1GTVA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gtvA00
1KKLA 5KPJA 3Q9LA 4FINA 5F9HA 3LBNA 4QC2A 3SS8A 4B44A 5JS7A 8OHMA 1SHZA 1XZPA 4BFUA 2O52A 1NI3A 3VKHA 2Q6TA 4FMBB 2WMOB 2ZRGA 3T1OA 3BGWA 4DLWA 3UMSA 5JWRA 2REOA 1V5WA 4US1R 5E95A 3NEYA 2BMFA 1Z6GA 2EYQA 3U7EB 2Z83A 3SU8A 1L7VC 1RJ9A 1N3BA 2XZPA 1EX7A 4PZYA 5C2JB 4OQNA 2X19A 3H1TA 2WJHA 4HDCA 2JLSA 4MDEA 3Q5DA 3RWOA 2ZJAA 4A0FA 1XPOA 2WJGA 2KI5A 2JATA 4A0HA 4QGHA 1F6BA 1FOEB 1ZW6A 2HT1A 3I8SA 3TUJC 2C99A 2NQ2C 2IHBA 4TYYA 3B78A 4A15A 4QGFA 2G0NA 3W6NA 1KI3A 3AQ4A 1SXJE 1IN8A 2F7SA 3PITA 5FBWB 1NJGA 1UM8A 1BMFA 2X77A 4JYBA 1BH2A 1E69A 4A4DA 5GJWC 2IF0A 1AA9A 4URWR 2AL7A 2RHDA 5L3SB 5J4KA 1OH8A 3B6EA 3ONWA 4TYWA 1TQDA 3TH5A 1EX6A 3CRQA 3UKDA 1CULC 1GNRA 4GNKA 4QHTA 4TMTA 3KX2A 1X8JA 1XTIA 721PA 3HJNA 4EPYA 3PCRB 3Q7PA 3QENA 4RD2A 1ZNZA 3GP8A 4B6FA 1U98A 2A3RA 4HZUB 1KMQA 2UZ3A 3WNDA 1TF7A 1HTWA 3HU2A 5FL7D 4R2HA 3QNUA 2XNDD 2P5SA 1OXTA 3AF2A 3K0FB 5SZJA 1VYVA 3MJRA 2Z4SA 3EASA 1ANKA 4Z1MD 1HT1E 1CJTC 5JRJA 1Q22A 1DAIA 3KL4A 2HT6A 5DH9A 2VO1A 3W8RA 2ONKA 1KJYA 4PC1A 3TAHA 5JLJA 1GKUB 1VIYA 3N70A 3VHLB 4NKRA 1W2HA 3A58B 4QHSA 3CW2A 2QTHA 2PX0A 3KKMA 2XSZA 3FHCB 1ZMXA 4JJKA 4V0OA 1ZRHA 3ZVMA 3ADDA 1Z83A 3LLUA 3KQLA 4M1KA 5CK5A 5C46F 3MWLA 4JSYA 5G3ZA 1U90A 3WXMA 2NZ8A 3WHLA 2DHRA 5CYOA 4DJTA 5EUMA 4XIGS 3AGPA 3QBVA 5KSYA 1XFAA 4C0QC 3BH7A 1E32A 2QT1A 4KYIB 3DOEA 1N2CE 1IN4A 3IIMA 1DELA 4X8HA 2QU8A 2WIBA 5H70A 5LPNA 4D4LA 4DDWA 3MJHA 3I5XA 3MLEA 4MGYR 2BEJA 2D2FA 5JJLA 2J0VA 2ZIAA 2VP4A 5EP1A 2ZSDA 4DDUA 4EQ6A 1ZVQA 2DFTA 2G1KA 4XWKA 4WA7A 4IEIA 5F98A 1ZNXA 2ZSAA 1GNQA 1JXOA 2EVWX 4Q1EA 4MGIR 2C8VA 2R6FA 2WSMA 3TKLA 1X1RA 2A7QA 2P3SA 1L4YA 2W6JD 3CPEA 2O5VA 3CLVA 3JVVA 4TLDA 3OEHD 1G291 2ZROA 1HEIA 3EIEA 5H68A 3K0SA 4Q21A 3AVPA 4X8MA 3THYA 4A6XA 4O25A 2ZSBA 4EDHA 2EFDB 4NONA 1LW7A 3T61A 3CBQA 4BLSA 4HSEA 1KJZA 1T3LA 2PCLA 3PUWA 2QP4A 1G19A 4PTLA 4LPSA 1R8SA 3GLHB 521PA 1XXHA 3O47A 2BCJQ 2QRNA 4X8LA 4C3ZA 3OIUA 5LD2C 1JALA 1MRSA 2EFCB 4V02A 2ZR7A 2IYSA 2O8CA 1OFHA 1E2MA 4G5SA 4G5RA 2WPDD 5JI2E 3TGPA 3H84A 1NG9A 3DZDA 1Z3IX 4N0DA 2N1BA 4XD7A 3SBEA 2Z43A 2J5XA 3GJ3A 3MWYW 2ASEA 1Z2CA 3FB4A 4I1VA 3K09A 2GBLC 3F3YA 5HE9A 3SFZA 5CLLA 1C9KA 1P9RA 4A8JA 1YJ5A 1P75A 1XBTA 1BYIA 5JSZA 3UXMA 2EYUA 1TTTA 3VKWA 1T91A 4BFSA 1G7RA 1IXZA 1AK2A 1GNPA 1T8TA 4QBHA 1SXJB 1W4AA 4Q9JA 1E2IA 3UK6A 2GZHA 2OT3B 3SFVA 3KJHA 3RS4A 1Z07A 2EW1A 621PA 2BIFA 4JT2A 5E7MA 3EPJA 2ZR9A 3C41J 4XTCS 1Z08A 3U6BA 1OE0A 3D31A 4PZLA 3TE6A 4QBGB 5KPDA 4RD0A 3EPKA 3VHXA 1N6KA 5FOWA 5HE8A 2OCYC 5CDFA 5EUQB 3T1VA 2BBOA 2F1HA 5L3QA 3VR1A 1IJEA 1KYIA 4I1OA 4TYNA 2OBNA 3B1ZA 2ZQ5A 4P4SA 2O0JA 5FUYA 4Q9LA 4NYIR 2CLSA 2Y8EA 1VYUA 3JVUA 3NBZC 4ZO4A 2EFHB 4B35A 1Y3AA 3IHLA 1XMIA 1ESNA 2D3WA 3DKPA 2HYDA 2IYZA 2C2HA 2J7KA 4IHQA 2ZPTX 2FGKA 4US2R 2BCGY 5KO2A 3EPHA 3LNCA 4Q7LA 1P72A 1Q3HA 3VKGA 4CVNA 1XWIA 4FW9A 1W44A 1VYTA 3GCGA 4LV8B 4LBWA 1KO5A 4FMDB 4HLQB 4TN1A 4F91B 2V6IA 2VP2A 1EFRA 1YQTA 4V03A 2C03A 1U8YA 4CEJB 2UVQA 3I8XA 3C7KA 1A4RA 1WQ1R 5BW8A 3ADCA 3RVBA 4DT1B 4II7A 4OI4A 4IDHA 2NGRA 4AKEA 3SJAA 5KDDA 3KUDA 3SR0A 4C0JA 2CE2X 3FVQA 2WKRA 5DN6A 1IN7A 1AIPA 1T0HB 5FPHA 2LWIA 4EUNA 5IK2D 3NDPA 3PUZA 5L8VA 3PJRA 4Y0VA 3AVXA 4JBYA 5CITA 2ZYTX 1ZCBA 1E2KA 1ZUHA 3CPJB 2VYFA 4JLJA 1HURA 1DBSA 3PUXA 2R9VA 5SZKB 2V7QD 1OFUX 2W2XA 4B47A 4JLDA 3HPQA 2WSSD 1H8EA 2QSZA 1VHTA 4MRNA 1IY0A 1G5RA 4C0HA 2DBYA 3GJ7A 4O2RA 4DSOA 2AD5A 1FQKA 4JLMA 1NLYA 4LBYA 1UEJA 1VECA 1ZM4A 2GJKA 1II8B 1NMXA 1PLLA 4F38A 1HA3A 5F2EA 1U0LA 5L3SA 4RZXA 3WNBA 4DDVA 5JZVA 5JI3E 4NYMQ 3T12A 1IONA 2O8EA 3H0KA 4LHXA 1W5SA 3IGFA 3UMRA 1HQCA 3L8YA 1U0HC 5FBLB 4LGMA 2A5YB 4CRWB 2BEKA 1OPXA 4LRWA 4AKIA 3BB4A 3B8HA 1DPFA 3EIHA 4QM7A 4OHYA 1CEEA 4BWYA 3CWQA 1E98A 1E9DA 2JLRA 1EFUA 1M7BA 5AUOB 5KUTA 4A92A 4NL4H 3G5UA 3GJXC 2FA9A 1E1QA 1UDWA 3LW7A 4MKGA 4DHEA 4PC6A 2YHSA 3ICEA 5JMTA 4WZBE 4CT5A 3T1QA 3IBYA 4BEBA 4D82A 1WP9A 2D74A 4OQFA 2IXFA 2YOGA 2PEZA 5AUNB 4OHVA 1OYWA 2KE5A 1R5OA 4OK6A 4F7WA 3GLFE 4KODA 1WBDA 3IEVA 4MRPA 3P4XA 1VHLA 1QHXA 3QUSA 4LBZA 4DLZA 3OEEA 4PQRA 1KK3A 4JLPA 5EXXA 1UEIA 4DDTA 2ERXA 3EC1A 3RABA 1G1MA 1XTRA 1K8RA 5FTNA 2CNWA 4ZI2A 4OQLA 2YNMA 2WWFA 2OZEA 4G0NA 4RJLA 1NNEA 3AF3A 1E2PA 2VEDA 2TMKA 3WBKA 3OE7D 1EXMA 2B8TA 3QF4B 4MYHA 3QF7A 3ECCA 1OH7A 2D7DA 4BZQA 4LX0A 1UKVY 1XCPA 4ABYA 3ADBA 1W5TA 5C4MA 4F93B 1F2UB 4HAUA 2E87A 5FOXA 3U6KA 2QM7A 3CX7A 4FN5A 2WWYA 5DGXA 2ECKA 1Z22A 5E7JA 3GEEA 2CLCX 3U7GA 1XJ0A 3L0IB 4A0RA 5IHPA 2GJAA 1KI6B 1CLUA 4OL0A 2E1RA 2R6CA 1KTVA 1KIMA 3BERA 4DEXA 1GL7A 4JBXA 1SHKA 1P2UA 2J1LA 1JR3A 2J3EA 1F5NA 4M0LA 5HCIA 5KSPA 5J4HA 4YQFA 2R65A 4C2TA 2KSQA 2Q9AA 3IQXA 1V43A 3QXSA 1IN5A 1OV4A 4H1VA 3ADKA 1PUJA 1KK0A 2ATXA 3FMPB 1TQ4A 3VR4A 4Q18A 1WMSA 3GEIA 1D6JA 3K9LA 3OZXA 2DY1A 1Z6AA 2XEXA 3R20A 4A2QA 2BV3A 2NO0A 1FTSA 4LWZA 1DS6A 2GZAA 4MRRA 4Q66C 1OH6A 5F3WB 1U2RA 1T9HA 4GT1A 1F2TA 5AJWA 3LD9A 2MMCA 1OIWA 2WV9A 2WWIA 4S35A 1DAGA 3AH8A 4M1SA 1N6HA 1YZNA 4WIAA 5FOUA 3V9PA 4DKXA 4DSNA 4UKDA 1ZD9A 1U9IA 4P4TA 3KQKA 3I1FA 4RKEA 1T0JB 4BLTA 3LW8A 4TTRA 3BB1A 2ZITA 5DI3B 2ZJZA 1RYFA 3LO5A 5FTJA 1IY1A 3BC1A 3K53A 2CL0X 4POAA 4U02A 2H5EA 1E79D 2JA1A 2Q3MA 3LBHA 4ACBA 4E5UA 2WOOA 3AVWA 1KDPA 3AV0B 2I3BA 1G7CA 1RE0A 1TX4B 2ODWA 1VCOA 1MRNA 3C15C 3QXCA 3NTUA 1KAOA 1J99A 4L5BA 1P2SA 4N1AA 3NC0C 3KKQA 4C0AC 2GXAA 2CMKA 1JEEA 2C04A 2IX3A 4PSKA 4EFLA 1T8UA 4D4KA 4PAQA 4CZ2A 2CCGA 4TYPA 2ORIA 4D26A 3X1WA 4OJKA 1AKYA 3DO6A 4LJYA 2RMKA 1DAKA 2ZSEA 3THWB 2W00A 4IOMA 1XD2B 1R0YA 2QE7A 2H1LA 1JB1A 2HF8A 1SXJA 1HV8A 3CUEF 2GAAA 1MO4A 4MKFA 4Q1BA 3WRYC 4NYJQ 2IYVA 2ZE7A 5J40A 1YE8A 5HZHA 4IJMA 1G20E 2GA8A 2RGGA 3AUYA 4WZ6A 4HLCA 4ASUD 3T35A 1LTQA 1G8PA 2FPMA 4K81B 3C4JA 2ZAMA 2ZYUX 1ZC3A 2AXNA 3B13B 4LDJA 2CE7A 2KBFA 4OKSA 3OHMA 4QG7A 1G8FA 4PO1A 2HEIA 4D4MA 2VLIA 2ANCA 3I62A 3OESA 1XTJA 3B5JA 1LS1A 1OHHD 1SVMA 3BFXA 5J47A 2FPKA 4R71A 2F3TA 4GI7A 3X1ZA 2WVJA 3VQTA 4AK9A 1AGPA 5DE3A 2X2EA 3LH5A 1RRCA 2CL7X 4NDZA 5CM9C 1LF5A 1Z0FA 4IDNA 1CJKC 2R6AA 3THOA 4ARZB 1G4UR 3RRZA 5GJCA 2AX4A 1YZQA 3KXIA 5BYJA 2IEYA 4XVQA 3U2QA 4M2LA 5JJIA 5FTLA 3RWMB 4FD2A 5FOSA 2YJTD 1KZ7B 2L0XA 3B60A 3CO5A 2Z0MA 1WBBA 1E2LA 2FWRA 4D4JA 1D5CA 2ANBA 4L15A 3FFBA 4KFSA 4DT1A 3U5ZB 5K8TA 5BN3A 3ETLA 1PV4A 3LVRE 2DFNA 2QG6A 2OLKA 4L4UA 3NWJA 3O8DA 1P62B 3L0OA 4GPTA 2J7PA 4BFXA 2FU5C 3AEZA 2JDID 1G5TA 4KHZA 2YWEA 4PXAA 1JNYA 4WAUA 5EE9A 2HLDD 4HLUA 3FWYA 2V6JA 4Q19A 3D8BA 1G8GA 1XF9A 2FFQA 1ZAKA 2XTNA 5DISB 4BUJA 1J8YF 4A2PA 2PZFA 2IHYA 2AXPA 2RB4A 1NN1A 4LZZA 3ZH9B 4DLYA 3UWKA 5DNYB 1TU4A 3CX8A 4RKFA 2BMDA 1G8HA 2W6IA 3N5CA 3ZLJA 3O8BA 4DIDA 3BOSA 4OQMA 2BOVA 4D81A 2IUUA 1KAGA 1S96A 2VHQA 3FE2A 5FUVA 2CCJA 2IS6A 4JZKA 4KI0A 2VP6A 4HUQA 1CKEA 3B82A 4JVSB 4IDPA 3FTQA 1P5ZB 1Q1EA 3KDSE 4YDHB 2WJYA 1VG0B 2B6HA 5GJBA 4WW0A 3ZD6A 3QG1A 1XCMA 3MAAC 2VHJA 1QDEA 2Z4RA 2O8FB 1AS2A 3AVOA 3IIKA 1KGDA 3PEVA 3LX5A 4AG6A 2XZOA 3U61B 3AP3A 4Q01A 3GJ5A 1B0UA 1XJCA 2FF7A 2GZDA 1Q1BA 4Q47A 3GJ8A 5TXGA 4JKYA 1O87A 1IAQA 4LSGA 2ZS9A 1US8B 4QKQA 5FH9A 1XDBA 3K9HA 2JLYA 1NY5A 3GLHE 3SJCA 1G3IA 5J4VA 3PEUA 1JPNA 2QAGA 1XMSA 3RRYA 3CKLA 3CONA 4IOKA 3MG9A 4BFWA 2JJ1A 4PHTA 4AURA 1MOZA 1UKYA 4URXR 4BRWA 3M0EA 4LBVA 2VH5R 3AUXA 4B71A 2MMGA 2OFXA 3BJIC 1G5PA 3UWOA 3B9QA 3EW9A 3FFAA 1AS3A 1CRQA 3FKSD 2Q3HA 3BWDD 3QOFA 1NY6A 4YXWD 3KFVA 2OXRA 2DYKA 4IOJA 1IHUA 1OF1A 1MO5A 2V55B 4W5WA 3N2IA 5HPYB 4OK5A 4M1WA 2VP9A 3UIEA 3TMKA 3QG5A 3A1UA 4KO8A 3ZZTA 5B57C 4Q9KA 2VIIA 5FUXA 1NRJB 1TF2A 1MO6A 1M34E 3ZIAA 4ON9A 4HATA 5J5CA 1IXRC 4GMXA 4L9SA 2HJGA 3ZJYA 4TL9A 1ZU4A 2JAQA 5AJVB 2QP9X 5DI9A 4GDFA 1F2UA 3RS5A 4IKEA 4YC7A 2V1XA 1KDTA 1TEVA 2WWXA 3R7WB 5C18A 2FSGA 5FOVA 4WVFA 1HT2E 1Z28A 4JJZA 1I2MA 2OCAA 2RGEA 2QPAA 3UATA 3RRMA 1BOFA 1QHHA 2CHVA 4WXRA 5AJXA 5TVKA 1I4DD 1RKBA 2IYUA 1C4OA 2CCKA 2QGZA 3K09C 4LYFA 2BKUA 4KITB 2W83A 1X6VA 4PPQA 1FUKA 3LQQA 4KFRA 1E1RD 1RRPA 2KJQA 3W5JA 2B92A 4A8JC 1OJLA 2AR7A 3AF1A 4OHXA 3AKEA 1HY3A 1XD9A 2IXEA 2MSDB 4TTQA 5AJYA 4F4CA 4PFSA 4B75A 5KSZA 2OAP1 4D0NA 1G6HA 1MABB 2NO1A 4A36A 2EWVA 1COWD 1M7GA 5KDLA 4C0SA 1SKYB 1DG3A 1YR9A 4MRVA 1ZM2A 5FBQB 2WJJA 1G41A 1M1YE 3KTAB 5EP4A 4L16A 5A0FA 3HU3A 4M1OA 4KBGA 2ZUBA 3GQBA 3WBJA 1E2HA 1TUEA 2EWWA 4DLRA 1MR3F 4IXNA 3VR2A 4BLRA 1ZCAA 3Q85A 2IYLD 4L9WA 3ZZUA 1KJWA 1N5JA 4JSTA 4BFZA 3NKVA 1TMKA 1SZPA 2ZRLA 3QQ5A 3TVDA 4DCNA 3FMFA 3H86A 4PPGA 4B3CA 1FTNA 1LY1A 2PT5A 1PLJA 4MYUA 3L43A 3PEWA 4Z8XA 3WYGA 1KDRA 2O8BA 3FMOB 4KAXA 1FX0A 3GMTA 4ZKEA 2A5JA 2IYRA 4X8OA 2F9LA 5SZIA 3U3RA 1K6MA 1VCMA 1VIAA 1XU4A 1KO8A 4TTPA 2ZJBA 1W1WA 4LJ5A 3SC3A 2MSCB 2BM1A 1A2KC 1KI4A 1G9XA 3CNNA 3GFTA 2N42A 5K8LA 3PIRA 4C30A 3IKJA 3SBDA 4M53A 4UNRA 1NP6A 3T1TA 3GLIB 4TWZA 2VHTA 1DTSA 2DWPA 2RGDA 3EG5A 2J0QA 3KKOA 4U7DA 3CR8A 3MUFA 5FL7A 1GTVA 2H92A 3ZVLA 3ND9A 2ODEA 4CF7A 3VU9A 1XTSA 3EA0A 1Z0AA 1D9ZA 5CYPA 5JECA 3NH9A 3NEJA 1I4LD 4Q9IA 3RLFA 3QJYA 2XAUA 4OHWA 3P32A 1NVXQ 4B34A 4E22A 3G0HA 3A4NA 2NMVA 4B3XA 1JAHA 1SVLA 3L82B 4NMMA 3GLGE 5GVRA 2OLJA 2WKQA 4ILEA 4RD4A 1TNDA 5EE3A 4B43A 1KOFA 1QVRA 4DB4A 4NCHA 2IEZA 1W46A 3I3SR 3K8YA 3B85A 3OFND 5CIWA 221PA 4V0KA 5HZKA 2YINC 1A5TA 2W2VA 2ZVQX 4KFUA 821PA 2BJWA 1GP2A 2JIZA 1OIXA 4BLOA 1DO0A 3ZS9A 2QMUA 2R62A 2YC4C 4PPNA 2CXXA 3FPAA 3JZMA 1HQYE 2HCJB 1VCIA 2Q3FA 3B7GA 3QIAA 1E4VA 2HCBA 5AUQA 1T3SA 3DMNA 2FEMA 4W7SA 3RAPR 4C0LA 3AM1A 421PA 2OFOA 4PHFA 5UKDA 4NH0A 4ARZA 3QPUA 3TIFA 1Q20A 1W0JD 3EPLA 3SZRA 2WMNB 3E5HA 2GRJA 1RPZA 4LUCA 2FG5A 3R8FA 4YMUA 2GJSA 2VL7A 4O3MA 3RSOA 5JHHB 4Q7MB 1W0KD 4FCTA 5JBQA 2A9KA 2D4HA 4C7OB 2GCOB 4RCYA 1J90A 1SVOA 4M9ZA 3GLFA 1F60A 1GRRA 2R44A 3F8TA 4TLBA 3RSLA 2ZRFA 3K0AA 1N6OA 4JYCA 2QNRA 2VSOA 4KXFB 3WRXC 1L2TA 3KJEA 4B73A 2PX3A 2QPOA 1RVDA 3ASZA 2SHKA 4HB4A 2W6JA 2NO9A 2P6UA 2ZAOA 3OEHA 1P3JA 2XXAA 3D6TB 3QKSA 4XVUA 1N0WA 3OAAD 4Q03A 3OIYA 4ZDIA 1W47A 5GADl 4PAMA 1EFCA 3IHWA 4RD6A 4AYWA 2JJ2A 2EFGA 1GL9B 2AHOA 1XPUA 2XNSA 2AK3A 3BORA 4IDOA 5LB4A 1X8LA 4ACAA 1P7CA 1Q12A 3LQRA 4G3XA 2O0KA 2GWHA 3GJ0A 3K70C 2CVFA 2OBMA 3DZ8A 1L4UA 1X8KA 4AIIA 5JWOA 4GMDA 1W2GA 1CJUC 2PZGA 3K1JA 3ZGXA 1M8PA 2VBCA 2ERYA 3ZQ6A 1GFIA 1T6NA 1SQ5A 4I1UA 2WPDA 2WBLC 4Q4JA 3TSWA 2IWRA 3KQUA 1AZTA 4HAYA 1OLOA 4TLCA 5F9FA 3RYTC 1Z29A 3DEFA 4M8NE 4Q4HA 1NBMD 4A1FA 1YRAA 4PANA 1N5IA 4RCZA 3W90A 1T5IA 3VAAA 4GZMA 5EXTA 2G83A 4DC9A 4NBSA 1VG9B 1G16A 2I1VB 4BFYA 3SEAA 2YYZA 3LX8A 4GP6A 1JXMA 1ZNWA 4JKIA 5DYGA 1W4RA 1H8HD 1OH5A 4LI0A 3REFA 1XEXB 1QVAA 3NXSA 3I5YA 1KI7A 2FFHA 4CDGA 5KDOA 1US8A 1TEXA 2A78A 3M4YA 2D7CA 5HKKD 4DCVA 2CLDX 4RD3A 3IUYA 1KSHA 3TR5A 1TQ6A 1YVDA 2IYQA 3NDBB 4KLNA 4DIEA 1Z5ZA 2GK6A 5FR2A 3QE0A 5BN4A 3U60B 1K5DA 1Z47A 5FPKA 4TQAA 2VPPA 1NIPA 2ZVPX 3VR3A 3R8CA 1XPRA 2R2AA 3SQWA 1QF9A 4PX9A 3JZAA 2ZEJA 3F5FA 2QORA 5EE1A 2CDNA 3DDCA 1KI2A 4HYYA 4MUBA 2AK2A 3NC1C 5BXQC 3AVTA 5SZHB 4LHWA 2EQBA 5JS8A 3IQWA 1A7JA 1U9IC 4UQOA 2V8OA 4DZZA 4BE7B 3ZD7A 3SI7A 4O0MA 1G64A 2ZS8A 2F55A 4D0GA 4DCSA 3X1YA 5JHGB 1N6NA 2H17A 3CX6A 4GOJA 2QL6A 3TSOA 4LJAA 4FMDF 4BASA 4D0LB 3NIBA 4JLOA 2GAOA 4B3DA 2W0MA 4E07A 1GDDA 2C9YA 2FN4A 2GJ9A 3V4FA 2QAJA 1XEFA 2GXUA 1U8AA 3CH5A 1VG8A 2IF2A 4A82A 3GLGB 2GEVA 2WTUA 1OXSC 1BS1A 2C98A 3NHBA 4CW7A 1CR2A 3Q5EA 1FMLA 2ZRNA 3EZ2A 3FYHA 3BD9A 1E94E 1NSFA 4RZUA 2NZJA 3TQCA 3FOZA 2QEQA 4HB2A 2V1UA 1MV5A 1AM4D 3A4MA 3C16C 2WICA 1ZNYA 4I4LA 4Q7KA 2QTVB 3IBGA 4Z51A 5IK2A 1J70A 3KFXA 1QG4A 1W36C 1MABA 3U4QB 3ICQB 1SXJC 1GILA 4EJSB 4JT4A 4HZUA 3U3JA 4WZAE 3B1VA 2Q9BA 4P32A 1YU9A 3SYNA 2BVNA 3KTAA 1SULA 4JLBA 4LHYA 4PC7A 4PHGA 1AZSC 1NVWQ 2V7QA 2MSEB 1PJRA 1XD8A 1E0SA 3K0FA 3A36A 2P67A 4Q7JB 3IPXA 2WSSA 1G3UA 4JLAA 1GRQA 1QZXA 2GESA 2HJVA 2QN6A 2GTPA 3TAUA 5G40A 1S0UA 2IXGA 1E9CA 1JJVA 1KNQA 3RANA 2IS2A 1DAHA 3KUCA 2HXYA 2QBYB 4I81A 4B3GA 4FIDA 3Q8XB 4H1UA 4TLAA 5CJ2A 3U7HB 3PVSA 4BFTA 3BIFA 3CZPA 1J7KA 3TR0A 3WHKA 1A82A 2OUKA 2EU8A 2IS4A 3CZQA 1Z2AA 2ZJ8A 2YV5A 4QHYA 3P1JA 2F1IA 1LF0A 2DCUA 3KQNA 3F0TA 4QXAA 2AFIE 3CF6R 1XMVA 3PR1A 3SYLA 3A1SA 5JCZA 4URZR 3FHOA 4PZZA 3PFIA 4LJ7A 1P61B 1ZBDA 2QMHA 1P2TA 2GVDC 2YVUA 3C5CA 2QROA 4HB3A 4TT3D 3PXGA 1JR3D 1GM5A 3K0EA 4PHHA 2NIPA 3OIVA 3PENA 2G0TA 4EFMA 4XTRA 4F4IA 4LYAA 2WKPA 5EE5B 5JRZA 4JL6A 4P3YA 2IK8A 1CR0A 2IUTA 1NF3A 3SE0A 1DG1G 2BWJA 1E2QA 5KYKA 4UXIA 1CP2A 4TMKA 1S4QA 1RIFA 4FXPA 4ZDKA 4HLUC 1XX6A 1DVRA 1IM2A 3LV8A 4Q5IA 5KNBA 4E03A 2B7BA 2F43B 1DEKA 4ITRC 2J9RA 2VHUA 2ZRDA 3MGCA 4EPTA 2NO6A 1D2NA 1RW4A 1YZUA 2Q21A 4CIDA 1MH1A 1Q0UA 1JPJA 2B7CA 1KI1A 2RGNC 3NG1A 2I4IA 4M22A 2G77B 1S2MA 2XJ9A 2ZR0A 2ZYWX 1VDZA 3OE7A 2FPLA 1TADA 4CEIB 1XNJA 2C5LA 4CYMA 2O8DB 1R5BA 3DHWC 3W3AA 4MKIA 3NBFA 1DADA 2AWNA 2GKSA 3C14C 4XSGA 3VR6A 3THXB 1WE2A 4JIMA 4QBFA 3CRVA 3X1DA 3D3QA 1ODFA 4BEJA 4BQSA 2HXSA 3GLHA 3LBIA 4NPHA 3ZVNA 4WOPA 4WXPA 3TVTA 5BWMA 1JBKA 4C7OA 1EWQA 2GCPA 3SYKA 2PH1A 4RFVA 1M74A 1ZINA 2IYWA 4ZCLA 3UMFA 4RFSB 3KXLA 3ZS8A 1PVOA 1X3SA 1EWRA 4LOAA 1ZM7A 1OB2A 2XJ4A 1NBME 3HYTA 3QPVA 5TARA 2IYXA 1P2VA 1B23P 2FE4A 1FFHA 2FSHA 3FKQA 3QY0A 1XCGB 1D2EA 4BPBA 1CXZA 3FDIA 5AR1A 3I4LA 2H57A 4EFNA 2PZEA 3CM0A 4BRUA 2XTMA 1XB2A 1U81A 2LKDA 2QAGC 4LCBA 2GHIA 1AJEA 3RC8A 3LXRA 4DUGD 2WHXA 1OKKD 3EA5A 5CB6A 4C0BA 4HAVA 1BKDR 3LA6A 1CU1A 2JLQA 2BC9A 3HPRA 4UJ3A 5EE0A 5D3MB 1VTKA 2C95A 3Q7QA 4HEJA 1E79A 1OFIA 2JLZA 1X86B 2XTZA 4OK3A 4QRHA 3KJGA 1XRJA 2VSXA 3AKCA 4Q00A 2ZE5A 4DLSA 3O8RA 4C4PA 1RRGA 2V4ZA 3BXZA 4IFBA 1OIVA 2G3YA 4LYJA 4NE2A 2FEOA 3N2EA 1DARA 1GWNA 1YZKA 2QSYA 1GKYA 5CJPA 5FI1B 2D2EA 1JEDA 1P9NA 1TAGA 2GJ8A 3SJZA 4MDFA 1L8QA 2PLRA 1BYUA 3SQXA 1Q57A 4MGKR 3H2YA 4V0ME 1SKYE 2ZANA 4P33A 4EQ6B 2PLFA 1F48A 4JLVA 1YR7A 4KVGA 1RZ3A 2CK3D 3MMPA 3QBTA 4GSYA 4WBSA 4QGGA 4R2IA 2BMEA 1ZIPA 3QVUA 1PLKA 2C77A 3TRFA 2OG2A 1WRBA 4P4UA 2JLVA 1VCNA 1SGWA 2ZETA 5BN5A 1NL3A 4AD8A 4AC9A 3B1WA 4ASUA 4CEJA 1SVIA 2AFHE 3WY9A 3NHAA 3D7MA 1R6BX 3TUZC 1T4GA 1TU3A 4FWTA 3THYB 4D25A 3EWAA 3VMFA 2FDCA 5C1BA 1ZM9A 4A9AA 2X8AA 5CLQA 2Q0HA 2AWOA 5FPSA 1OHHA 1NKSA 3IDQA 4IVQA 4TMXA 3GEHA 4URVR 3VNVA 4B33A 2ONJA 2G9NA 1Q21A 1XXHB 1CIPA 1FUUA 2H16A 1J8MF 3GLIE 2YOFA 1N6LA 5CM8B 2Z6VA 2HYIC 3U3MA 2XOKD 4KLZA 3LWNA 4MQBA 4NHOA 5FOTA 2VP5A 1UBGA 1E0JA 1XEWX 3IIJA 4TMZA 3OIWA 4TSFD 2RGNA 4LY6A 2P5TB 1EFHA 4FMCB 4LHZA 2IS1A 2OO7A 2C9CA 2VRWA 5E4FA 4B2IA 4I1SA 4B6EA 3EZFA 1II8A 3GLGA 1BIFA 2BBTA 4HAWA 4NYMR 5EZ5A 1XP8A 4A8JB 2GDJA 2ZUCA 1N5LA 2H8KA 4D6PA 5JSZB 3W34A 3ZYCA 2JDIA 1G3RA 3AKDA 5TDHA 5DIFA 2LCFA 2IT1A 1UDXA 4C2UA 2XB4A 2HLDA 3B1XA 4Z54A 5C4GB 3E70C 5ANRB 3BS4A 4URYR 3U4QA 2JASA 2ZI4A 4GP7A 4ZDWA 1Q3TA 4ZV4A 3GJ4A 4G5QA 2QT0A 3QKTA 4MH0R 4PO8A 2WJVA 2DR3A 2RKOA 3PUVA 4BGDA 1DOAA 1UKEA 4TLEA 5P21A 2BJVA 4KVAA 4DLXA 4R98A 2GXQA 3DMDA 4QNRA 2IUSA 1YR8A 2DWOA 4P4SB 1KY3A 4DCUA 3TQFA 4R7ZA 3A1WA 1UF9A 3K0CC 1G7TA 3V00A 1CR1A 3EC2A 4MUAA 4KSBA 2QBYA 1S9HA 2PMKA 4Q1AA 4MYTA 4JLNA 1NVVQ 4NU0A 4XJXA 4Q48A 2GVZC 4GRAA 5KOYA 2ZSFA 4DVGA 1R7RA 2X1VA 4IDQA 4BLPA 5FFMA 1FZQA 1YKSA 5AK0A 4Q02A 5K8UA 3ZZ0A 4ZPXA 2OSBA 3AF4A 3T06B 3RC3A 4LC1A 4JLKA 3AF0A 4A2WA 2IYTA 1BMFD 2K5UA 1FMJA 2QQEA 1SKQA 1H65A 1I2DA 2J59A 3Q3JB 2YZ2A 3QF4A 1OFTA 4W5JA 3CWZA 5BYKA 4YLGA 3IPYA 5DO9A 4N0EA 5LBIA 3EWSA 2QP3A 5EJEA 1IQPA 3UANA 1YHNA 1WCV1 2QM8A 2QRZA 4M9QA 1AQYA 1D2MA 3REGA 1U94A 5L3RA 1NMZA 1KI6A 4EPRA 4US0R 2QQ0A 5LB2A 3LVQE 4DSUA 5GJVC 2H18A 5J4YA 1LB1B 5A5GA 4BZXA 1G21E 1GG2A 4AKHA 3FKSA 3ASYA 4TQ9A 4YXWA 5AJZA 5ELXA 2F43A 2OCBA 1W7AA 1FW6A 3I32A 1IJFA 4KJZA 4FCVA 2F6RA 3DM9B 3L0SA 1QBKC 4OHZA 3U3OA 4BFVA 2J0UB 1GL6A 1R0XA 4U5XA 4MGZR 2G1JA 2JCSA 4M1TA 2J45A 2QY9A 1I4TD 4XOIA 2P6RA 4U00A 4QJ3A 4Y0AA 4CEIA 3NBXX 3KB2A 2O8DA 3CH4B 1KMHB 5TB5A 1Q44A 4OI0A 4OI2A 4XWAA 3THXA 1IBRA 2O8EB 1GIAA 1E3MA 2XSZD 4TQUS 4IEEA 5LD2B 2ODNA 2JLXA 1JJ7A 1TQ2A 1U99A 3GFPA 2ODBA 4PR0A 5DI3A 5G41A 2PJRA 3DL0A 3W8NA 4KV9A 2O0HA 4YMSA 2QMOA 3UPUA 4RFSA 1CJMA 3LLMA 1VPLA 1S1CA 2KB0A 2XITA 2ZI3A 5EP2A 5EZ6B 1E1RA 1ETUA 3BH6A 3IO5A 5H8WA 1G8YA 2JLUA 2PEYA 2OCPA 2WWWA 2ZREA 2V9PA 2VQSA 4LPKA 1XJQA 5IDVA 4FI3C 4ERNA 1E9BA 4DSTA 4UNSA 2CEAA 2GXSA 4PSAA 1TUIA 4NP6A 5FPTA 1COWA 2REBA 2J41A 5JEDA 2VHCA 4GBMA 2A2ZA 2IBMA 3A4LA 4HLDA 2OM2A 2IL1A 4PSVA 2XNDA 3SHWA 3U44B 1JECA 3K70B 1NJFA 3KQHA 4B76A 1HE1C 2EFEB 1BO6A 3W9YA 4EIWA 4CGZA 1JAIA 3THWA 1XD2A 1N0UA 2F1RA 2P65A 4Z1MA 1VG1A 4NYJR 4Q1DA 3EZ9A 3HR8A 2J0SA 2B8WA 4ZKDA 4ESVA 5J4LA 2E9SA 1FPMA 2JIZD 1E2JA 3PG5A 4K46A 1P60A 5D3MA 4IVPA 3PV0A 1IY2A 2ZRJA 4AKGA 3MD0A 2VSFA 4DLVA 3EIQA 2ZRBA 1KO1A 4Q4LA 4YMVA 4BLQA 2I1QA 1AS0A 1SVWA 2ZE6A 2DFKB 4HB0A 4JS0A 1R0WA 4HZIA 3T34A 1G7SA 3C5HA 3X2SA 2AN9A 3K0CA 2P2LA 1GOTA 1QHNA 1S9DA 4M9XA 1S3SA 1N0VC 3RS7A 3V4RA 2RH5A 2W0SA 1WA5A 2F9MA 2OXCA 2ZS7A 3KZ1E 3ND8A 1R0ZA 2XZLA 3MSXA 1KHTA 4PQYA 3A6PC 1ELOA 4CT4B 1OXXK 3CF2A 1TL7C 2ZTSA 4KFTA 4MA4A 1T5LA 4TZ0A 5FL3A 1EK0A 1W4CA 1ESMA 3LFUA 1SVKA 1YZLA 2JEOA 3VX3A 1E9FA 4OQXA 2QGNA 3HDTA 5AUPB 1CJVC 3RS0A 2CJWB 4XD7D 5DSZA 2CL6X 3AP1A 3FMIA 3SOPA 4DBLC 1E0AA 5G3YA 4M4SA 2G6BA 4QGAA 1OB5A 3OFNA 1N5KA 1CBUA 4LV5B 4DRZA 2JJ2D 3QEJA 1F2TB 3TNFA 2ZI6A 4ZIRB 5DYIA 1OW3B 3I61A 1E9EA 1MKYA 1NN3A 2JGNA 2LKCA 2YWFA 4NTZA 3TW4A 5JCPA 4B2LA 3CIOA 3SNHA 2WZQA 4B2PA 2QTFA 1X1SA 2NO7A 1MO3A 1Z06A 2FOLA 2GF9A 1VKJA 2J46A 3EZ6A 3P27A 4LJ6A 3S1AB 1IOZA 1OSNA 2BKEA 4EPVA 1GUAA 1G18A 2RGBA 3IEUA 3C8UA 3AP2A 6Q21A 2F1JA 2VA8A 2YWGA 5EP3A 3A8TA 1W0JA 4UNQA 1JR6A 2FMXA 3DOFA 4V0NA 4RZ3A 3DM5A 3R9IA 5TMPA 2OHFA 1Z0KA 2X2FA 4ZDJA 3TJZA 4DWJA 1DAFA 1W0KA 2FJUA 1E6CA 1Z6YA 5EXPA 3BB3A 2BHRA 4IFEA 1UADA 1UBFA 4IW3B 4PO9A 2QUZA 2R6GA 3R9WA 1NG1A 3U7FB 2P6NA 5B64A 3PQCA 2A5FA 2PMDA 1FP7A 4G01B 2UKDA 4R9UC 4DEYA 4EPWA 2QZ4A 4KSCA 1O3YA 1XZQA 3BBPA 1GSIA 4D2IA 5TV2A 4Q1CA 1R2QA 4G5GA 2OAQ1 1W36B 2OEPA 3TUIC 3KKPA 4M1MA 2ZU0C 1IN6A 4UJ5A 4IXMA 2PL3A 2NOAA 4HDQB 4KYUA 2O8FA 3TBKA 1KDOA 3OAAA 4KU4A 2GCNA 4HAXA 4HUTA 1EFRD 1TF5A 2ZRKA 1TPZA 2OBLA 1NKTA 3WNCA 4AYXA 3T5GA 3TK1A 4DLTA 2FSIA 3KB1A 1QRAA 2NTYC 2R8RA 4QNMA 1FNMA 1JI0A 3QVVA 4EPXA 2W2TA 5D3QA 4TL6A 4B74A 5KNCA 2GK7A 2FH5B 2FNAA 4C9BA 1LS6A 2ZJ2A 3FHTA 5DN6D 1F3OA 1R8QA 4Q9HA 1KI8A 4G1UC 4KBFA 4AYTA 5CK4A 2QENA 1K5GA 4PC3A 2V54A 1KK2A 3TLXA 1QG2A 1GZSA 1KY2A 2KWIA 1NVVR 2RGAA 1J2JA 3BAFA 4P31A 3LAWA 4JL8A 2D06A 4B3FX 1RYHA 4LK2A 1NBMA 5DLQC 3CF0A 4XSHA 1RC8A 1KKMA 3HR7A 3DPUA 3RHFA 4IOLA 3BE4A 2V3CC 4PC2A 1YR6A 1H8ED 5M04A 1AQUA 2D62A 1UFQA 1P6XA 4TYQA 3BFKA 1LVGA 2ZJYA 1Q1ZA 1H8HA 4FCWA 4CEHB 2FV8A 1FQJA 1KSFX 2RGXA 4ESHA 4L8GA 1E4YA 2J87A 2H7VA 3VR5A 2KBEA 4QL3A 4TMVA 5HKKA 4HDOB 3R7WA 3QKRB 4M1YA 1S8FA 1IXSB 1KZGB 3I92A 4H9GA 2B21A 4GOXA 4TL8A 1PUIA 4HI0E 1WDTA 4RY2A 5B2ZA 5E7IA 4Q4AB 1CR4A 1P9WA 3B1YA 1EESA 4TMWA 1II9A 4OJQA 3UG6A 1VMAA 1E1QD 2ZJOA 3QI2A 3B9PA 2BBWA 2ATVA 4EKDA 1E2NA 2ZI5A 2GEDA 3TW8B 2IW3A 2NPFA 4OYHA 1KK1A 2J0UA 3TSZA 4V0MA 2FX3A 2ZI9A 3BH0A 3HU1A 3K9NA 5DHAA 3MRSA 2DPXA 1W49A 2OV2A 4HUQB 2F3RA 4PPFA 3M1IA 4N3NA 4BECA 4Z8YA 3W6PA 1ZM3A 1KMHA 2IC5A 4NCKA 3K70D 3SHFA 2AKAB 3DKVA 1P73A 3QEOA 4NZYA 1OT3A 1ZC4A 2A5GA 4RVCA 3OEED 4F92B 4YDSA 1ZIOA 121PA 2OILA 3AVUA 3FGNA 4DLUA 5E3HA 1AGRA 1Z6TA 2CNWD 1S1MA 2QPTA 5FPYA 2FGJA 1OXVA 4XWOA 5FBRB 2W58A 4MRSA 5DHFA 3IILA 3AKYA 5HCNA 3WMGA 2FFAA 1E2EA 1E99A 4DCTA 1S3GA 1DAEA 1RFLA 5IT5A 2AD1A 3M6AA 2P0EA 3KXKA 1ZD8A 4MITA 1UAAA 2GBLA 1HE8B 1E2DA 3G82C 3QXHA 5FBVB 3LXXA 1G17A 1N25A 2VF7A 1A2BA 1YZTA 2Q9CA 1NSTA 2QAGB 3CNOA 1G3MA 1N6RA 1M6NA 1XXHE 3GJ6A 3O8CA 2C9OA 4JVMA 3GLIA 3RS3A 3WYAA 1XEWY 3QSYA 1LV7A 3EX7C 4PQFA 2ZRHA 5B58C 3WP0A 2FZLA 1ZD1A 2YC2C 3U44A 4URUR 3NVAA 1NN5A 1ZP6A 3BK7A 2DWQA 1RJ9B 2QMEA 1KSGA 1U0JA 1NLZA 3A1TA 2WJIA 4IRUB 3QKUA 5EXSA 1G3QA 2IA5A 3A1VA 4K8OA 1ZUIA 3KJIA 4TZ6A 1N6IA 5H1YA 5IF9A 1R4AA 3L8ZA 1UKZA 1N6PA 2AKYA 2RHMA 3CR7A 4XVRA 2VTKA 1Z6XA 3HWSA 2ZM5A 3GD7A 3W6OA 1DAMA 1E9SA 1P4SA 3OF5A 4JL5A 1NN0A 3E2IA 4RZ2A 4A6PA 4QFMA 2CVHA 2HUPA 2ZUDA 5AWFC 2CHQA 4QJ4A 4QJ5A 1QHHB 3LRPA 2C96A 1DO2A 3MCAA 2ZRAA 3PEYA 3W5IA 5GVSA 2XX3A 4EAQA 3QXXA 4TT3A 3QXJA 5CDFE 1HUQA 1AKEA 2NG1A 2WM9B 2YWHA 4ZCIA 3CPHA 1E0KA 2BDTA 4TL7A 1WB9A 2ZE8A 2GNOA 1W4BA 4UXJA 1UBEA 2CJWA 3MFYA 4UNNA 4MYCA 3W3ZB 3DVLA 2GCOA 1YZGA 4QM6A 4LC0A 1XTQA 1G4AE 2ORVA 3HP1A 1XTKA 4GOKA 2PJZA 3ZVRA 1II0A 1QHYA 1HH4A 2ZXUA 4NCJA 4IVRA 2FFBA 4EJSC 4ZIRA 2GILA 4GZLA 4ZI3A 2NPIA 1M7HA 3UG7A 1W36D 1QHSA 2FSFA 2QE7D 2BMJA 1CF4A 1SXJD 4OI1A 3S1AA 1Z0IA 5A4JA 2OFWA 4S2EA 3BRWD 3MWKA 2IWHA 5JJKA 3J81k 1E96A 4BZPA 1E9AA 1KSJA 4M9SA 2YKGA 2O8BB 1Z8FA 1Z0DA 2BBSA 3ZDQA 1FX0B 1KO7A 1GVNB 2WOJA 4B32A 3CRRA 1JQJC 1UJ2A 5FUWA 2HV8A 3L0PA 1GAJA 1DE0A 4I99A 3VFDA 3B2EA 2OE2A 3GPLA 5K8IA 2ZRIA 4RD1A 2G88A 1LFDB 4B48A 1ZYUA 3SJBA 1C1YA 1ZJ6A 4AY2A 4A0GA 1EGAA 4C0KA 2UZIR 1OXUA 2CHGA 3EXAA 1ZUNB 2JJ8A 3CRW1 4YMTA 5FTKA 2A5DA 3WYFA 1CS4C 5FI0B 4HAZA 5JEEA 1CRPA 1W48A 2RCNA 3EARA 4JMPA 2DB3A 3VTKA 3VU9B 3WMEA 4ZCMA 2WAXA 3AGQA 5EQTA 3CRMA 4LJ9A 4YMWA 2ZU6A 3VX4A 1E2FA 2XB2A 4G5OA 3PUYA 4V0LA 3QPWA 1D8TA 3ZQJA 1D9XA 3LDAA 2ZRMA 3AVVA 5JFGA 1UBCA 4LV6A 5CB8A 1GRNA 3I73A 3IO3A 4DUGA 4GFDA 1OKKA 1EFTA 5LDDC 1XEXA 5HR5A 1EG7A 1WXQA 3AVYA 2GETA 1NVUQ 3Q72A 4NCNA 4PAOA 3EZ7A 3LY5A 2J7PD 4YONB 4QOSA 4DB2A 4J0QA 4UNPA 1RRFA 4MKHA 3WP1B 3KKNA 1AN0A 2QA5A 4B3BA 5BQ5A 1LNZA 2PT7A 4F4JA 1QHIA 5FTMA 1GITA 3NBYC 1YRBA 2ZRCA 2ZI7A 5CIQA 2WIAA 3NH6A 4NCIA 3K9GA 2FZ4A 2REXB 2W6ID 1WF3A 3RNLA 2A30A 3CB4A 2WWHA 3SN6A 4UXHA 3HYRA 3L2OB 1HYQA 5B30A 3EAQA 1NMYA 2HF9A 3GLFB 2CK3A 4CEHA 5FR1A 2O8CB 1T3HA 1G6OA 1PZNA 1Y63A 2PCJA 3K0AB 3U3KA 3VNUA 2C78A 4XH9B 1UPTA 2HDNB 3P20A 3QKRA 4FWIB 3RS2A 1MT0A 4AWXA 1A1VA 2ORWA 1E2GA 1FP6A 1GKIA 1SVSA 2N46A 4LYHA 4LJ8A 2XGJA 2ZJ5A 2RAPA 2XXAB 1XMJA 1ONBA 3I72A 4O2LA 3QKSB 2PBRA 5TY0A 3GFOA 3SDZA 1M2OB 1Z63A 5KU1A 1U8ZA 4LJ4A 3R9XA 5G53C 4Q4AA 4DXAA 3WMFA 4AG5A 3CNLA 2CBZA 5KTYA 3T5DA 3RDPA 2VF8A 4Q1FA 5KSOA 1FNNA 1QHGA 4E09A 2RGCA 3MWJA 3H4MA 4OBEA 3BFVA 2BM0A 2WAYA 2ZRPA 3AVQA 4RSGA 4JBWA 2JLWA 2JJ1D 5KHOC 4EJSA 2WWGA 2XOKA 4W9MC 4W5HA 3T15A 2OESA 1KO4A 2ZYVX 2DFLA 3AB3A 3A37A 4JVLA 2GF0A 5JWHA 4D80A 3P4YA 4FMCF 4Q4JB 4GL2A 1JR3E 5HTKA 3X1XA 4AI6A 1E9RA 4TSFA 5L3QB 4Q4HB 2VP0A 1NLFA 1CTQA 1R5NA 4M21A 1Z0JA 4LHVA 1NIJA 2Z5FA 4NYIQ 4QBIA 1R10A 1ZU5A 3P26A 1Q1QA 4KCGA 3RRNA 1FL9A 2GEUA 4P0TA 2IYYA 3ZIAD 5L3VA 2QI9C 2YOHA 1JQLB 3E1SA 5KNDA 2R6DA 4JVNA 1OYYA 1KI9A 1KNXA 5IRCD
chains in the Genus database with same CATH superfamily
4AMZA 3Q9LA 1R9NA 1PNQA 3ON5A 4HLNA 4QC2A 1YCFA 4RVHA 4Z0NA 3NJ4A 4YRJA 4I50A 1DC6A 2J08A 2G4LA 1PWXA 2Q49A 2VUSA 3NBQA 3H1GA 4Z99A 4QLBA 2P4HX 1XXLA 3BCUA 3FYSA 3TR6A 3K0BA 3W5HA 1UMBB 4FMBB 3PD0A 4EO7A 2WYHA 5KWJA 2I1WA 1XL0A 2QLNA 3TN7A 2Z58A 4JB3A 3W5BA 3T1OA 4FT2A 4K3VA 2HHJA 1FFBA 2W48A 4K9LA 4L8WB 4US1R 3TZCA 3UMSA 3ZKWA 3V4LA 4EI9A 1Y5NA 2CLKB 1QVWA 1Z6GA 2OZLA 3IMGA 3WAJA 4A73A 1H3EA 1S02A 3CMMA 4XQ0A 5JFOA 1WM1A 3ED5A 1EX7A 1XNRB 2C7QA 1E89A 1USWA 3H1TA 1AGNA 4MDEA 1FTQA 2JLSA 4IXWA 2H4XA 4KZPA 1RI5A 3I2IA 2VYVD 4MI1A 2JFHA 5FBRB 1IZ8A 2KI5A 3RQSA 2CYCA 4LW8A 4A0HA 4B4WA 4BLWA 5L95A 1BKYA 1OXBB 4S1NA 3TKYA 4FYKA 4GKJB 3V7UA 1H3NA 3VHRA 5B1DA 1XWFA 3ELDA 1VLVA 2C99A 2XUAA 3H87A 2IHBA 2XQVA 4GS5A 4LRXA 4N9QA 1Q7GA 2JIDA 4G4GA 1ISRA 4OQ4A 2VTBB 4A15A 1KRWA 4Z4QA 4JC0A 3G85A 3RUCA 3PITA 1W76A 2I7XA 3O95A 1DKUA 4RMJA 1QGOA 1UM8A 5FHQA 5BVGA 3DQPA 2OC4A 4ZREA 3JAWB 2G63A 1FFEA 3E5MA 3AILA 4URWR 3RIEA 2LGJA 2Z9DA 3HN2A 2VPWA 1LEHA 1OH8A 2WRZA 3GNSA 3B6EA 4MMYB 2QD5A 5DCWA 3VDRA 2VRCD 3QHAA 3ZNNA 1U9ZA 4LXQA 1L5HB 2AT1A 5K3BA 2YYAA 5KS2A 5CVEA 1R9JA 5ENZA 3MS2A 3AUAA 3CLUD 3DL4A 3E03A 3KX2A 1XTIA 3MPUA 4C6HA 2EZ8A 4CDRA 3DLHA 1ZNZA 4KMOA 4EUKA 4WWHA 3GP8A 2VXCA 1PYGA 5JAQA 1U98A 3ILHA 3WADA 1P1FA 2A3RA 2HM7A 3WIOA 3IBFA 4HZUB 3WLKX 2W7TA 3KVRA 1J97A 1KMQA 4BNGA 3WNDA 4E4RA 3S1SA 4RTMA 1XZLA 3HU2A 2ZUFA 5F35A 4O2BF 2PKRA 4B84A 3R24A 3E3NA 3F4BA 1IEVA 3AV3A 5SZJA 4A5SA 5IUKC 1VYVA 1KEVA 1FP4B 4IG9A 3E9ZA 5DNCA 2Z2IA 3C3AA 4G4IA 1OLUB 2QZZA 1VFNA 4MW1A 5CYFA 1F8FA 2HXGA 2X76A 2HRQA 2G9VA 2E5LB 3A7EA 3L1KA 5ARCA 1KJYA 4PC1A 2AZDA 4RH0A 2YRXA 1W52X 4TWRA 3VHLB 4DV1B 1OBOA 2HJSA 3CW2A 3NAGA 2O5CA 4D1YA 2PX0A 1ID1A 3C1TA 3KKMA 3FHCB 4ZYXA 3HFRA 4V0OA 3ADDA 1V8BA 3LLUA 3HWWA 5IDYA 3M83A 4ES6A 1WCIA 1CY4A 1NQAO 4JSYA 4IAOA 1LK7A 4YCDA 1XFDA 3T7AA 2Y1EA 4DJTA 1D6SA 1NX6A 4YNBA 4E33A 1A97A 3QBVA 4Z3DA 1PNRA 3GF4A 5TT1A 4C0QC 5ED4A 2QT1A 5EC8A 4L8YA 2PANA 2YDYA 4JBIA 5I7RA 4FBMA 1T3ZA 2OHIA 1IN4A 4KVFA 4M0KA 4WNAA 4BX9A 5JIBA 2L42A 4X8HA 2OO5C 3ZK7A 5C51B 3R77A 4Z7NB 4JJGA 1NTOA 2AYYA 2JW5A 3TE7A 1BQEA 1B2LA 2IEDA 4PYKA 3IIIA 3OEWA 5HFJA 5C5DA 3JQGB 5C8YF 2D2FA 1EBUA 1CUVA 5HIIA 4I1PA 3TTUA 2VP4A 2COKA 1JBQA 1D04A 1DRVA 2OBBA 2O3SA 1U0OC 3DYVA 4EQ6A 1GFWA 1Z4QA 1GPLA 2H1HA 2IOYA 3QTTA 4KXXA 4AMYA 1E1DA 2ENUA 5F98A 2ZSAA 1GNQA 1JXOA 3OZVA 4MIYA 4R2LA 4FNGA 4EHKA 4GUDA 1W59A 3DOJA 1X7ZB 1S2LA 2YR0A 1CQXA 3T52A 1X1RA 3VSBA 1Y9EA 2LPMA 3JVVA 3PBKA 1EVYA 5CLIA 1G291 1XUOA 3AJDA 1HEIA 3K1AB 4DS3A 1J1UA 3GT0A 3A0UA 5IS2A 3D8HA 1AO3A 1UXGA 1S4MA 4ZVQA 2FP4A 2VH2A 3GHHA 2D8AA 3FAZA 4O25A 5LA6A 3PRKE 3R75A 4EDHA 5KVAA 3RVDA 3WWPA 1KJZA 2HJ9A 1NUSA 2W11A 4PYLA 5CMLA 5K09A 4GXTA 3WZ2A 5JH7A 2WD7A 4B83A 1JDNA 2HD4A 4LPSA 3PFFA 2YN4A 3GNQA 3TJMA 2AW5A 1OPRA 1PT7A 1ZOSA 2FTKE 1BWQA 2BCJQ 2PQMA 4OJTA 2ORYA 4P81A 1X7WA 3OMXA 1JIVA 4H18A 3M2TA 4YP0A 1I2AA 2BH2A 4F5YA 2EATA 1CVRA 3DWIA 2ZB4A 3N6VA 2PX2A 5JOQA 4G5SA 1E2MA 4G5RA 4CUZA 3TGPA 2O8CA 3TLBA 4AKTA 3ORRA 4NV1A 2EQ5A 1CRZA 3CE6A 1QOQB 4NNPA 3HB5X 5AVOA 4N0DA 4UM9B 4R81A 8ADHA 3SR3A 3F73A 2GHRA 3HCPA 4GYJA 1XZJA 3MWYW 4BNYA 2ASEA 3FB4A 1ZD4A 1OJ7A 2I2DA 3K09A 4P5PA 3FDFA 3OC0A 1FNDA 3CUSA 1CSEE 4ZVNA 4AP5A 3DYBA 4ZI5A 1KOLA 1EVIA 1OAOC 1MVOA 1C9KA 2D59A 2Q3DA 4MWTA 1M34B 3BSSA 4NWIA 1P9RA 4WN9A 3VPCA 1P75A 3H9JA 4P58A 1JG7A 1OASA 3WB0A 4DG5A 1U1GA 4BFSA 4M3NA 5LZ7A 1N7IA 3G2KA 1AK2A 1GNPA 3M1YA 4HQNA 3JZDA 2MU1A 3SHQA 3PQ2A 3QSGA 5HVNA 3CZ4A 2ZIFA 4N7RA 1L7PA 2Z1MA 4MK4A 1WPGA 2VHXA 2QTLA 3K32A 2EW1A 4E21A 1RD4A 2Y3IA 4JT2A 621PA 3EPJA 5ABPA 2VQDA 3C41J 3K6SA 3D31A 1IE3A 1PHPA 4IV5A 4FFVA 4Z4CA 4I14A 2EJUA 1GGMA 4X93A 1N6KA 3OECA 5JCJA 4FR0A 3SZLA 4TLMB 1CD5A 1KYIA 2CFRA 3BDIA 4NNJA 4TYNA 2I3AA 2CJXA 3PTZA 3GUYA 1TD1A 2Y8EA 3JVUA 3NBZC 3VNRA 1BFDA 1WTAA 4HRAA 4IS2A 1WPXA 3A6EA 1XDZA 1Y3AA 3UAVA 1ESNA 2GPJA 2HYDA 1A88A 3GDFA 2C2HA 3H1FA 5M7EA 1B6TA 1L4LA 1WJGA 3QWBA 1J5XA 1GLGA 4EDFA 3DLBA 5GGXA 5BV2P 3AINA 2EJTA 4DQLA 3UGJA 5CLFA 3NR2A 5GIPE 3F97A 5INTA 4EL5A 3EPHA 2PUWA 3R5SA 3T4PA 1WL8A 1E92A 1C7QA 1HKHA 1X70A 1QSGA 1HQKA 1IOWA 1XWIA 3HV0A 3I2JA 4FW9A 5K3EA 3GCGA 4KKVA 1AUQA 2HU2A 1K7FB 2GD6A 4TN1A 5ADWA 1K1EA 1Y8RA 2WVAA 1CK4A 2VP2A 3QITA 1XG5A 2C03A 4V2IA 1ID8A 2XMQA 2O7SA 3I8XA 4D6YA 1GV1A 2PH5A 1WQ1R 2Q27A 4RGYA 3PUKA 2G5CA 4YT4A 3NB0A 2Z6QA 5HF9A 1RWBA 1IJBA 2GK4A 5A0TA 4DR5B 1S2IA 1HPLA 1NUAA 1WY7A 4PXYA 3GFBA 1P4RA 1ADFA 3FSEA 2VDWB 4ZVUA 2P6OA 4HH1A 4ZCTA 5DLPA 5TF0A 1T5TA 3EEYA 2W2LD 3HDVA 5BNFA 3OX4A 3C5WP 1W96A 3OZBA 4J03A 4K26A 2GO7A 3SDBA 2R84A 4R05A 3U62A 5IK2D 3LLSA 2UUAB 1OTYA 1GA4A 2VZ0A 3IL2A 2AOTA 1JX6A 2QM3A 3WDMA 1KXJA 3C74A 4Q3DA 5IM4F 3H0EA 4ECAA 4LXUA 4ZT3A 2JD0A 1ZOIA 3GCDA 1VKOA 3HJGA 3ICVA 2ZBDA 4FPXA 4KN8A 3RS9A 4B4VA 1YJQA 3IUBA 1OFUX 3IC5A 3LL4A 4B47A 4JLDA 1MF7A 3HPQA 5HILA 3HNPA 1E60A 1CZLA 1VHTA 1Z13A 1ZIXA 4MRNA 1C50A 1ZESA 1T6ZA 4C0HA 4V0RA 4ESVA 1Z75A 2AD5A 3IXLA 3KB6A 1WQ4A 1ZM4A 1VECA 2X9VA 2GJKA 3PUJA 4LBYA 2YIDA 4II3A 1O95C 3BG5A 5BMVA 2H11A 4RZXA 5ELMA 1UP7A 3WNBA 2GLXA 5LWQA 2PRIA 3HFGA 3T12A 1IONA 2LV8A 1RYNA 4LGVA 4P35A 3U4GA 4ZVLA 3IGFA 4H08A 3WLLA 1RR6A 4ESOA 4JI2B 1U3DA 2KLHA 4LGMA 2L18A 1OPXA 3FM9A 3P2OA 4LRWA 4TS1A 4DJJA 2HKIA 2PPLA 2Y93A 3BB4A 4KO4S 4ZYUA 2W2KA 4QM7A 4CLXA 1UKCA 2JVJA 4B7ZA 2Y66A 1NQTA 5MFZA 2R87A 1Z7YA 3N0RA 1M2JA 4HP8A 5AUOB 3PDHA 3ENVA 3G5UA 3ZU5A 2FA9A 4EH1A 3LW7A 3H05A 4PC6A 2DPMA 3PL5A 4HFRA 1YJBA 4GR4A 4OXNA 1CP3A 3TDNA 3ZQKA 4BO2A 4JN6B 2MHCA 5DOVA 3RSCA 3T1QA 5EUCA 3TLMA 2CLHB 3V42A 3FCUB 1WXHA 2E6UX 2D74A 1C3VA 1ULZA 1YS7A 2J85A 4UKDA 3F3MA 5AHRA 1MGOA 5AKJA 3HCNA 1E6LA 2PEZA 3H11A 4OHVA 3GLFE 3N75A 4ARIA 3IEVA 1WSBA 5AM3A 3BRCA 1VOTA 3CURA 4GOND 3N6XA 1QHXA 1ETHA 4LBZA 2JGEA 1KEZA 4DLZA 3T9EA 1DBVO 3OEEA 3OQMA 4PQRA 5KQMA 5CIYA 1MZPA 5FFFA 1Y9ZA 3P9KA 4YJ2A 4LKOA 4H3HB 2YFQA 2NVUA 3EC1A 2CNWA 1KVTA 1Q17A 1MD9A 3F7MA 1W88A 1QK3A 3WI7A 1E6EA 2QTWB 3FHJA 2WWFA 4C7VA 2R2GA 5EIAA 2DH6A 3JWEA 1ODTC 3AF3A 5AJHA 2VEDA 4HNQA 1SOVA 2PGJA 4A1OA 4WBNA 3QLVA 3WBKA 1OH7A 5CB4F 2D7DA 1JLKA 2Z8XA 3ECCA 4IWYA 4WBXC 4HOYA 4LX0A 3WR5A 3W3AD 1W5TA 4F93B 5B5SA 4HAUA 1B2RA 1XCJA 2BFEA 4ZOBA 2WWYA 4HMPA 1XA4A 5DGXA 2ECKA 4ENPA 1B43A 1EGVB 1O57A 4S0ZA 4WKNA 5DWDA 5E7JA 1QCYA 1SH7A 1T6BY 1QNLA 2J67A 1CJBA 1CLUA 1O1YA 1VJCA 2BM8A 2E1RA 1QE3A 2NV2B 2JFVA 2XE8A 3BGDA 3HL0A 4G9GA 3R76A 1KTVA 1Z9BA 5C9ZA 1OT5A 5JD6A 2YZ7A 1GPMA 3BERA 1DV2A 3AG5A 4DEXA 1ZRMA 4HPJB 1SHKA 3PC2A 3TBHA 1JR3A 4UVDA 2GN8A 4M0LA 4EGAA 1Q7RA 2R65A 5EWMA 2KSQA 2Q9AA 3S8EA 4NBNA 3O21A 2ZQZA 4LE1A 4H1VA 1DNPA 2PX8A 3VHQA 5G0VA 3FMPB 1I7SB 2V5UA 1NGSA 3KAJA 2J3LA 3IUPA 1H2WA 2EEPA 3GEIA 5HDBB 4ZHSA 4I46A 2H31A 3R20A 1Z6AA 2D1RA 2CXTA 4A2QA 4YUZA 1F4LA 1O5OA 3KHSA 2SICE 1FTSA 4RVFA 1DS6A 1RTKA 3OCYA 1OH6A 4ME6A 2I7VA 5F9MA 3LOPA 4KE8A 1FNCA 1KERA 2MMCA 3GQBB 1C1HA 2WWIA 3EGCA 3OJEA 3AH8A 4Y2UA 3VO9A 2PUTA 4FP9A 4M1SA 10MHA 1XK6A 1R3UA 2ID7A 3IHTA 4WIAA 3V9PA 1T1EA 4DSNA 3MT8A 1ZI6A 1JIUA 2O05A 2RFLA 4P4TA 2GLTA 3QA9A 2LRHA 4RKEA 1NVKA 3E9CA 3HCAA 1T0JB 3I28A 5H3LA 1M2KA 4TTRA 3BB1A 4BMOB 2NQ8A 1YF3A 4OXXA 4K88A 2C4MA 5FAXA 3LT0A 5FTJA 3RV4A 3W5AA 3O4JA 5FFNA 1IQUA 1E79D 1A9SA 1RZVA 4BRSA 4CCSA 1M1XB 2BI4A 3DJFA 4MPPA 2WOOA 4CF6A 1O0SA 2C8LA 2EWMA 3PI6A 3AV0B 3ST7A 2I3BA 1NPDA 2B1JA 1TX4B 3K9CA 3QELB 4YWJA 3F90A 2WMDA 1DCTA 1U5BB 3HY3A 3QXCA 2XE4A 2IP1A 3B52X 5CT6A 3G2QA 1ISFA 4L5BA 1P2SA 4YAKA 4XIFA 1H2AS 3A6HA 2ZM6B 4P3XA 4PX3A 2PL5A 3NV7A 1SCJA 1PW5A 3HKCB 3SMVA 3JTMA 3RNOA 4GH5A 4EW1A 1JEEA 2HEGA 3R09A 3IEMA 4EFLA 1NJ1A 1T8UA 3S2IA 2I34A 2A8YA 4KMSA 3UMCA 4D4KA 1EH5A 3HUTA 2CCGA 2ORIA 1LFAA 1AKYA 3DO6A 4YJFB 1NQUA 4LJYA 4OMUA 3T5MA 4CTNA 2RMKA 3OPYB 4OJMX 4GL4A 3ELUA 4FC6A 4FIZA 4MV8A 4YRQA 5AQ1A 5F2NA 1W6RA 1XD2B 3D6MA 3FDZA 3FZNA 3GLQA 2QE7A 2H1LA 3M34A 4MGHA 3ZKAA 2ZYHA 2W2QA 2ZFUA 1ND6A 4MKFA 4OCZA 3ZE2B 2IYVA 2ZE7A 1DJQA 4PPYA 4FYWA 5ERGB 1G20E 1I30A 1M2VB 4WZ6A 4TKVB 4AWBA 3SSAA 3AEKB 2J09A 1BJKA 3T35A 1K6JA 2PPVA 1KYYA 1H3FA 4K81B 3C4JA 2ZYUX 4LDJA 2AXNA 4AJLA 9GPBA 3GJYA 4OKSA 2KBFA 1TYCA 3OHMA 1BJTA 3BXPA 2ANCA 1ORRA 3FHLA 3I2KA 4W99A 1CQJB 1LS1A 3EQ8A 3I6QA 4MV5A 5DBFA 1OHHD 1P17A 4UVEA 5EL0A 3P2IA 3TM4A 1G8MA 1I33A 1NUPA 1YUBA 5G2OA 2Z30A 1E4EA 2QNBA 3ESYA 3LRTA 3OF2A 2FPKA 4X1IB 4R71A 2F3TA 3X1ZA 2NUBA 3ZCRA 3STTA 2I9PA 4X3CA 3FDXA 1DIBA 2VJNA 4PZDA 4CM4A 1RRCA 1B15A 3SKYA 1KMMA 3UENA 4FC7A 4I3FA 4FGZA 3PEFA 3THOA 4ARZB 3RRZA 3PFBA 1PN3A 4YASA 2QVZX 1PL0A 2GBCA 4N0QA 4ZT5A 2AX4A 4F9EA 1M6YA 2DMRA 1SJ9A 3KXIA 4J3JA 5ILQA 3IT1A 1G6KA 2XNHA 3C4VA 4XB6B 3SJ7A 4M2LA 2OO3A 2RCYA 5E9AA 2YJTD 1Z0UA 2XT9A 1Z6ZA 5JO9A 2QIOA 5H83A 1QH0A 1WB5A 2NXNA 4MMXB 2L0XA 3U3ZA 1UMDB 3CO5A 4BGUA 1MLDA 3W2IA 5LMCA 2COEA 4B3MB 3D6JA 4QYTA 4DDKA 5TS2A 3MTDA 4DT1A 3AT1A 2WA1A 1WUJS 3U5ZB 3GK3A 4MUHA 1CE8B 1O96A 4H31A 1JDBC 4H6VA 1VLMA 1GCUA 4L4UA 3NWJA 2HQRA 3O8DA 3NTRA 5FD8A 3S2GA 4R3WA 4BFXA 1JEYA 5HYVA 2IHJA 4I1RA 4BNWA 1G5TA 2IIPA 1JQBA 2YWEA 1LDNA 1JNYA 2EEZA 2I5PO 2XMDA 4WK4B 2MYNA 2AFIB 4OHPA 2V6JA 1GG9A 4IIJA 3PC3A 2FFQA 2VUTA 4HGNA 2UZAA 4OIFA 4X54A 2ZSHA 5J63A 4KPFC 4ZJZA 1LH0A 3GPCA 1R4MB 4ZO8A 3G0CA 2RB4A 3ESQA 1NN1A 4DJFC 4YRNA 3MELA 3UWKA 2PWPA 5DNYB 1TIBA 2FR8C 1K6IA 2BMDA 2W6IA 4TV8A 2G08A 3TM5A 3KSAC 3O8BA 5AVKA 2IZ1A 3BOSA 1SXGA 1CEQA 1UWKA 2WTEA 1S96A 1SPBS 1JXAA 1MEEA 5CXSA 2OGUA 3BZWA 4EB3A 3ZGNA 3I9FA 3MJFA 1LV8A 2H5JA 4HUQA 2NYVA 2P90A 3HEMA 4QDJA 3UAZA 5L6LB 4KOEC 2NW6A 3IP8A 1GPWB 4JELA 1VL2A 5C8YA 3RREA 1TE2A 2ZIXB 4BNMA 2WJYA 5BOSB 1VG0B 2OV3A 1A0OA 3D0QA 2NV6A 4WW0A 2FW8A 1NXQA 1LPAB 4A6EA 5AIBA 4BNNA 3CUWA 5D3KA 3WGGA 3WWCA 2PHZA 1TUBB 4ZAWA 2NNWB 1U7DA 3W8DA 3MBOA 3G0GA 2H7YA 3GHYA 5AW9A 2QX8A 3ZEIA 5C3UA 3AP3A 3KJNA 1WHTB 1X0VA 4B6QA 1RPNA 1Q16A 4IMIB 4R9NA 3VYRB 4F6RA 3ZJVA 3CJRA 4Q47A 3GJ8A 2DG2A 3EVTA 2ZULA 1ZKMA 3MMZA 5TXGA 3ZV5A 5FH9A 2PMBA 4QKQA 4F3RA 1XDBA 4JA2A 1B8PA 2ZLBA 2AEMA 3B6IA 2EZTA 1YI0A 1OCEA 2OHJA 4KV7A 3DXXA 3RYCB 3AF6A 2B1QA 3IODA 5F3DA 3VPFA 4CMEA 3L1HA 4FQ7A 4LBVA 5ALSA 5LYYA 2VH5R 3AUXA 1PT5A 4IMPA 1K89A 3BJIC 3ETEA 4QQRA 3EH1A 3K1TA 4S1VA 4B82A 1G5PA 3B9QA 4Z9XA 1E8NA 2K4MA 3QQPA 4D57A 4D9KA 2H4ZA 3FKSD 2IHNA 1NY6A 4E2FA 5BWLA 4IOJA 2CKMA 5F64A 1OF1A 1Z37A 2V55B 3E61A 5AI9A 1JEQB 3W4JA 1NONA 3LP8A 4P36A 3Q2KA 4M1WA 3TMKA 4B40A 1DKLA 2VFAA 3EDRA 1MRZA 4GZ3A 4Q9KA 3U1VA 4IZIA 1NRJB 2PRJA 4Y2HA 4BO6A 5I7UA 1M34E 5JJBA 2DKNA 3EXFA 4RM3A 1IXRC 5DU2A 2ISCA 3DBLB 2HJGA 5GWXA 4KIWA 2XA2A 1PK8A 3JD4A 4M8LA 5AJVB 4UE2A 2FMKA 2QP9X 1EHIA 1OA1A 4GDFA 4YP6A 1GJRA 1JHMA 1NU6A 1KDTA 2HU8A 4YC7A 3R7WB 4OY3A 4BN5A 4M38A 4MQFB 1JJIA 3ONVA 1I2MA 2OCAA 2QPAA 4CYMA 3RRMA 1WTCA 2J9ZB 2OQIA 2YN2A 2PUEA 2EZUA 5AOBA 1BE0A 1V1RB 2J9YB 3HJBA 3C0KA 4QXPA 3RIGA 4MROA 1FLAA 1W8IA 3K09C 2OXTA 1OI4A 2HRDA 4KITB 2W83A 1X6VA 3K2IA 2NO5A 2YVQA 3OFJA 3N8GA 5K8VA 1YBVA 3GEMA 3WS7A 4EYQA 1W29A 2XQFA 2OBXA 4HBGA 5HXAA 1E1RD 4LDAA 5CNKA 3EDCA 2FQXA 1P1HA 2KJQA 4RELA 4J90A 1ZD3A 4TRNA 1OJLA 5EGNA 4KI7A 5AW0A 1HY3A 3NRJA 4TTQA 4XSVA 5JY6A 2Q5JA 1V37A 3FTCA 4EJ6A 1ZJJA 4XLTA 4PFSA 2BFWA 2LTAA 2PGXA 5AM4A 3OQJA 1P77A 2IDJA 2OAP1 1G6HA 1ZZEA 2NO1A 2QQFA 5KDLA 3WGQA 4M54A 3ZW7A 3P71T 3GLSA 3WL7A 5FBQB 1ZM2A 2DLDA 3B6JA 2WJJA 2VOEA 5FLYA 3BFJA 5B3AA 4R54A 3L1UA 1ZGCA 3R2JA 4O4IA 1P0PA 1M8JA 2ZUBA 4Q6WA 5F21A 3WBJA 3EXIB 4BDTA 4LXXA 5B3KA 4NEQA 3VR2A 3ZJ5A 1ZCAA 4L9WA 2IYLD 2HRBA 1N5JA 4JSTA 3INTA 4DNOA 4IYRA 3QQ5A 1R00A 5ES3A 4ZVPA 4RVUA 1SCDA 5I3ZA 4PPGA 1RI2A 5LZ5A 2PT5A 3PEWA 1CRLA 1PLJA 2GUWA 2TMDA 4PN3A 1MTOA 2O8BA 1CDDA 1NMSA 4OMDA 3FMOB 3VVLA 1SCUA 4P4NA 4J4TA 1SNYA 1YRHA 1L3CA 3GMTA 4JI3B 2VUUA 2A5JA 3LBYA 4U2KA 1BHQ1 1O2DA 3LCRA 1EVEA 1VKRA 3N74A 4TTPA 4UDNA 3R74A 1W1WA 4J16A 3FWNA 1SWVA 1E1CB 2MSCB 2Q6VA 4XASA 3TEJA 1A2KC 1KI4A 1G9XA 3CNNA 4R16A 5EJ7A 5K8UA 1J25A 1M2HA 5K8LA 1MW9X 4C30A 1E0DA 5CVTA 4QUBA 4M53A 1XZDA 2Y9MB 2ZTUA 1WB6A 3AI3A 1EVLA 3PNKA 3RVKA 2PXHA 1HK7A 4TWZA 2YTZA 3W5CA 1DTSA 2DWPA 3S7TA 1CPYA 1A8IA 1YUMA 4W5NA 4U7DA 1ZUNA 4ALNA 5HKBA 5DP2A 1GTVA 4Y9RA 1WKCA 3OTWA 5DT9A 3RG8A 2XQIA 1Q1NA 3L1VA 2A35A 1TTHA 4TGLA 3T6KA 3BMNA 1SCQA 4MR9B 3KSUA 3IAS6 5IC4A 2C5AA 1A8PA 4YLEA 1SVNA 3QWFA 2VCEA 1XHFA 2NUTA 1XMPA 3G0HA 1P8JA 1NC3A 1YD7A 4B3XA 2CSUA 1JAHA 5CDUA 5HSGA 2GS9A 1ZKDA 3L82B 3MYYA 3OC6A 1FC0A 4LRYA 1E7MA 4ZAFA 2B0JA 1R5JA 1XU7A 1TNDA 1AXGA 1KYXA 1QVRA 2XYVA 3R1IA 1QKIA 4HMOA 3VC1A 4CUJA 4ITUA 4YAIA 3CVXA 3I3SR 3B85A 5BV8A 4CDNA 3MWFA 3PTAA 5AI0A 1Z74A 3W78A 3ZWMA 2N9UA 2BLLA 1PEAA 2W2VA 1TT5B 2ZVQX 3ZXXA 1O9GA 2BJWA 3T1NA 3KOYA 4BLOA 1QTRA 1T25A 2HSJA 2QMUA 4JCOA 4KQKA 4OYLA 1NVGA 3RUPA 4BJ5A 4PPNA 1G38A 3PE3A 4PICA 3BGOS 1D7AA 2NLOA 3DQZA 2Q3FA 3B7GA 1C7FA 1E4VA 3EE6A 4PLCA 5SY4A 4X6XA 2CKDA 3UUGA 1IVSA 4MUKA 3OQ6A 2FEMA 3TRHA 4IHKA 5IFKA 1JHOA 1ZGAA 3SXUA 1KL7A 2I6FA 2N3ZA 3TIFA 2ICAA 1V11B 4KX5A 4II2A 1RPZA 2GRJA 3RG2A 4G1EB 1KFEB 1FXUA 1TMOA 5TGDA 2KHZA 2GJSA 4ZQGA 3R8FA 2H1OA 2WB4A 4O3MA 5JHHB 4RJIA 2KX7A 3C87A 3EOZA 3MT9A 2HIHA 4IH9A 5I48A 3BFPA 4C7OB 2GCOB 4EKYA 3KYDA 3UF0A 4JI8B 3MN1A 4BE4A 5IZCA 3AY6A 1K92A 1NWCA 3OBBA 5NULA 3TOZA 3IMKA 4ROSA 4QQKA 2H4YA 1U04A 2EKLA 3ICOA 4HH0A 4IUYA 3SIPA 3F8TA 4ETMA 1V4NA 3RADC 3K0AA 1N6OA 4JYCA 3KJEA 3OZTA 4KKXB 2QPOA 1RVDA 2NSLA 3A11A 4BVAA 3NHSA 2SHKA 4Q9AA 5IH7A 2HY7A 2W6JA 4P08A 1VJRA 1MOQA 2P6UA 1JVBA 1Q0HA 5AVSA 4F2DA 4V1CA 1RAIA 1XVLA 3BDAA 1EQUA 2HFKA 3H3XA 2VSNA 4BB0A 1ZK4A 5GADl 3GG9A 3HVKA 2HK9A 1DX6A 2JJ2A 3Q9UA 4C07A 5K2OA 1PX2A 3D4PA 5LXTF 1DWOA 1JYSA 2XNSA 4J0IA 1U7TA 5HOQA 1KF0A 4ACAA 4N39A 4ZTZB 4BP8A 3LQRA 4RIIA 3C3EA 4G3XA 1QGAA 1O7JA 1XKLA 2O0KA 4QUAA 2X8BA 4RQTA 2OBMA 1KDZA 1L7DA 3ZEAA 4CL0A 5A3RA 4AIIA 5JWOA 1V95A 4LMAA 5IC5A 1W2GA 1BX1A 1OILA 1P4GA 2QZPA 3RFFA 3F4LA 1HGXA 2P68A 2HNAA 4C88A 1U3UA 2PY6A 4ZICA 1VA5A 3I23A 4ZRNA 2QRJA 1HE4A 4UUNA 5AW3A 4ZRMA 2BFFB 1SOWA 1K2VN 1AT1A 4J4BA 1VRVA 1YZYA 4L7VA 4RIHA 3TSWA 1AZTA 2RK4A 2W2OA 4TLCA 1AMNA 3RYTC 3DEFA 3QLVC 4EOGA 1NBMD 3CR3C 3LUJA 2O23A 3VZBA 5TJ9A 3ITKA 5CX1B 1J5EB 1M3SA 4J0GA 3W90A 5B12A 1T5IA 1MJNA 3VAAA 1DOHA 3CLKA 1E77A 1N5RA 2QN9A 1C4KA 1X1TA 4P7GA 4CL2A 1CS0B 3PUHA 4KXLA 3INYA 3OKPA 2PNJA 4BFYA 4NI5A 3LX8A 4GP6A 1NJ8A 2A4KA 2RKBA 4IJVA 4MCIA 4ZJUA 1M1YB 1LQ2A 4WT7A 1L4KA 2BD0A 1RMYA 4LI0A 2VZEA 3VPDA 3ZI4A 1A9PA 2WHQA 3WKBA 4QVGA 4CKCA 2BZSA 2VYNA 1KI7A 4CDGA 2VH1A 2MOKA 1SKAA 3PZBA 3GARA 1TEXA 3MUEA 5AKXA 3H5RA 5K4AA 4KQMA 1J1ZA 2WM2A 2CLDX 4RD3A 1SZJG 3IUYA 5HFAA 2J0EA 3IP3A 5AMXA 1KSHA 5JSYA 1JHAA 3CVWA 1C3OA 1T2VA 1TQ6A 1YVDA 2CHEA 2IYQA 3BGIA 4JUFA 5BN5B 2E55A 3VRHA 3NDBB 1MNAA 4KLNA 4OA8A 3JQQA 4RESA 1Z47A 4G63A 3C1UA 1T36A 2ZVPX 4HGQA 1DJPA 4Z1OA 4PZAA 5TVGA 4YA6A 3ZWCA 2Q4BA 2QVYX 3NANA 4FUTA 1UFVA 2ZIVB 3TOXA 1Q0TA 3R4VA 2VKTA 3JZAA 5AKEA 4MUMA 3F5FA 5ALTA 1UZAA 5EIHA 2MSNA 3T7IA 1Z16A 2C5EA 1RIIA 4WFIA 4YAOA 4GMGA 5DTRA 5BXQC 3LUKA 5IVKA 5SZHB 4LHWA 2IOQA 1NE2A 2RBEA 3RV3A 1A7JA 3IPAA 2O0MA 2HQOA 3GFSA 2VPZA 2E21A 4G07A 3CSUA 4HXGA 5IH3A 3VYUB 2Z56A 4CLOB 5IAAA 1BW9A 1G64A 2ZS8A 2F55A 2CY0A 1N6NA 2H17A 2LDBA 1WSWA 4GU5A 1VZ2A 4BTVA 4JROA 4GOJA 4FHGA 1H85A 5K0EA 1GPAA 4YRAA 2GZRA 4FMDF 3RODA 4D0LB 5C80A 2GAOA 5CEEA 4E07A 3HEAA 3A6GA 2R8OA 3BGSA 4YRZA 1CX9B 3FH0A 1PFQA 1SBTA 4IDBA 3NU1A 5DM0A 1LWNA 1QQ5A 3NDRA 1SD1A 1U8AA 2I99A 3G5TA 3EGIA 3MZ0A 1VG8A 2IF2A 3OLQA 5GPBA 2D5AA 2GEVA 2X23A 1FFAA 2DSTA 2X8JB 4A82A 1V1JA 3Q5EA 3R9XB 4NE9A 2WZDA 2ZWOA 4M36A 3ZHXA 4I36A 4PFJA 1TVEA 5ECYA 1NMQA 4O08A 4RZUA 3RSSA 3TQCA 1YQXA 1KBOA 2DBQA 3C3WA 4HB2A 4PG4A 1KETA 3C16C 3R5FA 2WICA 1ZNYA 3IUMA 5LUAA 4W1SA 1SUCA 3IKLA 5DX1A 1KTIA 3GBPA 2E0IA 3KFXA 1QG4A 2R7LA 1MABA 2V7VA 3U4QB 4I9NA 2C4VA 2GDZA 1JLLA 4G84A 1GILA 3LY8A 1XTZA 3WK4A 4JT4A 4CM5A 4E7OA 5DSXA 4ER3A 4ZYTA 2Q6KA 5E2AA 3B1VA 2Q9BA 4P32A 5K8CA 2PXAA 1Q2XA 3TLAA 1L5FA 1Y89A 4PHGA 5I5EA 2B5VA 4LDPA 2I91A 4MVJH 1E0SA 1N8TA 5CTJA 2G70A 3DCJA 3UOAB 2VRBA 1SC3A 3IAAA 1GRQA 4JLAA 1EUCA 5IAJA 4F21A 4CL3A 1BEUB 1I5EA 1S0UA 1DKPA 4KXYA 1Q6ZA 1QANA 1E9CA 5ALNA 1JHVA 4DSAA 1DAHA 4B1FA 1XR3A 4OYYA 4TT8A 2B4TO 1C9EA 1VLQA 5KYYB 2QTGA 2PNFA 5HOEA 3QYFA 1FFWA 4L2IA 1POWA 3K2QA 4TLAA 1O03A 4BFTA 3SM3A 2YCLA 1GN8A 4EJ2A 2DQZA 4WE3A 2NSDA 5U9CA 5JADA 3BVPA 4AJKA 4QNNA 3AY3A 3FLEA 2F1IA 2DPYA 4I50B 2K87A 5BNWA 3F0TA 4RW0A 2OMKA 3JQAD 4ZVRA 3AQIA 2AFIE 4QXAA 2H0AA 1L8OA 5D51S 3ZCPA 5JARA 2I6TA 3FHOA 3WL3A 3PFIA 1WUIS 4LJ7A 1P61B 1JDUA 2FPUA 2H5IA 4F7DA 1D03A 1IHXA 4FOPA 4PFQA 4KTTE 2ASVA 2BKAA 2GVDC 2PRSA 1M75A 2YVUA 1OI3A 3EISA 3GJTA 4TUYF 4UUBA 5A1JA 4ZCPA 1LQTA 2OZLB 1JR3D 1JMKC 2NIPA 4P9NA 3PENA 1W75A 1E3TA 3OPYI 3K9BA 4LYAA 4N7MA 4Q37A 5JRDS 5EE5B 1MH9A 1QGYA 2CJFA 1M1NA 4P3YA 2R8XA 3JWJA 2GMWA 2IUTA 4HCJA 5IKXA 1ZRNA 2VT2A 1RJEA 1DG1G 4OHMA 3CG0A 4UXIA 2PAAA 1L5NA 4B7UA 4ZDKA 2DQSA 2V97A 3EC7A 1Q14A 1IHYA 1DVRA 5CA0B 4DEVA 4RKQA 2F43B 5CGZA 3N07A 4HWTA 4UDXX 3WIUA 2B82A 5TS3A 2JEYA 1YOBA 3Q8MA 3MGCA 1NMEA 4DNPA 3RSZA 1RC0A 1YZUA 1D2NA 3AB7A 1RCUA 1YCDA 1Y4ZA 1AB5A 1FRVA 3OY7A 4QBTA 1N3IA 2WV7A 3DVSX 3JWPA 1KI1A 5BVGB 3KALA 3NG1A 3TXXA 3WLAA 1JDSA 3X2EA 2P6PA 1YR3A 3JD1A 2IZZA 1VDZA 2C2XA 3P94A 3FFTA 4RTPA 2C5LA 3QEAZ 2AJCA 2XUFA 1DC3A 5DHUA 1BDHA 3NBFA 1L4FA 5EE9A 1RRMA 4HWOA 3MBKA 3HN7A 4ED9A 1FDUA 4QPZA 4Y1GA 1CY2A 1QYWA 2VUIB 3X1DA 4CNQA 5IJ9A 1ODFA 1JPVA 1U3WA 2DUMA 4BEJA 3DGEC 3GIDA 3COVA 1OZFA 1GUFA 2O48X 4DMKA 1U9YA 1T9DA 5FQOA 3FPKA 1RP1A 4ZD6A 5BWMA 4J49A 1JBKA 2SCUA 5IHXA 4QDOA 4R8SA 1GD1O 4EJFA 3NHYA 2A3NA 3LQ2A 2PZ8A 4RFVA 4ZCLA 2GJ4A 2Q99A 3CU5A 3G49A 4RFSB 5DPMA 2Q0XA 3ILYA 3ZS8A 1JDBB 4KPUA 5D87A 1PVOA 4CT0A 1WMBA 3F6EX 1B8OA 1EWRA 1FFCA 4R0MA 5LZ2A 4HH3C 4GI2A 3QPVA 3DEZA 4RENA 4CIBA 3HBNA 2IYXA 5K0LA 5JDIA 1ISJA 1P2VA 3FKQA 3M6UA 2W2MA 5KAMA 4YCAA 1CXZA