1GUKA

Crystal structure of murine alpha-class gsta4-4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
215
structure length
215
Chain Sequence
PKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE A4-4
publication title Crystal structure of a murine alpha-class glutathione S-transferase involved in cellular defense against oxidative stress.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 78
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gukA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gukA01
2HFDA 1TI3A 3L9VA 5A4WA 3Q19A 3C73A 5HQPA 2V2GA 4TKYA 1WRYA 1ML6A 2E0QA 1YEXA 3GKKA 4XCSA 3DKSA 3KJYA 2JSYA 1SK0A 1OVNA 4MF7A 1R5AA 5F07A 3MDKA 3EMPA 2XHFA 1CQGA 1ZCPA 3HY2A 3R3EA 2VD0A 4JBBA 4TXOB 1FB6A 4MDCA 2XC2A 5IIZA 3IA1A 5JWOB 1F2EA 2HI7A 3LFLA 2A2RA 4BL7B 4KA0A 1XFLA 3TJJA 2AAWA 3GSSA 4YQUA 2HLSA 4G0IA 4MP4A 2HSMB 1WOUA 4ULXA 1R26A 3D22A 1K0AA 5EY6A 2H73A 2IPAA 4J56E 4J2FA 1GSFA 3VLNA 2H8LA 2GT6A 2PVOC 1OE7A 1GLQA 4HZ2A 3DEXA 5J4UA 2AUVA 2YCDA 1OYJA 3FZ4A 3VPQA 1YZXA 3UVTA 2F8AA 3MWHA 3LYKA 2VIMA 2CAIA 22GSA 3GTUA 3WD6A 2C1YA 2M72A 4I2UA 1IYIA 3LXZA 5B7CA 4IHUA 1TRSA 2XBQA 3F4RA 2NPBA 1EOHA 2VAFA 2X8GA 4DSRA 2ALBA 4KAEA 1VF2A 1Z6MA 2LV3A 3RHCA 3EYTA 5JCUA 3D0ZA 2IMIA 2O8VB 3ZL5A 3HVSA 1SL1B 1MTCA 4V2NA 5GSTA 3VI5A 2M80A 1QQ2A 4TOPA 2K8SA 2H71A 2YZUA 3IXRA 5D9XA 5HR3A 1ZOFA 4E8HA 4XS4A 5ECNB 5IQYA 2R3XA 3ZITA 5IMAA 3FR9A 2REMA 1GTBA 2YWNA 3UL3A 2GSRA 1G7OA 6GSUA 3TKRA 1N8JA 3EE2A 1R5PA 4BWSA 4MPFA 2R6KA 2TIRA 2YV7A 3A3TA 1BEDA 1U6TA 4LLRA 5JCWA 4K7NA 2PN8A 5IOXA 5DBQA 4ML6A 3IOSA 13GSA 3VWXA 4CW9A 5A4VA 3EVIA 1XWGA 2I4AA 1G6WA 5G2ZA 3TOTA 3TCOA 3F3RA 4L5OA 4TXVA 4PNGA 1DE1A 2N5BA 1F37A 2LNTA 2YWIA 2V6KA 4WXTA 3ED3A 2P31A 4N10A 1OKTA 2Z9SA 3BCKA 5INYA 5A4UA 3P2AA 4G0LA 2FUG2 1N2AA 3J7Yk 4MPGA 1M9AA 3FZAA 4ML1A 3M1GA 4MABA 5B8BA 1DE2A 2RUEA 3RDWA 4POLA 1WP0A 3O76A 5AIXA 3H4KA 4K6XA 5KN3A 4JRRA 1GSQA 1V40A 1SK1A 4L0UA 4HJMA 4WBRD 2GZPA 2K6VA 5H5QA 2DJJA 4FYUA 10GSA 4GQFA 2HRKB 4ID0A 1AUCA 3HZ4A 4AJ6A 1SL0B 2V32A 5GZZB 3GX8A 5CRDA 3TGZA 2PWJA 1EWXA 3QAVA 2H0HA 3ISOA 2FWGA 1C72A 2AYTA 2FCHA 2LJAA 2I81A 4PNFA 2WULA 4HJ2A 1GSDA 4NXIA 1OC3A 5GSSA 1EV9A 3APOA 1BQ7A 3E9JB 3ME7A 5ECSA 2MMAA 2AHEA 4IP1A 3GUSA 5BMUA 3RPNA 5CAXA 2FWEA 1WIKA 1EP7A 3H1NA 1VF4A 4YAPA 4CHSA 4RQXA 1Y25A 2C3NA 2VLTA 3TKSC 3P7XA 4NHWA 3KD0A 2VUPA 3IHQA 3LEFA 3EMXA 1YY7A 1BAYA 2H75A 3ZLPA 3P90A 3G7JA 3F6DA 1OAZA 4JE1A 1WMJA 6GSWA 2JACA 4EUYA 4O5RA 3ZVJA 1TRVA 2C0GA 2O7KA 1NSWA 4TN8A 2VM1A 3EURA 5DJLA 1XPVA 1LU4A 3LWAA 1XVQA 2LJRA 2IMFA 2OADA 3SBCA 1CQHA 4IJIA 5DALB 3HJOA 1ZMAA 3N5OA 2B5EA 7GSSA 2RM5A 3S9FA 1K3YA 3O6TA 4GTUA 2LQOA 3CYNA 3US3A 5ECKB 1T4ZA 2PVQA 5CRHA 6GSTA 4PGTA 1SYRA 3GURA 1GTAA 4AGSA 3ZIJA 4PQHA 5ID2B 2VCTA 1RQMA 4XIHA 3IR4A 1PKWA 3VPTA 5FHIA 5B6NA 1T7PB 2VO4A 5E59A 2IFQB 3VWWA 5DAKA 2C0DA 3NOFA 3ZVJD 1GLPA 3HA9A 2JSZA 2NTOA 2L57A 3QOUA 3LXTA 1OE8A 2H01A 1Z3EA 3WYWA 1FAAA 3KIJA 4MH3A 4ZIJA 1TRUA 4GSSA 1RW1A 2DMLA 2XPDA 2H0GA 3WGDA 2V1MA 5ELGA 2FA4A 5G1LA 3WT1A 4DSSB 5IMFA 3GIXA 5IMZA 4WR5A 3KP8A 5ABRA 4NV2A 1T4YA 1ZL9A 4BVYA 1M7TA 4O7HA 1DUGA 3ZTLA 1TK5B 4EDYA 2I3YA 2C80A 4GF0A 3R2QA 1AW9A 1I9DA 9GSSA 3I69A 4PUAA 4WBJA 3TDGA 3ZFLA 3L0HA 3KXOA 2WZ9A 3PPUA 1ABAA 2B5XA 3APQA 4ZXGA 5CO3A 3UEMA 3ZZXA 5HR0A 1PSQA 4PQ1A 3IK9A 1U88A 1UVZA 1ST9A 5G1KA 4MF5A 2H76A 2QGVA 3GYKA 1YJ6A 2R4VA 1A24A 1O81A 1XWCA 3GL3A 1Z9HA 4KDUA 4USSA 2OE3A 2RM6A 5HFIA 5DVBA 3TRXA 2B3SA 3A2XA 4ECCA 2HE3A 1VF1A 4GQCA 4DVCA 3U5RE 4MK3A 4MZCA 1SKWB 3ZIVA 3QAGA 2HQTA 1O6JA 4LL4B 1R4WA 2YANA 4OCEA 4ACSA 1A0RP 1PX6A 2H6ZA 4HU7A 1USBA 1PD21 3DYRA 3M9JA 5HFGA 3CTGA 4F0BA 2FNOA 5ECHB 2WGRA 3EU3A 3KMNA 2WRTA 3UBLA 1PL2A 1SU9A 2YOIA 1AQVA 1AXDA 3DGQA 2VD1A 5J9BA 3L78A 5D93A 3BJ5A 1JLVA 2L6DA 3HXSA 4ISDA 4HDEA 1OC9A 1FO5A 2OACA 1HNCA 3HCZA 4PQIA 4KSOA 3RAZA 2VCWA 3KH9A 11GSA 1TP9A 4TR1B 3GMFA 3IPZA 2B6MA 2BTOT 3DD3A 4XTSA 4V2LA 1B8XA 3ERWA 5D9VA 2PGTA 1JLWA 1V9WA 2R2JA 4GSTA 1MD4A 1JZRA 4I5QA 2EIRA 1YEPA 4Q5NA 1URMA 1JZOA 3UOMA 4D73A 3M3MA 1QMVA 2OE1A 2YV9A 2KOKA 5DCHA 3KGKA 1TI1A 2GS3A 1K0CA 2YP6A 1F3AA 3KMOA 3I43A 4IW9A 2GSQA 4G2EA 5H5RA 1GSUA 3UJ1A 4OO4A 1M9BA 1KTEA 1JZDA 1TU8A 2FA8A 3PGTA 3D21A 3GRXA 1HNBA 3C1SA 1ERWA 1GWCA 4IJ3A 2GSTA 1XIYA 2C0FA 4NWYA 4HEA2 2JADA 3V1WA 4TXOA 2ES7A 2DLXA 3L9SA 4MF6A 4BL7A 3AY8A 3GV1A 3VFIA 4PXOA 1PQNA 2LS5A 2CT6A 1VF3A 2MMNA 3GH9A 3M8NA 1G0TA 4KCEA 2TRXA 2A2SA 3GH6A 5AN1A 5DQYA 1B9YC 3W6GA 3TRQA 1QXHA 1H4OA 2H6XA 1PKZA 3APSA 3L9UA 4GLTA 6GSYA 1M2BA 4MA9A 3BOAA 3UIWA 1EEJA 17GSA 4LA1A 2JL4A 4G0KA 2H74A 4O32A 5AIVA 5J3RA 3IK7A 5IM9A 1U3AA 5IO2A 1F9MA 2P5RA 3H79A 2H30A 4LL1B 1A0FA 2HZEB 1YKAA 3QCPA 4F2IA 2AJQB 1F6MC 2VCVA 1SJZA 1XCCA 4LMWA 6GSSA 3VWVA 2K9FA 2L59A 1YF1A 4KNDA 5B6MA 2PU9C 2HYXA 2IL3A 1GRXA 2IMDA 6GSXA 1E6BA 3FYGA 1K3LA 1SKSB 4FYCA 1V2AA 4KE3A 2H66A 2OA7A 2WS2A 3GX0A 1V98A 1AC1A 2YJ7A 3QPMA 3P8WA 1M0UA 5ECOB 3C8EA 1FB0A 3U6VA 2OBIA 1TU7A 1YDKA 1W89A 1VRSD 2IMKA 4F0CA 2L5LA 3Q6OA 2K18A 2AV4A 2CVBA 3G9BA 1GUMA 2D2ZA 1X9SB 3OR5A 4MMMA 4N0ZA 5ECQB 5J41A 2H70A 3DVWA 6GSVA 4HZ4A 16GSA 4WR4A 3ZREA 4POMA 4AF2A 2VLUA 4MH2A 2TRCP 3FY7A 5COHA 1M2AA 1YKCA 4IELA 2H72A 5JWRB 1DSBA 1ZYQB 3CSHA 1PA3A 3EC3A 3F63A 1W4VA 3SWLA 3WGXA 2HRAA 1GSYA 2MYGA 4HI7A 4E8EA 2LKUA 4ZL7A 3C1RA 4ZBAA 2H19A 3LORA 4KDXA 4EXJA 2EIQA 4MLYA 2PBJA 2VLVA 3F4TA 4KW6A 4QQ7A 2HRKA 2KP2A 4FYBA 2QKEA 5DJMA 3EU4A 2E7PA 3TJKA 3FW2A 3ZFBA 3GNJA 1B9XC 1Z7RA 2VCXA 3UMAA 3IBHA 1GULA 3DVXA 3IC8A 1SENA 4K2DA 2L6CA 4ZB9A 4KGIA 5D8IA 1K0DA 3GA4A 4K0GA 1U87A 2VL2A 2BMXA 3TJBA 4MJAA 3G7IA 2O89A 4FO5A 1XW6A 2DIZA 3CRUA 4DEJA 2X8HA 3H8QA 3RPPA 2IWTA 3GKXA 2RLIA 1O7UA 4K7OA 4BVXB 19GSA 3LJRA 1ILOA 1XW9A 1G7EA 1ERTA 4EL1A 2V6OA 1FVJA 14GSA 5CYYA 4MCUA 1SD8A 3PH9A 4N0VA 1AIUA 5ECRB 4YQVA 3IAS2 2H1DA 4WF4A 2L4CA 4KX4A 3Q18A 2CVKA 4XRAA 1PMTA 4YQMA 2CA8A 3TJGA 1IYHA 5DQSA 4IBPA 2KP1A 5C00A 1PGTA 1GP1A 1I5GA 2JU5A 3TB2A 1G6YA 4YAVA 4WEYA 3CXGA 2YNXA 4BWQA 3VI7A 1EZKA 3D5JA 2CX4A 3CBUA 2PPTA 4XS1A 4TR3A 5ECLB 3A5WA 12GSA 5LD0A 5ECIB 2DJ0A 5DALA 4JR4A 1X5EA 3UAPA 2YN1A 2MZCA 1UC7A 4ZBBA 4ZB6A 1TKDB 3PINA 1GSSA 4J57E 2LEGA 18GSA 4PUFC 2B1LA 4BPYA 2DBCA 2JZRA 5J9CA 2HRNA 1SK2A 3TKSE 2F3MA 1AQXA 1A2LA 2QSIA 4P3YB 4HU9A 5ID2A 3IE3A 1M2DA 4MZWA 4K8MA 2G0FA 4HQSA 1J0FA 2CZ2A 3MNGA 2IFQA 1B48A 2DMMA 2WCIA 2FD3A 1JZWA 3TKPA 4GWRA 2DJKA 1DBYA 5LNKe 3UVHA 1UA5A 1Z6NA 1MEKA 1RK4A 2HSHA 5F0GA 2HSNB 3O3TA 3LGCA 1O85A 1ERVA 5CREA 2GZYA 3KTLA 3FHKA 1T8EB 2MBSA 3IAM2 5E4WA 2LTKA 5IMDA 2G2QA 2CQ9A 4PX1A 4DSSA 5ELAA 1LJRA 5A5KA 5ECPB 5G5EA 1TK0B 5HR1A 2JZSA 1V58A 3QFBC 1Y6EA 3FKFA 4O92A 3KM6A 3M0FA 2WFCA 1M99A 5L71A 2VL3A 3FK8A 1H75A 3HHVA 3ERFA 1TK8B 3TJFA 1ZGNA 3DXBA 1ZZYA 5CRGA 2N5FA 4KCAA 1FVKA 2F51A 5D73A 3FR6A 1MDIA 1QGVA 1XWBA 2AB6A 4NAXA 2KLXA 1SD9A 3W8JA 5IMCA 5G30A 3RHBA 2DC5A 2YZHA 4D73B 1X9WB 3BD2A 2J9HA 3VURA 2GQMA 1T3BA 3HDCA 4GSNA 3GTUB 3GSTA 1SJ6A 4HQZA 2UZ8A 2CX3A 2C8UA 3ZYWA 4I8BA 4WF5A 5JWQB 4K9ZA 3TKQA 2IMEA 1EEMA 1PN9A 1JHBA 4OCFA 2ZUPA 3HZ8A 2VCQA 2I9HA 2PUKC 1BJXA 3D4TA 1B4QA 4IKHA 1EP8A 1ACVA 3CSIA 2H6YA 1TOFA 2DSAA 5IOWA 1EGOA 1FW1A 1T1VA 1J08A 2ON7A 4ECBA 1JFUA 4F82A 1J9BA 4RI7A 4IGJA 3HD5A 1GNWA 4XS4B 4ZL8A 2GGTA 3QMXA 1GL8A 4EKZA 5J5NA 2P5QA 1YF0A 4X43A 3CSJA 1NHYA 5IO0A 3KCMA 4JZQA 2ZCTA 1XWKA 1K0MA 3KZQA 2FHEA 4NV5A 2HZFA 2QC7A 2HSYA 2L4QA 1V57A 2J23A 4Q5FA 2PERA 2LQQA 4X1UA 4V1Ap 4IN0A 1K0NA 2YPMA 4OFMA 2GQKA 1OC8A 2KUCA 4V1Ag 4QL9A 2PMTA 4V2MA 1NM3A 2MMOA 2MMZA 4GRFA 3MAKA 4AJ7A 4XS6A 4Q5QA 3BCIA 2OE0A 4KF9A 3EINA 4JU5A 1WJKA 1QK8A 3QAWA 3A2WA 2H0IA 2X64A 2DJ1A 2M46A 4TR1A 3HYPA 2LRNA 2GDRA 2ON5A 4IVFA 4TR0A 3K8NA 1OKDA 1WE0A 4WKWA 1A2JA 5EVOA 2RUFA 1GH2A 4X0XA 3RBTA 4KUNA 2K8VA 2GTUA 2HSMA 3H93A 5D9TA 1SL2B 1XZOA 1BG5A 3F6FA 5G5FA 3KEBA 3ERGA 1A23A 4JR6A 3CTFA 4HOJA 5GAND 2FWFA 4JEDA 2WDUA 2DIYA 3PR8A 2HNLA 3TKSA 2E2MA 4MJBA 5GAPD 3F9UA 3GN3A 4KH7A 5ECMB 4EE0A 3DMLA 3LQ7A 2VCZA 2FLSA 3ZMKA 4EDZA 2H1BA 4N30A 5C04A 4RI6A 2O85A 3GKNA 1QUWA 4BA7A 2JZTA 1KNGA 1TJDA 4POKA 1UN2A 4ZB8A 5IPGA 2LRCA 1TRWA 4H86A 3GKMA 1O73A 3GL5A 3LSZA 1TTZA 1O8WA 4G19A 1B4PA 5F8BA 4YH2A 3GFKA 1MDJA 2HXKA 2MBTA 2B5YA 2YWMA 1TW9A 4IQAA 2HRFA 5AISA 5FWGA 4LMVA 3UBKA 2YWOA 2P0GA 2C3QA 1GTUA 4I2TA 4ECIA 2H1AA 4FIWA 3DWVA 4I97A 1FG4A 1AQWA 4OO5A 8GSSA 1U3IA 2V41A 2GSSA 4L8EA 3FZ5A 1BX9A 2EC4A 4OMVA 2NDOA 2LJKA 1XW5A 1GTIA 1XWAA 1F3BA 5AGYA 4KB3A 3I9V2 5ENUA 2WJUA 1SKRB 2IJYA 2X99A 2DJ2A 2GT5A 2IIYA 2O87A 2CVDA 4L0WA 4ILFA 4TVEA 3C7MA 3FZ9A 5EL8A 5FT3A 4PURA 1EOGA 4F03A 1K0OA 3L4NA 4XRDA 1MD3A 2VOCA 4KDYA 4POBA 3KTBA 3DRNA 1XXUA 3DIEA 1X9MB 3IDVA 5DDLA 4MJCA 5D96A 1PX7A 2C4JA 4RQRA 2B7KA 2HZEA 3FEUA 2XPEA 4L5LA 1X5CA 4KSMA 4TW5A 1HQOA 5CP1A 3QR6A 5KN0A 1ON4A 4OWYA 1S3CA 4XHMA 1EGRA 2A4VA 2LRTA 3NZNA 1E2YA 2FY6A 1XVWA 1GSEA 5H5SA 4K0NA 4MJEA 3EWLA 2IN3A 3HKRA 1Q98A 4IP6A 2VM2A 1GUKA 1PRXA 4ZILA 3ZMLA 4ZL9A 1HNAA 3E0UA 2B1KA 2GQLA 5DAKB 1NW2A 1KEBA 2CV4A 4Q5RA 4OFNA 2OJLA 1FHEA 5F05A 3GHAA 20GSA 3F0IA 4NMUA 1WWJA 3C71A 2RIIA 3IV4A 5JCGA 2VL9A 2C3TA 4N11A 3QDNA 3N9JA 5IPHA 1S3DA 4EVMA 2KHPA 3HVVA 3WT2A 2LSTA 2R37A 1Z7PA 4BVYB 1X0RA 2CZ3A 1XOAA 1X5DA 3QFAC 3UARA 2XBIA 1MDKA 3WGEA 3ZRDA 1BYEA 4HUAA 4TR4A 3KP9A 3MSZA 3D4MA 3F4SA 4K7IA 3I6AA 4HS1A 1YQ1A 2H1GA 1AAZA 2LUSA 4IS0A 4I6XA 2I1UA 5F06A 4F9ZA 4PTSA 5HFKA 1O8XA 2LNSA 3E3EA 3KH7A 3LG6A 4OFTA 3HJPA 1TDIA 2BJXA 2F8FA 4G9HA 1THXA 1EV4A 3VK9A 5LCZA 3NIVA 3J7Yb 3G7YA 2NVLA 1Z5YE 1LBKA 5KEJA 5KN1A 3QD9A 1THOA 2GLRA 1WPIA 1K3OA 4AJ8A 4MZBA 2WB9A 3HJMA 3FRCA 1A8LA 1KBNA 3HVXA 4IQ1A 4FH8A 3CRTA 2L5OA 5EPFA 2NBSA 2DJ3A 4EF0A 2FWHA 4WETA 4NPBA 4EC0A 1QFNA 4ZBDA 4GXZA 2EIOA 4ECJA 1FOVA 4FQUA 2OBKA 5CNWA 1SJIA 4TRXA 4BVXA 1HD2A 4G10A 3TRPA 5IMVA 5CRWA 1SYXA 1ERUA 3A2VA 3TOUA 4Z7XA 4QL7A 1VGLA 2F9SA 3IC4A 3W8SA 3F8UA 3F3QA 4DSQA 4CDOA 4GCIA 1NHOA 1K0BA 1TXXA 3Q74A 1S3AA 5G31A 1GNEA 2GZZA 1OC9B 2YJHA 5HR2A 3LYPA 4NHZA 5KN2A 1A8YA 4EO3A 5DCGA 1XBSA 2HT9A 4OD7A 2N5AA 1A2MA 4K1FA 2B7JA 3FR3A 5B8AA 1HYUA 3D6IA 3VWUA 3BBYA 3CMIA 3ME8A 4RUVA 1Q4JA 2R5GA 2ZNMA 2GVPA 2C0EA 2CAQA 1XOBA 3M9KA 2OKAA 1R7HA 3JCML 1T00A 1GUHA 5D9WA 2VL2C 1PL1A 2E2GA 2X8CA 1ZYEA 3IRAA 3TUEA 2FGXA
chains in the Genus database with same CATH superfamily
2HFDA 1TI3A 1YEWC 3L9VA 1BF5A 5A4WA 3A5IA 3Q19A 3C73A 5HQPA 2V2GA 4TKYA 4K5SA 1WRYA 1ML6A 2E0QA 4G01A 1YEXA 3GKKA 2HSNA 4XCSA 3DKSA 3KJYA 2JSYA 1SK0A 1OVNA 4MF7A 1R5AA 5F07A 3MDKA 3EMPA 2XHFA 4Z2UA 1CQGA 1ZCPA 3HY2A 4CY8A 3R3EA 2VD0A 2R0CA 4JBBA 2EFEA 4TXOB 1FB6A 4MDCA 2XC2A 5IIZA 3IA1A 5JWOB 1F2EA 2HI7A 3LFLA 2A2RA 4BL7B 4KA0A 1XFLA 3TJJA 2AAWA 3GSSA 4YQUA 2HLSA 4G0IA 4MP4A 2HSMB 1WOUA 2WW2A 4ULXA 1R26A 3D22A 1K0AA 5EY6A 2H73A 2IPAA 4J56E 4J2FA 1GSFA 3VLNA 2H8LA 2GT6A 2PVOC 1OE7A 1GLQA 4HZ2A 3DEXA 5J4UA 1PFOA 2AUVA 2YCDA 1OYJA 3FZ4A 3VPQA 1YZXA 3UVTA 2F8AA 3MWHA 3LYKA 2VIMA 2CAIA 22GSA 3GTUA 3WD6A 2C1YA 2M72A 4I2UA 1IYIA 3LXZA 5B7CA 4IHUA 1TRSA 2XBQA 3F4RA 2NPBA 1EOHA 2VAFA 2X8GA 4DSRA 2ALBA 4KAEA 1VF2A 1Z6MA 2LV3A 3RHCA 3EYTA 5JCUA 4O5QA 3D0ZA 2IMIA 2O8VB 3ZL5A 3HVSA 1SL1B 1MTCA 4V2NA 5GSTA 3VI5A 2M80A 1QQ2A 4TOPA 2K8SA 2H71A 2YZUA 3IXRA 5D9XA 5HR3A 1ZOFA 4E8HA 4XS4A 5ECNB 5IQYA 1FOHA 2R3XA 3ZITA 5IMAA 3FR9A 2REMA 1GTBA 2YWNA 3UL3A 2GSRA 1G7OA 6GSUA 3TKRA 1N8JA 3EE2A 1R5PA 4BWSA 4MPFA 2R6KA 2TIRA 2YV7A 3A3TA 1BEDA 1U6TA 4LLRA 5JCWA 4K7NA 2PN8A 2WW1A 5IOXA 1I1IP 1SVOA 5KOWA 5DBQA 4ML6A 3IOSA 13GSA 3VWXA 2WVYA 4CW9A 5A4VA 3EVIA 1XWGA 2I4AA 1G6WA 5G2ZA 3TOTA 3TCOA 3F3RA 4L5OA 4TXVA 4PNGA 1DE1A 2N5BA 1F37A 2LNTA 2YWIA 2V6KA 4WXTA 3ED3A 2P31A 4N10A 1OKTA 2Z9SA 3BCKA 5INYA 5A4UA 3P2AA 4G0LA 2FUG2 1N2AA 3J7Yk 5KOXA 4MPGA 1M9AA 3FZAA 4ML1A 3M1GA 4MABA 3MIXA 5B8BA 2RUEA 1DE2A 3RDWA 4POLA 1WP0A 3O76A 5AIXA 1BG1A 3H4KA 4K6XA 5KN3A 5J47A 4JRRA 1GSQA 1V40A 1SK1A 4L0UA 4HJMA 4WBRD 2GZPA 2K6VA 5H5QA 2DJJA 2X4AA 4FYUA 10GSA 4GQFA 2HRKB 4ID0A 1AUCA 3HZ4A 4AJ6A 1SL0B 2V32A 5GZZB 3GX8A 5CRDA 3TGZA 2PWJA 1EWXA 3QAVA 2H0HA 3ISOA 2FWGA 1C72A 2AYTA 2FCHA 2LJAA 2I81A 4PNFA 2WULA 4HJ2A 1GSDA 4NXIA 1OC3A 5GSSA 1EV9A 3APOA 1BQ7A 3E9JB 3ME7A 5ECSA 2MMAA 2AHEA 4IP1A 3GUSA 5BMUA 3RPNA 5CAXA 2FWEA 1WIKA 1EP7A 3H1NA 1VF4A 4YAPA 4CHSA 4RQXA 1Y25A 2C3NA 2VLTA 3TKSC 3P7XA 4NHWA 3KD0A 5A5HA 2VUPA 3IHQA 3LEFA 3EMXA 1YY7A 1BAYA 2H75A 3ZLPA 3P90A 3G7JA 3F6DA 1OAZA 4JE1A 5A34A 1WMJA 6GSWA 2JACA 4EUYA 4O5RA 5J40A 3ZVJA 1TRVA 2C0GA 2O7KA 1NSWA 4TN8A 2VM1A 3EURA 5DJLA 4MNNA 1XPVA 4QMKA 1LU4A 3LWAA 1XVQA 2LJRA 2IMFA 4AI6A 2OADA 3SBCA 1CQHA 4IJIA 5DALB 3HJOA 1ZMAA 3N5OA 2B5EA 7GSSA 2RM5A 3S9FA 1K3YA 3O6TA 4GTUA 2LQOA 4K2XA 3CYNA 3US3A 5ECKB 1T4ZA 2PVQA 5CRHA 6GSTA 4PGTA 1SYRA 3GURA 1GTAA 4AGSA 3ZIJA 4PQHA 5ID2B 4PHZC 2VCTA 1RQMA 4XIHA 3IR4A 1PKWA 3VPTA 5FHIA 5B6NA 1T7PB 2VO4A 5E59A 2IFQB 3VWWA 5DAKA 2C0DA 3NOFA 3ZVJD 1GLPA 3HA9A 2JSZA 2NTOA 4GDFA 2L57A 3QOUA 3LXTA 1OE8A 2H01A 1Z3EA 3WYWA 1FAAA 3KIJA 4MH3A 4ZIJA 3LW9A 1TRUA 4GSSA 1RW1A 2DMLA 4N3ZA 2XPDA 2H0GA 3WGDA 2V1MA 5ELGA 2FA4A 5G1LA 3WT1A 4DSSB 5IMFA 3GIXA 5IMZA 4WR5A 3KP8A 5ABRA 4NV2A 1T4YA 2WW0A 1ZL9A 4BVYA 1M7TA 4O7HA 4ZB7A 1DUGA 3ZTLA 1TK5B 4EDYA 2I3YA 2C80A 4GF0A 3R2QA 1AW9A 1I9DA 9GSSA 3I69A 4PUAA 4WBJA 3TDGA 3ZFLA 3L0HA 3KXOA 2WZ9A 3PPUA 1ABAA 2B5XA 3APQA 4ZXGA 5CO3A 3UEMA 3ZZXA 5HR0A 1PSQA 4PQ1A 1Y1UA 3IK9A 1U88A 1UVZA 1ST9A 5G1KA 4MF5A 2H76A 2QGVA 3GYKA 1YJ6A 2R4VA 1A24A 1O81A 1XWCA 3GL3A 1Z9HA 4KDUA 4USSA 3CWGA 2OE3A 2RM6A 5HFIA 5DVBA 3TRXA 2B3SA 3A2XA 4ECCA 2HE3A 1VF1A 4GQCA 4DVCA 3U5RE 4MK3A 4MZCA 1SKWB 3ZIVA 3QAGA 2HQTA 1O6JA 4LL4B 1R4WA 2YANA 4OCEA 4ACSA 1A0RP 1PX6A 2H6ZA 4HU7A 1USBA 1PD21 3DYRA 3M9JA 5HFGA 2O3EA 3CTGA 4F0BA 2FNOA 5ECHB 2WGRA 3EU3A 3KMNA 2WRTA 3UBLA 1PL2A 1SU9A 4EIQA 2YOIA 1AQVA 1M3JA 1AXDA 3DGQA 5A1NB 2VD1A 5J9BA 4EIPA 3L78A 1S3RA 5D93A 4ICYA 3BJ5A 1JLVA 2L6DA 4W66A 3HXSA 4ISDA 4HDEA 1OC9A 1FO5A 2OACA 1HNCA 3HCZA 4PQIA 4KSOA 3RAZA 2VCWA 3KH9A 11GSA 1TP9A 4TR1B 3GMFA 3IPZA 2B6MA 2BTOT 4A5PA 3DD3A 4XTSA 4V2LA 1B8XA 3ERWA 5D9VA 2PGTA 1JLWA 1V9WA 2R2JA 4GSTA 1MD4A 1JZRA 4I5QA 2EIRA 1YEPA 3CQFA 4Q5NA 1URMA 1JZOA 3UOMA 4PI0C 4D73A 3M3MA 1QMVA 2OE1A 2YV9A 2KOKA 5DCHA 3KGKA 1TI1A 2GS3A 1K0CA 2YP6A 1F3AA 3KMOA 3I43A 4IW9A 2GSQA 4G2EA 5H5RA 1GSUA 3UJ1A 4OO4A 1M9BA 1KTEA 1JZDA 1TU8A 2FA8A 3PGTA 3D21A 3GRXA 1HNBA 3C1SA 1ERWA 1GWCA 4IJ3A 2GSTA 4BIKA 1XIYA 2C0FA 4NWYA 4HEA2 2JADA 3V1WA 2WZSA 4TXOA 2ES7A 2OT3A 2DLXA 3L9SA 4MF6A 4BL7A 3AY8A 3GV1A 4AKHA 3VFIA 4PXOA 1PQNA 2LS5A 2CT6A 1VF3A 2MMNA 3GH9A 3M8NA 1G0TA 4KCEA 5BRTA 2TRXA 2A2SA 3GH6A 5AN1A 5DQYA 1B9YC 3W6GA 3TRQA 1QXHA 1H4OA 2H6XA 1N25A 1PKZA 3APSA 3L9UA 4GLTA 6GSYA 1M2BA 1M3IA 4MA9A 3BOAA 4PI2C 3UIWA 1EEJA 17GSA 4LA1A 2JL4A 4G0KA 2H74A 4O32A 4YKGA 5AIVA 5J3RA 3IK7A 5IM9A 1XG8A 1U3AA 5IO2A 1F9MA 2P5RA 3H79A 2H30A 4LL1B 1A0FA 2HZEB 1YKAA 3QCPA 4F2IA 2AJQB 1F6MC 2VCVA 1SJZA 1XCCA 4LMWA 6GSSA 3VWVA 2K9FA 2L59A 1YF1A 4KNDA 5B6MA 2PU9C 2HYXA 2IL3A 1GRXA 4X4JA 2IMDA 6GSXA 1E6BA 3FYGA 1K3LA 1SKSB 4FYCA 1V2AA 4KE3A 2H66A 2OA7A 2WS2A 3GX0A 1V98A 1AC1A 2YJ7A 3QPMA 3P8WA 1M0UA 5ECOB 3C8EA 1FB0A 3U6VA 2OBIA 1TU7A 1YDKA 1W89A 4HSCX 1VRSD 4AKGA 2IMKA 4F0CA 2L5LA 3Q6OA 2K18A 2AV4A 3CHXC 2CVBA 3G9BA 1GUMA 2D2ZA 1X9SB 3OR5A 4MMMA 4N0ZA 5ECQB 5J41A 2H70A 2WW3A 3DVWA 6GSVA 4HZ4A 16GSA 4WR4A 3ZREA 4POMA 4AF2A 2VLUA 4MH2A 2TRCP 3FY7A 5COHA 1M2AA 2QA1A 1YKCA 4IELA 2H72A 5JWRB 1DSBA 1ZYQB 3CSHA 1PA3A 3EC3A 3F63A 2WVZA 1W4VA 3SWLA 3WGXA 2HRAA 1GSYA 2MYGA 4HI7A 4E8EA 2X49A 2LKUA 4ZL7A 3C1RA 4ZBAA 2H19A 3LORA 4KDXA 4EXJA 2EIQA 2R0GA 4MLYA 2PBJA 2VLVA 3F4TA 4KW6A 4QQ7A 2HRKA 2KP2A 4FYBA 2QKEA 5DJMA 3EU4A 2E7PA 3TJKA 3HVNA 3FW2A 3ZFBA 3GNJA 2WVXB 1B9XC 1Z7RA 2VCXA 3UMAA 3IBHA 1GULA 3DVXA 3IC8A 1SENA 4K2DA 2L6CA 4ZB9A 4KGIA 5D8IA 1K0DA 3GA4A 4K0GA 1U87A 2VL2A 4O5UA 2BMXA 3TJBA 4MJAA 3G7IA 2O89A 4FO5A 1XW6A 2DIZA 3CRUA 4DEJA 2R0PA 2X8HA 3H8QA 3RPPA 2IWTA 3GKXA 2RLIA 1O7UA 4K7OA 1SVMA 4BVXB 19GSA 3LJRA 1ILOA 1XW9A 1ZYNA 1G7EA 1ERTA 4EL1A 2V6OA 1FVJA 14GSA 5CYYA 4MCUA 1SD8A 3PH9A 4N0VA 1AIUA 5ECRB 4YQVA 3IAS2 2H1DA 4WF4A 2L4CA 4KX4A 3Q18A 2CVKA 4XRAA 1PMTA 4YQMA 2CA8A 3TJGA 1IYHA 5DQSA 4IBPA 2KP1A 5C00A 1PGTA 1GP1A 1I5GA 2JU5A 3TB2A 1G6YA 4YAVA 4WEYA 3CXGA 2YNXA 4BWQA 2A4HA 3VI7A 1EZKA 3D5JA 2CX4A 3CBUA 2PPTA 4XS1A 4TR3A 5ECLB 3A5WA 12GSA 5LD0A 5ECIB 2DJ0A 5DALA 3HMJG 4JR4A 1X5EA 3UAPA 2YN1A 2MZCA 1UC7A 4ZBBA 4ZB6A 1TKDB 3PINA 1GSSA 4J57E 2LEGA 18GSA 4PUFC 2B1LA 4BPYA 2DBCA 2JZRA 5J9CA 2HRNA 1SK2A 4Z2RA 3TKSE 2F3MA 1AQXA 1A2LA 2QSIA 4P3YB 4HU9A 5ID2A 3IE3A 1M2DA 4MZWA 4K8MA 2G0FA 4HQSA 1J0FA 2CZ2A 3MNGA 2IFQA 1B48A 2DMMA 2WCIA 2FD3A 1JZWA 3TKPA 4GWRA 2DJKA 1DBYA 5LNKe 3UVHA 1UA5A 1Z6NA 5J4VA 1RK4A 1MEKA 2HSHA 5F0GA 2HSNB 3O3TA 3LGCA 1O85A 1ERVA 5CREA 1SVLA 2GZYA 3KTLA 3FHKA 1T8EB 2MBSA 3IAM2 5E4WA 2LTKA 5IMDA 2G2QA 2CQ9A 4PX1A 4DSSA 5ELAA 1LJRA 5A5KA 5ECPB 5G5EA 1TK0B 5HR1A 2JZSA 1V58A 3QFBC 1Y6EA 3FKFA 4O92A 3KM6A 3M0FA 2WFCA 2H1LA 1M99A 5L71A 2VL3A 3FK8A 1H75A 3HHVA 3ERFA 1TK8B 3TJFA 1ZGNA 3DXBA 1ZZYA 5CRGA 2N5FA 4KCAA 1FVKA 2F51A 5D73A 3FR6A 1MDIA 1QGVA 1XWBA 2AB6A 4NAXA 2KLXA 1SD9A 3W8JA 5IMCA 5G30A 1PN0A 3RHBA 2DC5A 2YZHA 4D73B 1X9WB 3FMWA 3BD2A 2J9HA 3VURA 2GQMA 1T3BA 3HDCA 4GSNA 4Z2TA 3GTUB 3GSTA 1SJ6A 4HQZA 2UZ8A 2CX3A 2C8UA 3ZYWA 4I8BA 4WF5A 5JWQB 4K9ZA 3TKQA 2IMEA 1EEMA 1PN9A 1JHBA 4OCFA 2ZUPA 3HZ8A 2VCQA 2I9HA 2PUKC 1BJXA 3D4TA 1B4QA 4IKHA 1EP8A 4CY6A 1ACVA 3CSIA 2H6YA 1TOFA 2DSAA 5IOWA 1EGOA 1FW1A 1T1VA 1J08A 2ON7A 4ECBA 1JFUA 4F82A 1J9BA 4RI7A 4IGJA 3HD5A 1GNWA 4XS4B 4ZL8A 2GGTA 3QMXA 1GL8A 4EKZA 5J5NA 2P5QA 1YF0A 4X43A 3CSJA 1NHYA 5IO0A 3KCMA 4JZQA 2ZCTA 1XWKA 1K0MA 3KZQA 2FHEA 4NV5A 2HZFA 2QC7A 2HSYA 2L4QA 1V57A 5A1NA 2J23A 4Q5FA 2PERA 2LQQA 4X1UA 4V1Ap 1ZYPA 4IN0A 1K0NA 2YPMA 4OFMA 2GQKA 1OC8A 2KUCA 4V1Ag 4QL9A 2PMTA 2EFCA 4K5RA 4V2MA 1NM3A 2MMOA 2MMZA 4GRFA 3MAKA 4AJ7A 4XS6A 4Q5QA 3BCIA 2OE0A 4KF9A 3EINA 4JU5A 1WJKA 1QK8A 3QAWA 3A2WA 2H0IA 2X64A 2DJ1A 2M46A 4TR1A 3HYPA 2LRNA 2VKZG 2GDRA 2ON5A 4IVFA 4TR0A 3K8NA 1OKDA 1WE0A 4WKWA 1A2JA 5EVOA 2RUFA 1GH2A 4X0XA 3RBTA 4KUNA 2K8VA 2GTUA 2HSMA 3H93A 5D9TA 1SL2B 1XZOA 1BG5A 3F6FA 5G5FA 3KEBA 3ERGA 1A23A 4JR6A 3CTFA 4HOJA 5GAND 2FWFA 4JEDA 2WDUA 2DIYA 3PR8A 2HNLA 3TKSA 2E2MA 4MJBA 5GAPD 3F9UA 3GN3A 4KH7A 5ECMB 4EE0A 3DMLA 2O36A 3LQ7A 2VCZA 2FLSA 3ZMKA 4EDZA 2H1BA 4N30A 5C04A 4RI6A 3TU3B 3GKNA 2O85A 1QUWA 4BA7A 2JZTA 1KNGA 1TJDA 4POKA 1UN2A 4ZB8A 5IPGA 2LRCA 1TRWA 4H86A 3GKMA 1O73A 3GL5A 3LSZA 1TTZA 1O8WA 4G19A 1B4PA 5F8BA 4YH2A 3GFKA 1MDJA 2HXKA 2MBTA 2B5YA 2YWMA 1TW9A 4IQAA 2HRFA 3RFRC 5AISA 5FWGA 4LMVA 3UBKA 2YWOA 2P0GA 2C3QA 1GTUA 4ECIA 2H1AA 3DWVA 4FIWA 4I2TA 4I97A 5BMUB 1FG4A 3EPTA 1AQWA 4OO5A 8GSSA 1U3IA 2V41A 2GSSA 4L8EA 3FZ5A 1BX9A 2EC4A 4OMVA 2NDOA 2LJKA 1XW5A 1GTIA 1XWAA 1F3BA 5AGYA 2EFHA 4KB3A 3I9V2 5ENUA 2WJUA 5A5HB 1SKRB 2IJYA 2X99A 2DJ2A 2GT5A 2IIYA 2O5VA 2O87A 2CVDA 4L0WA 4ILFA 4TVEA 3C7MA 3FZ9A 5EL8A 5FT3A 5A34B 4PURA 1EOGA 4F03A 1K0OA 3L4NA 4XRDA 1MD3A 2VOCA 4KDYA 4POBA 3KTBA 3DRNA 1XXUA 3DIEA 1X9MB 3IDVA 5DDLA 4MJCA 5D96A 1PX7A 2C4JA 4RQRA 2B7KA 2HZEA 3FEUA 2XPEA 4L5LA 1X5CA 4KSMA 4TW5A 2DKHA 1HQOA 5CP1A 3QR6A 5KN0A 1ON4A 4OWYA 4YKFA 1S3CA 4XHMA 1EGRA 2A4VA 2LRTA 3NZNA 1E2YA 2FY6A 1XVWA 1GSEA 5H5SA 4K0NA 4MJEA 3EWLA 2IN3A 3HKRA 1Q98A 4IP6A 2VM2A 1GUKA 1PRXA 4ZILA 3ZMLA 4ZL9A 1HNAA 3E0UA 2B1KA 2GQLA 5DAKB 1NW2A 1KEBA 2CV4A 4Q5RA 4OFNA 2OJLA 1FHEA 3MYDA 5F05A 3GHAA 20GSA 3F0IA 4NMUA 1WWJA 3C71A 1TXUA 2RIIA 3IV4A 5JCGA 2VL9A 2A2PA 2C3TA 4N11A 3QDNA 3N9JA 5IPHA 1S3DA 4EVMA 2KHPA 3HVVA 3WT2A 2LSTA 2R37A 1Z7PA 4BVYB 1X0RA 2CZ3A 1YVLA 1X5DA 1XOAA 3QFAC 3UARA 2XBIA 1MDKA 3WGEA 3ZRDA 1BYEA 4HUAA 4TR4A 5J4YA 3KP9A 3MSZA 3D4MA 3F4SA 4K7IA 3I6AA 4HS1A 1YQ1A 2H1GA 1AAZA 2LUSA 4IS0A 4I6XA 2I1UA 5F06A 2UV8G 4F9ZA 4PTSA 5HFKA 1O8XA 2LNSA 3E3EA 3KH7A 3LG6A 4OFTA 3HJPA 1TDIA 2BJXA 2F8FA 4G9HA 1THXA 1EV4A 3VK9A 5LCZA 3IHGA 3NIVA 3J7Yb 2WVXA 3G7YA 2NVLA 1Z5YE 1LBKA 5KEJA 5KN1A 3QD9A 1THOA 2GLRA 1WPIA 1K3OA 4AJ8A 4MZBA 4E68A 2WB9A 3HJMA 3FRCA 1A8LA 1KBNA 3HVXA 4IQ1A 4FH8A 3CRTA 2L5OA 5EPFA 2EFDA 2NBSA 4AKIA 2DJ3A 4EF0A 2FWHA 4WETA 4NPBA 4EC0A 1QFNA 4ZBDA 4GXZA 2EIOA 4ECJA 1FOVA 4FQUA 2OBKA 5CNWA 1SJIA 4TRXA 4BVXA 1HD2A 4G10A 3TRPA 5IMVA 5CRWA 1SYXA 1ERUA 3A2VA 3TOUA 4Z7XA 4QL7A 1VGLA 2F9SA 3IC4A 3W8SA 3F8UA 3F3QA 4FXYP 4DSQA 1S4BP 4CDOA 4GCIA 1NHOA 1K0BA 1TXXA 3Q74A 1S3AA 5G31A 1GNEA 2GZZA 1OC9B 2YJHA 5HR2A 3LYPA 4NHZA 5KN2A 2QA2A 1A8YA 4EO3A 5DCGA 1XBSA 2HT9A 4OD7A 2N5AA 1A2MA 4K1FA 3RGBC 2B7JA 4AKXB 3FR3A 5B8AA 1HYUA 3D6IA 3VWUA 3BBYA 3CMIA 3ME8A 4RUVA 1Q4JA 2R5GA 2ZNMA 2GVPA 2DKIA 2C0EA 2CAQA 1XOBA 3M9KA 2OKAA 1R7HA 3JCML 1T00A 1GUHA 5D9WA 2VL2C 1PL1A 2E2GA 2X8CA 1ZYEA 3IRAA 3TUEA 2FGXA
chains in the Genus database with same CATH topology
2HFDA 1TI3A 3L9VA 1BF5A 5A4WA 3A5IA 3Q19A 3C73A 5HQPA 2V2GA 4TKYA 4K5SA 1WRYA 1ML6A 2E0QA 4G01A 1YEXA 3GKKA 2HSNA 4XCSA 3DKSA 3KJYA 2JSYA 1SK0A 1OVNA 4MF7A 1R5AA 5F07A 3MDKA 3EMPA 2XHFA 4Z2UA 1CQGA 1ZCPA 3HY2A 4CY8A 3R3EA 2VD0A 2R0CA 4JBBA 2EFEA 4TXOB 1FB6A 4MDCA 2XC2A 5IIZA 3IA1A 5JWOB 1F2EA 2HI7A 3LFLA 2A2RA 4BL7B 4KA0A 1XFLA 3TJJA 2AAWA 3GSSA 4YQUA 2HLSA 4G0IA 4MP4A 2HSMB 1WOUA 4ULXA 1R26A 3D22A 1K0AA 5EY6A 2H73A 2IPAA 4J56E 4J2FA 1GSFA 3VLNA 2H8LA 2GT6A 2PVOC 1OE7A 1GLQA 4HZ2A 3DEXA 5J4UA 2AUVA 2YCDA 1OYJA 3FZ4A 3VPQA 1YZXA 3UVTA 2F8AA 3MWHA 3LYKA 2VIMA 2CAIA 22GSA 3GTUA 3WD6A 2C1YA 2M72A 4I2UA 1IYIA 3LXZA 5B7CA 4IHUA 1TRSA 2XBQA 3F4RA 2NPBA 1EOHA 2VAFA 2X8GA 4DSRA 2ALBA 4KAEA 1VF2A 1Z6MA 2LV3A 3RHCA 3EYTA 5JCUA 4O5QA 3D0ZA 2IMIA 2O8VB 3ZL5A 3HVSA 1SL1B 1MTCA 4V2NA 5GSTA 3VI5A 2M80A 1QQ2A 4TOPA 2K8SA 2H71A 2YZUA 3IXRA 5D9XA 5HR3A 1ZOFA 4E8HA 4XS4A 5ECNB 5IQYA 1FOHA 2R3XA 3ZITA 5IMAA 3FR9A 2REMA 1GTBA 2YWNA 3UL3A 2GSRA 1G7OA 6GSUA 3TKRA 1N8JA 3EE2A 1R5PA 4BWSA 4MPFA 2R6KA 2TIRA 2YV7A 3A3TA 1BEDA 1U6TA 4LLRA 5JCWA 4K7NA 2PN8A 5IOXA 1SVOA 5KOWA 5DBQA 4ML6A 3IOSA 13GSA 3VWXA 4CW9A 5A4VA 3EVIA 1XWGA 2I4AA 1G6WA 5G2ZA 3TOTA 3TCOA 3F3RA 4L5OA 4TXVA 4PNGA 1DE1A 2N5BA 1F37A 2LNTA 2YWIA 2V6KA 4WXTA 3ED3A 2P31A 4N10A 1OKTA 2Z9SA 3BCKA 5INYA 5A4UA 3P2AA 4G0LA 2FUG2 1N2AA 3J7Yk 5KOXA 4MPGA 1M9AA 3FZAA 4ML1A 3M1GA 4MABA 3MIXA 5B8BA 2RUEA 1DE2A 3RDWA 4POLA 1WP0A 3O76A 5AIXA 1BG1A 3H4KA 4K6XA 5KN3A 5J47A 4JRRA 1GSQA 1V40A 1SK1A 4L0UA 4HJMA 4WBRD 2GZPA 2K6VA 5H5QA 2DJJA 2X4AA 4FYUA 10GSA 4GQFA 2HRKB 4ID0A 1AUCA 3HZ4A 4AJ6A 1SL0B 2V32A 5GZZB 3GX8A 5CRDA 3TGZA 2PWJA 1EWXA 3QAVA 2H0HA 3ISOA 2FWGA 1C72A 2AYTA 2FCHA 2LJAA 2I81A 4PNFA 2WULA 4HJ2A 1GSDA 4NXIA 1OC3A 5GSSA 1EV9A 3APOA 1BQ7A 3E9JB 3ME7A 5ECSA 2MMAA 2AHEA 4IP1A 3GUSA 5BMUA 3RPNA 5CAXA 2FWEA 1WIKA 1EP7A 3H1NA 1VF4A 4YAPA 4CHSA 4RQXA 1Y25A 2C3NA 2VLTA 3TKSC 3P7XA 4NHWA 3KD0A 5A5HA 2VUPA 3IHQA 3LEFA 3EMXA 1YY7A 1BAYA 2H75A 3ZLPA 3P90A 3G7JA 3F6DA 1OAZA 4JE1A 5A34A 1WMJA 6GSWA 2JACA 4EUYA 4O5RA 5J40A 3ZVJA 1TRVA 2C0GA 2O7KA 1NSWA 4TN8A 2VM1A 3EURA 5DJLA 4MNNA 1XPVA 4QMKA 1LU4A 3LWAA 1XVQA 2LJRA 2IMFA 4AI6A 2OADA 3SBCA 1CQHA 4IJIA 5DALB 3HJOA 1ZMAA 3N5OA 2B5EA 7GSSA 2RM5A 3S9FA 1K3YA 3O6TA 4GTUA 2LQOA 4K2XA 3CYNA 3US3A 5ECKB 1T4ZA 2PVQA 5CRHA 6GSTA 4PGTA 1SYRA 3GURA 1GTAA 4AGSA 3ZIJA 4PQHA 5ID2B 2VCTA 1RQMA 4XIHA 3IR4A 1PKWA 3VPTA 5FHIA 5B6NA 1T7PB 2VO4A 5E59A 2IFQB 3VWWA 5DAKA 2C0DA 3NOFA 3ZVJD 1GLPA 3HA9A 2JSZA 2NTOA 4GDFA 2L57A 3QOUA 3LXTA 1OE8A 2H01A 1Z3EA 3WYWA 1FAAA 3KIJA 4MH3A 4ZIJA 3LW9A 1TRUA 4GSSA 1RW1A 2DMLA 4N3ZA 2XPDA 2H0GA 3WGDA 2V1MA 5ELGA 2FA4A 5G1LA 3WT1A 4DSSB 5IMFA 3GIXA 5IMZA 4WR5A 3KP8A 5ABRA 4NV2A 1T4YA 1ZL9A 4BVYA 1M7TA 4O7HA 4ZB7A 1DUGA 3ZTLA 1TK5B 4EDYA 2I3YA 2C80A 4GF0A 3R2QA 1AW9A 1I9DA 9GSSA 3I69A 4PUAA 4WBJA 3TDGA 3ZFLA 3L0HA 3KXOA 2WZ9A 3PPUA 1ABAA 2B5XA 3APQA 4ZXGA 5CO3A 3UEMA 3ZZXA 5HR0A 1PSQA 4PQ1A 1Y1UA 3IK9A 1U88A 1UVZA 1ST9A 5G1KA 4MF5A 2H76A 2QGVA 3GYKA 1YJ6A 2R4VA 1A24A 1O81A 1XWCA 3GL3A 1Z9HA 4KDUA 4USSA 3CWGA 2OE3A 2RM6A 5HFIA 5DVBA 3TRXA 2B3SA 3A2XA 4ECCA 2HE3A 1VF1A 4GQCA 4DVCA 3U5RE 4MK3A 4MZCA 1SKWB 3ZIVA 3QAGA 2HQTA 1O6JA 4LL4B 1R4WA 2YANA 4OCEA 4ACSA 1A0RP 1PX6A 2H6ZA 4HU7A 1USBA 1PD21 3DYRA 3M9JA 5HFGA 3CTGA 4F0BA 2FNOA 5ECHB 2WGRA 3EU3A 3KMNA 2WRTA 3UBLA 1PL2A 1SU9A 4EIQA 2YOIA 1AQVA 1AXDA 3DGQA 5A1NB 2VD1A 5J9BA 4EIPA 3L78A 5D93A 4ICYA 3BJ5A 1JLVA 2L6DA 4W66A 3HXSA 4ISDA 4HDEA 1OC9A 1FO5A 2OACA 1HNCA 3HCZA 4PQIA 4KSOA 3RAZA 2VCWA 3KH9A 11GSA 1TP9A 4TR1B 3GMFA 3IPZA 2B6MA 2BTOT 4A5PA 3DD3A 4XTSA 4V2LA 1B8XA 3ERWA 5D9VA 2PGTA 1JLWA 1V9WA 2R2JA 4GSTA 1MD4A 1JZRA 4I5QA 2EIRA 1YEPA 4Q5NA 1URMA 1JZOA 3UOMA 4D73A 3M3MA 1QMVA 2OE1A 2YV9A 2KOKA 5DCHA 3KGKA 1TI1A 2GS3A 1K0CA 2YP6A 1F3AA 3KMOA 3I43A 4IW9A 2GSQA 4G2EA 5H5RA 1GSUA 3UJ1A 4OO4A 1M9BA 1KTEA 1JZDA 1TU8A 2FA8A 3PGTA 3D21A 3GRXA 1HNBA 3C1SA 1ERWA 1GWCA 4IJ3A 2GSTA 1XIYA 2C0FA 4NWYA 4HEA2 2JADA 3V1WA 4TXOA 2ES7A 2OT3A 2DLXA 3L9SA 4MF6A 4BL7A 3AY8A 3GV1A 4AKHA 3VFIA 4PXOA 1PQNA 2LS5A 2CT6A 1VF3A 2MMNA 3GH9A 3M8NA 1G0TA 4KCEA 5BRTA 2TRXA 2A2SA 3GH6A 5AN1A 5DQYA 1B9YC 3W6GA 3TRQA 1QXHA 1H4OA 2H6XA 1N25A 1PKZA 3APSA 3L9UA 4GLTA 6GSYA 1M2BA 4MA9A 3BOAA 3UIWA 1EEJA 17GSA 4LA1A 2JL4A 4G0KA 2H74A 4O32A 4YKGA 5AIVA 5J3RA 3IK7A 5IM9A 1U3AA 5IO2A 1F9MA 2P5RA 3H79A 2H30A 4LL1B 1A0FA 2HZEB 1YKAA 3QCPA 4F2IA 2AJQB 1F6MC 2VCVA 1SJZA 1XCCA 4LMWA 6GSSA 3VWVA 2K9FA 2L59A 1YF1A 4KNDA 5B6MA 2PU9C 2HYXA 2IL3A 1GRXA 4X4JA 2IMDA 6GSXA 1E6BA 3FYGA 1K3LA 1SKSB 4FYCA 1V2AA 4KE3A 2H66A 2OA7A 2WS2A 3GX0A 1V98A 1AC1A 2YJ7A 3QPMA 3P8WA 1M0UA 5ECOB 3C8EA 1FB0A 3U6VA 2OBIA 1TU7A 1YDKA 1W89A 1VRSD 4AKGA 2IMKA 4F0CA 2L5LA 3Q6OA 2K18A 2AV4A 2CVBA 3G9BA 1GUMA 2D2ZA 1X9SB 3OR5A 4MMMA 4N0ZA 5ECQB 5J41A 2H70A 3DVWA 6GSVA 4HZ4A 16GSA 4WR4A 3ZREA 4POMA 4AF2A 2VLUA 4MH2A 2TRCP 3FY7A 5COHA 1M2AA 2QA1A 1YKCA 4IELA 2H72A 5JWRB 1DSBA 1ZYQB 3CSHA 1PA3A 3EC3A 3F63A 1W4VA 3SWLA 3WGXA 2HRAA 1GSYA 2MYGA 4HI7A 4E8EA 2X49A 2LKUA 4ZL7A 3C1RA 4ZBAA 2H19A 3LORA 4KDXA 4EXJA 2EIQA 2R0GA 4MLYA 2PBJA 2VLVA 3F4TA 4KW6A 4QQ7A 2HRKA 2KP2A 4FYBA 2QKEA 5DJMA 3EU4A 2E7PA 3TJKA 3FW2A 3ZFBA 3GNJA 1B9XC 1Z7RA 2VCXA 3UMAA 3IBHA 1GULA 3DVXA 3IC8A 1SENA 4K2DA 2L6CA 4ZB9A 4KGIA 5D8IA 1K0DA 3GA4A 4K0GA 1U87A 2VL2A 4O5UA 2BMXA 3TJBA 4MJAA 3G7IA 2O89A 4FO5A 1XW6A 2DIZA 3CRUA 4DEJA 2R0PA 2X8HA 3H8QA 3RPPA 2IWTA 3GKXA 2RLIA 1O7UA 4K7OA 1SVMA 4BVXB 19GSA 3LJRA 1ILOA 1XW9A 1ZYNA 1G7EA 1ERTA 4EL1A 2V6OA 1FVJA 14GSA 5CYYA 4MCUA 1SD8A 3PH9A 4N0VA 1AIUA 5ECRB 4YQVA 3IAS2 2H1DA 4WF4A 2L4CA 4KX4A 3Q18A 2CVKA 4XRAA 1PMTA 4YQMA 2CA8A 3TJGA 1IYHA 5DQSA 4IBPA 2KP1A 5C00A 1PGTA 1GP1A 1I5GA 2JU5A 3TB2A 1G6YA 4YAVA 4WEYA 3CXGA 2YNXA 4BWQA 2A4HA 3VI7A 1EZKA 3D5JA 2CX4A 3CBUA 2PPTA 4XS1A 4TR3A 5ECLB 3A5WA 12GSA 5LD0A 5ECIB 2DJ0A 5DALA 3HMJG 4JR4A 1X5EA 3UAPA 2YN1A 2MZCA 1UC7A 4ZBBA 4ZB6A 1TKDB 3PINA 1GSSA 4J57E 2LEGA 18GSA 4PUFC 2B1LA 4BPYA 2DBCA 2JZRA 5J9CA 2HRNA 1SK2A 4Z2RA 3TKSE 2F3MA 1AQXA 1A2LA 2QSIA 4P3YB 4HU9A 5ID2A 3IE3A 1M2DA 4MZWA 4K8MA 2G0FA 4HQSA 1J0FA 2CZ2A 3MNGA 2IFQA 1B48A 2DMMA 2WCIA 2FD3A 1JZWA 3TKPA 4GWRA 2DJKA 1DBYA 5LNKe 3UVHA 1UA5A 1Z6NA 5J4VA 1RK4A 1MEKA 2HSHA 5F0GA 2HSNB 3O3TA 3LGCA 1O85A 1ERVA 5CREA 1SVLA 2GZYA 3KTLA 3FHKA 1T8EB 2MBSA 3IAM2 5E4WA 2LTKA 5IMDA 2G2QA 2CQ9A 4PX1A 4DSSA 5ELAA 1LJRA 5A5KA 5ECPB 5G5EA 1TK0B 5HR1A 2JZSA 1V58A 3QFBC 1Y6EA 3FKFA 4O92A 3KM6A 3M0FA 2WFCA 2H1LA 1M99A 5L71A 2VL3A 3FK8A 1H75A 3HHVA 3ERFA 1TK8B 3TJFA 1ZGNA 3DXBA 1ZZYA 5CRGA 2N5FA 4KCAA 1FVKA 2F51A 5D73A 3FR6A 1MDIA 1QGVA 1XWBA 2AB6A 4NAXA 2KLXA 1SD9A 3W8JA 5IMCA 5G30A 1PN0A 3RHBA 2DC5A 2YZHA 4D73B 1X9WB 3FMWA 3BD2A 2J9HA 3VURA 2GQMA 1T3BA 3HDCA 4GSNA 4Z2TA 3GTUB 3GSTA 1SJ6A 4HQZA 2UZ8A 2CX3A 2C8UA 3ZYWA 4I8BA 4WF5A 5JWQB 4K9ZA 3TKQA 2IMEA 1EEMA 1PN9A 1JHBA 4OCFA 2ZUPA 3HZ8A 2VCQA 2I9HA 2PUKC 1BJXA 3D4TA 1B4QA 4IKHA 1EP8A 4CY6A 1ACVA 3CSIA 2H6YA 1TOFA 2DSAA 5IOWA 1EGOA 1FW1A 1T1VA 1J08A 2ON7A 4ECBA 1JFUA 4F82A 1J9BA 4RI7A 4IGJA 3HD5A 1GNWA 4XS4B 4ZL8A 2GGTA 3QMXA 1GL8A 4EKZA 5J5NA 2P5QA 1YF0A 4X43A 3CSJA 1NHYA 5IO0A 3KCMA 4JZQA 2ZCTA 1XWKA 1K0MA 3KZQA 2FHEA 4NV5A 2HZFA 2QC7A 2HSYA 2L4QA 1V57A 5A1NA 2J23A 4Q5FA 2PERA 2LQQA 4X1UA 4V1Ap 1ZYPA 4IN0A 1K0NA 2YPMA 4OFMA 2GQKA 1OC8A 2KUCA 4V1Ag 4QL9A 2PMTA 2EFCA 4K5RA 4V2MA 1NM3A 2MMOA 2MMZA 4GRFA 3MAKA 4AJ7A 4XS6A 4Q5QA 3BCIA 2OE0A 4KF9A 3EINA 4JU5A 1WJKA 1QK8A 3QAWA 3A2WA 2H0IA 2X64A 2DJ1A 2M46A 4TR1A 3HYPA 2LRNA 2VKZG 2GDRA 2ON5A 4IVFA 4TR0A 3K8NA 1OKDA 1WE0A 4WKWA 1A2JA 5EVOA 2RUFA 1GH2A 4X0XA 3RBTA 4KUNA 2K8VA 2GTUA 2HSMA 3H93A 5D9TA 1SL2B 1XZOA 1BG5A 3F6FA 5G5FA 3KEBA 3ERGA 1A23A 4JR6A 3CTFA 4HOJA 5GAND 2FWFA 4JEDA 2WDUA 2DIYA 3PR8A 2HNLA 3TKSA 2E2MA 4MJBA 5GAPD 3F9UA 3GN3A 4KH7A 5ECMB 4EE0A 3DMLA 3LQ7A 2VCZA 2FLSA 3ZMKA 4EDZA 2H1BA 4N30A 5C04A 4RI6A 3TU3B 3GKNA 2O85A 1QUWA 4BA7A 2JZTA 1KNGA 1TJDA 4POKA 1UN2A 4ZB8A 5IPGA 2LRCA 1TRWA 4H86A 3GKMA 1O73A 3GL5A 3LSZA 1TTZA 1O8WA 4G19A 1B4PA 5F8BA 4YH2A 3GFKA 1MDJA 2HXKA 2MBTA 2B5YA 2YWMA 1TW9A 4IQAA 2HRFA 5AISA 5FWGA 4LMVA 3UBKA 2YWOA 2P0GA 2C3QA 1GTUA 4ECIA 2H1AA 3DWVA 4FIWA 4I2TA 4I97A 5BMUB 1FG4A 3EPTA 1AQWA 4OO5A 8GSSA 1U3IA 2V41A 2GSSA 4L8EA 3FZ5A 1BX9A 2EC4A 4OMVA 2NDOA 2LJKA 1XW5A 1GTIA 1XWAA 1F3BA 5AGYA 2EFHA 4KB3A 3I9V2 5ENUA 2WJUA 5A5HB 1SKRB 2IJYA 2X99A 2DJ2A 2GT5A 2IIYA 2O5VA 2O87A 2CVDA 4L0WA 4ILFA 4TVEA 3C7MA 3FZ9A 5EL8A 5FT3A 5A34B 4PURA 1EOGA 4F03A 1K0OA 3L4NA 4XRDA 1MD3A 2VOCA 4KDYA 4POBA 3KTBA 3DRNA 1XXUA 3DIEA 1X9MB 3IDVA 5DDLA 4MJCA 5D96A 1PX7A 2C4JA 4RQRA 2B7KA 2HZEA 3FEUA 2XPEA 4L5LA 1X5CA 4KSMA 4TW5A 2DKHA 1HQOA 5CP1A 3QR6A 5KN0A 1ON4A 4OWYA 4YKFA 1S3CA 4XHMA 1EGRA 2A4VA 2LRTA 3NZNA 1E2YA 2FY6A 1XVWA 1GSEA 5H5SA 4K0NA 4MJEA 3EWLA 2IN3A 3HKRA 1Q98A 4IP6A 2VM2A 1GUKA 1PRXA 4ZILA 3ZMLA 4ZL9A 1HNAA 3E0UA 2B1KA 2GQLA 5DAKB 1NW2A 1KEBA 2CV4A 4Q5RA 4OFNA 2OJLA 1FHEA 3MYDA 5F05A 3GHAA 20GSA 3F0IA 4NMUA 1WWJA 3C71A 1TXUA 2RIIA 3IV4A 5JCGA 2VL9A 2A2PA 2C3TA 4N11A 3QDNA 3N9JA 5IPHA 1S3DA 4EVMA 2KHPA 3HVVA 3WT2A 2LSTA 2R37A 1Z7PA 4BVYB 1X0RA 2CZ3A 1YVLA 1X5DA 1XOAA 3QFAC 3UARA 2XBIA 1MDKA 3WGEA 3ZRDA 1BYEA 4HUAA 4TR4A 5J4YA 3KP9A 3MSZA 3D4MA 3F4SA 4K7IA 3I6AA 4HS1A 1YQ1A 2H1GA 1AAZA 2LUSA 4IS0A 4I6XA 2I1UA 5F06A 2UV8G 4F9ZA 4PTSA 5HFKA 1O8XA 2LNSA 3E3EA 3KH7A 3LG6A 4OFTA 3HJPA 1TDIA 2BJXA 2F8FA 4G9HA 1THXA 1EV4A 3VK9A 5LCZA 3IHGA 3NIVA 3J7Yb 3G7YA 2NVLA 1Z5YE 1LBKA 5KEJA 5KN1A 3QD9A 1THOA 2GLRA 1WPIA 1K3OA 4AJ8A 4MZBA 4E68A 2WB9A 3HJMA 3FRCA 1A8LA 1KBNA 3HVXA 4IQ1A 4FH8A 3CRTA 2L5OA 5EPFA 2EFDA 2NBSA 4AKIA 2DJ3A 4EF0A 2FWHA 4WETA 4NPBA 4EC0A 1QFNA 4ZBDA 4GXZA 2EIOA 4ECJA 1FOVA 4FQUA 2OBKA 5CNWA 1SJIA 4TRXA 4BVXA 1HD2A 4G10A 3TRPA 5IMVA 5CRWA 1SYXA 1ERUA 3A2VA 3TOUA 4Z7XA 4QL7A 1VGLA 2F9SA 3IC4A 3W8SA 3F8UA 3F3QA 4DSQA 4CDOA 4GCIA 1NHOA 1K0BA 1TXXA 3Q74A 1S3AA 5G31A 1GNEA 2GZZA 1OC9B 2YJHA 5HR2A 3LYPA 4NHZA 5KN2A 2QA2A 1A8YA 4EO3A 5DCGA 1XBSA 2HT9A 4OD7A 2N5AA 1A2MA 4K1FA 2B7JA 4AKXB 3FR3A 5B8AA 1HYUA 3D6IA 3VWUA 3BBYA 3CMIA 3ME8A 4RUVA 1Q4JA 2R5GA 2ZNMA 2GVPA 2DKIA 2C0EA 2CAQA 1XOBA 3M9KA 2OKAA 1R7HA 3JCML 1T00A 1GUHA 5D9WA 2VL2C 1PL1A 2E2GA 2X8CA 1ZYEA 3IRAA 3TUEA 2FGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFD A;  1TI3 A;  3L9V A;  5A4W A;  3Q19 A;  3C73 A;  5HQP A;  2V2G A;  4TKY A;  1WRY A;  1ML6 A;  2E0Q A;  1YEX A;  3GKK A;  4XCS A;  3DKS A;  3KJY A;  2JSY A;  1SK0 A;  1OVN A;  4MF7 A;  1R5A A;  5F07 A;  3MDK A;  3EMP A;  2XHF A;  1CQG A;  1ZCP A;  3HY2 A;  3R3E A;  2VD0 A;  4JBB A;  4TXO B;  1FB6 A;  4MDC A;  2XC2 A;  5IIZ A;  3IA1 A;  5JWO B;  1F2E A;  2HI7 A;  3LFL A;  2A2R A;  4BL7 B;  4KA0 A;  1XFL A;  3TJJ A;  2AAW A;  3GSS A;  4YQU A;  2HLS A;  4G0I A;  4MP4 A;  2HSM B;  1WOU A;  4ULX A;  1R26 A;  3D22 A;  1K0A A;  5EY6 A;  2H73 A;  2IPA A;  4J56 E;  4J2F A;  1GSF A;  3VLN A;  2H8L A;  2GT6 A;  2PVO C;  1OE7 A;  1GLQ A;  4HZ2 A;  3DEX A;  5J4U A;  2AUV A;  2YCD A;  1OYJ A;  3FZ4 A;  3VPQ A;  1YZX A;  3UVT A;  2F8A A;  3MWH A;  3LYK A;  2VIM A;  2CAI A;  22GS A;  3GTU A;  3WD6 A;  2C1Y A;  2M72 A;  4I2U A;  1IYI A;  3LXZ A;  5B7C A;  4IHU A;  1TRS A;  2XBQ A;  3F4R A;  2NPB A;  1EOH A;  2VAF A;  2X8G A;  4DSR A;  2ALB A;  4KAE A;  1VF2 A;  1Z6M A;  2LV3 A;  3RHC A;  3EYT A;  5JCU A;  3D0Z A;  2IMI A;  2O8V B;  3ZL5 A;  3HVS A;  1SL1 B;  1MTC A;  4V2N A;  5GST A;  3VI5 A;  2M80 A;  1QQ2 A;  4TOP A;  2K8S A;  2H71 A;  2YZU A;  3IXR A;  5D9X A;  5HR3 A;  1ZOF A;  4E8H A;  4XS4 A;  5ECN B;  5IQY A;  2R3X A;  3ZIT A;  5IMA A;  3FR9 A;  2REM A;  1GTB A;  2YWN A;  3UL3 A;  2GSR A;  1G7O A;  6GSU A;  3TKR A;  1N8J A;  3EE2 A;  1R5P A;  4BWS A;  4MPF A;  2R6K A;  2TIR A;  2YV7 A;  3A3T A;  1BED A;  1U6T A;  4LLR A;  5JCW A;  4K7N A;  2PN8 A;  5IOX A;  5DBQ A;  4ML6 A;  3IOS A;  13GS A;  3VWX A;  4CW9 A;  5A4V A;  3EVI A;  1XWG A;  2I4A A;  1G6W A;  5G2Z A;  3TOT A;  3TCO A;  3F3R A;  4L5O A;  4TXV A;  4PNG A;  1DE1 A;  2N5B A;  1F37 A;  2LNT A;  2YWI A;  2V6K A;  4WXT A;  3ED3 A;  2P31 A;  4N10 A;  1OKT A;  2Z9S A;  3BCK A;  5INY A;  5A4U A;  3P2A A;  4G0L A;  2FUG 2;  1N2A A;  3J7Y k;  4MPG A;  1M9A A;  3FZA A;  4ML1 A;  3M1G A;  4MAB A;  5B8B A;  1DE2 A;  2RUE A;  3RDW A;  4POL A;  1WP0 A;  3O76 A;  5AIX A;  3H4K A;  4K6X A;  5KN3 A;  4JRR A;  1GSQ A;  1V40 A;  1SK1 A;  4L0U A;  4HJM A;  4WBR D;  2GZP A;  2K6V A;  5H5Q A;  2DJJ A;  4FYU A;  10GS A;  4GQF A;  2HRK B;  4ID0 A;  1AUC A;  3HZ4 A;  4AJ6 A;  1SL0 B;  2V32 A;  5GZZ B;  3GX8 A;  5CRD A;  3TGZ A;  2PWJ A;  1EWX A;  3QAV A;  2H0H A;  3ISO A;  2FWG A;  1C72 A;  2AYT A;  2FCH A;  2LJA A;  2I81 A;  4PNF A;  2WUL A;  4HJ2 A;  1GSD A;  4NXI A;  1OC3 A;  5GSS A;  1EV9 A;  3APO A;  1BQ7 A;  3E9J B;  3ME7 A;  5ECS A;  2MMA A;  2AHE A;  4IP1 A;  3GUS A;  5BMU A;  3RPN A;  5CAX A;  2FWE A;  1WIK A;  1EP7 A;  3H1N A;  1VF4 A;  4YAP A;  4CHS A;  4RQX A;  1Y25 A;  2C3N A;  2VLT A;  3TKS C;  3P7X A;  4NHW A;  3KD0 A;  2VUP A;  3IHQ A;  3LEF A;  3EMX A;  1YY7 A;  1BAY A;  2H75 A;  3ZLP A;  3P90 A;  3G7J A;  3F6D A;  1OAZ A;  4JE1 A;  1WMJ A;  6GSW A;  2JAC A;  4EUY A;  4O5R A;  3ZVJ A;  1TRV A;  2C0G A;  2O7K A;  1NSW A;  4TN8 A;  2VM1 A;  3EUR A;  5DJL A;  1XPV A;  1LU4 A;  3LWA A;  1XVQ A;  2LJR A;  2IMF A;  2OAD A;  3SBC A;  1CQH A;  4IJI A;  5DAL B;  3HJO A;  1ZMA A;  3N5O A;  2B5E A;  7GSS A;  2RM5 A;  3S9F A;  1K3Y A;  3O6T A;  4GTU A;  2LQO A;  3CYN A;  3US3 A;  5ECK B;  1T4Z A;  2PVQ A;  5CRH A;  6GST A;  4PGT A;  1SYR A;  3GUR A;  1GTA A;  4AGS A;  3ZIJ A;  4PQH A;  5ID2 B;  2VCT A;  1RQM A;  4XIH A;  3IR4 A;  1PKW A;  3VPT A;  5FHI A;  5B6N A;  1T7P B;  2VO4 A;  5E59 A;  2IFQ B;  3VWW A;  5DAK A;  2C0D A;  3NOF A;  3ZVJ D;  1GLP A;  3HA9 A;  2JSZ A;  2NTO A;  2L57 A;  3QOU A;  3LXT A;  1OE8 A;  2H01 A;  1Z3E A;  3WYW A;  1FAA A;  3KIJ A;  4MH3 A;  4ZIJ A;  1TRU A;  4GSS A;  1RW1 A;  2DML A;  2XPD A;  2H0G A;  3WGD A;  2V1M A;  5ELG A;  2FA4 A;  5G1L A;  3WT1 A;  4DSS B;  5IMF A;  3GIX A;  5IMZ A;  4WR5 A;  3KP8 A;  5ABR A;  4NV2 A;  1T4Y A;  1ZL9 A;  4BVY A;  1M7T A;  4O7H A;  1DUG A;  3ZTL A;  1TK5 B;  4EDY A;  2I3Y A;  2C80 A;  4GF0 A;  3R2Q A;  1AW9 A;  1I9D A;  9GSS A;  3I69 A;  4PUA A;  4WBJ A;  3TDG A;  3ZFL A;  3L0H A;  3KXO A;  2WZ9 A;  3PPU A;  1ABA A;  2B5X A;  3APQ A;  4ZXG A;  5CO3 A;  3UEM A;  3ZZX A;  5HR0 A;  1PSQ A;  4PQ1 A;  3IK9 A;  1U88 A;  1UVZ A;  1ST9 A;  5G1K A;  4MF5 A;  2H76 A;  2QGV A;  3GYK A;  1YJ6 A;  2R4V A;  1A24 A;  1O81 A;  1XWC A;  3GL3 A;  1Z9H A;  4KDU A;  4USS A;  2OE3 A;  2RM6 A;  5HFI A;  5DVB A;  3TRX A;  2B3S A;  3A2X A;  4ECC A;  2HE3 A;  1VF1 A;  4GQC A;  4DVC A;  3U5R E;  4MK3 A;  4MZC A;  1SKW B;  3ZIV A;  3QAG A;  2HQT A;  1O6J A;  4LL4 B;  1R4W A;  2YAN A;  4OCE A;  4ACS A;  1A0R P;  1PX6 A;  2H6Z A;  4HU7 A;  1USB A;  1PD2 1;  3DYR A;  3M9J A;  5HFG A;  3CTG A;  4F0B A;  2FNO A;  5ECH B;  2WGR A;  3EU3 A;  3KMN A;  2WRT A;  3UBL A;  1PL2 A;  1SU9 A;  2YOI A;  1AQV A;  1AXD A;  3DGQ A;  2VD1 A;  5J9B A;  3L78 A;  5D93 A;  3BJ5 A;  1JLV A;  2L6D A;  3HXS A;  4ISD A;  4HDE A;  1OC9 A;  1FO5 A;  2OAC A;  1HNC A;  3HCZ A;  4PQI A;  4KSO A;  3RAZ A;  2VCW A;  3KH9 A;  11GS A;  1TP9 A;  4TR1 B;  3GMF A;  3IPZ A;  2B6M A;  2BTO T;  3DD3 A;  4XTS A;  4V2L A;  1B8X A;  3ERW A;  5D9V A;  2PGT A;  1JLW A;  1V9W A;  2R2J A;  4GST A;  1MD4 A;  1JZR A;  4I5Q A;  2EIR A;  1YEP A;  4Q5N A;  1URM A;  1JZO A;  3UOM A;  4D73 A;  3M3M A;  1QMV A;  2OE1 A;  2YV9 A;  2KOK A;  5DCH A;  3KGK A;  1TI1 A;  2GS3 A;  1K0C A;  2YP6 A;  1F3A A;  3KMO A;  3I43 A;  4IW9 A;  2GSQ A;  4G2E A;  5H5R A;  1GSU A;  3UJ1 A;  4OO4 A;  1M9B A;  1KTE A;  1JZD A;  1TU8 A;  2FA8 A;  3PGT A;  3D21 A;  3GRX A;  1HNB A;  3C1S A;  1ERW A;  1GWC A;  4IJ3 A;  2GST A;  1XIY A;  2C0F A;  4NWY A;  4HEA 2;  2JAD A;  3V1W A;  4TXO A;  2ES7 A;  2DLX A;  3L9S A;  4MF6 A;  4BL7 A;  3AY8 A;  3GV1 A;  3VFI A;  4PXO A;  1PQN A;  2LS5 A;  2CT6 A;  1VF3 A;  2MMN A;  3GH9 A;  3M8N A;  1G0T A;  4KCE A;  2TRX A;  2A2S A;  3GH6 A;  5AN1 A;  5DQY A;  1B9Y C;  3W6G A;  3TRQ A;  1QXH A;  1H4O A;  2H6X A;  1PKZ A;  3APS A;  3L9U A;  4GLT A;  6GSY A;  1M2B A;  4MA9 A;  3BOA A;  3UIW A;  1EEJ A;  17GS A;  4LA1 A;  2JL4 A;  4G0K A;  2H74 A;  4O32 A;  5AIV A;  5J3R A;  3IK7 A;  5IM9 A;  1U3A A;  5IO2 A;  1F9M A;  2P5R A;  3H79 A;  2H30 A;  4LL1 B;  1A0F A;  2HZE B;  1YKA A;  3QCP A;  4F2I A;  2AJQ B;  1F6M C;  2VCV A;  1SJZ A;  1XCC A;  4LMW A;  6GSS A;  3VWV A;  2K9F A;  2L59 A;  1YF1 A;  4KND A;  5B6M A;  2PU9 C;  2HYX A;  2IL3 A;  1GRX A;  2IMD A;  6GSX A;  1E6B A;  3FYG A;  1K3L A;  1SKS B;  4FYC A;  1V2A A;  4KE3 A;  2H66 A;  2OA7 A;  2WS2 A;  3GX0 A;  1V98 A;  1AC1 A;  2YJ7 A;  3QPM A;  3P8W A;  1M0U A;  5ECO B;  3C8E A;  1FB0 A;  3U6V A;  2OBI A;  1TU7 A;  1YDK A;  1W89 A;  1VRS D;  2IMK A;  4F0C A;  2L5L A;  3Q6O A;  2K18 A;  2AV4 A;  2CVB A;  3G9B A;  1GUM A;  2D2Z A;  1X9S B;  3OR5 A;  4MMM A;  4N0Z A;  5ECQ B;  5J41 A;  2H70 A;  3DVW A;  6GSV A;  4HZ4 A;  16GS A;  4WR4 A;  3ZRE A;  4POM A;  4AF2 A;  2VLU A;  4MH2 A;  2TRC P;  3FY7 A;  5COH A;  1M2A A;  1YKC A;  4IEL A;  2H72 A;  5JWR B;  1DSB A;  1ZYQ B;  3CSH A;  1PA3 A;  3EC3 A;  3F63 A;  1W4V A;  3SWL A;  3WGX A;  2HRA A;  1GSY A;  2MYG A;  4HI7 A;  4E8E A;  2LKU A;  4ZL7 A;  3C1R A;  4ZBA A;  2H19 A;  3LOR A;  4KDX A;  4EXJ A;  2EIQ A;  4MLY A;  2PBJ A;  2VLV A;  3F4T A;  4KW6 A;  4QQ7 A;  2HRK A;  2KP2 A;  4FYB A;  2QKE A;  5DJM A;  3EU4 A;  2E7P A;  3TJK A;  3FW2 A;  3ZFB A;  3GNJ A;  1B9X C;  1Z7R A;  2VCX A;  3UMA A;  3IBH A;  1GUL A;  3DVX A;  3IC8 A;  1SEN A;  4K2D A;  2L6C A;  4ZB9 A;  4KGI A;  5D8I A;  1K0D A;  3GA4 A;  4K0G A;  1U87 A;  2VL2 A;  2BMX A;  3TJB A;  4MJA A;  3G7I A;  2O89 A;  4FO5 A;  1XW6 A;  2DIZ A;  3CRU A;  4DEJ A;  2X8H A;  3H8Q A;  3RPP A;  2IWT A;  3GKX A;  2RLI A;  1O7U A;  4K7O A;  4BVX B;  19GS A;  3LJR A;  1ILO A;  1XW9 A;  1G7E A;  1ERT A;  4EL1 A;  2V6O A;  1FVJ A;  14GS A;  5CYY A;  4MCU A;  1SD8 A;  3PH9 A;  4N0V A;  1AIU A;  5ECR B;  4YQV A;  3IAS 2;  2H1D A;  4WF4 A;  2L4C A;  4KX4 A;  3Q18 A;  2CVK A;  4XRA A;  1PMT A;  4YQM A;  2CA8 A;  3TJG A;  1IYH A;  5DQS A;  4IBP A;  2KP1 A;  5C00 A;  1PGT A;  1GP1 A;  1I5G A;  2JU5 A;  3TB2 A;  1G6Y A;  4YAV A;  4WEY A;  3CXG A;  2YNX A;  4BWQ A;  3VI7 A;  1EZK A;  3D5J A;  2CX4 A;  3CBU A;  2PPT A;  4XS1 A;  4TR3 A;  5ECL B;  3A5W A;  12GS A;  5LD0 A;  5ECI B;  2DJ0 A;  5DAL A;  4JR4 A;  1X5E A;  3UAP A;  2YN1 A;  2MZC A;  1UC7 A;  4ZBB A;  4ZB6 A;  1TKD B;  3PIN A;  1GSS A;  4J57 E;  2LEG A;  18GS A;  4PUF C;  2B1L A;  4BPY A;  2DBC A;  2JZR A;  5J9C A;  2HRN A;  1SK2 A;  3TKS E;  2F3M A;  1AQX A;  1A2L A;  2QSI A;  4P3Y B;  4HU9 A;  5ID2 A;  3IE3 A;  1M2D A;  4MZW A;  4K8M A;  2G0F A;  4HQS A;  1J0F A;  2CZ2 A;  3MNG A;  2IFQ A;  1B48 A;  2DMM A;  2WCI A;  2FD3 A;  1JZW A;  3TKP A;  4GWR A;  2DJK A;  1DBY A;  5LNK e;  3UVH A;  1UA5 A;  1Z6N A;  1MEK A;  1RK4 A;  2HSH A;  5F0G A;  2HSN B;  3O3T A;  3LGC A;  1O85 A;  1ERV A;  5CRE A;  2GZY A;  3KTL A;  3FHK A;  1T8E B;  2MBS A;  3IAM 2;  5E4W A;  2LTK A;  5IMD A;  2G2Q A;  2CQ9 A;  4PX1 A;  4DSS A;  5ELA A;  1LJR A;  5A5K A;  5ECP B;  5G5E A;  1TK0 B;  5HR1 A;  2JZS A;  1V58 A;  3QFB C;  1Y6E A;  3FKF A;  4O92 A;  3KM6 A;  3M0F A;  2WFC A;  1M99 A;  5L71 A;  2VL3 A;  3FK8 A;  1H75 A;  3HHV A;  3ERF A;  1TK8 B;  3TJF A;  1ZGN A;  3DXB A;  1ZZY A;  5CRG A;  2N5F A;  4KCA A;  1FVK A;  2F51 A;  5D73 A;  3FR6 A;  1MDI A;  1QGV A;  1XWB A;  2AB6 A;  4NAX A;  2KLX A;  1SD9 A;  3W8J A;  5IMC A;  5G30 A;  3RHB A;  2DC5 A;  2YZH A;  4D73 B;  1X9W B;  3BD2 A;  2J9H A;  3VUR A;  2GQM A;  1T3B A;  3HDC A;  4GSN A;  3GTU B;  3GST A;  1SJ6 A;  4HQZ A;  2UZ8 A;  2CX3 A;  2C8U A;  3ZYW A;  4I8B A;  4WF5 A;  5JWQ B;  4K9Z A;  3TKQ A;  2IME A;  1EEM A;  1PN9 A;  1JHB A;  4OCF A;  2ZUP A;  3HZ8 A;  2VCQ A;  2I9H A;  2PUK C;  1BJX A;  3D4T A;  1B4Q A;  4IKH A;  1EP8 A;  1ACV A;  3CSI A;  2H6Y A;  1TOF A;  2DSA A;  5IOW A;  1EGO A;  1FW1 A;  1T1V A;  1J08 A;  2ON7 A;  4ECB A;  1JFU A;  4F82 A;  1J9B A;  4RI7 A;  4IGJ A;  3HD5 A;  1GNW A;  4XS4 B;  4ZL8 A;  2GGT A;  3QMX A;  1GL8 A;  4EKZ A;  5J5N A;  2P5Q A;  1YF0 A;  4X43 A;  3CSJ A;  1NHY A;  5IO0 A;  3KCM A;  4JZQ A;  2ZCT A;  1XWK A;  1K0M A;  3KZQ A;  2FHE A;  4NV5 A;  2HZF A;  2QC7 A;  2HSY A;  2L4Q A;  1V57 A;  2J23 A;  4Q5F A;  2PER A;  2LQQ A;  4X1U A;  4V1A p;  4IN0 A;  1K0N A;  2YPM A;  4OFM A;  2GQK A;  1OC8 A;  2KUC A;  4V1A g;  4QL9 A;  2PMT A;  4V2M A;  1NM3 A;  2MMO A;  2MMZ A;  4GRF A;  3MAK A;  4AJ7 A;  4XS6 A;  4Q5Q A;  3BCI A;  2OE0 A;  4KF9 A;  3EIN A;  4JU5 A;  1WJK A;  1QK8 A;  3QAW A;  3A2W A;  2H0I A;  2X64 A;  2DJ1 A;  2M46 A;  4TR1 A;  3HYP A;  2LRN A;  2GDR A;  2ON5 A;  4IVF A;  4TR0 A;  3K8N A;  1OKD A;  1WE0 A;  4WKW A;  1A2J A;  5EVO A;  2RUF A;  1GH2 A;  4X0X A;  3RBT A;  4KUN A;  2K8V A;  2GTU A;  2HSM A;  3H93 A;  5D9T A;  1SL2 B;  1XZO A;  1BG5 A;  3F6F A;  5G5F A;  3KEB A;  3ERG A;  1A23 A;  4JR6 A;  3CTF A;  4HOJ A;  5GAN D;  2FWF A;  4JED A;  2WDU A;  2DIY A;  3PR8 A;  2HNL A;  3TKS A;  2E2M A;  4MJB A;  5GAP D;  3F9U A;  3GN3 A;  4KH7 A;  5ECM B;  4EE0 A;  3DML A;  3LQ7 A;  2VCZ A;  2FLS A;  3ZMK A;  4EDZ A;  2H1B A;  4N30 A;  5C04 A;  4RI6 A;  2O85 A;  3GKN A;  1QUW A;  4BA7 A;  2JZT A;  1KNG A;  1TJD A;  4POK A;  1UN2 A;  4ZB8 A;  5IPG A;  2LRC A;  1TRW A;  4H86 A;  3GKM A;  1O73 A;  3GL5 A;  3LSZ A;  1TTZ A;  1O8W A;  4G19 A;  1B4P A;  5F8B A;  4YH2 A;  3GFK A;  1MDJ A;  2HXK A;  2MBT A;  2B5Y A;  2YWM A;  1TW9 A;  4IQA A;  2HRF A;  5AIS A;  5FWG A;  4LMV A;  3UBK A;  2YWO A;  2P0G A;  2C3Q A;  1GTU A;  4I2T A;  4ECI A;  2H1A A;  4FIW A;  3DWV A;  4I97 A;  1FG4 A;  1AQW A;  4OO5 A;  8GSS A;  1U3I A;  2V41 A;  2GSS A;  4L8E A;  3FZ5 A;  1BX9 A;  2EC4 A;  4OMV A;  2NDO A;  2LJK A;  1XW5 A;  1GTI A;  1XWA A;  1F3B A;  5AGY A;  4KB3 A;  3I9V 2;  5ENU A;  2WJU A;  1SKR B;  2IJY A;  2X99 A;  2DJ2 A;  2GT5 A;  2IIY A;  2O87 A;  2CVD A;  4L0W A;  4ILF A;  4TVE A;  3C7M A;  3FZ9 A;  5EL8 A;  5FT3 A;  4PUR A;  1EOG A;  4F03 A;  1K0O A;  3L4N A;  4XRD A;  1MD3 A;  2VOC A;  4KDY A;  4POB A;  3KTB A;  3DRN A;  1XXU A;  3DIE A;  1X9M B;  3IDV A;  5DDL A;  4MJC A;  5D96 A;  1PX7 A;  2C4J A;  4RQR A;  2B7K A;  2HZE A;  3FEU A;  2XPE A;  4L5L A;  1X5C A;  4KSM A;  4TW5 A;  1HQO A;  5CP1 A;  3QR6 A;  5KN0 A;  1ON4 A;  4OWY A;  1S3C A;  4XHM A;  1EGR A;  2A4V A;  2LRT A;  3NZN A;  1E2Y A;  2FY6 A;  1XVW A;  1GSE A;  5H5S A;  4K0N A;  4MJE A;  3EWL A;  2IN3 A;  3HKR A;  1Q98 A;  4IP6 A;  2VM2 A;  1GUK A;  1PRX A;  4ZIL A;  3ZML A;  4ZL9 A;  1HNA A;  3E0U A;  2B1K A;  2GQL A;  5DAK B;  1NW2 A;  1KEB A;  2CV4 A;  4Q5R A;  4OFN A;  2OJL A;  1FHE A;  5F05 A;  3GHA A;  20GS A;  3F0I A;  4NMU A;  1WWJ A;  3C71 A;  2RII A;  3IV4 A;  5JCG A;  2VL9 A;  2C3T A;  4N11 A;  3QDN A;  3N9J A;  5IPH A;  1S3D A;  4EVM A;  2KHP A;  3HVV A;  3WT2 A;  2LST A;  2R37 A;  1Z7P A;  4BVY B;  1X0R A;  2CZ3 A;  1XOA A;  1X5D A;  3QFA C;  3UAR A;  2XBI A;  1MDK A;  3WGE A;  3ZRD A;  1BYE A;  4HUA A;  4TR4 A;  3KP9 A;  3MSZ A;  3D4M A;  3F4S A;  4K7I A;  3I6A A;  4HS1 A;  1YQ1 A;  2H1G A;  1AAZ A;  2LUS A;  4IS0 A;  4I6X A;  2I1U A;  5F06 A;  4F9Z A;  4PTS A;  5HFK A;  1O8X A;  2LNS A;  3E3E A;  3KH7 A;  3LG6 A;  4OFT A;  3HJP A;  1TDI A;  2BJX A;  2F8F A;  4G9H A;  1THX A;  1EV4 A;  3VK9 A;  5LCZ A;  3NIV A;  3J7Y b;  3G7Y A;  2NVL A;  1Z5Y E;  1LBK A;  5KEJ A;  5KN1 A;  3QD9 A;  1THO A;  2GLR A;  1WPI A;  1K3O A;  4AJ8 A;  4MZB A;  2WB9 A;  3HJM A;  3FRC A;  1A8L A;  1KBN A;  3HVX A;  4IQ1 A;  4FH8 A;  3CRT A;  2L5O A;  5EPF A;  2NBS A;  2DJ3 A;  4EF0 A;  2FWH A;  4WET A;  4NPB A;  4EC0 A;  1QFN A;  4ZBD A;  4GXZ A;  2EIO A;  4ECJ A;  1FOV A;  4FQU A;  2OBK A;  5CNW A;  1SJI A;  4TRX A;  4BVX A;  1HD2 A;  4G10 A;  3TRP A;  5IMV A;  5CRW A;  1SYX A;  1ERU A;  3A2V A;  3TOU A;  4Z7X A;  4QL7 A;  1VGL A;  2F9S A;  3IC4 A;  3W8S A;  3F8U A;  3F3Q A;  4DSQ A;  4CDO A;  4GCI A;  1NHO A;  1K0B A;  1TXX A;  3Q74 A;  1S3A A;  5G31 A;  1GNE A;  2GZZ A;  1OC9 B;  2YJH A;  5HR2 A;  3LYP A;  4NHZ A;  5KN2 A;  1A8Y A;  4EO3 A;  5DCG A;  1XBS A;  2HT9 A;  4OD7 A;  2N5A A;  1A2M A;  4K1F A;  2B7J A;  3FR3 A;  5B8A A;  1HYU A;  3D6I A;  3VWU A;  3BBY A;  3CMI A;  3ME8 A;  4RUV A;  1Q4J A;  2R5G A;  2ZNM A;  2GVP A;  2C0E A;  2CAQ A;  1XOB A;  3M9K A;  2OKA A;  1R7H A;  3JCM L;  1T00 A;  1GUH A;  5D9W A;  2VL2 C;  1PL1 A;  2E2G A;  2X8C A;  1ZYE A;  3IRA A;  3TUE A;  2FGX A; 
#chains in the Genus database with same CATH topology
 2HFD A;  1TI3 A;  1YEW C;  3L9V A;  1BF5 A;  5A4W A;  3A5I A;  3Q19 A;  3C73 A;  5HQP A;  2V2G A;  4TKY A;  4K5S A;  1WRY A;  1ML6 A;  2E0Q A;  4G01 A;  1YEX A;  3GKK A;  2HSN A;  4XCS A;  3DKS A;  3KJY A;  2JSY A;  1SK0 A;  1OVN A;  4MF7 A;  1R5A A;  5F07 A;  3MDK A;  3EMP A;  2XHF A;  4Z2U A;  1CQG A;  1ZCP A;  3HY2 A;  4CY8 A;  3R3E A;  2VD0 A;  2R0C A;  4JBB A;  2EFE A;  4TXO B;  1FB6 A;  4MDC A;  2XC2 A;  5IIZ A;  3IA1 A;  5JWO B;  1F2E A;  2HI7 A;  3LFL A;  2A2R A;  4BL7 B;  4KA0 A;  1XFL A;  3TJJ A;  2AAW A;  3GSS A;  4YQU A;  2HLS A;  4G0I A;  4MP4 A;  2HSM B;  1WOU A;  2WW2 A;  4ULX A;  1R26 A;  3D22 A;  1K0A A;  5EY6 A;  2H73 A;  2IPA A;  4J56 E;  4J2F A;  1GSF A;  3VLN A;  2H8L A;  2GT6 A;  2PVO C;  1OE7 A;  1GLQ A;  4HZ2 A;  3DEX A;  5J4U A;  1PFO A;  2AUV A;  2YCD A;  1OYJ A;  3FZ4 A;  3VPQ A;  1YZX A;  3UVT A;  2F8A A;  3MWH A;  3LYK A;  2VIM A;  2CAI A;  22GS A;  3GTU A;  3WD6 A;  2C1Y A;  2M72 A;  4I2U A;  1IYI A;  3LXZ A;  5B7C A;  4IHU A;  1TRS A;  2XBQ A;  3F4R A;  2NPB A;  1EOH A;  2VAF A;  2X8G A;  4DSR A;  2ALB A;  4KAE A;  1VF2 A;  1Z6M A;  2LV3 A;  3RHC A;  3EYT A;  5JCU A;  4O5Q A;  3D0Z A;  2IMI A;  2O8V B;  3ZL5 A;  3HVS A;  1SL1 B;  1MTC A;  4V2N A;  5GST A;  3VI5 A;  2M80 A;  1QQ2 A;  4TOP A;  2K8S A;  2H71 A;  2YZU A;  3IXR A;  5D9X A;  5HR3 A;  1ZOF A;  4E8H A;  4XS4 A;  5ECN B;  5IQY A;  1FOH A;  2R3X A;  3ZIT A;  5IMA A;  3FR9 A;  2REM A;  1GTB A;  2YWN A;  3UL3 A;  2GSR A;  1G7O A;  6GSU A;  3TKR A;  1N8J A;  3EE2 A;  1R5P A;  4BWS A;  4MPF A;  2R6K A;  2TIR A;  2YV7 A;  3A3T A;  1BED A;  1U6T A;  4LLR A;  5JCW A;  4K7N A;  2PN8 A;  2WW1 A;  5IOX A;  1I1I P;  1SVO A;  5KOW A;  5DBQ A;  4ML6 A;  3IOS A;  13GS A;  3VWX A;  2WVY A;  4CW9 A;  5A4V A;  3EVI A;  1XWG A;  2I4A A;  1G6W A;  5G2Z A;  3TOT A;  3TCO A;  3F3R A;  4L5O A;  4TXV A;  4PNG A;  1DE1 A;  2N5B A;  1F37 A;  2LNT A;  2YWI A;  2V6K A;  4WXT A;  3ED3 A;  2P31 A;  4N10 A;  1OKT A;  2Z9S A;  3BCK A;  5INY A;  5A4U A;  3P2A A;  4G0L A;  2FUG 2;  1N2A A;  3J7Y k;  5KOX A;  4MPG A;  1M9A A;  3FZA A;  4ML1 A;  3M1G A;  4MAB A;  3MIX A;  5B8B A;  2RUE A;  1DE2 A;  3RDW A;  4POL A;  1WP0 A;  3O76 A;  5AIX A;  1BG1 A;  3H4K A;  4K6X A;  5KN3 A;  5J47 A;  4JRR A;  1GSQ A;  1V40 A;  1SK1 A;  4L0U A;  4HJM A;  4WBR D;  2GZP A;  2K6V A;  5H5Q A;  2DJJ A;  2X4A A;  4FYU A;  10GS A;  4GQF A;  2HRK B;  4ID0 A;  1AUC A;  3HZ4 A;  4AJ6 A;  1SL0 B;  2V32 A;  5GZZ B;  3GX8 A;  5CRD A;  3TGZ A;  2PWJ A;  1EWX A;  3QAV A;  2H0H A;  3ISO A;  2FWG A;  1C72 A;  2AYT A;  2FCH A;  2LJA A;  2I81 A;  4PNF A;  2WUL A;  4HJ2 A;  1GSD A;  4NXI A;  1OC3 A;  5GSS A;  1EV9 A;  3APO A;  1BQ7 A;  3E9J B;  3ME7 A;  5ECS A;  2MMA A;  2AHE A;  4IP1 A;  3GUS A;  5BMU A;  3RPN A;  5CAX A;  2FWE A;  1WIK A;  1EP7 A;  3H1N A;  1VF4 A;  4YAP A;  4CHS A;  4RQX A;  1Y25 A;  2C3N A;  2VLT A;  3TKS C;  3P7X A;  4NHW A;  3KD0 A;  5A5H A;  2VUP A;  3IHQ A;  3LEF A;  3EMX A;  1YY7 A;  1BAY A;  2H75 A;  3ZLP A;  3P90 A;  3G7J A;  3F6D A;  1OAZ A;  4JE1 A;  5A34 A;  1WMJ A;  6GSW A;  2JAC A;  4EUY A;  4O5R A;  5J40 A;  3ZVJ A;  1TRV A;  2C0G A;  2O7K A;  1NSW A;  4TN8 A;  2VM1 A;  3EUR A;  5DJL A;  4MNN A;  1XPV A;  4QMK A;  1LU4 A;  3LWA A;  1XVQ A;  2LJR A;  2IMF A;  4AI6 A;  2OAD A;  3SBC A;  1CQH A;  4IJI A;  5DAL B;  3HJO A;  1ZMA A;  3N5O A;  2B5E A;  7GSS A;  2RM5 A;  3S9F A;  1K3Y A;  3O6T A;  4GTU A;  2LQO A;  4K2X A;  3CYN A;  3US3 A;  5ECK B;  1T4Z A;  2PVQ A;  5CRH A;  6GST A;  4PGT A;  1SYR A;  3GUR A;  1GTA A;  4AGS A;  3ZIJ A;  4PQH A;  5ID2 B;  4PHZ C;  2VCT A;  1RQM A;  4XIH A;  3IR4 A;  1PKW A;  3VPT A;  5FHI A;  5B6N A;  1T7P B;  2VO4 A;  5E59 A;  2IFQ B;  3VWW A;  5DAK A;  2C0D A;  3NOF A;  3ZVJ D;  1GLP A;  3HA9 A;  2JSZ A;  2NTO A;  4GDF A;  2L57 A;  3QOU A;  3LXT A;  1OE8 A;  2H01 A;  1Z3E A;  3WYW A;  1FAA A;  3KIJ A;  4MH3 A;  4ZIJ A;  3LW9 A;  1TRU A;  4GSS A;  1RW1 A;  2DML A;  4N3Z A;  2XPD A;  2H0G A;  3WGD A;  2V1M A;  5ELG A;  2FA4 A;  5G1L A;  3WT1 A;  4DSS B;  5IMF A;  3GIX A;  5IMZ A;  4WR5 A;  3KP8 A;  5ABR A;  4NV2 A;  1T4Y A;  2WW0 A;  1ZL9 A;  4BVY A;  1M7T A;  4O7H A;  4ZB7 A;  1DUG A;  3ZTL A;  1TK5 B;  4EDY A;  2I3Y A;  2C80 A;  4GF0 A;  3R2Q A;  1AW9 A;  1I9D A;  9GSS A;  3I69 A;  4PUA A;  4WBJ A;  3TDG A;  3ZFL A;  3L0H A;  3KXO A;  2WZ9 A;  3PPU A;  1ABA A;  2B5X A;  3APQ A;  4ZXG A;  5CO3 A;  3UEM A;  3ZZX A;  5HR0 A;  1PSQ A;  4PQ1 A;  1Y1U A;  3IK9 A;  1U88 A;  1UVZ A;  1ST9 A;  5G1K A;  4MF5 A;  2H76 A;  2QGV A;  3GYK A;  1YJ6 A;  2R4V A;  1A24 A;  1O81 A;  1XWC A;  3GL3 A;  1Z9H A;  4KDU A;  4USS A;  3CWG A;  2OE3 A;  2RM6 A;  5HFI A;  5DVB A;  3TRX A;  2B3S A;  3A2X A;  4ECC A;  2HE3 A;  1VF1 A;  4GQC A;  4DVC A;  3U5R E;  4MK3 A;  4MZC A;  1SKW B;  3ZIV A;  3QAG A;  2HQT A;  1O6J A;  4LL4 B;  1R4W A;  2YAN A;  4OCE A;  4ACS A;  1A0R P;  1PX6 A;  2H6Z A;  4HU7 A;  1USB A;  1PD2 1;  3DYR A;  3M9J A;  5HFG A;  2O3E A;  3CTG A;  4F0B A;  2FNO A;  5ECH B;  2WGR A;  3EU3 A;  3KMN A;  2WRT A;  3UBL A;  1PL2 A;  1SU9 A;  4EIQ A;  2YOI A;  1AQV A;  1M3J A;  1AXD A;  3DGQ A;  5A1N B;  2VD1 A;  5J9B A;  4EIP A;  3L78 A;  1S3R A;  5D93 A;  4ICY A;  3BJ5 A;  1JLV A;  2L6D A;  4W66 A;  3HXS A;  4ISD A;  4HDE A;  1OC9 A;  1FO5 A;  2OAC A;  1HNC A;  3HCZ A;  4PQI A;  4KSO A;  3RAZ A;  2VCW A;  3KH9 A;  11GS A;  1TP9 A;  4TR1 B;  3GMF A;  3IPZ A;  2B6M A;  2BTO T;  4A5P A;  3DD3 A;  4XTS A;  4V2L A;  1B8X A;  3ERW A;  5D9V A;  2PGT A;  1JLW A;  1V9W A;  2R2J A;  4GST A;  1MD4 A;  1JZR A;  4I5Q A;  2EIR A;  1YEP A;  3CQF A;  4Q5N A;  1URM A;  1JZO A;  3UOM A;  4PI0 C;  4D73 A;  3M3M A;  1QMV A;  2OE1 A;  2YV9 A;  2KOK A;  5DCH A;  3KGK A;  1TI1 A;  2GS3 A;  1K0C A;  2YP6 A;  1F3A A;  3KMO A;  3I43 A;  4IW9 A;  2GSQ A;  4G2E A;  5H5R A;  1GSU A;  3UJ1 A;  4OO4 A;  1M9B A;  1KTE A;  1JZD A;  1TU8 A;  2FA8 A;  3PGT A;  3D21 A;  3GRX A;  1HNB A;  3C1S A;  1ERW A;  1GWC A;  4IJ3 A;  2GST A;  4BIK A;  1XIY A;  2C0F A;  4NWY A;  4HEA 2;  2JAD A;  3V1W A;  2WZS A;  4TXO A;  2ES7 A;  2OT3 A;  2DLX A;  3L9S A;  4MF6 A;  4BL7 A;  3AY8 A;  3GV1 A;  4AKH A;  3VFI A;  4PXO A;  1PQN A;  2LS5 A;  2CT6 A;  1VF3 A;  2MMN A;  3GH9 A;  3M8N A;  1G0T A;  4KCE A;  5BRT A;  2TRX A;  2A2S A;  3GH6 A;  5AN1 A;  5DQY A;  1B9Y C;  3W6G A;  3TRQ A;  1QXH A;  1H4O A;  2H6X A;  1N25 A;  1PKZ A;  3APS A;  3L9U A;  4GLT A;  6GSY A;  1M2B A;  1M3I A;  4MA9 A;  3BOA A;  4PI2 C;  3UIW A;  1EEJ A;  17GS A;  4LA1 A;  2JL4 A;  4G0K A;  2H74 A;  4O32 A;  4YKG A;  5AIV A;  5J3R A;  3IK7 A;  5IM9 A;  1XG8 A;  1U3A A;  5IO2 A;  1F9M A;  2P5R A;  3H79 A;  2H30 A;  4LL1 B;  1A0F A;  2HZE B;  1YKA A;  3QCP A;  4F2I A;  2AJQ B;  1F6M C;  2VCV A;  1SJZ A;  1XCC A;  4LMW A;  6GSS A;  3VWV A;  2K9F A;  2L59 A;  1YF1 A;  4KND A;  5B6M A;  2PU9 C;  2HYX A;  2IL3 A;  1GRX A;  4X4J A;  2IMD A;  6GSX A;  1E6B A;  3FYG A;  1K3L A;  1SKS B;  4FYC A;  1V2A A;  4KE3 A;  2H66 A;  2OA7 A;  2WS2 A;  3GX0 A;  1V98 A;  1AC1 A;  2YJ7 A;  3QPM A;  3P8W A;  1M0U A;  5ECO B;  3C8E A;  1FB0 A;  3U6V A;  2OBI A;  1TU7 A;  1YDK A;  1W89 A;  4HSC X;  1VRS D;  4AKG A;  2IMK A;  4F0C A;  2L5L A;  3Q6O A;  2K18 A;  2AV4 A;  3CHX C;  2CVB A;  3G9B A;  1GUM A;  2D2Z A;  1X9S B;  3OR5 A;  4MMM A;  4N0Z A;  5ECQ B;  5J41 A;  2H70 A;  2WW3 A;  3DVW A;  6GSV A;  4HZ4 A;  16GS A;  4WR4 A;  3ZRE A;  4POM A;  4AF2 A;  2VLU A;  4MH2 A;  2TRC P;  3FY7 A;  5COH A;  1M2A A;  2QA1 A;  1YKC A;  4IEL A;  2H72 A;  5JWR B;  1DSB A;  1ZYQ B;  3CSH A;  1PA3 A;  3EC3 A;  3F63 A;  2WVZ A;  1W4V A;  3SWL A;  3WGX A;  2HRA A;  1GSY A;  2MYG A;  4HI7 A;  4E8E A;  2X49 A;  2LKU A;  4ZL7 A;  3C1R A;  4ZBA A;  2H19 A;  3LOR A;  4KDX A;  4EXJ A;  2EIQ A;  2R0G A;  4MLY A;  2PBJ A;  2VLV A;  3F4T A;  4KW6 A;  4QQ7 A;  2HRK A;  2KP2 A;  4FYB A;  2QKE A;  5DJM A;  3EU4 A;  2E7P A;  3TJK A;  3HVN A;  3FW2 A;  3ZFB A;  3GNJ A;  2WVX B;  1B9X C;  1Z7R A;  2VCX A;  3UMA A;  3IBH A;  1GUL A;  3DVX A;  3IC8 A;  1SEN A;  4K2D A;  2L6C A;  4ZB9 A;  4KGI A;  5D8I A;  1K0D A;  3GA4 A;  4K0G A;  1U87 A;  2VL2 A;  4O5U A;  2BMX A;  3TJB A;  4MJA A;  3G7I A;  2O89 A;  4FO5 A;  1XW6 A;  2DIZ A;  3CRU A;  4DEJ A;  2R0P A;  2X8H A;  3H8Q A;  3RPP A;  2IWT A;  3GKX A;  2RLI A;  1O7U A;  4K7O A;  1SVM A;  4BVX B;  19GS A;  3LJR A;  1ILO A;  1XW9 A;  1ZYN A;  1G7E A;  1ERT A;  4EL1 A;  2V6O A;  1FVJ A;  14GS A;  5CYY A;  4MCU A;  1SD8 A;  3PH9 A;  4N0V A;  1AIU A;  5ECR B;  4YQV A;  3IAS 2;  2H1D A;  4WF4 A;  2L4C A;  4KX4 A;  3Q18 A;  2CVK A;  4XRA A;  1PMT A;  4YQM A;  2CA8 A;  3TJG A;  1IYH A;  5DQS A;  4IBP A;  2KP1 A;  5C00 A;  1PGT A;  1GP1 A;  1I5G A;  2JU5 A;  3TB2 A;  1G6Y A;  4YAV A;  4WEY A;  3CXG A;  2YNX A;  4BWQ A;  2A4H A;  3VI7 A;  1EZK A;  3D5J A;  2CX4 A;  3CBU A;  2PPT A;  4XS1 A;  4TR3 A;  5ECL B;  3A5W A;  12GS A;  5LD0 A;  5ECI B;  2DJ0 A;  5DAL A;  3HMJ G;  4JR4 A;  1X5E A;  3UAP A;  2YN1 A;  2MZC A;  1UC7 A;  4ZBB A;  4ZB6 A;  1TKD B;  3PIN A;  1GSS A;  4J57 E;  2LEG A;  18GS A;  4PUF C;  2B1L A;  4BPY A;  2DBC A;  2JZR A;  5J9C A;  2HRN A;  1SK2 A;  4Z2R A;  3TKS E;  2F3M A;  1AQX A;  1A2L A;  2QSI A;  4P3Y B;  4HU9 A;  5ID2 A;  3IE3 A;  1M2D A;  4MZW A;  4K8M A;  2G0F A;  4HQS A;  1J0F A;  2CZ2 A;  3MNG A;  2IFQ A;  1B48 A;  2DMM A;  2WCI A;  2FD3 A;  1JZW A;  3TKP A;  4GWR A;  2DJK A;  1DBY A;  5LNK e;  3UVH A;  1UA5 A;  1Z6N A;  5J4V A;  1RK4 A;  1MEK A;  2HSH A;  5F0G A;  2HSN B;  3O3T A;  3LGC A;  1O85 A;  1ERV A;  5CRE A;  1SVL A;  2GZY A;  3KTL A;  3FHK A;  1T8E B;  2MBS A;  3IAM 2;  5E4W A;  2LTK A;  5IMD A;  2G2Q A;  2CQ9 A;  4PX1 A;  4DSS A;  5ELA A;  1LJR A;  5A5K A;  5ECP B;  5G5E A;  1TK0 B;  5HR1 A;  2JZS A;  1V58 A;  3QFB C;  1Y6E A;  3FKF A;  4O92 A;  3KM6 A;  3M0F A;  2WFC A;  2H1L A;  1M99 A;  5L71 A;  2VL3 A;  3FK8 A;  1H75 A;  3HHV A;  3ERF A;  1TK8 B;  3TJF A;  1ZGN A;  3DXB A;  1ZZY A;  5CRG A;  2N5F A;  4KCA A;  1FVK A;  2F51 A;  5D73 A;  3FR6 A;  1MDI A;  1QGV A;  1XWB A;  2AB6 A;  4NAX A;  2KLX A;  1SD9 A;  3W8J A;  5IMC A;  5G30 A;  1PN0 A;  3RHB A;  2DC5 A;  2YZH A;  4D73 B;  1X9W B;  3FMW A;  3BD2 A;  2J9H A;  3VUR A;  2GQM A;  1T3B A;  3HDC A;  4GSN A;  4Z2T A;  3GTU B;  3GST A;  1SJ6 A;  4HQZ A;  2UZ8 A;  2CX3 A;  2C8U A;  3ZYW A;  4I8B A;  4WF5 A;  5JWQ B;  4K9Z A;  3TKQ A;  2IME A;  1EEM A;  1PN9 A;  1JHB A;  4OCF A;  2ZUP A;  3HZ8 A;  2VCQ A;  2I9H A;  2PUK C;  1BJX A;  3D4T A;  1B4Q A;  4IKH A;  1EP8 A;  4CY6 A;  1ACV A;  3CSI A;  2H6Y A;  1TOF A;  2DSA A;  5IOW A;  1EGO A;  1FW1 A;  1T1V A;  1J08 A;  2ON7 A;  4ECB A;  1JFU A;  4F82 A;  1J9B A;  4RI7 A;  4IGJ A;  3HD5 A;  1GNW A;  4XS4 B;  4ZL8 A;  2GGT A;  3QMX A;  1GL8 A;  4EKZ A;  5J5N A;  2P5Q A;  1YF0 A;  4X43 A;  3CSJ A;  1NHY A;  5IO0 A;  3KCM A;  4JZQ A;  2ZCT A;  1XWK A;  1K0M A;  3KZQ A;  2FHE A;  4NV5 A;  2HZF A;  2QC7 A;  2HSY A;  2L4Q A;  1V57 A;  5A1N A;  2J23 A;  4Q5F A;  2PER A;  2LQQ A;  4X1U A;  4V1A p;  1ZYP A;  4IN0 A;  1K0N A;  2YPM A;  4OFM A;  2GQK A;  1OC8 A;  2KUC A;  4V1A g;  4QL9 A;  2PMT A;  2EFC A;  4K5R A;  4V2M A;  1NM3 A;  2MMO A;  2MMZ A;  4GRF A;  3MAK A;  4AJ7 A;  4XS6 A;  4Q5Q A;  3BCI A;  2OE0 A;  4KF9 A;  3EIN A;  4JU5 A;  1WJK A;  1QK8 A;  3QAW A;  3A2W A;  2H0I A;  2X64 A;  2DJ1 A;  2M46 A;  4TR1 A;  3HYP A;  2LRN A;  2VKZ G;  2GDR A;  2ON5 A;  4IVF A;  4TR0 A;  3K8N A;  1OKD A;  1WE0 A;  4WKW A;  1A2J A;  5EVO A;  2RUF A;  1GH2 A;  4X0X A;  3RBT A;  4KUN A;  2K8V A;  2GTU A;  2HSM A;  3H93 A;  5D9T A;  1SL2 B;  1XZO A;  1BG5 A;  3F6F A;  5G5F A;  3KEB A;  3ERG A;  1A23 A;  4JR6 A;  3CTF A;  4HOJ A;  5GAN D;  2FWF A;  4JED A;  2WDU A;  2DIY A;  3PR8 A;  2HNL A;  3TKS A;  2E2M A;  4MJB A;  5GAP D;  3F9U A;  3GN3 A;  4KH7 A;  5ECM B;  4EE0 A;  3DML A;  2O36 A;  3LQ7 A;  2VCZ A;  2FLS A;  3ZMK A;  4EDZ A;  2H1B A;  4N30 A;  5C04 A;  4RI6 A;  3TU3 B;  3GKN A;  2O85 A;  1QUW A;  4BA7 A;  2JZT A;  1KNG A;  1TJD A;  4POK A;  1UN2 A;  4ZB8 A;  5IPG A;  2LRC A;  1TRW A;  4H86 A;  3GKM A;  1O73 A;  3GL5 A;  3LSZ A;  1TTZ A;  1O8W A;  4G19 A;  1B4P A;  5F8B A;  4YH2 A;  3GFK A;  1MDJ A;  2HXK A;  2MBT A;  2B5Y A;  2YWM A;  1TW9 A;  4IQA A;  2HRF A;  3RFR C;  5AIS A;  5FWG A;  4LMV A;  3UBK A;  2YWO A;  2P0G A;  2C3Q A;  1GTU A;  4ECI A;  2H1A A;  3DWV A;  4FIW A;  4I2T A;  4I97 A;  5BMU B;  1FG4 A;  3EPT A;  1AQW A;  4OO5 A;  8GSS A;  1U3I A;  2V41 A;  2GSS A;  4L8E A;  3FZ5 A;  1BX9 A;  2EC4 A;  4OMV A;  2NDO A;  2LJK A;  1XW5 A;  1GTI A;  1XWA A;  1F3B A;  5AGY A;  2EFH A;  4KB3 A;  3I9V 2;  5ENU A;  2WJU A;  5A5H B;  1SKR B;  2IJY A;  2X99 A;  2DJ2 A;  2GT5 A;  2IIY A;  2O5V A;  2O87 A;  2CVD A;  4L0W A;  4ILF A;  4TVE A;  3C7M A;  3FZ9 A;  5EL8 A;  5FT3 A;  5A34 B;  4PUR A;  1EOG A;  4F03 A;  1K0O A;  3L4N A;  4XRD A;  1MD3 A;  2VOC A;  4KDY A;  4POB A;  3KTB A;  3DRN A;  1XXU A;  3DIE A;  1X9M B;  3IDV A;  5DDL A;  4MJC A;  5D96 A;  1PX7 A;  2C4J A;  4RQR A;  2B7K A;  2HZE A;  3FEU A;  2XPE A;  4L5L A;  1X5C A;  4KSM A;  4TW5 A;  2DKH A;  1HQO A;  5CP1 A;  3QR6 A;  5KN0 A;  1ON4 A;  4OWY A;  4YKF A;  1S3C A;  4XHM A;  1EGR A;  2A4V A;  2LRT A;  3NZN A;  1E2Y A;  2FY6 A;  1XVW A;  1GSE A;  5H5S A;  4K0N A;  4MJE A;  3EWL A;  2IN3 A;  3HKR A;  1Q98 A;  4IP6 A;  2VM2 A;  1GUK A;  1PRX A;  4ZIL A;  3ZML A;  4ZL9 A;  1HNA A;  3E0U A;  2B1K A;  2GQL A;  5DAK B;  1NW2 A;  1KEB A;  2CV4 A;  4Q5R A;  4OFN A;  2OJL A;  1FHE A;  3MYD A;  5F05 A;  3GHA A;  20GS A;  3F0I A;  4NMU A;  1WWJ A;  3C71 A;  1TXU A;  2RII A;  3IV4 A;  5JCG A;  2VL9 A;  2A2P A;  2C3T A;  4N11 A;  3QDN A;  3N9J A;  5IPH A;  1S3D A;  4EVM A;  2KHP A;  3HVV A;  3WT2 A;  2LST A;  2R37 A;  1Z7P A;  4BVY B;  1X0R A;  2CZ3 A;  1YVL A;  1X5D A;  1XOA A;  3QFA C;  3UAR A;  2XBI A;  1MDK A;  3WGE A;  3ZRD A;  1BYE A;  4HUA A;  4TR4 A;  5J4Y A;  3KP9 A;  3MSZ A;  3D4M A;  3F4S A;  4K7I A;  3I6A A;  4HS1 A;  1YQ1 A;  2H1G A;  1AAZ A;  2LUS A;  4IS0 A;  4I6X A;  2I1U A;  5F06 A;  2UV8 G;  4F9Z A;  4PTS A;  5HFK A;  1O8X A;  2LNS A;  3E3E A;  3KH7 A;  3LG6 A;  4OFT A;  3HJP A;  1TDI A;  2BJX A;  2F8F A;  4G9H A;  1THX A;  1EV4 A;  3VK9 A;  5LCZ A;  3IHG A;  3NIV A;  3J7Y b;  2WVX A;  3G7Y A;  2NVL A;  1Z5Y E;  1LBK A;  5KEJ A;  5KN1 A;  3QD9 A;  1THO A;  2GLR A;  1WPI A;  1K3O A;  4AJ8 A;  4MZB A;  4E68 A;  2WB9 A;  3HJM A;  3FRC A;  1A8L A;  1KBN A;  3HVX A;  4IQ1 A;  4FH8 A;  3CRT A;  2L5O A;  5EPF A;  2EFD A;  2NBS A;  4AKI A;  2DJ3 A;  4EF0 A;  2FWH A;  4WET A;  4NPB A;  4EC0 A;  1QFN A;  4ZBD A;  4GXZ A;  2EIO A;  4ECJ A;  1FOV A;  4FQU A;  2OBK A;  5CNW A;  1SJI A;  4TRX A;  4BVX A;  1HD2 A;  4G10 A;  3TRP A;  5IMV A;  5CRW A;  1SYX A;  1ERU A;  3A2V A;  3TOU A;  4Z7X A;  4QL7 A;  1VGL A;  2F9S A;  3IC4 A;  3W8S A;  3F8U A;  3F3Q A;  4FXY P;  4DSQ A;  1S4B P;  4CDO A;  4GCI A;  1NHO A;  1K0B A;  1TXX A;  3Q74 A;  1S3A A;  5G31 A;  1GNE A;  2GZZ A;  1OC9 B;  2YJH A;  5HR2 A;  3LYP A;  4NHZ A;  5KN2 A;  2QA2 A;  1A8Y A;  4EO3 A;  5DCG A;  1XBS A;  2HT9 A;  4OD7 A;  2N5A A;  1A2M A;  4K1F A;  3RGB C;  2B7J A;  4AKX B;  3FR3 A;  5B8A A;  1HYU A;  3D6I A;  3VWU A;  3BBY A;  3CMI A;  3ME8 A;  4RUV A;  1Q4J A;  2R5G A;  2ZNM A;  2GVP A;  2DKI A;  2C0E A;  2CAQ A;  1XOB A;  3M9K A;  2OKA A;  1R7H A;  3JCM L;  1T00 A;  1GUH A;  5D9W A;  2VL2 C;  1PL1 A;  2E2G A;  2X8C A;  1ZYE A;  3IRA A;  3TUE A;  2FGX A; 
#chains in the Genus database with same CATH homology
 2HFD A;  1TI3 A;  3L9V A;  1BF5 A;  5A4W A;  3A5I A;  3Q19 A;  3C73 A;  5HQP A;  2V2G A;  4TKY A;  4K5S A;  1WRY A;  1ML6 A;  2E0Q A;  4G01 A;  1YEX A;  3GKK A;  2HSN A;  4XCS A;  3DKS A;  3KJY A;  2JSY A;  1SK0 A;  1OVN A;  4MF7 A;  1R5A A;  5F07 A;  3MDK A;  3EMP A;  2XHF A;  4Z2U A;  1CQG A;  1ZCP A;  3HY2 A;  4CY8 A;  3R3E A;  2VD0 A;  2R0C A;  4JBB A;  2EFE A;  4TXO B;  1FB6 A;  4MDC A;  2XC2 A;  5IIZ A;  3IA1 A;  5JWO B;  1F2E A;  2HI7 A;  3LFL A;  2A2R A;  4BL7 B;  4KA0 A;  1XFL A;  3TJJ A;  2AAW A;  3GSS A;  4YQU A;  2HLS A;  4G0I A;  4MP4 A;  2HSM B;  1WOU A;  4ULX A;  1R26 A;  3D22 A;  1K0A A;  5EY6 A;  2H73 A;  2IPA A;  4J56 E;  4J2F A;  1GSF A;  3VLN A;  2H8L A;  2GT6 A;  2PVO C;  1OE7 A;  1GLQ A;  4HZ2 A;  3DEX A;  5J4U A;  2AUV A;  2YCD A;  1OYJ A;  3FZ4 A;  3VPQ A;  1YZX A;  3UVT A;  2F8A A;  3MWH A;  3LYK A;  2VIM A;  2CAI A;  22GS A;  3GTU A;  3WD6 A;  2C1Y A;  2M72 A;  4I2U A;  1IYI A;  3LXZ A;  5B7C A;  4IHU A;  1TRS A;  2XBQ A;  3F4R A;  2NPB A;  1EOH A;  2VAF A;  2X8G A;  4DSR A;  2ALB A;  4KAE A;  1VF2 A;  1Z6M A;  2LV3 A;  3RHC A;  3EYT A;  5JCU A;  4O5Q A;  3D0Z A;  2IMI A;  2O8V B;  3ZL5 A;  3HVS A;  1SL1 B;  1MTC A;  4V2N A;  5GST A;  3VI5 A;  2M80 A;  1QQ2 A;  4TOP A;  2K8S A;  2H71 A;  2YZU A;  3IXR A;  5D9X A;  5HR3 A;  1ZOF A;  4E8H A;  4XS4 A;  5ECN B;  5IQY A;  1FOH A;  2R3X A;  3ZIT A;  5IMA A;  3FR9 A;  2REM A;  1GTB A;  2YWN A;  3UL3 A;  2GSR A;  1G7O A;  6GSU A;  3TKR A;  1N8J A;  3EE2 A;  1R5P A;  4BWS A;  4MPF A;  2R6K A;  2TIR A;  2YV7 A;  3A3T A;  1BED A;  1U6T A;  4LLR A;  5JCW A;  4K7N A;  2PN8 A;  5IOX A;  1SVO A;  5KOW A;  5DBQ A;  4ML6 A;  3IOS A;  13GS A;  3VWX A;  4CW9 A;  5A4V A;  3EVI A;  1XWG A;  2I4A A;  1G6W A;  5G2Z A;  3TOT A;  3TCO A;  3F3R A;  4L5O A;  4TXV A;  4PNG A;  1DE1 A;  2N5B A;  1F37 A;  2LNT A;  2YWI A;  2V6K A;  4WXT A;  3ED3 A;  2P31 A;  4N10 A;  1OKT A;  2Z9S A;  3BCK A;  5INY A;  5A4U A;  3P2A A;  4G0L A;  2FUG 2;  1N2A A;  3J7Y k;  5KOX A;  4MPG A;  1M9A A;  3FZA A;  4ML1 A;  3M1G A;  4MAB A;  3MIX A;  5B8B A;  2RUE A;  1DE2 A;  3RDW A;  4POL A;  1WP0 A;  3O76 A;  5AIX A;  1BG1 A;  3H4K A;  4K6X A;  5KN3 A;  5J47 A;  4JRR A;  1GSQ A;  1V40 A;  1SK1 A;  4L0U A;  4HJM A;  4WBR D;  2GZP A;  2K6V A;  5H5Q A;  2DJJ A;  2X4A A;  4FYU A;  10GS A;  4GQF A;  2HRK B;  4ID0 A;  1AUC A;  3HZ4 A;  4AJ6 A;  1SL0 B;  2V32 A;  5GZZ B;  3GX8 A;  5CRD A;  3TGZ A;  2PWJ A;  1EWX A;  3QAV A;  2H0H A;  3ISO A;  2FWG A;  1C72 A;  2AYT A;  2FCH A;  2LJA A;  2I81 A;  4PNF A;  2WUL A;  4HJ2 A;  1GSD A;  4NXI A;  1OC3 A;  5GSS A;  1EV9 A;  3APO A;  1BQ7 A;  3E9J B;  3ME7 A;  5ECS A;  2MMA A;  2AHE A;  4IP1 A;  3GUS A;  5BMU A;  3RPN A;  5CAX A;  2FWE A;  1WIK A;  1EP7 A;  3H1N A;  1VF4 A;  4YAP A;  4CHS A;  4RQX A;  1Y25 A;  2C3N A;  2VLT A;  3TKS C;  3P7X A;  4NHW A;  3KD0 A;  5A5H A;  2VUP A;  3IHQ A;  3LEF A;  3EMX A;  1YY7 A;  1BAY A;  2H75 A;  3ZLP A;  3P90 A;  3G7J A;  3F6D A;  1OAZ A;  4JE1 A;  5A34 A;  1WMJ A;  6GSW A;  2JAC A;  4EUY A;  4O5R A;  5J40 A;  3ZVJ A;  1TRV A;  2C0G A;  2O7K A;  1NSW A;  4TN8 A;  2VM1 A;  3EUR A;  5DJL A;  4MNN A;  1XPV A;  4QMK A;  1LU4 A;  3LWA A;  1XVQ A;  2LJR A;  2IMF A;  4AI6 A;  2OAD A;  3SBC A;  1CQH A;  4IJI A;  5DAL B;  3HJO A;  1ZMA A;  3N5O A;  2B5E A;  7GSS A;  2RM5 A;  3S9F A;  1K3Y A;  3O6T A;  4GTU A;  2LQO A;  4K2X A;  3CYN A;  3US3 A;  5ECK B;  1T4Z A;  2PVQ A;  5CRH A;  6GST A;  4PGT A;  1SYR A;  3GUR A;  1GTA A;  4AGS A;  3ZIJ A;  4PQH A;  5ID2 B;  2VCT A;  1RQM A;  4XIH A;  3IR4 A;  1PKW A;  3VPT A;  5FHI A;  5B6N A;  1T7P B;  2VO4 A;  5E59 A;  2IFQ B;  3VWW A;  5DAK A;  2C0D A;  3NOF A;  3ZVJ D;  1GLP A;  3HA9 A;  2JSZ A;  2NTO A;  4GDF A;  2L57 A;  3QOU A;  3LXT A;  1OE8 A;  2H01 A;  1Z3E A;  3WYW A;  1FAA A;  3KIJ A;  4MH3 A;  4ZIJ A;  3LW9 A;  1TRU A;  4GSS A;  1RW1 A;  2DML A;  4N3Z A;  2XPD A;  2H0G A;  3WGD A;  2V1M A;  5ELG A;  2FA4 A;  5G1L A;  3WT1 A;  4DSS B;  5IMF A;  3GIX A;  5IMZ A;  4WR5 A;  3KP8 A;  5ABR A;  4NV2 A;  1T4Y A;  1ZL9 A;  4BVY A;  1M7T A;  4O7H A;  4ZB7 A;  1DUG A;  3ZTL A;  1TK5 B;  4EDY A;  2I3Y A;  2C80 A;  4GF0 A;  3R2Q A;  1AW9 A;  1I9D A;  9GSS A;  3I69 A;  4PUA A;  4WBJ A;  3TDG A;  3ZFL A;  3L0H A;  3KXO A;  2WZ9 A;  3PPU A;  1ABA A;  2B5X A;  3APQ A;  4ZXG A;  5CO3 A;  3UEM A;  3ZZX A;  5HR0 A;  1PSQ A;  4PQ1 A;  1Y1U A;  3IK9 A;  1U88 A;  1UVZ A;  1ST9 A;  5G1K A;  4MF5 A;  2H76 A;  2QGV A;  3GYK A;  1YJ6 A;  2R4V A;  1A24 A;  1O81 A;  1XWC A;  3GL3 A;  1Z9H A;  4KDU A;  4USS A;  3CWG A;  2OE3 A;  2RM6 A;  5HFI A;  5DVB A;  3TRX A;  2B3S A;  3A2X A;  4ECC A;  2HE3 A;  1VF1 A;  4GQC A;  4DVC A;  3U5R E;  4MK3 A;  4MZC A;  1SKW B;  3ZIV A;  3QAG A;  2HQT A;  1O6J A;  4LL4 B;  1R4W A;  2YAN A;  4OCE A;  4ACS A;  1A0R P;  1PX6 A;  2H6Z A;  4HU7 A;  1USB A;  1PD2 1;  3DYR A;  3M9J A;  5HFG A;  3CTG A;  4F0B A;  2FNO A;  5ECH B;  2WGR A;  3EU3 A;  3KMN A;  2WRT A;  3UBL A;  1PL2 A;  1SU9 A;  4EIQ A;  2YOI A;  1AQV A;  1AXD A;  3DGQ A;  5A1N B;  2VD1 A;  5J9B A;  4EIP A;  3L78 A;  5D93 A;  4ICY A;  3BJ5 A;  1JLV A;  2L6D A;  4W66 A;  3HXS A;  4ISD A;  4HDE A;  1OC9 A;  1FO5 A;  2OAC A;  1HNC A;  3HCZ A;  4PQI A;  4KSO A;  3RAZ A;  2VCW A;  3KH9 A;  11GS A;  1TP9 A;  4TR1 B;  3GMF A;  3IPZ A;  2B6M A;  2BTO T;  4A5P A;  3DD3 A;  4XTS A;  4V2L A;  1B8X A;  3ERW A;  5D9V A;  2PGT A;  1JLW A;  1V9W A;  2R2J A;  4GST A;  1MD4 A;  1JZR A;  4I5Q A;  2EIR A;  1YEP A;  4Q5N A;  1URM A;  1JZO A;  3UOM A;  4D73 A;  3M3M A;  1QMV A;  2OE1 A;  2YV9 A;  2KOK A;  5DCH A;  3KGK A;  1TI1 A;  2GS3 A;  1K0C A;  2YP6 A;  1F3A A;  3KMO A;  3I43 A;  4IW9 A;  2GSQ A;  4G2E A;  5H5R A;  1GSU A;  3UJ1 A;  4OO4 A;  1M9B A;  1KTE A;  1JZD A;  1TU8 A;  2FA8 A;  3PGT A;  3D21 A;  3GRX A;  1HNB A;  3C1S A;  1ERW A;  1GWC A;  4IJ3 A;  2GST A;  1XIY A;  2C0F A;  4NWY A;  4HEA 2;  2JAD A;  3V1W A;  4TXO A;  2ES7 A;  2OT3 A;  2DLX A;  3L9S A;  4MF6 A;  4BL7 A;  3AY8 A;  3GV1 A;  4AKH A;  3VFI A;  4PXO A;  1PQN A;  2LS5 A;  2CT6 A;  1VF3 A;  2MMN A;  3GH9 A;  3M8N A;  1G0T A;  4KCE A;  5BRT A;  2TRX A;  2A2S A;  3GH6 A;  5AN1 A;  5DQY A;  1B9Y C;  3W6G A;  3TRQ A;  1QXH A;  1H4O A;  2H6X A;  1N25 A;  1PKZ A;  3APS A;  3L9U A;  4GLT A;  6GSY A;  1M2B A;  4MA9 A;  3BOA A;  3UIW A;  1EEJ A;  17GS A;  4LA1 A;  2JL4 A;  4G0K A;  2H74 A;  4O32 A;  4YKG A;  5AIV A;  5J3R A;  3IK7 A;  5IM9 A;  1U3A A;  5IO2 A;  1F9M A;  2P5R A;  3H79 A;  2H30 A;  4LL1 B;  1A0F A;  2HZE B;  1YKA A;  3QCP A;  4F2I A;  2AJQ B;  1F6M C;  2VCV A;  1SJZ A;  1XCC A;  4LMW A;  6GSS A;  3VWV A;  2K9F A;  2L59 A;  1YF1 A;  4KND A;  5B6M A;  2PU9 C;  2HYX A;  2IL3 A;  1GRX A;  4X4J A;  2IMD A;  6GSX A;  1E6B A;  3FYG A;  1K3L A;  1SKS B;  4FYC A;  1V2A A;  4KE3 A;  2H66 A;  2OA7 A;  2WS2 A;  3GX0 A;  1V98 A;  1AC1 A;  2YJ7 A;  3QPM A;  3P8W A;  1M0U A;  5ECO B;  3C8E A;  1FB0 A;  3U6V A;  2OBI A;  1TU7 A;  1YDK A;  1W89 A;  1VRS D;  4AKG A;  2IMK A;  4F0C A;  2L5L A;  3Q6O A;  2K18 A;  2AV4 A;  2CVB A;  3G9B A;  1GUM A;  2D2Z A;  1X9S B;  3OR5 A;  4MMM A;  4N0Z A;  5ECQ B;  5J41 A;  2H70 A;  3DVW A;  6GSV A;  4HZ4 A;  16GS A;  4WR4 A;  3ZRE A;  4POM A;  4AF2 A;  2VLU A;  4MH2 A;  2TRC P;  3FY7 A;  5COH A;  1M2A A;  2QA1 A;  1YKC A;  4IEL A;  2H72 A;  5JWR B;  1DSB A;  1ZYQ B;  3CSH A;  1PA3 A;  3EC3 A;  3F63 A;  1W4V A;  3SWL A;  3WGX A;  2HRA A;  1GSY A;  2MYG A;  4HI7 A;  4E8E A;  2X49 A;  2LKU A;  4ZL7 A;  3C1R A;  4ZBA A;  2H19 A;  3LOR A;  4KDX A;  4EXJ A;  2EIQ A;  2R0G A;  4MLY A;  2PBJ A;  2VLV A;  3F4T A;  4KW6 A;  4QQ7 A;  2HRK A;  2KP2 A;  4FYB A;  2QKE A;  5DJM A;  3EU4 A;  2E7P A;  3TJK A;  3FW2 A;  3ZFB A;  3GNJ A;  1B9X C;  1Z7R A;  2VCX A;  3UMA A;  3IBH A;  1GUL A;  3DVX A;  3IC8 A;  1SEN A;  4K2D A;  2L6C A;  4ZB9 A;  4KGI A;  5D8I A;  1K0D A;  3GA4 A;  4K0G A;  1U87 A;  2VL2 A;  4O5U A;  2BMX A;  3TJB A;  4MJA A;  3G7I A;  2O89 A;  4FO5 A;  1XW6 A;  2DIZ A;  3CRU A;  4DEJ A;  2R0P A;  2X8H A;  3H8Q A;  3RPP A;  2IWT A;  3GKX A;  2RLI A;  1O7U A;  4K7O A;  1SVM A;  4BVX B;  19GS A;  3LJR A;  1ILO A;  1XW9 A;  1ZYN A;  1G7E A;  1ERT A;  4EL1 A;  2V6O A;  1FVJ A;  14GS A;  5CYY A;  4MCU A;  1SD8 A;  3PH9 A;  4N0V A;  1AIU A;  5ECR B;  4YQV A;  3IAS 2;  2H1D A;  4WF4 A;  2L4C A;  4KX4 A;  3Q18 A;  2CVK A;  4XRA A;  1PMT A;  4YQM A;  2CA8 A;  3TJG A;  1IYH A;  5DQS A;  4IBP A;  2KP1 A;  5C00 A;  1PGT A;  1GP1 A;  1I5G A;  2JU5 A;  3TB2 A;  1G6Y A;  4YAV A;  4WEY A;  3CXG A;  2YNX A;  4BWQ A;  2A4H A;  3VI7 A;  1EZK A;  3D5J A;  2CX4 A;  3CBU A;  2PPT A;  4XS1 A;  4TR3 A;  5ECL B;  3A5W A;  12GS A;  5LD0 A;  5ECI B;  2DJ0 A;  5DAL A;  3HMJ G;  4JR4 A;  1X5E A;  3UAP A;  2YN1 A;  2MZC A;  1UC7 A;  4ZBB A;  4ZB6 A;  1TKD B;  3PIN A;  1GSS A;  4J57 E;  2LEG A;  18GS A;  4PUF C;  2B1L A;  4BPY A;  2DBC A;  2JZR A;  5J9C A;  2HRN A;  1SK2 A;  4Z2R A;  3TKS E;  2F3M A;  1AQX A;  1A2L A;  2QSI A;  4P3Y B;  4HU9 A;  5ID2 A;  3IE3 A;  1M2D A;  4MZW A;  4K8M A;  2G0F A;  4HQS A;  1J0F A;  2CZ2 A;  3MNG A;  2IFQ A;  1B48 A;  2DMM A;  2WCI A;  2FD3 A;  1JZW A;  3TKP A;  4GWR A;  2DJK A;  1DBY A;  5LNK e;  3UVH A;  1UA5 A;  1Z6N A;  5J4V A;  1RK4 A;  1MEK A;  2HSH A;  5F0G A;  2HSN B;  3O3T A;  3LGC A;  1O85 A;  1ERV A;  5CRE A;  1SVL A;  2GZY A;  3KTL A;  3FHK A;  1T8E B;  2MBS A;  3IAM 2;  5E4W A;  2LTK A;  5IMD A;  2G2Q A;  2CQ9 A;  4PX1 A;  4DSS A;  5ELA A;  1LJR A;  5A5K A;  5ECP B;  5G5E A;  1TK0 B;  5HR1 A;  2JZS A;  1V58 A;  3QFB C;  1Y6E A;  3FKF A;  4O92 A;  3KM6 A;  3M0F A;  2WFC A;  2H1L A;  1M99 A;  5L71 A;  2VL3 A;  3FK8 A;  1H75 A;  3HHV A;  3ERF A;  1TK8 B;  3TJF A;  1ZGN A;  3DXB A;  1ZZY A;  5CRG A;  2N5F A;  4KCA A;  1FVK A;  2F51 A;  5D73 A;  3FR6 A;  1MDI A;  1QGV A;  1XWB A;  2AB6 A;  4NAX A;  2KLX A;  1SD9 A;  3W8J A;  5IMC A;  5G30 A;  1PN0 A;  3RHB A;  2DC5 A;  2YZH A;  4D73 B;  1X9W B;  3FMW A;  3BD2 A;  2J9H A;  3VUR A;  2GQM A;  1T3B A;  3HDC A;  4GSN A;  4Z2T A;  3GTU B;  3GST A;  1SJ6 A;  4HQZ A;  2UZ8 A;  2CX3 A;  2C8U A;  3ZYW A;  4I8B A;  4WF5 A;  5JWQ B;  4K9Z A;  3TKQ A;  2IME A;  1EEM A;  1PN9 A;  1JHB A;  4OCF A;  2ZUP A;  3HZ8 A;  2VCQ A;  2I9H A;  2PUK C;  1BJX A;  3D4T A;  1B4Q A;  4IKH A;  1EP8 A;  4CY6 A;  1ACV A;  3CSI A;  2H6Y A;  1TOF A;  2DSA A;  5IOW A;  1EGO A;  1FW1 A;  1T1V A;  1J08 A;  2ON7 A;  4ECB A;  1JFU A;  4F82 A;  1J9B A;  4RI7 A;  4IGJ A;  3HD5 A;  1GNW A;  4XS4 B;  4ZL8 A;  2GGT A;  3QMX A;  1GL8 A;  4EKZ A;  5J5N A;  2P5Q A;  1YF0 A;  4X43 A;  3CSJ A;  1NHY A;  5IO0 A;  3KCM A;  4JZQ A;  2ZCT A;  1XWK A;  1K0M A;  3KZQ A;  2FHE A;  4NV5 A;  2HZF A;  2QC7 A;  2HSY A;  2L4Q A;  1V57 A;  5A1N A;  2J23 A;  4Q5F A;  2PER A;  2LQQ A;  4X1U A;  4V1A p;  1ZYP A;  4IN0 A;  1K0N A;  2YPM A;  4OFM A;  2GQK A;  1OC8 A;  2KUC A;  4V1A g;  4QL9 A;  2PMT A;  2EFC A;  4K5R A;  4V2M A;  1NM3 A;  2MMO A;  2MMZ A;  4GRF A;  3MAK A;  4AJ7 A;  4XS6 A;  4Q5Q A;  3BCI A;  2OE0 A;  4KF9 A;  3EIN A;  4JU5 A;  1WJK A;  1QK8 A;  3QAW A;  3A2W A;  2H0I A;  2X64 A;  2DJ1 A;  2M46 A;  4TR1 A;  3HYP A;  2LRN A;  2VKZ G;  2GDR A;  2ON5 A;  4IVF A;  4TR0 A;  3K8N A;  1OKD A;  1WE0 A;  4WKW A;  1A2J A;  5EVO A;  2RUF A;  1GH2 A;  4X0X A;  3RBT A;  4KUN A;  2K8V A;  2GTU A;  2HSM A;  3H93 A;  5D9T A;  1SL2 B;  1XZO A;  1BG5 A;  3F6F A;  5G5F A;  3KEB A;  3ERG A;  1A23 A;  4JR6 A;  3CTF A;  4HOJ A;  5GAN D;  2FWF A;  4JED A;  2WDU A;  2DIY A;  3PR8 A;  2HNL A;  3TKS A;  2E2M A;  4MJB A;  5GAP D;  3F9U A;  3GN3 A;  4KH7 A;  5ECM B;  4EE0 A;  3DML A;  3LQ7 A;  2VCZ A;  2FLS A;  3ZMK A;  4EDZ A;  2H1B A;  4N30 A;  5C04 A;  4RI6 A;  3TU3 B;  3GKN A;  2O85 A;  1QUW A;  4BA7 A;  2JZT A;  1KNG A;  1TJD A;  4POK A;  1UN2 A;  4ZB8 A;  5IPG A;  2LRC A;  1TRW A;  4H86 A;  3GKM A;  1O73 A;  3GL5 A;  3LSZ A;  1TTZ A;  1O8W A;  4G19 A;  1B4P A;  5F8B A;  4YH2 A;  3GFK A;  1MDJ A;  2HXK A;  2MBT A;  2B5Y A;  2YWM A;  1TW9 A;  4IQA A;  2HRF A;  5AIS A;  5FWG A;  4LMV A;  3UBK A;  2YWO A;  2P0G A;  2C3Q A;  1GTU A;  4ECI A;  2H1A A;  3DWV A;  4FIW A;  4I2T A;  4I97 A;  5BMU B;  1FG4 A;  3EPT A;  1AQW A;  4OO5 A;  8GSS A;  1U3I A;  2V41 A;  2GSS A;  4L8E A;  3FZ5 A;  1BX9 A;  2EC4 A;  4OMV A;  2NDO A;  2LJK A;  1XW5 A;  1GTI A;  1XWA A;  1F3B A;  5AGY A;  2EFH A;  4KB3 A;  3I9V 2;  5ENU A;  2WJU A;  5A5H B;  1SKR B;  2IJY A;  2X99 A;  2DJ2 A;  2GT5 A;  2IIY A;  2O5V A;  2O87 A;  2CVD A;  4L0W A;  4ILF A;  4TVE A;  3C7M A;  3FZ9 A;  5EL8 A;  5FT3 A;  5A34 B;  4PUR A;  1EOG A;  4F03 A;  1K0O A;  3L4N A;  4XRD A;  1MD3 A;  2VOC A;  4KDY A;  4POB A;  3KTB A;  3DRN A;  1XXU A;  3DIE A;  1X9M B;  3IDV A;  5DDL A;  4MJC A;  5D96 A;  1PX7 A;  2C4J A;  4RQR A;  2B7K A;  2HZE A;  3FEU A;  2XPE A;  4L5L A;  1X5C A;  4KSM A;  4TW5 A;  2DKH A;  1HQO A;  5CP1 A;  3QR6 A;  5KN0 A;  1ON4 A;  4OWY A;  4YKF A;  1S3C A;  4XHM A;  1EGR A;  2A4V A;  2LRT A;  3NZN A;  1E2Y A;  2FY6 A;  1XVW A;  1GSE A;  5H5S A;  4K0N A;  4MJE A;  3EWL A;  2IN3 A;  3HKR A;  1Q98 A;  4IP6 A;  2VM2 A;  1GUK A;  1PRX A;  4ZIL A;  3ZML A;  4ZL9 A;  1HNA A;  3E0U A;  2B1K A;  2GQL A;  5DAK B;  1NW2 A;  1KEB A;  2CV4 A;  4Q5R A;  4OFN A;  2OJL A;  1FHE A;  3MYD A;  5F05 A;  3GHA A;  20GS A;  3F0I A;  4NMU A;  1WWJ A;  3C71 A;  1TXU A;  2RII A;  3IV4 A;  5JCG A;  2VL9 A;  2A2P A;  2C3T A;  4N11 A;  3QDN A;  3N9J A;  5IPH A;  1S3D A;  4EVM A;  2KHP A;  3HVV A;  3WT2 A;  2LST A;  2R37 A;  1Z7P A;  4BVY B;  1X0R A;  2CZ3 A;  1YVL A;  1X5D A;  1XOA A;  3QFA C;  3UAR A;  2XBI A;  1MDK A;  3WGE A;  3ZRD A;  1BYE A;  4HUA A;  4TR4 A;  5J4Y A;  3KP9 A;  3MSZ A;  3D4M A;  3F4S A;  4K7I A;  3I6A A;  4HS1 A;  1YQ1 A;  2H1G A;  1AAZ A;  2LUS A;  4IS0 A;  4I6X A;  2I1U A;  5F06 A;  2UV8 G;  4F9Z A;  4PTS A;  5HFK A;  1O8X A;  2LNS A;  3E3E A;  3KH7 A;  3LG6 A;  4OFT A;  3HJP A;  1TDI A;  2BJX A;  2F8F A;  4G9H A;  1THX A;  1EV4 A;  3VK9 A;  5LCZ A;  3IHG A;  3NIV A;  3J7Y b;  3G7Y A;  2NVL A;  1Z5Y E;  1LBK A;  5KEJ A;  5KN1 A;  3QD9 A;  1THO A;  2GLR A;  1WPI A;  1K3O A;  4AJ8 A;  4MZB A;  4E68 A;  2WB9 A;  3HJM A;  3FRC A;  1A8L A;  1KBN A;  3HVX A;  4IQ1 A;  4FH8 A;  3CRT A;  2L5O A;  5EPF A;  2EFD A;  2NBS A;  4AKI A;  2DJ3 A;  4EF0 A;  2FWH A;  4WET A;  4NPB A;  4EC0 A;  1QFN A;  4ZBD A;  4GXZ A;  2EIO A;  4ECJ A;  1FOV A;  4FQU A;  2OBK A;  5CNW A;  1SJI A;  4TRX A;  4BVX A;  1HD2 A;  4G10 A;  3TRP A;  5IMV A;  5CRW A;  1SYX A;  1ERU A;  3A2V A;  3TOU A;  4Z7X A;  4QL7 A;  1VGL A;  2F9S A;  3IC4 A;  3W8S A;  3F8U A;  3F3Q A;  4DSQ A;  4CDO A;  4GCI A;  1NHO A;  1K0B A;  1TXX A;  3Q74 A;  1S3A A;  5G31 A;  1GNE A;  2GZZ A;  1OC9 B;  2YJH A;  5HR2 A;  3LYP A;  4NHZ A;  5KN2 A;  2QA2 A;  1A8Y A;  4EO3 A;  5DCG A;  1XBS A;  2HT9 A;  4OD7 A;  2N5A A;  1A2M A;  4K1F A;  2B7J A;  4AKX B;  3FR3 A;  5B8A A;  1HYU A;  3D6I A;  3VWU A;  3BBY A;  3CMI A;  3ME8 A;  4RUV A;  1Q4J A;  2R5G A;  2ZNM A;  2GVP A;  2DKI A;  2C0E A;  2CAQ A;  1XOB A;  3M9K A;  2OKA A;  1R7H A;  3JCM L;  1T00 A;  1GUH A;  5D9W A;  2VL2 C;  1PL1 A;  2E2G A;  2X8C A;  1ZYE A;  3IRA A;  3TUE A;  2FGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...