1GU4A

Crystal structure of c/ebpbeta bzip homodimer bound to a high affinity dna fragment
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 32
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu4A00
3L36A 3T97A 5AW4B 3B8EB 2YNYA 3LIDA 1HWTC 3NXSA 3VTPC 2P2UA 3O8ZA 1OXZA 2Z5IA 2WWWA 3L37A 4C46A 2E42A 5AW3B 4LC1A 1GU4A 4C7NA 5APTA 1YYCA 2E43A 2YO2A 4RESB 3V5BA 3TNUB 3NTNA 3M0AA 5AW1B 3IR9A 1HUCA 3P7KA 3VMYA 1JUNA 1S9KE 2R5DA 5AVYB 3VMZA 5AVUB 5APSA 4EOTA 5AW0B 3TK1A 4HYTB 4KHXA 2XU6A 5AVSB 4JYBA 1SP4A 3SWFA 2ZXEB 3VN0A 2IPPA 4AYCA 3A5TA 1A02F 2WT7A 2WT7B 2P7JA 1NAFA 3M06A 3M9BA 2BASA 1GZLA 2Q7CA 3UIAA 3V4WA 4GT1A 3HE5A 3TNUA 4GKGA 4AQRD 3HE5B 1FAVA 1NWQA 4AUWA 2W6AA 5AW8B 3HE4A 5AVZB 3HE4B 1J2JB 1SLQA 2W27A 2JJLA 2XV5A 3M91A 1G2CB 2KP8A 3A7OA 3M0DA 2Q3IA 1MV8A 5APWA 2C9NY 2N9BA 3TYYA 4I6MC 2ZFCA 1DH3A 5AVRB 2WPSA 1H89A 1CZQA 2WTYA 1H88A 3KQGA 1GU5A 3LIEA 1CI6A 3VMXA 1HJBA 1CI6B 1GK6A 2R5BA 3MD0A 4M3LA 3P32A 4JYCA 2Z5HA 5AVVB 3MGNA 1MUUA 3P8MC 1KQLA 1MFZA 3OAKA 5AVWB 1JNMA 5AVQB 5AVXB 4DZOA 5CMZA 3NFQA 1T2KC 3NMDA 1CSBA 2QM8A 5APXA 3KDPB 1GD2E 2R32A 5AW9B 5AW6B 5AVTB 2WPQA 3M9HA 2WPRA 1GTWA 1FOSF 3I5CA 2QM7A 4C7NB 4I2LC 1IO4A 3L35A 5AW2B 4B86A 1A02J 3HTKA 1GK4A 2XZRA 2R3CA 1X8YA 5APVA 3A2AA 2C9LY 1HBWA 3A3YB 1S9KD 2VRSA 2P67A 3V4QA 1OWAA 5AW7B 2YO3A 5APQA 1T2KD 4XE5B 1H8AA 5APUA 3VYIA 1FOSE 5AW5B 5APYA 2H7HA 2Q5UA
chains in the Genus database with same CATH superfamily
3Q5RA 3RK2D 1SFCC 2E75C 3L73G 3WUVA 4D6TG 2Z5IA 4C46A 5C39A 2QIWA 1IK9A 1KZUB 4NPFX 4IFFA 1GL2D 4I7ZC 2E43A 1SQXK 1EZVD 2ZT9B 3M0AA 1LP1A 3IR9A 1S9KE 1W5CE 2XU6A 2DW3A 2GUSA 1LTIC 3HUSA 2W6BA 5M1BA 1YQ3C 2N1TD 3RBXA 4AQRD 2W6AA 1G1JA 3C9IA 2FXOA 1NTZE 1HVVA 2WQYC 3B71A 3FGAD 1EC5A 3CCUP 1H88A 1S5LX 4H0LB 1Q2NA 4CPGA 1N73A 3P32A 4JYCA 3BRTB 2QJKB 4ASVA 1P84I 4ZNCA 3LW5J 1BE3E 1T2KC 1G2CA 1Y8AA 2KS1A 3H1KD 1UIIA 2KYVA 2J59M 2K9YA 4EI2A 1IO4A 3L71D 1NTME 3B5NB 2IBZI 1WT6A 2BEQD 4XE5B 1BE3G 2HFED 1S2EA 4U3FJ 3H1IJ 5AW4B 2B88A 1AV1A 2YNYA 3LIDA 4PJ0E 4UB6H 1SQQK 2KOGA 1LT9C 1LWUB 1NTMG 3M0DC 5APTA 2YO2A 3K5BA 5CCHA 2OTJP 3USSA 5CCGA 2ZT9D 2WITA 3MUDC 4GOEA 2IDBA 2K3RA 2HODA 3TK1A 1AQ5A 2E76C 2IFNA 2OARA 3MIWA 1SQPJ 2CK3H 4LLHA 4NPEA 2I8DA 4R4LA 1FAVA 3GLMA 3D71A 1LT1A 3TGUE 1L0NE 3P8CE 3RL0B 1PL5A 2M0BA 1KB9D 3JCUH 2J58A 2FYNC 2Y0DA 1JTHA 2PGDA 5AVVB 4BRYB 1KYOI 4H0LD 1SQVD 1BGYJ 3AE5C 1JY3N 3TGUG 1LTTC 2WVRA 2J5UA 3NFQA 3D6ZA 1CSBA 3O6QA 2M5AB 3AE2C 4QMAA 2G8YA 1FJKA 3G71P 2YXRB 2B87A 3CWBE 1LP1B 5KJ7A 3B5ND 3BCCJ 4ASWA 5TISH 3C1LA 3T97A 1RQVA 1EXIA 3H1JE 1Z56A 3MTUE 1PZQA 2KNCA 1NJIQ 3CWBG 2AXTH 2YKPA 3L74E 1NOHA 4JQ0D 5AW0B 3CCQP 1ZR4A 1SQPK 1OW7A 1EDKA 3VN0A 2Q3EA 2WZ7A 2WT7B 1N73B 1J1DC 2IYPA 3L74G 3HE5B 1P84D 1L0LJ 1SQXD 3VP8A 2W27A 3CPWO 5KAIH 1G2CB 3VOPA 1EZVE 4XFJA 2KS1B 3L72D 3RL0D 1DH3A 1R5SA 5K5GB 1QGKB 1N2DC 1LJ2A 1L2PA 5KLVJ 2ZVNB 3OAKA 4GDOA 3V2RA 3CXHI 1EZVG 4DZOA 3L73D 1ZLLA 4D6TD 5KLIB 3E1IA 2FKWB 4WBAA 4Y99C 2ZXXA 5KAFE 2WMMA 2OYIC 3L35A 4B86A 3HTKA 2KSEA 1LTBC 4DOJA 1PV3A 4OVNF 1IFMA 3N7NA 1JM0A 2Y0CA 2HG5D 2HODB 2O1JA 3S4RA 3L37A 2E74B 4R4MA 3H1KE 4RESB 3V5BA 2JKVA 2P1JA 1ZOYC 2Q6QA 4TT3H 2XNDH 3L71E 3EQ2A 1LT9A 3FWLA 2H89C 4OWFA 3SWKA 1KC8Q 2JWDA 1JTHB 3H1KG 3SSUA 4YXDC 3GF7A 4PD4H 2ZAEB 1NAFA 3MUDA 1SQQD 2BASA 2QJPB 1IFNA 1L0LK 1M56D 1KYOD 4YTPC 3RK3C 3GW6A 3TSIA 1VL2A 4MN4C 1IZNB 1R8EA 1BSHA 4IL6X 2H8PD 3O6QB 3RGUA 2PFXA 3CX5H 5KLVK 4L75A 1FZGA 3Q2YA 3H1LJ 2B87B 1PP9J 3RL0g 1Y47A 1D7MA 1NTKK 1URQC 4U7JA 3T97B 2Y9YA 1BCCJ 2NPSB 2QEXP 3E7KA 2KNCB 3CCVP 1A02J 2ZYAA 1KB9E 5H2FH 1S5LE 2WSFJ 2P67A 1R5LA 2E75B 2I1KA 5CCHD 2OTLP 1S1CX 3OW2O 2KUBA 3CL3D 5CCGD 1SQVE 4IOIH 3B8EB 3VTPC 1U7JA 1TU3F 1ZR2A 1YITP 3BASA 4BXLA 2E74D 2FFDB 2AEMA 1L4AC 3W67A 1HGZA 1PGPA 4I1LA 1SQVG 4U3FD 5GTIE 1S4XA 2E5YA 1SP4A 5CJ0A 1N7SB 2ZYGA 4OGQC 1GZLA 1YHQP 4WWIA 2XNXA 3R2PA 1NH4A 2MJZA 1IK7A 3CXHD 3H32A 1KORA 2W90A 4EDFA 2Q3IA 1AVOA 2GM4A 1FDOA 4UB8H 1YJWP 1T3UA 1JCCA 2N1TB 3HTKB 3FXDA 5DJTB 1SS1A 3P8MC 3AE7C 3CLQA 1RH5B 2W8ZA 5KJ7D 5APXA 3PHLA 1P84E 5AW9B 2RH0A 1VQOP 3PLNA 1SQXE 2YMKA 1IFIA 1YJ9P 3AE4C 1NKNA 2H43A 1AFOA 3L72E 1GK4A 2QJYB 2XZRA 1X8YA 1BGYD 4RO0A 3G6EP 1HH0A 1DD3A 1XTCC 2E75D 1LT9B 2KZJA 2OYIA 2Q9IA 1JY3O 1SQXG 2P2UA 1OXZA 3L72G 3L73E 5L8RJ 1EDLA 3AEGC 4D6TE 1OW8A 2E76B 1X22A 2FYZA 2E5TA 2KB7P 3BCCD 3PH0A 3Q5SA 2R5DA 3CX5I 4HYTB 2D2CC 1PIXA 5B66E 4WY4C 1LTJB 1K04A 3AECC 2K88A 1VQMP 1N7LA 1N7SD 1H0TA 4A7PA 5AVZB 3HE4B 2FYNB 3IN6A 2Y9ZA 4GOFA 1U7MA 3A7OA 2KZIA 1VQ4P 1JY2P 1FJPA 3HD7C 1NTZJ 2WTYA 2R5BA 2W83C 3L70J 3CCMP 5GTHE 1KV4A 3AE1C 1SQQE 5CMZA 1KYOE 1M1JC 2HYNA 1JEKA 1GD2E 2R32A 3RK2C 1OIPA 2HPCA 3U1CA 3A2AA 3WMM0 5KLVD 3SWYA 1SQQG 2ZJSE 2P58A 3VYIA 4TLFA 2OYHC 1IC2A 1NTKD 1YBKA 3G3ZA 4C7NA 2IFMA 1NGMB 1NYHA 3H32B 2E76D 3VMYA 2K37A 4RJTA 1L4AA 3D6YA 3A5TA 2LKMA 3L75J 3ZDMA 3M06A 5E79E 1KFNA 2KLVA 3CC2P 5CBNA 1MV8A 1NTZK 1JY2O 4U3FE 1RF1C 3H1HJ 1IFDA 1HJBA 1CI6A 1Q7YQ 1L0NJ 4PV1B 2B9BA 1J1EB 2A45H 2QVAA 3CMAP 1Q81Q 1RY3A 2CPBA 3A0BE 4HKZH 1VDFA 3MP7B 4GIFA 1VQ6P 4U3FG 3CXHE 3GG2A 3H1IG 4IL6E 3Q5PA 4UB6E 3OJAB 3JC22 1KILB 1PGOA 2OGUA 2R3CA 3H1LD 2JR8A 1KFMA 4H13C 5AW5B 5KKZB 1FS0E 2R44A 2Y0EA 3O8ZA 1BCCD 1RE3A 2E42A 1QVFO 3W68A 1DEEG 5AW3B 1OVVA 1VPCA 1H0TB 3H1JJ 1SQPG 1ZP0C 1SQBJ 2FYUJ 1QX8A 2YIUC 1K8AQ 5AVUB 1BGYE 2IX7C 1Q86Q 2CPSA 3IF4A 1QEXA 2P7JA 3HUSB 4JF7A 1KQGB 2UWJE 2HR3A 2I1JA 1SFCA 3WU2E 1DD4A 4H0LC 2XKMA 1VQNP 1FDMA 1BGYG 4WY4A 2PAJA 2QJKC 2O3JA 2AXCA 4IFMA 1EXJA 5TJHA 3EFFK 3BCCE 1L0NK 3WUUA 1ZW0A 1HJ0A 2HPCB 3VMXA 1GK6A 3MD0A 1FZAA 3IFMA 1RE4C 3CCLP 4PV1D 3KZIE 3I55P 3HD7A 2KLUA 5AVXB 2FBWC 3B5NC 2YKOA 3BCCG 2RKLA 5KAFH 1N86A 3M9HA 4L73A 4C7NB 3M9QA 1FZCC 1DEBA 1M1JA 2VRSA 1KILD 2IBZD 3TF5A 1FOSE 3C8VA 3AE3C 3I56P 5APYA 1S3JA 1JO5A 3PTZA 1L4AB 4GODA 3CD6P 2WWWA 1AA0A 1FZBA 1RHZB 4YXWH 3NTNA 1SQBK 5CHXA 2OYHA 1VF5B 2FYUK 1YIJP 3EWKA 3SFDC 5KLVE 5AVYB 4OGQB 1M90Q 3A0HE 3Q3DA 4KHXA 3L71J 2IZ0A 2A45I 3RL0C 1VQ8P 2QA4P 1NTKE 4GT1A 1IJDB 3R4YA 4GKGA 2C0WA 5KLVG 1SLQA 1OFCX 1PGQA 4W80A 1FE6A 2WSSH 2PRRA 3M0DA 5APWA 4I6MC 2YKQA 2NZ2A 4H44C 3PP5A 1NTKG 2NRGA 4HB1A 3BATA 2R3SA 5KTBA 2QM8A 5BU8B 3KPEA 5AW6B 2A06G 1FOSF 1KB9H 1S5LH 3BRVB 4BWNA 2C9LY 1HBWA 3L70D 2P10A 3CCRP 5APUA 2H7HA 2OTKE 3KHUA 1FDIA 5BU5A 1W2EA 5B5EH 1L4AD 3V6IA 1M1KQ 1USDA 2ITAA 2BCCJ 2FXMA 3FWNA 1OVRA 1EZVI 1SFCB 1T6AA 5GTIH 1VF5D 1HUCA 1JUNA 3H1LE 1JY3P 1K9MQ 3VMAA 1JB0J 4I7ZB 3QWOC 2LR2A 4OGQD 2RMZA 2IPPA 2GUVA 1VQ7P 1CW5A 1BCCE 1HF9A 1LGHB 1NU1J 2KIKA 3HD7B 3H1LG 3PJSK 3IAOA 1WMKA 1PP9G 2OYOA 2N9BA 3H1ID 4N3YB 2MKVA 5AVRB 4JPZB 1BCCG 3L75D 4M3LA 2Z5HA 1M1JB 3G4SP 1FZFA 5H2FE 1JNMA 1T8ZA 1Q82Q 1P84H 5CCHC 5CCGC 4LGDE 2O1KA 1RE4A 2WPRA 3H1HD 3D70A 4KT0J 1SQPD 2E74C 2OYHB 4ZMDA 3L36A 1FZCA 1VQLP 2YMYA 1KQSO 4LC1A 2WSCH 4DT0A 3AEFC 3CI9A 3OA7A 3GHGC 1ZXGA 1GMJA 4K35A 3L73J 2QJPC 1SFCD 4D6TJ 1KILE 2IBZE 2Z4EA 4WY4D 2ZVOB 5B66H 4PD4I 3SWFA 1FC2C 1A02F 1NU1K 3JSVC 1Q90D 2V4HA 1GW3A 1YTZI 1OX3A 1X9VA 2IBZG 3HD7D 1SQBD 2KP8A 2FYUD 2KSJA 3N4XA 1LTSC 5GTHH 4K3AA 1JMBA 2NPSC 1RF0C 1PPJD 1N8RQ 2Q1KA 1KYOH 4DJGA 1OW6A 5AVQB 3AEAC 1NAYA 4HH2A 3V2QA 1YTZT 1EDIA 1OZHA 5AVTB 2M5AA 2QM7A 1SQQJ 4H13B 4YPCA 5APVA 4C7RA 3V4QA 1T3JA 1PGJA 2ZYDA 1ZRTD 1T2KD 2FFDC 1L0LD 1NO4A 2QE7H 1BE3J 1URQA 2YIUB 2B89A 1USEA 3KYQA 1GL2C 4HJGH 3CMEP 1N7SC 2RN0A 1M57D 5EFWB 1AJYA 3L70E 4PJ0H 5CJ4A 1NTMJ 4L74A 3LW5H 2WT7A 5E79H 3QH9A 1NTZG 1E79H 3HE5A 3TNUA 1NWQA 4AUWA 3VP9A 5AW8B 2N1TC 3L70G 2JJLA 2XV5A 3GF3A 2A06D 1QL2A 1J1DB 2JO1A 1K05A 3KQGA 3A0BH 1MFZA 2QJYC 1G1IA 2KXPB 3NMDA 1FZCB 3CXHH 3AE9C 4IL6H 4XA4A 2FY8A 1VQ5P 3KXDA 2WPQA 3ITKA 3CCEP 4WVZA 1UIXA 3E1RA 3H1IE 1OMIA 3U1AA 3TGUJ 3II6A 4H13D 2N9YB 3A3YB 1VQKP 4Y99B 2IYOA 3GMAA 1ZV8A 3L75E 4ZKPA 2OYIB 4N78D 1HWTC 4PD4D 2H88C 1IFPA 3L4FA 3L75G 3S9OA 3H1HE 1LTJC 3SFEC 1NTMK 1PP9D 1SQPE 3P7KA 3GHGA 4W7YA 2ZT9C 3CX5D 3FXEA 3CWBJ 1NKZB 4JYBA 3CCJP 2KI7B 4W7ZA 3M9BA 4NPDA 2BCCD 3H1HG 3WU2H 1BDCA 1L0NG 1J2JB 1JOCA 1YJNP 1KN7A 4H44B 1YQ4C 3BVHA 1M7LA 3RK3B 1NHLA 2LXCB 3JCUE 3L74J 1GU5A 3LIEA 2QG4A 3G9RA 1JMMA 3KZIH 2A45G 1BDDA 1NU1D 5AVWB 1HTLC 2O01H 1KQFB 1QLED 3H25A 2NPSA 1RF0A 1GTWA 1NVOA 1SQBE 1QVGO 2FYUE 3FX0A 2QSIA 1URQB 2O01J 1AVYA 2HLOA 1VQ9P 3H1JG 3HRNA 2O01N 4JBZA 5TISE 1PPJE 2G3AA 1KTMA 1SQBG 1ZMEC 2FYUG 4EYYQ 1FU1A 1Y9BA 2WSEH 2FFDA 3TNUB 5AW1B 1LWUC 2QRXA 4IFDK 2AXTE 2K9JA 1PPJG 3F89A 3B4SA 3A0HH 2WSEJ 1ZRTE 1VQPP 2JEEA 1E5WA 1L0LE 2JDIH 1GL2A 4OH8B 1N7SA 2KK7A 2Q7CA 1U57A 3MHVA 4PV1C 3M91A 1J1EC 3CC7P 1NTKJ 2GA1A 3H1KJ 4H44D 1L0LG 5KAIE 1KMIZ 2N1TA 1CI6B 3RK3D 1MFTA 3ABVC 1KILC 1DX7A 3KDPB 3U59A 4Y28J 4O9BA 5KKZC 2A06E 2FXPA 1S9KD 3Q1MA 1URQD 2YO3A 5APQA 1JY2N 1RF1A 3AEEC 3GHGB 1S72P 2L91A 3NXSA 1FBMA 2AEFA 4WB4A 1NTZD 4KJMA 4DCKA 1K73Q 1XTGB 3L71G 4N6JA 3S1KA 2V7QH 3HUSC 3AEBC 4L76A 1W2BO 3AE6C 1EQ7A 5APSA 4EOTA 3RBZA 4AYCA 1LTJA 4N78E 2OQQA 2V7QJ 5BVZA 3V4WA 1SQVJ 4PD4E 1BE3D 1QL1A 1DIPA 3HE4A 1AQTA 2D2CB 1N73C 2WSFH 4EIJA 4WY4B 1EDJA 3TYYA 1NTMD 2ZFCA 1PP9E 1H89A 1CZQA 1SVFA 3CX5E 1RQUA 1MUUA 3MZWB 1KQLA 1PFIA 2POHA 4RKUJ 3EFGA 2M3BA 2BCCE 3V2NA 2M3EA 5CBOA 2PP6A 1MKMA 1LNQA 2JWAA 5B5EE 5AW2B 5KLIC 1OWAA 2IZ1A 2BCCG 1H8AA 3RK2B 2K9JB 1BSNA 1JCDA 4Z1MH 1VF5C 1NU1E 1OVUA 1GL2B 1GU4A 2AEJA 1YYCA 3TGUD 1L0ND 3P8CD 3B5NA 3CCSP 1M8OB 1SQXJ 2C0XA 1GDTA 1NU1G 3AE8C 3L72J 3VMZA 2W6JH 2YXQB 1MZ9A 1YI2P 1ZN5A 5AVSB 2ZXEB 1SQVK 4ZKUA 1LWUA 2WPVB 3UIAA 3F5HA 2LXBA 1X79B 3AEDC 2D2CD 2C9NY 2WSCJ 2K1AA 1LTGC 1IFJA 2WPSA 3CWBD 1GW4A 2NPSD 4UB8E 2BEZF 1LTAC 2JP3A 3MGNA 1RE3C 3H6PA 5DJUB 1KD1Q 2L5GB 3H1JD 1RF1B 3V2PA 3PRJA 1WRGA 2XDJA 1FZEA 1KB9I 5KJ7C 3TDKA 3I5CA 2SPZA 4I2LC 3L74D 1KILA 1HGVA 3WUTA 4BRYA 2M8RA 1X0TA 5AW7B 3RK3E 3CC4P 2Q5UA
chains in the Genus database with same CATH topology
3CL3D 5CCGD 3RK2D 2OYIB 4N78D 1JO5A 3B8EB 1HWTC 1SFCC 1L4AB 3VTPC 2Z5IA 2WWWA 4C46A 1ZR2A 3BASA 1FZBA 1IK9A 1KZUB 4IFFA 1GL2D 2FFDB 2E43A 1SQXK 1L4AC 3L4FA 3NTNA 3M0AA 1HGZA 1SQBK 5CHXA 2OYHA 2FYUK 1LTJC 4I1LA 1NTMK 3IR9A 3P7KA 1S9KE 5AVYB 3GHGA 4W7YA 4KHXA 1NKZB 2XU6A 4JYBA 1SP4A 2GUSA 5CJ0A 2A45I 3RL0C 4W7ZA 1LTIC 1N7SB 3HUSA 2W6BA 3M9BA 1GZLA 2N1TD 4GT1A 1IJDB 2XNXA 4GKGA 3R2PA 4AQRD 2W6AA 1G1JA 3C9IA 1J2JB 1JOCA 1NH4A 2C0WA 2MJZA 1HVVA 1SLQA 3H32A 4W80A 3M0DA 2Q3IA 5APWA 4I6MC 3BVHA 2GM4A 2YKQA 1M7LA 3RK3B 1NHLA 1T3UA 1JCCA 1H88A 3PP5A 2N1TB 3LIEA 1GU5A 3HTKB 1N73A 3P32A 4JYCA 1JMMA 2A45G 3P8MC 3CLQA 3BRTB 3BATA 5AVWB 5KTBA 1HTLC 2O01H 5KJ7D 1T2KC 5APXA 2QM8A 5BU8B 1G2CA 3KPEA 5AW9B 5AW6B 2NPSA 1RF0A 1GTWA 1FOSF 1IFIA 1NKNA 2KYVA 2J59M 1IO4A 2H43A 1AFOA 3BRVB 1GK4A 2XZRA 1URQB 1X8YA 2C9LY 1HBWA 3B5NB 1WT6A 4XE5B 5APUA 1HH0A 2HFED 2HLOA 1XTCC 2H7HA 1LT9B 3HRNA 5AW4B 2OYIA 2Q9IA 1JY3O 2YNYA 3LIDA 2P2UA 1SQQK 1OXZA 2KOGA 5BU5A 1W2EA 1FU1A 1L4AD 1LT9C 1LWUB 3M0DC 2WSEH 5APTA 2FFDA 2YO2A 2FXMA 5CCHA 3TNUB 2FYZA 1SFCB 5AW1B 1LWUC 2KB7P 5CCGA 4IFDK 2WITA 1HUCA 1JUNA 1JY3P 2R5DA 2HODA 3TK1A 1AQ5A 4HYTB 2IFNA 2JEEA 1E5WA 2OARA 3MIWA 1GL2A 2IPPA 4OH8B 2GUVA 4WY4C 1LTJB 1N7SA 4LLHA 2Q7CA 1CW5A 1N7LA 1N7SD 1LGHB 1FAVA 5AVZB 3HD7B 3HE4B 3M91A 3P8CE 3A7OA 1J1EC 3RL0B 2N9BA 4N3YB 1JY2P 1FJPA 5AVRB 2J58A 3HD7C 1JTHA 2WTYA 2N1TA 1CI6B 2R5BA 3RK3D 4M3LA 2Z5HA 5AVVB 1M1JB 1FZFA 1JY3N 1JNMA 1T8ZA 1KILC 1LTTC 1DX7A 5CMZA 5CCHC 3NFQA 1CSBA 1M1JC 3KDPB 3U59A 2HYNA 1GD2E 2R32A 4O9BA 5CCGC 4LGDE 2O1KA 3RK2C 1RE4A 2WPRA 2HPCA 1FJKA 3U1CA 3A2AA 3WMM0 1S9KD 3SWYA 2OYHB 1URQD 2YO3A 5APQA 5KJ7A 3B5ND 3VYIA 1JY2N 1RF1A 3L36A 3T97A 1FZCA 3GHGB 2OYHC 3NXSA 2YMYA 1Z56A 3MTUE 1IC2A 1FBMA 4LC1A 2WSCH 3G3ZA 4C7NA 4WB4A 3CI9A 3OA7A 3GHGC 1XTGB 2IFMA 2YKPA 4N6JA 3H32B 3HUSC 1SFCD 3VMYA 1NOHA 2Z4EA 1EQ7A 5APSA 4WY4D 4EOTA 5AW0B 1L4AA 1ZR4A 1SQPK 3SWFA 4AYCA 3VN0A 1A02F 1LTJA 3A5TA 2LKMA 4N78E 2WZ7A 2WT7B 1N73B 1NU1K 3M06A 1J1DC 3V4WA 5BVZA 1GW3A 1QL1A 1YTZI 3HE5B 1X9VA 3HE4A 1KFNA 2KLVA 3VP8A 1N73C 2WSFH 2W27A 4EIJA 3HD7D 1G2CB 2KP8A 4WY4B 3VOPA 1MV8A 1NTZK 3TYYA 2ZFCA 3RL0D 1DH3A 1JY2O 2KSJA 1H89A 1RF1C 1CZQA 1IFDA 3N4XA 1SVFA 1CI6A 1LTSC 1N2DC 1HJBA 1MUUA 2NPSC 1KQLA 1J1EB 2A45H 1RF0C 3OAKA 1PFIA 3V2RA 1RY3A 2CPBA 2POHA 5AVQB 3EFGA 4DZOA 1VDFA 2M3BA 1ZLLA 4GIFA 4HH2A 3V2QA 3V2NA 3E1IA 1YTZT 2FKWB 5AVTB 4WBAA 4Y99C 2PP6A 2QM7A 3OJAB 2OYIC 3L35A 5AW2B 4B86A 3HTKA 1KILB 1LTBC 2R3CA 5APVA 4C7RA 4DOJA 3V4QA 1T3JA 1OWAA 1T2KD 1H8AA 3RK2B 1KFMA 5AW5B 1IFMA 2FFDC 1JCDA 3N7NA 1NO4A 2HG5D 2HODB 3O8ZA 2O1JA 1RE3A 2E42A 3L37A 1GL2B 5AW3B 1GU4A 1YYCA 4RESB 3V5BA 1URQA 1VPCA 3P8CD 3B5NA 2P1JA 3KYQA 1GL2C 1N7SC 2C0XA 1GDTA 3EQ2A 1LT9A 3VMZA 5AVUB 5CJ4A 2IX7C 3LW5H 1MZ9A 1ZN5A 5AVSB 2CPSA 1JTHB 2ZXEB 1SQVK 4ZKUA 1LWUA 2WT7A 2P7JA 1NAFA 3HUSB 3MUDA 2BASA 4JF7A 1IFNA 3UIAA 1L0LK 3HE5A 3TNUA 3RK3C 1NWQA 3VP9A 4AUWA 2I1JA 3TSIA 5AW8B 1SFCA 2N1TC 2XKMA 1X79B 2JJLA 2XV5A 1FDMA 4WY4A 2PAJA 2C9NY 1QL2A 4IFMA 2H8PD 1J1DB 1LTGC 1L0NK 1IFJA 2WPSA 5KLVK 1GW4A 2NPSD 2HPCB 3KQGA 3VMXA 1GK6A 3MD0A 1FZGA 1LTAC 1FZAA 3MGNA 3IFMA 1RE3C 3H6PA 1RE4C 1MFZA 2L5GB 3HD7A 5AVXB 1NTKK 1RF1B 1URQC 3V2PA 1G1IA 1WRGA 3B5NC 2XDJA 3NMDA 1FZEA 1FZCB 2YKOA 4XA4A 1N86A 2WPQA 5KJ7C 3M9HA 2NPSB 3I5CA 4C7NB 4I2LC 3M9QA 1KILA 1A02J 1FZCC 3U1AA 1DEBA 1HGVA 3II6A 1M1JA 3A3YB 2VRSA 2P67A 1KILD 2M8RA 5AW7B 2I1KA 5CCHD 4Y99B 1FOSE 1ZV8A 4ZKPA 5APYA 2Q5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L36 A;  3T97 A;  5AW4 B;  3B8E B;  2YNY A;  3LID A;  1HWT C;  3NXS A;  3VTP C;  2P2U A;  3O8Z A;  1OXZ A;  2Z5I A;  2WWW A;  3L37 A;  4C46 A;  2E42 A;  5AW3 B;  4LC1 A;  1GU4 A;  4C7N A;  5APT A;  1YYC A;  2E43 A;  2YO2 A;  4RES B;  3V5B A;  3TNU B;  3NTN A;  3M0A A;  5AW1 B;  3IR9 A;  1HUC A;  3P7K A;  3VMY A;  1JUN A;  1S9K E;  2R5D A;  5AVY B;  3VMZ A;  5AVU B;  5APS A;  4EOT A;  5AW0 B;  3TK1 A;  4HYT B;  4KHX A;  2XU6 A;  5AVS B;  4JYB A;  1SP4 A;  3SWF A;  2ZXE B;  3VN0 A;  2IPP A;  4AYC A;  3A5T A;  1A02 F;  2WT7 A;  2WT7 B;  2P7J A;  1NAF A;  3M06 A;  3M9B A;  2BAS A;  1GZL A;  2Q7C A;  3UIA A;  3V4W A;  4GT1 A;  3HE5 A;  3TNU A;  4GKG A;  4AQR D;  3HE5 B;  1FAV A;  1NWQ A;  4AUW A;  2W6A A;  5AW8 B;  3HE4 A;  5AVZ B;  3HE4 B;  1J2J B;  1SLQ A;  2W27 A;  2JJL A;  2XV5 A;  3M91 A;  1G2C B;  2KP8 A;  3A7O A;  3M0D A;  2Q3I A;  1MV8 A;  5APW A;  2C9N Y;  2N9B A;  3TYY A;  4I6M C;  2ZFC A;  1DH3 A;  5AVR B;  2WPS A;  1H89 A;  1CZQ A;  2WTY A;  1H88 A;  3KQG A;  1GU5 A;  3LIE A;  1CI6 A;  3VMX A;  1HJB A;  1CI6 B;  1GK6 A;  2R5B A;  3MD0 A;  4M3L A;  3P32 A;  4JYC A;  2Z5H A;  5AVV B;  3MGN A;  1MUU A;  3P8M C;  1KQL A;  1MFZ A;  3OAK A;  5AVW B;  1JNM A;  5AVQ B;  5AVX B;  4DZO A;  5CMZ A;  3NFQ A;  1T2K C;  3NMD A;  1CSB A;  2QM8 A;  5APX A;  3KDP B;  1GD2 E;  2R32 A;  5AW9 B;  5AW6 B;  5AVT B;  2WPQ A;  3M9H A;  2WPR A;  1GTW A;  1FOS F;  3I5C A;  2QM7 A;  4C7N B;  4I2L C;  1IO4 A;  3L35 A;  5AW2 B;  4B86 A;  1A02 J;  3HTK A;  1GK4 A;  2XZR A;  2R3C A;  1X8Y A;  5APV A;  3A2A A;  2C9L Y;  1HBW A;  3A3Y B;  1S9K D;  2VRS A;  2P67 A;  3V4Q A;  1OWA A;  5AW7 B;  2YO3 A;  5APQ A;  1T2K D;  4XE5 B;  1H8A A;  5APU A;  3VYI A;  1FOS E;  5AW5 B;  5APY A;  2H7H A;  2Q5U A; 
#chains in the Genus database with same CATH topology
 3Q5R A;  3RK2 D;  1SFC C;  2E75 C;  3L73 G;  3WUV A;  4D6T G;  2Z5I A;  4C46 A;  5C39 A;  2QIW A;  1IK9 A;  1KZU B;  4NPF X;  4IFF A;  1GL2 D;  4I7Z C;  2E43 A;  1SQX K;  1EZV D;  2ZT9 B;  3M0A A;  1LP1 A;  3IR9 A;  1S9K E;  1W5C E;  2XU6 A;  2DW3 A;  2GUS A;  1LTI C;  3HUS A;  2W6B A;  5M1B A;  1YQ3 C;  2N1T D;  3RBX A;  4AQR D;  2W6A A;  1G1J A;  3C9I A;  2FXO A;  1NTZ E;  1HVV A;  2WQY C;  3B71 A;  3FGA D;  1EC5 A;  3CCU P;  1H88 A;  1S5L X;  4H0L B;  1Q2N A;  4CPG A;  1N73 A;  3P32 A;  4JYC A;  3BRT B;  2QJK B;  4ASV A;  1P84 I;  4ZNC A;  3LW5 J;  1BE3 E;  1T2K C;  1G2C A;  1Y8A A;  2KS1 A;  3H1K D;  1UII A;  2KYV A;  2J59 M;  2K9Y A;  4EI2 A;  1IO4 A;  3L71 D;  1NTM E;  3B5N B;  2IBZ I;  1WT6 A;  2BEQ D;  4XE5 B;  1BE3 G;  2HFE D;  1S2E A;  4U3F J;  3H1I J;  5AW4 B;  2B88 A;  1AV1 A;  2YNY A;  3LID A;  4PJ0 E;  4UB6 H;  1SQQ K;  2KOG A;  1LT9 C;  1LWU B;  1NTM G;  3M0D C;  5APT A;  2YO2 A;  3K5B A;  5CCH A;  2OTJ P;  3USS A;  5CCG A;  2ZT9 D;  2WIT A;  3MUD C;  4GOE A;  2IDB A;  2K3R A;  2HOD A;  3TK1 A;  1AQ5 A;  2E76 C;  2IFN A;  2OAR A;  3MIW A;  1SQP J;  2CK3 H;  4LLH A;  4NPE A;  2I8D A;  4R4L A;  1FAV A;  3GLM A;  3D71 A;  1LT1 A;  3TGU E;  1L0N E;  3P8C E;  3RL0 B;  1PL5 A;  2M0B A;  1KB9 D;  3JCU H;  2J58 A;  2FYN C;  2Y0D A;  1JTH A;  2PGD A;  5AVV B;  4BRY B;  1KYO I;  4H0L D;  1SQV D;  1BGY J;  3AE5 C;  1JY3 N;  3TGU G;  1LTT C;  2WVR A;  2J5U A;  3NFQ A;  3D6Z A;  1CSB A;  3O6Q A;  2M5A B;  3AE2 C;  4QMA A;  2G8Y A;  1FJK A;  3G71 P;  2YXR B;  2B87 A;  3CWB E;  1LP1 B;  5KJ7 A;  3B5N D;  3BCC J;  4ASW A;  5TIS H;  3C1L A;  3T97 A;  1RQV A;  1EXI A;  3H1J E;  1Z56 A;  3MTU E;  1PZQ A;  2KNC A;  1NJI Q;  3CWB G;  2AXT H;  2YKP A;  3L74 E;  1NOH A;  4JQ0 D;  5AW0 B;  3CCQ P;  1ZR4 A;  1SQP K;  1OW7 A;  1EDK A;  3VN0 A;  2Q3E A;  2WZ7 A;  2WT7 B;  1N73 B;  1J1D C;  2IYP A;  3L74 G;  3HE5 B;  1P84 D;  1L0L J;  1SQX D;  3VP8 A;  2W27 A;  3CPW O;  5KAI H;  1G2C B;  3VOP A;  1EZV E;  4XFJ A;  2KS1 B;  3L72 D;  3RL0 D;  1DH3 A;  1R5S A;  5K5G B;  1QGK B;  1N2D C;  1LJ2 A;  1L2P A;  5KLV J;  2ZVN B;  3OAK A;  4GDO A;  3V2R A;  3CXH I;  1EZV G;  4DZO A;  3L73 D;  1ZLL A;  4D6T D;  5KLI B;  3E1I A;  2FKW B;  4WBA A;  4Y99 C;  2ZXX A;  5KAF E;  2WMM A;  2OYI C;  3L35 A;  4B86 A;  3HTK A;  2KSE A;  1LTB C;  4DOJ A;  1PV3 A;  4OVN F;  1IFM A;  3N7N A;  1JM0 A;  2Y0C A;  2HG5 D;  2HOD B;  2O1J A;  3S4R A;  3L37 A;  2E74 B;  4R4M A;  3H1K E;  4RES B;  3V5B A;  2JKV A;  2P1J A;  1ZOY C;  2Q6Q A;  4TT3 H;  2XND H;  3L71 E;  3EQ2 A;  1LT9 A;  3FWL A;  2H89 C;  4OWF A;  3SWK A;  1KC8 Q;  2JWD A;  1JTH B;  3H1K G;  3SSU A;  4YXD C;  3GF7 A;  4PD4 H;  2ZAE B;  1NAF A;  3MUD A;  1SQQ D;  2BAS A;  2QJP B;  1IFN A;  1L0L K;  1M56 D;  1KYO D;  4YTP C;  3RK3 C;  3GW6 A;  3TSI A;  1VL2 A;  4MN4 C;  1IZN B;  1R8E A;  1BSH A;  4IL6 X;  2H8P D;  3O6Q B;  3RGU A;  2PFX A;  3CX5 H;  5KLV K;  4L75 A;  1FZG A;  3Q2Y A;  3H1L J;  2B87 B;  1PP9 J;  3RL0 g;  1Y47 A;  1D7M A;  1NTK K;  1URQ C;  4U7J A;  3T97 B;  2Y9Y A;  1BCC J;  2NPS B;  2QEX P;  3E7K A;  2KNC B;  3CCV P;  1A02 J;  2ZYA A;  1KB9 E;  5H2F H;  1S5L E;  2WSF J;  2P67 A;  1R5L A;  2E75 B;  2I1K A;  5CCH D;  2OTL P;  1S1C X;  3OW2 O;  2KUB A;  3CL3 D;  5CCG D;  1SQV E;  4IOI H;  3B8E B;  3VTP C;  1U7J A;  1TU3 F;  1ZR2 A;  1YIT P;  3BAS A;  4BXL A;  2E74 D;  2FFD B;  2AEM A;  1L4A C;  3W67 A;  1HGZ A;  1PGP A;  4I1L A;  1SQV G;  4U3F D;  5GTI E;  1S4X A;  2E5Y A;  1SP4 A;  5CJ0 A;  1N7S B;  2ZYG A;  4OGQ C;  1GZL A;  1YHQ P;  4WWI A;  2XNX A;  3R2P A;  1NH4 A;  2MJZ A;  1IK7 A;  3CXH D;  3H32 A;  1KOR A;  2W90 A;  4EDF A;  2Q3I A;  1AVO A;  2GM4 A;  1FDO A;  4UB8 H;  1YJW P;  1T3U A;  1JCC A;  2N1T B;  3HTK B;  3FXD A;  5DJT B;  1SS1 A;  3P8M C;  3AE7 C;  3CLQ A;  1RH5 B;  2W8Z A;  5KJ7 D;  5APX A;  3PHL A;  1P84 E;  5AW9 B;  2RH0 A;  1VQO P;  3PLN A;  1SQX E;  2YMK A;  1IFI A;  1YJ9 P;  3AE4 C;  1NKN A;  2H43 A;  1AFO A;  3L72 E;  1GK4 A;  2QJY B;  2XZR A;  1X8Y A;  1BGY D;  4RO0 A;  3G6E P;  1HH0 A;  1DD3 A;  1XTC C;  2E75 D;  1LT9 B;  2KZJ A;  2OYI A;  2Q9I A;  1JY3 O;  1SQX G;  2P2U A;  1OXZ A;  3L72 G;  3L73 E;  5L8R J;  1EDL A;  3AEG C;  4D6T E;  1OW8 A;  2E76 B;  1X22 A;  2FYZ A;  2E5T A;  2KB7 P;  3BCC D;  3PH0 A;  3Q5S A;  2R5D A;  3CX5 I;  4HYT B;  2D2C C;  1PIX A;  5B66 E;  4WY4 C;  1LTJ B;  1K04 A;  3AEC C;  2K88 A;  1VQM P;  1N7L A;  1N7S D;  1H0T A;  4A7P A;  5AVZ B;  3HE4 B;  2FYN B;  3IN6 A;  2Y9Z A;  4GOF A;  1U7M A;  3A7O A;  2KZI A;  1VQ4 P;  1JY2 P;  1FJP A;  3HD7 C;  1NTZ J;  2WTY A;  2R5B A;  2W83 C;  3L70 J;  3CCM P;  5GTH E;  1KV4 A;  3AE1 C;  1SQQ E;  5CMZ A;  1KYO E;  1M1J C;  2HYN A;  1JEK A;  1GD2 E;  2R32 A;  3RK2 C;  1OIP A;  2HPC A;  3U1C A;  3A2A A;  3WMM 0;  5KLV D;  3SWY A;  1SQQ G;  2ZJS E;  2P58 A;  3VYI A;  4TLF A;  2OYH C;  1IC2 A;  1NTK D;  1YBK A;  3G3Z A;  4C7N A;  2IFM A;  1NGM B;  1NYH A;  3H32 B;  2E76 D;  3VMY A;  2K37 A;  4RJT A;  1L4A A;  3D6Y A;  3A5T A;  2LKM A;  3L75 J;  3ZDM A;  3M06 A;  5E79 E;  1KFN A;  2KLV A;  3CC2 P;  5CBN A;  1MV8 A;  1NTZ K;  1JY2 O;  4U3F E;  1RF1 C;  3H1H J;  1IFD A;  1HJB A;  1CI6 A;  1Q7Y Q;  1L0N J;  4PV1 B;  2B9B A;  1J1E B;  2A45 H;  2QVA A;  3CMA P;  1Q81 Q;  1RY3 A;  2CPB A;  3A0B E;  4HKZ H;  1VDF A;  3MP7 B;  4GIF A;  1VQ6 P;  4U3F G;  3CXH E;  3GG2 A;  3H1I G;  4IL6 E;  3Q5P A;  4UB6 E;  3OJA B;  3JC2 2;  1KIL B;  1PGO A;  2OGU A;  2R3C A;  3H1L D;  2JR8 A;  1KFM A;  4H13 C;  5AW5 B;  5KKZ B;  1FS0 E;  2R44 A;  2Y0E A;  3O8Z A;  1BCC D;  1RE3 A;  2E42 A;  1QVF O;  3W68 A;  1DEE G;  5AW3 B;  1OVV A;  1VPC A;  1H0T B;  3H1J J;  1SQP G;  1ZP0 C;  1SQB J;  2FYU J;  1QX8 A;  2YIU C;  1K8A Q;  5AVU B;  1BGY E;  2IX7 C;  1Q86 Q;  2CPS A;  3IF4 A;  1QEX A;  2P7J A;  3HUS B;  4JF7 A;  1KQG B;  2UWJ E;  2HR3 A;  2I1J A;  1SFC A;  3WU2 E;  1DD4 A;  4H0L C;  2XKM A;  1VQN P;  1FDM A;  1BGY G;  4WY4 A;  2PAJ A;  2QJK C;  2O3J A;  2AXC A;  4IFM A;  1EXJ A;  5TJH A;  3EFF K;  3BCC E;  1L0N K;  3WUU A;  1ZW0 A;  1HJ0 A;  2HPC B;  3VMX A;  1GK6 A;  3MD0 A;  1FZA A;  3IFM A;  1RE4 C;  3CCL P;  4PV1 D;  3KZI E;  3I55 P;  3HD7 A;  2KLU A;  5AVX B;  2FBW C;  3B5N C;  2YKO A;  3BCC G;  2RKL A;  5KAF H;  1N86 A;  3M9H A;  4L73 A;  4C7N B;  3M9Q A;  1FZC C;  1DEB A;  1M1J A;  2VRS A;  1KIL D;  2IBZ D;  3TF5 A;  1FOS E;  3C8V A;  3AE3 C;  3I56 P;  5APY A;  1S3J A;  1JO5 A;  3PTZ A;  1L4A B;  4GOD A;  3CD6 P;  2WWW A;  1AA0 A;  1FZB A;  1RHZ B;  4YXW H;  3NTN A;  1SQB K;  5CHX A;  2OYH A;  1VF5 B;  2FYU K;  1YIJ P;  3EWK A;  3SFD C;  5KLV E;  5AVY B;  4OGQ B;  1M90 Q;  3A0H E;  3Q3D A;  4KHX A;  3L71 J;  2IZ0 A;  2A45 I;  3RL0 C;  1VQ8 P;  2QA4 P;  1NTK E;  4GT1 A;  1IJD B;  3R4Y A;  4GKG A;  2C0W A;  5KLV G;  1SLQ A;  1OFC X;  1PGQ A;  4W80 A;  1FE6 A;  2WSS H;  2PRR A;  3M0D A;  5APW A;  4I6M C;  2YKQ A;  2NZ2 A;  4H44 C;  3PP5 A;  1NTK G;  2NRG A;  4HB1 A;  3BAT A;  2R3S A;  5KTB A;  2QM8 A;  5BU8 B;  3KPE A;  5AW6 B;  2A06 G;  1FOS F;  1KB9 H;  1S5L H;  3BRV B;  4BWN A;  2C9L Y;  1HBW A;  3L70 D;  2P10 A;  3CCR P;  5APU A;  2H7H A;  2OTK E;  3KHU A;  1FDI A;  5BU5 A;  1W2E A;  5B5E H;  1L4A D;  3V6I A;  1M1K Q;  1USD A;  2ITA A;  2BCC J;  2FXM A;  3FWN A;  1OVR A;  1EZV I;  1SFC B;  1T6A A;  5GTI H;  1VF5 D;  1HUC A;  1JUN A;  3H1L E;  1JY3 P;  1K9M Q;  3VMA A;  1JB0 J;  4I7Z B;  3QWO C;  2LR2 A;  4OGQ D;  2RMZ A;  2IPP A;  2GUV A;  1VQ7 P;  1CW5 A;  1BCC E;  1HF9 A;  1LGH B;  1NU1 J;  2KIK A;  3HD7 B;  3H1L G;  3PJS K;  3IAO A;  1WMK A;  1PP9 G;  2OYO A;  2N9B A;  3H1I D;  4N3Y B;  2MKV A;  5AVR B;  4JPZ B;  1BCC G;  3L75 D;  4M3L A;  2Z5H A;  1M1J B;  3G4S P;  1FZF A;  5H2F E;  1JNM A;  1T8Z A;  1Q82 Q;  1P84 H;  5CCH C;  5CCG C;  4LGD E;  2O1K A;  1RE4 A;  2WPR A;  3H1H D;  3D70 A;  4KT0 J;  1SQP D;  2E74 C;  2OYH B;  4ZMD A;  3L36 A;  1FZC A;  1VQL P;  2YMY A;  1KQS O;  4LC1 A;  2WSC H;  4DT0 A;  3AEF C;  3CI9 A;  3OA7 A;  3GHG C;  1ZXG A;  1GMJ A;  4K35 A;  3L73 J;  2QJP C;  1SFC D;  4D6T J;  1KIL E;  2IBZ E;  2Z4E A;  4WY4 D;  2ZVO B;  5B66 H;  4PD4 I;  3SWF A;  1FC2 C;  1A02 F;  1NU1 K;  3JSV C;  1Q90 D;  2V4H A;  1GW3 A;  1YTZ I;  1OX3 A;  1X9V A;  2IBZ G;  3HD7 D;  1SQB D;  2KP8 A;  2FYU D;  2KSJ A;  3N4X A;  1LTS C;  5GTH H;  4K3A A;  1JMB A;  2NPS C;  1RF0 C;  1PPJ D;  1N8R Q;  2Q1K A;  1KYO H;  4DJG A;  1OW6 A;  5AVQ B;  3AEA C;  1NAY A;  4HH2 A;  3V2Q A;  1YTZ T;  1EDI A;  1OZH A;  5AVT B;  2M5A A;  2QM7 A;  1SQQ J;  4H13 B;  4YPC A;  5APV A;  4C7R A;  3V4Q A;  1T3J A;  1PGJ A;  2ZYD A;  1ZRT D;  1T2K D;  2FFD C;  1L0L D;  1NO4 A;  2QE7 H;  1BE3 J;  1URQ A;  2YIU B;  2B89 A;  1USE A;  3KYQ A;  1GL2 C;  4HJG H;  3CME P;  1N7S C;  2RN0 A;  1M57 D;  5EFW B;  1AJY A;  3L70 E;  4PJ0 H;  5CJ4 A;  1NTM J;  4L74 A;  3LW5 H;  2WT7 A;  5E79 H;  3QH9 A;  1NTZ G;  1E79 H;  3HE5 A;  3TNU A;  1NWQ A;  4AUW A;  3VP9 A;  5AW8 B;  2N1T C;  3L70 G;  2JJL A;  2XV5 A;  3GF3 A;  2A06 D;  1QL2 A;  1J1D B;  2JO1 A;  1K05 A;  3KQG A;  3A0B H;  1MFZ A;  2QJY C;  1G1I A;  2KXP B;  3NMD A;  1FZC B;  3CXH H;  3AE9 C;  4IL6 H;  4XA4 A;  2FY8 A;  1VQ5 P;  3KXD A;  2WPQ A;  3ITK A;  3CCE P;  4WVZ A;  1UIX A;  3E1R A;  3H1I E;  1OMI A;  3U1A A;  3TGU J;  3II6 A;  4H13 D;  2N9Y B;  3A3Y B;  1VQK P;  4Y99 B;  2IYO A;  3GMA A;  1ZV8 A;  3L75 E;  4ZKP A;  2OYI B;  4N78 D;  1HWT C;  4PD4 D;  2H88 C;  1IFP A;  3L4F A;  3L75 G;  3S9O A;  3H1H E;  1LTJ C;  3SFE C;  1NTM K;  1PP9 D;  1SQP E;  3P7K A;  3GHG A;  4W7Y A;  2ZT9 C;  3CX5 D;  3FXE A;  3CWB J;  1NKZ B;  4JYB A;  3CCJ P;  2KI7 B;  4W7Z A;  3M9B A;  4NPD A;  2BCC D;  3H1H G;  3WU2 H;  1BDC A;  1L0N G;  1J2J B;  1JOC A;  1YJN P;  1KN7 A;  4H44 B;  1YQ4 C;  3BVH A;  1M7L A;  3RK3 B;  1NHL A;  2LXC B;  3JCU E;  3L74 J;  1GU5 A;  3LIE A;  2QG4 A;  3G9R A;  1JMM A;  3KZI H;  2A45 G;  1BDD A;  1NU1 D;  5AVW B;  1HTL C;  2O01 H;  1KQF B;  1QLE D;  3H25 A;  2NPS A;  1RF0 A;  1GTW A;  1NVO A;  1SQB E;  1QVG O;  2FYU E;  3FX0 A;  2QSI A;  1URQ B;  2O01 J;  1AVY A;  2HLO A;  1VQ9 P;  3H1J G;  3HRN A;  2O01 N;  4JBZ A;  5TIS E;  1PPJ E;  2G3A A;  1KTM A;  1SQB G;  1ZME C;  2FYU G;  4EYY Q;  1FU1 A;  1Y9B A;  2WSE H;  2FFD A;  3TNU B;  5AW1 B;  1LWU C;  2QRX A;  4IFD K;  2AXT E;  2K9J A;  1PPJ G;  3F89 A;  3B4S A;  3A0H H;  2WSE J;  1ZRT E;  1VQP P;  2JEE A;  1E5W A;  1L0L E;  2JDI H;  1GL2 A;  4OH8 B;  1N7S A;  2KK7 A;  2Q7C A;  1U57 A;  3MHV A;  4PV1 C;  3M91 A;  1J1E C;  3CC7 P;  1NTK J;  2GA1 A;  3H1K J;  4H44 D;  1L0L G;  5KAI E;  1KMI Z;  2N1T A;  1CI6 B;  3RK3 D;  1MFT A;  3ABV C;  1KIL C;  1DX7 A;  3KDP B;  3U59 A;  4Y28 J;  4O9B A;  5KKZ C;  2A06 E;  2FXP A;  1S9K D;  3Q1M A;  1URQ D;  2YO3 A;  5APQ A;  1JY2 N;  1RF1 A;  3AEE C;  3GHG B;  1S72 P;  2L91 A;  3NXS A;  1FBM A;  2AEF A;  4WB4 A;  1NTZ D;  4KJM A;  4DCK A;  1K73 Q;  1XTG B;  3L71 G;  4N6J A;  3S1K A;  2V7Q H;  3HUS C;  3AEB C;  4L76 A;  1W2B O;  3AE6 C;  1EQ7 A;  5APS A;  4EOT A;  3RBZ A;  4AYC A;  1LTJ A;  4N78 E;  2OQQ A;  2V7Q J;  5BVZ A;  3V4W A;  1SQV J;  4PD4 E;  1BE3 D;  1QL1 A;  1DIP A;  3HE4 A;  1AQT A;  2D2C B;  1N73 C;  2WSF H;  4EIJ A;  4WY4 B;  1EDJ A;  3TYY A;  1NTM D;  2ZFC A;  1PP9 E;  1H89 A;  1CZQ A;  1SVF A;  3CX5 E;  1RQU A;  1MUU A;  3MZW B;  1KQL A;  1PFI A;  2POH A;  4RKU J;  3EFG A;  2M3B A;  2BCC E;  3V2N A;  2M3E A;  5CBO A;  2PP6 A;  1MKM A;  1LNQ A;  2JWA A;  5B5E E;  5AW2 B;  5KLI C;  1OWA A;  2IZ1 A;  2BCC G;  1H8A A;  3RK2 B;  2K9J B;  1BSN A;  1JCD A;  4Z1M H;  1VF5 C;  1NU1 E;  1OVU A;  1GL2 B;  1GU4 A;  2AEJ A;  1YYC A;  3TGU D;  1L0N D;  3P8C D;  3B5N A;  3CCS P;  1M8O B;  1SQX J;  2C0X A;  1GDT A;  1NU1 G;  3AE8 C;  3L72 J;  3VMZ A;  2W6J H;  2YXQ B;  1MZ9 A;  1YI2 P;  1ZN5 A;  5AVS B;  2ZXE B;  1SQV K;  4ZKU A;  1LWU A;  2WPV B;  3UIA A;  3F5H A;  2LXB A;  1X79 B;  3AED C;  2D2C D;  2C9N Y;  2WSC J;  2K1A A;  1LTG C;  1IFJ A;  2WPS A;  3CWB D;  1GW4 A;  2NPS D;  4UB8 E;  2BEZ F;  1LTA C;  2JP3 A;  3MGN A;  1RE3 C;  3H6P A;  5DJU B;  1KD1 Q;  2L5G B;  3H1J D;  1RF1 B;  3V2P A;  3PRJ A;  1WRG A;  2XDJ A;  1FZE A;  1KB9 I;  5KJ7 C;  3TDK A;  3I5C A;  2SPZ A;  4I2L C;  3L74 D;  1KIL A;  1HGV A;  3WUT A;  4BRY A;  2M8R A;  1X0T A;  5AW7 B;  3RK3 E;  3CC4 P;  2Q5U A; 
#chains in the Genus database with same CATH homology
 3CL3 D;  5CCG D;  3RK2 D;  2OYI B;  4N78 D;  1JO5 A;  3B8E B;  1HWT C;  1SFC C;  1L4A B;  3VTP C;  2Z5I A;  2WWW A;  4C46 A;  1ZR2 A;  3BAS A;  1FZB A;  1IK9 A;  1KZU B;  4IFF A;  1GL2 D;  2FFD B;  2E43 A;  1SQX K;  1L4A C;  3L4F A;  3NTN A;  3M0A A;  1HGZ A;  1SQB K;  5CHX A;  2OYH A;  2FYU K;  1LTJ C;  4I1L A;  1NTM K;  3IR9 A;  3P7K A;  1S9K E;  5AVY B;  3GHG A;  4W7Y A;  4KHX A;  1NKZ B;  2XU6 A;  4JYB A;  1SP4 A;  2GUS A;  5CJ0 A;  2A45 I;  3RL0 C;  4W7Z A;  1LTI C;  1N7S B;  3HUS A;  2W6B A;  3M9B A;  1GZL A;  2N1T D;  4GT1 A;  1IJD B;  2XNX A;  4GKG A;  3R2P A;  4AQR D;  2W6A A;  1G1J A;  3C9I A;  1J2J B;  1JOC A;  1NH4 A;  2C0W A;  2MJZ A;  1HVV A;  1SLQ A;  3H32 A;  4W80 A;  3M0D A;  2Q3I A;  5APW A;  4I6M C;  3BVH A;  2GM4 A;  2YKQ A;  1M7L A;  3RK3 B;  1NHL A;  1T3U A;  1JCC A;  1H88 A;  3PP5 A;  2N1T B;  3LIE A;  1GU5 A;  3HTK B;  1N73 A;  3P32 A;  4JYC A;  1JMM A;  2A45 G;  3P8M C;  3CLQ A;  3BRT B;  3BAT A;  5AVW B;  5KTB A;  1HTL C;  2O01 H;  5KJ7 D;  1T2K C;  5APX A;  2QM8 A;  5BU8 B;  1G2C A;  3KPE A;  5AW9 B;  5AW6 B;  2NPS A;  1RF0 A;  1GTW A;  1FOS F;  1IFI A;  1NKN A;  2KYV A;  2J59 M;  1IO4 A;  2H43 A;  1AFO A;  3BRV B;  1GK4 A;  2XZR A;  1URQ B;  1X8Y A;  2C9L Y;  1HBW A;  3B5N B;  1WT6 A;  4XE5 B;  5APU A;  1HH0 A;  2HFE D;  2HLO A;  1XTC C;  2H7H A;  1LT9 B;  3HRN A;  5AW4 B;  2OYI A;  2Q9I A;  1JY3 O;  2YNY A;  3LID A;  2P2U A;  1SQQ K;  1OXZ A;  2KOG A;  5BU5 A;  1W2E A;  1FU1 A;  1L4A D;  1LT9 C;  1LWU B;  3M0D C;  2WSE H;  5APT A;  2FFD A;  2YO2 A;  2FXM A;  5CCH A;  3TNU B;  2FYZ A;  1SFC B;  5AW1 B;  1LWU C;  2KB7 P;  5CCG A;  4IFD K;  2WIT A;  1HUC A;  1JUN A;  1JY3 P;  2R5D A;  2HOD A;  3TK1 A;  1AQ5 A;  4HYT B;  2IFN A;  2JEE A;  1E5W A;  2OAR A;  3MIW A;  1GL2 A;  2IPP A;  4OH8 B;  2GUV A;  4WY4 C;  1LTJ B;  1N7S A;  4LLH A;  2Q7C A;  1CW5 A;  1N7L A;  1N7S D;  1LGH B;  1FAV A;  5AVZ B;  3HD7 B;  3HE4 B;  3M91 A;  3P8C E;  3A7O A;  1J1E C;  3RL0 B;  2N9B A;  4N3Y B;  1JY2 P;  1FJP A;  5AVR B;  2J58 A;  3HD7 C;  1JTH A;  2WTY A;  2N1T A;  1CI6 B;  2R5B A;  3RK3 D;  4M3L A;  2Z5H A;  5AVV B;  1M1J B;  1FZF A;  1JY3 N;  1JNM A;  1T8Z A;  1KIL C;  1LTT C;  1DX7 A;  5CMZ A;  5CCH C;  3NFQ A;  1CSB A;  1M1J C;  3KDP B;  3U59 A;  2HYN A;  1GD2 E;  2R32 A;  4O9B A;  5CCG C;  4LGD E;  2O1K A;  3RK2 C;  1RE4 A;  2WPR A;  2HPC A;  1FJK A;  3U1C A;  3A2A A;  3WMM 0;  1S9K D;  3SWY A;  2OYH B;  1URQ D;  2YO3 A;  5APQ A;  5KJ7 A;  3B5N D;  3VYI A;  1JY2 N;  1RF1 A;  3L36 A;  3T97 A;  1FZC A;  3GHG B;  2OYH C;  3NXS A;  2YMY A;  1Z56 A;  3MTU E;  1IC2 A;  1FBM A;  4LC1 A;  2WSC H;  3G3Z A;  4C7N A;  4WB4 A;  3CI9 A;  3OA7 A;  3GHG C;  1XTG B;  2IFM A;  2YKP A;  4N6J A;  3H32 B;  3HUS C;  1SFC D;  3VMY A;  1NOH A;  2Z4E A;  1EQ7 A;  5APS A;  4WY4 D;  4EOT A;  5AW0 B;  1L4A A;  1ZR4 A;  1SQP K;  3SWF A;  4AYC A;  3VN0 A;  1A02 F;  1LTJ A;  3A5T A;  2LKM A;  4N78 E;  2WZ7 A;  2WT7 B;  1N73 B;  1NU1 K;  3M06 A;  1J1D C;  3V4W A;  5BVZ A;  1GW3 A;  1QL1 A;  1YTZ I;  3HE5 B;  1X9V A;  3HE4 A;  1KFN A;  2KLV A;  3VP8 A;  1N73 C;  2WSF H;  2W27 A;  4EIJ A;  3HD7 D;  1G2C B;  2KP8 A;  4WY4 B;  3VOP A;  1MV8 A;  1NTZ K;  3TYY A;  2ZFC A;  3RL0 D;  1DH3 A;  1JY2 O;  2KSJ A;  1H89 A;  1RF1 C;  1CZQ A;  1IFD A;  3N4X A;  1SVF A;  1CI6 A;  1LTS C;  1N2D C;  1HJB A;  1MUU A;  2NPS C;  1KQL A;  1J1E B;  2A45 H;  1RF0 C;  3OAK A;  1PFI A;  3V2R A;  1RY3 A;  2CPB A;  2POH A;  5AVQ B;  3EFG A;  4DZO A;  1VDF A;  2M3B A;  1ZLL A;  4GIF A;  4HH2 A;  3V2Q A;  3V2N A;  3E1I A;  1YTZ T;  2FKW B;  5AVT B;  4WBA A;  4Y99 C;  2PP6 A;  2QM7 A;  3OJA B;  2OYI C;  3L35 A;  5AW2 B;  4B86 A;  3HTK A;  1KIL B;  1LTB C;  2R3C A;  5APV A;  4C7R A;  4DOJ A;  3V4Q A;  1T3J A;  1OWA A;  1T2K D;  1H8A A;  3RK2 B;  1KFM A;  5AW5 B;  1IFM A;  2FFD C;  1JCD A;  3N7N A;  1NO4 A;  2HG5 D;  2HOD B;  3O8Z A;  2O1J A;  1RE3 A;  2E42 A;  3L37 A;  1GL2 B;  5AW3 B;  1GU4 A;  1YYC A;  4RES B;  3V5B A;  1URQ A;  1VPC A;  3P8C D;  3B5N A;  2P1J A;  3KYQ A;  1GL2 C;  1N7S C;  2C0X A;  1GDT A;  3EQ2 A;  1LT9 A;  3VMZ A;  5AVU B;  5CJ4 A;  2IX7 C;  3LW5 H;  1MZ9 A;  1ZN5 A;  5AVS B;  2CPS A;  1JTH B;  2ZXE B;  1SQV K;  4ZKU A;  1LWU A;  2WT7 A;  2P7J A;  1NAF A;  3HUS B;  3MUD A;  2BAS A;  4JF7 A;  1IFN A;  3UIA A;  1L0L K;  3HE5 A;  3TNU A;  3RK3 C;  1NWQ A;  3VP9 A;  4AUW A;  2I1J A;  3TSI A;  5AW8 B;  1SFC A;  2N1T C;  2XKM A;  1X79 B;  2JJL A;  2XV5 A;  1FDM A;  4WY4 A;  2PAJ A;  2C9N Y;  1QL2 A;  4IFM A;  2H8P D;  1J1D B;  1LTG C;  1L0N K;  1IFJ A;  2WPS A;  5KLV K;  1GW4 A;  2NPS D;  2HPC B;  3KQG A;  3VMX A;  1GK6 A;  3MD0 A;  1FZG A;  1LTA C;  1FZA A;  3MGN A;  3IFM A;  1RE3 C;  3H6P A;  1RE4 C;  1MFZ A;  2L5G B;  3HD7 A;  5AVX B;  1NTK K;  1RF1 B;  1URQ C;  3V2P A;  1G1I A;  1WRG A;  3B5N C;  2XDJ A;  3NMD A;  1FZE A;  1FZC B;  2YKO A;  4XA4 A;  1N86 A;  2WPQ A;  5KJ7 C;  3M9H A;  2NPS B;  3I5C A;  4C7N B;  4I2L C;  3M9Q A;  1KIL A;  1A02 J;  1FZC C;  3U1A A;  1DEB A;  1HGV A;  3II6 A;  1M1J A;  3A3Y B;  2VRS A;  2P67 A;  1KIL D;  2M8R A;  5AW7 B;  2I1K A;  5CCH D;  4Y99 B;  1FOS E;  1ZV8 A;  4ZKP A;  5APY A;  2Q5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...