UDXA 2IXGA 4RFSB 3GJ5A 4PHHA 2ZRLA 1JAIA 1G1MA 3P4XA 4UKDA 1X8KA 5JFGA 4LBVA 3IEVA 1P73A 3WNCA 1E1RA 3N5CA 2ZRFA 3KJEA 3M4YA 1GIAA 2WWGA 4D4KA 3H1TA 3CWZA 4YMVA 1NSTA 2QAGB 4DCNA 5K8LA 3CLVA 4OBEA 3N2IA 5TVKA 2X2EA 1T3LA 3AF0A 3AUXA 3ECCA 1I2MA 3GLIA 4BWYA 2KBFA 3R7WA 4ZCMA 4M8NE 3ZJYA 3TJZA 5FOUA 4BRWA 1E32A 2ONKA 4CEIB 4FIDA 4DUGD 1E2KA 2GJ8A 4TT3A 2ZYWX 1KKLA 1CJTC 2W6JA 1NVVQ 1DEKA 4B47A 3W34A 2PZGA 3UK6A 2CNWA 3W5JA 2VSXA 1VTKA 2WKRA 1OHHA 3T34A 1K6MA 1OF1A 2N42A 2IYQA 5KYKA 4U7DA 1AS2A 2V54A 2PEYA 2ZI3A 5FOVA 2P65A 3EAQA 4JSYA 4JVSB 4URUR 1QHYA 2Z4RA 2BBTA 1GWNA 2QMUA 1KZ7B 5FR1A 3VMFA 4YQFA
chains in the Genus database with same CATH superfamily
1NW3A 4GMHA 1I4TD 5JDCA 4D97A 1RLIA 2AEFA 4DCGA 1R9MA 2CBZA 4OSEA 1BWRA 2IZ1A 2ZIUB 3GEHA 3TNYA 3CWCA 3IERA 4D6XA 4XR9A 4YRRA 3W8EA 2HPVA 3VNSA 1QGED 2JRLA 3N76A 1XEWY 1IRXA 3QE9Y 3AVPA 1CTQA 4LZWA 2YN0A 2X7XA 4B3DA 2O4UX 1ZOIA 3AIMA 1HG0A 1I51A 4PYMA 1P7ZA 2P8JA 5FAKA 2HEGA 3ML1A 3S68A 4YAEA 5KYNA 3IE0A 1BE1A 1QTRA 2QG9A 2C9YA 3AF3A 5LXTB 3W5BA 2J7KA 3L06A 3L6CA 1UC9A 3KZXA 2H8GA 2N9UA 4KLNA 3RTBA 3AESA 1T8SA 2OAGA 2VBGA 2OGWA 2VP2A 5B4TA 5KYXB 3GAFA 3KX2A 3M3HA 4PIVA 1K7SN 4GH5A 4G4SO 1B14A 3WBFA 1N6RA 1RPAA 3JQFC 2XUGA 4IAOA 3K8OE 2VJBA 4B3MB 1J5EB 2M98A 2XPCA 1CV2A 3V9PA 4HV4A 1XIVA 3IILA 3TTYA 5LDHA 1RCFA 2ACKA 3LUFA 4YR7A 1DKMA 1MDBA 1N2GA 1PUXA 2QA5A 1C0KA 4AF6A 3JWEA 3RTEA 1Z4PX 4M6WB 1LFAA 1N5RA 4Y0VA 3D8BA 2Q3HA 4BVEA 2CNNA 2Z5LA 2MINA 4Q3OA 4TYPA 1U90A 4URZR 5EJ2A 4B1FA 4BLQA 3NYWA 1RP7A 2OYCA 2QD3A 4UMVA 1K27A 1TVKB 2ADFA 2G9UA 5TPWB 2YJGA 3K32A 4IEFB 4MI9A 3FNEA 2PL9A 3KOZA 1Y8QB 2DFPA 1O9GA 3FROA 2GH1A 4OI2A 4PGMA 4TL7A 5GM1A 4Q3LA 1WUKS 4E1AA 4D9EA 4P4SB 5C2JB 1ZH6A 2HWYA 5J23A 3GFBA 4UHBA 3UW3A 1H0KA 4LDQA 1ZU5A 3MWFA 4WOBA 5HKAA 3BMNB 5FAXA 3NHRA 4JJ8A 1MXFA 1GNTA 3MOIA 4JLDA 2I87A 3LU1A 1P75A 3TQCA 1PQYA 4P7BA 4PGGA 5CITA 1OXXK 3PCRB 1DKPA 1HLPA 1PR0A 2W2PA 1NN3A 5CCXA 1IEQA 1ZJWA 1H9AA 1BW9B 1SG6A 3CC8A 1SXIA 3EQ2A 3N0RA 1F14A 3WWOA 4RY8A 2I1VB 4B0PA 1QKKA 3SYNA 1NR5A 3ZGOA 2CEKA 4P3PA 4PO3X 1XCMA 5DGCA 2QYTA 2R1TB 5DE3A 2R5NA 5GINE 5FV7A 4NPCA 5A2GA 1H1TA 2F3QA 5AJXA 4TSRA 3B48A 3TIFA 4EHLA 1XTUA 3T7DA 5JQGB 1C1DB 1QRAA 4HB0A 5F5XA 1A7KA 4EB3A 5FUBA 3ADBA 3HKDA 1X7YA 5JMPA 1G17A 1CLEA 4OGKA 1AKVA 3OHMA 4DV2B 3E3OA 1KFBB 1O6GA 1V2HE 3B38A 2DVMA 2D6FA 1BDHA 5DHFA 1N34B 1TYBE 3HY6A 3UGKA 1OW3B 3R7WB 4F2GA 2RH8A 2FYTA 4V0QA 1PWZA 2REQA 1KAQA 4GZ6A 4G84A 2PL1A 1PFQA 2WT4A 3EIXA 5TARA 4DEXA 1EQUA 2OGZA 3TVTA 1OT3A 2FEAA 5P21A 3JTMA 1RWNA 5FHRA 4RE5A 5HVNA 4FYXA 5K1ZA 3DM5A 4L9AA 3CRZA 1H69A 1YH3A 1Q0ZA 3DFUA 4GGMX 2QLFA 2VJCA 3QG5A 4Y7DA 1UPFA 5CB8A 4DA4A 1ORIA 1FNMA 4YJHB 3PUZA 5DYIA 4CFSA 3HFJA 2H4XA 2EQ5A 4WLOA 4XQ9A 1TO1E 5EJ6A 8OHMA 2IIBA 5AKJA 2YFHA 5TSDA 5FQNA 5BW4A 3SNHA 5CM8B 4FYIA 1YXMA 2AE1A 2GERA 2GTIA 2NV2B 2X23A 5JCZA 4RO0A 4B3JA 2OCLA 3EASA 3D5QA 2WC1A 5HEKA 4QJIA 2CBGA 2P5TB 3RLFA 4HDQB 1WE2A 2EFEB 6AT1A 4ADSG 3EIQA 1L7BA 3S1AB 4Q7QA 3BD8A 5F1PA 1ZJ6A 1CY2A 3F9CA 1GL3A 1X1TA 1XTZA 1YZUA 3LT1A 4ENVA 4RADA 1JBQA 4H7KA 4M9CA 3EPPA 2YRFA 3OAAD 4JC0A 3FGZA 4OQPA 4H3HB 4FMPA 4BGEA 5KOYA 1SXJA 1D0VA 1O95C 3F90A 2C8VA 3ZQUA 1R1DA 1SUWA 3PYLA 4HRAA 3KTDA 4RIEA 5KKNB 5ALZA 1XRNA 4LRYA 3STYA 5J63A 4HDAA 3DGEC 4H27A 4R0VA 1PG2A 5F2NA 5KCZA 3CZQA 4ZVVA 3STWA 1BX0A 4A1FA 3OTOB 3PKIA 3GPLA 1NXXA 1M1ZA 5CW2A 1MRSA 4RKQA 3ABIA 3KTAB 1Z22A 1JFFB 3C8UA 3CZPA 3VZQA 1ORHA 5BSUA 3ZWXA 2ST1A 1A88A 4NG5A 1CUAA 5ADVA 3FWPA 3CX6A 1P17A 4NHEA 2PHZA 4LV5B 5FULA 4BEBA 1NBME 4NESA 2GPWA 2YIMA 2CHFA 1L8OA 1Q6ZA 1W5AA 1QFSA 3IQEA 4BB6A 4LHYA 1EFKA 2OC9A 1D8AA 3T5AA 1FB5A 1L6IA 4A73A 3TI7A 2O5VA 2YX1A 1WSAA 1EUYA 3OEHD 4ZO6A 3T3OA 1P31A 5BNFA 2BI7A 1CVIA 1XK7A 4I1SA 4UXJA 2FMKA 2A4MA 2XBLA 1QQ5A 5KWIA 2QRGA 2XA1A 1L4BA 4G1EB 1GADO 4JT8A 3MTEA 4IUBS 2QD2A 1W1IA 4JY7A 5HUQA 2ZUFA 4ECAA 1O8BA 3SXPA 3THRA 3IP7A 1Y3HA 3Q40A 4DT1B 2EZ4A 1A2BA 1YB6A 3G0CA 1Y7HA 5AR1A 3K6SB 3SG0A 5ALSA 1ZSNA 2J3LA 4UVHA 3I8OA 4FSHA 4TWIA 3ELUA 4DSUA 1GQ2A 1GZ6A 3IUQA 3MFQA 1V4VA 3HJHA 5JRZA 4QPZA 4XYMA 2ECPA 1X7WB 3LKBA 2G9QA 1CPYA 2G4LA 1RJFA 4DB4A 2C29D 1M67A 1NU8A 1TZ2A 2H8KA 3OZUA 2EGHA 3FDJA 2XWBF 1UBTS 2EYQA 3KDSE 5ALNA 5GTDA 5JSZA 2ATCA 4TYWA 2CLOB 3FCUB 5AHRA 1W5BA 2AX3A 1JT9A 5HP4A 1IFXA 2NSLA 2QAIA 2ZDGA 3A2LA 4CKBB 4DR4B 3JQ9C 2PMCA 4AIRA 1YQGA 3AWDA 1JEQA 2UYQA 2HNAA 4X9XA 1SFRA 4BGVA 5CA1A 1RI3A 2G8LA 1ZEJA 2P6RA 1BXZA 1PS0A 2AA3A 3A05A 5EE9A 5I9TA 3T7KA 1UBSB 3ZDZB 2NOAA 2OFWA 3H5RA 4M1WA 3RSGA 3QE2A 3LOUA 2P5YA 1BJRE 1R3UA 3OPYA 3VR3D 3M2PA 3GYGA 1QYIA 3UHOA 4MDHA 4YRDA 4P5DA 1V0JA 4L8WB 1L3CA 1ISSA 5AJUA 1A3CA 3VC1A 1W7AA 2YOGA 1VG1A 2DSNA 4J9VA 4J3JA 4KYTA 4OHZA 4YC7A 1II8B 4DMHA 3BHNA 4YQZA 3HWSA 2UDPA 4J2HA 5EKTA 4K46A 1LBTA 4MVJG 4TN1A 2GJ4A 5AW5A 1JI3A 1Z6PA 4LOKA 4RXUA 2IY9A 2OK7A 1J21A 3ZWPA 2F2TA 3RVJA 2PUTA 3KZCA 4ETIA 4YRAA 4KHZA 1TGVA 4YAJA 4C21A 1OGYA 2WF5A 2J46A 4ZC8A 1RRPA 2KYRA 1E79D 1MHPA 2W8BB 4CF5A 4I1UA 3DO8A 2K6GA 2HSGA 4U6NA 3OE1A 4FD3A 4BC0A 3VAYA 2I6FA 1MF7A 1UM9B 2BHSA 3SBOA 5KTMA 1OBHA 1H93A 1D03A 4HG2A 2Q7DA 3ESBA 3EVDA 2I2BA 4FDTA 4DCSA 4DVJA 1PFUA 3C3PA 4QYWA 4N1AA 4YBRA 2VSOA 5HKKD 5KQLA 4OTZA 2BTQA 4EX7A 3BL6A 3BXPA 2BI8A 1LF5A 1KNQA 2ATXA 4MJ7A 3NDJA 1IZ9A 4YXWA 4ZCRA 4KDFA 3LY5A 1P1BA 4Q47A 1L6RA 5CAEA 1RRFA 1FTNA 3NEPX 1IEXA 3NTUA 2D2XA 2ZB2A 2I8AA 3AHHA 4H1HA 2C4TA 2Q6IA 1GG2A 2R6GA 3DMFA 3R3XA 1OAOC 2C2ZA 4MKHA 5SZJA 3IUSA 3PT9A 4Y1FA 4DN6A 4LJ6A 1PJ3A 2PS0A 3I01M 5ILGA 3ROQA 3MD9A 1M3SA 4PX3A 4GNRA 4EH1A 2VPIA 4GMGA 4ZU1X 3ZU4A 1Z8DA 2RAVA 3PYXA 1QO7A 3RFTA 3RJTA 3ZU3A 3AVYA 1JEOA 4DV3B 1NW9B 3C85A 3UY4A 2RCNA 2OXIA 4UUQA 2ATIA 3FDZA 3RI3A 4C6TA 2DMRA 1NN5A 2X2FA 5GZ1A 4D2IA 2JLSA 3QVOA 1G8KA 2V7WA 3HCFA 4NOLA 3L82B 4N6NA 2XUOA 4B6EA 1OXBB 4KQIA 1G8HA 3D31A 3TF5A 2PBLA 1FTGA 1G98A 2AYXA 1RXYA 5FFMA 2BT4A 3N8GA 4YXFA 1SKQA 5LQRA 2FFJA 1DWPA 4BBJA 1GAXA 3E5NA 4GQIA 1IXZA 1GZ3A 4WLEA 4EG4A 1WETA 3EPJA 3R3VA 3Q8KA 4CTKA 3H9EO 4MS4B 1H6CA 1X8XA 3MMPA 1H2EA 1UOQA 2N0SA 2ZIVB 4RGBA 2FPOA 5IW8A 2PL5A 1W581 1PF7E 3IBTA 5TJHA 5EIBD 1MA0A 2M1ZA 3PCXA 5A02A 5L7WA 4Q1CA 1AQNA 3OQJA 3IAEA 4QDKA 1YRHA 3G0DA 1GKUB 3D64A 1JE1A 4X1KB 3THXB 4CF6A 3VA7A 3D7RA 2YYYA 1IN6A 2DPGA 3AUKA 3CISA 4YAOA 3ZH2A 3NEYA 1RI5A 3B3JA 1NRIA 3JZAA 3V6MA 3KPJA 2YXDA 5DHQA 1MABB 1KDVA 4OFWA 2HLNA 3QWFA 5P8WA 5GZ3A 1ZDMA 2R85A 4Q3AA 5A2QA 4L4ZA 3GJSA 3UHAA 4QYXA 4DR7B 4UE6A 2Z83A 2I8CA 2QLTA 1KS9A 2VG8A 1NBOA 2AJ8A 3LUCA 1WMBA 2X0FA 3Q8XB 3SE7A 2VSNA 4EY7A 4YUXA 2HY7A 6NULA 8ABPA 1GARA 3AR4A 3U7QA 1JE0A 1HZZC 1AKRA 1GZ5A 1HFJA 2C2OA 3QX9A 1YS4A 3QWBA 1GU7A 5BRNA 1MB0A 2ZB3A 5FI1B 1T2UA 2H2FA 4IMJB 4WUVA 5JSHA 5JAUA 2IOFK 1GOTA 2B0JA 2Y92A 3FFAA 3Q7SA 4PY2A 1XZKA 1Y34E 3MNFA 4OF4A 4R9SA 1QK3A 2CXNA 2JLZA 1CQIA 3N7TA 5BWCA 4FBMA 3FPFA 1GQYA 2FPIA 3R9XB 3H5NA 5CFQA 4FBGA 3HG7A 4UVEA 2QTZA 1FQJA 1KIAA 2ZBUA 2JIZA 2X9GA 2AI2A 4FYWA 4OXNA 5FWYB 3U26A 5IWCA 3T9BA 1BX3A 1K2WA 4WJLA 3DWGA 3FZQA 4HGNA 2WYOA 2NO6A 3JATA 4L1KA 4IS2A 4IDGA 4GZ5A 2WM3A 4YGYA 4XWYA 2TSYB 1HDEA 3GJ4A 1UZUA 4WCVA 3BTOA 421PA 2OXTA 4HD8A 5H8WA 3RQSA 3SBDA 1O03A 1Q0HA 3QYPA 3WYCA 5BMVA 1UKAA 3D59A 1MU0A 2FSVA 2YV2A 5DT9A 1E0SA 1LX7A 2NSYA 2PQ2A 3O95A 2BM1A 3TN7A 4BU1A 1QO9A 1USGA 4UW9A 1TT7A 1HXHA 1LQTA 3TD9A 2VJLA 3EGOA 3IXLA 4KBFA 3UMFA 1M66A 4XUDA 1A5TA 1M76A 4AJLA 4C29A 1UH5A 4DLUA 4KR3A 1G2IA 5AQ1A 3GCGA 3D4OA 1IONA 1Y6GA 4JXZA 3GJTA 1O8CA 3IVCA 4NV1A 2AJTA 5F51A 1GYRA 1LDGA 1LI5A 1QCDA 3EVBA 2BP7A 2QQEA 4FFOA 5T3YA 1JF8A 1XP8A 2I6SA 3RVKA 3M4JA 2VH5R 1HEYA 1JR3D 2A30A 2QV0A 2K5UA 3H16A 3RTAA 1KJIA 2J6BA 1A8PA 4KE8A 1T8TA 2QPAA 3WO0A 3B6KA 5KQSA 3WK4A 2HIHA 3W3AA 1QRUA 3Q88A 3CY6A 2WJ4A 3HJUA 4UD2A 4ZT7A 2K4MA 2D5AA 5JLAA 5TQ0A 3VUFA 5JFTA 3OECA 4NAVA 4JMLA 3IDZA 1F5SA 1VLQA 2UZ0A 1G9SA 2A1TR 2P0YA 2PGOA 3Q0TA 2QZZA 3DQQA 1BKYA 3EUEA 4RXMA 1Z06A 2IUTA 4E5UA 4CQMA 3ZWBA 1O3YA 4CZ2A 4IH4A 3FNFA 3T5CA 2HI0A 4FN5A 3Q5DA 5DI9A 3FFBA 2M6SA 1E1NA 4HNSA 2OSBA 3LJKA 2P79A 3NCHA 1AU9A 4BNYA 3Q7RA 2FWIA 3AKDA 4OP3A 2IH5A 2IVZA 4IQ8A 3ZZTA 4FOSA 1J97A 1NLFA 1DKQA 3BDAA 2LNDA 4FCTA 4GYJA 4MW0A 1DRVA 2Q4EA 1IQUA 2R65A 5BP7A 2QRLA 3H2ZA 2COKA 1KHTA 4L51A 2EFHB 2I54A 1PZXA 4RX1A 1LKZA 1YRAA 4MPPA 3EGXA 1SZJG 2EWVA 4A16A 2JA2A 5COQA 4L0CA 4DBLC 1D2EA 4F8JA 5KB3A 3G5MA 5F1OA 3T3NA 4LBYA 4YR9A 3I92A 1UKEA 2WPDD 3ZWAA 4Y67A 3CPJB 4HLCA 4PCUA 5LQKA 2IW3A 1YJBA 2OBXA 3GOQA 3K30A 4NMHA 1CQPA 1Y1PA 3UO8B 5HCIA 5B55A 3RR2A 5AW2A 4JHXA 1P60A 2VPPA 2XCQA 4HDOB 3PUIA 1Z0JA 1Z74A 2ZRKA 2P9FA 2BGLA 5B1HA 1QP4A 3HWRA 4TLBA 2DERA 5B3LA 1VPTA 1GRVA 3E22B 2ILVA 3IEUA 4Y6RA 4XJTA 2M6LA 1XKTA 1WKVA 5I4KA 1X9GA 3KAPA 5IFKA 1SA0B 1SVSA 2WJ3A 2AUMA 3B7GA 5ER6A 5KMGA 1KKUA 2JCGA 1E3EA 4C3VA 4PZUA 3UENA 5F12A 4TWAA 4OKNA 3V4LA 1FNSA 3WFIA 1YZYA 1R37A 1RHMA 1W75A 2PGNA 4HK4A 1A50B 2ZIAA 3O2QB 3MWDA 4DCMA 1W88B 2P6MA 1LTQA 4OQXA 2H4JA 3NHKA 1ATIA 2FPRA 1E2LA 1H8HD 2WP0A 1IBMB 3KS9A 3LZCA 3TTTA 3M6AA 3EVTA 3NS7A 4I9NA 3A10A 2GJSA 2GM5A 4CHTA 4UHKA 4OG2A 2EW8A 1MNQA 4HQLA 4IQGA 4KAFA 4LOAA 4IKEA 4QVGA 3GG2A 3ZZMA 2ZSAA 5JMOA 1PQ4A 2V4MA 3K2EA 1J06A 3RU7A 2A4KA 2GLTA 2PZAA 4B2PA 5DHAA 2E18A 3LSTA 2XWSA 3GFSA 3QNMA 3E5RA 3FMFA 3STVA 3PHHA 4NF2A 3ONNA 4KXNA 1B8UA 1IVNA 1MAWA 3IEIA 2O8FB 3LPCA 2BSQA 3GJ3A 1QQ7A 1RYZA 2J0UA 1H42A 1V39A 2PZEA 3IJEB 3NBKA 5CA1F 2ZK7A 5C1DA 1NT2A 4GKKB 3ZV4A 2C54A 4HEA1 3SKXA 2A14A 1E2JA 1UMCA 3EXG1 2QUZA 1I14A 3O94A 2X7JA 3QPWA 4AFNA 1FDWA 4KZPA 3S4YA 4UMDA 1J42A 1V1RA 1ZLYA 5K0ZA 1JN0A 2ISSD 1BTOA 1VYTA 5K3AA 4BNHA 1N0UA 1PT8A 2PRJA 1T36A 4FFDA 5TY0A 5IRCD 1DSSG 4HWPA 2PZ8A 1WXQA 1RWPA 3RUHA 1WF3A 4KAAA 2OGTA 2ODBA 2BKEA 5B58C 5FJJA 2GT1A 2GLXA 3GEIA 4RA6A 5ADUS 1DX4A 4YP0A 2QOEA 5TPZD 2NZ8A 1EFHA 4BB0A 4JBXA 3KQKA 1GQOA 3IT0A 1UBFA 3AB7A 1QB7A 2D7CA 2WU4A 4GXRA 4OMFG 1KYYA 5GV7A 1PR2A 3SXUA 5IG2A 3ZHXA 1U4NA 4JLKA 2F1OA 4RKFA 1NMYA 1DE0A 4H9GA 3B9QA 3JD0A 1OXVA 2BFEA 1J49A 1TW2A 3RYHB 2ZJ2A 4UEJA 3GAAA 1UBUS 4JJ7A 3GDWA 3FOFC 3E84A 1CF9A 4DM4A 4E88A 4CI9A 1F4PA 4NQZA 4HDKA 3AM5A 4LXXA 4Y2PA 4ZOLA 4DCTA 4XAQA 1DC6A 1DIBA 2HREA 2GM9A 1PEYA 4TKLA 3A0UA 1QB8A 2RHWA 3IA7A 1VJTA 4BO1A 4QU0A 4XTCS 5BSGA 1TCBA 2J7PD 2I2CA 3IAM6 1VIDA 2OAP1 3LXXA 1QDEA 4PRLA 4N0PA 3IELA 3VKWA 4YO8A 5JAMA 3EDMA 5AESA 1E3IA 3PPVA 3T1VA 3IALA 4JDUA 3ODPA 2XRMA 3EW7A 2FOIA 5E2IA 1CZOA 3TNFA 1OX6A 1IVYA 2DQ4A 4M55A 3B6ZA 1U1IA 3TOZA 4JEIA 4J0HA 3ZQJA 4B75A 1DBWA 4JEUA 4ZGBA 1TA9A 1KXJA 1CRZA 2WWIA 4IX1A 2YV5A 5LQCA 1X70A 1NVDA 1WXHA 2HQ1A 3Q11A 2WFZA 3MK31 4YY3B 3SS8A 2OTCA 2GZHA 4K1XA 4OXIA 3R77A 1RRCA 3OA2A 4J76A 5GJBA 3D7MA 3WS7A 1QLWA 3WLRA 4MR9A 4EJ0A 1DCKA 4EW6A 2D0PB 4Z5XA 1PQUA 1I4OA 3PUHA 4MP6A 4QJ4A 3U7IA 5CDHA 2RGGA 2BH2A 1NBMA 2ACVA 3I52A 4ZODA 4AK9A 4QARA 1AXRA 2BHLA 1AN0A 1EJ6A 4M22A 4R8SA 5I47A 5CD1A 1USVA 3KZMA 3JARB 4OH1A 1Q77A 3HBMA 5A6VA 1B42A 1A7UA 1GXSA 4RV9A 4HN9A 3FZNA 1G42A 1TKBA 1RWQA 2QZPA 4INZA 4BN5A 2FZVA 4MUYA 3NEJA 1OJ7A 3OU7A 1XDUA 2AVNA 3LT0A 3O3OB 1X1CA 3NALA 3NC4A 4DRZA 3TMKA 4UEWA 2JGDA 1YHZA 4PIMA 3HXOA 2ZM6B 3DAOA 1EIZA 3K16A 2FQXA 3JQQA 5FX2A 2IH4A 4UUOA 4QHSA 2WAXA 3E7PA 4GU5A 1YS9A 4H60A 4MEBA 3RH0A 3ZI7A 5EE3A 4AF8A 2IX3A 2YWXA 2QTWB 3K9NA 4HNTA 2Y71A 4KR0A 3IEPA 1FQOA 4FNGA 4MCAA 4ZAVA 3AI7A 2OA0A 2YHUA 2GF0A 3FG9A 4YT2A 1XCLA 4UXHA 2XCOA 3I6MA 4H7HA 1PSWA 3EFOA 4HN2A 3E2MA 2UV8A 1T6ZA 2Y1EA 1C3EA 1ZXBA 5EWJA 2ZU6A 3TMAA 1CY7A 5JPCA 2W48A 3BOSA 3D3EA 4LY9A 4UPEA 4EO7A 4F8EA 4ZPXA 4OHVA 5IJAA 4S05A 4LX0A 4LY3A 1HKHA 2FWJA 4KFTA 2OFFA 4CLOB 4ZT2A 1CBUA 5B53A 1XJ5A 1MGOA 3CB4A 4FGUA 2V55B 10MHA 5IFLA 2VHQA 2P1DA 4RIFA 3T7EA 4AG3A 2PUFA 5AUPB 4DE5A 2AYZA 1P5RA 4QDZA 5CJPA 1L8QA 2WTAA 4QVKA 5DBGA 5HMLA 2FRDC 1OV4A 3QU2A 5HF5A 4Z7JA 3Q12A 3TW6A 4C87A 2OMKA 1NXPA 1VJCA 1QPBA 3AYXB 1P6XA 5BRAA 4B8YA 1Z73A 3WLAA 3FPJA 4KNYA 2AG1A 1XELA 2NPIA 4CNQA 1VSUA 3TMYA 3RGWS 2D1QA 1DQNA 4BLUA 3EQ8A 4KUGA 3A1CA 3H9JA 3I2KA 1XWIA 2HA0A 3O0DA 4IF6A 2GASA 3H3XA 3IMKA 4Q3KA 3ENNA 1IN1A 3AINA 2XT9A 1RZRA 2I2WA 1R6UA 3IQZA 2PS3A 4ZYZA 3CKLA 1DADA 4OL0A 4YP5A 5CBPB 4JI7B 4P7KA 3WQSB 3KEMA 4DS3A 2F62A 2ZWVA 5ESXA 1MV5A 3IODA 2MYNA 3WGNA 2GZDA 3CEHA 2WWTA 2VWGA 4G1BA 3OLVA 3UYKA 4QSHA 2Y77A 4EB6A 1KFJB 3ST7A 5BMVF 5MGNA 3IKMB 4ZVTA 2PX6A 2QUAA 2DQSA 3HCRA 2IEIA 4Z4IA 1CFJA 1Q15A 3K0EA 1GR1A 3GFPA 4KXFB 4V03A 2Q2OA 2ZPTX 5EI5A 1NLMA 3FPCA 4YRIA 1T4GA 2C97A 1TM4E 1Z5NA 2XQVA 1L5OA 3SN6A 4ZT3A 2HA7A 3CNBA 4Y6QA 5YASA 2CMDA 4KQMA 4NCKA 2X0DA 4W63A 1T9BA 2FCAA 4RF3A 3DH0A 1X15A 4OV6B 2I7DA 3DZGA 3VO9A 3EC2A 3RU9A 3IP8A 2BI4A 2Q0SA 3BEDA 4G0PA 2BM8A 2FUEA 3NYIA 4KSBA 2IYYA 2PSHA 4NVRA 1FUEA 3SQXA 5KKCA 2CL7X 4FYHA 1LS6A 3LD9A 4JGBA 1RM5A 4OIFA 1BMFA 2VP4A 1LH0A 5BR4A 4JJKA 3TB6A 1CUZA 2ZPAA 5CLQA 3P9SA 4MIOA 5A0FA 1EDBA 1SPBS 3DWEX 4OOEA 4YP9A 4IIVA 1WCIB 4Z3DA 2IZOA 3NHJA 3AR3A 4LRWA 3USES 3U4MA 2CVQA 3PDHA 4JQCA 4KH1A 1K0UA 2AL7A 3QBJA 3NXSA 4ZDKA 4MUMA 3TLGA 1GAWA 3GPCA 2J8ZA 3KD3A 2PCJA 4Q7KA 3NKLA 2V7QA 3BG5A 2PZJA 2X14A 3UK0A 1J0DA 1EINA 2D0IA 1I13A 4GAEA 2V65A 4QG7A 4ZIRA 1K89A 2JGRA 3RS4A 5KX5A 3O8OA 3JQFA 4F3KA 1QGOA 3L7KA 5TMDA 1WDKA 2O8NA 3L0SA 3NR2A 2XB8A 3UAWA 1GL9B 1OLSB 1R7RA 4K9MA 4PSKA 3PS9A 3S2SA 3Q15C 2AI3A 4RU1A 4PG6A 2XOEA 1JFVA 1K3UB 1ZW6A 2OZLA 1FZQA 3NHWA 1L4UA 1YA8A 3M6MD 4IJQA 4B4KA 3MA0A 4EI8A 1X7ZB 2XYRA 1V9CA 4FKZA 2V1XA 4RDHA 4OP2A 1FP6A 5ECYA 2I4MA 3G13A 3LH5A 3O6VA 4FTWA 1CNEA 1VJ5A 5GONB 3UJHA 1KH1A 2V97A 4JXJA 1A4UA 5G1PA 2BMFA 1TE2A 3DE2X 4G67A 4V2IA 4YRQA 5ITVA 5BWLA 3R3ZA 2YJ6A 2VDRB 5HDQA 3KELA 4O4LB 4MVJE 1AQ6A 1B8NA 1YRBA 5L7YA 2WUGA 1DAMA 4HZUB 2JFUA 4ZVUA 2OCAA 4JI2B 3AQ4A 1U8AA 3KFXA 1JHQA 2CFRA 3HB0A 1YR2A 3FB1A 1KC3A 3KFLA 2Q0HA 3QY9A 4O4JB 1ZNZA 5AKXA 1KSHA 5KJ6A 3B52X 3KQVA 2C1XA 4RZSA 1V1MB 2QNRA 2JAPA 2YL2A 4YMSA 5EJ8A 1PTJA 1TYCA 2CE7A 1SZPA 4J0DA 2JDID 2WFLB 1E2IA 2XMRA 1MC5A 2ZAMA 4OSOA 4TL8A 2HWKA 5G41A 1E69A 3SHVA 5KVCA 2BLLA 4XD2A 4H31A 3T1QA 1FLAA 5C18A 4HF7A 3BXXA 3OPNA 3IPYA 3PUJA 2FLWA 2Z1NA 1TIPA 4KQ1A 1ESEA 4BFZA 2QRUA 3GJYA 3G2JA 3V7WA 4LYYA 3L9WA 3EIEA 5A5EA 4CTOA 4MV0A 3OCJA 1JBKA 4OKIA 1LWNA 3E53A 1NVUQ 3F5SA 2F9MA 2W6CX 2A0FA 3PSHA 4XEHA 3TECE 2PV0A 1XQYA 3OIUA 2EWMA 2RBEA 4XLLA 3MAJA 4UTZA 2BFDA 5A6SB 2QVBA 1KPIA 1KAMA 2XMPA 4UDYX 4D45A 4EP1A 1DS6A 3ESXA 4S04A 3U13A 1W8IA 1KEUA 3BVPA 2PPVA 1KK3A 3V4RA 2PN1A 2DTDA 2QX8A 2ZBPA 4L85A 4REQB 3VOTA 1WUHS 4BEVA 4MPRA 4F6RB 1RPNA 1VG9B 2EKLA 4LDAA 1I4EB 2ODNA 4MCJA 2NSJA 4PLFA 4QOIA 1AF4A 5TB5A 3WB1A 5A62A 4RULA 4N8DA 3E9EA 4BJ1A 4D8XA 5JJCA 1C0EA 1SC3A 1W94A 2CLLB 3C14C 3JZIA 4A4DA 3VHXA 4PHFA 5ICEA 4MUIA 2DWPA 1Q19A 4NFYA 1I2CA 2CCGA 1GDDA 2OUKA 3N9IA 4FHFA 3TBKA 2HDHA 4B2LA 2P62A 4WK4B 3DEFA 4AJOA 2HNKA 2QTVB 1K2VN 4IFIA 4P2GA 4PPQA 2Z2XA 4NHOA 4ER0A 3RJ5A 1BNCA 4M7RA 1ZHHA 3ADOA 1JI0A 3QEOA 2FLVA 1HE2A 1JMKC 2PMKA 3CTMA 3NVAA 5CVUA 3WHPA 3CNNA 3ZWDA 4EPTA 2BEWA 4G8BA 1HT3A 4LSGA 3TLCA 5ALFA 2PK3A 1NKSA 1GNLA 3OM8A 4II2A 4NOJA 3W8NA 2Y3IA 3TQFA 5I7OA 4LJAA 2VSFA 4NZ9A 4XQEA 5FI0B 4BQEA 1V7ZA 2QP9X 2VAXA 2EQBA 2IU0A 1KC1A 4P6VF 2JFGA 4U2DA 3K6RA 2PAFA 3CM0A 1H05A 3P9YA 3B1KA 3W04A 2WI8A 2BELA 4YCJA 3P9XA 3VHQA 4GBED 3ZTYA 1HEUA 2ZRGA 2GJ9A 3WWZA 3P9QA 2W4IA 3SXJA 4C0JA 5BN1A 5C7OO 1ONSA 2DBRA 3K1AA 3KUKA 1IJFA 3JD4A 3BICA 3ANYB 4DQ0A 1BDMA 1HK7A 2NYRA 5HR5A 1Z6AA 2DYKA 1XC7A 4JWKA 3HFSA 4PC2A 3I2JA 4ZOLF 2NQ8A 5DTIA 4JYAB 2J5KA 1Y9JA 3WLSA 2R7NA 5EJ5A 2Z4SA 4R1UA 5DHRA 1QGZA 4MS3B 3RVBA 3OKPA 4UU1A 5KHLB 4EA8A 3M8KA 4KE6A 5DM4A 5JD5A 2JFBA 2K2QB 3N7UA 4KN8A 2J5QA 3GK3A 4IJVA 3SOPA 4KREA 5BYJA 2NU6B 5A0TA 3AF2A 2A9PA 2G5GX 1ILEA 3ROKA 5TC4A 1N9KA 2XQGA 2PJZA 1AUPA 3QUAA 2BKAA 1ULAA 2P8SA 1N7IA 2G1JA 3ZU6A 4HNAA 3A1FA 3SPXA 4M98A 4OK3A 1CZRA 1KYVA 4JQYA 2Q6TA 3NORA 4LJ8A 4J0JA 2XCTB 1JGTA 5H3LA 3AHCA 2QLMA 5LQSA 4NXMB 4Z99A 4S1OA 4F92B 2I6TA 4WNAB 1FSGA 1NM5A 2IHVA 4LTMA 3BAFA 1IY2A 3BRWD 4YPOA 1VE3A 1SXQA 1KO5A 2O23A 2DRIA 2O7RA 2WOOA 2UVPA 2XX3A 3GUUA 1VGQA 2RG1A 4G9EA 1V16A 4UAVA 5CGZA 2C4HA 4XWWA 5DKFA 2XGJA 3TVDA 2ENWA 3WLNA 2BKVA 3CNQS 1U8YA 2Q1UA 3KRTA 2FPXA 2PVSA 1G38A 2H4ZA 3S2YA 3KR0A 4JYBA 2LPMA 2R8EA 3FMPB 4C3ZA 3T9AA 3ILHA 3WL8A 1GU0A 1DBRA 4MWBA 1NVWQ 1TVCA 3I1YA 4ALMA 3RC1A 1FS4A 2JI4A 1RLMA 1RZVA 3MBIA 4Z0NA 4N03A 3U16A 1GAJA 3PNMA 4YXWD 1JEEA 4ZP1A 1E6UA 1UP6A 1G8FA 4G4IA 2AFIE 2AZMA 1JXAA 4G1FA 4N6OA 2ZB7A 5ALHA 4TYNA 3GMSA 2WUFA 3CG0A 4RPKA 5JE8A 4M9XA 3C4VA 2VXYA 1NLYA 3JR7A 1GILA 2F43A 1K7YA 2XWQA 3PTLA 1FNDA 2BR4A 2OCKA 1DQYA 1R0WA 4GI2A 4BX9A 1ULUA 2EJTA 4DXAA 2FR8A 4WFJA 3T38A 2ZRBA 4XM1A 3OEED 1PCXA 2FXVA 4I46A 2B1GA 1NL3A 1N0WA 4LRTB 4MWZA 3RDPA 4CG0A 4BFUA 5KEIA 5LM3A 4EPRA 2XMQA 1SR8A 4EA9A 4HVLA 1M8PA 2JBWA 3JQ9A 4WWHA 4EY5A 1NATA 1W2GA 3HKCB 3D0QA 3MINA 3VZBA 3J81A 4QYTA 4Y3UA 4NDAA 1CE8B 4XEUA 2WV7A 1GA4A 4PLYA 4LGYA 3JASA 1ZMBA 4YMIA 2ZJ7A 3PXEA 3PC7A 3ROZA 3PYMA 2R1VA 5M7EA 2QN1A 4AKSA 1RKBA 4WSOA 2GB4A 3EY9A 4DXDA 2WZBA 3L7OA 2O5EA 5JJKA 2GPBA 4D26A 3LK7A 2WZCA 4IGFA 3QKUA 4J1TC 5DSTA 2UZ1A 4IOKA 3EH2A 2HPHA 2W11A 3EEOA 4AD8A 3ZHTA 4LF8B 3GRVA 3IB6A 1ZPDA 3TXAA 3KT6A 2HM7A 1QLJA 1I9GA 4HH1A 1VHJA 3T0GA 2VJPA 2WJPA 3PFNA 3PGKA 2E1RA 2HQRA 4P5PA 2C5AA 3C4QA 1NE7A 5JVDB 4PONA 3PPXA 2IGTA 4CMCA 2QTNA 1G16A 3CCFA 2O3SA 4WXHA 3H6KA 2E9SA 4WEOA 2H9AA 4BNGA 3E3AA 3I61A 2GRAA 2XNSA 2VTVA 5EKDA 5G0WA 4FQ8A 5LDDC 2Q41A 4I0WB 3O8QA 1XCBA 3IOMA 3UMRA 1BVRA 1C1XB 1H2ZA 1MFPA 2HMAA 2B5WA 4P80A 2FX2A 5DIFA 3H3JA 4QASA 3AEUA 1XAJA 2HLDA 2R6R1 4CLRB 5JXGA 5JZMA 3LPMA 4L73A 2MCFA 3MWKA 1ZGCA 4RQUA 3I4LA 4TLMB 4EI2A 4N5NA 3NT4A 3A0RB 3SDZA 3QUCA 2GX6A 4HMQA 4XARA 2G5CA 3I39X 1QC5A 1J56A 1KPGA 4GI5A 1R4ZA 1UFRA 3P9RA 2HQSA 3UUGA 3AG5A 4F85A 3NX4A 4IUDS 4YJ2A 3VR2D 5FT9A 4CTJA 4HUQA 1O6CA 2IDZA 1E6EA 5FOQA 2V4ZA 1Q84A 1EM8B 2AXPA 5FL7A 3I1FA 2RE8A 4M99A 3GEBA 4GYWA 1M75A 5B7PA 3HPRA 1ZK3A 2YQZA 3WI7A 4DR1B 3ESAA 3CB2A 4TMYA 5FADA 3HB1A 3P96A 4FJ1A 4GLFA 2PUHA 3DOCA 3GQBB 5LKRA 4N0MA 4YMUA 3B3AA 2VQFB 2G67A 3IDFA 1Y9EA 3H11B 4L28A 2ZQYA 3MWGA 3MCZA 4FX2A 5DBIA 4K87A 2V03A 2YKGA 2YMPA 4HVCA 3WP0A 2J4FA 3GEPA 2NVWA 2YICA 3EF1A 1I36A 3IT2A 3I04M 4RLQA 4CQLB 1D4AA 3CO0S 4EBBA 2PUEA 3AMVA 2B8JA 1D1TA 1JQAA 2AQ8A 3PICA 5HIMA 1XMPA 2XCRB 3OP1A 1GTG1 2VK4A 1XTSA 3I34X 4MKIA 1DJNA 1MC1A 2C2MA 1JIQA 3I83A 4F11A 2JEOA 5DBOA 5U4XA 5KX5F 3NWOA 4HNHA 4OB8A 2YH2A 4FB4A 3I53A 2Q45A 3BMOB 4C0QC 2R48A 4E12A 2HUPA 1Y5LA 4S2EA 3O2SB 5ALRA 3UTCA 3O75A 1EVLA 3ANXA 2YTZA 3I8XA 4R40A 3SY8A 4XOUA