1GTVA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gtvA00
1FL9A 4H9GA 5AJWA 2DFNA 1FMJA 1KNQA 4Q9IA 4XTRA 5IHPA 4ZDIA 5JCPA 4NBSA 2W6JD 2XJ4A 2PLFA 4EPVA 2RGCA 2H57A 1ZD9A 1R0XA 4V0LA 3QKSA 5KO2A 2OEPA 2QY9A 3CH5A 3X1XA 1S8FA 1KO5A 4M22A 3QKRA 5HZHA 1KJWA 1NKTA 1AS3A 4D4MA 1JR3E 5FUVA 1Q12A 3HJNA 1MABB 4HB2A 3ZJYA 3VFDA 1A2KC 1XTJA 2V3CC 4HB0A 3LV8A 1J90A 3K0EA 3KXKA 1F2UA 1U9IC 2FFHA 2WWGA 3QENA 4PSAA 1E1RA 2WV9A 2B21A 4GP7A 4D4KA 1CS4C 4EQ6B 2ANBA 3TBKA 1NI3A 2QN6A 3AUXA 3WYAA 2V6IA 4A2WA 1E4VA 2A30A 1G7SA 4TYNA 2C96A 2WM9B 2B6HA 2WWHA 5JHHB 4CEHB 3AGPA 3CUEF 2WVJA 2FNAA 3X1YA 3TMKA 1FMLA 4D4LA 2Y8EA 3QEJA 3ND8A 5JS7A 5J40A 1VECA 3CNNA 4Z54A 5A5GA 2V7QD 3C15C 4DSUA 2AKYA 2ZJOA 2QROA 3B7GA 2D2FA 1OIVA 3JVVA 4A8JB 2B7CA 2D7DA 2PT7A 3GJ0A 1CKEA 1DAIA 3BB4A 4DCVA 3P20A 3I5YA 1SVWA 1Z0IA 2LKCA 4IDNA 2B92A 4NONA 2QRNA 2WKPA 4QBFA 4XWAA 3CW2A 3SJBA 4ITRC 2G0NA 2AWNA 4RFSB 1T9HA 3LX8A 3UWKA 4BLPA 5GADl 4AD8A 3B1ZA 3DO6A 1NIPA 4BE7B 1DAMA 2C98A 3CPHA 1AA9A 1E9CA 1SVOA 4QBGB 4QHTA 3WRYC 2J0VA 4TMWA 2J3EA 2VYFA 5JEEA 4IEEA 1KI7A 1G4AE 4ZDJA 1PLJA 2KJQA 3L8ZA 5KPDA 3EPLA 4KFTA 1NNEA 3T06B 3KKNA 1G5PA 4B76A 1PZNA 2C03A 3WY9A 2MMCA 1ZM4A 2AWOA 2V4ZA 4C0HA 3PQCA 4W5WA 1IY0A 1UM8A 2V8OA 4X8OA 2H8KA 5G53C 4LOAA 3DMNA 4A0RA 4HDOB 4OJQA 4KSCA 1Q57A 2P67A 3GQBA 2IUSA 2L0XA 1R5OA 1D9ZA 4KFRA 1FZQA 5FOVA 2ODBA 3QBVA 4FN5A 4M1OA 4P3YA 4RFVA 3SYKA 3W90A 5IK2D 1ELOA 4Q4AB 5SZJA 4KFUA 4N1AA 2VF7A 3CONA 2ZS8A 2CNWD 3UPUA 1IXZA 3CRMA 2A5DA 3RANA 4US0R 4H1VA 3TKLA 4UKDA 5EP3A 1EESA 2BMFA 1T3LA 1E79A 1NJGA 4UNSA 3ETLA 5EE0A 3ZS9A 4A2QA 3KJIA 2ZEJA 1GFIA 2GZAA 3F5FA 1KIMA 4AKEA 3EPHA 3T1VA 1DEKA 3P4XA 4XD7D 4EPXA 3IUYA 1DAEA 1VYTA 1QHGA 4DSTA 1P6XA 1IY2A 2F43B 2JLYA 2ZI9A 2RGXA 2R6DA 4BASA 4QJ5A 1AK2A 1S96A 1GNPA 4Z1MD 4QOSA 1XBTA 1EGAA 3TW8B 5GJBA 4PAMA 1TF5A 4NZYA 4ZDWA 4PSKA 2YVUA 5LPNA 3DKPA 2W6IA 1Q0UA 4TN1A 2ZTSA 5CM9C 2J0UB 4FMDF 1GUAA 1LTQA 3FMFA 4Q5IA 1OV4A 4J0QA 2AD5A 1E99A 3QEOA 1DOAA 5AUPB 2F9LA 1Q20A 4HUQA 3SYLA 2YINC 1GOTA 1DAGA 2FGJA 3QKRB 3SFVA 4IOKA 3K70B 1WMSA 4PPNA 4QGFA 3KUCA 5L3QA 2JJ1A 4PC6A 3THXB 4TMXA 2J46A 2JIZD 2PEZA 4P31A 3NH6A 3T35A 1S3GA 2BM1A 1H8HA 4M2LA 2ATXA 4R7ZA 1N6IA 1JJVA 4UJ3A 4CDGA 1W48A 5CJPA 4RZ2A 2QMEA 5M04A 2OFOA 2QP9X 2PT5A 2ODEA 3I62A 3ADCA 3CWQA 4TQ9A 2RH5A 4Q9HA 2IF0A 3RABA 5GJCA 2WZQA 1XZPA 4JLKA 2WIBA 4M1YA 1W47A 3FFBA 2AK3A 3L0SA 3QXHA 1E9EA 1DVRA 1YQTA 1NVVQ 2SHKA 4MKHA 1ZRHA 4LK2A 2G1JA 1CLUA 4YMUA 1ZU4A 3W8NA 2FFQA 1YZGA 2NQ2C 3RDPA 2CHVA 3PUVA 1YR9A 2WJIA 1OPXA 2GZDA 4LJ5A 3R9WA 2XZPA 3B2EA 4S35A 2RGGA 4R98A 1PLKA 2ZI3A 4XVUA 2CL6X 1E1QA 3K0FB 2PL3A 1ZVQA 2QBYA 2BBTA 2PJRA 4B3GA 4V0OA 2CE2X 2D62A 3AVXA 2VP4A 2E1RA 5FPTA 4TYWA 1HH4A 4JLPA 1S1MA 3C16C 4B2IA 3ONWA 2QT1A 2ZJAA 3HPQA 3LW7A 3OHMA 2P6RA 1ZW6A 4HLUA 1E2HA 1KGDA 3B5JA 4Q7KA 5EE1A 2JCSA 4B47A 2BMDA 1D9XA 3T5GA 1CRQA 3RAPR 1IJEA 2ZPTX 4M1TA 2FZ4A 3AV0B 4PHHA 5HKKA 2VIIA 1NP6A 3AQ4A 1U81A 2ZREA 4GZLA 4YMSA 1DAKA 3IDQA 3D8BA 2IX3A 1GVNB 2BKUA 1U94A 3U3MA 4G5OA 2XGJA 2YV5A 3OE7D 2OV2A 4IVPA 4OQFA 3D7MA 4M9ZA 1A82A 1P62B 5JJIA 1XEXA 3DOEA 1TUIA 2QMUA 3A58B 3BERA 2H1LA 4MGKR 2IS2A 1TU3A 5CB8A 2GZHA 3SI7A 1G16A 4A15A 1EFCA 4FCWA 4M21A 1GSIA 2JJ8A 1W4AA 3CZPA 1G291 2Z0MA 3H0KA 2GF9A 5EZ5A 3ECCA 1SVLA 2NOAA 3KTAA 4TL8A 4V03A 1ZM2A 1OFHA 5EQTA 3ZS8A 1SQ5A 2NPFA 2J41A 2J7PA 4ESHA 5FFMA 1TNDA 5HCIA 4I99A 4QM6A 1J8MF 2GCOA 4UNRA 5JEDA 4IW3B 1E9AA 2G88A 1KK2A 4KU4A 3EWAA 2K5UA 1LV7A 1TPZA 3HU3A 4OI4A 4AWXA 1G8HA 2PH1A 5EXTA 1G18A 3T1OA 1IONA 4KCGA 2FX3A 4TL9A 1JBKA 3AVQA 2R65A 1I4DD 3EA0A 3H1TA 2A7QA 2O0KA 1G4UR 1R6BX 4M1KA 5AK0A 4HUQB 4ZKDA 2ZI5A 4M8NE 3PUYA 1QRAA 2DFLA 4DLVA 3EWSA 4LPKA 1N5KA 3EZFA 3EZ9A 2A5YB 1ZMXA 4MQBA 1YZKA 4B3DA 3UMSA 2QZ4A 3BH7A 2HT1A 3TE6A 4IXNA 3QIAA 4QJ3A 2ZRJA 3NH9A 4FMDB 4IFBA 3RRZA 3KQUA 4FMBB 2EFDB 1T91A 4IOJA 2OG2A 4G01B 4F93B 4LV6A 5L3SA 1JEEA 4TQAA 2XNDA 3EG5A 1OFUX 4RKEA 4URYR 1OXXK 2VA8A 4KLZA 4ZI2A 4KXFB 1IHUA 3B78A 1G6OA 2LCFA 3KL4A 3CKLA 2YWHA 1DE0A 3P32A 3TGPA 2AK2A 2ZQ5A 3A1UA 1KO8A 5TV2A 2O8BB 2ZRDA 1RIFA 1GAJA 1KY2A 1E2FA 4D81A 1A7JA 4LRWA 2WTUA 1E9RA 1NRJB 1XF9A 2QSYA 2R6GA 5TARA 4A0GA 4B2PA 4PR0A 2DY1A 4NYJR 1R5BA 2GJ8A 2RGAA 4RD6A 5CLLA 2DR3A 1E2KA 4PPFA 3UMFA 4YONB 4G0NA 4HLDA 2ZM5A 3VR5A 1NL3A 2YJTD 3RSLA 4ZV4A 4TL7A 2FPKA 5DYIA 5DGXA 5TDHA 2QBYB 2FFBA 4HLUC 1E1RD 3CIOA 3SE0A 4BZXA 3TRFA 4TMKA 1GTVA 3V00A 4AYXA 3B6EA 3C7KA 4ZDKA 1E6CA 1D2EA 1NMYA 1CR2A 1JR3D 1W4BA 5IF9A 3ZIAA 1I4LD 2P2LA 4WBSA 4ZCIA 4XSGA 4UNPA 1E2NA 1FFHA 3EIQA 1CJMA 1X3SA 2EYQA 4KYUA 3WHLA 3BB1A 4OHXA 1P72A 1R8SA 3LVQE 1ZM9A 4PAOA 4QG7A 1OB5A 1E2EA 3V4RA 3VKGA 1NSFA 3QE0A 3LXRA 5AWFC 1NSTA 5FL7A 1Q21A 2FZLA 3ZQJA 1RC8A 2EW1A 4PO8A 2FWRA 1IAQA 2BBOA 2QT0A 3UK6A 1E9SA 4PHTA 3R8FA 3NDBB 2ZI7A 4I4LA 4Q4HA 2ZR0A 3BFKA 4A6XA 4I1OA 4KJZA 4BFSA 4BQSA 1XEXB 1VHLA 2JLXA 4BWYA 1HT1E 2X19A 3D3QA 1II8A 1GZSA 1RW4A 1ZM7A 2C95A 2WWFA 4KBGA 5FTKA 5JCZA 2G0TA 4JVLA 4GZMA 2R9VA 1G6HA 1U0HC 5G3YA 4A82A 2HUPA 3CLVA 3V9PA 4NYMR 2GEDA 2CBZA 3RLFA 1V5WA 3VX3A 3C5CA 4A36A 3TK1A 4IOLA 4DCUA 3FKQA 3KTAB 2BCGY 2N46A 4N0EA 3HYRA 3PFIA 3WMFA 1P9NA 3RS0A 4DC9A 2CK3A 2WSMA 2ZYTX 1W0JA 3ZZ0A 3FWYA 5EP1A 2IEYA 4POAA 4IEIA 4UXIA 4OI0A 2ZYUX 1EXMA 1R10A 2FSGA 3CPJB 4M9SA 3Q85A 2RMKA 4AYWA 3MWKA 1BKDR 3A4NA 3QJYA 4X8HA 3OESA 1E98A 1TADA 4ASUD 4CT5A 1NVWQ 2YWGA 1NBME 5A4JA 3X2SA 1FPMA 3R9IA 4E09A 2LKDA 4QGHA 5CITA 4MUBA 2F3RA 3UWOA 3ZVRA 4WZ6A 1I2DA 2QI9C 2GESA 1R0WA 1XXHE 5JHGB 1ZIOA 1N25A 5JS8A 3LRPA 2REBA 3TIFA 1E79D 2ZRNA 3KX2A 5EXSA 4GOXA 1X8KA 5LD2B 1ZNWA 4HATA 2IHBA 1NBMA 1QHHA 3SU8A 1VG8A 2ZRIA 1N6NA 2F6RA 2VL7A 3LO5A 4JLNA 4OK3A 4ACBA 1XXHA 1CU1A 4U5XA 2XJ9A 1RE0A 4LJAA 3W34A 2HXSA 4QGGA 3NHBA 1YR7A 4Q01A 1HQCA 4CW7A 5E7JA 4L8GA 1OFIA 3SR0A 2WJJA 3QNUA 4JKIA 2KE5A 4LJ9A 4HLQB 4JVMA 1U99A 1W5TA 1Z3IX 2JJ1D 3AVWA 2OESA 4BLTA 2G1KA 2GNOA 2NO6A 4P4UA 3N70A 1YR8A 2BDTA 3HPRA 1CR0A 5EE3A 3OAAA 3UXMA 4E5UA 1VYVA 2ZUCA 3FE2A 2VLIA 4DBLC 5CDFA 5BN4A 5JSZA 2LWIA 5JJKA 4RJLA 3ZQ6A 1E96A 3NBYC 3RWMB 4DLWA 3M1IA 2IT1A 2QUZA 3WYFA 3I5XA 1ZD1A 2ZS9A 2AKAB 1RZ3A 3KZ1E 4B34A 5DNYB 1Z8FA 1OJLA 1CRPA 5DN6A 4EJSB 4Q19A 4DVGA 4U7DA 3JZMA 4BLSA 4DWJA 1E0AA 3IIJA 1W4CA 2CL0X 3IGFA 3O8CA 1OT3A 3U44A 4KV9A 2JGNA 5BWMA 4A8JA 2A9KA 4IJMA 2IXGA 1N2CE 1ETUA 3P27A 5FR2A 4PC7A 4P4TA 4DT1A 3LVRE 1E1QD 2GTPA 1Z5ZA 4BLQA 2NZJA 4Q4HB 3T5DA 5GVRA 1WXQA 5EJEA 3I92A 3GEIA 3RC8A 1ZD8A 1EK0A 4G5GA 3ADBA 2OBMA 1OH8A 2AXPA 4DXAA 1XTSA 1KI2A 4S2EA 3BFXA 1IN8A 3QPWA 4DLZA 1ZUHA 1DADA 2ZAMA 3CNLA 3CR7A 1N0UA 4G3XA 2G9NA 1U0JA 4FIDA 2ZRLA 3A36A 4TSFA 2BEKA 1PVOA 4ZIRA 4DLRA 1LF5A 3LFUA 3QXJA 1UKZA 4JT2A 2REXB 1CJKC 1UEIA 3L0PA 1M8PA 3AGQA 1SZPA 4JVSB 2C8VA 4Q1DA 4WXPA 4YC7A 1KZ7B 4I1SA 4US1R 3T1TA 4FINA 2QM7A 3ASZA 4QFMA 5CB6A 1IBRA 4LBVA 2FPLA 4BLRA 3BE4A 1E69A 5HZKA 2DBYA 4OHVA 1W7AA 2B7BA 4RY2A 1RRPA 3NVAA 2A5GA 1IXRC 2WSSD 2UZ3A 1II0A 4C7OA 5BN3A 3SBEA 2C04A 5TY0A 2XB4A 3REGA 3SQXA 3K0CA 3JZAA 1JPJA 1UJ2A 5K8IA 1ZM3A 2MSEB 4MITA 3EA5A 5FPHA 3CF0A 5FH9A 1HA3A 2CL7X 4NCNA 4Q00A 3TSWA 2VSFA 2ERYA 2NO0A 4X8LA 2J7KA 4URZR 1QHYA 1QHHB 4MDFA 1N0WA 2B8WA 1VCNA 1AM4D 4LI0A 2IK8A 1T3HA 1W4RA 1HTWA 5CLQA 2F43A 1W2GA 2YOFA 4FD2A 3KXIA 2PBRA 3BC1A 1XXHB 3R8CA 2BOVA 3CRVA 5GJWC 3FOZA 3QOFA 4TTRA 3OIVA 3KQNA 4OK6A 2W2XA 4NU0A 2WWYA 4PSVA 2Z5FA 2ZE6A 1NJFA 1OXUA 2J0UA 1SULA 2ONKA 1UKYA 5BYKA 1KK0A 1KMHB 2OILA 4I1UA 4CYMA 4DLUA 4BPBA 5KSPA 2GXUA 2HYIC 4Q4JA 1HYQA 2VEDA 1J7KA 3UKDA 1S9HA 2W2TA 4B6EA 2F7SA 2D2EA 2JEOA 3C14C 4RCZA 3T61A 4F4IA 3THXA 2ATVA 4F92B 4GOJA 1E4YA 2VP2A 2QG6A 4C0KA 2GBLA 2ZVQX 4BEBA 2PZFA 3KDSE 5GJVC 1CXZA 4KSBA 1NKSA 1KHTA 5JSZB 3E2IA 1U8AA 5AUOB 4HZUA 1Z6YA 3AKDA 3FMOB 5AJYA 3TQFA 3LWNA 3AVUA 3A37A 3H84A 4NP6A 1R0ZA 2XNDD 2HT6A 3I4LA 1AKEA 4L9SA 4A8JC 1HURA 2GHIA 3AVTA 3R7WA 1WF3A 2QORA 4LBYA 4LGMA 1VCOA 4I81A 2O0HA 5DE3A 1A4RA 3GJ7A 2IYXA 2MSCB 1LS6A 1P61B 3ASYA 3U44B 1P2VA 1KI6A 2QTHA 4KYIB 2W0MA 2ZE8A 4BFZA 4DUGA 1D2NA 3MAAC 4UJ5A 4BECA 4D6PA 2I1QA 2WBLC 5J4VA 4DT1B 3K9NA 3K0FA 1CTQA 1KMQA 1S1CA 4NTZA 4C0SA 1NVXQ 2PX3A 1OIXA 2DPXA 4NYJQ 4QHSA 4PC3A 5C46F 2RGBA 2WAYA 1RKBA 2QQEA 3WHKA 2FV8A 3BGWA 3IPXA 3HU1A 3LX5A 1N6LA 3DL0A 1P4SA 1VG0B 4KAXA 4WW0A 1G8FA 1Z0AA 3ZIAD 2F1RA 4GMDA 4NHOA 2AR7A 4PQFA 3NEYA 4C9BA 2YNMA 3OEEA 4M1SA 4LBWA 4ACAA 4EPYA 4DIEA 1MRNA 2ODNA 4BFWA 3VHLB 4ZIRB 1CULC 2CJWA 5DIFA 1E94E 4C4PA 2XZLA 1FOEB 421PA 1VG1A 3AVPA 5FL7D 1ZUIA 4DLXA 3U3KA 2ORIA 1NIJA 1IY1A 3AF1A 4WIAA 4YDHB 3RRNA 3F8TA 4L9WA 1NLYA 4NCJA 1G3MA 1GITA 3ZYCA 3G0HA 4LPSA 3W5IA 2VP0A 4ZCLA 2HLDA 3MSXA 2ZANA 3B8HA 4M9QA 1XJ0A 2OE2A 3PR1A 1Q1EA 1TMKA 2PCJA 4BEJA 5E7MA 1OF1A 4M9XA 4MKIA 3GFPA 4XVRA 2ZI6A 1FUUA 4DHEA 5BXQC 4YXWA 3GFTA 1XRJA 2YKGA 3FHCB 3NC0C 4C7OB 2J87A 2GF0A 5B64A 4US2R 4TL6A 3S1AA 1XZQA 3M4YA 4V0KA 4C0BA 1OHHD 4TLDA 1UKEA 3DPUA 2WICA 4JMPA 3SEAA 721PA 1KK1A 4L5BA 4CT4B 1V43A 3GJ4A 2NO1A 2ZROA 4D0NA 4EFNA 2CK3D 2TMKA 2ZAOA 4XJXA 1Q22A 3IEVA 2YC4C 2OXCA 2F1IA 2ZUBA 1FQJA 2ZE5A 3OEHA 4XH9B 3FPAA 1T3SA 2P5SA 2VF8A 4Q9KA 3AKYA 3QVVA 4LV8B 1GL9B 1ZNZA 5CYOA 1X8JA 3K70C 4QBHA 1J70A 1TUEA 3PG5A 1Z28A 3N2EA 1TU4A 4RSGA 5KDOA 1Z47A 5KHOC 4OJKA 2A3RA 2VSOA 3GLHE 4L16A 2GEUA 4MRRA 3B9PA 4CZ2A 4CGZA 4LV5B 2WMNB 4QXAA 3X1ZA 2ERXA 1WE2A 2YWEA 4Q4JB 3C4JA 3TQCA 4KFSA 1M7HA 1Z08A 3DM9B 121PA 4RD3A 4OQNA 1OFTA 3B85A 3B82A 3SNHA 1NBMD 1SHZA 5FOTA 4EKDA 1SVKA 2KBFA 4HEJA 4TLCA 5F2EA 1IN6A 3RS2A 1W49A 3GLHA 1GNQA 1VYUA 2Q3FA 2V6JA 4V0ME 4KHZA 3FHTA 4W9MC 1MH1A 3PUWA 3OFNA 5G41A 3PEWA 4P0TA 4NYIQ 4HZUB 1AZTA 2C9YA 2Z4RA 2EQBA 4OI2A 5FPKA 1IJFA 3UMRA 2N1BA 1NMZA 1AS0A 3T1QA 4GPTA 1AJEA 1OXVA 2O5VA 1W5SA 4Q66C 2CLDX 1UBCA 2IWHA 4LHYA 3R7WB 4EFMA 1MO6A 4V0MA 5DHAA 4ZKEA 4AK9A 1VTKA 2RKOA 3PENA 2O8BA 4JSYA 1M7GA 4URXR 4AY2A 1ESMA 1KYIA 1KI6B 5KNCA 1VKJA 1OE0A 2FJUA 2IEZA 4LYJA 3GLFE 1ODFA 1D5CA 1X86B 1XMJA 1JALA 4PZYA 1SHKA 1QVRA 4Z8YA 1XPRA 1E2JA 2EFHB 2ZI4A 4I1VA 3OAAD 4IHQA 4GSYA 5AJVB 4RD1A 3KJGA 2WOOA 2VHTA 4BZPA 5EE9A 1XD8A 1T8TA 4LHVA 2OXRA 5EXXA 4MRPA 4P4SA 1Z2CA 4BZQA 3GLFA 4ON9A 3RS5A 3KQKA 3UIEA 3LAWA 4GMXA 1XMIA 3REFA 1PUIA 2QE7A 2VHQA 3FKSA 5E4FA 5ANRB 5C1BA 1G1MA 1E0KA 1QHXA 2HDNB 2GXAA 2CJWB 1Z2AA 5GVSA 3RVBA 5CK5A 2PX0A 1RRCA 4K46A 1NMXA 3BAFA 2IC5A 4NE2A 3DOFA 2HF8A 4YQFA 5F9HA 1XPUA 2GXQA 2AL7A 4U02A 2CVHA 5FI1B 4B44A 1UDWA 4FMCF 3QY0A 3N5CA 3LBIA 4HUTA 5B57C 1O87A 1JXMA 4LHXA 3K0AA 4K8OA 1GRQA 1I4TD 2O8CB 3D6TB 1G64A 3AP1A 3MMPA 1AQUA 2V1XA 4A0FA 4RKFA 4R71A 2ZRMA 2IYWA 1RYHA 4NPHA 1XJCA 2D4HA 1KAGA 4C0QC 2IYVA 1SXJE 1VCIA 3S1AB 3V4FA 2QQ0A 2QSZA 2REOA 4TSFD 3QXXA 3VHXA 3PCRB 2ZE7A 1FUKA 3MLEA 3EIHA 1PV4A 2VPPA 1MV5A 3PV0A 1XX6A 2WOJA 3L82B 5J4KA 2O8FA 2IYTA 5DHFA 3VR4A 1K8RA 2DB3A 3PJRA 2GA8A 5D3QA 3A1SA 4HAYA 1RRFA 3EXAA 2HF9A 5HTKA 1IQPA 1FP6A 1DO0A 1SXJA 3U61B 3TUIC 1U0LA 1LNZA 2ZRBA 1N6OA 1P2UA 2ZR9A 4MUAA 1P9WA 1GKIA 3MCAA 2P5TB 1DPFA 3K09A 4Q1FA 3BORA 2QP4A 4E22A 3AVYA 3E1SA 3FMPB 2XTNA 3TAUA 1OKKA 5FTNA 1WBBA 2FEOA 2UZIR 3CRW1 4FWIB 3W6NA 5F98A 2EFGA 1X8LA 4G5RA 5AUNB 1XU4A 4Q1AA 5LBIA 2W00A 2NGRA 3M0EA 1H65A 4B6FA 1LS1A 4RZXA 1YHNA 4GOKA 3GLHB 2W6JA 1F3OA 1EFRA 3DMDA 2KI5A 3ZLJA 2R8RA 4LHZA 4N0DA 4MYCA 1NN0A 3I32A 2QENA 3DM5A 2J9RA 3LXXA 4Q7JB 3VR2A 4ERNA 1QHNA 3ZVLA 3B1YA 2VSXA 3AEZA 2Q0HA 1AIPA 1W36C 4Q47A 1KDPA 3IPYA 1C1YA 4P33A 1AN0A 2Z4SA 3HWSA 5JWRA 3K70D 4D25A 4B74A 1GRRA 1AZSC 5EP4A 1IN5A 4PQRA 1GKUB 4IDHA 4ARZA 5KSOA 3D31A 4UNQA 1UBGA 3EASA 3VR6A 5F9FA 3AKEA 1CJVC 2AHOA 1W36B 2C9CA 1T0HB 1XD9A 2ZRPA 3GMTA 3TVTA 1KK3A 1C9KA 1HY3A 3WMGA 1TL7C 4WA7A 2EWVA 1BIFA 3H2YA 4X8MA 2ZR7A 2I4IA 2CVFA 4YDSA 3NBXX 5LB2A 1M74A 3CF2A 3PEVA 3FGNA 5FOWA 4PPGA 1P9RA 4P4SB 1G9XA 1EFUA 2WIAA 4DKXA 3GLFB 2J59A 4LC0A 2EWWA 1Z29A 4EJSA 1DAFA 1W2HA 4H1UA 2GWHA 2XNSA 3RRYA 2VH5R 3TR0A 3ADDA 3KQHA 3B9QA 1P2SA 1AKYA 2JJ2A 3QXCA 1GG2A 2OBNA 3MRSA 3AH8A 1NF3A 1T0JB 4Z51A 4HDQB 4WAUA 2IYYA 4ZCMA 2ZRHA 4XOIA 3QVUA 1Z63A 2BMEA 2E9SA 3PITA 4JLJA 4DUGD 5KUTA 2FFAA 1CJUC 2ZJZA 2QGNA 3AB3A 2FPMA 3L2OB 1L4UA 2F3TA 5C4GB 5FR1A 4DZZA 4F91B 3LLUA 1P75A 2FEMA 3K0AB 5SZHB 2JLVA 1E2GA 5JLJA 1YRBA 1MKYA 1A2BA 2W0SA 1N0VC 1UKVY 2A5JA 4NH0A 1QDEA 1R0YA 3DVLA 3K9GA 4RD2A 5JJLA 1Q1QA 1TF7A 1P7CA 4JLMA 3F3YA 2ONJA 3KUDA 3SDZA 4F4CA 4FMCB 2DFKB 4G5QA 1MT0A 2YYZA 1M7BA 4OBEA 2H7VA 2V1UA 1SXJC 4RZUA 1QBKC 3K8YA 5P21A 4GDFA 1WDTA 3ICEA 2QPAA 3U4QB 5JWHA 2HV8A 2BIFA 4GRAA 5CIQA 2O8FB 5TB5A 4BGDA 4G5SA 2RGDA 3AF4A 1F2TA 1DTSA 3KKOA 4XIGS 4DB2A 4QNMA 1AQYA 2CHGA 3K09C 2BMJA 4LJ4A 5IK2A 2JA1A 2J1LA 4JVNA 1SXJB 4Q02A 2HLDD 2YHSA 4PZZA 1XCGB 4HAUA 3SOPA 1TEVA 3O8BA 1U90A 2CNWA 4LYAA 4HLCA 4AIIA 1GKYA 3LQRA 2ODWA 5SZIA 1G19A 4TTQA 2V54A 4O2RA 5FPSA 1PUJA 2BV3A 2Q21A 3HDTA 3TAHA 1TQ6A 5LD2C 4JKYA 1II9A 4YXWD 4L15A 4XTCS 4D0GA 4TQUS 4A9AA 1Z6XA 4XD7A 2HJVA 1ZIPA 3VU9A 1JNYA 3NTUA 1XD2B 3TR5A 1OXTA 1XJQA 3GJ8A 3AM1A 4GL2A 1F6BA 4KVAA 4PXAA 4XVQA 5A0FA 4Z1MA 3RHFA 3VMFA 5JWOA 3WNCA 4DCSA 4DJTA 3QXSA 3VR1A 3W3AA 4IDOA 3BRWD 3FVQA 4HAVA 4B73A 2GVDC 1KI3A 3DZDA 3OEHD 3EX7C 4CEJA 1OH5A 3VR3A 3KJEA 2OM2A 1ESNA 1RFLA 5B58C 2DWOA 4DDTA 3VTKA 2ZJ2A 2YOHA 2QTFA 2W6ID 5JBQA 5H8WA 4JS0A 5CM8B 4OYHA 4Q18A 4L4UA 3SN6A 1BH2A 1E3MA 2JIZA 1KMHA 5CDFE 1KI9A 1QG2A 3IO5A 5DH9A 5E95A 5G3ZA 4A1FA 3QSYA 1E9BA 1ANKA 4WZAE 1MRSA 3RS3A 2IS6A 5FUWA 4ARZB 1U8ZA 4M1MA 4HAXA 4LX0A 1X1RA 4PFSA 2EFCB 1NVVR 3MFYA 1W1WA 1B23P 4MYHA 1H8HD 2FG5A 3Q7QA 1COWA 4ZO4A 2BM0A 2QGZA 5KOYA 1XEWX 3TUJC 3GJ3A 4LWZA 2Q3HA 3OFND 4EJSC 4OQMA 4Z8XA 1FQKA 4KO8A 3BIFA 4OHYA 4M4SA 2ZIAA 2JLZA 3DZ8A 1S3SA 4MYUA 3P26A 4JBWA 2WWIA 4PC1A 2AN9A 4QC2A 2XSZA 4GNKA 3L0IB 4Q48A 1JQJC 221PA 4DLYA 5FTLA 2QMHA 2WPDA 3RS7A 1TQ2A 4EPRA 2IL1A 1LB1B 4F4JA 1W36D 1N5LA 2V9PA 4F7WA 1EFHA 2OLKA 1EX7A 1Y3AA 3WNDA 4JSTA 1VHTA 3KJHA 4BUJA 1VCMA 4B71A 1XTKA 3ZVNA 2X2EA 4PQYA 3TSZA 3PIRA 1NVUQ 2ZSBA 4RZ3A 1JEDA 1XNJA 3FFAA 3AKCA 2C78A 3GLGB 1XMVA 3U7FB 1J99A 4EUNA 4IKEA 2GXSA 2QE7D 4DDVA 1Z0DA 5HKKD 4TZ0A 1NY6A 5BQ5A 4CRWB 1T8UA 1KNXA 2X2FA 1VMAA 2CEAA 2OFWA 3M6AA 3K9HA 1XTQA 4OHZA 2ZRGA 3BK7A 3PUXA 2NG1A 2Z6VA 4MDEA 4Q7LA 1F2TB 1R8QA 2AFHE 3U2QA 4AKGA 1KZGB 2ZYWX 3FB4A 4D0LB 4Q7MB 2OFXA 2G3YA 4ZI3A 3GPLA 1KI8A 1OLOA 4NDZA 2H92A 2J45A 1G7CA 5F3WB 4BLOA 3C8UA 1LF0A 3MGCA 4B32A 1T5IA 2QRZA 4O3MA 3L43A 1G17A 2ZSEA 1YU9A 3IQXA 5KSYA 3B1XA 5FBQB 1D2MA 3VU9B 3OZXA 3NIBA 3MWLA 1UEJA 1UPTA 4PC2A 4DEXA 1FX0A 3IKJA 3EIEA 3W9YA 4DSOA 2PMDA 3G82C 3GEEA 2H18A 2Z83A 1XDBA 2IYZA 5D3MB 1M2OB 3W6OA 4AI6A 4Q4LA 2D7CA 3O8DA 2J7PD 1LVGA 2QAGA 3AP3A 5FBVB 4MGYR 1DG1G 2IBMA 4CEJB 1JPNA 3ZZUA 1SXJD 5J5CA 4GT1A 1KJZA 1LY1A 5FTMA 5IT5A 1JQLB 1BOFA 3HYTA 3I8XA 2HCJB 4KODA 2ZXUA 1HUQA 1TEXA 3A1WA 2AX4A 3BH6A 1N6PA 1W0KA 3RNLA 3B1VA 1KO4A 1N5JA 1BYIA 1K6MA 2CXXA 4V0NA 3BBPA 4MA4A 3THOA 4C3ZA 1G41A 2OCYC 1TQ4A 1OKKD 3GJ6A 4YLGA 3TLXA 4D82A 2FF7A 3Q8XB 1S9DA 4HAWA 1B0UA 2QU8A 4Y0AA 1ONBA 1VIYA 3HP1A 3MG9A 4LZZA 2PEYA 2P6NA 4URWR 2GRJA 5FPYA 3A6PC 3A4LA 3RS4A 5HCNA 1KSGA 4ESVA 1N5IA 2GDJA 2CMKA 4XWOA 5EXPA 1EFRD 2OAP1 4PTLA 4DIDA 2ORWA 2EVWX 2IXFA 2QPOA 2ZJ5A 3PUZA 2ZRKA 5TMPA 1GDDA 4IDQA 2IUTA 3QUSA 2A78A 2BHRA 3NEJA 1KDOA 2OZEA 3BH0A 4PX9A 5FUXA 2KSQA 1E2LA 4B43A 2PCLA 4QJ4A 1FNNA 3I73A 4O0MA 5EE5B 2IS4A 2QEQA 2IW3A 3EZ2A 3U3RA 3EARA 1G20E 1G5TA 2GCNA 2JDIA 2NZ8A 5DI3A 3A4MA 1IN4A 1Y63A 2DWPA 2MSDB 3KFXA 1Q3HA 1DARA 3IILA 4GI7A 1JR3A 1X1SA 1YZQA 1UBFA 2X77A 2DWQA 3QF4B 2DCUA 5KDDA 3NWJA 3WBJA 1DBSA 4EDHA 2JATA 3H86A 3EAQA 3LA6A 3UG7A 5KPJA 2XOKA 2BCJQ 5FBLB 3U6KA 4QKQA 4LHWA 2R62A 1ZCAA 4LJ7A 2O8EA 1HEIA 3GFOA 3IHLA 2FE4A 3EZ6A 4D2IA 3AF2A 3CX7A 1UBEA 5UKDA 1U2RA 4TMVA 3SJZA 2ECKA 1YZTA 2VTKA 2JJ2D 3AF0A 2XB2A 2DHRA 5EUMA 4NKRA 1DELA 1JR6A 2MMGA 4TMZA 5FUYA 3ZVMA 4Q1BA 4GP6A 2UVQA 2BKEA 2ANCA 4RVCA 3FDIA 3L8YA 2Q3MA 4QGAA 2IHYA 1G3RA 1ZCBA 2R44A 4E03A 1Q1BA 5HE9A 4EFLA 5H68A 2C77A 3E5HA 1N6KA 1KDTA 1E0JA 2FU5C 4A2PA 2O8CA 3K0CC 1Z0KA 3SYNA 2EFEB 5TXGA 2ZYVX 2H16A 4IRUB 2HXYA 3WP0A 3Q9LA 1SKYB 2VQSA 4IFEA 3TH5A 5DISB 4A4DA 1NN1A 3LLMA 4TT3A 3CB4A 4AYTA 2IYUA 3ADKA 1E2PA 2QAGC 3IIMA 5EZ6B 2JLRA 3CZQA 3X1DA 4FW9A 821PA 2VP5A 3AUYA 4W5JA 3WNBA 1UAAA 1FX0B 3R20A 1YZLA 2WAXA 1NG1A 4LYHA 1JI0A 3BWDD 3H4MA 1EX6A 3GD7A 1W0JD 4NYMQ 1H8EA 4Q03A 1QHIA 2GK7A 1BO6A 4BRWA 2WJGA 4RCYA 1W44A 1ZU5A 1IOZA 2QAGB 3PVSA 2WJHA 2X1VA 2HEIA 1Z0JA 2IYSA 2FH5B 1Q44A 1S0UA 3VNUA 4QRHA 3NKVA 5KNBA 1LW7A 3TUZC 2Q9AA 3THWA 3Q72A 4TZ6A 1Z6TA 2CCKA 2FN4A 3LH5A 1S2MA 1SVSA 1XMSA 1YR6A 2C99A 3BB3A 1E9DA 1XEFA 3I3SR 1F5NA 2GBLC 2JLSA 3KKQA 5AR1A 5HE8A 3CX8A 2WJVA 3IHWA 3CX6A 3K1JA 4QHYA 4QM7A 1CF4A 2ZJBA 5G40A 2XITA 1JAHA 1Z22A 4EPTA 4LC1A 4DCTA 4DDUA 1E0SA 2O0JA 2QL6A 2ZU6A 4OL0A 4OK5A 3VNVA 2FSHA 4CVNA 1G8GA 2WKQA 5KTYA 1G21E 1R2QA 3SHFA 4FI3C 1ZC3A 4BRUA 3DEFA 5FL3A 5JI3E 1HT2E 2I3BA 4PZLA 3QG1A 1RPZA 1NY5A 4P32A 2UKDA 3QKSB 3VKHA 2GILA 4IXMA 2QA5A 3MJRA 2NO9A 1AS2A 3ZZTA 4DCNA 1MO5A 4JLDA 2ZU0C 3GEHA 4JT4A 4LY6A 5DSZA 3THYA 3C41J 4E07A 3PEUA 1KOFA 2CDNA 1WQ1R 2BC9A 2BJVA 4NL4H 3CRRA 4IVRA 1DG3A 2ZRAA 1JECA 1KSFX 3KB1A 4WVFA 4EIWA 4W5HA 4B2LA 2QM8A 1F2UB 1ZINA 5DI3B 5J4LA 4M1WA 3TW4A 3SFZA 1WA5A 3GLIE 4MGIR 1VDZA 2XZOA 1UADA 4LSGA 3ND9A 1GL7A 3ICQB 2OBLA 1XB2A 6Q21A 1COWD 3OF5A 2P65A 3B1WA 2CLSA 4MGZR 4WZBE 3NXSA 2ZSFA 2YZ2A 3SS8A 3LNCA 3NDPA 3SQWA 3T15A 4W7SA 2PLRA 4HAZA 1QVAA 5FTJA 1E2MA 2IUUA 4C0JA 3I61A 4HYYA 4XWKA 3GLIA 4DRZA 1R7RA 1G3QA 4D26A 1CR4A 3QQ5A 1FTNA 2O8EB 4PO1A 3TNFA 1I2MA 4JL6A 3CO5A 5DN6D 4ZPXA 2OO7A 2XSZD 3G5UA 2BEJA 1TAGA 3UANA 2P6UA 2QP3A 5KNDA 4B75A 2AFIE 1CJTC 2O52A 2WPDD 1XCMA 2Q9CA 4Q21A 1F60A 4B48A 3TSOA 1L2TA 521PA 3KQLA 1SVIA 2WWXA 1IM2A 1P2TA 1SGWA 1QHSA 4Q1CA 1JB1A 5BN5A 1JJ7A 3U6BA 4C2TA 2XXAA 3LY5A 1U98A 2D3WA 1ZYUA 3CM0A 3KXLA 4V02A 2P0EA 3O8RA 1D8TA 3VQTA 1KY3A 1VG9B 1XEWY 1FTSA 4FCTA 2EU8A 4UQOA 5CYPA 5LDDC 1NLFA 5CIWA 1BMFA 1G8YA 1M1YE 4WOPA 4CF7A 5JZVA 3A1TA 3LD9A 3IEUA 4JLBA 5BW8A 1N6RA 2CLCX 2Q6TA 4JZKA 4LBZA 2VO1A 1XCPA 1KKMA 1ZNYA 2ASEA 4PPQA 2WWWA 2IYQA 2IWRA 4AG5A 4DDWA 1M6NA 5AJXA 4YMTA 3Q3JB 3DKVA 1R5NA 1ZBDA 1QF9A 621PA 2HCBA 2ZITA 2OLJA 3EC1A 3K9LA 3ZH9B 5JMTA 4EAQA 3OIWA 4QNRA 4U00A 3WMEA 3U4QA 4CEIA 1XTIA 1Q3TA 4JJZA 8OHMA 4AURA 1KKLA 4II7A 1KAOA 2F1JA 3CWZA 3HR7A 4OKSA 2CCGA 2GCPA 2FSFA 5K8LA 1OW3B 1CP2A 2WSSA 4YMWA 5DI9A 4A6PA 5L3VA 2ZRFA 4JYCA 4Q1EA 1HQYE 4UXJA 1OSNA 2V55B 3QPVA 3SC3A 3MUFA 2W2VA 3THWB 2KBEA 1E2QA 1ZNXA 3E70C 4DLSA 3U5ZB 5IRCD 4A92A 2AD1A 3CR8A 1PLLA 4N3NA 2GJKA 4URUR 1XD2A 2A5FA 2R6AA 2ORVA 1KI1A 2BJWA 2P3SA 1OH7A 4B35A 1AGPA 1VPLA 4ASUA 3P1JA 3QPUA 4WXRA 5KSZA 3AP2A 3PXGA 3RRMA 1YVDA 2GJSA 4AG6A 1MO3A 5AJZA 2WMOB 2G6BA 5K8TA 4NCHA 2YOGA 1EWQA 4TYQA 4JJKA 1L8QA 2RHMA 3IBYA 3LDAA 1E2IA 2BWJA 4TTPA 2CHQA 2JLUA 2RCNA 4BFYA 3TVDA 2C9OA 4NCKA 4KVGA 2G83A 2VHJA 1W0KD 1RRGA 1RVDA 1Z6AA 5DLQC 5L3QB 3BS4A 2WKRA 3THYB 2NO7A 4MRVA 5E3HA 5DO9A 3CF6R 2ZVPX 1T6NA 4DLTA 1E2DA 4PHFA 1N6HA 1OIWA 4PHGA 3BXZA 2E87A 2KB0A 4LJ6A 5JRJA 1YJ5A 5H70A 3VAAA 1GIAA 4IDPA 2OSBA 1GM5A 2NPIA 1VIAA 5LB4A 1GRNA 1YZNA 3EPJA 1US8A 3LBHA 2PZEA 5BYJA 4YMVA 1YE8A 4R2IA 5JECA 4BFUA 2V7QA 1TQDA 4M53A 5FOSA 4TWZA 3BOSA 2OCPA 3U60B 3DDCA 4JL8A 4C2UA 3LW8A 1KDRA 1ZUNB 3GLIB 1F48A 4XSHA 3B13B 4JIMA 3UATA 3WRXC 2R6CA 2FMXA 1WP9A 4LCBA 5KU1A 1RJ9A 3CH4B 2CE7A 1KSHA 1Z06A 3FYHA 3O47A 1CIPA 3DHWC 4RD0A 1M34E 2XAUA 4LJYA 2GK6A 2JDID 5AUQA 1G5RA 4UNNA 2QAJA 1QG4A 3QF7A 1WB9A 3QKTA 1CBUA 2Q9BA 4LDJA 2HJGA 2IXEA 4DEYA 4UXHA 4R9UC 2WHXA 4TMTA 2PZGA 3EZ7A 1DS6A 3GLGE 5TVKA 5B30A 3IQWA 4HI0E 4BFTA 1Z83A 2GAAA 3NHAA 2WJYA 3TJZA 1E9FA 2XXAB 3AVVA 1FW6A 5C18A 1TX4B 2RB4A 2QMOA 2H5EA 4MRNA 1HE8B 1GL6A 1KJYA 1P3JA 2RGNA 3T12A 2XOKD 1TTTA 3RWOA 2GJ9A 1TF2A 3K0SA 3GCGA 2J0SA 4B3FX 4GFDA 4ILEA 3GLGA 3K53A 1EWRA 3C5HA 1ZAKA 5J4HA 2BVNA 2OUKA 3OEED 2GJAA 1O3YA 4Q9JA 2O8DA 3Q5DA 4C0LA 3IO3A 1EFTA 2BBSA 4R2HA 1XPOA 2RHDA 4CEIB 4JLOA 1A1VA 2J5XA 2XTMA 2JLWA 3KB2A 3A8TA 3CPEA 4QBIA 5B2ZA 2AXNA 3OIYA 2XTZA 4NCIA 1IXSB 3ZDQA 5E7IA 2QPTA 1OB2A 5JFGA 3BFVA 5C2JB 2DFTA 3AVOA 1YKSA 1UDXA 2EYUA 4JL5A 1ZP6A 2G77B 2ZJ8A 4ABYA 4EPWA 3WXMA 1OHHA 2VHCA 1T4GA 3F0TA 3RYTC 3U7EB 2H17A 5HR5A 3MWYW 3L0OA 1EG7A 2GVZC 4TT3D 2IYRA 2HYDA 3WBKA 2NIPA 3T34A 1WCV1 1NLZA 1SKQA 3HR8A 3I8SA 2XX3A 3LBNA 4FXPA 2GCOB 4LUCA 3Q7PA 4B3CA 1BYUA 1HE1C 5D3MA 4D4JA 4PANA 2OT3B 1H8ED 2F55A 4CEHA 3QBTA 3CNOA 1J8YF 2OCAA 5L8VA 1CR1A 1DAHA 1C4OA 3KFVA 5J47A 1PJRA 1T5LA 1KI4A 1XTRA 4JBYA 1MO4A 1WRBA 3FTQA 5FBWB 3ZD7A 3PEYA 1U8YA 1JXOA 5KDLA 2I1VB 1G3UA 3CBQA 3BJIC 1SVMA 4G1UC 5JI2E 2NTYC 2JAQA 4NYIR 2J0QA 1A5TA 1LFDB 3P4YA 2VP6A 4IVQA 1G8PA 4FCVA 4MRSA 2OCBA 2IS1A 3U3OA 3QG5A 3U7GA 2ZJYA 3JVUA 3VKWA 1BS1A 5FI0B 1YZUA 1OXSC 1KO1A 2R2AA 1P60A 1MR3F 1R4AA 5L3SB 1P73A 2IYLD 3MWJA 1KTVA 3LQQA 3SJCA 3A1VA 2VHUA 2OHFA 2BBWA 4B33A 5ELXA 1DO2A 1US8B 1OYYA 3N2IA 2ZETA 5C4MA 3I1FA 3GJ5A 4CIDA 1MOZA 4MH0R 4QL3A 1AGRA 2D74A 2F1HA 2N42A 5DYGA 2IF2A 5JRZA 3NBZC 3RSOA 3CRQA 4JYBA 4MKFA 1KSJA 1XWIA 2VP9A 5FBRB 5FOXA 3ZGXA 1MABA 1RJ9B 1ZJ6A 2FSIA 3U7HB 2FOLA 3FMIA 3FHOA 4HB4A 1G7RA 5L3RA 3MD0A 1GP2A 3IIKA 1L7VC 1FP7A 1UFQA 2YC2C 4URVR 4KI0A 2PJZA 5KYKA 4EQ6A 3NC1C 4OHWA 2RGNC 3W5JA 2ZS7A 2W58A 4TLBA 4D80A 1QZXA 4IOMA 3QF4A 5FOUA 4BFXA 3SZRA 4K81B 3EC2A 1Z6GA 4DSNA 1U9IA 2ZUDA 4F38A 1XP8A 4LYFA 1K5DA 4OQLA 1G7TA 2R6FA 2D06A 4MYTA 2PMKA 3KKMA 1L4YA 2RAPA 3GP8A 2RGEA 4C30A 3WP1B 1S4QA 2ZSDA 1P5ZB 4FWTA 4KLNA 5CK4A 5HPYB 3UG6A 1E32A 4C0AC 3KKPA 4MKGA 3EW9A 1UF9A 2VBCA 3FKSD 4AKIA 4OI1A 2O8DB 3HU2A 2ZSAA 3OE7A 2CCJA 2ZRCA 2XEXA 2QTVB 5EUQB 1Q1ZA 5J4YA 2YWFA 4RFSA 2X8AA 2OAQ1 4GBMA 3Q5EA 4B3BA 1SKYE 1OYWA 1II8B 1ZC4A 1NG9A 5K8UA 4HSEA 3J81k 2NMVA 1GNRA 3W3ZB 4TLAA 3U3JA 2C2HA 1NN3A 4JLAA 1BMFD 4PAQA 3IBGA 5EP2A 2Z43A 5H1YA 4DB4A 3SBDA 3SJAA 1YRAA 2JASA 5CJ2A 4O2LA 4LJ8A 1IN7A 4HB3A 3BD9A 2A2ZA 3QI2A 1D6JA 3SHWA 2QNRA 3W6PA 1GILA 1Z07A 2DYKA 4JLVA 4KBFA 4JBXA 1GWNA 3B60A 2F9MA 4OQXA 5IDVA 4Y0VA 4Q9LA 1G3IA 4B3XA 4AKHA 1NN5A 3VX4A 1X6VA 4TYYA 4AC9A 3EPKA 3WYGA 1XFAA 3NG1A 4HZIA 2VRWA 4RD4A 2W83A 4TYPA 1JAIA 4Q4AA 2IA5A 1WBDA 3RC3A 1J2JA 4BFVA 4PO9A 1CEEA 2GEVA 3MJHA 2GAOA 2FDCA 3ZD6A 2FGKA 1KO7A 1HV8A 3GJXC 3QKUA 1FNMA 5SZKB 3NBFA 4M0LA 2C5LA 2GKSA 2KWIA 4TLEA 3X1WA 1Z0FA 1RYFA 4O25A 1OH6A 2FA9A 1N3BA 2GETA 4KITB 3R9XA 4A0HA 4HDCA 4NMMA 3OIUA 3W8RA 1K5GA 2JLQA 3AF3A 1W46A 2B8TA 3I72A
chains in the Genus database with same CATH superfamily
4HHEA 1FL9A 2PRJA 4FNAA 1WXFA 2KM1A 4OUDB 1QX4A 2PKYX 4MUFA 4NFHA 1ULAA 4XTRA 5DGCA 1P0MA 4MJXA 1IEQA 2CZGA 1O95A 1G5QA 2NQ8A 2W6JD 3LKZA 2A86A 4PTYA 4ZYVA 1ZD9A 4ZANA 3HK2A 3WWOA 3QKSA 2OEPA 3CH5A 2GO1A 3Q3GE 1GRCA 1D2GA 3ES9A 1BHJA 1KJWA 3L7MA 4C05A 3QU5A 1PT8A 1QGYA 4ZAVA 4QXMA 1G9TA 1T1JA 4D4MA 2QQGA 1C30B 1SBTA 3ZY5A 3IMGA 1QYWA 4HB2A 3TJRA 5FAKA 2JHFA 5H3HA 3CH7A 3VFDA 2V3CC 5E1BA 1RPTA 1WU7A 5ALZA 3TOCA 1OI4A 1W19A 3IMEA 2JFYA 4F3RA 1U9IC 2FFHA 2WWGA 3JYPA 4LRXA 1U2GC 3RG8A 3SIWA 4GP7A 1J7JA 4EQ6B 2ANBA 3TBKA 2B5OA 2YBEA 4RV9A 1IHXA 1GUFA 3C6BA 4UUMA 2QOEA 2XKAA 1SXIA 2QRVB 4W4TA 2WVJA 3NUZA 3X1YA 1YJBA 3D8HA 1FSGA 2ILTA 1FMLA 2IITA 2VNAA 2BLNA 2HPZA 2ZKIA 4K05A 4GQIA 4D4LA 5J5VA 5JS7A 1J0AA 3IMFA 3X2SA 5EHGA 4CGYA 4X7BA 1WHSA 4QXOA 4WMLA 3RIEA 2QROA 5CD9A 2QQ5A 1USWA 2Y67A 1WCIA 3WJAA 1BRTA 1OIVA 1X7WA 3GX1A 4FC6A 4KJXA 5DJ5A 2X0EA 3CURA 3WGVA 3JALB 5C7YA 2D7DA 1SU7A 4KQJA 4C01A 1ZGZA 3KDPA 2JAPA 3FCOA 3LOUA 5J2UB 3RKSA 3T8YA 3UA4A 2B92A 2I33A 2B5WA 4LXXA 3D8RA 4UU1A 3CW2A 4MUMA 3I5AA 3CXRA 4CLRA 2FRDC 4L0MA 1X7YB 1GZUA 1XLVA 3CUYA 1YJ8A 1AB6A 1Q7TA 1DV1A 2JKYA 2P2CA 3AUFA 1T9HA 3LX8A 4NAHA 3T5MA 4QPCA 4LMAA 3LXUX 5IBQA 2J9ZB 1DAMA 1ZOOA 4N7MA 4B8WA 3DE5X 3I58A 1E9CA 3A11A 3PJFA 4Z99A 4G81A 1CZOA 1T4CA 4M8SA 3WRYC 4O02B 3WJ2A 5JEEA 4XGRA 3ZV5A 4GOLD 2CSXA 1KI7A 2WFAA 2DOKA 2QW1A 3RIYA 2D5LA 3GMDA 1NNLA 4FJ1A 4OJNA 1NUAA 1NNEA 4M8KA 1ZA1A 4R1PA 3H8WA 4TQGA 1MJ5A 1P1RA 2MMCA 1UFOA 1WUJS 1NXWA 4GUDA 3RV3A 3WY9A 4A6DA 5AESA 1CUYA 2AYYA 3U26A 2ZZKA 2V4ZA 1LJLA 2X7JA 4B9EA 5KX5B 2O7VA 4MIOA 4B46A 1UM8A 5I7VA 5JQGF 1R4MA 1V8FA 4JBHA 5JC1A 2G06A 3GH1A 2HUNA 2IS1A 2CJXA 2IUSA 3O7MA 4L76A 3D6VA 1JGTA 2PRSA 5KQMA 1IIRA 2R8OA 4RFVA 3V80A 5ADHA 3CZAA 4OXIA 1QC5A 1YD7A 3IUEA 4HPXB 1NHGA 3ZCQA 3VKUA 4ZOQI 5IKXA 2A1TR 4TWJA 3EFBA 1KTIA 2F3QA 2ZUUA 3MIIA 5DNCA 3JPWA 1YBAA 2CNWD 3UAZA 1Z0ZA 2VFAA 3TKLA 3LT0A 4H1VA 1J8FA 5K3AA 3H1PA 3G9XA 2BSXA 4I6JA 3ZS9A 1YQWA 4KDRA 2R00A 2GZAA 3A14A 3F5FA 4FDAA 4FYXA 1V8ZA 4H3HB 4AKEA 1DEKA 3P4XA 4EI7A 1WETA 4UDXX 2OCIA 1VYTA 4FYKA 1V16A 1WJGA 3BRWA 4Z86A 1X7GA 4B6RA 3VH3A 2ZI9A 3PPIA 3QEBZ 1S2LA 1FDTA 2Z08A 3COWA 1B16A 3HFJA 1AK2A 1NHWA 3ZCPA 5K99A 2WQ6A 3T7SA 4QXQA 4Z1MD 2JCYA 5E3JA 3EVEA 3U61B 1PGPA 4PWZA 5ER6A 2Q50A 4ZT2A 3ZWPA 4EGFA 3DKPA 3KHUA 3E18A 3PU6A 5CM9C 1RZRD 4MYRA 2R7KA 2GX6A 3FMFA 4XXHA 5EJ7A 1F51E 1K27A 1E99A 2JLCA 1F5SA 1VJCA 3PRYA 4IMPA 1JEYA 1EBUA 2DKNA 4JB0A 3OQOA 3HI4A 1GOTA 2PU7A 4MW6A 3SFVA 4IOKA 3KJNA 1G8AA 2ZJFA 4YRTA 4AJKA 4PPNA 3IAM1 1FYVA 3K70B 2D0IA 2AXEA 4XPZA 3UNXA 2DFVA 1NT4A 4UTRA 4RNDB 3GVHA 4FFNA 1R4NB 3KEGA 2I4LA 1ENPA 2ZTHA 5I3ZA 2XT0A 2V7UA 3EMKA 4UJ3A 4DVJA 1MENA 3DWEX 4O4LF 3TKYA 3FLBA 4CDGA 4H7DA 1W48A 4QEKA 5CJPA 2BUBA 1PGNA 4MVJI 3WK7A 1Q6YA 2QP9X 3Q8LA 2ODEA 2FQ1A 5ARDA 4Z2AA 1JJAA 1OZFA 1PQWA 3FSEA 1ZK4A 3CWQA 3ADCA 3LY7A 4TQ9A 1JP7A 1Q11A 3S2IA 4JJAA 1L8XA 4W9RA 4HDAA 4QOGA 4HTAA 1XL0A 1W47A 4N6GA 1NRXA 3FUCA 2AK3A 3L0SA 5LLTA 1Z7YA 1DVRA 2SHKA 4JB2A 3W7AA 3ZHTA 1ZRHA 4DQ0A 4ZZIA 1XN4A 5KYTA 1ZUNA 4IIJF 5LKAA 2G1JA 1CLUA 4JASB 5LCXA 3W8NA 1ODJA 2HEGA 3H5RA 5CNJA 2FFQA 4IJQA 1TZ2A 2NQ2C 4BNJA 3Q0TA 3PUVA 4AKSA 3G2IA 4QNNA 2HRZA 2QYSA 2RI0A 2GZDA 4JX9A 3RJMA 2HJRA 3A31A 5CLHA 4PXYA 4PR3A 1WCWA 3R6WA 2YZNA 1NVEA 2JI7A 1C8BA 1E1QA 1FX1A 1KORA 2PL3A 2RHBA 2F1OA 3E8MA 3USZA 2QBYA 2QE6A 1NX6A 2Z5VA 2L18A 1UWKA 3I39X 2D62A 4HYQA 4NVRA 4V0OA 5BORA 2PJRA 4YT5A 3BDAA 3AVXA 5FPTA 3CTPA 1FFWA 2MSKA 3RTDA 2I29A 4PGGA 3HADA 1HZZC 3S7TA 3D4OA 1D2RA 1VE1A 2D0PB 3ONWA 4LXTA 3T9BA 3GIDA 3OHMA 3HPQA 3DBLA 1UC5B 4HLUA 1E2HA 2X3YA 3GARA 4BNKA 2QB5A 3K35A 3DL4A 1LK0A 1UPFA 2ZPTX 3ITDA 1CWUA 4HFMA 4PHHA 6ADHA 2GB4A 1H1LA 1KFKB 3PLNA 1Z37A 2AG5A 1L5QA 4DA9A 2Y0DA 2WE8A 1RM3A 2J6HA 3RVNA 4HS9A 4GC5A 1X8XA 3IDQA 1ID1A 3D8BA 1GG9A 4ZAYA 2VJAA 2BKUA 3AX6A 5KNCH 1IG0A 5GZ3A 1Q91A 1Y6ZA 2GUGA 2YIJA 3A10A 3TLAA 5EIXA 2XGJA 2YWCA 1WR8A 1HFJA 4R68A 3UY4A 4EUSA 2J48A 4M9ZA 1A82A 1P0CA 2D1SA 1P62B 3U9SA 5JJIA 1RYBA 3E2PA 3D59A 2O59A 4DPLA 1GPWB 3C3AA 5E2IA 1HYGA 3G85A 2NZYA 3FDZB 1YC5A 3C1TA 4OGWA 3ZGNA 1A7UA 4IUYA 4AF6A 4C04A 4GPEA 2GZHA 4HCJA 1KF0A 3TAXA 3CLTC 2HM7A 5EY5B 4PVCA 3HLKA 2NU8A 1EFCA 4FCWA 3TRHA 3C3CA 3CZPA 1G291 4FGUA 3T41A 3AG5A 3GDOA 2H2DA 1EQAA 1U3UA 3PQ7A 5DYNA 5EZ5A 3QYAA 5JQGB 4RPKA 4RETA 1FFGA 2MT9A 2V6FA 1THZA 5U9CA 1GTRA 3W5AA 3FYTA 2VPIA 1IWOA 3QVKA 1Y5LA 4KXVA 2ASVA 4KQHA 2JH9A 4CL0A 4ESHA 1TNDA 1RLJA 4ID9A 1IMJA 1ADBA 2WSYB 5BR7A 2GCOA 5JEDA 3I1JA 2YIDA 4KU4A 1THGA 2K5UA 3QHAA 1I4OA 3HU3A 3RF7A 4KQWA 3KSRA 3MGKA 1G18A 1QE5A 2PLNA 1VL8A 2R65A 2Q7XA 3STXA 2PZKA 1I4DD 3EA0A 5FA6A 1D0VA 3ONNA 3LBFA 2BHLA 2O0KA 3FFTA 1G4UR 4RX1A 1JQKA 3RUPA 4RSHA 4EL0A 2BR5A 3PDIA 4HUQB 4TXMA 4TV8A 1GTG1 3FUVA 3K6KA 4TRNA 1YDHA 1R64A 4E2WA 1NC3A 3UW1A 4DLVA 2P41A 1FQOA 1GQSA 3EZFA 1H2EA 4FYPA 4LPKA 3NGMA 3ZUGA 4U7HA 5LZ7A 5B2FA 1E5QA 3AUSA 2YW2A 2QZ4A 3P0HA 3U56A 3MWDB 1CJBA 1MORA 2ZRJA 3JWPA 4ARBA 1EVLA 2JLBA 2RHTA 3BXPA 4IFBA 4CKWB 3RRZA 1ZSYA 4KR6A 2YRXA 3VNRA 5LC1A 5JNUA 1OZHA 1TDJA 4FW8A 4J2OA 2GM3A 2NYAA 4XFDA 1KMIY 2RONA 1FNDA 3T5BA 2PGDA 4K5QA 3R5TA 1UAGA 3MCTA 3CQ9A 4KQCA 1RWOA 2XNDA 3EG5A 4U7JA 1OXXK 4KLZA 4ZI2A 2H06A 1JIJA 1O95D 5I4CA 4Q37A 3AXTA 4JNKA 3M1AA 2LCFA 2Q46A 4LE2A 1HQDA 4P8RA 1KYTA 2CLKB 4OLBA 2ZUSA 1ZK2A 4NV1A 1DDOA 1KERA 2HBZA 3A1UA 3P32A 5DXFA 2HSZA 1IRIA 2BEWA 3TGPA 3IIIA 2ZRDA 3SQMA 2VYCA 4D81A 1E2FA 2O2GA 1E9RA 1NRJB 3C0KA 4OJTA 1X1AA 3T5CA 4PR0A 4B2PA 1Y3DE 4AZ3A 3UB4A 3KZCA 2B2NA 4NYJR 4A27A 4JC0A 4URUR 5CJJA 3W2FA 1Z75A 2VAWA 4PPFA 5K0CA 1PL6A 1D2HA 3E22A 2B30A 4KQ2A 4OL9A 3G2JA 1RAGA 2C4VA 3SHQA 1CUXA 1YGPA 4QGBA 2B4RO 3BL5A 4KR9A 5TDHA 2R79A 2Y1FA 2VXOA 1B0ZA 3SE0A 4IDBA 4YCCA 3TRFA 2I2WA 5CDUA 5G2OA 3IDSA 5A0VA 2AG0A 4UMVA 4HAOA 4IIJB 1KAQA 2ON6A 3KD3A 2LVBA 1T10A 3KKZA 2NV2B 3VDMA 5DOVA 5K6RA 2Q2VA 2P2LA 4WBSA 4ZCIA 4ZJYA 5KTPA 2IYFA 4N5DA 4UNPA 3V1TC 5JV5A 3IEMA 2VT2A 1FP2A 1X3SA 2EYQA 2X5JO 1E4OA 2J07A 3WHLA 3OETA 1JHZA 1PKEA 4OHXA 1U1CA 1YK1A 5ECGC 5LQSA 3LVQE 4MVJM 2DSTA 2GTIA 4QG7A 1E2EA 2DF8A 3QE0A 1Q15A 3NHWA 2Y0EA 4R2MA 1OCEA 2VUTA 5K6AC 3FHJA 3DE2X 4CF4A 4MW7A 1JKIA 1X1EA 1ZQ1A 4E46A 1IBKB 1RZUA 1Q7EA 3DTVB 4GI1A 4OV6B 3ISTA 2QLTA 4N0PA 3ZU4A 3DAHA 3UHPA 2RGYA 2ZI7A 2AF4C 2QZ9A 2ZR0A 4I4LA 1WZEA 1T2FA 1GYQA 1A50B 3VR5H 4BFSA 1VHLA 4CU2A 5G0TA 4XYLA 2ACWA 1ULZA 2NU7A 2XYHA 1ZM7A 2C95A 2XVXA 1KDVA 2G0TA 2Y1XA 3K5PA 2YN0A 4JQSA 4TS3A 4GZMA 1RAFA 2LCIA 2UYGA 1HQKA 4X93A 4CKXA 4KQGA 4YJGB 5A3SA 4D9GA 3CLVA 3V9PA 2FMTA 5BV2P 2CBZA 4ISCA 3C5CA 3BT7A 4A36A 1ECPA 3BQ9A 1EMDA 3RAEC 2DUMA 2YJNA 3FKQA 3KTAB 2BCGY 2N46A 4G0XA 5LLSA 5F77A 2ZIVB 1Z33A 3TLBA 2VP3A 3L6EA 3MNFA 2CK3A 3VPAA 2VDRB 1QE0A 4YJ3F 3ZZ0A 1PJ8A 4POAA 4UXIA 5EP1A 1HTBA 1K3FA 3FRHA 3DDHA 1OBCA 1PHRA 1PUXA 4HRVA 2JLVA 2YZMA 3MWKA 1V7CA 2FWMX 4KRXA 2CYBA 1GAWA 1DX6A 1E98A 1TADA 2FFRA 2BHNA 2VT3A 1B26A 5DGHA 4RMHA 5EJ4A 1NBME 3S5UA 1P5HA 4B81A 3R9IA 2YCBA 3BJRA 2QTWB 2VHEA 3DZJA 3LUAA 1JDZA 4O63O 4QGHA 2F3RA 5FJJA 3PDWA 3WO0A 5ITWA 1RM5A 4IXWA 2HCTA 4QU0A 1NTRA 1EDOA 2PSEA 5JHGB 1PGQA 1NE2A 1GY8A 3E8SA 1SUAA 2WV7A 4LDQA 1YS9A 2HPHA 2REBA 1KZ4A 2JFNA 3TIFA 1LDEA 1OWNA 2ZRNA 3HN7A 3KX2A 3PF8A 5EXSA 4CMCA 1L4GA 2IY9A 1RHMA 2ENUA 3TINA 9LDTA 4GKJB 1NBMA 1UXKA 3L0BA 3KJFA 4L8YA 4DBZA 2ZRIA 3GRCA 3VO1A 5JT1A 2P4SA 5M34A 5C35A 3I6MA 3S29A 4ALNA 1CU1A 1FS6A 4DMHA 2UUCB 1CQIA 1ZH0A 3GNTA 2APJA 2I8LA 4J0DA 3CA8A 3W34A 2BGWA 4XD2A 5GIOE 3ZQKA 3HCAA 3NHBA 4PNZA 3AOEA 4YRNA 3UPTA 1VE3A 2P68A 2QR2A 1HQCA 1LFAA 4ZN6A 4P0PB 3VRHA 4CW7A 1H3FA 1U0NA 1XAJA 2FHSA 2V7PA 4GXQA 4OQDA 4M0PA 4OP3A 2MOKA 2HBYA 3BMQB 4PG5A 4PYIA 3NGXA 4EHKA 5EN4A 5I48A 4LJ9A 1KFJB 1BX0A 1MOQA 4JVMA 1T9BA 1Z8HA 4OXQA 5BSWA 3TXXA 1FB5A 2E4YA 1ONNA 2FOXA 4FT4A 4XA8A 3C6QA 4Y1RA 4WY2A 4KZKA 1MIHA 5DNDA 1V9CA 3VXKA 3EULA 4GX2A 2IIPA 3ANXA 3DBOB 3C85A 2A9FA 2BDTA 4J90A 3VSDA 5JSZA 4ERXA 3W06A 2R4UA 5BN4A 5HK9A 1PG0A 2JB9A 5JZBA 5JJKA 3JQPA 1JG1A 4RJLA 3WWYA 3BA6A 5DGDA 4TSKA 5D7NA 4OLFA 3NBYC 5EFZA 5L53A 3BILA 4YRCA 1PR5A 1SCUA 3LP6A 4F04A 1C8KA 1EFLA 4D8XA 3TX6A 3PLAE 2CBGA 3VJRA 1E5XA 1U3WA 4E5NA 2B1JA 1ZICA 2PWBA 2EGHA 3KZ1E 3QEKA 4B34A 4B31A 3Q3IA 1CRPA 4LSMA 1RQXA 2OO3A 4Q19A 2X41A 3JZMA 4DWJA 5JCOC 4W5QA 2BKVA 4AAYA 4ZT3A 4CLHA 1TGYA 3C3MA 4GE0A 3E1GA 4HGYA 3U44A 4BNIA 5BURA 1O97C 4KV9A 3ZDAA 2YJ5A 1GDTA 3RVKA 4A8JA 2HA5A 3RT7A 4Q3AA 3IA7A 1EZ1A 3CCBA 1ETUA 3SEQA 5FR2A 4P4TA 3SICE 5IN5A 4K9QA 1U7XA 4JA2A 1E1QD 2HNKA 1Z5ZA 4E33A 3I1YA 4Q4HB 3T5DA 5HF6A 3GUCA 1N75A 3D3JA 3WNZA 3D0KA 3LUGA 2Z1DA 1EK0A 1X2EA 1JHRA 1U9JA 3PNQA 1JUDA 1VLVA 4G5GA 4BV3A 3ADBA 2D8MA 4DXAA 3I62A 5CLGA 3MSCA 5A02A 1IN8A 2PIAA 3NEPX 1ZOLA 3QTBA 4UBJA 3CR7A 5JO9A 4O5AA 2B2XA 3LDFA 3FDXA 4JOBA 5C5DA 3A36A 4JGIA 2BEKA 2Y71A 5FT9A 4FJ2A 4BNTA 3QXJA 1NBOA 4JT2A 1TIKA 1G5IA 1GT91 4M38A 4RGYA 3SZUA 3ND7A 1CYDA 5T3YA 1H2ZA 2WSBA 5CT5A 5JAQA 2HJSA 1I2AA 3ME5A 1JFFB 3OCYA 2M6KA 5LOVF 3T1TA 3MOGA 2YFHA 3OU6A 3JQCA 3ASZA 3EN0A 3ZV7A 4Z0TA 3AFOA 2A0WA 3OPYA 1G8MA 4LBVA 6YASA 1H2XA 2MINA 3DHEA 1E69A 1GYPA 3OZCA 1N0HA 4YHBA 5HZKA 2GPBA 3PKZA 4OHVA 3M1LA 1DKNA 2B7BA 2XODA 3DQZA 3NAZA 1IJBA 1WLYA 3IR5A 4WX2B 4ZVNA 4B8YA 4MVCA 2WSSD 3T5AA 4YJ3B 3BHIA 1W96A 1O5IA 3REGA 4NMXB 2AF3C 4HGNA 1IQ0A 5JAZA 1JU4A 4MITA 2CXUA 4YV7A 5K0TA 3L0DA 1AUXA 3SBOA 2GPWA 1HA3A 5FH9A 4NCNA 4Q00A 5JXIA 3CC8A 3KBBA 3JASB 5DHQA 1C3XA 4GWKA 1SY7A 3QEMA 2JL1A 3DE4X 1NURA 5FXMA 5KHAA 1AM4D 1RM0A 1AQJA 3JQBA 3ROZA 4QDKA 5JZOA 1XAIA 1LQ2A 3ID6C 2ZAYA 1W2GA 2PK3A 4DLNA 3UMYA 3HACA 3BC1A 4JFAA 4RWZA 5CURA 2BOVA 5A5DA 1KJ8A 3OIVA 2RAUA 4Y9DA 2OB1A 2W2XA 5ARCA 4C2AA 2WI8A 3NJ4A 3P9RA 1TZKA 3JVDA 4L2IB 4CCAA 2Q4TA 4EO7A 2XUIA 2Z5FA 2ZE6A 1VL2A 1QUFA 2XUGA 4GYWA 2J0UA 3AK4A 4H6WA 3WX0A 2NXJA 2QRQA 3QMMA 1YB4A 4KTTE 1YB1A 4BBJA 1IOVA 1LI7A 3BWXA 6AT1A 1DEXA 3DYBA 1KEWA 3HJHA 3Q2OA 4KBYA 3K4PA 2IDZA 4DLUA 4BPBA 2GXUA 2VXYA 3ZWVA 4Q4JA 1W8DA 2VEDA 2D2EA 4ZT4A 4RCZA 1ZN8A 1DFIA 1GZ7A 2XD9A 1E6LA 1UM9A 5J58A 5A5FA 4RZIA 4OHCA 4C6SA 3OPXA 1FDWA 4F4UA 4H3KB 2GAFA 2P75A 2C2XA 3LUFA 1XN1A 3G5AA 2GBLA 5K8CA 3ZWOA 3LHIA 4DCPA 4G9GA 4BEBA 2VJBA 3VOAA 1QFZA 2O5RA 1CXZA 3WLJA 5TR9A 4KX5A 2R1ZA 3DQPA 2D0OB 2IDKA 3JD3A 5AUOB 1Z6YA 2R97A 3AKDA 5IJWA 1CVLA 2DQSA 3MGAA 5A3QA 4DXHA 4X6XA 3C5EA 1U8EA 3NV7A 4ZRNA 2PTGA 4U4AA 2OC4A 3KSBC 1NXXA 1R0ZA 2XNDD 4MQFA 2RBEA 4MV9A 1G59A 4YP6A 1NP7A 3RGGA 4GF5A 4XQCA 2ZWOA 3N58A 1WF3A 1CR6A 2QORA 1GG8A 1PQUA 3GOQA 1DBPA 1XZ8A 4O4IF 1VCOA 1IHPA 1YBVA 2O0HA 1TLTA 1SQGA 1A4RA 3WV4A 2YZGA 1XKXA 2BGMA 3EQ7A 3LF1A 2QZSA 2P3LA 3HBNA 2X1MA 3IP5A 3ORYA 4GVXA 3QELA 4XYBA 5TJ9A 3U40A 2C00A 2FN8A 1G5FA 2RH9B 1D2NA 2W22A 1ODLA 3MAAC 4DUGA 5MFPA 5MF6A 2GBGA 1O0BA 4JQYA 1Y3FE 3AMVA 2OBYA 2WBLC 4D92A 2EKPA 2SBTA 5TC4A 2ETVA 1S3IA 5D85A 1EA5A 5HHTA 1GTL1 1XTVA 4DUYB 3FWNA 2Q8QA 4NTZA 1CFZA 1P9LA 4P7KA 4R3NA 3OQ1A 2OO5C 4C0SA 5EIHA 4QHSA 2DPXA 4RGQA 3I64A 1SCAA 3LZCA 1RAEA 4RHFA 5FADA 2WQ7A 1OV6A 1QZUA 3DYIA 1VG0B 2G8LA 4RPGA 1C7QA 3FJOA 1N1MA 3T9AA 1CQJA 1N2CB 2AR7A 1J0BA 3W77A 3MTEA 5IAGA 2HA3A 3SKVA 4LSZA 3UJCA 2NYVA 1OGJA 4LBWA 4M1SA 3EZYA 2H63A 3MBKA 3SG0A 1XR3A 3ZU5A 1MRNA 5JJCA 1HGXA 3DE7X 3DMRA 5H80A 1F4VA 1NV9A 1YRWA 2EG9A 3DMTA 2C54A 3EDYA 3GVXA 4GAEA 4QVGA 4EK9A 5SY9A 1QNLA 2Z6UA 1ABFA 1DLIA 3GFFA 3SVZA 3OT1B 1RM4A 2IPAB 3PIIA 3DCJA 5F1YA 1TUBB 1L7DA 3ZV6A 3HI6A 4YDHB 3RRNA 3QYJA 1KVUA 3ANNA 3PWSA 1G3MA 4NCJA 4FGWA 5GVSA 3G0HA 4LPSA 3W5IA 3N3BC 2VP0A 4YUVA 4DJ5X 4CKCA 2V9ZA 3FJ1A 3MSXA 1YDGA 2Z98A 4M9QA 1AUOA 2F48A 1DHRA 2Q5OA 1WUTA 1Q1EA 2EAUA 1TMKA 2PCJA 4RV4A 3EEIA 3IRVA 3RJ9A 1XLUA 2QGFA 4L6IA 5PNTA 2WYWA 2ZI6A 4L4ZA 3TF5A 2L82A 3Q87B 1FUUA 4DHEA 1HDZA 5L7YA 4JUBA 2QW8A 5HGJA 1LLFA 1AVTA 3NC0C 5E6SA 2I4MA 5LIPA 4RK7A 3NHLA 1T35A 4PYQA 3E9ZA 1MC8A 4TL6A 4MR9A 2NNWB 2EZUA 5LOVB 3BCHA 4I50A 2J8ZA 1HYBA 4YT2A 4JI1B 4BO3A 4RTSA 2WICA 4MZDA 1EVEA 1KK1A 4L5BA 3UUEA 1ISFA 3VDRA 2NO1A 4D0NA 2PKEA 2GFHA 2CK3D 2H59A 2ZAOA 3B7PA 3JTEA 1F17A 1Q22A 2YCLA 3JY6A 4MQ4A 1QO0D 4RKQA 6LDHA 1C1HA 5BW5A 1PR0A 4DR3B 1UXHA 1JIIA 2FMHA 3HCDA 4JI3B 3VSAA 1FBTA 4QQNA 2C9BA 2IQIA 1TKCA 3LP5A 2EDAA 1ZNZA 3HVKA 2AZMA 2JIDA 4WXYB 5LNK6 3DKRA 1OLSA 1Z47A 4O2AB 2I67A 3SHOA 3PXXA 2A3NA 4EKEA 2QZPA 3EH2A 4CZ2A 1RJFA 3X1ZA 3WZMA 4MWGA 3G02A 2Q1SA 4RHXA 1QH0A 5FHRA 2JAHA 2A1IA 5HKBA 3AESB 3DFZA 3MT8A 2PNJA 2H1IA 1UMCA 1Z08A 3WOVA 4UU8A 3B85A 3SNHA 1NBMD 3PHCA 4KIJA 1GL3A 1I0LA 2PKRA 4N40A 3WGIA 3VC1A 3G8AA 3EFEA 3F2VA 4V0ME 4ZALA 2V6JA 1VHDA 4FHEA 4KHZA 1OWLA 1Q1AA 1UKBA 3NHFA 4LDPA 4RVNA 2ECPA 1CERA 3KTFA 3WMXA 5G41A 4YIHA 5ALRA 1AZTA 2C9YA 2Z4RA 1DGQA 2JGMA 1R37A 2EQBA 1PWEA 3MB5A 3PFCA 1NM5C 2EF1A 4IKPA 4KQ6A 1WM1A 3EEYA 3NHKA 1NMZA 3BMCB 3U7IA 3UMRA 5BW4A 4IF4A 4Z2YA 3DC2A 1N2GA 3T1QA 4EFKA 3DCYA 4Q66C 3V33A 4DRXA 1OU4A 3R7WB 1BWSA 4V0MA 4EFMA 3P0IA 1DNPA 1SKAA 4TKLA 4OYRA 4PYKA 2O8BA 4J6FA 1L4FA 4EHBA 2Q6VA 5KC9A 4BMPB 1D4FA 5IDQA 5CT8A 4X1KB 2F1KA 5C8ZA 3IESA 1C7JA 2HHJA 3IXLA 2CNOA 4YR9A 2IEZA 3PFGA 3DWGA 2HOQA 1JALA 3RWBA 2RGWA 4PZYA 1SHKA 3CEJA 4L95C 3F1LA 4BB6A 2O50A 1UZMA 2QZZA 4RJTA 4O4IB 3H9BA 4UBKA 3RUEA 4TRMA 5F12A 2VHTA 4JI6B 2X40A 5EE9A 1XD8A 5HKOA 4UDOA 4MQLA 1P3Y1 3DC7A 3GDFA 4WACA 3W1EA 4WK6A 1DV2A 2EC5A 1C0PA 2HU8A 4OHOA 3KQKA 2J3DA 3EIWA 5IUJC 3HDVA 1YF3A 1JZTA 2DERA 2CYCA 1YS2X 4WLUA 4G86A 4MROA 5JXHA 1ISGA 3C8MA 5C1BA 3DAGA 5E4FA 2B7LA 1G1MA 1E0KA 1B2RA 1YBHA 1MDFA 5JDIA 1MW8X 1QH9A 3DEZA 4WKBA 1SOUA 3RVBA 3ED1A 4R81A 3DOFA 2HF8A 1TT7A 3KJQA 5AOAA 1O4VA 1HT3A 2GXQA 5DWDA 2ACKA 4LCEA 4XARA 4ZARA 5FI1B 4CM8A 5C37A 4C1BA 4IWYA 4UZEA 2A84A 3NAMA 3OUZA 2AJBA 1B7GO 2X4IA 3ZWNA 1BE8A 5HZGA 2C4UA 4LJSA 4LHXA 1YL6A 1GQFA 3TTUA 4ZZ3A 1Z7GA 2DM6A 1GRQA 2NUAA 3K0AA 4K8OA 3D6TB 3CIFA 1RABA 3I9MA 1G64A 1U5BB 1YV9A 3C1AA 3CEMA 3JZFA 4P54A 4ZQEA 4MV7A 1O0SA 2P0YA 2IEIA 3P9SA 4OTZA 1N2ZA 3EBPA 3VSBA 2IYVA 1DIHA 1VI5A 4Y3UA 1VPDA 5IJZA 3SXJA 9GPBA 2GERA 1E3IA 2ZJ6A 4QDTA 2HK6A 2QSZA 3RT1A 2C58A 1NQAO 1KJJA 1JDPA 1OZGA 1KOJA 4WKOA 2ZE7A 4U3JA 4QSMA 2AHRA 2J9FA 3EIHA 3KLMX 3PV0A 1YS6A 3EXIA 4FTWA 1L3BA 1TI7A 1GCOA 1GN9A 2Y1LA 3W1WA 1K8RA 2IKSA 2GA8A 3HB4X 3L8EA 4KQEA 4CM5A 1RRFA 4OXRA 1QIDA 1IQPA 4HWOA 1KY4A 5JC8A 4XOUA 1MG5A 2QMQA 2ZG6A 4MPDA 1CF9A 3TPCA 3UA3A 1KXJA 1N6OA 2R87A 1UZLA 1U28A 4ZVKA 2FPIB 2ZR9A 2IPNA 4WFIA 2M6LA 3ZHOA 3ZDFA 1F9EA 1BCSB 2A0UA 1WMEA 3H11B 4QO8A 4FFSA 2YWXA 3NNSA 4Q1FA 2LDBA 4JCOA 3BORA 3CUTA 4IG9A 4Y6QA 3AVYA 2GPJA 5KVSA 4QYIB 3OJFA 3EVFA 2XTNA 3DOHA 3O74A 5D1NA 3T7EA 4ER7A 1WW3A 1O9HA 3ETEA 4IIHA 2UZIR 3AHHA 2EFGA 1BEZA 5IEBA 3FCSB 4L3VA 4QEZA 3IE1A 2BEVB 3ZDYB 1YFJA 1OXBB 4MP8A 4CV1A 1TQHA 4RZXA 1ECCA 3TZBA 5HS6A 2R47A 1YHNA 1ZH6A 4GOKA 2AIRA 3TOVA 5T8KA 4DMFA 1TM7E 4MSUA 4AJIA 4BNDA 3AHCA 3KOWA 2O2ZA 4LSWA 4R1UA 4F60A 4PLYA 3ZLJA 3HUFA 2IW1A 3PFNA 3TG2A 3PNVA 2UVDA 3IAS6 4EKYA 1NN0A 3ZJ4A 3I32A 3KWJA 3NP7A 3H1FA 4Q7JB 3VR2A 4ENWA 4ERNA 2D4AA 3J80A 3TFOA 1FDIA 1JEOA 3LCVB 5TQ0B 3ZD9A 3AEZA 1GPLA 4DQKA 3IAEA 3O1LA 2I6XA 2WMYA 4CIXA 1EVYA 2GPYA 3IPYA 1DQRA 1C1YA 2A57A 3DTYA 3H9CA 4GPAA 5A9SB 4QYMA 3HWSA 2IZ5A 3S0JA 1XGKA 4ARAA 2C5AA 4B74A 1GPYA 3PFKA 5FF9A 2HW8A 1V45E 3L40A 1IN5A 2FR1A 4R40A 3OPQA 4UNQA 1UBGA 1NLUA 5A9TA 3VR6A 4ZZ1A 3FWHA 4BMYA 5CBKA 4PHCA 2Y6UA 1KAHA 5AI4A 1JQ5A 5HDBB 2TECE 2IBTA 1T0HB 2G4VA 3CLRD 2V65A 1XD9A 2ZRPA 3QLTA 5GAJA 3ZV4A 4F96A 5B6IA 4DARA 3WMGA 1TL7C 2EWVA 3TIIA 1ZXLA 4GPD1 1QH1A 2OD9A 1HDOA 4OQZA 1FVHA 3AFIA 5SYNA 1U1EA 1M6HA 3BUSA 1A27A 1M74A 3PEVA 2HQ1A 2VYNA 3VPSA 3PGMA 3OICA 1E92A 3FGNA 2AJDA 2ZXFA 3PPVA 1UPCA 3BF7A 4PPGA 5HSGA 5JJBA 5B4TA 1T2EA 1AA6A 2WIAA 1LVHA 5BPHA 3JU3A 2J59A 2QWXA 3H99A 3FTFA 3OT5A 2Q29A 2PV0A 1Z29A 3QLUA 1SCIA 4G5FA 1O54A 3DMYA 3EGDA 2XNSA 3EVZA 2VH5R 3RRYA 3OTHA 4O8ZA 3FLMA 4NU6A 5I7RA 3KQHA 1AKYA 2JJ2A 3QXCA 1GG2A 1ULSA 4EJSA 4D8YA 4Z51A 3EVGA 1C5KA 2IYYA 3VI4B 1QAMA 2DBVO 2OCLA 3EA4A 1P19A 1PJ3A 2ZR8A 3U19A 2PO7A 4M86A 4DUGD 5KUTA 4HPJB 1RQLA 1WPGA 4YV0A 4YQYA 3AB3A 1CY0A 3NBUA 2Q0SA 2Y2VA 2ZFUA 3DGFC 5CB4A 1VZ3A 4CM4A 1FLVA 2VN8A 3FNBA 1TYCA 4HNSA 5TGDA 4X41A 2B4TO 2RAVA 4WADA 1NR7A 4KN5A 4F91B 3K96A 2BP7A 2B1GA 1IY9A 1P75A 3ELUA 3IQFA 1NULA 1E2GA 3LLUA 1H0HA 1MKYA 4I4TA 1ITZA 4BO8A 2HF2A 3VVMA 5JSKA 1HWYA 4L85A 3R8XA 1UKVY 2VHYA 2D5BA 4RM3A 4NK4A 5JJLA 1TF7A 5TQJA 2YVAA 2NSHA 4RHUA 4RF4A 5CM2Z 2OYSA 5AI8A 3SDZA 2PSSA 1P3DA 3LUBA 1MT0A 1EB8A 3HY4A 2YYZA 3HJGA 4B17A 3VHXB 4UOZA 1SXJC 4RZUA 5P21A 1L5LA 1BHO1 4PLCA 1DC8A 1WDTA 2ZJ4A 3H5AA 1IG3A 3KALA 1S2IA 3MB8A 4JEHA 4M83A 4ZEOA 5KCZA 3JYOA 1ECGA 4GRAA 5CIQA 1V71A 3GEPA 5AD1A 4JI2B 4X6LA 2JGAA 2RGDA 3AF4A 2WIGA 2YN2A 1DTSA 4G5SA 3DUFA 3BICA 3EVCA 4UCFA 4XIGS 2WK1A 3O4FA 1AQYA 2CHGA 5IK2A 1O1YA 1ZKMA 4M3NA 5KVQA 1SXJB 4RZSA 1EINA 1GQOA 1ODKA 3L0CA 1JIKA 2YHSA 1XCGB 4HAUA 3V55A 1Y8RA 1DUIA 3NHMA 3OZDA 5SY4A 2ATCA 3ZBPA 2FX5A 1NWHA 2KQUA 4HLCA 4M7OA 4MLDA 3CRNA 3L46A 4U0KA 3KV3O 1WCYA 3T4XA 3EAGA 3BWYA 3T7AA 1TQ6A 1EVQA 1II9A 1O5TA 1ORHA 1PJBA 2PD4A 3EXHC 3FG9A 2ZPUA 3IQZA 3L93A 1RYZA 1G42A 1XRRA 2FSVA 4TQUS 4XD7A 4LJRA 2GH1A 1JNYA 1X7ZB 3CB2A 3NTUA 4MQMA 1UXGA 1F6BA 1SKUA 2O6HA 3W79A 1B8NA 3VYUB 2PXHA 3I6QA 1JMKC 3MMZA 5A0FA 2NW6A 5HIKA 3ZJVA 3EXHB 1EVIA 4EUEA 2G9VA 3KSZO 3A3NA 2VTBB 1GQYA 3VR1A 3JQAB 4YJHB 1UKAA 1D1PA 1GARA 2HJWA 5HWSA 5T41A 1GHTA 4LZWA 5AW5A 2RHRA 1QX3A 1YS1X 3WLOA 1ZPDA 3GCXA 2HWYA 1B00A 5K51A 3VC2A 3WISA 2G5CA 2Y1GA 4R2KA 5CTAA 5KYGA 1WUHS 2JAXA 4D98A 3G7UA 4FUTA 1J0XO 4YBZA 5HEKA 2BTQA 3DVAA 3H19A 4KV7A 1RYNA 4L4UA 3I83A 4GU5A 5A05A 1E3MA 2VYQA 2C7PA 4HEA6 4MWDA 1O4WA 3GB9A 2ZPAA 3HABA 3EPRA 5CDFE 4CR8A 2RHGB 3PIDA 4BQFA 3IBSA 5HYVA 4LQDA 3T3NA 4WZAE 1MRSA 4G8CA 3PTLA 3U3ZA 4NARA 4AJ4A 1H94A 1U8ZA 4ARZB 5KMGA 1L7QA 3H5NA 3IQIX 4HAXA 2J67A 1DAPA 1HI9A