1GU4A

Crystal structure of c/ebpbeta bzip homodimer bound to a high affinity dna fragment
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
total genus 32
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu4A00
3NFQA 3A2AA 3KQGA 2WPSA 4AUWA 1S9KE 1X8YA 3A3YB 2WPRA 5APVA 4EOTA 4JYBA 3B8EB 4RESB 2QM7A 5AW0B 1GK4A 3HE5A 5AVQB 5AW5B 2E42A 5AW8B 2VRSA 5APQA 5APUA 3TNUA 1GK6A 1JNMA 4HYTB 4C7NB 3VYIA 3M0AA 3L36A 5AW3B 3VN0A 3A7OA 2R5BA 3VTPC 3L35A 3M9HA 5AVUB 1GTWA 1H88A 5APTA 5AW7B 3LIDA 2H7HA 1T2KD 3VMYA 1SP4A 1CZQA 3IR9A 3L37A 5AVVB 3MD0A 3VMZA 4DZOA 1MFZA 1S9KD 3KDPB 2QM8A 3NMDA 4C46A 5AVRB 3NXSA 2C9LY 4GKGA 4B86A 2JJLA 3TK1A 3UIAA 5APXA 2P2UA 1A02J 1CSBA 4KHXA 1KQLA 3V5BA 3V4QA 1IO4A 1NAFA 5APWA 1T2KC 3NTNA 4GT1A 3M91A 2XZRA 4C7NA 5APSA 2BASA 2P7JA 2R5DA 3HE4A 3I5CA 5AVZB 2Q5UA 3P7KA 1JUNA 1MUUA 1CI6B 3HE4B 2WT7B 3VMXA 2W27A 3O8ZA 5AVTB 5AVWB 1HWTC 3MGNA 2YNYA 2Z5HA 2C9NY 1HBWA 1MV8A 1NWQA 2R32A 2YO2A 1GU4A 3M0DA 4AQRD 2WT7A 1HJBA 1FOSF 2XU6A 1G2CB 1GZLA 3P32A 2KP8A 2WPQA 3HE5B 4JYCA 3LIEA 3A5TA 1FOSE 1GD2E 2IPPA 2E43A 1YYCA 1OXZA 5AVXB 1DH3A 2W6AA 3P8MC 3M06A 4AYCA 5AVYB 5AW6B 2Q3IA 5AW1B 3OAKA 5AW9B 1FAVA 1H8AA 2ZFCA 1J2JB 4M3LA 3SWFA 1H89A 2XV5A 3T97A 5AW4B 4LC1A 1SLQA 1GU5A 4I2LC 1A02F 1CI6A 2P67A 5AW2B 2YO3A 1HUCA 1OWAA 2N9BA 2ZXEB 2Q7CA 4I6MC 2R3CA 3HTKA 5APYA 5CMZA 2WWWA 3M9BA 5AVSB 2Z5IA 3V4WA 2WTYA 3TYYA 3TNUB 4XE5B
chains in the Genus database with same CATH superfamily
2P1JA 3HRNA 1LP1A 2YIUB 4AUWA 1VF5B 1RE3A 1BCCG 3L71D 1NU1E 3B4SA 1KILC 3MIWA 3WUTA 2WSEH 3GF3A 1FDIA 3MUDA 3BVHA 2FYZA 4GOEA 1FS0E 1VF5D 2IZ0A 2IBZG 2RMZA 4KJMA 2QM7A 1KFMA 2YXQB 2KS1B 4HB1A 4NPFX 1SQVK 2K9JA 2PRRA 3RK2D 5GTIE 2Y9ZA 1GK4A 2GM4A 2E75D 2D2CD 5KLVK 4H0LD 2OYHB 5AW8B 2VRSA 1PP9D 3TNUA 1PGQA 4OGQB 1KYOD 2KNCA 3L74E 4HYTB 5AW3B 3VN0A 2D2CB 2WSFJ 2Y0DA 1SQXG 2YKQA 3JC22 4TLFA 1S5LE 2YKOA 4L75A 4DJGA 3CX5H 3H1JE 4EIJA 3CCRP 1VQ5P 2KXPB 1KYOE 2K9YA 3LIDA 5GTHH 5KLIB 1JM0A 2QJPB 4UB8H 2IFMA 4GODA 1VQKP 3AE1C 1SQPK 1N7LA 4UB8E 4BWNA 1JY3P 1Q2NA 1E5WA 3EWKA 3GMAA 3H32B 3GHGC 3O6QA 4W7ZA 2RN0A 1U7JA 1NO4A 3MD0A 2N1TC 1IFJA 1PZQA 1JY3O 3HUSB 3PRJA 1BSNA 4DZOA 1FU1A 2ZJSE 4D6TG 1SQPD 1KILB 1S9KD 1NTZG 3KDPB 2QM8A 2FYUG 3H1IJ 2KNCB 2JR8A 2FFDC 1L2PA 1M7LA 1SFCC 2OQQA 1SQQD 1QL1A 1T6AA 2IX7C 2JJLA 4NPEA 1NTMG 5B5EH 1AQ5A 1H0TA 3L70G 3Q5SA 1M1JA 2W8ZA 1VQ6P 1SQBJ 3SWYA 2P2UA 1IFNA 1A02J 2K9JB 1VDFA 3B71A 1J1EB 2J5UA 1IK7A 1KQLA 5E79H 3V5BA 4JPZB 3PH0A 1L4AB 1M1KQ 3NTNA 1HJ0A 2BCCG 3L72G 4H13B 3WUUA 4Z1MH 2V4HA 1XTCC 3TGUE 5B66H 2K3RA 2P7JA 1LTJC 2KYVA 2WSEJ 3H1JD 4PD4I 1GW3A 2HG5D 1J1EC 5AVZB 3CCMP 1UIXA 2Q5UA 1K9MQ 1RH5B 3GHGB 1FJKA 3AEFC 2OYHA 1QGKB 2W6BA 1PGJA 1KILE 3RK2C 3M0DC 2P58A 3JCUE 4PD4D 1BGYJ 1PPJE 1G1IA 3H1ID 3FX0A 1W2BO 1NWQA 2R3SA 2YO2A 2BEZF 3MHVA 1AVYA 2WT7A 1NU1K 3CC7P 1NTZJ 3CCUP 1S3JA 1NTKE 1G2CB 5C39A 1JY3N 4OGQC 2ZAEB 1YTZT 1EZVG 2BEQD 1NU1D 3HE5B 4JYCA 4R4MA 3SWKA 3H32A 3G6EP 1ZOYC 1GD2E 3D70A 2OTJP 1FZGA 1GL2C 2RH0A 3AEBC 2P10A 5AW6B 1USDA 3KZIE 2Q3IA 3A0BE 3S4RA 1L0LG 3OAKA 1K73Q 1R5LA 1M56D 2IBZI 1L4AC 5AW9B 1Q7YQ 1N8RQ 1BDCA 5KKZB 1H8AA 1J2JB 1NTZK 2O3JA 1L0LJ 4PD4H 1BDDA 1AQTA 2NPSC 3EQ2A 4A7PA 3T97A 1KQFB 3G71P 5AW4B 5KAFE 1SLQA 1SFCA 2BCCE 4ZKUA 4IFDK 3ABVC 1SQXJ 4PV1C 2GUVA 1WT6A 2P67A 2XKMA 1BE3D 1RF1A 2FFDB 1HUCA 1L4AA 1AFOA 1JO5A 4U3FJ 1HTLC 1N7SB 1NVOA 1JEKA 2O01H 3LW5J 3CXHD 4K35A 5KJ7D 4IL6X 5APYA 2HPCB 3H1HG 3L73D 2N1TA 2NPSA 4IL6H 2Q9IA 1JB0J 3E1IA 3GG2A 4H44C 1KD1Q 4U3FG 1URQD 2WTYA 3N4XA 3AE5C 3V6IA 3CCJP 4L73A 2C9LY 3MZWB 3A2AA 1W2EA 1K05A 3H1KG 1ZV8A 3L73E 1YJWP 3TGUG 2KZJA 2CK3H 1GL2B 4I1LA 1EZVI 1EDIA 3T97B 1NTKG 1VQNP 3CWBD 3OJAB 1E79H 2O1KA 1SQVG 3AE4C 2WPRA 2E74D 4QMAA 3CC4P 1RQVA 1IJDB 1M57D 2LR2A 2YMYA 2QJYB 3CWBE 4UB6H 4Y99C 2IZ1A 2K88A 2HPCA 3AE6C 1L0NK 3RK2B 1JMBA 3CCSP 1LTTC 3CX5I 3HE5A 1BE3J 2E42A 1SVFA 3L72J 1YQ3C 5KLVE 3L74G 2IDBA 5APQA 1VQ4P 3AE2C 5H2FH 3TNUB 4C7NB 1TU3F 3VYIA 3M0AA 3CX5E 2O01N 3A7OA 2KLUA 3E1RA 1EDJA 2R5BA 1NAYA 3VTPC 2M0BA 3O6QB 2Q3EA 3B5NC 4MN4C 5AVUB 5APTA 4YXDC 1GTWA 3WU2H 1T2KD 2J58A 1D7MA 1KC8Q 2H7HA 1KQGB 1NH4A 1IFIA 2OARA 1SP4A 1JY2N 3IR9A 3L71J 3RL0B 3V2QA 1OZHA 3V2RA 3KYQA 2POHA 2Y0CA 1IFPA 2KIKA 1KFNA 3L70E 2N1TD 3SFDC 5K5GB 1MFZA 2ZVOB 2FFDA 3CXHI 3H1KJ 1NKNA 3NMDA 4C46A 2QG4A 1X22A 4BRYB 5CJ0A 2WSCJ 3RK3E 4Y99B 1OW7A 1P84H 1SQVJ 2E75C 4GOFA 4DCKA 1PP9J 3TK1A 1K8AQ 3QWOC 1LTAC 3UIAA 5APXA 2A45G 3RGUA 1N7SC 4KHXA 5KLVD 3QH9A 2WVRA 3VP8A 1NAFA 1EQ7A 4EYYQ 1RHZB 2L91A 1LT9A 5DJTB 2ZT9B 1L0NJ 2NZ2A 2JDIH 1NHLA 2R44A 3H1HJ 1KYOH 1RY3A 3IAOA 3M91A 5APSA 2BASA 5KAIE 2R5DA 4C7NA 2NPSB 5CBOA 1HVVA 1PPJD 3H1IE 1NTZD 2IFNA 1VF5C 4CPGA 3P7KA 2FYUD 1CI6B 2A06G 1SQBK 1SQBE 2FXMA 2W27A 2ZYGA 3IFMA 1BCCD 1FBMA 3O8ZA 4PJ0E 3L70D 2QSIA 4UB6E 5AVWB 1N73C 2WPVB 1GW4A 1MV8A 1AJYA 1NYHA 2R32A 3AE9C 3CLQA 3V2PA 2XNXA 5GTIH 1EC5A 2KSEA 4RO0A 3H25A 1QL2A 1GU4A 4PV1D 1UIIA 1OX3A 1FZBA 1HJBA 1KB9D 2B87B 1GZLA 1OVVA 2KLVA 2WPQA 2WMMA 4ZMDA 2M5AA 3LIEA 3N7NA 1ZRTE 2E43A 4R4LA 2N9YB 3PHLA 4WWIA 1JTHB 5AVXB 4ASWA 3VP9A 1M1JC 2XNDH 1R5SA 3B5NB 3L75E 5AVYB 3F5HA 2H89C 4N78E 1M90Q 4YPCA 5AW1B 1BGYE 2PP6A 2JWAA 2LKMA 1AA0A 3H1LJ 1WMKA 4PD4E 2AEJA 2FYUK 2H88C 2M3EA 1LGHB 2O01J 4HH2A 4LLHA 1URQC 4W80A 3SWFA 1NTZE 2XV5A 1FDMA 2B88A 1NOHA 1U57A 3H1LG 4H44D 1BCCJ 3WUVA 3EFFK 1G2CA 3R2PA 4YTPC 3A0BH 1A02F 1OIPA 3U1CA 5KJ7C 1CI6A 1Q82Q 5AW2B 3K5BA 3GHGA 3HD7B 1EZVD 1OWAA 1SQPG 2N9BA 2ZXEB 3BCCJ 3R4YA 4L76A 4Y28J 5DJUB 2Q7CA 2R3CA 5CMZA 2QRXA 1NU1J 2H8PD 2IYPA 2WWWA 3GF7A 2NPSD 1GL2A 3BCCG 4WBAA 1PGOA 1NTMD 3L75G 1VQ7P 1SQQK 4LGDE 1YBKA 1LTSC 4ZNCA 4KT0J 2ZT9D 4XE5B 3NFQA 5APUA 1LTJB 5CJ4A 3KQGA 1YJNP 1USEA 4NPDA 2Q6QA 1IZNB 1MZ9A 3AEEC 1N2DC 2BCCJ 2E76B 5CCHD 1L0NG 3ITKA 2AXTH 2WSSH 3A3YB 1U7MA 5TJHA 1P84D 5APVA 3CCEP 1LTGC 3WMM0 3JCUH 1BE3G 1KYOI 4JYBA 4L74A 4RESB 4WY4A 3L74J 5AW0B 4N3YB 1MFTA 2M8RA 1NTKK 1JOCA 3FXDA 1FZCC 3H1JJ 3AE7C 5AW5B 1FZCA 1LJ2A 2NRGA 2I1JA 2KS1A 1JNMA 2ZYDA 2FYUJ 3H1IG 3L73J 3HD7D 1S1CX 3H1KD 3JSVC 3L35A 1H88A 1NTMJ 1S4XA 1DEEG 2A06E 3II6A 2GUSA 5AW7B 5CBNA 1IK9A 2ITAA 3KPEA 1LTIC 1ZRTD 3CXHH 3VMYA 2QJKC 5B5EE 1VQMP 1CZQA 1NJIQ 1Q90D 4JQ0D 3RK3B 3L37A 1R8EA 1X9VA 2E76D 1ZLLA 3D6YA 5CCGA 2Y9YA 1XTGB 1KZUB 3CCVP 3MTUE 3D71A 2E76C 4PJ0H 1QVGO 1DIPA 1LT1A 1KORA 1SQQE 3FXEA 3CCQP 1N86A 5AVRB 3I55P 5KJ7A 1BGYD 3CMEP 4DOJA 3W68A 1KQSO 2HYNA 1L0LK 2WQYC 2WSFH 3BASA 3CMAP 1N73B 1LT9B 3TDKA 5CCHA 4HJGH 1URQA 5CHXA 4HKZH 4I7ZB 4EDFA 2WSCH 1CSBA 3L71G 3V4QA 2AXTE 1SQPJ 3CI9A 5GTHE 2O1JA 1FE6A 1S5LX 1JY2P 1X0TA 2E5YA 1ZW0A 3CPWO 1S5LH 1OW8A 2B89A 1YIJP 2XZRA 1T2KC 2FYNC 3PP5A 4D6TJ 3USSA 1EXIA 2AEFA 3H1KE 3L73G 1VQLP 1CW5A 1GDTA 2I8DA 2JWDA 2YXRB 3P8CE 4U3FD 1VPCA 1K04A 4XA4A 2JEEA 1SQVE 2QJKB 3ZDMA 1JUNA 1MUUA 4U7JA 5EFWB 1PP9E 5BU5A 3HE4B 2CPSA 3RK3C 1DEBA 1SQBG 1Z56A 3TGUJ 2WT7B 3Q5RA 4WB4A 1NTKJ 2DW3A 2PFXA 1HWTC 1HBWA 2AEMA 2YNYA 1ZN5A 3CWBG 2QJYC 2WITA 2MKVA 1SQVD 4H13C 2M5AB 1YQ4C 4BXLA 4AQRD 4H0LC 1EDLA 1AV1A 2OYHC 2D2CC 3H1HE 3W67A 1FOSF 5CCHC 2XU6A 3OA7A 1EXJA 2KP8A 3BATA 2PGDA 2G3AA 3A5TA 2RKLA 1LT9C 4IOIH 1ZMEC 2SPZA 3FWNA 2CPBA 1S72P 2C0XA 3RL0g 3Q2YA 1DH3A 1PGPA 2QJPC 1J1DB 1KB9E 1PPJG 2W6AA 3L74D 3M06A 4ZKPA 1LWUC 3HTKB 4RKUJ 2HFED 3E7KA 1L0LE 4AYCA 4D6TD 2QVAA 1KILD 4TT3H 1PL5A 5CCGC 3A0HH 4OWFA 3HUSC 2KUBA 3KHUA 1RF0A 2GA1A 1YI2P 2ZFCA 1MKMA 4M3LA 1H89A 3P8CD 4U3FE 1ZP0C 2FY8A 1HGZA 5KTBA 2ZVNB 1SS1A 2L5GB 2B87A 1GU5A 3CD6P 1OW6A 4I2LC 1OVRA 2JKVA 2IBZD 2Y0EA 3LW5H 1HH0A 1G1JA 3C9IA 3G3ZA 1W5CE 3L72D 5BVZA 1OMIA 3L75J 2KB7P 3B5NA 3C1LA 4OVNF 3VMAA 2KK7A 3CC2P 1LWUA 1SQXE 2A45H 1PP9G 1SQXK 1T3JA 3M9BA 2Z5IA 4H0LB 4N78D 2M3BA 3BRVB 1GL2D 3H6PA 2K1AA 2QIWA 1RE4C 3TYYA 4EI2A 1X79B 4H13D 2OYIA 2LXBA 1KB9H 1QLED 2ZXXA 1SQXD 2WPSA 5KKZC 5KAIH 2N1TB 3CCLP 5KLVG 1DD3A 2JO1A 1Q81Q 3FGAD 3RK3D 1S9KE 2FBWC 2OTLP 3H1LD 2KI7B 1X8YA 2HODB 1Y47A 1RE3C 5BU8B 1BE3E 4ASVA 3CL3D 4DT0A 2OTKE 4O9BA 5KLVJ 4EOTA 1YJ9P 3M9QA 3B8EB 3MUDC 4H44B 1FZEA 1LNQA 1P84E 1PIXA 4I7ZC 2JP3A 5AVQB 4IFMA 2A06D 3F89A 3MP7B 3PJSK 1HF9A 3KZIH 2HLOA 1GK6A 2LXCB 3L75D 1N7SD 3CWBJ 1LTJA 3L36A 1SQQG 3AEDC 1JCCA 1RE4A 3S9OA 2B9BA 2OGUA 1L0LD 1P84I 3HD7A 3U1AA 2ZYAA 2J59M 3M9HA 1M1JB 2YKPA 5L8RJ 3L72E 3L70J 3TSIA 2OYIC 4RJTA 2E74B 3WU2E 3Q3DA 1DD4A 1LWUB 2A45I 2QE7H 2W6JH 2BCCD 2V7QJ 4WY4C 1EDKA 5AVVB 3RBZA 1VQPP 1RF1C 1VQ8P 2V7QH 3H1JG 3VMZA 5H2FE 5KLIC 2FXPA 1FDOA 1RQUA 3L4FA 4K3AA 1IFDA 2XDJA 3G9RA 3L71E 4PV1B 3VOPA 3Q5PA 2FYUE 1Q86Q 2HR3A 3HUSA 1OFCX 2W90A 3KXDA 3NXSA 4GKGA 4B86A 1VQOP 1NTME 3OW2O 5B66E 1DX7A 3HD7C 1SFCD 1FZCB 4BRYA 1ZXGA 1M8OB 1LP1B 2UWJE 5M1BA 2QEXP 1Y8AA 1T8ZA 2AXCA 3TGUD 4W7YA 5APWA 3SFEC 2YMKA 1IO4A 1NTKD 5E79E 1EZVE 1VL2A 3G4SP 1WRGA 3CXHE 3IF4A 4GT1A 1JMMA 3B5ND 3BRTB 4JF7A 1FJPA 4GIFA 1NU1G 1VQ9P 3AEAC 3HE4A 4WVZA 1SQQJ 1NGMB 1N73A 4WY4D 3I5CA 3FWLA 1FZAA 1T3UA 2G8YA 3BCCD 3GLMA 3PLNA 2E74C 4IFFA 2KSJA 4IL6E 2OYIB 1L0NE 1YTZI 1RF1B 4WY4B 3VMXA 1KB9I 1FZFA 5AVTB 1KTMA 3MGNA 1ZR4A 2Z5HA 2C9NY 4OH8B 1Y9BA 1L0ND 4GDOA 2ZT9C 3AECC 1J1DC 1NKZB 1SQPE 2Q1KA 3M0DA 3I56P 2H43A 1JTHA 1KN7A 3AEGC 4D6TE 1IFMA 1JCDA 1SFCB 3P32A 5TISH 3RBXA 2MJZA 1PFIA 2I1KA 1FOSE 2IPPA 2YIUC 3AE8C 1QVFO 2IBZE 2IYOA 1YYCA 1OXZA 3RL0D 1URQB 1JY2O 1N7SA 3P8MC 3SSUA 3H1HD 5CCGD 3C8VA 3GW6A 1KILA 1S2EA 1NTMK 1ZR2A 1HGVA 1BCCE 3IN6A 2K37A 1SQBD 2WZ7A 2FXOA 3AE3C 1FAVA 3PTZA 2OYOA 2Z4EA 1KMIZ 2FKWB 1H0TB 3BCCE 3Q1MA 2W83C 2E5TA 4XFJA 1QX8A 1LTBC 1IC2A 1PV3A 4LC1A 3EFGA 4N6JA 3H1LE 2E75B 1FC2C 2PAJA 2YO3A 1AVOA 3S1KA 3A0HE 2KOGA 3D6ZA 1BSHA 5TISE 1L4AD 1GMJA 4I6MC 4OGQD 3HTKA 3U59A 4C7RA 1BGYG 1YITP 3TF5A 3V2NA 1YHQP 2C0WA 4JBZA 5AVSB 3V4WA 5KAFH 1KV4A 4YXWH 2FYNB 1RF0C 2KZIA 1QEXA 2QA4P 1OVUA 3RL0C 2HODA 3CX5D
chains in the Genus database with same CATH topology
2P1JA 3HRNA 4AUWA 3MIWA 1RE3A 1KILC 2WSEH 3MUDA 3BVHA 2FYZA 2QM7A 1KFMA 1SQVK 3RK2D 1GK4A 5KLVK 2OYHB 5AW8B 2VRSA 3TNUA 4HYTB 5AW3B 3VN0A 2YKQA 4EIJA 2YKOA 3LIDA 2IFMA 1SQPK 1N7LA 1JY3P 1E5WA 3H32B 3GHGC 4W7ZA 3MD0A 1NO4A 2N1TC 1IFJA 1JY3O 3HUSB 4DZOA 1FU1A 1KILB 1S9KD 3KDPB 2QM8A 2FFDC 1M7LA 1SFCC 1QL1A 2IX7C 2JJLA 1AQ5A 1M1JA 3SWYA 2P2UA 1IFNA 1A02J 1VDFA 1J1EB 1KQLA 3V5BA 1L4AB 3NTNA 1XTCC 2P7JA 4WY4A 1LTJC 2KYVA 1GW3A 2HG5D 1J1EC 5AVZB 2Q5UA 3GHGB 1FJKA 2OYHA 2W6BA 3RK2C 3M0DC 1G1IA 1NWQA 2YO2A 2WT7A 1NU1K 1G2CB 1JY3N 3HE5B 1YTZT 4JYCA 1GD2E 3H32A 1FZGA 1GL2C 5AW6B 2Q3IA 3OAKA 1L4AC 5AW9B 1H8AA 1J2JB 1NTZK 2NPSC 3EQ2A 3T97A 5AW4B 1SLQA 1SFCA 4ZKUA 4IFDK 2GUVA 1WT6A 2P67A 2XKMA 1RF1A 2FFDB 1HUCA 1L4AA 1AFOA 1JO5A 1HTLC 1N7SB 2O01H 5KJ7D 2HPCB 1N73B 5APYA 2N1TA 2NPSA 2Q9IA 3E1IA 1URQD 2WTYA 3N4XA 2C9LY 3A2AA 1W2EA 1ZV8A 4I1LA 1GL2B 3OJAB 2O1KA 2WPRA 1IJDB 2YMYA 4Y99C 1L0NK 3RK2B 1LTTC 3HE5A 2E42A 1SVFA 5APQA 4C7NB 3VYIA 3M0AA 3A7OA 2R5BA 3VTPC 5AVUB 1GTWA 3B5NC 5APTA 2H7HA 1T2KD 2J58A 1NH4A 1IFIA 2OARA 1SP4A 1JY2N 3IR9A 3RL0B 3V2QA 3V2RA 3KYQA 2POHA 1KFNA 2N1TD 1MFZA 2FFDA 1NKNA 3NMDA 4C46A 5CJ0A 4Y99B 3TK1A 1LTAC 3UIAA 5APXA 1N7SC 4KHXA 3VP8A 1NAFA 1EQ7A 1LT9A 3M91A 1N73A 1NHLA 1FZCA 4C7NA 1RY3A 5APSA 2BASA 2R5DA 2NPSB 1HVVA 2IFNA 3P7KA 1CI6B 1SQBK 2FXMA 2W27A 3IFMA 3O8ZA 1N73C 1FBMA 5AVWB 1GW4A 1MV8A 3CLQA 2R32A 3V2PA 2XNXA 1GU4A 1QL2A 1FZBA 1HJBA 1GZLA 2KLVA 2WPQA 3LIEA 3N7NA 2E43A 1JTHB 5AVXB 3VP9A 1M1JC 3B5NB 5AVYB 4N78E 5AW1B 2PP6A 2LKMA 2FYUK 1LGHB 4LLHA 4HH2A 4W80A 1URQC 3SWFA 2XV5A 1FDMA 1NOHA 1G2CA 3R2PA 1A02F 3U1CA 5KJ7C 1CI6A 5AW2B 3GHGA 3HD7B 1OWAA 2N9BA 2ZXEB 2Q7CA 2R3CA 5CMZA 2H8PD 2WWWA 2NPSD 1GL2A 4WBAA 1SQQK 4LGDE 1LTSC 5CJ4A 4XE5B 5APUA 3NFQA 1LTJB 3KQGA 1MZ9A 1N2DC 5CCHD 3A3YB 5APVA 1LTGC 3WMM0 4JYBA 4RESB 5AW0B 4N3YB 2M8RA 1NTKK 1JOCA 1FZCC 5AW5B 2I1JA 1JNMA 3HD7D 3L35A 1H88A 3II6A 5AW7B 2GUSA 1IK9A 3KPEA 3VMYA 1LTIC 1CZQA 3RK3B 3L37A 1X9VA 1ZLLA 5CCGA 1XTGB 1KZUB 3MTUE 1N86A 5AVRB 5KJ7A 4DOJA 2HYNA 1L0LK 2WSFH 3BASA 1LT9B 5CCHA 1URQA 5CHXA 2WSCH 1CSBA 3V4QA 3CI9A 2O1JA 1JY2P 1T2KC 2XZRA 3PP5A 1CW5A 1GDTA 3P8CE 1VPCA 4XA4A 2JEEA 1JUNA 1MUUA 5BU5A 3HE4B 2CPSA 3RK3C 1DEBA 1Z56A 2WT7B 2GM4A 4WB4A 1HBWA 1HWTC 2YNYA 1ZN5A 2WITA 4AQRD 2OYHC 1FOSF 5CCHC 2XU6A 3OA7A 2KP8A 3BATA 3A5TA 1LT9C 2CPBA 2C0XA 1DH3A 1J1DB 2W6AA 3M06A 4ZKPA 1LWUC 3HTKB 2HFED 4AYCA 1KILD 5CCGC 3HUSC 1RF0A 2ZFCA 4M3LA 1H89A 3P8CD 1HGZA 5KTBA 1GU5A 2L5GB 4I2LC 3LW5H 1HH0A 1G1JA 3C9IA 3G3ZA 5BVZA 2KB7P 3B5NA 3M9BA 1LWUA 2A45H 1SQXK 1T3JA 4N78D 2Z5IA 2M3BA 3BRVB 1GL2D 3H6PA 3TYYA 1RE4C 2OYIA 1X79B 2WPSA 2N1TB 3RK3D 1S9KE 1X8YA 2HODB 5BU8B 1RE3C 3CL3D 4EOTA 4O9BA 3M9QA 3B8EB 1FZEA 5AVQB 4IFMA 2HLOA 1GK6A 1N7SD 1LTJA 3L36A 1JCCA 1RE4A 3HD7A 3U1AA 3M9HA 2J59M 1M1JB 2YKPA 3TSIA 2OYIC 1LWUB 2A45I 4WY4C 5AVVB 1RF1C 3VMZA 3L4FA 1IFDA 2XDJA 3VOPA 3HUSA 3NXSA 4GKGA 4B86A 1DX7A 3HD7C 1SFCD 1FZCB 1T8ZA 1IO4A 4W7YA 5APWA 1WRGA 4GT1A 1JMMA 3B5ND 3BRTB 4JF7A 1FJPA 4GIFA 3HE4A 4WY4D 3I5CA 1FZAA 1T3UA 4IFFA 2KSJA 2OYIB 1YTZI 1RF1B 4WY4B 3VMXA 1FZFA 5AVTB 3MGNA 1ZR4A 2Z5HA 2C9NY 4OH8B 1J1DC 1NKZB 3M0DA 2H43A 1JTHA 1IFMA 1JCDA 1SFCB 3P32A 2MJZA 1PFIA 2I1KA 1FOSE 2IPPA 1YYCA 1OXZA 3RL0D 1URQB 1JY2O 1N7SA 3P8MC 5CCGD 1KILA 1NTMK 1ZR2A 1HGVA 2WZ7A 2Z4EA 1FAVA 2FKWB 1LTBC 1IC2A 4LC1A 3EFGA 4N6JA 2PAJA 2YO3A 2KOGA 1L4AD 4I6MC 3HTKA 3U59A 4C7RA 3V2NA 2C0WA 5AVSB 3V4WA 1RF0C 3TNUB 2A45G 3RL0C 2HODA 2HPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFQ A;  3A2A A;  3KQG A;  2WPS A;  4AUW A;  1S9K E;  1X8Y A;  3A3Y B;  2WPR A;  5APV A;  4EOT A;  4JYB A;  3B8E B;  4RES B;  2QM7 A;  5AW0 B;  1GK4 A;  3HE5 A;  5AVQ B;  5AW5 B;  2E42 A;  5AW8 B;  2VRS A;  5APQ A;  5APU A;  3TNU A;  1GK6 A;  1JNM A;  4HYT B;  4C7N B;  3VYI A;  3M0A A;  3L36 A;  5AW3 B;  3VN0 A;  3A7O A;  2R5B A;  3VTP C;  3L35 A;  3M9H A;  5AVU B;  1GTW A;  1H88 A;  5APT A;  5AW7 B;  3LID A;  2H7H A;  1T2K D;  3VMY A;  1SP4 A;  1CZQ A;  3IR9 A;  3L37 A;  5AVV B;  3MD0 A;  3VMZ A;  4DZO A;  1MFZ A;  1S9K D;  3KDP B;  2QM8 A;  3NMD A;  4C46 A;  5AVR B;  3NXS A;  2C9L Y;  4GKG A;  4B86 A;  2JJL A;  3TK1 A;  3UIA A;  5APX A;  2P2U A;  1A02 J;  1CSB A;  4KHX A;  1KQL A;  3V5B A;  3V4Q A;  1IO4 A;  1NAF A;  5APW A;  1T2K C;  3NTN A;  4GT1 A;  3M91 A;  2XZR A;  4C7N A;  5APS A;  2BAS A;  2P7J A;  2R5D A;  3HE4 A;  3I5C A;  5AVZ B;  2Q5U A;  3P7K A;  1JUN A;  1MUU A;  1CI6 B;  3HE4 B;  2WT7 B;  3VMX A;  2W27 A;  3O8Z A;  5AVT B;  5AVW B;  1HWT C;  3MGN A;  2YNY A;  2Z5H A;  2C9N Y;  1HBW A;  1MV8 A;  1NWQ A;  2R32 A;  2YO2 A;  1GU4 A;  3M0D A;  4AQR D;  2WT7 A;  1HJB A;  1FOS F;  2XU6 A;  1G2C B;  1GZL A;  3P32 A;  2KP8 A;  2WPQ A;  3HE5 B;  4JYC A;  3LIE A;  3A5T A;  1FOS E;  1GD2 E;  2IPP A;  2E43 A;  1YYC A;  1OXZ A;  5AVX B;  1DH3 A;  2W6A A;  3P8M C;  3M06 A;  4AYC A;  5AVY B;  5AW6 B;  2Q3I A;  5AW1 B;  3OAK A;  5AW9 B;  1FAV A;  1H8A A;  2ZFC A;  1J2J B;  4M3L A;  3SWF A;  1H89 A;  2XV5 A;  3T97 A;  5AW4 B;  4LC1 A;  1SLQ A;  1GU5 A;  4I2L C;  1A02 F;  1CI6 A;  2P67 A;  5AW2 B;  2YO3 A;  1HUC A;  1OWA A;  2N9B A;  2ZXE B;  2Q7C A;  4I6M C;  2R3C A;  3HTK A;  5APY A;  5CMZ A;  2WWW A;  3M9B A;  5AVS B;  2Z5I A;  3V4W A;  2WTY A;  3TYY A;  3TNU B;  4XE5 B; 
#chains in the Genus database with same CATH topology
 2P1J A;  3HRN A;  1LP1 A;  2YIU B;  4AUW A;  1VF5 B;  1RE3 A;  1BCC G;  3L71 D;  1NU1 E;  3B4S A;  1KIL C;  3MIW A;  3WUT A;  2WSE H;  3GF3 A;  1FDI A;  3MUD A;  3BVH A;  2FYZ A;  4GOE A;  1FS0 E;  1VF5 D;  2IZ0 A;  2IBZ G;  2RMZ A;  4KJM A;  2QM7 A;  1KFM A;  2YXQ B;  2KS1 B;  4HB1 A;  4NPF X;  1SQV K;  2K9J A;  2PRR A;  3RK2 D;  5GTI E;  2Y9Z A;  1GK4 A;  2GM4 A;  2E75 D;  2D2C D;  5KLV K;  4H0L D;  2OYH B;  5AW8 B;  2VRS A;  1PP9 D;  3TNU A;  1PGQ A;  4OGQ B;  1KYO D;  2KNC A;  3L74 E;  4HYT B;  5AW3 B;  3VN0 A;  2D2C B;  2WSF J;  2Y0D A;  1SQX G;  2YKQ A;  3JC2 2;  4TLF A;  1S5L E;  2YKO A;  4L75 A;  4DJG A;  3CX5 H;  3H1J E;  4EIJ A;  3CCR P;  1VQ5 P;  2KXP B;  1KYO E;  2K9Y A;  3LID A;  5GTH H;  5KLI B;  1JM0 A;  2QJP B;  4UB8 H;  2IFM A;  4GOD A;  1VQK P;  3AE1 C;  1SQP K;  1N7L A;  4UB8 E;  4BWN A;  1JY3 P;  1Q2N A;  1E5W A;  3EWK A;  3GMA A;  3H32 B;  3GHG C;  3O6Q A;  4W7Z A;  2RN0 A;  1U7J A;  1NO4 A;  3MD0 A;  2N1T C;  1IFJ A;  1PZQ A;  1JY3 O;  3HUS B;  3PRJ A;  1BSN A;  4DZO A;  1FU1 A;  2ZJS E;  4D6T G;  1SQP D;  1KIL B;  1S9K D;  1NTZ G;  3KDP B;  2QM8 A;  2FYU G;  3H1I J;  2KNC B;  2JR8 A;  2FFD C;  1L2P A;  1M7L A;  1SFC C;  2OQQ A;  1SQQ D;  1QL1 A;  1T6A A;  2IX7 C;  2JJL A;  4NPE A;  1NTM G;  5B5E H;  1AQ5 A;  1H0T A;  3L70 G;  3Q5S A;  1M1J A;  2W8Z A;  1VQ6 P;  1SQB J;  3SWY A;  2P2U A;  1IFN A;  1A02 J;  2K9J B;  1VDF A;  3B71 A;  1J1E B;  2J5U A;  1IK7 A;  1KQL A;  5E79 H;  3V5B A;  4JPZ B;  3PH0 A;  1L4A B;  1M1K Q;  3NTN A;  1HJ0 A;  2BCC G;  3L72 G;  4H13 B;  3WUU A;  4Z1M H;  2V4H A;  1XTC C;  3TGU E;  5B66 H;  2K3R A;  2P7J A;  1LTJ C;  2KYV A;  2WSE J;  3H1J D;  4PD4 I;  1GW3 A;  2HG5 D;  1J1E C;  5AVZ B;  3CCM P;  1UIX A;  2Q5U A;  1K9M Q;  1RH5 B;  3GHG B;  1FJK A;  3AEF C;  2OYH A;  1QGK B;  2W6B A;  1PGJ A;  1KIL E;  3RK2 C;  3M0D C;  2P58 A;  3JCU E;  4PD4 D;  1BGY J;  1PPJ E;  1G1I A;  3H1I D;  3FX0 A;  1W2B O;  1NWQ A;  2R3S A;  2YO2 A;  2BEZ F;  3MHV A;  1AVY A;  2WT7 A;  1NU1 K;  3CC7 P;  1NTZ J;  3CCU P;  1S3J A;  1NTK E;  1G2C B;  5C39 A;  1JY3 N;  4OGQ C;  2ZAE B;  1YTZ T;  1EZV G;  2BEQ D;  1NU1 D;  3HE5 B;  4JYC A;  4R4M A;  3SWK A;  3H32 A;  3G6E P;  1ZOY C;  1GD2 E;  3D70 A;  2OTJ P;  1FZG A;  1GL2 C;  2RH0 A;  3AEB C;  2P10 A;  5AW6 B;  1USD A;  3KZI E;  2Q3I A;  3A0B E;  3S4R A;  1L0L G;  3OAK A;  1K73 Q;  1R5L A;  1M56 D;  2IBZ I;  1L4A C;  5AW9 B;  1Q7Y Q;  1N8R Q;  1BDC A;  5KKZ B;  1H8A A;  1J2J B;  1NTZ K;  2O3J A;  1L0L J;  4PD4 H;  1BDD A;  1AQT A;  2NPS C;  3EQ2 A;  4A7P A;  3T97 A;  1KQF B;  3G71 P;  5AW4 B;  5KAF E;  1SLQ A;  1SFC A;  2BCC E;  4ZKU A;  4IFD K;  3ABV C;  1SQX J;  4PV1 C;  2GUV A;  1WT6 A;  2P67 A;  2XKM A;  1BE3 D;  1RF1 A;  2FFD B;  1HUC A;  1L4A A;  1AFO A;  1JO5 A;  4U3F J;  1HTL C;  1N7S B;  1NVO A;  1JEK A;  2O01 H;  3LW5 J;  3CXH D;  4K35 A;  5KJ7 D;  4IL6 X;  5APY A;  2HPC B;  3H1H G;  3L73 D;  2N1T A;  2NPS A;  4IL6 H;  2Q9I A;  1JB0 J;  3E1I A;  3GG2 A;  4H44 C;  1KD1 Q;  4U3F G;  1URQ D;  2WTY A;  3N4X A;  3AE5 C;  3V6I A;  3CCJ P;  4L73 A;  2C9L Y;  3MZW B;  3A2A A;  1W2E A;  1K05 A;  3H1K G;  1ZV8 A;  3L73 E;  1YJW P;  3TGU G;  2KZJ A;  2CK3 H;  1GL2 B;  4I1L A;  1EZV I;  1EDI A;  3T97 B;  1NTK G;  1VQN P;  3CWB D;  3OJA B;  1E79 H;  2O1K A;  1SQV G;  3AE4 C;  2WPR A;  2E74 D;  4QMA A;  3CC4 P;  1RQV A;  1IJD B;  1M57 D;  2LR2 A;  2YMY A;  2QJY B;  3CWB E;  4UB6 H;  4Y99 C;  2IZ1 A;  2K88 A;  2HPC A;  3AE6 C;  1L0N K;  3RK2 B;  1JMB A;  3CCS P;  1LTT C;  3CX5 I;  3HE5 A;  1BE3 J;  2E42 A;  1SVF A;  3L72 J;  1YQ3 C;  5KLV E;  3L74 G;  2IDB A;  5APQ A;  1VQ4 P;  3AE2 C;  5H2F H;  3TNU B;  4C7N B;  1TU3 F;  3VYI A;  3M0A A;  3CX5 E;  2O01 N;  3A7O A;  2KLU A;  3E1R A;  1EDJ A;  2R5B A;  1NAY A;  3VTP C;  2M0B A;  3O6Q B;  2Q3E A;  3B5N C;  4MN4 C;  5AVU B;  5APT A;  4YXD C;  1GTW A;  3WU2 H;  1T2K D;  2J58 A;  1D7M A;  1KC8 Q;  2H7H A;  1KQG B;  1NH4 A;  1IFI A;  2OAR A;  1SP4 A;  1JY2 N;  3IR9 A;  3L71 J;  3RL0 B;  3V2Q A;  1OZH A;  3V2R A;  3KYQ A;  2POH A;  2Y0C A;  1IFP A;  2KIK A;  1KFN A;  3L70 E;  2N1T D;  3SFD C;  5K5G B;  1MFZ A;  2ZVO B;  2FFD A;  3CXH I;  3H1K J;  1NKN A;  3NMD A;  4C46 A;  2QG4 A;  1X22 A;  4BRY B;  5CJ0 A;  2WSC J;  3RK3 E;  4Y99 B;  1OW7 A;  1P84 H;  1SQV J;  2E75 C;  4GOF A;  4DCK A;  1PP9 J;  3TK1 A;  1K8A Q;  3QWO C;  1LTA C;  3UIA A;  5APX A;  2A45 G;  3RGU A;  1N7S C;  4KHX A;  5KLV D;  3QH9 A;  2WVR A;  3VP8 A;  1NAF A;  1EQ7 A;  4EYY Q;  1RHZ B;  2L91 A;  1LT9 A;  5DJT B;  2ZT9 B;  1L0N J;  2NZ2 A;  2JDI H;  1NHL A;  2R44 A;  3H1H J;  1KYO H;  1RY3 A;  3IAO A;  3M91 A;  5APS A;  2BAS A;  5KAI E;  2R5D A;  4C7N A;  2NPS B;  5CBO A;  1HVV A;  1PPJ D;  3H1I E;  1NTZ D;  2IFN A;  1VF5 C;  4CPG A;  3P7K A;  2FYU D;  1CI6 B;  2A06 G;  1SQB K;  1SQB E;  2FXM A;  2W27 A;  2ZYG A;  3IFM A;  1BCC D;  1FBM A;  3O8Z A;  4PJ0 E;  3L70 D;  2QSI A;  4UB6 E;  5AVW B;  1N73 C;  2WPV B;  1GW4 A;  1MV8 A;  1AJY A;  1NYH A;  2R32 A;  3AE9 C;  3CLQ A;  3V2P A;  2XNX A;  5GTI H;  1EC5 A;  2KSE A;  4RO0 A;  3H25 A;  1QL2 A;  1GU4 A;  4PV1 D;  1UII A;  1OX3 A;  1FZB A;  1HJB A;  1KB9 D;  2B87 B;  1GZL A;  1OVV A;  2KLV A;  2WPQ A;  2WMM A;  4ZMD A;  2M5A A;  3LIE A;  3N7N A;  1ZRT E;  2E43 A;  4R4L A;  2N9Y B;  3PHL A;  4WWI A;  1JTH B;  5AVX B;  4ASW A;  3VP9 A;  1M1J C;  2XND H;  1R5S A;  3B5N B;  3L75 E;  5AVY B;  3F5H A;  2H89 C;  4N78 E;  1M90 Q;  4YPC A;  5AW1 B;  1BGY E;  2PP6 A;  2JWA A;  2LKM A;  1AA0 A;  3H1L J;  1WMK A;  4PD4 E;  2AEJ A;  2FYU K;  2H88 C;  2M3E A;  1LGH B;  2O01 J;  4HH2 A;  4LLH A;  1URQ C;  4W80 A;  3SWF A;  1NTZ E;  2XV5 A;  1FDM A;  2B88 A;  1NOH A;  1U57 A;  3H1L G;  4H44 D;  1BCC J;  3WUV A;  3EFF K;  1G2C A;  3R2P A;  4YTP C;  3A0B H;  1A02 F;  1OIP A;  3U1C A;  5KJ7 C;  1CI6 A;  1Q82 Q;  5AW2 B;  3K5B A;  3GHG A;  3HD7 B;  1EZV D;  1OWA A;  1SQP G;  2N9B A;  2ZXE B;  3BCC J;  3R4Y A;  4L76 A;  4Y28 J;  5DJU B;  2Q7C A;  2R3C A;  5CMZ A;  2QRX A;  1NU1 J;  2H8P D;  2IYP A;  2WWW A;  3GF7 A;  2NPS D;  1GL2 A;  3BCC G;  4WBA A;  1PGO A;  1NTM D;  3L75 G;  1VQ7 P;  1SQQ K;  4LGD E;  1YBK A;  1LTS C;  4ZNC A;  4KT0 J;  2ZT9 D;  4XE5 B;  3NFQ A;  5APU A;  1LTJ B;  5CJ4 A;  3KQG A;  1YJN P;  1USE A;  4NPD A;  2Q6Q A;  1IZN B;  1MZ9 A;  3AEE C;  1N2D C;  2BCC J;  2E76 B;  5CCH D;  1L0N G;  3ITK A;  2AXT H;  2WSS H;  3A3Y B;  1U7M A;  5TJH A;  1P84 D;  5APV A;  3CCE P;  1LTG C;  3WMM 0;  3JCU H;  1BE3 G;  1KYO I;  4JYB A;  4L74 A;  4RES B;  4WY4 A;  3L74 J;  5AW0 B;  4N3Y B;  1MFT A;  2M8R A;  1NTK K;  1JOC A;  3FXD A;  1FZC C;  3H1J J;  3AE7 C;  5AW5 B;  1FZC A;  1LJ2 A;  2NRG A;  2I1J A;  2KS1 A;  1JNM A;  2ZYD A;  2FYU J;  3H1I G;  3L73 J;  3HD7 D;  1S1C X;  3H1K D;  3JSV C;  3L35 A;  1H88 A;  1NTM J;  1S4X A;  1DEE G;  2A06 E;  3II6 A;  2GUS A;  5AW7 B;  5CBN A;  1IK9 A;  2ITA A;  3KPE A;  1LTI C;  1ZRT D;  3CXH H;  3VMY A;  2QJK C;  5B5E E;  1VQM P;  1CZQ A;  1NJI Q;  1Q90 D;  4JQ0 D;  3RK3 B;  3L37 A;  1R8E A;  1X9V A;  2E76 D;  1ZLL A;  3D6Y A;  5CCG A;  2Y9Y A;  1XTG B;  1KZU B;  3CCV P;  3MTU E;  3D71 A;  2E76 C;  4PJ0 H;  1QVG O;  1DIP A;  1LT1 A;  1KOR A;  1SQQ E;  3FXE A;  3CCQ P;  1N86 A;  5AVR B;  3I55 P;  5KJ7 A;  1BGY D;  3CME P;  4DOJ A;  3W68 A;  1KQS O;  2HYN A;  1L0L K;  2WQY C;  2WSF H;  3BAS A;  3CMA P;  1N73 B;  1LT9 B;  3TDK A;  5CCH A;  4HJG H;  1URQ A;  5CHX A;  4HKZ H;  4I7Z B;  4EDF A;  2WSC H;  1CSB A;  3L71 G;  3V4Q A;  2AXT E;  1SQP J;  3CI9 A;  5GTH E;  2O1J A;  1FE6 A;  1S5L X;  1JY2 P;  1X0T A;  2E5Y A;  1ZW0 A;  3CPW O;  1S5L H;  1OW8 A;  2B89 A;  1YIJ P;  2XZR A;  1T2K C;  2FYN C;  3PP5 A;  4D6T J;  3USS A;  1EXI A;  2AEF A;  3H1K E;  3L73 G;  1VQL P;  1CW5 A;  1GDT A;  2I8D A;  2JWD A;  2YXR B;  3P8C E;  4U3F D;  1VPC A;  1K04 A;  4XA4 A;  2JEE A;  1SQV E;  2QJK B;  3ZDM A;  1JUN A;  1MUU A;  4U7J A;  5EFW B;  1PP9 E;  5BU5 A;  3HE4 B;  2CPS A;  3RK3 C;  1DEB A;  1SQB G;  1Z56 A;  3TGU J;  2WT7 B;  3Q5R A;  4WB4 A;  1NTK J;  2DW3 A;  2PFX A;  1HWT C;  1HBW A;  2AEM A;  2YNY A;  1ZN5 A;  3CWB G;  2QJY C;  2WIT A;  2MKV A;  1SQV D;  4H13 C;  2M5A B;  1YQ4 C;  4BXL A;  4AQR D;  4H0L C;  1EDL A;  1AV1 A;  2OYH C;  2D2C C;  3H1H E;  3W67 A;  1FOS F;  5CCH C;  2XU6 A;  3OA7 A;  1EXJ A;  2KP8 A;  3BAT A;  2PGD A;  2G3A A;  3A5T A;  2RKL A;  1LT9 C;  4IOI H;  1ZME C;  2SPZ A;  3FWN A;  2CPB A;  1S72 P;  2C0X A;  3RL0 g;  3Q2Y A;  1DH3 A;  1PGP A;  2QJP C;  1J1D B;  1KB9 E;  1PPJ G;  2W6A A;  3L74 D;  3M06 A;  4ZKP A;  1LWU C;  3HTK B;  4RKU J;  2HFE D;  3E7K A;  1L0L E;  4AYC A;  4D6T D;  2QVA A;  1KIL D;  4TT3 H;  1PL5 A;  5CCG C;  3A0H H;  4OWF A;  3HUS C;  2KUB A;  3KHU A;  1RF0 A;  2GA1 A;  1YI2 P;  2ZFC A;  1MKM A;  4M3L A;  1H89 A;  3P8C D;  4U3F E;  1ZP0 C;  2FY8 A;  1HGZ A;  5KTB A;  2ZVN B;  1SS1 A;  2L5G B;  2B87 A;  1GU5 A;  3CD6 P;  1OW6 A;  4I2L C;  1OVR A;  2JKV A;  2IBZ D;  2Y0E A;  3LW5 H;  1HH0 A;  1G1J A;  3C9I A;  3G3Z A;  1W5C E;  3L72 D;  5BVZ A;  1OMI A;  3L75 J;  2KB7 P;  3B5N A;  3C1L A;  4OVN F;  3VMA A;  2KK7 A;  3CC2 P;  1LWU A;  1SQX E;  2A45 H;  1PP9 G;  1SQX K;  1T3J A;  3M9B A;  2Z5I A;  4H0L B;  4N78 D;  2M3B A;  3BRV B;  1GL2 D;  3H6P A;  2K1A A;  2QIW A;  1RE4 C;  3TYY A;  4EI2 A;  1X79 B;  4H13 D;  2OYI A;  2LXB A;  1KB9 H;  1QLE D;  2ZXX A;  1SQX D;  2WPS A;  5KKZ C;  5KAI H;  2N1T B;  3CCL P;  5KLV G;  1DD3 A;  2JO1 A;  1Q81 Q;  3FGA D;  3RK3 D;  1S9K E;  2FBW C;  2OTL P;  3H1L D;  2KI7 B;  1X8Y A;  2HOD B;  1Y47 A;  1RE3 C;  5BU8 B;  1BE3 E;  4ASV A;  3CL3 D;  4DT0 A;  2OTK E;  4O9B A;  5KLV J;  4EOT A;  1YJ9 P;  3M9Q A;  3B8E B;  3MUD C;  4H44 B;  1FZE A;  1LNQ A;  1P84 E;  1PIX A;  4I7Z C;  2JP3 A;  5AVQ B;  4IFM A;  2A06 D;  3F89 A;  3MP7 B;  3PJS K;  1HF9 A;  3KZI H;  2HLO A;  1GK6 A;  2LXC B;  3L75 D;  1N7S D;  3CWB J;  1LTJ A;  3L36 A;  1SQQ G;  3AED C;  1JCC A;  1RE4 A;  3S9O A;  2B9B A;  2OGU A;  1L0L D;  1P84 I;  3HD7 A;  3U1A A;  2ZYA A;  2J59 M;  3M9H A;  1M1J B;  2YKP A;  5L8R J;  3L72 E;  3L70 J;  3TSI A;  2OYI C;  4RJT A;  2E74 B;  3WU2 E;  3Q3D A;  1DD4 A;  1LWU B;  2A45 I;  2QE7 H;  2W6J H;  2BCC D;  2V7Q J;  4WY4 C;  1EDK A;  5AVV B;  3RBZ A;  1VQP P;  1RF1 C;  1VQ8 P;  2V7Q H;  3H1J G;  3VMZ A;  5H2F E;  5KLI C;  2FXP A;  1FDO A;  1RQU A;  3L4F A;  4K3A A;  1IFD A;  2XDJ A;  3G9R A;  3L71 E;  4PV1 B;  3VOP A;  3Q5P A;  2FYU E;  1Q86 Q;  2HR3 A;  3HUS A;  1OFC X;  2W90 A;  3KXD A;  3NXS A;  4GKG A;  4B86 A;  1VQO P;  1NTM E;  3OW2 O;  5B66 E;  1DX7 A;  3HD7 C;  1SFC D;  1FZC B;  4BRY A;  1ZXG A;  1M8O B;  1LP1 B;  2UWJ E;  5M1B A;  2QEX P;  1Y8A A;  1T8Z A;  2AXC A;  3TGU D;  4W7Y A;  5APW A;  3SFE C;  2YMK A;  1IO4 A;  1NTK D;  5E79 E;  1EZV E;  1VL2 A;  3G4S P;  1WRG A;  3CXH E;  3IF4 A;  4GT1 A;  1JMM A;  3B5N D;  3BRT B;  4JF7 A;  1FJP A;  4GIF A;  1NU1 G;  1VQ9 P;  3AEA C;  3HE4 A;  4WVZ A;  1SQQ J;  1NGM B;  1N73 A;  4WY4 D;  3I5C A;  3FWL A;  1FZA A;  1T3U A;  2G8Y A;  3BCC D;  3GLM A;  3PLN A;  2E74 C;  4IFF A;  2KSJ A;  4IL6 E;  2OYI B;  1L0N E;  1YTZ I;  1RF1 B;  4WY4 B;  3VMX A;  1KB9 I;  1FZF A;  5AVT B;  1KTM A;  3MGN A;  1ZR4 A;  2Z5H A;  2C9N Y;  4OH8 B;  1Y9B A;  1L0N D;  4GDO A;  2ZT9 C;  3AEC C;  1J1D C;  1NKZ B;  1SQP E;  2Q1K A;  3M0D A;  3I56 P;  2H43 A;  1JTH A;  1KN7 A;  3AEG C;  4D6T E;  1IFM A;  1JCD A;  1SFC B;  3P32 A;  5TIS H;  3RBX A;  2MJZ A;  1PFI A;  2I1K A;  1FOS E;  2IPP A;  2YIU C;  3AE8 C;  1QVF O;  2IBZ E;  2IYO A;  1YYC A;  1OXZ A;  3RL0 D;  1URQ B;  1JY2 O;  1N7S A;  3P8M C;  3SSU A;  3H1H D;  5CCG D;  3C8V A;  3GW6 A;  1KIL A;  1S2E A;  1NTM K;  1ZR2 A;  1HGV A;  1BCC E;  3IN6 A;  2K37 A;  1SQB D;  2WZ7 A;  2FXO A;  3AE3 C;  1FAV A;  3PTZ A;  2OYO A;  2Z4E A;  1KMI Z;  2FKW B;  1H0T B;  3BCC E;  3Q1M A;  2W83 C;  2E5T A;  4XFJ A;  1QX8 A;  1LTB C;  1IC2 A;  1PV3 A;  4LC1 A;  3EFG A;  4N6J A;  3H1L E;  2E75 B;  1FC2 C;  2PAJ A;  2YO3 A;  1AVO A;  3S1K A;  3A0H E;  2KOG A;  3D6Z A;  1BSH A;  5TIS E;  1L4A D;  1GMJ A;  4I6M C;  4OGQ D;  3HTK A;  3U59 A;  4C7R A;  1BGY G;  1YIT P;  3TF5 A;  3V2N A;  1YHQ P;  2C0W A;  4JBZ A;  5AVS B;  3V4W A;  5KAF H;  1KV4 A;  4YXW H;  2FYN B;  1RF0 C;  2KZI A;  1QEX A;  2QA4 P;  1OVU A;  3RL0 C;  2HOD A;  3CX5 D; 
#chains in the Genus database with same CATH homology
 2P1J A;  3HRN A;  4AUW A;  3MIW A;  1RE3 A;  1KIL C;  2WSE H;  3MUD A;  3BVH A;  2FYZ A;  2QM7 A;  1KFM A;  1SQV K;  3RK2 D;  1GK4 A;  5KLV K;  2OYH B;  5AW8 B;  2VRS A;  3TNU A;  4HYT B;  5AW3 B;  3VN0 A;  2YKQ A;  4EIJ A;  2YKO A;  3LID A;  2IFM A;  1SQP K;  1N7L A;  1JY3 P;  1E5W A;  3H32 B;  3GHG C;  4W7Z A;  3MD0 A;  1NO4 A;  2N1T C;  1IFJ A;  1JY3 O;  3HUS B;  4DZO A;  1FU1 A;  1KIL B;  1S9K D;  3KDP B;  2QM8 A;  2FFD C;  1M7L A;  1SFC C;  1QL1 A;  2IX7 C;  2JJL A;  1AQ5 A;  1M1J A;  3SWY A;  2P2U A;  1IFN A;  1A02 J;  1VDF A;  1J1E B;  1KQL A;  3V5B A;  1L4A B;  3NTN A;  1XTC C;  2P7J A;  4WY4 A;  1LTJ C;  2KYV A;  1GW3 A;  2HG5 D;  1J1E C;  5AVZ B;  2Q5U A;  3GHG B;  1FJK A;  2OYH A;  2W6B A;  3RK2 C;  3M0D C;  1G1I A;  1NWQ A;  2YO2 A;  2WT7 A;  1NU1 K;  1G2C B;  1JY3 N;  3HE5 B;  1YTZ T;  4JYC A;  1GD2 E;  3H32 A;  1FZG A;  1GL2 C;  5AW6 B;  2Q3I A;  3OAK A;  1L4A C;  5AW9 B;  1H8A A;  1J2J B;  1NTZ K;  2NPS C;  3EQ2 A;  3T97 A;  5AW4 B;  1SLQ A;  1SFC A;  4ZKU A;  4IFD K;  2GUV A;  1WT6 A;  2P67 A;  2XKM A;  1RF1 A;  2FFD B;  1HUC A;  1L4A A;  1AFO A;  1JO5 A;  1HTL C;  1N7S B;  2O01 H;  5KJ7 D;  2HPC B;  1N73 B;  5APY A;  2N1T A;  2NPS A;  2Q9I A;  3E1I A;  1URQ D;  2WTY A;  3N4X A;  2C9L Y;  3A2A A;  1W2E A;  1ZV8 A;  4I1L A;  1GL2 B;  3OJA B;  2O1K A;  2WPR A;  1IJD B;  2YMY A;  4Y99 C;  1L0N K;  3RK2 B;  1LTT C;  3HE5 A;  2E42 A;  1SVF A;  5APQ A;  4C7N B;  3VYI A;  3M0A A;  3A7O A;  2R5B A;  3VTP C;  5AVU B;  1GTW A;  3B5N C;  5APT A;  2H7H A;  1T2K D;  2J58 A;  1NH4 A;  1IFI A;  2OAR A;  1SP4 A;  1JY2 N;  3IR9 A;  3RL0 B;  3V2Q A;  3V2R A;  3KYQ A;  2POH A;  1KFN A;  2N1T D;  1MFZ A;  2FFD A;  1NKN A;  3NMD A;  4C46 A;  5CJ0 A;  4Y99 B;  3TK1 A;  1LTA C;  3UIA A;  5APX A;  1N7S C;  4KHX A;  3VP8 A;  1NAF A;  1EQ7 A;  1LT9 A;  3M91 A;  1N73 A;  1NHL A;  1FZC A;  4C7N A;  1RY3 A;  5APS A;  2BAS A;  2R5D A;  2NPS B;  1HVV A;  2IFN A;  3P7K A;  1CI6 B;  1SQB K;  2FXM A;  2W27 A;  3IFM A;  3O8Z A;  1N73 C;  1FBM A;  5AVW B;  1GW4 A;  1MV8 A;  3CLQ A;  2R32 A;  3V2P A;  2XNX A;  1GU4 A;  1QL2 A;  1FZB A;  1HJB A;  1GZL A;  2KLV A;  2WPQ A;  3LIE A;  3N7N A;  2E43 A;  1JTH B;  5AVX B;  3VP9 A;  1M1J C;  3B5N B;  5AVY B;  4N78 E;  5AW1 B;  2PP6 A;  2LKM A;  2FYU K;  1LGH B;  4LLH A;  4HH2 A;  4W80 A;  1URQ C;  3SWF A;  2XV5 A;  1FDM A;  1NOH A;  1G2C A;  3R2P A;  1A02 F;  3U1C A;  5KJ7 C;  1CI6 A;  5AW2 B;  3GHG A;  3HD7 B;  1OWA A;  2N9B A;  2ZXE B;  2Q7C A;  2R3C A;  5CMZ A;  2H8P D;  2WWW A;  2NPS D;  1GL2 A;  4WBA A;  1SQQ K;  4LGD E;  1LTS C;  5CJ4 A;  4XE5 B;  5APU A;  3NFQ A;  1LTJ B;  3KQG A;  1MZ9 A;  1N2D C;  5CCH D;  3A3Y B;  5APV A;  1LTG C;  3WMM 0;  4JYB A;  4RES B;  5AW0 B;  4N3Y B;  2M8R A;  1NTK K;  1JOC A;  1FZC C;  5AW5 B;  2I1J A;  1JNM A;  3HD7 D;  3L35 A;  1H88 A;  3II6 A;  5AW7 B;  2GUS A;  1IK9 A;  3KPE A;  3VMY A;  1LTI C;  1CZQ A;  3RK3 B;  3L37 A;  1X9V A;  1ZLL A;  5CCG A;  1XTG B;  1KZU B;  3MTU E;  1N86 A;  5AVR B;  5KJ7 A;  4DOJ A;  2HYN A;  1L0L K;  2WSF H;  3BAS A;  1LT9 B;  5CCH A;  1URQ A;  5CHX A;  2WSC H;  1CSB A;  3V4Q A;  3CI9 A;  2O1J A;  1JY2 P;  1T2K C;  2XZR A;  3PP5 A;  1CW5 A;  1GDT A;  3P8C E;  1VPC A;  4XA4 A;  2JEE A;  1JUN A;  1MUU A;  5BU5 A;  3HE4 B;  2CPS A;  3RK3 C;  1DEB A;  1Z56 A;  2WT7 B;  2GM4 A;  4WB4 A;  1HBW A;  1HWT C;  2YNY A;  1ZN5 A;  2WIT A;  4AQR D;  2OYH C;  1FOS F;  5CCH C;  2XU6 A;  3OA7 A;  2KP8 A;  3BAT A;  3A5T A;  1LT9 C;  2CPB A;  2C0X A;  1DH3 A;  1J1D B;  2W6A A;  3M06 A;  4ZKP A;  1LWU C;  3HTK B;  2HFE D;  4AYC A;  1KIL D;  5CCG C;  3HUS C;  1RF0 A;  2ZFC A;  4M3L A;  1H89 A;  3P8C D;  1HGZ A;  5KTB A;  1GU5 A;  2L5G B;  4I2L C;  3LW5 H;  1HH0 A;  1G1J A;  3C9I A;  3G3Z A;  5BVZ A;  2KB7 P;  3B5N A;  3M9B A;  1LWU A;  2A45 H;  1SQX K;  1T3J A;  4N78 D;  2Z5I A;  2M3B A;  3BRV B;  1GL2 D;  3H6P A;  3TYY A;  1RE4 C;  2OYI A;  1X79 B;  2WPS A;  2N1T B;  3RK3 D;  1S9K E;  1X8Y A;  2HOD B;  5BU8 B;  1RE3 C;  3CL3 D;  4EOT A;  4O9B A;  3M9Q A;  3B8E B;  1FZE A;  5AVQ B;  4IFM A;  2HLO A;  1GK6 A;  1N7S D;  1LTJ A;  3L36 A;  1JCC A;  1RE4 A;  3HD7 A;  3U1A A;  3M9H A;  2J59 M;  1M1J B;  2YKP A;  3TSI A;  2OYI C;  1LWU B;  2A45 I;  4WY4 C;  5AVV B;  1RF1 C;  3VMZ A;  3L4F A;  1IFD A;  2XDJ A;  3VOP A;  3HUS A;  3NXS A;  4GKG A;  4B86 A;  1DX7 A;  3HD7 C;  1SFC D;  1FZC B;  1T8Z A;  1IO4 A;  4W7Y A;  5APW A;  1WRG A;  4GT1 A;  1JMM A;  3B5N D;  3BRT B;  4JF7 A;  1FJP A;  4GIF A;  3HE4 A;  4WY4 D;  3I5C A;  1FZA A;  1T3U A;  4IFF A;  2KSJ A;  2OYI B;  1YTZ I;  1RF1 B;  4WY4 B;  3VMX A;  1FZF A;  5AVT B;  3MGN A;  1ZR4 A;  2Z5H A;  2C9N Y;  4OH8 B;  1J1D C;  1NKZ B;  3M0D A;  2H43 A;  1JTH A;  1IFM A;  1JCD A;  1SFC B;  3P32 A;  2MJZ A;  1PFI A;  2I1K A;  1FOS E;  2IPP A;  1YYC A;  1OXZ A;  3RL0 D;  1URQ B;  1JY2 O;  1N7S A;  3P8M C;  5CCG D;  1KIL A;  1NTM K;  1ZR2 A;  1HGV A;  2WZ7 A;  2Z4E A;  1FAV A;  2FKW B;  1LTB C;  1IC2 A;  4LC1 A;  3EFG A;  4N6J A;  2PAJ A;  2YO3 A;  2KOG A;  1L4A D;  4I6M C;  3HTK A;  3U59 A;  4C7R A;  3V2N A;  2C0W A;  5AVS B;  3V4W A;  1RF0 C;  3TNU B;  2A45 G;  3RL0 C;  2HOD A;  2HPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...