1GTVA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 81
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gtvA00
1JXOA 1H8EA 3PVSA 3RS4A 4YMSA 4CEJA 4ZDIA 3M6AA 1XD9A 3Q8XB 1XEXA 2ZR7A 2ZE6A 2AK3A 3ZS9A 1II0A 4KJZA 2C9OA 2IYYA 4P32A 1HV8A 1S3SA 1XZPA 2Y8EA 2CVHA 3OIUA 1C4OA 4XVUA 4DT1B 4GZMA 4GP6A 1RYHA 4QGAA 3OFNA 4KLZA 1Z0KA 3GD7A 1CS4C 2BC9A 2FEMA 2KWIA 2QMEA 3I1FA 4B2PA 3OF5A 5KU1A 1II8A 1T8TA 3R9IA 1F60A 2DR3A 4R2HA 1MO4A 2O0JA 4EFNA 4WZ6A 3HPRA 2FDCA 1ZC4A 1S9HA 4Q4AB 1RRGA 1NY6A 1WXQA 5DLQC 3ZZTA 1SXJC 3GLGA 3CNLA 1KJZA 3FVQA 2A5JA 2OM2A 3UMFA 4E03A 1US8A 2JCSA 4MKGA 3A1TA 4YC7A 3FHTA 4QC2A 3FMFA 3T1QA 3C4JA 2IX3A 4OKSA 4URUR 1HTWA 1QZXA 2O52A 4ZIRA 2XSZD 3A37A 1GRNA 2KBEA 2QY9A 3I4LA 1NBMA 4MRPA 3QBTA 3R7WA 3QKTA 3TRFA 4TLEA 4YMTA 4EJSB 4CT4B 1IHUA 1TQ6A 1F2TB 1XTIA 2HUPA 2ZSEA 2JEOA 3KKQA 2IT1A 4M1KA 4PPNA 4Z8XA 2WHXA 4TT3A 1D8TA 3DOEA 2EWVA 2VO1A 4A4DA 5L3QB 1NKTA 1FZQA 5EQTA 4IOKA 4I1SA 1NI3A 3QUSA 3SS8A 2D4HA 3KX2A 3IBGA 1MH1A 1DEKA 1XB2A 4LYJA 2VH5R 1I2DA 5GJCA 2EW1A 4HLQB 1YE8A 3A1UA 3U3MA 2GF9A 1Z3IX 1S0UA 1V5WA 1NJGA 3THXA 4OQXA 2O8CA 2AFHE 1N6NA 3AVVA 4OQFA 3CX7A 1RIFA 2OCYC 4L9SA 1BO6A 2ZRNA 2WKPA 2Z4SA 1AM4D 1G6HA 1YR7A 2V6IA 4FWTA 2R6DA 4TL9A 1OKKA 4OYHA 4U02A 3VU9B 2GBLA 3TR0A 3SOPA 3U3JA 2DFKB 2UKDA 1OIVA 1E9DA 2CE7A 5LB4A 1PV4A 1E2GA 1LFDB 3TSWA 5CIWA 3QI2A 3CRRA 4IKEA 4U7DA 4NONA 1FNMA 2NO0A 4PO8A 5FL7D 3EPJA 3GEHA 4GP7A 4ON9A 5KOYA 3LBIA 2C04A 4TTRA 2ZETA 3AKEA 3IHLA 5EP1A 4HUTA 2RCNA 1IONA 1KI7A 2NZJA 2YZ2A 3QJYA 3PXGA 1HT2E 2BM1A 5IF9A 1UKEA 3A58B 2H57A 1XWIA 4Q1EA 4IVQA 1C1YA 1SKQA 2AX4A 2VHTA 4FCTA 3EG5A 5HCNA 2ORWA 3ADCA 4DLUA 2SHKA 3C5CA 4LJ5A 2UZIR 5LPNA 3IIKA 4LRWA 1G3IA 4HB4A 4OL0A 5HE9A 3RYTC 4M9SA 1S1MA 3SQXA 1JEDA 2PLRA 1E2FA 3THYB 3BRWD 3RNLA 4C30A 3I32A 4H1UA 1HE1C 2CHQA 2IF2A 3E5HA 2F1JA 2QBYA 4QG7A 1KTVA 2BDTA 5B2ZA 621PA 3DZ8A 4GBMA 2JGNA 4M22A 1G8GA 1KKMA 2QP9X 4B6FA 4ACBA 3I72A 4NTZA 4RD6A 1MR3F 3IPYA 4S2EA 5AJWA 5JSZA 3A8TA 3SC3A 1AKYA 3EWAA 1M34E 1E94E 1NL3A 2I1VB 1EGAA 1X1RA 4F92B 1AZTA 1Q1ZA 1OXUA 3AKDA 5DIFA 2EQBA 2G83A 3IHWA 1OH6A 2ZVPX 4URZR 2WJHA 2LKDA 3ZS8A 4AC9A 2IYQA 4OQMA 3R7WB 1Q0UA 3W6NA 2WV9A 1IN8A 2QI9C 3DPUA 4B3FX 4B74A 5D3MA 4D4MA 3GJXC 3ZH9B 2JJ2A 1GSIA 4C0HA 5EXTA 2UVQA 3C8UA 1X6VA 4PAQA 3KKNA 1VCMA 4IOLA 5GVSA 3PEWA 1HE8B 1K8RA 3O8CA 5AUOB 2EFDB 2BBWA 4JKIA 1TNDA 4V02A 5AJXA 1QHHB 1Z0IA 2EVWX 2QEQA 3V9PA 1HT1E 3MJRA 2VF7A 5FBWB 3LA6A 3HP1A 3CLVA 1KI8A 5AWFC 4MYTA 1Z08A 2JIZA 4DUGD 2G6BA 2R44A 1DG3A 5CIQA 3GLFA 4G5SA 4NKRA 3H1TA 3K9GA 1CR0A 1W4AA 5G53C 1P5ZB 1G5TA 1S8FA 4AD8A 4I4LA 4ZPXA 4DT1A 3VKHA 3OEHD 1GVNB 1OH8A 1KYIA 1SVWA 5FH9A 4EPRA 2OESA 3GJ0A 4YMVA 3CW2A 4RD1A 1IN5A 4TT3D 1E96A 3KXIA 4NYIR 4Q5IA 721PA 2XGJA 2DB3A 3EZ2A 1T91A 1G17A 1EXMA 1H8HD 4CYMA 5G3YA 4D4KA 4D6PA 2O8EB 3GLIA 3IIMA 5JLJA 3KQUA 2QU8A 2ZRDA 5DI3B 1R0XA 5H1YA 3QEOA 2W6ID 3AUXA 1OB2A 5E95A 2ZSDA 1KIMA 1W0KA 2IYWA 4WAUA 4HLUC 1TL7C 1GZSA 5FBVB 3EARA 1JNYA 5CLLA 2R2AA 4MDEA 4CEHB 4RKFA 1E1RD 2YNMA 1NN0A 2ERXA 4KSCA 4K46A 4CGZA 3K09C 4EJSA 1U99A 2FX3A 221PA 1ZM9A 3CZQA 3HYRA 4LBVA 3X1DA 2GEVA 1P73A 3VX4A 3AP3A 3WXMA 2BWJA 4O2RA 4FINA 3WRYC 4C9BA 2Q21A 1U0JA 1YR8A 3I62A 1CLUA 1E0KA 1E2DA 4IXMA 1US8B 3AV0B 4PQYA 1XTQA 4OHYA 2GF0A 2QBYB 1KI2A 2ZRJA 1W0JD 4ZDKA 1MO6A 3K0CA 3SYNA 4B48A 3QKSA 1VG9B 2PJZA 2ZRHA 2CLSA 1G9XA 3LH5A 4V0NA 5FPTA 1V43A 5FTMA 2F7SA 1XMSA 3PUVA 1LB1B 1YZGA 3TQFA 4BWYA 4BFSA 1E2IA 1XCMA 3SFZA 4DCVA 2C78A 3NH6A 2WPDD 2IYTA 5FUYA 4NE2A 1N0UA 4URXR 2BOVA 1EK0A 2OBNA 4IDHA 1T4GA 4FXPA 3WRXC 4DEXA 4YLGA 2FGJA 4PC3A 5DH9A 1QG4A 3PG5A 3T35A 3TAUA 2REOA 1KZGB 2VEDA 3OIVA 2YOHA 2X2EA 5CB6A 3BH7A 2ZUDA 2D06A 3SZRA 3HJNA 3FYHA 3R9XA 3NWJA 1E2MA 4C0LA 5C2JB 3W3ZB 4TYPA 2XTNA 1QRAA 4JMPA 4MDFA 4F91B 1XEWY 2ZRAA 3L8ZA 2G0TA 1P61B 1XTKA 2VQSA 3AQ4A 2DFTA 1FFHA 4XD7A 3KQHA 3KJIA 1QHHA 2WJVA 4KO8A 3KKPA 2VHJA 1GL9B 1OLOA 1E4YA 2CXXA 3QXCA 1Z6GA 5FOSA 1XPRA 1N6OA 2A5GA 1HY3A 1Q3TA 1E2KA 4DUGA 1HH4A 3TSOA 1OIXA 4M8NE 4NZYA 1G3MA 4HAXA 1L4UA 1MABA 1KSGA 3GLIE 2FFHA 3GJ6A 2BBTA 5F9FA 1N0VC 2CEAA 5BYJA 4Y0AA 2ZSBA 1G8HA 2WMNB 3RRNA 3WHLA 1E9CA 1UBFA 1ZCBA 5HCIA 4BLQA 4KVGA 2JLVA 3QKRB 1ELOA 3K0FB 3EPHA 2QT1A 3GLIB 2JLWA 4TYNA 3O47A 4KLNA 3B5JA 2ANCA 2W2XA 1ZINA 2BMJA 4P4TA 2BKUA 2GEDA 4F4IA 3KTAA 4A2QA 3TJZA 1DPFA 3GFOA 4TMXA 1QHIA 3RSOA 1IY1A 3FMOB 3K9HA 4Q21A 5DYGA 1RPZA 4NCHA 4PHGA 4RD3A 3DO6A 2QM7A 1SVKA 1NN1A 2B8TA 2J0VA 2VBCA 5JHHB 5JRJA 1A2KC 1OB5A 4DCNA 5DISB 3B2EA 3VR4A 1YZQA 2QA5A 2AWNA 4KFTA 1X1SA 3SJAA 5FL3A 3Q7PA 4QXAA 1ZM7A 4TTPA 3R20A 4HAUA 5HZKA 4IFEA 1OJLA 4M21A 3CNNA 4QRHA 2V3CC 3Q5EA 3TUZC 1Z07A 1G18A 4Q4LA 4JLJA 5FBLB 1VMAA 3KJEA 2PZFA 3OIWA 1Q20A 4LJ9A 4TMTA 2B21A 1E79D 1RC8A 1HUQA 4G5QA 4JKYA 2V55B 3AVOA 5J4VA 2UZ3A 4NYMR 2B8WA 2OV2A 1P9NA 1EWQA 1DARA 4EPXA 1GOTA 1U81A 4GZLA 2ZVQX 2KJQA 3MG9A 5DN6D 2RGGA 4M9QA 2CHVA 3A1SA 2AFIE 1TF5A 3BJIC 1E2PA 2MMGA 2ZITA 5AUPB 3FB4A 3CR7A 2VSFA 1TAGA 5FOWA 3VR3A 4A6XA 4UKDA 1QHXA 2OFXA 3X1YA 3ZVMA 2RGNA 1G21E 3LX5A 4DLVA 3FFBA 5FPSA 1TMKA 3NDPA 4Q1DA 5DI3A 2GZHA 3QSYA 1CR4A 3UG6A 4BUJA 3C7KA 2DWPA 1KK0A 3SBDA 4C4PA 5TXGA 1OH7A 3EX7C 4IVRA 2VP9A 4Q66C 1P3JA 2J46A 4EFLA 1VG0B 4HUQB 2FPMA 3L0IB 4ILEA 5DI9A 4IDOA 5AJVB 3ND9A 3GLHB 4Q18A 2Q6TA 1QHGA 5CB8A 4K81B 3VR6A 3PUZA 2GILA 4M2LA 1JR3E 2X19A 1W4RA 1YZKA 2N1BA 1OXXK 4WVFA 4ITRC 1U0LA 3H2YA 1OV4A 1COWD 3GFPA 2WJJA 4M1WA 4A92A 3REGA 2H16A 4LC0A 4BASA 1WBBA 2WWWA 2MSEB 4TYWA 2MSDB 4B44A 1E9SA 1NMZA 2QUZA 4B32A 2QL6A 2ZRPA 1W0KD 3TLXA 3IEUA 3WNCA 1KK2A 1ZBDA 3LWNA 2NPFA 4ERNA 4B71A 1OFHA 4ASUD 4D0LB 2BKEA 2B92A 5A0FA 2BVNA 3AGPA 5IHPA 5DNYB 1VCNA 1L8QA 1QHYA 1TEXA 3BIFA 1KAOA 2VP0A 2BMEA 4TLBA 4HLCA 1ESNA 4A0HA 2ZI3A 4EQ6B 1GP2A 2O8DB 4CVNA 1NNEA 1IY0A 1W2GA 1S1CA 3ZQ6A 3LXXA 1VCIA 4DLZA 4GNKA 1XPOA 4XIGS 2OBLA 3T5GA 4LYHA 4UNQA 1II8B 3B8HA 4PHTA 3B1VA 3TVDA 2EFGA 4TZ0A 1UF9A 1Z2AA 4N1AA 2BEJA 2J1LA 2REXB 4TWZA 4LJ7A 3SR0A 4PC1A 5FTKA 2FFQA 2BMFA 1I4TD 4IJMA 4PZYA 2P6UA 2GXQA 5KPJA 1NJFA 1P2UA 2PH1A 4Q00A 1CRQA 4DCUA 2HCBA 2VP6A 5GJWC 4OK5A 4DDWA 5HKKD 1Q1BA 1QDEA 2JIZD 4WW0A 5EE1A 2KSQA 4YMUA 5JJIA 3BK7A 3K0EA 2RKOA 4C2UA 1SHZA 3WMFA 5FUVA 5E7IA 2RAPA 4E07A 4W7SA 3FKSD 1Z0FA 1J2JA 2ZAOA 3RANA 2ZPTX 1DO0A 1TU3A 2FWRA 3O8RA 2ZSAA 3IEVA 1AGRA 2RB4A 4LHVA 1I2MA 2IW3A 2Q9BA 2ZI4A 3FFAA 2YVUA 3K0AB 4O25A 3TE6A 2MSCB 4P33A 5KNDA 2V4ZA 4PFSA 3W9YA 2FFBA 4DBLC 3S1AA 4UJ5A 2OZEA 4YDSA 5EE9A 1ZM2A 3OHMA 3L2OB 3TH5A 1CKEA 1Z6YA 4NMMA 3IKJA 5F3WB 1MKYA 2KI5A 4DLXA 3I73A 3L82B 2FZ4A 2IF0A 2JASA 3U5ZB 2CLDX 1W36C 2IXFA 2XOKD 4MKIA 2F9LA 2V54A 3U3RA 3ZGXA 2ZEJA 1M2OB 4PR0A 1OXVA 3GEEA 2FGKA 1SULA 4DWJA 4DLWA 1ZIOA 4B75A 3RS2A 1RFLA 1I4DD 4N3NA 3CM0A 4EPWA 1NY5A 2ZRCA 3QXXA 2WKRA 1WDTA 3WYGA 3AM1A 5JMTA 1BYUA 2IYLD 2W00A 3AVTA 5JJKA 4Z51A 3NVAA 2QPTA 4IXNA 4BEJA 2GXAA 2YOGA 2XX3A 4C0JA 3RABA 3O8DA 4PXAA 4HI0E 5EE3A 1ZM3A 1AS2A 3OE7A 4KITB 3U6KA 2JATA 3KTAB 2F55A 1N6HA 1R5OA 4Q01A 1IQPA 1AK2A 4OK6A 1R7RA 4ZDWA 1G4AE 3Q7QA 4E09A 2OXRA 2OEPA 2HV8A 1G7TA 1N5JA 2NPIA 4LBWA 4MRNA 1JI0A 4DIEA 1NSTA 1IN4A 3UATA 5C4GB 2RHMA 4IDQA 5JEEA 3BB4A 4EFMA 2AN9A 1X8LA 4N0DA 4I1OA 3TIFA 4RZXA 2Q9AA 3PITA 4U5XA 3F3YA 3DM9B 1J8YF 4MYHA 4BECA 1OF1A 4TMWA 3VX3A 1EWRA 4BZPA 1WMSA 3B85A 3H84A 3OAAA 1EG7A 3W5JA 4FCWA 2J0QA 1ZUIA 2GNOA 1IJFA 3IUYA 4JLKA 1G8FA 1M7BA 2BCJQ 2ZJYA 2KE5A 5KHOC 3F8TA 2BV3A 2G9NA 1N2CE 3LQQA 5AK0A 3LQRA 2ZU0C 1E3MA 3MLEA 2VHQA 3IQXA 3ND8A 3B1YA 4P4SB 1EFRD 1OFIA 1OKKD 4BZQA 4LV8B 3KFXA 3NHAA 1DS6A 5KSYA 1KK1A 2QAGB 3GMTA 2J7KA 2W6JD 3SE0A 4MRRA 3KQKA 5HE8A 1XXHE 1CJVC 2IS2A 2GBLC 1DAHA 3U60B 1TEVA 2DY1A 2A2ZA 2R62A 2GKSA 5BN5A 4AY2A 3GLHA 4G5RA 1E2QA 1W4CA 4HAZA 2WBLC 2QQEA 2FSIA 2FEOA 1LVGA 1FP7A 1OW3B 3TNFA 2ZJAA 1KMQA 1Z47A 5GVRA 1XTJA 1E0JA 3QENA 1BMFD 3LBHA 4LHWA 4W5JA 2P3SA 5DGXA 2FMXA 5FOVA 5CDFA 4WZAE 1SXJD 2D62A 2Z83A 4UNRA 1SVOA 5JWRA 1ODFA 1E2LA 3HR8A 3I8SA 3TSZA 5L3SB 1Z0AA 2BBSA 3KL4A 4TTQA 5FPYA 2V1XA 1F2TA 1GRRA 4PSVA 3RRZA 1XPUA 1U9IA 1DO2A 2NO6A 2QSYA 2HLDA 2FFAA 3VQTA 4KHZA 3RWMB 4XVRA 1XMJA 1OFTA 2GZAA 4M1OA 2IEZA 4ACAA 3NG1A 4B3DA 4Z54A 5FPHA 1M6NA 4H9GA 1AJEA 2ZI6A 2FJUA 4D81A 1HA3A 2C95A 3U7EB 2P0EA 3RRYA 5E7MA 3NKVA 2ZM5A 4Q7KA 3J81k 1E9EA 5FR1A 1JECA 4NPHA 3E70C 2ZE5A 1P2VA 1RRFA 3TW8B 1JR3A 1XEFA 3OFND 2R6CA 2WJGA 3BORA 1UM8A 3NC1C 1HYQA 1XD2A 4OHZA 4MGYR 3SBEA 4LGMA 5KNBA 3CB4A 3VKWA 3UANA 1G7SA 3HYTA 3A1VA 4HAWA 1GNRA 4LBZA 4Q7JB 3H4MA 1DAMA 3P20A 2VLIA 3VU9A 3U6BA 2BHRA 2IL1A 3NEJA 4GT1A 4CW7A 4JS0A 4Q4HA 2O8FA 3ZIAA 3BFVA 4XJXA 5FOTA 1R0ZA 1QHNA 4B47A 4BGDA 2JLYA 4D25A 3U44A 4GFDA 1JALA 2PX0A 1G3QA 1LW7A 4DRZA 2WSSA 2XNDA 5CJPA 1KSJA 1I4LD 4C3ZA 4NYJQ 5G41A 1FNNA 4JYCA 2NO7A 4D0GA 5HKKA 3SHWA 4II7A 2HCJB 3R9WA 1KAGA 3KKOA 5M04A 4DVGA 1W49A 4MA4A 1FL9A 4TL6A 4A0GA 2G0NA 2AKAB 4JBXA 3THWA 2IUUA 1CIPA 3AF1A 2QMUA 2WOJA 2ZJ2A 4D4JA 2E1RA 1DAFA 2A7QA 3QKSB 4QM7A 3M4YA 3WBKA 4NYMQ 5J4HA 1G1MA 1Z8FA 5C46F 1KI1A 4C0AC 1YRAA 3KXLA 4G3XA 2NIPA 3NXSA 4ZDJA 2QNRA 1P6XA 3GJ8A 3QPWA 4Q03A 4XOIA 3SJBA 4W9MC 1T3LA 2R6GA 1G64A 1TUIA 5KSZA 2ZRKA 3THOA 4BLPA 4JLVA 3LD9A 4OI2A 4IEEA 1YZUA 3GJ5A 3TW4A 3VFDA 1N6PA 3K0AA 3AVWA 4I99A 3UXMA 5AR1A 1TF7A 4LZZA 3QXSA 2FH5B 4KAXA 1EX6A 2ZI7A 2H8KA 3CWZA 3I5XA 5A4JA 4UNSA 4HLDA 4R9UC 1K5GA 3W6OA 2X8AA 2XTZA 3R8CA 2EYQA 4TMVA 1X86B 1L2TA 1VYVA 4TLCA 1N0WA 4BFXA 2EYUA 1MO5A 3IGFA 5E3HA 2RGBA 2GCOA 5KUTA 4G01B 4XSHA 1G5RA 1TQ4A 3AF2A 2HYIC 1VPLA 3SU8A 2ZXUA 2C9YA 1WQ1R 4TQAA 5E7JA 2GA8A 4BFVA 2PZEA 4JVMA 4LPSA 4Y0VA 2LCFA 2W6JA 1E2NA 3CF0A 1KHTA 1W0JA 3P1JA 4O0MA 1OHHD 4Q7LA 1E2HA 4P0TA 2DCUA 1Z28A 1DG1G 3D8BA 1XZQA 4Z8YA 4GRAA 5JRZA 3RDPA 1FX0B 1L4YA 5AUQA 1FPMA 1PLJA 2IYRA 1A7JA 4HATA 4S35A 3O8BA 4R98A 3VMFA 1XF9A 3CNOA 3TAHA 1NMYA 4AYXA 2VSXA 4OQNA 4LUCA 1DAGA 3T06B 2XNSA 2F3RA 1JQLB 2D2EA 5JHGB 4X8MA 1Q1EA 2TMKA 4L5BA 4P4SA 2IHYA 5L8VA 4D4LA 5FUXA 2GAOA 2VSOA 4JL6A 1XMIA 2VHUA 3MRSA 3I8XA 2ZE7A 2QPAA 4N0EA 1XEXB 4UXHA 1SVIA 3V4FA 5AUNB 3SQWA 1QVRA 1ZIPA 2YYZA 5FPKA 4R7ZA 2JLUA 3PIRA 5HR5A 2AD5A 2HEIA 1R4AA 2AKYA 3V00A 3AGQA 1GKUB 1M7HA 4M1MA 4NYIQ 3WP0A 3I3SR 1GL7A 3W6PA 1YQTA 3A4LA 3WHKA 1NBMD 2ZUBA 2Z6VA 4DIDA 4QBHA 2HT1A 1YR6A 4BLSA 1XXHB 1Q12A 3KQLA 2A30A 5AJYA 4AWXA 2P5SA 1W36D 3AP1A 4UNPA 1E79A 3EWSA 4IFBA 2ODEA 3EZ6A 3B6EA 1B0UA 2PMKA 3K0CC 5SZKB 3MWJA 4RVCA 5L3SA 2YKGA 5FUWA 4XWAA 1UFQA 4Q9LA 2OILA 2CK3D 2NG1A 4TN1A 2J0SA 4OI4A 1ZVQA 3EXAA 2XZLA 2C5LA 1ZNXA 1CR2A 1XJQA 1TU4A 3AUYA 1E0AA 2EFHB 2ZREA 4URYR 1XX6A 3QVUA 1Z5ZA 2C9CA 3FMPB 1KI6A 1PVOA 1VG1A 4TYQA 4DJTA 1P7CA 4URVR 2WWGA 2PZGA 1G5PA 2Q0HA 1DVRA 1NLYA 3C16C 1NIPA 4Z1MA 4LWZA 1KDRA 1X3SA 3QPUA 4RD0A 2OUKA 3DHWC 3F5FA 1KDTA 3L8YA 4TSFA 2ECKA 2RGDA 3M1IA 2AXNA 3AP2A 1HURA 2CCGA 2IUTA 4L16A 5DHAA 5K8LA 1W46A 1P62B 3RSLA 1LF5A 4PSKA 3HPQA 4JLPA 4DB2A 2WAXA 2WWHA 3KUCA 5FTJA 4PTLA 1BYIA 3KXKA 3JZAA 2P6RA 4MKHA 2BJVA 4TQUS 4QBFA 3HDTA 5IRCD 3OZXA 4CEIA 5JJLA 3ETLA 1KO1A 2R6AA 2RGCA 3B7GA 2RGNC 1QBKC 1A1VA 1YR9A 4DDVA 2ZR9A 1UKYA 1Z06A 2YOFA 2QE7D 5JEDA 4XD7D 1E0SA 2VPPA 4TZ6A 2DYKA 1RW4A 3CRQA 1UDXA 5J4LA 4PQFA 3U7GA 3KQNA 1Z6AA 3RC8A 3LRPA 2HF8A 1Z22A 1T0JB 1SXJB 4EPTA 4YDHB 4P4UA 4GPTA 1ZUNB 1S9DA 4KCGA 1Q22A 2FSFA 3C41J 4LJAA 4MGKR 4V0KA 4F38A 3U7HB 3MWYW 5JI3E 3W8NA 3UPUA 3AVUA 3EA0A 2GTPA 3L43A 2OHFA 1AZSC 2QGNA 4IOJA 2ZIAA 5FBQB 3RS0A 4EIWA 1MV5A 3PV0A 4ARZA 1FTSA 1GTVA 4JT4A 4Q19A 3U4QA 2J59A 4BLTA 4KI0A 4FIDA 5KSPA 4JL8A 4ASUA 2JDIA 5BN3A 2BEKA 2JLRA 1R10A 4BFUA 4AG5A 1BOFA 5H68A 2C96A 4EQ6A 5BW8A 1GKYA 2PX3A 3AKYA 4RKEA 3THWB 5LDDC 4KU4A 2YHSA 2L0XA 1VKJA 1DELA 4FWIB 5UKDA 1U94A 3FMIA 4GMDA 5EUQB 1LTQA 4QHYA 3DOFA 4CEJB 1RE0A 3CBQA 3AVYA 4DCTA 3T15A 3LW8A 3ZDQA 4PPGA 3AF3A 5D3QA 2NMVA 4BFTA 3ZVNA 3X1WA 3E1SA 3T1TA 1JAIA 4L8GA 3TBKA 3CPHA 4A0RA 2GCOB 2QZ4A 4OK3A 4C0SA 5SZHB 2FG5A 3IIJA 4Q4JA 1KKLA 4ESHA 4LV6A 1OYYA 1E9FA 2AWOA 3P27A 5CJ2A 4WZBE 5C18A 4WIAA 5LD2C 3PR1A 1KNQA 1XP8A 4FMCB 2BM0A 3TR5A 2GXSA 2WICA 3BS4A 4D0NA 2WWIA 1FQKA 3KKMA 2PCLA 2IS1A 3HWSA 4Q1AA 3CZPA 5BWMA 4GSYA 2AL7A 3ADDA 1YU9A 4B43A 3L0PA 5G3ZA 2QPOA 3REFA 2WKQA 1K5DA 2NOAA 2OAQ1 4KODA 3A4NA 4MITA 3UWOA 4DEYA 1IY2A 4Q47A 4RZUA 5EZ6B 1A2BA 2G77B 2VP4A 2HF9A 3RVBA 3RWOA 3WYFA 4LY6A 5B57C 1GL6A 2EU8A 1FMLA 2CVFA 1NVVQ 2W6IA 3B13B 3ICEA 2F1IA 2PEYA 1P4SA 2K5UA 3MD0A 3QF7A 5FI0B 4HEJA 3CPJB 4JBYA 2IS6A 2IBMA 1GG2A 3I61A 2PBRA 4MUAA 3Q9LA 3MUFA 1EFTA 4IVPA 2O8DA 4HB0A 1RVDA 2F43A 4Q02A 3F0TA 4WOPA 1IXSB 4CZ2A 1KI9A 2BBOA 3AF4A 1ZAKA 1E69A 2WOOA 3OIYA 1PUJA 4AKGA 1YKSA 3ZJYA 4JYBA 3W8RA 4AYTA 2QMHA 4F4JA 3WMGA 3ADBA 5B30A 3BE4A 2ZRFA 2PJRA 4M1SA 3K70B 3QF4A 1T5IA 3AF0A 2IC5A 1IXZA 2J5XA 1XRJA 2X2FA 2QSZA 3L0SA 4EDHA 4IHQA 1H65A 3ZIAD 2HT6A 3B1WA 4TLDA 3NHBA 2OO7A 3DL0A 2FSGA 3CO5A 2HDNB 2OCPA 4AG6A 3DDCA 4AKIA 2H7VA 3DKPA 1MT0A 1SKYE 1T3SA 2J41A 2XTMA 2EFEB 1U0HC 5CM8B 5J4YA 5GADl 1FQJA 3JVUA 4DLRA 4QHSA 4PC2A 3N70A 1R8QA 4KV9A 2ZI9A 4A8JC 1R5NA 2XJ9A 1W48A 1O87A 2NGRA 4NBSA 3SJCA 4A0FA 4KYUA 5FTNA 1F5NA 5HZHA 3HU2A 3BH6A 2ZROA 4ABYA 4KFRA 4BFWA 1N5IA 4Q9HA 1OPXA 1W44A 2CJWA 4JVSB 1SKYB 2CCKA 1CEEA 3ICQB 1A82A 3K09A 4RZ3A 3IBYA 4C0QC 2GJKA 1U2RA 4JSTA 2XZOA 4B3GA 5L3QA 2C99A 1FOEB 2A5YB 3BFXA 1WF3A 2QAGA 4I1VA 1RRPA 4AURA 3V4RA 3B9PA 4XTRA 1D6JA 4A9AA 4RFSB 4R2IA 1UBGA 2FOLA 1D2MA 2YC4C 2OCAA 4NHOA 2VP5A 2ZRLA 1PJRA 1UBEA 1OT3A 3B82A 1VIAA 1ZCAA 4LJYA 2VF8A 3EC2A 1PZNA 2F1RA 1D2EA 4LOAA 4LV5B 5IK2D 1ZW6A 4TL7A 2RH5A 1NN3A 3NBZC 4MH0R 3DMNA 4US2R 1G291 5B64A 1MRSA 1TQ2A 1ZNZA 3K9LA 2E9SA 2QORA 1XCPA 4G5GA 2XEXA 4JT2A 3WNBA 4JLAA 5L3VA 2C2HA 3A36A 1IAQA 2DFLA 3TUJC 4ZI3A 4LYFA 4MRVA 1XJCA 2OT3B 2VTKA 1AGPA 3KB1A 3LXRA 1KGDA 4B3XA 3QQ5A 2FNAA 1DAEA 2P65A 2VA8A 2GAAA 3PENA 3LY5A 1YRBA 3QNUA 4IEIA 4NL4H 3T1VA 2RHDA 3KJGA 2NQ2C 3U2QA 1VIYA 5FL7A 1FMJA 3B60A 4EKDA 4Z1MD 3RRMA 1BKDR 4KSBA 2R8RA 2F43B 3N5CA 3KUDA 1G7RA 4QNMA 2JJ8A 4TYYA 2NO1A 5J47A 2O0KA 1ZUHA 4C0BA 4A2PA 1N5KA 2Z0MA 2IWHA 1A4RA 1KJYA 4OHWA 1XJ0A 4YONB 1G3RA 2H92A 2WSMA 3QKRA 4Q7MB 3W90A 4FN5A 3EZ7A 1JBKA 4RD2A 2FN4A 5JWHA 1R0YA 3CH4B 1G41A 4GDFA 4Q48A 4KFUA 1SQ5A 3QF4B 4TMKA 5P21A 3ZLJA 3LLMA 5HPYB 3QEJA 3PQCA 1FW6A 4QM6A 2VP2A 5JFGA 1RJ9A 1E2JA 1MRNA 2ZQ5A 1E1RA 3AVXA 4M9ZA 1JQJC 2DPXA 1E32A 4DC9A 1IBRA 1HEIA 4QGFA 2J7PD 5KSOA 1E99A 1S96A 1NG9A 3OE7D 1KY3A 2WJIA 2XSZA 1P9RA 3ADKA 5JECA 3IO5A 4JLNA 1KO5A 4HB3A 4OJKA 1W4BA 3RS3A 4LJ4A 5TMPA 2ZANA 4RSGA 2H18A 4PANA 2ANBA 1J99A 4L9WA 4MUBA 1DAKA 3HU1A 1TF2A 1N3BA 4CEHA 3W34A 3GLGE 1XD8A 1W7AA 2V1UA 2QTVB 5FBRB 3BXZA 2YV5A 2PLFA 1G4UR 1G19A 1J8MF 2OE2A 1MO3A 4AYWA 4B2IA 3VNVA 2QRNA 1CULC 2IHBA 2VYFA 3UIEA 3U3OA 2B7BA 5F9HA 4CRWB 2QRZA 1ETUA 4BFYA 4NCKA 1LY1A 2QMOA 1MABB 3NBFA 5TARA 1NBME 3VAAA 1XTSA 3IILA 1ZMXA 2H5EA 2VHCA 3FE2A 3MWLA 1E2EA 1GRQA 3ECCA 4NCNA 2WM9B 3ZQJA 1OSNA 1M8PA 1O3YA 1SXJE 2P67A 3T1OA 1JR6A 1IXRC 1N6LA 2AK2A 4OHVA 4FCVA 2O8BA 2ZJZA 4A15A 3C5HA 2DWOA 2WSSD 5DO9A 3K0SA 2AD1A 3A6PC 1WRBA 5KNCA 1WA5A 3KB2A 3PUXA 4DKXA 1Z0DA 2ZRBA 2Z4RA 3BB1A 1QVAA 2DWQA 5DE3A 1CP2A 1GILA 1G3UA 2P5TB 1KK3A 4JSYA 3EASA 1YVDA 1KSFX 2AHOA 2IXGA 4MYCA 4KBFA 5JCPA 5TDHA 5KYKA 2ODBA 2Q3FA 2GHIA 1Z29A 3LV8A 4RCZA 4B76A 3RAPR 3FHCB 1T0HB 3QKUA 2YJTD 1XMVA 1KSHA 4PHFA 3U7FB 1DAIA 3D7MA 2FU5C 1E9BA 4Q4HB 1TTTA 2CLCX 4V0ME 2O8FB 3CH5A 1G8PA 3KJHA 4LHXA 1C9KA 4A1FA 4X8OA 4M1YA 4LBYA 3U44B 3KZ1E 2PT5A 1G16A 2DFNA 5IK2A 1SHKA 5FTLA 1E4VA 5K8TA 3L0OA 4D80A 3FWYA 421PA 5C1BA 5H8WA 1XEWX 4M0LA 1NP6A 3PCRB 1Q1QA 5J4KA 4QKQA 4J0QA 4JBWA 5FFMA 2BJWA 4R71A 2CJWB 2OG2A 2ONJA 3ZD6A 4QBGB 1AIPA 2FF7A 3GJ4A 3KDSE 4RY2A 4XTCS 4ZIRB 3FDIA 1ZC3A 2OFOA 2V8OA 3NEYA 1VHLA 2W83A 1E9RA 3LO5A 2IYVA 2VRWA 5J5CA 3G5UA 2WTUA 4F7WA 4EJSC 2ZR0A 3ONWA 3AEZA 1CBUA 2PT7A 3TVTA 4BLOA 2RGEA 2FE4A 4B34A 4DXAA 2R65A 3DKVA 3DM5A 4QGHA 4H1VA 2QP4A 1U90A 3LX8A 2QTHA 1KMHA 4WBSA 3B78A 2DBYA 1LS6A 2IYSA 3D31A 1NN5A 4QL3A 1RKBA 4Q1BA 5BN4A 3X1ZA 2D7CA 2ONKA 4PPQA 1COWA 3LLUA 1AS0A 5K8UA 5KDOA 4F4CA 3A1WA 4LPKA 1S4QA 1AN0A 1LV7A 3THXB 1P2TA 2FSHA 2OSBA 3PJRA 2XITA 4W5WA 4ZO4A 1NLFA 3U61B 5TY0A 4EPYA 4W5HA 2JJ1D 2IS4A 1VDZA 5EXPA 2YWFA 1Z0JA 3CX8A 4POAA 5C4MA 3CX6A 1W36B 3EPKA 2W2VA 3VR5A 4DSNA 3UMRA 4QBIA 1SZPA 2P2LA 2XB2A 1VYTA 2QN6A 4TQ9A 2HXSA 3UWKA 5LD2B 2PEZA 3W3AA 4XSGA 4QJ5A 3CF6R 3X1XA 5J40A 2CNWD 1FX0A 3LDAA 3MGCA 3E2IA 4BZXA 3HR7A 3LVQE 3BBPA 4JLBA 4RFVA 4URWR 5FI1B 1ZU4A 3AH8A 2WJYA 5BYKA 4EAQA 4ZI2A 4V0MA 2CBZA 3TKLA 1GWNA 3IQWA 4FI3C 2ZAMA 4Q9JA 5KTYA 1ESMA 1M7GA 1R2QA 3QVVA 2YWHA 2P6NA 3H86A 4XH9B 2ORIA 4A8JA 1XFAA 1Y63A 4JJKA 3WY9A 1OIWA 1Y3AA 1F2UB 1NRJB 4ESVA 4A36A 1JAHA 3TMKA 5JS7A 4PPFA 4HSEA 2D3WA 4KYIB 3LVRE 1CXZA 4E5UA 4XWOA 1NSFA 5KDLA 3FHOA 1IM2A 1BMFA 3OEHA 3B1XA 1VECA 1CRPA 2QE7A 3BH0A 4V0LA 2GJ9A 3GPLA 2FA9A 4PX9A 2A3RA 1LF0A 3BERA 5FOXA 1NMXA 4B33A 2WMOB 1WB9A 5JSZB 4B3CA 2CNWA 1EX7A 3PUWA 4IRUB 1J70A 1OFUX 3GFTA 2CMKA 3QBVA 5BXQC 2OCBA 2BMDA 2W2TA 4Q1FA 4AIIA 3H0KA 3PFIA 4DDTA 2ATXA 2N42A 4PO1A 4QNRA 4DSOA 3EIEA 3BFKA 2JLXA 3EZFA 2GEUA 2GJ8A 3CRVA 4I1UA 1W1WA 1KO4A 3QY0A 2O0HA 1OH5A 2BCGY 2ZYUX 3K70C 5E4FA 4TL8A 4DHEA 1TQDA 3IDQA 3KFVA 1GM5A 3QXHA 4ARZB 3U4QB 4TSFD 1RYFA 5G40A 2ZE8A 2WWYA 1CF4A 1H8ED 1KI6B 2YWGA 3GEIA 3TUIC 121PA 3DZDA 5CITA 3WNDA 1AKEA 4LK2A 2QP3A 5DSZA 3CR8A 3AVPA 2JDID 4D2IA 1XBTA 1ZU5A 4F93B 4NDZA 3S1AB 2GVZC 3FKSA 4ZCIA 5DHFA 1M74A 3M0EA 4PQRA 1DOAA 4B2LA 2OBMA 2QGZA 2CK3A 8OHMA 4HDOB 4GMXA 4MYUA 4DLSA 4OHXA 2CL0X 3MFYA 5EXXA 5EXSA 2J0UA 4HZUA 1KZ7B 2J45A 5CK4A 3PEYA 4B3BA 4M9XA 1G20E 4DDUA 3UMSA 4MGIR 2I1QA 2ZS9A 1CR1A 2C98A 1BS1A 3ASZA 2IUSA 1NVWQ 2HYDA 4IOMA 1E6CA 521PA 3SFVA 3SJZA 5JZVA 2N46A 4DSTA 3NBYC 4B73A 3ZZUA 4DSUA 1VTKA 4JLOA 1NVUQ 2HJGA 2ODWA 4UXIA 2O8CB 2O8EA 4CDGA 3K53A 2OFWA 2JLZA 4PO9A 1KDOA 3W5IA 1S2MA 2D2FA 3N2EA 5SZJA 3MCAA 1UEJA 3C14C 1D9ZA 4L4UA 4EPVA 4OJQA 2E87A 1VCOA 1SXJA 3VTKA 5JCZA 1UBCA 3UG7A 3CF2A 1BIFA 1CJMA 4PAMA 4V0OA 3JVVA 5CDFE 1Q21A 4C0KA 2ZTSA 1NVXQ 2B6HA 4OBEA 2XNDD 5CM9C 3SI7A 4WA7A 4YXWD 1A5TA 1OXTA 1QF9A 1DTSA 1U8AA 2H1LA 2IK8A 3QOFA 1GITA 4HZIA 3CONA 2RGXA 1DBSA 1Q3HA 3BGWA 4WXPA 4GOJA 1FP6A 2GZDA 4GL2A 4PC6A 3LNCA 3BAFA 1AA9A 4KXFB 4LSGA 4XWKA 4NCIA 3SDZA 3GJ3A 4BFZA 1U8ZA 1WP9A 1NF3A 1N6IA 1T6NA 4G0NA 5GJBA 4D82A 3EIQA 3DEFA 1E1QA 4CF7A 2C03A 3DMDA 3VNUA 3GCGA 2R9VA 2WIBA 3T61A 2LKCA 3GLFB 2WWXA 4RZ2A 1YJ5A 3PUYA 821PA 3NTUA 4HB2A 5CYPA 1Z83A 3OAAD 2JLSA 4LHZA 2YINC 4Q4JB 1T3HA 3VR2A 2F3TA 2JAQA 4P31A 2A5FA 6Q21A 1KMHB 4CEIB 1JJVA 3FGNA 4NCJA 2ODNA 3FOZA 2ZYWX 3CIOA 2CE2X 4FMCF 4PZLA 3MMPA 1MOZA 5EP3A 1WBDA 4LHYA 4M53A 3SN6A 3EW9A 4MKFA 4QOSA 1UAAA 4K8OA 1EESA 1ZYUA 2ASEA 2F9MA 4RJLA 1N6KA 3LW7A 3SYLA 4P3YA 1U8YA 2V7QA 1K6MA 3ASYA 1ZJ6A 4NYJR 1R0WA 2HJVA 4ZV4A 4OI0A 2ZYTX 5HTKA 1KI3A 3LAWA 4C7OB 4QFMA 1BH2A 1Z6TA 2AR7A 2ERYA 4TMZA 4LYAA 5IDVA 2Z5FA 3ZVLA 1KO7A 2J7PA 1JJ7A 1LS1A 2GESA 4JLMA 1YZTA 3T12A 2PL3A 4JL5A 2CHGA 2WIAA 4A8JB 3QG1A 2D7DA 1KI4A 1W47A 2J0UB 3FKQA 4FD2A 1F2UA 3TGPA 5K8IA 1R8SA 1G6OA 2GCPA 2IYXA 1F6BA 1P2SA 1ANKA 1SVLA 1UKZA 1FTNA 2C8VA 2XOKA 3P4YA 4CT5A 2FPKA 5JWOA 2WAYA 3NC0C 1ZD9A 1Z2CA 2ZS8A 1S3GA 4RFSA 2B7CA 4UQOA 1LNZA 3CWQA 3AVQA 1RRCA 1J7KA 2CCJA 4BRUA 1DE0A 2G1KA 2ZJ8A 4PC7A 5KO2A 3MSXA 1E9AA 3WP1B 3QXJA 4BLRA 4US0R 4E22A 3MJHA 3EIHA 1IN7A 1D2NA 1ZP6A 2G1JA 2JLQA 4NH0A 1Z6XA 1NKSA 1B23P 2XXAB 1R5BA 4LCBA 2JJ2D 4PZZA 1KY2A 1ZRHA 5ELXA 2RMKA 1N5LA 1JR3D 1SVSA 1NLZA 1AQYA 1ONBA 3AB3A 1HQYE 1GNQA 2CL6X 1QHSA 4FW9A 4YXWA 1GFIA 3G82C 2WZQA 3RS5A 5CYOA 2REBA 3NH9A 3C15C 3CPEA 3IPXA 4PSAA 4XVQA 2XJ4A 2GDJA 3Q5DA 1G7CA 4GI7A 1VYUA 3GQBA 2V9PA 4O2LA 2FZLA 4IDNA 3X2SA 5CLQA 2QTFA 2HLDD 2F6RA 2KB0A 1VHTA 2J3EA 1X8KA 3RHFA 2IEYA 5F98A 3T5DA 1XTRA 4QGGA 2ZJOA 1P9WA 3B9QA 1OE0A 3QIAA 2J87A 3BWDD 4OI1A 1EFCA 1YHNA 5DYIA 4IDPA 2QM8A 2Q9CA 1F48A 4PHHA 5FOUA 2GK7A 2GJSA 4U00A 4HDCA 1CU1A 1F3OA 5JS8A 2QQ0A 2XB4A 1OXSC 4Q9IA 2ZJBA 4X8LA 2GK6A 2Q3HA 5H70A 2NO9A 4MGZR 4NP6A 4I81A 1N25A 2JA1A 1GKIA 2ZU6A 1YZLA 4NU0A 3DVLA 4FMDB 1JXMA 2DHRA 4JVLA 1FUKA 1YZNA 3PEVA 1UADA 1W5TA 4HZUB 4Q1CA 2GCNA 3NBXX 2KBFA 5EP2A 4BRWA 1P72A 1GUAA 4DLTA 4C2TA 1JPJA 1ZD1A 5EUMA 1Q44A 2NTYC 5IT5A 3G0HA 4HUQA 3JZMA 1FUUA 1D9XA 3BC1A 1EFRA 1UPTA 5KDDA 4M1TA 4JLDA 3SYKA 1SVMA 2QAJA 3BB3A 5TV2A 3ZVRA 5GJVC 1ZD8A 4LDJA 4LJ8A 3SHFA 3LFUA 4JIMA 2A9KA 2IYUA 2QG6A 2IYZA 1IJEA 2WVJA 3BD9A 3SEAA 3GLGB 1IN6A 4ZKEA 2ZSFA 3CUEF 4AKEA 3VKGA 1GNPA 4YMWA 2NZ8A 3VHXA 2ZRIA 3D3QA 4DZZA 2GETA 1UJ2A 1VG8A 3VHLB 2D74A 2QAGC 3TK1A 3K70D 2IWRA 1XNJA 4JVNA 4V03A 1TUEA 1UDWA 1XU4A 4LX0A 4KFSA 2ZRGA 4GOXA 2FV8A 4IW3B 1QG2A 1Q57A 3P4XA 4KBGA 3B1ZA 3ZZ0A 4ZCMA 2ZS7A 4MQBA 3PEUA 2ZUCA 1D5CA 2IA5A 4KVAA 3RLFA 1NVVR 1RJ9B 3I92A 3HU3A 3IO3A 4HDQB 3UKDA 1CJKC 3A4MA 4YQFA 3EC1A 3MWKA 3CKLA 4AI6A 4LC1A 2C77A 3EA5A 5EP4A 3EZ9A 2XXAA 1M1YE 5SZIA 4X8HA 5L3RA 1TPZA 1JB1A 3D6TB 4DB4A 1G8YA 2XZPA 1NG1A 3AKCA 3K0FA 4G5OA 4HAVA 1H8HA 1XD2B 4PAOA 2V7QD 3QG5A 3WBJA 5LBIA 2RGAA 2QT0A 3NIBA 1R6BX 3CRW1 1GAJA 4BE7B 2I3BA 1PLKA 2XAUA 2GJAA 4Q9KA 1WE2A 3K8YA 2W0SA 3CRMA 4ZKDA 2MMCA 3Q72A 2VIIA 3SNHA 2G3YA 3LBNA 4JJZA 1II9A 1UKVY 2WPDA 4ZCLA 5A5GA 3EPLA 1Z63A 2F1HA 3FTQA 5ANRB 3ZD7A 1XCGB 1SGWA 2O5VA 1OHHA 1PUIA 4A82A 1OYWA 1T9HA 5EE0A 4HAYA 4QJ3A 4Q4AA 1XDBA 1DADA 2QENA 2R6FA 4BEBA 1E1QD 2OLJA 3K9NA 1ZNWA 2X1VA 3THYA 3P32A 1HQCA 1L7VC 3WMEA 4M4SA 4O3MA 4US1R 5EZ5A 1TX4B 5BQ5A 2CDNA 3K1JA 3RS7A 3N2IA 5TB5A 4CIDA 4C7OA 4EUNA 2Z43A 3TQCA 2O8BB 5F2EA 2JJ1A 1W2HA 4QHTA 3QPVA 5EE5B 4A2WA 4BQSA 4B6EA 3OEED 3NDBB 4D26A 1ZM4A 1EFUA 5B58C 4RD4A 2VL7A 4TLAA 3P26A 2YWEA 2OAP1 2Q3MA 2W58A 4A6PA 4MRSA 2YC2C 1U98A 2GRJA 1N6RA 4B35A 1KJWA 4LJ6A 2OXCA 2IXEA 4HYYA 1PLLA 2GVDC 2A5DA 3U3KA 2ORVA 4UNNA 1EFHA 2BIFA 3UK6A 1KDPA 1P60A 1U9IC 2GWHA 2W0MA 5DN6A 3RC3A 2ZI5A 3Q85A 2PMDA 5EJEA 2J9RA 2WWFA 5AJZA 1NIJA 1XXHA 2ZYVX 2ZJ5A 4OQLA 4WXRA 4BPBA 4L15A 1X8JA 2EWWA 2CL7X 3GLHE 4QJ4A 5KPDA 1E98A 3EAQA 3T34A 2ZRMA 3GLFE 1AQUA 4UJ3A 1T8UA 3BOSA 2FPLA 5TVKA 2A78A 2OLKA 2GXUA 1IOZA 1W5SA 1ZNYA 1KNXA 2QROA 3QE0A 5FR2A 2G88A 2HXYA 1UEIA 5JBQA 1GDDA 1J90A 1KO8A 2X77A 4AK9A 4LI0A 4UXJA 2V6JA 5JI2E 1GIAA 1CJTC 3Q3JB 5D3MB 4GOKA 3VR1A 4HLUA 1WCV1 3R8FA 1RZ3A 1TADA 4AKHA 3WYAA 2H17A 2ATVA 1AS3A 3ZYCA 4JZKA 4RCYA 2PCJA 3OEEA 4FMDF 4DCSA 5CK5A 2I4IA 2AXPA 1JPNA 4FMBB 2LWIA 1CJUC 4DLYA 3I5YA 1JEEA 3OESA 2EFCB 1KOFA 1P75A 3GP8A 4G1UC 3MAAC 1T5LA 3GJ7A 1CTQA 5LB2A 3FPAA
chains in the Genus database with same CATH superfamily
1JXOA 1H8EA 1U0RA 3OVMA 5K03A 1PS9A 4M54A 4YMSA 3KOMA 4ZDIA 2RHHA 3ZXUB 5KHLB 2QXTA 2O2HA 1CUVA 1WM1A 2ZR7A 2ZE6A 4KLAA 3GDOA 3MJTA 3GH3A 1Y7PA 4XYMA 3K9QO 1IEVA 1XZPA 1D04A 1KEVA 5AVOA 1L6RA 1KZYC 2H5IA 3R4CA 3V4SA 1NW5A 3KYBA 4FJ2A 1ISSA 4YMHA 3OC6A 4QGAA 2RONA 1XCLA 3DZGA 3Q9NA 5KU1A 4IWXA 3SNKA 4IF4A 3QOXA 1II8A 3WSTA 2PSHA 1XKTA 3L9WA 4X66B 3QPAA 2OXEA 2BW0A 1ZC4A 1S9HA 4B6QA 2NYUA 4RL6A 4Q4AB 4UE2A 1NY6A 1WXQA 3AONB 3FFXA 5DLQC 3ZZTA 4EI2A 1SXJC 3CN7A 3FVQA 1PT5A 2A5JA 1VL6A 3CTMA 4PO3X 4UHFA 5JJCA 2O3QA 3BTUA 3UMFA 3TDMA 1JQ5A 3A1TA 4TT8A 1RJWA 2XDQA 3K1ZA 1S6YA 1PO7A 3FGOA 1HLDA 3HADA 5CDTA 1MLDA 1HTWA 4GH5A 3GXBA 2I3DA 2XCTB 2KBEA 1YDMA 1NXTA 3LY9A 1MVOA 3I4LA 3UO8B 1SXHA 3LY8A 1NBMA 3R7WA 1T1JA 3X2EA 3DBVO 1OI2A 4TLEA 5EHGA 1Q1AA 4YQEA 4BMZA 2FSPA 3DEIA 4RSRA 1TQ6A 3AHDA 1F2TB 3FYCA 3HYSA 4UPEA 4Z8XA 3MJFA 1KAQA 4PPNA 4OMUA 1TA0A 5CNKA 5EWLB 3SQOA 1C9JA 4IR7A 3G49A 3RRBA 3K1AB 4I5GA 1FZQA 5EQTA 5FNZA 1CZOA 1OBHA 1PJAA 2FPOA 3UJHA 3D8SA 1A2QA 4ZMBA 4CG0A 4X85A 2AQHA 3ROTA 3KX2A 3ZW7A 4ZALA 1ZONA 3KZCA 4YJGA 4EB3A 3IBGA 3MC1A 4RUKA 2O5EA 2B25A 2CNKA 4GWLA 3R3ZA 4LYJA 1I2DA 1TRHA 4HLQB 1E3JA 2VDJA 3SC2B 4HADA 4BKUA 1E5VA 1YE8A 1YR3A 2I87A 3CCCA 3GUUA 3KOXA 1F17A 2VAPA 1V5WA 3O90A 4XGIA 3REOA 5AVWA 2AFHE 2QDKA 1FP4B 4MPJA 4OQFA 5DYNA 3SDSA 3IEMA 2H3HA 3AVVA 1ZX1A 3OCVA 1BO6A 4JR1A 3SZ3A 3P9XA 1X9HA 3ZWPA 3UUEA 1G6HA 1RKQA 1VP9A 3VR5D 4EQZA 5IZCC 1LX6A 2EBHX 1DSSG 3OPYA 4P2BA 1K8ZB 4FD3A 4OYHA 4U02A 3VU9B 3ROPA 1B2LA 3AJEA 3NTLA 4IZHA 3U3JA 3SOPA 4BQOA 1OIVA 1E9DA 3PNPA 5FFFA 5B1IA 3WMXA 1E2GA 2L2QA 5SYAA 3W2IA 3CRRA 3KJZA 3EGXB 1FNMA 2NO0A 4OB7A 4PO8A 5FL7D 3QE3A 4QXPA 3U1TA 2RD2A 5ALJA 1UDRA 5IMBA 2R2GA 4LCEA 3LBIA 5JS2A 1E1CB 4TTRA 3U1VA 4HUTA 3PXCX 1SOVA 2RCNA 3ZV4A 4B40A 5C8YB 3QEBZ 1DWUA 5JMPA 2J31A 4NAVA 1ZGHA 4PGMA 2OCGA 3PXGA 3T5BA 2PBFA 2WYVA 4R3UC 1F8XA 5GTDA 2XCSB 4NDAA 4D4IA 4IIUA 4NBVA 3TI7A 2E5FA 2O0MA 4NXMB 3GDWA 3H9GA 1MB9A 1Z2PX 1YO6A 3C3PA 4GOOD 1C1YA 1GGMA 4A91A 4C6TA 3ADCA 1JEYB 1J0EA 2NZWA 1YNOA 2UZIR 3NYIA 4LJ5A 3RGGA 3DAGA 1G3IA 5FWYB 1WMFA 3UMCA 4OL0A 3B6JA 5HE9A 1RTKA 3W1VA 3VISA 1YA8A 4M9SA 1Z7BA 3GOQA 4MS4A 1JEDA 3TQQA 2OKCA 2PV0A 2CVQA 1IH8A 1E2FA 1DQSA 2VNIA 3GAAA 1T15A 5DWQA 2JGDB 3I32A 5ERXA 3K6SB 2PD3A 3AJDA 3E5HA 5CLFA 1UFKA 2JC3A 1GG8A 4IL5A 1CZHA 1Y3CE 3DEHA 3HL4A 1KTVA 4QQNA 2PD4A 4CUZA 2BDTA 1E64A 4G86A 4K6MA 2CLFB 3DWEX 3CO0S 3BWCA 1IZ0A 4QDJA 2HLHA 4PU0A 3MIZA 4ACBA 2FHSA 4CETA 4ZZIA 4RD6A 1BRTA 2JFOA 3M6WA 3RFCA 5M2QA 3BAZA 4OXRA 3IB3A 3A8TA 5L53A 1Z68A 4Y2YA 3HJHA 2B5OA 3FXAA 2CLOB 2PZKA 3GT7A 1NL3A 2I3GA 3WIBA 2I1VB 1STOA 4ALMA 2X9GA 4B81A 1PQWA 1YULA 2Y2UA 4PQGA 1OXUA 5DIFA 1YI8A 5CEFA 3IHWA 4DJ5X 1IWOA 1IMJA 1E6EA 2WJHA 3CU5A 1LJLA 1LLQA 3WLHA 1JLRA 5ALRA 2IYQA 2OL4A 5F35A 3R7WB 1Q0UA 1IN8A 1R9MA 3FUCA 4Z9YA 4YRLA 3NIDB 1QFYA 4BLVA 1KH3A 1MQ8B 5LQNA 1GTZA 2VBIA 2BM9A 3BXXA 3OE4A 4INOA 1B6TA 2CHFA 4QUBA 1WZNA 4M1EA 1VCMA 2EG9A 5C1DA 5LN1A 4QEKA 3WK8A 1SD1A 1C8KA 2XTAA 2FPIB 2NUPA 1WLYA 3H8VA 3N59A 4MW9A 3TLBA 3FNHA 3HFSA 3WA7A 1ZOIA 1XNHA 3NONA 3KEGA 1TNDA 4JUCA 1W5FA 1OAKA 1MIHA 4X6YA 4YAEA 5AJXA 4EY3A 2RH9B 3DF9A 2VVTA 5I3CA 5CYGA 2PZLA 3RT1A 2VF7A 2RC5A 3LA6A 3V4LA 3QWIA 3R7NA 4A03A 3EDYA 1T2AA 2GLUA 4I14A 4MYTA 4DUGD 5T57A 5CIQA 4NOLA 2SKEA 5KBYA 3DA8A 1G5QA 3EIWA 3U9LA 4RTKA 2CJXA 3E5MA 1P5ZB 3RT7A 4IIHA 1C2YA 2WE7A 1ST2A 4QOJA 1C8VB 4ZPXA 1Y1RA 4AD8A 4DT1A 2XUIA 3OO0A 5BW6B 1SVWA 1CUXA 3RKRA 7ADHA 3SCZA 4FEYA 3M6XA 5DT2A 1J2UA 4YMLA 1Y34E 1E96A 1Q6YA 1CYDA 2IV7A 4HDRB 1HDYA 2RG1A 1R0KA 1EXMA 3GMSA 1H8HD 1IQUA 1F9AA 1VRWA 4LRUA 4XB2A 3SVLA 2F1KA 3UMMA 1E1CA 1MV8A 2J07A 3KQUA 3R3XA 2QU8A 2ZRDA 3LX4A 2EG5A 4XUEA 5E3IA 1R0XA 3OTQA 1LZKA 1YB4A 4UREA 2W6ID 3DMHA 4GAEA 2YL2A 1QV7A 3W5BA 5JH7A 1KIMA 2IYWA 4AJ9A 4HLUC 4WHMA 3HRHA 2AZ4A 4Q7EA 2YQZA 2BDEA 3EARA 2ZUSA 4MAAA 5LYJA 5LQKA 3GQBB 1JYEA 2OMEA 3DQQA 5EKTA 4L4ZA 4OV6B 3T95A 2IPNA 1RFGE 1XEAA 1PZFA 3OZUA 2GBGA 3QPDA 4K46A 3DBOB 4CGZA 5U4QA 3PX7A 3T7DA 1LBEA 1ZM9A 2P91A 3X1DA 3UAVA 2GEVA 3VX4A 2QUBA 1Y3BE 2B34A 1X1BA 2GDZA 4I3HA 1PGPA 1H1LA 4D0SA 1YFKA 4O2RA 2W48A 4LJKA 3GUVA 5ALNA 3QU9A 3DLAA 2EL7A 4NR0A 2Q21A 1F7UA 1F20A 1RHRA 1E0KA 1CP3A 1E2DA 1WLSA 1CUEA 4PQYA 4R1UA 2Q4EA 3SJ7A 2GF0A 4KAFA 1Z4OA 3GLRA 4NENB 4E11A 2FDXA 3ND5A 3FI0A 3KALA 3ITDA 1DIHA 5DGHA 4DV0B 1W0JD 3DR5A 4FBLA 4HPWA 1BCRB 2ZIEA 1H2XA 1LLFA 3QKSA 5FJIA 2XMQA 3T7EA 2X4IA 4JDPA 4D6YA 5LU8A 3JQ8A 2EJUA 2WM3A 3Q3IA 5HFAA 2R96A 2HJHA 1ODJA 1WQ3A 2AXQA 4BX0A 5F21A 2PG3A 4BWYA 1G6KA 1E2IA 3BCRA 4BFSA 1LPBB 3QV2A 4DMKA 4KQKA 3AXSA 5FUYA 3HHEA 2HADA 5HRCA 1FCJA 4MOWA 4G67A 4URXR 1NBIA 2NADA 2OBNA 5T67A 3DTVB 2G25A 5CFQA 4DEXA 4REQA 3GC6A 5LA6B 2ZWPA 2FGJA 4PC3A 3RW9A 3TD6A 4P38A 2R5NA 3M33A 4PG7A 1QG4A 2YWRA 3FSEA 5DH9A 4GX0A 3T35A 2Q2VA 3ES9A 3OU2A 2W5UA 2YOHA 3IBSA 4HQNA 3BD7A 1UMKA 2MT9A 3ACBA 3HKCB 1G66A 5CB6A 3CVUA 4M86A 4AN0A 4PXYA 1NC3A 4PYMA 3HJNA 3KC2A 1L1EA 1VLHA 3G9ZA 3EDMA 3KSMA 4G26A 4R84A 2E7ZA 1P45A 3IP5A 2GUWA 2RCYA 6ABPA 1NSYA 3I9KA 5HJ7A 4OLJA 2O3JA 4Z86A 2GEJA 3FPGA 3R76A 4EJ0A 10MHA 4MLDA 1XTKA 5KCMA 2VOJA 2X5XA 2QVXX 3D43A 1FFHA 4FFSA 4ARSA 3NMUF 3KJIA 2P79A 4LX8A 3N87A 1UPFA 3FDZB 3RYCA 1M33A 2CXXA 2QG9A 2X9QA 3CUSA 5I51A 1XPRA 2H63A 2V5AA 1HY3A 1Q3TA 1QTRA 3E58A 3JYPA 1KAMA 3OT1A 4I46A 1XRQA 4PINA 4DFDA 4HAXA 4ER7A 1L4UA 1MABA 3G2MA 5CUQA 2FPRA 3GLIE 3INTA 3EULA 5IC5A 1OZ0A 3GJ6A 5BP7A 1N0VC 1XTVA 1UEXC 1WV1A 1ADJA 1PL6A 1QF6A 1CZLA 1JT9A 5A4FS 1V4BA 4Y0AA 2HU8A 3WYBA 3EFOA 1G59A 3FYTA 4EMUA 2WMNB 4JA2A 1V1RA 3H9QA 4Q3EA 1TVEA 1Z33A 3AI3A 3EIFA 1DAOA 2YJGA 3G0IA 5D3KA 4KQWA 2FKAA 3WHLA 1UBFA 2Q2WA 2YV4A 2AUMA 5ABPA 3H5OA 2QN7A 4MUMA 2R5WA 3QKRB 3G7SA 4LSZA 5C5IA 3SHTA 2JLWA 4HYQA 3B5JA 5IABA 1U8TA 1B3RA 2WDZA 3UJAA 1WHSA 3LVBA 4P4TA 2W2XA 2BMJA 4WOJA 3ZDDA 2C2WA 1E7YA 1X42A 2V03A 2DOKA 2C3OA 3L4BC 4H6PA 4NFSA 4A2QA 2Y99A 4R8LA 4TMXA 1WCYA 3JQPA 3PVZA 1IY1A 3S2FA 2FJPA 2VTBB 2UYCA 3USCS 4EO9A 2GYVA 4RD3A 4FYVA 3PQ3A 3WLAA 1IYZA 2H1IA 5JRJA 1JKJA 3T38A 1R3UA 3Q1KA 4GG1A 4YAWA 4DCNA 1I3LA 3VZPA 5H3LA 3DT8A 1AB5A 3ILHA 3BK2A 3TIGA 1RAGA 3KKLA 3ZCVA 2YJ3A 1YZQA 4J0CA 1F0PA 1V48A 1EZ4A 4FM9A 3Q7PA 2JLCA 3OCJA 3FCUB 3L0DA 3A6DA 2C3YA 3K8QA 2P77A 4QXAA 1ZM7A 3ZWNA 1TM7E 3PDIB 1SBZA 1P0PA 4X3PA 5THQA 3R20A 3KQVA 4IFEA 2H2AA 3DHVA 4NENA 1LPPA 2A0UA 4LI3X 3Q5EA 4QRHA 4Z2YA 4AMVA 5IEBA 2V3CC 3MT7A 1P1RA 5ED4A 4RENA 2FXVA 4R9NA 4N9QA 4WKBA 1E1NA 3VXKA 1FFAA 1VMAA 1QO7A 5CFOA 1U28A 1ZHHA 3OIWA 4WNIA 4ZC8A 3LT2A 4IMIB 1RM3A 4N7MA 4POOA 4G5QA 1GQ2A 4H4CA 4N8EA 4P81A 3ROKA 3ZIDA 4RNDB 2ZYSA 4B0PA 4UEQA 1SQSA 3M6LA 4FTWA 2CT8A 5EJ7A 1P1FA 4IFTA 4MHSA 2P2NA 1EGMB 4OHKA 4GZLA 5CVTA 2KJQA 1NPDA 2QTLA 3MG9A 4WDQA 2Q5EA 1KYTA 3IOEA 5EFOA 1KE2A 1JZSA 3T6KA 3ZD9A 5ALLA 1B14A 1HTTA 2AFIE 3BJIC 5AIBA 1GLGA 1EBBA 1A97A 3UT5B 4IIDA 4A6XA 2XVAA 4JUAA 4CF3A 1S89A 1QHXA 2I0FA 3C70A 3IQZA 3ZVMA 2IEBA 2ABWA 2DKOA 2H4HA 2VZEA 4WCFB 5FPSA 1TMKA 3GA5A 2HMWA 4PZEA 3EXG1 5DI3A 3ZE9A 3QSYA 4N0MA 3AEUA 2C54A 4KQ9A 3RTBA 4DWWA 4KDFA 3C7KA 2DWPA 3EWNA 4FMPA 4AJ4A 5JUWA 4RHFA 4IUYA 8ATCA 3EX7C 4G0MA 4RBNA 2EJWA 1B76A 4QOHA 5A0VA 1ADGA 2XH8A 3QLUA 2DULA 1W73A 2HHLA 3O4RA 4HUQB 1U7DA 4MYSA 4KR9A 3VTZA 5CFNA 3HVRA 4ILEA 5DI9A 4IDOA 3VPXA 5AJVB 3ND9A 4Q18A 1KYVA 5KJ6A 3MYRA 3NANA 3VR6A 4R16A 4GR9A 2OYCA 3MGGA 1I3OA 2I7DA 2VOEA 2X19A 2ZBGA 1U9ZA 5K4GA 2N1BA 1V5IA 4L6AA 1XC7A 3H9CA 1EFPB 1U0LA 5JVDB 3H2YA 3R40A 1COWD 1G20B 3ZJUA 3NPMA 1GADO 4RF5A 4BASA 2WWWA 2RJ3A 3HN6A 4MQ6A 4N40A 4RETA 3FB1A 1E9SA 1I1NA 2QUZA 4Y2HA 1POXA 1VKZA 1I7DA 1MP0A 4AQ7A 3T41A 3EVTA 3IPLA 2DQSA 3LWNA 2NPFA 1QGOA 4D9CA 4B71A 4R0MA 1GLVA 1I1HA 1OROA 5DBOA 4D0LB 2Y68A 5CAEB 1A96A 1QIMA 5BSUA 3MTDA 4K0RA 1G9TA 2BVNA 3AGPA 1UPUA 1SOMA 3Q7RA 5IJAA 2IZ5A 4IXTA 1L8QA 1NTRA 1QHYA 2CLLB 2ZJ4A 4UTRA 5CA1A 3IPRA 3ZNPA 2VP0A 2BMEA 4HNVA 2IPMA 1GP2A 4NXNB 1I5OA 2GSWA 3H42B 1IY0A 4ZO9A 4K28A 2XIJA 4KPUB 1XPOA 1K3TA 4XIGS 4E12A 1F4VA 3BGDA 3T5GA 5JYCA 4B3JA 1II8B 2HCTA 4QT4A 4ETNA 4Y2UA 4JI1B 1UF9A 3FM9A 4KE7A 1PSDA 5DOVA 3TZCA 5LU9A 3LP5A 1DKRA 4EJMA 2P0YA 1MJ5A 3KSRA 3SR0A 1EPUA 3G0OA 1SNYA 2Z3ZA 3N07A 1T0PA 5A1JA 2BMFA 4R81A 1JFLA 1ODSA 4HQ6A 2P6UA 5LXTF 3DVAA 1P2UA 1RD4A 1GKLA 3FBTA 3FYUB 4TSRA 2K2QB 1LK0A 3M4NA 2UUBB 3OLQA 4TVOA 1SZDA 2ZWOA 3WZ2A 1B16A 3QFSA 3BK7A 3K0EA 2RKOA 1EB9A 4C2UA 4GBGA 3V7UA 1SHZA 2FG6C 3ZWWA 3EY4A 4DG8A 5FUVA 4YAUA 3P19A 1VXRA 2X15A 4HYEA 4OMFG 3QMVA 4W82A 5E7IA 4BCDA 3WGIA 4W5NA 1GU1A 3MNFA 1L7MA 4ND1A 2D0OB 4B0OA 4F46A 3U0VA 3PGVA 2ZAOA 2GFQA 1DO0A 3KEOA 2C4WA 2FWRA 3CZCA 3S29A 4F5EA 2Y1DA 5JNWA 3B3FA 2XR1A 2DKNA 3KQWA 4L07A 1Y6GA 3CW8X 2IP1A 4LHVA 4QEZA 1N5DA 3P0JA 3TGLA 2ZI4A 4AWBA 1DXOA 4O25A 4E08A 4PHCA 2MSCB 1ZY2A 4OAOA 2E4YA 5BMVA 3OIDA 2WSIA 2VN8A 3HDHA 3PUJA 4UJ5A 2OZEA 3AL3A 4YDSA 3DBRA 3OJEA 2MU1A 1CNFA 1GUFA 2IU4A 2FWMX 2R8ZA 3L2OB 3LQ2A 4GYJA 3K7EA 4QU0A 1MC5A 3TH5A 1FJXA 3RFFA 4B80A 3A1EA 2XNCA 3VH2A 1NF2A 2HMUA 1C0IA 3LTNC 2I03A 5JXHA 2ZB2A 1CUSA 4ZARA 4BRSA 4DLXA 3O38A 2IF0A 3LSTA 3BMNB 4QASA 2R8XA 3TJMA 4J3FA 4BNZA 3U3RA 1M8KA 2C5GA 2V54A 3BK1A 1U5BA 4HRXA 1JFRA 1Z26A 1OXVA 4IGKA 3ZGNA 2MHCA 3DNMA 3F71A 1QE3A 2BFBA 3GEEA 4F06A 5F3RA 3PQ2A 5H4HA 2A59A 4B75A 1EQ2A 1RFLA 4UUOA 3IPCA 4WINA 1PJCA 2AW3A 2A5LA 3OPNA 1JXAA 1YD7A 1KFEB 3WK7A 1K08A 4KAAA 5TQVA 2WKRA 3W78A 1GTJ1 3QE2A 3R3UA 3WYGA 1F06A 3D5EA 1OI3A 1NDUA 2W00A 3AVTA 2FK8A 4IAOA 5DRTA 3SXUA 5HKBA 2QPTA 2A92A 4DCJA 5KYTA 2GXAA 1YE5A 2E48A 2YOGA 3NIGB 1FSPA 1V5FA 1HLFA 1RCFA 3C3CA 3GVXA 4PXAA 4R2MA 5EE3A 5FA6A 1ZM3A 1AS2A 3ITKA 1GFSA 1KYXA 1ML4A 4L9AA 3DLPX 1N6HA 1YIAA 1YACA 2O0LA 1R5OA 3R09A 4JJ7A 4RMGA 3H5LA 5CPBA 4OO3A 4DLLA 4NZOA 4OK6A 3L5KA 2Q6KA 4ZDWA 1VIMA 2OXRA 4MV0A 1R4ZA 3WWZA 4DIEA 4JAVC 4YT4A 5C4GB 1A8HA 2RHMA 3GPIA 1MNQA 2CD9A 3DZHA 2FQQA 1DBRA 4IDQA 4DNOA 2ZYIA 2DLNA 5HDQA 1PG5A 1GPJA 4KB5A 1SC9A 4R69A 1D4FA 4BECA 4LQDA 2PWZA 1OF1A 5BNZA 1Y8QB 4MVJF 3R44A 4EDFA 4JP1A 4I6JA 2YXLA 1EG7A 3NJRA 3W5JA 3IC5A 1EIWA 4RYDA 2OHJA 4OB8A 5IKPA 3R6DA 3OD5A 1IJFA 3VR4H 4BVLA 3ECSA 1G8FA 3JRXA 4XB6B 1FLNA 1XLVA 2CXSA 2ZJYA 2I29A 1OBCA 2G9NA 5JO0A 1IK4A 2KLBA 3L4BA 1PYGA 3R0XA 4FONA 4I7EA 1E3MA 2VHQA 3SIPA 3IQXA 3B1YA 2XIQA 1EFRD 1QQ5A 1OFIA 1U2SA 2JHGA 4LV8B 3KFXA 3NHAA 1DS6A 3WJAA 3ZGLA 3KOZA 3GMTA 2WNHA 3RREA 4J2HA 1WVMA 3TO5A 5A71A 4BP3A 3KQKA 1TGVA 4F2HA 2NU7B 3UHPA 2ZTHA 2ZUVA 3CFYA 1XXHE 4XPIA 1P17A 3Q6MA 4BLUA 5IDWA 2TMDA 2IS2A 5F33A 1RYYA 5KVCA 4JXZA 1TEVA 2A2ZA 3AUFA 4PG8A 2GKSA 3FLMA 4AY2A 1VRCA 1PS8A 1E2QA 2J3JA 3GLHA 4G5RA 2WBLC 4HAZA 2BP7A 1CD5A 3NM6B 1OTYA 5CW2A 4C3OB 4E7PA 3QX3A 5AI0A 2ZJAA 2G8LA 1ABFA 4S3MA 1KMQA 2FR0A 2CY0A 1HDRA 2IGBA 5GVRA 3RE1A 4E5NA 1X9GA 4Z9XA 1R12A 4YI5A 5EAIA 4LHWA 4ZVLA 2P3SA 5ALKA 1IVSA 2XYHA 4UDNA 1NW7A 3FHLA 2NSHA 4M87A 2IPXA 1SXJD 4JK3A 2GKOA 1HDIA 4MVCA 4S24A 5JRDS 3N2NA 5L3SB 3MMXA 2WYIA 2P6OA 1Z0AA 3FZGA 4CU2A 1PD0A 4CIVA 1ECBA 1UXJA 2FX2A 2R86A 3DTVD 1GT91 5HP4A 4HDSB 2AN5A 4BQQA 4YCAA 4AP9A 2Q3CA 2R1VB 4EG4A 1NM5C 1RZUA 3ZIUA 4WFIA 4UAGA 2HQSA 3NCTA 4X3OA 5T41A 3UWDA 4M46A 1TM1E 1MB4A 1XZFA 1TC1A 4Y1RB 5JYEA 4KE8A 4E5DA 1QSGA 1Y6JA 3BBLA 4Q15A 4KHZA 4XVRA 4E31A 3I45A 3UWMA 4CM7A 1ZIYA 2ID7A 4UVHA 4X7BA 5EWJB 3NG1A 4RVGA 1JVNA 1OLXB 4BVGA 4HJXA 3IUMA 2C95A 3PWSA 5IH3A 1C4XA 4CR7A 2P0EA 3STXA 1QWSA 1QHEA 5ESWA 3SKVA 4Y2TA 3NKVA 2ZM5A 3FJ1A 3O4VA 1E9EA 1SHUX 3GAFA 4NH4A 1RHQA 3E9EA 4JBHA 3E70C 4N54A 2ZE5A 3G59A 4OLHA 4KNVA 1JQKA 1RHKA 4PE5B 1RRFA 3WFJA 3ER9A 2HIAA 2EX4A 1JR3A 1OYOA 1L9KA 3OFND 3V8PA 3BORA 4XEHA 1L5KA 3SBEA 1G6Q1 3KPVA 4ND7A 1TLLA 4Q7JB 2VATA 3H4MA 1E6KA 3OMXA 1XDSA 2OV4A 1PBTA 3OETA 3X2FA 3VU9A 2RGYA 3W9BA 2O5CA 5EJ2A 1L0BA 3WL3A 1XRSB 3UGQA 3ZIAA 2PUBA 2Q8QA 4GPAA 5JNRA 1DKOA 1QKIA 3L8FA 3NJ8A 1YK1A 5YASA 5K4HA 4RJ2A 3E84A 4I5EA 4D25A 1T8RA 2B4AA 4TS1A 3L4EA 4EHKA 4ZQCB 4DZRA 3A9WA 1NNUA 4P58A 1U2DC 4X97A 3CUWA 1G2QA 2IE8A 1QQ6A 2OECA 4M0EA 4I1YA 3C7AA 5CJPA 4DBLE 3C24A 4DW8A 3DAYA 4G8DA 4D0GA 1H1LB 2I67A 2NO7A 3OQOA 2FTKE 3SHWA 3G89A 3AG6A 3PJEA 4ARVA 1DU4A 3VYWA 1Y89A 3A3OA 3I53A 3M5CA 2IELA 3GHHA 4GMGA 4MA4A 2JGFA 4TL6A 1Y9JA 1O95A 1YZFA 3K8OE 3QLTA 4JBXA 4D9GA 2V4UA 1YCFA 1RLUA 3VI3B 3EAFA 3S99A 1JAXA 3B6KA 5AOBA 2Q8NA 1SD5A 3E48A 2WOJA 3F78A 2ZJ2A 5AKLA 1NBWB 2PZAA 2DFDA 2A7QA 3KB6A 4I1IA 4AJJA 2WABA 3DOUA 2Q2QA 1Z8FA 5JY1A 5C46F 4RDIA 4H77A 3IQDB 3KXLA 4G3XA 3UMJA 5LL6P 5SYNA 2PGAA 3GJRA 1SRRA 5JYBA 4RHCA 3C0KA 1T3LA 1YRHA 2XHZA 2Y0DA 1J21A 3HA7A 1BROA 4XOUA 5EMNA 5D86A 1JIJA 1KJNA 2QWXA 2ZRKA 3THOA 3DTVA 2XQVA 3NAMA 3VHRA 4LF7B 2QMQA 3OSUA 1YOVA 1YZUA 2ZYDA 1JWLA 1MW8X 4I99A 4Z7QB 3MCVA 5GMOA 1G2IA 4Z6KA 2PYDA 2PZMA 2PK3A 3OQIA 4QU8A 3TOZA 4ZMSA 2X0FA 4LOIA 5A5DA 3ABRB 3QFHA 3GRRA 3ER8A 2FH5B 1JT2A 1WMEA 2ZI7A 3DC7A 4MS1A 4BMXA 5A7FA 5A4MS 2E4ZA 4P7FA 1B43A 3W6OA 2X8AA 1Z8HA 4DGSA 3OHPA 3R9XB 1W9HA 2BEUB 3MCWA 3NDIA 3DR3A 3RIGA 4NJMB 1N0WA 2JHPA 1FDIA 1RQLA 3N2KA 4EO7A 1SCUA 3MOSA 3RI3A 1E1YA 1MO5A 1TZCA 4YNBA 3A70A 3VSDA 3RYIA 4P6VF 3TG2A 4UVDA 4TTTS 3K9WA 1KH2A 1YNSA 3ZD8A 2DWCA 3S28A 2W2KA 5AVJA 3T1NA 4BWGA 1VPLA 2PGXA 2C9YA 1WQ1R 3VMMA 3GPCA 1O9BA 2GA8A 3OCWA 3QU7A 4WBXC 4BFVA 4CLXA 4Y0VA 1XVVA 2OORA 4EJ6A 1AKVA 3I05A 5IBQA 4EKGA 1KHTA 1QJ4A 4O0MA 2XADA 4KRFA 4C5BA 1E2HA 1I2BA 2VT6A 4M38A 4P0TA 3U31A 4X64B 1Z28A 3JYNA 1XZQA 2WYOA 3FR7A 4RL4A 2OY0A 1OTXA 2YUIA 3VH4A 1QP7A 4XEUA 3RDPA 3PDJA 4M83A 5AUQA 4N5NA 3BDVA 3VU3A 1PZGA 3A28A 2SNIE 1O6GA 4HATA 4F12A 3A4VA 3ANNA 3CG4A 3LWBA 4WY5A 2R66A 1IBKB 4R7GA 3WYCA 1NMYA 1EVKA 4AYXA 5K2OA 2VSXA 1I0ZA 4ABTA 5ALDA 3DONA 4N9WA 3T06B 3JYHA 1JKMA 1GU0A 3FA2A 3QIVA 1JQLB 2D2EA 2DQZA 4MI6A 4P4SA 2X4GA 5KNDH 2IHYA 4D4LA 1X7YB 1XMIA 3UJCA 4F3RA 4YAGA 4HJRA 3MRSA 5JZBA 2G70A 2ZE7A 4UXHA 1XEXB 1SVIA 4BNGA 1ZIPA 3C6MA 3E9RA 3JWHA 4KIJA 4ZOLA 4Z1OA 3F6RA 2NUBA 1U2PA 3O3CA 2Q41A 1P0CA 3OZIA 3HMKA 2R7NA 3AGQA 1D07A 3L7KA 4FFDA 5D3ZA 1DCKA 3BMXA 1LK7A 4NYIQ 1P7YA 3SFTA 1JHPA 1YQTA 3A4LA 5DXAA 3WADA 3WHKA 4B2YA 1PNRA 3PGMA 2CKMA 3W5VA 1O94C 1NM5A 1EUZA 3GOHA 3ORYA 2Q1SA 3GBVA 3LBAA 4YN3A 1T9AA 1UM9A 2LCIA 4ATNA 3IDFA 1COZA 2H52A 2Z2XA 2PSEA 3EWSA 1L7DA 3IMEA 4HXEB 4DTCA 2AI1A 3EZ6A 2IH5A 1E58A 2B1QA 2PMKA 3K0CC 3ROZA 2F62A 4H1WA 4RVCA 3W1WA 2X8BA 3BWMA 1A04A 4NU6A 2YFKA 3ESAA 3ZE2B 3MFQA 5B7NA 2BFEA 3H2GA 4IS3A 5HRUA 2QKYA 5CB4F 2I4RA 2GZ2A 5FUWA 4XWAA 3RAGA 3J80A 1UFQA 3ANLA 4V0SA 5I7HA 2CK3D 2NYVA 2PH7A 5HMLA 4JBIA 2DF8A 2PX8A 5HGJA 4RPLA 1GQYA 1ZNXA 3D7KA 4YAFA 4IIBA 5CH5A 1DC8A 2EFHB 2R3SA 2ZREA 2ZT8A 3BIOA 3EVBA 3ZDFA 1N34B 4URYR 4U3JA 1W25A 5A3JA 3ITEA 1YV9A 3KR1A 4EHNA 4TYQA 4OUDA 4URVR 1Y8RA 2D5BA 1QRSA 4Z4HA 4YS6A 3MRXA 3C16C 2Q0HA 3P2OA 4JOSA 4HV4A 5IZ4A 5IS2A 1NIPA 1CB7A 2BMVA 4HEHA 4LAFA 1Y6FA 3QPUA 4RD0A 3RCBA 2OUKA 1PIWA 1UC8A 2F8MA 4TSFA 4EB8A 4BUZA 2AXNA 4B83A 4BQFA 2I8LA 1HZZA 1MAAA 3K16A 1G2OA 2CCGA 5ETJA 4C1BA 1SU7A 3DLTA 4OF4A 3PQFA 1P62B 4S1OA 1Y7HA 2Q5QA 4H2DA 3LF2A 4KR2A 4DB2A 4LRQA 2HL6A 2WWHA 1FP4A 4WOBA 5AK5A 2PRYA 5DPMA 3EVGA 5FTJA 4J3NA 3KXKA 2I2BA 1SCUB 3JZAA 3S1LA 1A3CA 2Y1OA 4UBNA 3BF8A 3STWA 2BGWA 4QWMA 3FNQA 3OZXA 4LGVA 1CEXA 3ETLA 1YGYA 3B7GA 3D6AA 1A1VA 5D6OA 1YR9A 1N3YA 3M1AA 2NSDA 3BJMA 3TTXA 4BKPA 2EFYA 5BOSA 1GYRA 4O1IA 3Q8LA 4NATA 5JEDA 2JGMA 4Q3DA 2QUIA 3RF6A 1OPRA 5TEWA 1RW4A 2G0AA 2CJFA 4HGOA 2NUAA 2C7BA 3QVGA 2OGWA 1Z6AA 5DFAA 5BVHA 1SXJB 2WC1A 2Y05A 2NAFA 4GPTA 1ZUNB 2VR1A 3Q6IA 4K1XA 3FJYA 4KCGA 3KG2A 2ACVA 4DMRA 1CY4A 4OP2A 3F47A 4BO0A 2XYVA 4HXGA 4M0FA 3L84A 3L43A 2OHFA 4JU8A 1JLSA 2ZIAA 3HBJA 4FOOA 4KL8S 2Y77A 3PV0A 1VE1A 1GTVA 3KO8A 2ZWAA 1IZ8A 1CVRA 4FIDA 1GA6A 3A6FA 3A6ZA 1PSZA 5KSPA 1DC7A 3TG8A 3P52A 4YMGA 1DP4A 2BEKA 4PLCA 4DPKA 1PWHA 3MW8A 2X8JB 5BW8A 5C80A 1C1DA 4L5AA 4HL6A 2DSNA 2RK3A 4XM0A 2YHSA 2WU3A 3OPYI 4CV3A 5DNAA 1EHCA 5EJ8A 4KGZA 1DIOB 1U94A 3FMIA 4YIKA 5DN9A 1SMKA 1LTQA 2C0CA 4P54A 3DS8A 3EGIA 3M9WA 3T15A 3LW8A 3ZDQA 1J0DA 2JZCA 5D3QA 5E6UB 2FP3A 1Z4PX 2QR3A 3IPAA 4BFTA 2E5LB 2JI9A 2FUG6 1NVAA 4GMFA 4L8GA 4U6SA 1UDBA 5DSXA 3ZWCA 3CPHA 1MA3A 3U81A 4GPEA 2QZ4A 1Z0SA 1XJ5A 3KAJA 4OK3A 5IC4A 5T7BA 2QTVA 3DJYA 4MIEA 4LV6A 1U04A 4WXEA 4B7UA 5CJ2A 2JNWA 4WNCA 2ECQA 2ZVDA 3ETHA 4MQLA 5IF3A 3TNLA 4FLFA 4KXNA 3BYZA 5JD4A 1XP8A 1TCAA 4JDUA 5FBKA 3TR5A 2WICA 4MS1B 4O4HF 4KQFA 5BWBA 2WWIA 2ZULA 3OWHA 4CQMD 2PCLA 1RQRA 3CZPA 4MDHA 4TWRA 2ZBDA 5KNCH 4GSYA 3GROA 1VSUA 3KCNA 4DV2B 3A6HA 3ADDA 1B6GA 1YU9A 1DXQA 2XDQB 5G3ZA 2QPOA 4X65B 4YLEA 4FNGA 3I30X 2FMHA 1NXQA 5IX8A 4KR6A 4KODA 1R8JA 3RYIB 5JV5A 1LVUA 2BSXA 1IY2A 1S2LA 4RZUA 1UWCA 1QUEA 1XQYA 1NGSA 4ECAA 1R4NB 4LY6A 3UC9A 1GL6A 1FFCA 3VU8A 1NVVQ 4RSHA 5G2OA 1TEZA 2F1IA 3R5SA 2HJRA 4L5YA 3FAKA 1M66A 1P1CA 1GG2A 3H1BA 5DTEA 2HK7A 5CNIA 1P5HA 1QIEA 3TQSA 4DUZB 1EDEA 5A5VA 3ILVA 4CEHB 5CHYA 3DTNA 3BHNA 4C78A 1HM5A 2DXIA 3HBNA 4HB0A 1FS4A 2EZ4A 4UE3S 3KQOA 4XRGA 4UQPA 1N77A 5HJEA 4Q02A 2B8NA 2VUSA 4E5MA 1KI9A 2BBOA 4YP0A 5KDDA 1RWOA 2PUJA 4U2CA 1E69A 3OIYA 4YRNA 4FHEA 1UBRS 1ZGZA 4HDRA 1YJCA 4N03A 5D85A 1BD3A 1VLLA 3K0KA 4JYBA 4KG7A 4TVKA 2BFFB 3ADBA 1DMSA 3SLGA 1QB7A 1OX4A 4D4HA 2W22A 2AI3A 3MXOA 3TLJA 5ICEA 3HCEA 3CUVA 4QPZA 3ZBQA 2X2FA 3ED5A 4IHQA 1H65A 2HT6A 4A23A 5HF8A 2OO7A 3UWSA 2FSGA 1N8NA 4JJEA 1VQ1A 4S0ZA 2HDNB 1BAPA 2OCPA 4MB2A 5EYPA 4AKIA 1MOSA 2H7VA 3NCHA 1BE0A 1JE0A 4BHTA 2PX4A 1SKYE 4QARA 2Q07A 2EFEB 5CM8B 1ONNA 4K26A 3PQ6A 3JVUA 1KYWA 4HWPA 3ICPA 4K40A 4XGQA 4B84A 3WAKA 2X3UA 2J3QA 4CM4B 4A8JC 4I5FA 4RZQA 1HNWB 4NDNE 3UXHA 2XCRB 2VQ6A 3K2BA 4OQ4A 3SJCA 4J0EA 1UOQA 4RIFA 5FTNA 1TKBA 3KOOA 1HQKA 1I9GA 5T6BA 4S05A 3DE3X 1MQAA 1ONOA 4KFRA 5AXCA 3WIVA 1XAIA 1W44A 2BFEB 3L7OA 4XJSA 4E5SA 5FWXB 4YJ2F 5M29A 1DRWA 1X1CA 1MJGM 4TV8F 2EZ8A 3DFUA 2CCKA 1K2WA 3FD8A 3OZFA 2POCA 3K09A 2YXPX 5AFSA 3IBYA 3RD5A 2CJPA