1GU4A

Crystal structure of c/ebpbeta bzip homodimer bound to a high affinity dna fragment
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
total genus 32
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu4A00
3VMZA 2W27A 2N9BA 1GU5A 4JYCA 1T2KD 4GT1A 1MUUA 1FAVA 3A2AA 3M9HA 2H7HA 1H89A 2JJLA 5AW4B 1X8YA 5AVYB 1GK4A 1CSBA 3VYIA 1G2CB 2VRSA 1GK6A 1H88A 1NAFA 2BASA 2ZXEB 1S9KE 1JUNA 3TNUB 3TYYA 3KDPB 1SLQA 1HBWA 2R5DA 5AW1B 3LIEA 5AVTB 4AQRD 4I6MC 2WPQA 3HE4A 2P2UA 4KHXA 3OAKA 2WTYA 5AW8B 4AYCA 5APSA 5APTA 3A3YB 3L36A 3M91A 1KQLA 3NXSA 3IR9A 4GKGA 2WPSA 2XZRA 1MV8A 2W6AA 3VMYA 1GD2E 5APQA 3B8EB 4I2LC 4HYTB 2YNYA 1GU4A 1HJBA 4EOTA 3V4WA 1CI6B 4C7NA 3M0DA 2QM8A 2E43A 3VTPC 3HE5A 5CMZA 3A7OA 2R5BA 3MGNA 4M3LA 5AW7B 1S9KD 3I5CA 5AW6B 3V4QA 3NFQA 2WT7A 1MFZA 1NWQA 1DH3A 5APYA 5AVQB 1OWAA 5AVWB 5AVXB 5AVUB 1T2KC 3A5TA 3TK1A 1GTWA 3P8MC 1IO4A 3V5BA 5APXA 3NTNA 1FOSF 2YO2A 3KQGA 1A02J 1GZLA 4LC1A 3HTKA 2P67A 2E42A 4AUWA 1A02F 2Q7CA 1HUCA 3MD0A 2R3CA 4JYBA 3L37A 3M0AA 3O8ZA 5AW5B 3TNUA 4B86A 2Q5UA 3T97A 1JNMA 3L35A 1HWTC 4RESB 5APVA 2P7JA 3HE4B 3UIAA 2XU6A 5AVVB 5AW0B 2WWWA 2YO3A 3VN0A 2IPPA 4DZOA 1FOSE 1YYCA 3P32A 3P7KA 3SWFA 1SP4A 2ZFCA 2Q3IA 5AW2B 3VMXA 3M06A 1J2JB 1H8AA 1CI6A 4C7NB 2C9LY 3NMDA 2WPRA 4XE5B 5APUA 5AW9B 3HE5B 1OXZA 5APWA 2C9NY 1CZQA 4C46A 2Z5HA 2XV5A 5AVZB 2KP8A 2WT7B 2Z5IA 3M9BA 2R32A 5AVSB 5AW3B 2QM7A 3LIDA 5AVRB
chains in the Genus database with same CATH superfamily
1URQD 1OFCX 1FC2C 1G1JA 2W27A 2N9BA 5CCHC 1PFIA 1HF9A 2D2CD 3AEDC 4PV1D 3TGUD 2N1TB 3L75J 1SFCD 2RH0A 4HKZH 1Z56A 2Y0EA 3JCUE 1QEXA 1N7SA 2BCCG 2XNDH 4UB8E 3Q5SA 2B9BA 1EDIA 2R3SA 5AVYB 5AW4B 5KLIB 2DW3A 4Z1MH 4IFDK 3N7NA 2KS1B 4OGQB 3GLMA 2M3EA 3HD7A 1EDLA 3PHLA 2BASA 3RK2C 3TGUE 3CLQA 3B5NC 3TNUB 5DJTB 1KYOD 2R5DA 5AW1B 2Q1KA 1IFNA 1SQXG 2H88C 3GHGA 2OYIC 1LWUC 1H0TB 2WPQA 1W2EA 2SPZA 3G9RA 1XTCC 1NJIQ 3OAKA 1LTSC 1EDJA 3AE8C 3FX0A 3LW5J 3BCCE 2E75C 3L36A 2NPSD 3NXSA 4GKGA 2XZRA 4ASVA 2E5TA 3B4SA 3WU2E 3CXHI 3L4FA 4ZKPA 1ZR4A 2A45I 4UB6E 1HJ0A 5APQA 1D7MA 4H0LC 3WUUA 1J1DB 1GL2C 1E5WA 1NTKK 1S3JA 3FXDA 4EOTA 2FYNC 4I2LC 1K8AQ 3H1HE 3HD7D 2CPBA 1U7MA 4C7NA 3M0DA 1FS0E 3AE9C 1M1JC 2A45H 1RE3C 3L74J 3H1LE 3L75D 4EI2A 3VTPC 3R2PA 1VQNP 1NU1K 1T8ZA 2LR2A 1FZAA 1NU1G 3U59A 4GIFA 2R5BA 5GTHE 1KN7A 3BATA 1LTTC 1IC2A 1JTHB 4M3LA 1ZLLA 1SQXD 1QX8A 1AQ5A 3I5CA 3CMAP 2Q6QA 1NOHA 1PGQA 5KLVD 1JOCA 3RL0g 2PGDA 2Q3EA 1E79H 3KZIE 1FU1A 2LKMA 3L70J 3MHVA 1SQBJ 2OTJP 1NWQA 1NTMK 1JMBA 2KNCB 1OWAA 1EZVI 1OMIA 1USDA 3GF7A 3FWNA 4Y99C 5AVQB 2NRGA 4ZNCA 2WITA 2FYUK 3P8CE 4WY4B 3G6EP 3GHGC 1LWUB 3F89A 4WVZA 1L4AA 2OQQA 3H1HJ 1M1KQ 5APXA 2YO2A 1L0NG 1LTGC 3L75E 3C1LA 1L0NK 2QE7H 4LC1A 5CBOA 3CCUP 2K88A 4IFFA 2E75B 2WSCH 3H1HD 2E42A 2KZIA 3IFMA 1A02F 1LP1A 2W6JH 3GG2A 4DCKA 5KJ7C 2AEMA 1LT9B 2R3CA 1WT6A 2GUVA 3CXHD 3L37A 3M0AA 4QMAA 5AW5B 1GL2B 4D6TJ 4B86A 1S5LE 1P84D 4WB4A 3K5BA 4H44B 2QIWA 4IFMA 5KLVG 1YJWP 3MUDC 2M8RA 1HWTC 1AJYA 3CX5E 1M1JB 3MIWA 1AA0A 5GTHH 2P7JA 4H13D 1N7SC 3A0HE 1FZFA 1ZMEC 1JM0A 1JY2O 2IPPA 1N7LA 2YKQA 1KILB 3AEBC 1YYCA 2RMZA 2KB7P 2XKMA 3AEGC 3L73J 1L0NJ 4I1LA 4NPFX 2J58A 1RF0A 1L0LG 4UB8H 2ZJSE 4UB6H 1S72P 5TJHA 1L0ND 1VF5B 4BXLA 3MZWB 1GDTA 1EXIA 3H1HG 4YXDC 4N6JA 1RH5B 2OYOA 1CI6A 1SQPJ 2M5AA 1JMMA 1QL2A 1G1IA 2RN0A 3CX5D 3NMDA 2QEXP 5L8RJ 1RF1B 5APUA 3Q5PA 1SQVK 1SQVG 3V2QA 3G71P 1OXZA 5APWA 1WMKA 1AVYA 1CZQA 1M7LA 3A0BE 2C9NY 3H1JD 1PP9J 1BE3J 3E1IA 2WMMA 4U3FJ 5AVZB 1M8OB 1KB9D 3R4YA 1K9MQ 1KFMA 4OVNF 2C0WA 3M9QA 1EZVE 4W80A 2PAJA 1IFMA 3D71A 3H1JJ 2MKVA 3M9BA 1AVOA 2R32A 3L73E 1SQXK 4U3FD 1HGVA 1FZCA 1LT9C 1PL5A 2HODB 2A06G 2PP6A 1LTJA 3H1ID 5KKZC 2OARA 1NYHA 3CI9A 4H44C 1GU5A 4C7RA 1OIPA 3II6A 4GT1A 3Q5RA 5TISE 3TF5A 1PGJA 4PJ0H 4XFJA 2E76D 3A2AA 4IL6X 5E79E 4BRYA 3CCRP 1IZNB 3L70E 3V2NA 4EDFA 1H89A 1X8YA 2FXOA 3HTKB 3V2RA 3H32B 1GK4A 1KILD 5KLVE 1RY3A 1GK6A 1X22A 2BCCE 2QJPC 3A0BH 1H88A 2O01J 3D6YA 5CJ4A 2E75D 4RJTA 1S9KE 5GTIE 1NTZK 2HG5D 1OW6A 1J1EB 4Y28J 1VF5C 2N9YB 3MTUE 2B87A 3T97B 1NTZJ 1RQVA 3BASA 1GMJA 3L72G 1BCCE 2QJKB 3TDKA 3WU2H 1NHLA 1VPCA 3O6QB 4R4MA 4AQRD 1RF1C 4H13C 2NPSB 1X9VA 1NTMJ 2A06D 3H1IG 4KHXA 4DT0A 5AW8B 1OX3A 1Q90D 1JY3N 3AE2C 3IF4A 5APTA 3M91A 1KQLA 4ZMDA 3WUTA 3P8CD 4N3YB 3RGUA 1IFDA 1YTZT 2W6AA 4W7YA 1LTBC 4PD4E 1IK9A 3BCCD 1NKNA 2WSEJ 5KLVJ 2E74D 2ZAEB 1QL1A 2V7QJ 3KHUA 3VOPA 3I56P 1YQ3C 3U1AA 4GDOA 1L0NE 1NTZE 1URQA 1LT1A 3L75G 4JPZB 2E43A 4R4LA 1HH0A 1BDCA 1L2PA 2N1TD 1JY3O 1NU1D 4OGQD 5CMZA 3AE4C 1VL2A 3MGNA 3W68A 1BCCJ 5AW7B 1OZHA 1S1CX 1Y9BA 2MJZA 3H1LG 5H2FE 1BDDA 1EC5A 3L72D 1JCDA 1S5LH 2QJYC 1K73Q 4IOIH 3NFQA 2AXTE 2WT7A 2O01N 2Y0DA 3H1KG 1HVVA 3L70G 1VQ5P 1XTGB 3AEEC 4DOJA 1N8RQ 2FFDB 2GUSA 5APYA 5AVXB 1DX7A 5KJ7D 2D2CC 4PV1C 3A5TA 1NGMB 2N1TA 1PP9G 2O01H 3P8MC 3CCJP 2QJKC 3V5BA 2WZ7A 4O9BA 1YIJP 3BVHA 3PH0A 4HH2A 1CW5A 3FGAD 1KTMA 1S4XA 2YXRB 3LW5H 2NZ2A 3KQGA 2J59M 1GZLA 2E76B 2K9JB 2Y9ZA 4PJ0E 3CL3D 2P67A 2FY8A 2JKVA 3CWBJ 3PRJA 3OA7A 4W7ZA 5BU5A 3HD7B 2XDJA 2WSSH 4AUWA 3CC7P 1HUCA 2IYOA 5B5EH 2O3JA 2ZT9B 4TT3H 3TNUA 1LTJC 1FZCC 1SQXJ 1JCCA 1VF5D 2Q5UA 1JNMA 1JY2P 1SFCB 1KMIZ 3F5HA 3H1KE 3L71G 3L70D 1U7JA 2IZ0A 1RQUA 2JDIH 1SQBD 2KIKA 2YO3A 5AVVB 3D6ZA 3CCVP 2QA4P 1BCCD 1FOSE 1PGPA 3W67A 4A7PA 2FBWC 1PP9D 1LGHB 2LXBA 2PFXA 2AXTH 3RBZA 3EFFK 1OW8A 1U57A 4D6TG 2I1KA 2WSFJ 1AV1A 2Q3IA 5AW2B 1SQBE 1DD3A 1J2JB 3AE1C 2JO1A 3KYQA 3L71E 1VQKP 2KOGA 1N2DC 4XE5B 1SQVD 1BE3E 2N1TC 2ZYDA 3C9IA 2W90A 2H89C 2A45G 3HE5B 1VQ9P 2W83C 3Q1MA 1JTHA 2YIUC 2K3RA 1HTLC 2E76C 1BGYD 2CPSA 3CX5H 2V4HA 1NKZB 3L71D 1UIIA 1ZN5A 2BEZF 1FZEA 2RKLA 3GMAA 3AE5C 3H1IE 1SQBG 1LTAC 2Z5IA 2OYHC 3RK2B 1BCCG 2QM7A 2QG4A 3RK3E 3S4RA 5AVRB 3B5NB 4D6TE 5TISH 3CCQP 4NPDA 3VMZA 2C0XA 3SSUA 1N73C 1MZ9A 1OVRA 1S2EA 4JYCA 1T2KD 5EFWB 3PLNA 2OYIB 1LWUA 1MUUA 1FAVA 3H6PA 2JP3A 3M9HA 2JJLA 2FXMA 3H1LJ 4GOFA 3U1CA 3VYIA 2Z4EA 3EQ2A 1G2CB 2KLUA 1LP1B 2HYNA 2VRSA 2ZYAA 4HB1A 2H43A 1NAFA 2IDBA 2ZXEB 3KXDA 1YI2P 1LT9A 1VQ4P 1JUNA 2JEEA 1RHZB 3SWYA 1SLQA 2IBZG 1HBWA 2XNXA 2YMYA 3BCCJ 3V2PA 1BGYG 5CCHA 1VQOP 2WSCJ 1ZXGA 3LIEA 3RK3D 1PGOA 5AVTB 1YHQP 2E74C 1L4AD 1M1JA 3HE4A 5KAFE 2E5YA 2P2UA 1SQBK 2Y0CA 2Q9IA 4N78E 1EZVD 2GA1A 2R44A 1W5CE 3E7KA 1KFNA 1KILA 1R5LA 2L5GB 1KYOH 5APSA 4AYCA 2FKWB 1LNQA 2JWDA 3IR9A 1ZW0A 2WPSA 4OGQC 1MV8A 2HR3A 3JSVC 4K35A 1EXJA 2WQYC 2KI7B 1GW3A 1GD2E 3BCCG 3AE3C 1JY3P 3B8EB 1Y47A 3CXHE 4GOEA 2HPCB 5KLVK 1NAYA 1GU4A 3BRTB 3C8VA 4JQ0D 2OYHB 3HUSB 4MN4C 3V4WA 2FYUJ 3GW6A 3ITKA 1CI6B 4Y99B 2M5AB 2IYPA 2QM8A 1KORA 2WPVB 3ABVC 1RF1A 1N73B 1PPJG 3AECC 2IBZE 1IFIA 3A7OA 1SQPK 2I1JA 2IBZD 2GM4A 1N86A 3H1LD 3KPEA 1KQSO 1NO4A 2K37A 1KYOI 1SQQE 2KXPB 1YJ9P 3AE7C 3V4QA 1AFOA 4H0LB 2V7QH 3H1KD 3USSA 1KB9H 5KJ7A 1MFZA 2AEJA 4LGDE 3CCMP 1Q7YQ 2HODA 2ZYGA 2FYNB 2WSFH 4LLHA 1DH3A 5AVWB 2O1KA 3QH9A 4H44D 1URQC 1FJPA 3L74G 2OTKE 1SQVE 3TK1A 1GTWA 4JBZA 1ZRTE 3MUDA 1RE4C 2E74B 4BRYB 1L0LJ 1N7SB 1SQPE 2O1JA 1FOSF 2HLOA 1LTIC 1P84H 1SVFA 2P58A 3HRNA 1K05A 1KILC 1FBMA 1KZUB 3H32A 3RL0D 2KS1A 1KYOE 1SQPD 1YBKA 1PP9E 1BGYE 1UIXA 2BEQD 3RK2D 1ZRTD 4JYBA 1NTKG 1YITP 3L74E 2I8DA 4PD4I 3ZDMA 2JR8A 2FYUD 2OTLP 3HUSC 4WY4C 1BE3D 2Y9YA 2W8ZA 3GHGB 3L35A 3T97A 1KILE 4ASWA 4EYYQ 4RESB 5APVA 1ZR2A 1L4AC 3PP5A 3O6QA 4NPEA 3CX5I 4U7JA 3Q3DA 2XU6A 5AW0B 3VN0A 2ZXXA 1JY2N 4DZOA 4I7ZB 2W6BA 3G3ZA 3WMM0 1PZQA 3L72J 4OH8B 2QRXA 1M56D 1EDKA 1KD1Q 1L0LK 1S5LX 2IFMA 1DEEG 4WWIA 3TGUJ 1FDOA 4D6TD 4XA4A 3SWFA 1NTZG 1SP4A 3SWKA 3PJSK 3VMXA 1LJ2A 4CPGA 3M06A 5BU8B 4KT0J 5KKZB 1H8AA 2YMKA 3H25A 3CWBG 4KJMA 4C7NB 1SQQK 1URQB 2G8YA 3H1JE 2FYUE 3AE6C 5CCGD 1ZP0C 3N4XA 1TU3F 2Z5HA 2XV5A 3A0HH 1BE3G 2WVRA 3CCEP 3E1RA 2A06E 3CWBE 1OVVA 2POHA 1VQ8P 2QJPB 1Q2NA 1HGZA 3L72E 3JCUH 5AVSB 3LIDA 1T6AA 4EIJA 1M57D 2FFDA 2AXCA 2KNCA 2P10A 3Q2YA 1YTZI 2UWJE 1NU1E 1BSNA 4WY4A 5M1BA 4L74A 3TGUG 4HJGH 1NTZD 1L4AB 5H2FH 2H7HA 3CD6P 1OVUA 3WUVA 4I7ZC 2K9JA 3QWOC 1CSBA 1EQ7A 1SQVJ 5CCGA 1P84E 1IJDB 3FXEA 2IX7C 1NTKE 1L0LE 2HFED 1FJKA 3KDPB 4IL6E 3TYYA 1GL2A 5CBNA 2K1AA 1T3JA 1BGYJ 4IL6H 3L71J 4H0LD 3CXHH 1SFCA 3L73G 3M0DC 4L76A 2JWAA 4I6MC 1FZBA 1RE3A 2YKPA 4RO0A 4U3FE 3S9OA 1EZVG 2B88A 2WTYA 1KB9E 2K9YA 1OW7A 3V6IA 3S1KA 1PIXA 4YXWH 5B66H 1Q86Q 1BSHA 3A3YB 3VMYA 3B5ND 5KAFH 4WBAA 1DEBA 2QJYB 1SS1A 2ZT9D 2ZVNB 1AQTA 2B89A 1P84I 2H8PD 2P1JA 1IFJA 1NTKJ 1J1EC 2YNYA 4HYTB 3RK3C 3EFGA 3VP9A 3OW2O 1HJBA 1JO5A 2M0BA 3D70A 1R5SA 4ZKUA 2FFDC 2IFNA 1W2BO 3VP8A 1T3UA 1PPJD 3RL0B 1SQXE 4H13B 2NPSC 1FDIA 2CK3H 3HE5A 3IAOA 5BVZA 5B66E 1K04A 3JC22 1IK7A 2J5UA 1SQQJ 2YKOA 3KZIH 1VQPP 1KV4A 1KB9I 3H1KJ 1PPJE 2YXQB 1S9KD 1Q81Q 1GL2D 3L73D 1NVOA 1Q82Q 5AW6B 2AEFA 2IZ1A 2KSEA 1Y8AA 2ITAA 3HD7C 4DJGA 4YTPC 1FZCB 3RBXA 1SQQG 3B5NA 1LTJB 2PRRA 3L74D 5CCHD 5AVUB 1T2KC 1WRGA 1VQ6P 1SFCC 1PV3A 3B71A 2OYIA 1IO4A 1DIPA 5C39A 3GF3A 4RKUJ 4WY4D 3SFDC 3NTNA 1X79B 5K5GB 1A02J 1IFPA 3AEAC 1FZGA 3HTKA 1N7SD 3EWKA 1SQPG 3CPWO 1G2CA 3CC4P 1NU1J 4GODA 1RF0C 3PTZA 1QLED 2KZJA 2M3BA 3MD0A 1NTKD 1YQ4C 2Q7CA 1R8EA 3CC2P 3O8ZA 3VMAA 3RK3B 2KSJA 4BWNA 1ZOYC 1NTMG 2FYUG 3H1IJ 5CHXA 2B87B 2D2CB 4PV1B 3I55P 1VQ7P 3SFEC 3CCSP 1RE4A 4TLFA 3RL0C 3AEFC 3HE4B 3UIAA 2NPSA 3MP7B 5GTIH 1SQQD 2KLVA 2WWWA 1YJNP 5KLIC 1GW4A 1FE6A 2OGUA 1QGKB 1JB0J 2IBZI 1JEKA 2QVAA 2YIUB 3P32A 5CCGC 1DD4A 1MFTA 2BCCJ 3P7KA 1NH4A 1KQFB 1USEA 5CJ0A 1L0LD 2HPCA 2ZT9C 4YPCA 2LXCB 4PD4H 1KQGB 5DJUB 5E79H 2ZFCA 3IN6A 2OYHA 2BCCD 1FDMA 3CMEP 3FWLA 3HUSA 3OJAB 3CWBD 5B5EE 2G3AA 1QVFO 4K3AA 4JF7A 1N73A 2ZVOB 2C9LY 2WPRA 3BRVB 1KC8Q 1VQMP 1H0TA 2QSIA 4L73A 4L75A 5AW9B 1VQLP 4PD4D 1NTME 1VDFA 1M90Q 1NTMD 3TSIA 3CCLP 4C46A 1QVGO 1MKMA 2KP8A 3H1JG 5KAIE 1X0TA 2L91A 4N78D 5KAIH 5KTBA 2FYZA 1ZV8A 2KUBA 2WT7B 1J1DC 3G4SP 5AW3B 4U3FG 2KK7A 4OWFA 2FXPA 2KYVA 2WSEH
chains in the Genus database with same CATH topology
1URQD 1G1JA 2W27A 5CCHC 2N9BA 1PFIA 2N1TB 1SFCD 1Z56A 1N7SA 5AW4B 5AVYB 4IFDK 3N7NA 3HD7A 2BASA 3RK2C 3CLQA 3B5NC 3TNUB 2R5DA 5AW1B 1IFNA 3GHGA 2OYIC 1LWUC 2WPQA 1W2EA 1XTCC 3OAKA 1LTSC 3L36A 2NPSD 3NXSA 4GKGA 2XZRA 3L4FA 4ZKPA 1ZR4A 2A45I 5APQA 1J1DB 1GL2C 1E5WA 1NTKK 4EOTA 3HD7D 2CPBA 4C7NA 3M0DA 1M1JC 2A45H 1RE3C 3VTPC 3R2PA 1NU1K 1T8ZA 1FZAA 3U59A 4GIFA 2R5BA 3BATA 1LTTC 1IC2A 1JTHB 4M3LA 1ZLLA 1AQ5A 3I5CA 1NOHA 1JOCA 1FU1A 2LKMA 1NWQA 1NTMK 5AVQB 1OWAA 4Y99C 2WITA 2FYUK 3P8CE 4WY4B 3GHGC 1LWUB 1L4AA 5APXA 2YO2A 1LTGC 4LC1A 1L0NK 4IFFA 2WSCH 2E42A 3IFMA 1A02F 5KJ7C 1LT9B 2R3CA 1WT6A 2GUVA 3L37A 3M0AA 5AW5B 1GL2B 4B86A 4WB4A 4IFMA 1HWTC 2M8RA 1M1JB 3MIWA 1FZFA 2P7JA 1N7SC 1JY2O 2IPPA 1N7LA 2YKQA 1KILB 1YYCA 2XKMA 2KB7P 4I1LA 2J58A 1RF0A 4N6JA 1CI6A 1JMMA 1QL2A 1G1IA 3NMDA 1RF1B 5APUA 1SQVK 3V2QA 1OXZA 5APWA 2C9NY 1M7LA 1CZQA 4DOJA 3E1IA 5AVZB 1KFMA 4W80A 2C0WA 2PAJA 1IFMA 3M9BA 2R32A 1SQXK 1HGVA 1FZCA 2PP6A 1LT9C 2HODB 1LTJA 2OARA 3CI9A 1GU5A 4C7RA 3II6A 4GT1A 3A2AA 3V2NA 1H89A 1X8YA 3HTKB 3V2RA 3H32B 1GK4A 1KILD 1RY3A 1GK6A 1H88A 5CJ4A 1S9KE 1NTZK 2HG5D 1J1EB 3MTUE 3BASA 4AQRD 1NHLA 1VPCA 1RF1C 2NPSB 1X9VA 4KHXA 5AW8B 1JY3N 5APTA 3M91A 1KQLA 3P8CD 4N3YB 1IFDA 1YTZT 2W6AA 4W7YA 1LTBC 1IK9A 1NKNA 1QL1A 3VOPA 3U1AA 1URQA 2E43A 1HH0A 2N1TD 1JY3O 5CMZA 3MGNA 5AW7B 2MJZA 1JCDA 3NFQA 2WT7A 1HVVA 1XTGB 2FFDB 2GUSA 5APYA 5AVXB 1DX7A 5KJ7D 3A5TA 2N1TA 3P8MC 2O01H 3V5BA 2WZ7A 4O9BA 3BVHA 1CW5A 4HH2A 3LW5H 3KQGA 2J59M 1GZLA 3CL3D 2P67A 4AUWA 4W7ZA 3OA7A 5BU5A 3HD7B 2XDJA 1HUCA 1FZCC 3TNUA 1LTJC 1JCCA 2Q5UA 1JNMA 1JY2P 1SFCB 5AVVB 2YO3A 1FOSE 1LGHB 2I1KA 2Q3IA 5AW2B 1J2JB 3KYQA 2KOGA 1N2DC 4XE5B 2N1TC 3HE5B 3C9IA 2A45G 1JTHA 1HTLC 2CPSA 1NKZB 1ZN5A 1FZEA 1LTAC 2Z5IA 2OYHC 3RK2B 2QM7A 5AVRB 3B5NB 3VMZA 2C0XA 1N73C 1MZ9A 4JYCA 1T2KD 2OYIB 1LWUA 1MUUA 1FAVA 3H6PA 3M9HA 2JJLA 2FXMA 3U1CA 3VYIA 2Z4EA 3EQ2A 1G2CB 2VRSA 2HYNA 2H43A 1NAFA 2ZXEB 1LT9A 1JUNA 2JEEA 3SWYA 1SLQA 1HBWA 2XNXA 2YMYA 3V2PA 5CCHA 3LIEA 3RK3D 5AVTB 1L4AD 1M1JA 3HE4A 2Q9IA 2P2UA 1SQBK 4N78E 4AYCA 1KILA 1KFNA 5APSA 2L5GB 2FKWB 3IR9A 2WPSA 1MV8A 1GW3A 1GD2E 2HPCB 3B8EB 1JY3P 5KLVK 1GU4A 3BRTB 2OYHB 3HUSB 3V4WA 4Y99B 1CI6B 1GDTA 2QM8A 1N73B 1RF1A 1IFIA 3A7OA 1SQPK 2I1JA 2GM4A 1N86A 3KPEA 1NO4A 3V4QA 1AFOA 5KJ7A 1MFZA 4LGDE 2HODA 2WSFH 4LLHA 1DH3A 5AVWB 2O1KA 1FJPA 1URQC 1GTWA 3TK1A 3MUDA 1RE4C 1N7SB 2O1JA 1FOSF 2HLOA 1LTIC 1SVFA 3HRNA 1KILC 3RL0D 1FBMA 1KZUB 3H32A 3RK2D 4JYBA 3HUSC 4WY4C 3T97A 1ZR2A 3GHGB 3L35A 4RESB 5APVA 1L4AC 3PP5A 2XU6A 5AW0B 3VN0A 1JY2N 4DZOA 2W6BA 3G3ZA 3WMM0 4OH8B 1L0LK 2IFMA 3SWFA 4XA4A 1SP4A 3VMXA 3M06A 5BU8B 1H8AA 4C7NB 1SQQK 1URQB 5CCGD 3N4XA 2Z5HA 2XV5A 2POHA 1HGZA 5AVSB 3LIDA 4EIJA 2FFDA 1YTZI 4WY4A 1L4AB 2H7HA 1CSBA 1EQ7A 5CCGA 1IJDB 2IX7C 2HFED 3TYYA 1FJKA 3KDPB 1GL2A 1T3JA 1SFCA 3M0DC 4I6MC 1FZBA 1RE3A 2YKPA 2WTYA 3A3YB 3VMYA 3B5ND 4WBAA 1DEBA 3M9QA 4I2LC 4HYTB 2P1JA 2H8PD 1IFJA 2YNYA 1J1EC 3RK3C 3VP9A 3EFGA 1HJBA 1JO5A 4ZKUA 2FFDC 2IFNA 3VP8A 1T3UA 3RL0B 2NPSC 3HE5A 5BVZA 2YKOA 1S9KD 1GL2D 5AW6B 3HD7C 1FZCB 3B5NA 1LTJB 5CCHD 5AVUB 1T2KC 1WRGA 1SFCC 2OYIA 1IO4A 4WY4D 3NTNA 1X79B 1A02J 1FZGA 3HTKA 1N7SD 1G2CA 1RF0C 2M3BA 2Q7CA 3MD0A 3O8ZA 3RK3B 2KSJA 5CHXA 1RE4A 3RL0C 3HE4B 3UIAA 2NPSA 2KLVA 2WWWA 1GW4A 3P32A 5CCGC 3P7KA 1NH4A 5CJ0A 2HPCA 2ZFCA 2OYHA 1FDMA 3HUSA 3OJAB 4JF7A 1N73A 2C9LY 2WPRA 3BRVB 5AW9B 1VDFA 3TSIA 4C46A 2KP8A 4N78D 5KTBA 2FYZA 1ZV8A 2WT7B 1J1DC 5AW3B 2KYVA 2WSEH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMZ A;  2W27 A;  2N9B A;  1GU5 A;  4JYC A;  1T2K D;  4GT1 A;  1MUU A;  1FAV A;  3A2A A;  3M9H A;  2H7H A;  1H89 A;  2JJL A;  5AW4 B;  1X8Y A;  5AVY B;  1GK4 A;  1CSB A;  3VYI A;  1G2C B;  2VRS A;  1GK6 A;  1H88 A;  1NAF A;  2BAS A;  2ZXE B;  1S9K E;  1JUN A;  3TNU B;  3TYY A;  3KDP B;  1SLQ A;  1HBW A;  2R5D A;  5AW1 B;  3LIE A;  5AVT B;  4AQR D;  4I6M C;  2WPQ A;  3HE4 A;  2P2U A;  4KHX A;  3OAK A;  2WTY A;  5AW8 B;  4AYC A;  5APS A;  5APT A;  3A3Y B;  3L36 A;  3M91 A;  1KQL A;  3NXS A;  3IR9 A;  4GKG A;  2WPS A;  2XZR A;  1MV8 A;  2W6A A;  3VMY A;  1GD2 E;  5APQ A;  3B8E B;  4I2L C;  4HYT B;  2YNY A;  1GU4 A;  1HJB A;  4EOT A;  3V4W A;  1CI6 B;  4C7N A;  3M0D A;  2QM8 A;  2E43 A;  3VTP C;  3HE5 A;  5CMZ A;  3A7O A;  2R5B A;  3MGN A;  4M3L A;  5AW7 B;  1S9K D;  3I5C A;  5AW6 B;  3V4Q A;  3NFQ A;  2WT7 A;  1MFZ A;  1NWQ A;  1DH3 A;  5APY A;  5AVQ B;  1OWA A;  5AVW B;  5AVX B;  5AVU B;  1T2K C;  3A5T A;  3TK1 A;  1GTW A;  3P8M C;  1IO4 A;  3V5B A;  5APX A;  3NTN A;  1FOS F;  2YO2 A;  3KQG A;  1A02 J;  1GZL A;  4LC1 A;  3HTK A;  2P67 A;  2E42 A;  4AUW A;  1A02 F;  2Q7C A;  1HUC A;  3MD0 A;  2R3C A;  4JYB A;  3L37 A;  3M0A A;  3O8Z A;  5AW5 B;  3TNU A;  4B86 A;  2Q5U A;  3T97 A;  1JNM A;  3L35 A;  1HWT C;  4RES B;  5APV A;  2P7J A;  3HE4 B;  3UIA A;  2XU6 A;  5AVV B;  5AW0 B;  2WWW A;  2YO3 A;  3VN0 A;  2IPP A;  4DZO A;  1FOS E;  1YYC A;  3P32 A;  3P7K A;  3SWF A;  1SP4 A;  2ZFC A;  2Q3I A;  5AW2 B;  3VMX A;  3M06 A;  1J2J B;  1H8A A;  1CI6 A;  4C7N B;  2C9L Y;  3NMD A;  2WPR A;  4XE5 B;  5APU A;  5AW9 B;  3HE5 B;  1OXZ A;  5APW A;  2C9N Y;  1CZQ A;  4C46 A;  2Z5H A;  2XV5 A;  5AVZ B;  2KP8 A;  2WT7 B;  2Z5I A;  3M9B A;  2R32 A;  5AVS B;  5AW3 B;  2QM7 A;  3LID A;  5AVR B; 
#chains in the Genus database with same CATH topology
 1URQ D;  1OFC X;  1FC2 C;  1G1J A;  2W27 A;  2N9B A;  5CCH C;  1PFI A;  1HF9 A;  2D2C D;  3AED C;  4PV1 D;  3TGU D;  2N1T B;  3L75 J;  1SFC D;  2RH0 A;  4HKZ H;  1Z56 A;  2Y0E A;  3JCU E;  1QEX A;  1N7S A;  2BCC G;  2XND H;  4UB8 E;  3Q5S A;  2B9B A;  1EDI A;  2R3S A;  5AVY B;  5AW4 B;  5KLI B;  2DW3 A;  4Z1M H;  4IFD K;  3N7N A;  2KS1 B;  4OGQ B;  3GLM A;  2M3E A;  3HD7 A;  1EDL A;  3PHL A;  2BAS A;  3RK2 C;  3TGU E;  3CLQ A;  3B5N C;  3TNU B;  5DJT B;  1KYO D;  2R5D A;  5AW1 B;  2Q1K A;  1IFN A;  1SQX G;  2H88 C;  3GHG A;  2OYI C;  1LWU C;  1H0T B;  2WPQ A;  1W2E A;  2SPZ A;  3G9R A;  1XTC C;  1NJI Q;  3OAK A;  1LTS C;  1EDJ A;  3AE8 C;  3FX0 A;  3LW5 J;  3BCC E;  2E75 C;  3L36 A;  2NPS D;  3NXS A;  4GKG A;  2XZR A;  4ASV A;  2E5T A;  3B4S A;  3WU2 E;  3CXH I;  3L4F A;  4ZKP A;  1ZR4 A;  2A45 I;  4UB6 E;  1HJ0 A;  5APQ A;  1D7M A;  4H0L C;  3WUU A;  1J1D B;  1GL2 C;  1E5W A;  1NTK K;  1S3J A;  3FXD A;  4EOT A;  2FYN C;  4I2L C;  1K8A Q;  3H1H E;  3HD7 D;  2CPB A;  1U7M A;  4C7N A;  3M0D A;  1FS0 E;  3AE9 C;  1M1J C;  2A45 H;  1RE3 C;  3L74 J;  3H1L E;  3L75 D;  4EI2 A;  3VTP C;  3R2P A;  1VQN P;  1NU1 K;  1T8Z A;  2LR2 A;  1FZA A;  1NU1 G;  3U59 A;  4GIF A;  2R5B A;  5GTH E;  1KN7 A;  3BAT A;  1LTT C;  1IC2 A;  1JTH B;  4M3L A;  1ZLL A;  1SQX D;  1QX8 A;  1AQ5 A;  3I5C A;  3CMA P;  2Q6Q A;  1NOH A;  1PGQ A;  5KLV D;  1JOC A;  3RL0 g;  2PGD A;  2Q3E A;  1E79 H;  3KZI E;  1FU1 A;  2LKM A;  3L70 J;  3MHV A;  1SQB J;  2OTJ P;  1NWQ A;  1NTM K;  1JMB A;  2KNC B;  1OWA A;  1EZV I;  1OMI A;  1USD A;  3GF7 A;  3FWN A;  4Y99 C;  5AVQ B;  2NRG A;  4ZNC A;  2WIT A;  2FYU K;  3P8C E;  4WY4 B;  3G6E P;  3GHG C;  1LWU B;  3F89 A;  4WVZ A;  1L4A A;  2OQQ A;  3H1H J;  1M1K Q;  5APX A;  2YO2 A;  1L0N G;  1LTG C;  3L75 E;  3C1L A;  1L0N K;  2QE7 H;  4LC1 A;  5CBO A;  3CCU P;  2K88 A;  4IFF A;  2E75 B;  2WSC H;  3H1H D;  2E42 A;  2KZI A;  3IFM A;  1A02 F;  1LP1 A;  2W6J H;  3GG2 A;  4DCK A;  5KJ7 C;  2AEM A;  1LT9 B;  2R3C A;  1WT6 A;  2GUV A;  3CXH D;  3L37 A;  3M0A A;  4QMA A;  5AW5 B;  1GL2 B;  4D6T J;  4B86 A;  1S5L E;  1P84 D;  4WB4 A;  3K5B A;  4H44 B;  2QIW A;  4IFM A;  5KLV G;  1YJW P;  3MUD C;  2M8R A;  1HWT C;  1AJY A;  3CX5 E;  1M1J B;  3MIW A;  1AA0 A;  5GTH H;  2P7J A;  4H13 D;  1N7S C;  3A0H E;  1FZF A;  1ZME C;  1JM0 A;  1JY2 O;  2IPP A;  1N7L A;  2YKQ A;  1KIL B;  3AEB C;  1YYC A;  2RMZ A;  2KB7 P;  2XKM A;  3AEG C;  3L73 J;  1L0N J;  4I1L A;  4NPF X;  2J58 A;  1RF0 A;  1L0L G;  4UB8 H;  2ZJS E;  4UB6 H;  1S72 P;  5TJH A;  1L0N D;  1VF5 B;  4BXL A;  3MZW B;  1GDT A;  1EXI A;  3H1H G;  4YXD C;  4N6J A;  1RH5 B;  2OYO A;  1CI6 A;  1SQP J;  2M5A A;  1JMM A;  1QL2 A;  1G1I A;  2RN0 A;  3CX5 D;  3NMD A;  2QEX P;  5L8R J;  1RF1 B;  5APU A;  3Q5P A;  1SQV K;  1SQV G;  3V2Q A;  3G71 P;  1OXZ A;  5APW A;  1WMK A;  1AVY A;  1CZQ A;  1M7L A;  3A0B E;  2C9N Y;  3H1J D;  1PP9 J;  1BE3 J;  3E1I A;  2WMM A;  4U3F J;  5AVZ B;  1M8O B;  1KB9 D;  3R4Y A;  1K9M Q;  1KFM A;  4OVN F;  2C0W A;  3M9Q A;  1EZV E;  4W80 A;  2PAJ A;  1IFM A;  3D71 A;  3H1J J;  2MKV A;  3M9B A;  1AVO A;  2R32 A;  3L73 E;  1SQX K;  4U3F D;  1HGV A;  1FZC A;  1LT9 C;  1PL5 A;  2HOD B;  2A06 G;  2PP6 A;  1LTJ A;  3H1I D;  5KKZ C;  2OAR A;  1NYH A;  3CI9 A;  4H44 C;  1GU5 A;  4C7R A;  1OIP A;  3II6 A;  4GT1 A;  3Q5R A;  5TIS E;  3TF5 A;  1PGJ A;  4PJ0 H;  4XFJ A;  2E76 D;  3A2A A;  4IL6 X;  5E79 E;  4BRY A;  3CCR P;  1IZN B;  3L70 E;  3V2N A;  4EDF A;  1H89 A;  1X8Y A;  2FXO A;  3HTK B;  3V2R A;  3H32 B;  1GK4 A;  1KIL D;  5KLV E;  1RY3 A;  1GK6 A;  1X22 A;  2BCC E;  2QJP C;  3A0B H;  1H88 A;  2O01 J;  3D6Y A;  5CJ4 A;  2E75 D;  4RJT A;  1S9K E;  5GTI E;  1NTZ K;  2HG5 D;  1OW6 A;  1J1E B;  4Y28 J;  1VF5 C;  2N9Y B;  3MTU E;  2B87 A;  3T97 B;  1NTZ J;  1RQV A;  3BAS A;  1GMJ A;  3L72 G;  1BCC E;  2QJK B;  3TDK A;  3WU2 H;  1NHL A;  1VPC A;  3O6Q B;  4R4M A;  4AQR D;  1RF1 C;  4H13 C;  2NPS B;  1X9V A;  1NTM J;  2A06 D;  3H1I G;  4KHX A;  4DT0 A;  5AW8 B;  1OX3 A;  1Q90 D;  1JY3 N;  3AE2 C;  3IF4 A;  5APT A;  3M91 A;  1KQL A;  4ZMD A;  3WUT A;  3P8C D;  4N3Y B;  3RGU A;  1IFD A;  1YTZ T;  2W6A A;  4W7Y A;  1LTB C;  4PD4 E;  1IK9 A;  3BCC D;  1NKN A;  2WSE J;  5KLV J;  2E74 D;  2ZAE B;  1QL1 A;  2V7Q J;  3KHU A;  3VOP A;  3I56 P;  1YQ3 C;  3U1A A;  4GDO A;  1L0N E;  1NTZ E;  1URQ A;  1LT1 A;  3L75 G;  4JPZ B;  2E43 A;  4R4L A;  1HH0 A;  1BDC A;  1L2P A;  2N1T D;  1JY3 O;  1NU1 D;  4OGQ D;  5CMZ A;  3AE4 C;  1VL2 A;  3MGN A;  3W68 A;  1BCC J;  5AW7 B;  1OZH A;  1S1C X;  1Y9B A;  2MJZ A;  3H1L G;  5H2F E;  1BDD A;  1EC5 A;  3L72 D;  1JCD A;  1S5L H;  2QJY C;  1K73 Q;  4IOI H;  3NFQ A;  2AXT E;  2WT7 A;  2O01 N;  2Y0D A;  3H1K G;  1HVV A;  3L70 G;  1VQ5 P;  1XTG B;  3AEE C;  4DOJ A;  1N8R Q;  2FFD B;  2GUS A;  5APY A;  5AVX B;  1DX7 A;  5KJ7 D;  2D2C C;  4PV1 C;  3A5T A;  1NGM B;  2N1T A;  1PP9 G;  2O01 H;  3P8M C;  3CCJ P;  2QJK C;  3V5B A;  2WZ7 A;  4O9B A;  1YIJ P;  3BVH A;  3PH0 A;  4HH2 A;  1CW5 A;  3FGA D;  1KTM A;  1S4X A;  2YXR B;  3LW5 H;  2NZ2 A;  3KQG A;  2J59 M;  1GZL A;  2E76 B;  2K9J B;  2Y9Z A;  4PJ0 E;  3CL3 D;  2P67 A;  2FY8 A;  2JKV A;  3CWB J;  3PRJ A;  3OA7 A;  4W7Z A;  5BU5 A;  3HD7 B;  2XDJ A;  2WSS H;  4AUW A;  3CC7 P;  1HUC A;  2IYO A;  5B5E H;  2O3J A;  2ZT9 B;  4TT3 H;  3TNU A;  1LTJ C;  1FZC C;  1SQX J;  1JCC A;  1VF5 D;  2Q5U A;  1JNM A;  1JY2 P;  1SFC B;  1KMI Z;  3F5H A;  3H1K E;  3L71 G;  3L70 D;  1U7J A;  2IZ0 A;  1RQU A;  2JDI H;  1SQB D;  2KIK A;  2YO3 A;  5AVV B;  3D6Z A;  3CCV P;  2QA4 P;  1BCC D;  1FOS E;  1PGP A;  3W67 A;  4A7P A;  2FBW C;  1PP9 D;  1LGH B;  2LXB A;  2PFX A;  2AXT H;  3RBZ A;  3EFF K;  1OW8 A;  1U57 A;  4D6T G;  2I1K A;  2WSF J;  1AV1 A;  2Q3I A;  5AW2 B;  1SQB E;  1DD3 A;  1J2J B;  3AE1 C;  2JO1 A;  3KYQ A;  3L71 E;  1VQK P;  2KOG A;  1N2D C;  4XE5 B;  1SQV D;  1BE3 E;  2N1T C;  2ZYD A;  3C9I A;  2W90 A;  2H89 C;  2A45 G;  3HE5 B;  1VQ9 P;  2W83 C;  3Q1M A;  1JTH A;  2YIU C;  2K3R A;  1HTL C;  2E76 C;  1BGY D;  2CPS A;  3CX5 H;  2V4H A;  1NKZ B;  3L71 D;  1UII A;  1ZN5 A;  2BEZ F;  1FZE A;  2RKL A;  3GMA A;  3AE5 C;  3H1I E;  1SQB G;  1LTA C;  2Z5I A;  2OYH C;  3RK2 B;  1BCC G;  2QM7 A;  2QG4 A;  3RK3 E;  3S4R A;  5AVR B;  3B5N B;  4D6T E;  5TIS H;  3CCQ P;  4NPD A;  3VMZ A;  2C0X A;  3SSU A;  1N73 C;  1MZ9 A;  1OVR A;  1S2E A;  4JYC A;  1T2K D;  5EFW B;  3PLN A;  2OYI B;  1LWU A;  1MUU A;  1FAV A;  3H6P A;  2JP3 A;  3M9H A;  2JJL A;  2FXM A;  3H1L J;  4GOF A;  3U1C A;  3VYI A;  2Z4E A;  3EQ2 A;  1G2C B;  2KLU A;  1LP1 B;  2HYN A;  2VRS A;  2ZYA A;  4HB1 A;  2H43 A;  1NAF A;  2IDB A;  2ZXE B;  3KXD A;  1YI2 P;  1LT9 A;  1VQ4 P;  1JUN A;  2JEE A;  1RHZ B;  3SWY A;  1SLQ A;  2IBZ G;  1HBW A;  2XNX A;  2YMY A;  3BCC J;  3V2P A;  1BGY G;  5CCH A;  1VQO P;  2WSC J;  1ZXG A;  3LIE A;  3RK3 D;  1PGO A;  5AVT B;  1YHQ P;  2E74 C;  1L4A D;  1M1J A;  3HE4 A;  5KAF E;  2E5Y A;  2P2U A;  1SQB K;  2Y0C A;  2Q9I A;  4N78 E;  1EZV D;  2GA1 A;  2R44 A;  1W5C E;  3E7K A;  1KFN A;  1KIL A;  1R5L A;  2L5G B;  1KYO H;  5APS A;  4AYC A;  2FKW B;  1LNQ A;  2JWD A;  3IR9 A;  1ZW0 A;  2WPS A;  4OGQ C;  1MV8 A;  2HR3 A;  3JSV C;  4K35 A;  1EXJ A;  2WQY C;  2KI7 B;  1GW3 A;  1GD2 E;  3BCC G;  3AE3 C;  1JY3 P;  3B8E B;  1Y47 A;  3CXH E;  4GOE A;  2HPC B;  5KLV K;  1NAY A;  1GU4 A;  3BRT B;  3C8V A;  4JQ0 D;  2OYH B;  3HUS B;  4MN4 C;  3V4W A;  2FYU J;  3GW6 A;  3ITK A;  1CI6 B;  4Y99 B;  2M5A B;  2IYP A;  2QM8 A;  1KOR A;  2WPV B;  3ABV C;  1RF1 A;  1N73 B;  1PPJ G;  3AEC C;  2IBZ E;  1IFI A;  3A7O A;  1SQP K;  2I1J A;  2IBZ D;  2GM4 A;  1N86 A;  3H1L D;  3KPE A;  1KQS O;  1NO4 A;  2K37 A;  1KYO I;  1SQQ E;  2KXP B;  1YJ9 P;  3AE7 C;  3V4Q A;  1AFO A;  4H0L B;  2V7Q H;  3H1K D;  3USS A;  1KB9 H;  5KJ7 A;  1MFZ A;  2AEJ A;  4LGD E;  3CCM P;  1Q7Y Q;  2HOD A;  2ZYG A;  2FYN B;  2WSF H;  4LLH A;  1DH3 A;  5AVW B;  2O1K A;  3QH9 A;  4H44 D;  1URQ C;  1FJP A;  3L74 G;  2OTK E;  1SQV E;  3TK1 A;  1GTW A;  4JBZ A;  1ZRT E;  3MUD A;  1RE4 C;  2E74 B;  4BRY B;  1L0L J;  1N7S B;  1SQP E;  2O1J A;  1FOS F;  2HLO A;  1LTI C;  1P84 H;  1SVF A;  2P58 A;  3HRN A;  1K05 A;  1KIL C;  1FBM A;  1KZU B;  3H32 A;  3RL0 D;  2KS1 A;  1KYO E;  1SQP D;  1YBK A;  1PP9 E;  1BGY E;  1UIX A;  2BEQ D;  3RK2 D;  1ZRT D;  4JYB A;  1NTK G;  1YIT P;  3L74 E;  2I8D A;  4PD4 I;  3ZDM A;  2JR8 A;  2FYU D;  2OTL P;  3HUS C;  4WY4 C;  1BE3 D;  2Y9Y A;  2W8Z A;  3GHG B;  3L35 A;  3T97 A;  1KIL E;  4ASW A;  4EYY Q;  4RES B;  5APV A;  1ZR2 A;  1L4A C;  3PP5 A;  3O6Q A;  4NPE A;  3CX5 I;  4U7J A;  3Q3D A;  2XU6 A;  5AW0 B;  3VN0 A;  2ZXX A;  1JY2 N;  4DZO A;  4I7Z B;  2W6B A;  3G3Z A;  3WMM 0;  1PZQ A;  3L72 J;  4OH8 B;  2QRX A;  1M56 D;  1EDK A;  1KD1 Q;  1L0L K;  1S5L X;  2IFM A;  1DEE G;  4WWI A;  3TGU J;  1FDO A;  4D6T D;  4XA4 A;  3SWF A;  1NTZ G;  1SP4 A;  3SWK A;  3PJS K;  3VMX A;  1LJ2 A;  4CPG A;  3M06 A;  5BU8 B;  4KT0 J;  5KKZ B;  1H8A A;  2YMK A;  3H25 A;  3CWB G;  4KJM A;  4C7N B;  1SQQ K;  1URQ B;  2G8Y A;  3H1J E;  2FYU E;  3AE6 C;  5CCG D;  1ZP0 C;  3N4X A;  1TU3 F;  2Z5H A;  2XV5 A;  3A0H H;  1BE3 G;  2WVR A;  3CCE P;  3E1R A;  2A06 E;  3CWB E;  1OVV A;  2POH A;  1VQ8 P;  2QJP B;  1Q2N A;  1HGZ A;  3L72 E;  3JCU H;  5AVS B;  3LID A;  1T6A A;  4EIJ A;  1M57 D;  2FFD A;  2AXC A;  2KNC A;  2P10 A;  3Q2Y A;  1YTZ I;  2UWJ E;  1NU1 E;  1BSN A;  4WY4 A;  5M1B A;  4L74 A;  3TGU G;  4HJG H;  1NTZ D;  1L4A B;  5H2F H;  2H7H A;  3CD6 P;  1OVU A;  3WUV A;  4I7Z C;  2K9J A;  3QWO C;  1CSB A;  1EQ7 A;  1SQV J;  5CCG A;  1P84 E;  1IJD B;  3FXE A;  2IX7 C;  1NTK E;  1L0L E;  2HFE D;  1FJK A;  3KDP B;  4IL6 E;  3TYY A;  1GL2 A;  5CBN A;  2K1A A;  1T3J A;  1BGY J;  4IL6 H;  3L71 J;  4H0L D;  3CXH H;  1SFC A;  3L73 G;  3M0D C;  4L76 A;  2JWA A;  4I6M C;  1FZB A;  1RE3 A;  2YKP A;  4RO0 A;  4U3F E;  3S9O A;  1EZV G;  2B88 A;  2WTY A;  1KB9 E;  2K9Y A;  1OW7 A;  3V6I A;  3S1K A;  1PIX A;  4YXW H;  5B66 H;  1Q86 Q;  1BSH A;  3A3Y B;  3VMY A;  3B5N D;  5KAF H;  4WBA A;  1DEB A;  2QJY B;  1SS1 A;  2ZT9 D;  2ZVN B;  1AQT A;  2B89 A;  1P84 I;  2H8P D;  2P1J A;  1IFJ A;  1NTK J;  1J1E C;  2YNY A;  4HYT B;  3RK3 C;  3EFG A;  3VP9 A;  3OW2 O;  1HJB A;  1JO5 A;  2M0B A;  3D70 A;  1R5S A;  4ZKU A;  2FFD C;  2IFN A;  1W2B O;  3VP8 A;  1T3U A;  1PPJ D;  3RL0 B;  1SQX E;  4H13 B;  2NPS C;  1FDI A;  2CK3 H;  3HE5 A;  3IAO A;  5BVZ A;  5B66 E;  1K04 A;  3JC2 2;  1IK7 A;  2J5U A;  1SQQ J;  2YKO A;  3KZI H;  1VQP P;  1KV4 A;  1KB9 I;  3H1K J;  1PPJ E;  2YXQ B;  1S9K D;  1Q81 Q;  1GL2 D;  3L73 D;  1NVO A;  1Q82 Q;  5AW6 B;  2AEF A;  2IZ1 A;  2KSE A;  1Y8A A;  2ITA A;  3HD7 C;  4DJG A;  4YTP C;  1FZC B;  3RBX A;  1SQQ G;  3B5N A;  1LTJ B;  2PRR A;  3L74 D;  5CCH D;  5AVU B;  1T2K C;  1WRG A;  1VQ6 P;  1SFC C;  1PV3 A;  3B71 A;  2OYI A;  1IO4 A;  1DIP A;  5C39 A;  3GF3 A;  4RKU J;  4WY4 D;  3SFD C;  3NTN A;  1X79 B;  5K5G B;  1A02 J;  1IFP A;  3AEA C;  1FZG A;  3HTK A;  1N7S D;  3EWK A;  1SQP G;  3CPW O;  1G2C A;  3CC4 P;  1NU1 J;  4GOD A;  1RF0 C;  3PTZ A;  1QLE D;  2KZJ A;  2M3B A;  3MD0 A;  1NTK D;  1YQ4 C;  2Q7C A;  1R8E A;  3CC2 P;  3O8Z A;  3VMA A;  3RK3 B;  2KSJ A;  4BWN A;  1ZOY C;  1NTM G;  2FYU G;  3H1I J;  5CHX A;  2B87 B;  2D2C B;  4PV1 B;  3I55 P;  1VQ7 P;  3SFE C;  3CCS P;  1RE4 A;  4TLF A;  3RL0 C;  3AEF C;  3HE4 B;  3UIA A;  2NPS A;  3MP7 B;  5GTI H;  1SQQ D;  2KLV A;  2WWW A;  1YJN P;  5KLI C;  1GW4 A;  1FE6 A;  2OGU A;  1QGK B;  1JB0 J;  2IBZ I;  1JEK A;  2QVA A;  2YIU B;  3P32 A;  5CCG C;  1DD4 A;  1MFT A;  2BCC J;  3P7K A;  1NH4 A;  1KQF B;  1USE A;  5CJ0 A;  1L0L D;  2HPC A;  2ZT9 C;  4YPC A;  2LXC B;  4PD4 H;  1KQG B;  5DJU B;  5E79 H;  2ZFC A;  3IN6 A;  2OYH A;  2BCC D;  1FDM A;  3CME P;  3FWL A;  3HUS A;  3OJA B;  3CWB D;  5B5E E;  2G3A A;  1QVF O;  4K3A A;  4JF7 A;  1N73 A;  2ZVO B;  2C9L Y;  2WPR A;  3BRV B;  1KC8 Q;  1VQM P;  1H0T A;  2QSI A;  4L73 A;  4L75 A;  5AW9 B;  1VQL P;  4PD4 D;  1NTM E;  1VDF A;  1M90 Q;  1NTM D;  3TSI A;  3CCL P;  4C46 A;  1QVG O;  1MKM A;  2KP8 A;  3H1J G;  5KAI E;  1X0T A;  2L91 A;  4N78 D;  5KAI H;  5KTB A;  2FYZ A;  1ZV8 A;  2KUB A;  2WT7 B;  1J1D C;  3G4S P;  5AW3 B;  4U3F G;  2KK7 A;  4OWF A;  2FXP A;  2KYV A;  2WSE H; 
#chains in the Genus database with same CATH homology
 1URQ D;  1G1J A;  2W27 A;  5CCH C;  2N9B A;  1PFI A;  2N1T B;  1SFC D;  1Z56 A;  1N7S A;  5AW4 B;  5AVY B;  4IFD K;  3N7N A;  3HD7 A;  2BAS A;  3RK2 C;  3CLQ A;  3B5N C;  3TNU B;  2R5D A;  5AW1 B;  1IFN A;  3GHG A;  2OYI C;  1LWU C;  2WPQ A;  1W2E A;  1XTC C;  3OAK A;  1LTS C;  3L36 A;  2NPS D;  3NXS A;  4GKG A;  2XZR A;  3L4F A;  4ZKP A;  1ZR4 A;  2A45 I;  5APQ A;  1J1D B;  1GL2 C;  1E5W A;  1NTK K;  4EOT A;  3HD7 D;  2CPB A;  4C7N A;  3M0D A;  1M1J C;  2A45 H;  1RE3 C;  3VTP C;  3R2P A;  1NU1 K;  1T8Z A;  1FZA A;  3U59 A;  4GIF A;  2R5B A;  3BAT A;  1LTT C;  1IC2 A;  1JTH B;  4M3L A;  1ZLL A;  1AQ5 A;  3I5C A;  1NOH A;  1JOC A;  1FU1 A;  2LKM A;  1NWQ A;  1NTM K;  5AVQ B;  1OWA A;  4Y99 C;  2WIT A;  2FYU K;  3P8C E;  4WY4 B;  3GHG C;  1LWU B;  1L4A A;  5APX A;  2YO2 A;  1LTG C;  4LC1 A;  1L0N K;  4IFF A;  2WSC H;  2E42 A;  3IFM A;  1A02 F;  5KJ7 C;  1LT9 B;  2R3C A;  1WT6 A;  2GUV A;  3L37 A;  3M0A A;  5AW5 B;  1GL2 B;  4B86 A;  4WB4 A;  4IFM A;  1HWT C;  2M8R A;  1M1J B;  3MIW A;  1FZF A;  2P7J A;  1N7S C;  1JY2 O;  2IPP A;  1N7L A;  2YKQ A;  1KIL B;  1YYC A;  2XKM A;  2KB7 P;  4I1L A;  2J58 A;  1RF0 A;  4N6J A;  1CI6 A;  1JMM A;  1QL2 A;  1G1I A;  3NMD A;  1RF1 B;  5APU A;  1SQV K;  3V2Q A;  1OXZ A;  5APW A;  2C9N Y;  1M7L A;  1CZQ A;  4DOJ A;  3E1I A;  5AVZ B;  1KFM A;  4W80 A;  2C0W A;  2PAJ A;  1IFM A;  3M9B A;  2R32 A;  1SQX K;  1HGV A;  1FZC A;  2PP6 A;  1LT9 C;  2HOD B;  1LTJ A;  2OAR A;  3CI9 A;  1GU5 A;  4C7R A;  3II6 A;  4GT1 A;  3A2A A;  3V2N A;  1H89 A;  1X8Y A;  3HTK B;  3V2R A;  3H32 B;  1GK4 A;  1KIL D;  1RY3 A;  1GK6 A;  1H88 A;  5CJ4 A;  1S9K E;  1NTZ K;  2HG5 D;  1J1E B;  3MTU E;  3BAS A;  4AQR D;  1NHL A;  1VPC A;  1RF1 C;  2NPS B;  1X9V A;  4KHX A;  5AW8 B;  1JY3 N;  5APT A;  3M91 A;  1KQL A;  3P8C D;  4N3Y B;  1IFD A;  1YTZ T;  2W6A A;  4W7Y A;  1LTB C;  1IK9 A;  1NKN A;  1QL1 A;  3VOP A;  3U1A A;  1URQ A;  2E43 A;  1HH0 A;  2N1T D;  1JY3 O;  5CMZ A;  3MGN A;  5AW7 B;  2MJZ A;  1JCD A;  3NFQ A;  2WT7 A;  1HVV A;  1XTG B;  2FFD B;  2GUS A;  5APY A;  5AVX B;  1DX7 A;  5KJ7 D;  3A5T A;  2N1T A;  3P8M C;  2O01 H;  3V5B A;  2WZ7 A;  4O9B A;  3BVH A;  1CW5 A;  4HH2 A;  3LW5 H;  3KQG A;  2J59 M;  1GZL A;  3CL3 D;  2P67 A;  4AUW A;  4W7Z A;  3OA7 A;  5BU5 A;  3HD7 B;  2XDJ A;  1HUC A;  1FZC C;  3TNU A;  1LTJ C;  1JCC A;  2Q5U A;  1JNM A;  1JY2 P;  1SFC B;  5AVV B;  2YO3 A;  1FOS E;  1LGH B;  2I1K A;  2Q3I A;  5AW2 B;  1J2J B;  3KYQ A;  2KOG A;  1N2D C;  4XE5 B;  2N1T C;  3HE5 B;  3C9I A;  2A45 G;  1JTH A;  1HTL C;  2CPS A;  1NKZ B;  1ZN5 A;  1FZE A;  1LTA C;  2Z5I A;  2OYH C;  3RK2 B;  2QM7 A;  5AVR B;  3B5N B;  3VMZ A;  2C0X A;  1N73 C;  1MZ9 A;  4JYC A;  1T2K D;  2OYI B;  1LWU A;  1MUU A;  1FAV A;  3H6P A;  3M9H A;  2JJL A;  2FXM A;  3U1C A;  3VYI A;  2Z4E A;  3EQ2 A;  1G2C B;  2VRS A;  2HYN A;  2H43 A;  1NAF A;  2ZXE B;  1LT9 A;  1JUN A;  2JEE A;  3SWY A;  1SLQ A;  1HBW A;  2XNX A;  2YMY A;  3V2P A;  5CCH A;  3LIE A;  3RK3 D;  5AVT B;  1L4A D;  1M1J A;  3HE4 A;  2Q9I A;  2P2U A;  1SQB K;  4N78 E;  4AYC A;  1KIL A;  1KFN A;  5APS A;  2L5G B;  2FKW B;  3IR9 A;  2WPS A;  1MV8 A;  1GW3 A;  1GD2 E;  2HPC B;  3B8E B;  1JY3 P;  5KLV K;  1GU4 A;  3BRT B;  2OYH B;  3HUS B;  3V4W A;  4Y99 B;  1CI6 B;  1GDT A;  2QM8 A;  1N73 B;  1RF1 A;  1IFI A;  3A7O A;  1SQP K;  2I1J A;  2GM4 A;  1N86 A;  3KPE A;  1NO4 A;  3V4Q A;  1AFO A;  5KJ7 A;  1MFZ A;  4LGD E;  2HOD A;  2WSF H;  4LLH A;  1DH3 A;  5AVW B;  2O1K A;  1FJP A;  1URQ C;  1GTW A;  3TK1 A;  3MUD A;  1RE4 C;  1N7S B;  2O1J A;  1FOS F;  2HLO A;  1LTI C;  1SVF A;  3HRN A;  1KIL C;  3RL0 D;  1FBM A;  1KZU B;  3H32 A;  3RK2 D;  4JYB A;  3HUS C;  4WY4 C;  3T97 A;  1ZR2 A;  3GHG B;  3L35 A;  4RES B;  5APV A;  1L4A C;  3PP5 A;  2XU6 A;  5AW0 B;  3VN0 A;  1JY2 N;  4DZO A;  2W6B A;  3G3Z A;  3WMM 0;  4OH8 B;  1L0L K;  2IFM A;  3SWF A;  4XA4 A;  1SP4 A;  3VMX A;  3M06 A;  5BU8 B;  1H8A A;  4C7N B;  1SQQ K;  1URQ B;  5CCG D;  3N4X A;  2Z5H A;  2XV5 A;  2POH A;  1HGZ A;  5AVS B;  3LID A;  4EIJ A;  2FFD A;  1YTZ I;  4WY4 A;  1L4A B;  2H7H A;  1CSB A;  1EQ7 A;  5CCG A;  1IJD B;  2IX7 C;  2HFE D;  3TYY A;  1FJK A;  3KDP B;  1GL2 A;  1T3J A;  1SFC A;  3M0D C;  4I6M C;  1FZB A;  1RE3 A;  2YKP A;  2WTY A;  3A3Y B;  3VMY A;  3B5N D;  4WBA A;  1DEB A;  3M9Q A;  4I2L C;  4HYT B;  2P1J A;  2H8P D;  1IFJ A;  2YNY A;  1J1E C;  3RK3 C;  3VP9 A;  3EFG A;  1HJB A;  1JO5 A;  4ZKU A;  2FFD C;  2IFN A;  3VP8 A;  1T3U A;  3RL0 B;  2NPS C;  3HE5 A;  5BVZ A;  2YKO A;  1S9K D;  1GL2 D;  5AW6 B;  3HD7 C;  1FZC B;  3B5N A;  1LTJ B;  5CCH D;  5AVU B;  1T2K C;  1WRG A;  1SFC C;  2OYI A;  1IO4 A;  4WY4 D;  3NTN A;  1X79 B;  1A02 J;  1FZG A;  3HTK A;  1N7S D;  1G2C A;  1RF0 C;  2M3B A;  2Q7C A;  3MD0 A;  3O8Z A;  3RK3 B;  2KSJ A;  5CHX A;  1RE4 A;  3RL0 C;  3HE4 B;  3UIA A;  2NPS A;  2KLV A;  2WWW A;  1GW4 A;  3P32 A;  5CCG C;  3P7K A;  1NH4 A;  5CJ0 A;  2HPC A;  2ZFC A;  2OYH A;  1FDM A;  3HUS A;  3OJA B;  4JF7 A;  1N73 A;  2C9L Y;  2WPR A;  3BRV B;  5AW9 B;  1VDF A;  3TSI A;  4C46 A;  2KP8 A;  4N78 D;  5KTB A;  2FYZ A;  1ZV8 A;  2WT7 B;  1J1D C;  5AW3 B;  2KYV A;  2WSE H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...