1GULA

Human glutathione transferase a4-4 complex with iodobenzyl glutathione
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
217
structure length
217
Chain Sequence
RPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE A4-4
publication title Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gulA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gulA01
5F06A 3GKXA 1O8XA 2YP6A 2AV4A 2H1DA 2LTKA 2REMA 3VFIA 4X1UA 3HDCA 1F37A 2K18A 4MF7A 3AY8A 4NXIA 1H75A 4NWYA 1GTAA 1TI3A 1QXHA 5BMUA 3ME7A 4HZ4A 2F51A 4PQIA 3RBTA 5JCGA 1ZMAA 5ECMB 3VK9A 2P31A 5ECNB 1QUWA 1RK4A 5IOXA 4GSNA 4IBPA 4HJ2A 2BJXA 1G7EA 2CX4A 2LNSA 2MMZA 1OKDA 3FHKA 2YCDA 1VF1A 4G0KA 3IC8A 4O92A 2QKEA 5IM9A 2V6OA 4L5LA 4O5RA 5JWOB 3FR3A 5C04A 5JCWA 4MJEA 1K3LA 1OKTA 5G1LA 5FHIA 1F3BA 4OMVA 1TTZA 1YJ6A 3EE2A 1GP1A 1XIYA 1SL0B 1M9AA 3QAGA 3V1WA 1U87A 2NVLA 3O76A 1SJZA 5AGYA 2FUG2 4HQZA 2HSYA 1MDIA 2P5QA 4EDZA 3HJMA 1V40A 4ZL9A 4TKYA 4YH2A 5A5KA 1QK8A 4OFNA 3L0HA 1KEBA 1ST9A 3GV1A 1KTEA 2N5FA 4ZB9A 1WWJA 3QFAC 5HR3A 4PGTA 3SBCA 4KNDA 5ENUA 4LL4B 2J23A 1K0MA 4ZXGA 10GSA 2H74A 3N9JA 2WB9A 1EOHA 5EVOA 2GZYA 4MPFA 3UVTA 1DE1A 2AUVA 3RPNA 3I43A 4ZILA 3L9SA 5ECKB 5IMDA 1FO5A 4QL9A 4POBA 2NTOA 2L59A 4N0ZA 3FR6A 5EY6A 2H70A 4ZBAA 4IN0A 5CRHA 4X0XA 3EVIA 1M2BA 5AISA 3GURA 4KCEA 2GGTA 5ELAA 1DSBA 1N2AA 2GSTA 3FZ4A 1GRXA 4IKHA 2VD0A 2FGXA 3OR5A 2NDOA 1AQWA 2HNLA 1XCCA 4KSMA 1O85A 1KBNA 1VF4A 3TRXA 1HNBA 7GSSA 1JFUA 3I9V2 2X8GA 4K0NA 1SKWB 1GUMA 4HEA2 3W8JA 13GSA 4EE0A 1YEXA 4BA7A 1XBSA 3UVHA 1V57A 4AJ7A 1BEDA 2DSAA 3VPTA 1OVNA 2WGRA 1EGRA 1FAAA 3HA9A 4ECJA 1G7OA 4F2IA 4NHWA 3GSTA 3TJFA 4HS1A 1PN9A 2WJUA 2JL4A 1F9MA 1HD2A 2GQLA 2M46A 2VL9A 1E2YA 2DJKA 2IMEA 2YV7A 5JWQB 2LRNA 4PQ1A 4ECBA 3EMXA 1X5DA 4XIHA 1SK2A 2DC5A 1EEJA 3ZTLA 1K3OA 3DYRA 3DKSA 5FWGA 2FLSA 3TRPA 1NSWA 3EU4A 4KF9A 1SD8A 4LMWA 1V98A 3HY2A 1OE7A 1XXUA 3I6AA 4MK3A 2EC4A 4KDUA 1M9BA 5G2ZA 3ZRDA 3TUEA 2HRFA 1EZKA 2A2RA 4I5QA 5J9CA 4Q5QA 2L57A 3UIWA 2RUFA 3LGCA 4G10A 4KDYA 4HU7A 4WBJA 2HXKA 3TKSA 4BVXB 1VF3A 1U88A 2WCIA 4RUVA 2MBTA 2KOKA 1ERWA 4DSRA 5DCGA 5E59A 19GSA 3E3EA 2VCWA 5H5SA 4JR6A 2H6ZA 5D8IA 1YZXA 1HQOA 2HRNA 1NHYA 4EC0A 1ZYQB 4BVXA 2IPAA 3L4NA 2XBQA 16GSA 3C8EA 4FQUA 3ZREA 1M2AA 1OE8A 2AYTA 2GT5A 2C0DA 4KUNA 3HJOA 1SD9A 4KA0A 1OAZA 1PMTA 2OE3A 1SL2B 2VCZA 3KH7A 3NOFA 2C0EA 3TJGA 3E9JB 3ME8A 3KMOA 2LV3A 2C3QA 2C0FA 2YWNA 2X99A 5KEJA 1T8EB 2XPDA 1J08A 1RW1A 4IS0A 5F05A 1IYHA 3A3TA 5A4UA 1E6BA 2TIRA 2NBSA 2HZEB 3DWVA 2CVBA 2JZTA 1SYXA 2M72A 2KLXA 3UBLA 5ABRA 1VF2A 2H1BA 3F4SA 1EEMA 2IMKA 4GCIA 4ACSA 3F6FA 1PKZA 2A4VA 5GZZB 4MH3A 1GTBA 1LJRA 1GWCA 2BMXA 2CVKA 5B7CA 3M9JA 5CRWA 4D73B 3FK8A 4OFTA 2YANA 1PX7A 4MCUA 4DEJA 1I5GA 4TR0A 2HFDA 2HZEA 3C71A 3IC4A 1O8WA 4FIWA 4V1Ap 2OBKA 5ECQB 2L6CA 4K7IA 4IJ3A 2LJRA 1T4YA 4G19A 3IBHA 4BWQA 1FB6A 1Q4JA 2LUSA 2KUCA 1MTCA 1TDIA 4ZL8A 4D73A 3ZITA 2LJKA 1Z7RA 2DJ2A 1FB0A 3VLNA 2XHFA 3GH9A 5ECLB 2VL2A 4PX1A 2V32A 2KP2A 5D9VA 2HZFA 3H93A 1AUCA 2FWGA 3FZAA 2GZZA 3P7XA 3SWLA 3J7Yk 1X9WB 3TB2A 4WETA 1R7HA 2KHPA 4K2DA 1FW1A 2RM5A 12GSA 1XWKA 2B5XA 4V1Ag 3LYKA 11GSA 5IMVA 3CSHA 2B7JA 3WGEA 3GL5A 3DXBA 1LU4A 2YJ7A 3PGTA 1M99A 2H71A 4FYCA 4FO5A 3KGKA 1DUGA 3MSZA 1AQVA 2HE3A 2LS5A 3GRXA 1SL1B 4ISDA 4G9HA 2LQOA 4E8EA 1Z6MA 2FY6A 1WRYA 1ZL9A 5CO3A 2VLTA 1UVZA 3RHBA 2QSIA 5ECHB 2X8CA 1T00A 4JR4A 4E8HA 3ZZXA 1G0TA 3EC3A 3DVXA 2HSMB 2WFCA 3TJBA 5CNWA 1XVWA 1A0FA 2NPBA 4KE3A 3CBUA 1X9MB 1NW2A 3KZQA 4OFMA 2FHEA 4YAVA 3WD6A 3DEXA 2C1YA 2LRTA 1SKSB 2K8VA 4TVEA 1S3CA 5D73A 1TP9A 3W8SA 2OA7A 1B9YC 3G9BA 2HSMA 4NV2A 1XPVA 2CQ9A 4TN8A 1U6TA 4RI6A 3APOA 1IYIA 3CSJA 4Q5FA 4MZWA 4ECIA 2L4CA 4L0UA 3S9FA 1LBKA 4USSA 2DIYA 1F3AA 1Z6NA 3QFBC 4WF5A 3I69A 1O81A 5DVBA 5D9WA 5DBQA 4CW9A 3FKFA 1PKWA 1KNGA 3O6TA 2IMIA 2OKAA 4TR3A 1ACVA 3BOAA 1EV9A 2LJAA 4ML6A 1X5EA 2YWOA 3TKSC 1TW9A 2FWFA 4HU9A 1GNWA 5ECIB 4WR5A 1K0AA 5DAKB 3KP9A 1GLQA 1GSQA 3BD2A 2YWMA 2H75A 2OACA 5B6NA 2X8HA 3ERWA 2VIMA 4GSTA 5DDLA 4POLA 1TRSA 2YPMA 6GSXA 3KCMA 5F0GA 2O85A 1MD3A 3D5JA 1S3DA 4POKA 5DAKA 4XHMA 5C00A 1PRXA 1MD4A 4JEDA 2I81A 1BQ7A 3U6VA 3RPPA 1F2EA 2AB6A 2A2SA 3WYWA 3FZ5A 1XW5A 3TJKA 1OC8A 3EU3A 3HJPA 4XTSA 3K8NA 2P5RA 4GQFA 3DRNA 4PNGA 3F3RA 3JCML 1K0OA 3Q6OA 2HRKB 2CA8A 4FYBA 2HRAA 3IR4A 2OE0A 3GUSA 3D4MA 2FCHA 3ZFBA 2VCTA 3APSA 5ECPB 2TRXA 1A2JA 1XFLA 1SJ6A 2CV4A 2C8UA 2CZ3A 4OO5A 5G30A 4PURA 2C4JA 2DJ0A 1Z3EA 1YF1A 1ZGNA 2ALBA 2HRKA 3DIEA 5CRDA 1ERTA 1AIUA 4I2UA 2HLSA 1T3BA 1UA5A 3U5RE 2H01A 2E2GA 1YY7A 2YWIA 3RAZA 1GUHA 5ELGA 3TGZA 5H5RA 4K1FA 3GL3A 4MP4A 3TOTA 2FA8A 3VPQA 3WT2A 2WS2A 3FY7A 5JCUA 4N10A 4ZB8A 2MZCA 5J4UA 3CRTA 2L5OA 4AGSA 3M9KA 2C0GA 5IOWA 4PQHA 4K7NA 2E2MA 3ISOA 4G0LA 3HVVA 4DSQA 3QCPA 4RQXA 1A23A 2VL2C 3ERGA 6GSWA 1NHOA 3LQ7A 4H86A 1TRVA 1XZOA 3J7Yb 2B1LA 5HR2A 1H4OA 2GZPA 2B6MA 3ZVJA 1TK8B 4PTSA 2GSSA 4GSSA 2AAWA 1R5PA 3QAVA 5COHA 1XWGA 2B1KA 1BAYA 3L9VA 2X64A 3TKPA 1WOUA 4AF2A 1ML6A 4I97A 5ECOB 1BX9A 3F8UA 1FVKA 3G7IA 2ON5A 3R3EA 6GSYA 1GNEA 2F3MA 2GDRA 4WR4A 1SENA 3TDGA 1QQ2A 2CVDA 4IW9A 5B6MA 2HI7A 5ECSA 4HDEA 2RUEA 4JE1A 4N30A 2B5YA 1FHEA 2HYXA 4TXOB 1B48A 3ZMLA 4EKZA 3HVXA 2H0HA 3LWAA 2V41A 3F4RA 5A4VA 4ZBBA 5H5QA 1AQXA 5IPHA 4IP1A 4XRDA 1SK0A 2VO4A 1XVQA 2ES7A 3A5WA 4IQAA 3PH9A 4MMMA 4V2NA 1X9SB 1EV4A 1GLPA 3IPZA 4TXOA 4L5OA 1A2MA 4PNFA 5HR1A 5CP1A 1PGTA 2BTOT 2E0QA 3GA4A 5D96A 1GL8A 4YAPA 4J2FA 1O73A 4X43A 2DIZA 3BCIA 3O3TA 2R37A 3M1GA 3E0UA 1GH2A 2R3XA 2IMFA 4F0CA 2VL3A 5FT3A 2YZHA 3BJ5A 4MZCA 4EVMA 4POMA 2PMTA 3LG6A 3IV4A 4KH7A 3IOSA 4P3YB 1PQNA 3CTGA 3HXSA 4GRFA 3EMPA 3PPUA 1PA3A 1Y6EA 1YF0A 3RDWA 1JZRA 1O7UA 3VWVA 4MJCA 3QD9A 2VM1A 4OO4A 2H6YA 4QQ7A 22GSA 3TKSE 5J3RA 2VOCA 2GQKA 5GAPD 1TXXA 3G7YA 4Q5RA 5DALB 2LEGA 4FYUA 4N0VA 3QOUA 5HFGA 1HNAA 4RI7A 2B3SA 1SKRB 3MWHA 2GSRA 2MBSA 3GN3A 1MDJA 2K6VA 3L78A 2H6XA 1AC1A 5HFIA 1EP7A 1XWCA 3GTUB 3EURA 4HJMA 3KIJA 2O89A 1OC9B 5DALA 2R4VA 4QL7A 3C1SA 4O32A 2O8VB 2JSYA 2LSTA 2PVQA 5AIVA 1DE2A 3ED3A 4KAEA 4K7OA 4MA9A 3TKRA 6GSTA 2DBCA 5L71A 3D6IA 4WBRD 1YDKA 2ON7A 2VUPA 3BCKA 4DSSB 1B8XA 1N8JA 1JLVA 3ZYWA 3GTUA 4NHZA 5DJLA 3MNGA 4Q5NA 2J9HA 1A8LA 4XRAA 1OC9A 3HCZA 3HD5A 3UARA 1WIKA 3WGXA 5IMZA 1B9XC 2DMLA 1V2AA 2EIQA 5ECRB 4TR4A 4V2LA 3ZVJD 5IMCA 1J0FA 4YQVA 4PUAA 2YZUA 2H73A 4BL7B 3GNJA 5CAXA 5LNKe 4DSSA 2F9SA 1TOFA 2OBIA 3HHVA 3IAS2 3P8WA 4GWRA 4F82A 1THXA 1R5AA 5LD0A 2EIRA 1ERUA 2L6DA 2ZCTA 2PU9C 3GFKA 3W6GA 2D2ZA 2CZ2A 4YQMA 5G5EA 2WRTA 5F07A 3GYKA 3VWWA 3QR6A 4XS1A 2YNXA 4BL7A 3IRAA 2R6KA 5GSTA 2I3YA 2GS3A 1B4PA 2JZRA 2F8AA 3QAWA 2VCXA 4GQCA 4F0BA 3H8QA 3TJJA 4JZQA 1JHBA 3P90A 1ZCPA 2H8LA 3FZ9A 4LL1B 2I1UA 2PN8A 4K6XA 2G2QA 2LNTA 3EWLA 4TRXA 5EL8A 3UL3A 2FNOA 2OJLA 2H76A 1V9WA 2H30A 5IO2A 4ZBDA 6GSVA 3TRQA 2L4QA 4AJ8A 2H0IA 2JZSA 1W4VA 1GTIA 4RQRA 3ZL5A 1GSFA 4XS6A 1OYJA 4Z7XA 2EIOA 1XWAA 5INYA 3GMFA 3LXTA 4TW5A 3LXZA 1CQHA 1THOA 5DQSA 5CREA 1HNCA 2RIIA 1GSSA 4XCSA 2HQTA 3D0ZA 3DVWA 1FG4A 3IE3A 5EPFA 3ERFA 3A2XA 2I9HA 1PD21 1C72A 2HSHA 2JADA 1A0RP 4WXTA 1T1VA 2H1GA 3IDVA 4MF6A 3KEBA 5IIZA 3QPMA 1AXDA 2TRCP 1BJXA 1USBA 2B7KA 2JU5A 4GTUA 2RM6A 4LMVA 1EOGA 3ZFLA 5CRGA 2H1AA 2IIYA 4BWSA 4ML1A 1Y25A 3KXOA 2JACA 1K0BA 2IN3A 2IL3A 2FA4A 3UAPA 3QDNA 1G6WA 3LSZA 2CAQA 5J9BA 1HYUA 3VI5A 1R26A 2ZNMA 2OADA 5IQYA 4JBBA 5JWRB 2H66A 1VGLA 3HKRA 2XPEA 3D22A 4MH2A 3LFLA 1TK0B 1XOAA 2CT6A 5DCHA 5B8AA 1K0CA 2DJ3A 5E4WA 4KX4A 4CDOA 3ZIJA 3BBYA 4HUAA 2VLUA 5CYYA 4F03A 3ZIVA 5LCZA 1TU7A 4ILFA 1ZYEA 2IWTA 3UOMA 3CYNA 1SK1A 5A4WA 5KN1A 2PERA 3DMLA 1A2LA 4OWYA 4GXZA 2IFQB 4EF0A 2F8FA 2GSQA 17GSA 4EDYA 6GSUA 1TI1A 4K8MA 2YJHA 2N5BA 1TKDB 5AIXA 4KB3A 1BG5A 2PUKC 2MMNA 4OCFA 5HQPA 1AAZA 2V6KA 4JRRA 2I4AA 5KN2A 1GUKA 2VM2A 4ULXA 4ZIJA 1M0UA 4TXVA 1FOVA 3LJRA 3HYPA 2IFQA 4HZ2A 1RQMA 1TJDA 1Z9HA 2FWEA 5AN1A 2GT6A 3G7JA 2HT9A 1PSQA 4FH8A 3CSIA 3Q19A 3VURA 2K9FA 2PVOC 14GSA 2FD3A 1WP0A 4KCAA 3FW2A 1PX6A 3GX0A 1PL1A 3F63A 4AJ6A 3HZ8A 2AJQB 3CRUA 5GAND 3FR9A 3PR8A 3C1RA 4BVYB 3ZMKA 5G1KA 3RHCA 4I2TA 2B5EA 3LORA 1AW9A 1GSDA 4TR1B 1JLWA 5DQYA 2MYGA 3KD0A 4XS4B 2IJYA 2VLVA 4HI7A 4KSOA 2C3NA 3GH6A 1ZOFA 4BPYA 3D4TA 4N11A 1NM3A 4EL1A 2O87A 3UEMA 3UMAA 4BVYA 4J56E 4PUFC 1R4WA 3CTFA 3R2QA 1Z7PA 1XW6A 3VWUA 3APQA 2LQQA 4TR1A 2K8SA 3KMNA 3M0FA 3Q18A 3M8NA 4IJIA 4ZB6A 5J41A 4XS4A 1K0NA 3PINA 3LYPA 4F9ZA 4IHUA 5ID2B 3TKQA 4MABA 3GKMA 2VCQA 2R2JA 1YKCA 2C80A 3F6DA 4LA1A 1TRUA 1X0RA 1ILOA 3DGQA 1CQGA 1M7TA 2H19A 3A2VA 2AHEA 3KP8A 1F6MC 3H1NA 3NIVA 3US3A 1M2DA 3TOUA 3GX8A 4J57E 1EGOA 3F4TA 2V2GA 3DD3A 1UC7A 1WPIA 2V1MA 4DVCA 5ID2A 9GSSA 2IMDA 4L0WA 2VCVA 1B4QA 1V58A 2P0GA 1VRSD 3MDKA 3D21A 5D9TA 2CAIA 2KP1A 2DMMA 1QMVA 1X5CA 1YKAA 2WDUA 3C7MA 2M80A 3WGDA 3H79A 1SYRA 4NMUA 3IA1A 1GSEA 4KDXA 3FRCA 4K9ZA 4EXJA 3EINA 1BYEA 3HVSA 2PWJA 3L9UA 4IGJA 2ZUPA 20GSA 4V2MA 3QMXA 2FWHA 3UJ1A 1TU8A 1EP8A 1YEPA 2L5LA 1QGVA 1G6YA 1DBYA 2XBIA 2MMAA 4TOPA 5KN3A 1Z5YE 4MLYA 4I6XA 2GTUA 2R5GA 3F3QA 4WF4A 1YQ1A 1J9BA 1SU9A 4ZL7A 3VI7A 1EWXA 3GIXA 1SJIA 2G0FA 2O7KA 1UN2A 2H0GA 3NZNA 3M3MA 3WT1A 3ZLPA 1FVJA 5IO0A 2DLXA 3EYTA 3IK7A 2MMOA 5B8BA 3KJYA 4EO3A 5D93A 1MEKA 4K0GA 2N5AA 1MDKA 5HFKA 2QC7A 2GLRA 1URMA 2C3TA 4MJAA 1ZZYA 3FEUA 2GQMA 1T7PB 4L8EA 4NV5A 1S3AA 4KGIA 3VWXA 1JZWA 4LLRA 4IQ1A 3IXRA 4JU5A 5KN0A 3IHQA 6GSSA 3MAKA 2YN1A 3Q74A 4HOJA 4WKWA 4IVFA 18GSA 4PXOA 1T4ZA 3UBKA 3A2WA 3CMIA 2PGTA 1A24A 2E7PA 4ECCA 4OCEA 1A8YA 2CX3A 5D9XA 1U3IA 5GSSA 4GF0A 1GULA 1W89A 1O6JA 2YV9A 2UZ8A 1GTUA 1PL2A 5G31A 4ID0A 3GKNA 2GVPA 2H72A 8GSSA 3F9UA 5DJMA 5J5NA 2PPTA 4O7HA 1ABAA 5IMAA 1QFNA 3IK9A 3GHAA 1XW9A 2OE1A 4MF5A 5HR0A 4MPGA 2XC2A 1OC3A 4I8BA 4MDCA 2VD1A 3KTLA 5F8BA 1XWBA 3IAM2 3KH9A 1TRWA 4G2EA 2HSNB 5G5FA 1WMJA 4WEYA 3C73A 3N5OA 2JSZA 2LKUA 1ERVA 2DJJA 4MZBA 5IMFA 4OD7A 2RLIA 2QGVA 3FYGA 4CHSA 3GKKA 1Q98A 3P2AA 3GSSA 2DJ1A 2WZ9A 4EUYA 4GLTA 1K0DA 1JZOA 4IELA 1TK5B 1U3AA 1JZDA 4KW6A 3LEFA 2VAFA 3CXGA 3F0IA 1XOBA 3H4KA 2Z9SA 4MJBA 5IPGA 4IP6A 1I9DA 2YOIA 3HZ4A 4NPBA 1WJKA 2WULA 1ON4A 1GSUA 4HQSA 4NAXA 2PBJA 1GSYA 3KM6A 3TCOA 4YQUA 1K3YA 2LRCA 1WE0A 4G0IA 3KTBA
chains in the Genus database with same CATH superfamily
5F06A 3GKXA 1O8XA 2YP6A 3A5IA 2AV4A 2H1DA 2LTKA 2OT3A 2REMA 3VFIA 4X1UA 3HDCA 1FOHA 1F37A 2K18A 4MF7A 3AY8A 4NXIA 1H75A 4NWYA 1GTAA 1TI3A 1QXHA 5BMUA 3ME7A 4HZ4A 2F51A 4PQIA 3RBTA 5JCGA 1ZMAA 5ECMB 3VK9A 2P31A 5ECNB 1RK4A 5IOXA 4GSNA 4IBPA 4HJ2A 2BJXA 1G7EA 2CX4A 2LNSA 2MMZA 1OKDA 3FHKA 2YCDA 1VF1A 4G0KA 3IC8A 4O92A 2QKEA 5IM9A 2V6OA 4L5LA 4O5RA 5JWOB 3FR3A 5C04A 5JCWA 4MJEA 1K3LA 1OKTA 5G1LA 5FHIA 1F3BA 4OMVA 1TTZA 1YJ6A 3EE2A 1GP1A 1XIYA 1SL0B 1M9AA 3QAGA 3V1WA 1U87A 2NVLA 3O76A 1SJZA 5AGYA 2FUG2 4HQZA 2HSYA 1MDIA 2P5QA 4EDZA 3HJMA 1V40A 4ZL9A 4TKYA 4YH2A 5A5KA 1QK8A 4OFNA 3L0HA 1KEBA 1ST9A 3GV1A 1KTEA 4Z2RA 2N5FA 4ZB9A 1WWJA 5A5HB 3QFAC 5HR3A 4PGTA 3SBCA 4KNDA 5ENUA 4LL4B 2J23A 1K0MA 4ZXGA 10GSA 2H74A 3N9JA 2WB9A 1EOHA 5EVOA 2GZYA 4MPFA 3UVTA 1BG1A 1DE1A 2AUVA 3RPNA 3I43A 4ZILA 4G01A 3L9SA 5ECKB 5IMDA 1FO5A 4QL9A 4POBA 2NTOA 2L59A 4N0ZA 3FR6A 5EY6A 2H70A 5A5HA 4ZBAA 4IN0A 1PN0A 5CRHA 4X0XA 3EVIA 1M2BA 5AISA 1SVOA 3GURA 4KCEA 2GGTA 5ELAA 1DSBA 1N2AA 2GSTA 1S3RA 3FZ4A 1GRXA 4IKHA 2VD0A 2FGXA 3OR5A 2NDOA 1AQWA 2HNLA 1XCCA 4KSMA 1O85A 1KBNA 1VF4A 3TRXA 1HNBA 7GSSA 1JFUA 3I9V2 2X8GA 4K0NA 1SKWB 1GUMA 4HEA2 3W8JA 13GSA 4EE0A 1YEXA 4BA7A 1XBSA 3UVHA 1V57A 4AJ7A 1BEDA 2DSAA 3VPTA 2R0CA 1OVNA 2WGRA 1EGRA 1FAAA 3HA9A 4ECJA 1G7OA 4F2IA 4NHWA 3GSTA 3TJFA 4HS1A 1PN9A 2WJUA 2JL4A 1F9MA 1HD2A 2GQLA 2M46A 2VL9A 1E2YA 2DJKA 2IMEA 2YV7A 5JWQB 2LRNA 4PQ1A 4ECBA 3EMXA 1X5DA 4XIHA 1SK2A 2DC5A 1EEJA 3ZTLA 1K3OA 2QA1A 3DYRA 3DKSA 5FWGA 2FLSA 3TRPA 1NSWA 3EU4A 4KF9A 1SD8A 4LMWA 1V98A 3HY2A 1OE7A 1XXUA 3I6AA 4MK3A 5A34B 1Y1UA 2EC4A 4KDUA 1M9BA 5G2ZA 3ZRDA 3TUEA 2HRFA 1EZKA 2A2RA 4I5QA 5J9CA 4Q5QA 2L57A 3UIWA 2RUFA 3LGCA 4G10A 4KDYA 4HU7A 3MIXA 4WBJA 2HXKA 3TKSA 4BVXB 5J4YA 1VF3A 1U88A 2WCIA 4RUVA 2MBTA 2KOKA 1ERWA 4DSRA 5DCGA 5A34A 5E59A 19GSA 3E3EA 2VCWA 5H5SA 4JR6A 2H6ZA 5D8IA 1YZXA 1HQOA 2HRNA 1NHYA 4EC0A 1ZYQB 4BVXA 4W66A 2IPAA 3L4NA 2XBQA 16GSA 3C8EA 4FQUA 3ZREA 1M2AA 1OE8A 2AYTA 2GT5A 2C0DA 4KUNA 3HJOA 1SD9A 4KA0A 1OAZA 1PMTA 4AKGA 2OE3A 1SL2B 2VCZA 3KH7A 3NOFA 2C0EA 3TJGA 3E9JB 3ME8A 3KMOA 2LV3A 2C3QA 2C0FA 2YWNA 2X99A 4AI6A 5KEJA 1T8EB 2XPDA 1J08A 1RW1A 4IS0A 5F05A 1IYHA 3A3TA 5A4UA 1E6BA 2TIRA 2NBSA 1ZYPA 2HZEB 3DWVA 2CVBA 2JZTA 1SYXA 4AKIA 2M72A 2KLXA 3UBLA 5ABRA 1VF2A 2H1BA 3F4SA 1EEMA 2IMKA 4GCIA 4ACSA 3F6FA 1PKZA 2A4VA 5GZZB 4MH3A 1GTBA 1LJRA 1GWCA 2BMXA 2CVKA 5B7CA 3M9JA 2H1LA 5CRWA 4D73B 3FK8A 4OFTA 2YANA 1PX7A 4MCUA 4DEJA 1I5GA 4TR0A 2HFDA 2HZEA 3C71A 3IC4A 1O8WA 4FIWA 1TXUA 4V1Ap 2OBKA 5ECQB 2L6CA 4K7IA 4IJ3A 2LJRA 1T4YA 4G19A 3IBHA 4ICYA 4BWQA 1FB6A 1Q4JA 2LUSA 2KUCA 2EFEA 1MTCA 1TDIA 4ZL8A 4D73A 3ZITA 2LJKA 1Z7RA 2DJ2A 1FB0A 3VLNA 2XHFA 3GH9A 5ECLB 2VL2A 4PX1A 2V32A 2KP2A 5D9VA 2HZFA 4MNNA 3H93A 1AUCA 2FWGA 3FZAA 2GZZA 3P7XA 3SWLA 3J7Yk 1X9WB 3TB2A 4WETA 1R7HA 2KHPA 4K2DA 1FW1A 2RM5A 12GSA 1XWKA 2B5XA 4V1Ag 3LYKA 11GSA 4X4JA 5IMVA 3CSHA 2B7JA 3WGEA 3GL5A 4BIKA 3DXBA 1LU4A 2YJ7A 3PGTA 1M99A 2H71A 4FYCA 4FO5A 3KGKA 1DUGA 3MSZA 1AQVA 2HE3A 2LS5A 5KOWA 1SVMA 3GRXA 1SL1B 4ISDA 4G9HA 2LQOA 4E8EA 1Z6MA 2FY6A 1WRYA 1YEWC 1ZL9A 5CO3A 2VLTA 1UVZA 3RHBA 2QSIA 5ECHB 2X8CA 1T00A 4JR4A 4E8HA 3ZZXA 1G0TA 3EC3A 3DVXA 2HSMB 2WFCA 3TJBA 5CNWA 1XVWA 1A0FA 2NPBA 4KE3A 3CBUA 1X9MB 1NW2A 3KZQA 4OFMA 2FHEA 4YAVA 3WD6A 3DEXA 2C1YA 2LRTA 1SKSB 2K8VA 2WZSA 4TVEA 1S3CA 5D73A 1TP9A 3W8SA 2OA7A 1B9YC 3G9BA 2HSMA 4NV2A 1XPVA 2CQ9A 4TN8A 1U6TA 4RI6A 3APOA 1IYIA 3CSJA 4Q5FA 4MZWA 2WVYA 4ECIA 2L4CA 4L0UA 3S9FA 2WW1A 1LBKA 4USSA 2DIYA 1F3AA 1Z6NA 3QFBC 4WF5A 3I69A 1O81A 5DVBA 5D9WA 5DBQA 4CW9A 3FKFA 4QMKA 1PKWA 4O5QA 1KNGA 3O6TA 2IMIA 2OKAA 4TR3A 1ACVA 3BOAA 1EV9A 2LJAA 4ML6A 1X5EA 2YWOA 1YVLA 3TKSC 1TW9A 2FWFA 4HU9A 1GNWA 2X4AA 5ECIB 3HMJG 4FXYP 5J4VA 4WR5A 1K0AA 5DAKB 3KP9A 1GLQA 1GSQA 3BD2A 2YWMA 2H75A 2OACA 5B6NA 4PHZC 2X8HA 3ERWA 4HSCX 2VIMA 4GSTA 5DDLA 4POLA 1TRSA 2YPMA 6GSXA 3KCMA 5F0GA 2O85A 1MD3A 3D5JA 1S3DA 4POKA 5DAKA 4XHMA 5C00A 1PRXA 3MYDA 1MD4A 4JEDA 2I81A 1BQ7A 3U6VA 3RPPA 1F2EA 2AB6A 2A2SA 3WYWA 3FZ5A 1XW5A 3TJKA 1OC8A 3EU3A 3HJPA 4XTSA 3K8NA 2P5RA 4GQFA 3DRNA 4PNGA 3F3RA 3JCML 1K0OA 3Q6OA 2HRKB 2CA8A 4FYBA 2HRAA 1N25A 3IR4A 2OE0A 3GUSA 3D4MA 2FCHA 3ZFBA 2VCTA 3APSA 5ECPB 2TRXA 1A2JA 1XFLA 1SJ6A 2CV4A 2C8UA 2CZ3A 4OO5A 4YKFA 5G30A 4PURA 2C4JA 2DJ0A 1Z3EA 1YF1A 1ZGNA 2ALBA 2HRKA 3DIEA 5CRDA 1ERTA 1AIUA 4I2UA 4CY6A 2HLSA 1T3BA 2DKHA 1UA5A 3U5RE 2H01A 2E2GA 1YY7A 2YWIA 3RAZA 1GUHA 5ELGA 3TGZA 3KTBA 5H5RA 4K1FA 3GL3A 4MP4A 3TOTA 2FA8A 3VPQA 3WT2A 2WS2A 3FY7A 5JCUA 4N10A 4ZB8A 2MZCA 5J4UA 3CRTA 4YKGA 2L5OA 4AGSA 3M9KA 2C0GA 5IOWA 4PQHA 4K7NA 2E2MA 3ISOA 4G0LA 2R0PA 3HVVA 4DSQA 3QCPA 4RQXA 1A23A 2VL2C 3ERGA 6GSWA 1NHOA 3LQ7A 4H86A 3RFRC 1TRVA 1XZOA 3J7Yb 2B1LA 5HR2A 1H4OA 2GZPA 2B6MA 3ZVJA 1TK8B 4PTSA 2UV8G 2GSSA 4GSSA 2AAWA 1R5PA 3QAVA 5COHA 1XWGA 2B1KA 1BAYA 3L9VA 2WVZA 2X64A 3TKPA 1WOUA 4AF2A 1ML6A 4I97A 5ECOB 1BX9A 3F8UA 1FVKA 3G7IA 2ON5A 3R3EA 6GSYA 1GNEA 2F3MA 2GDRA 4WR4A 1SENA 1I1IP 3TDGA 1QQ2A 5J47A 2CVDA 4IW9A 5B6MA 2HI7A 5ECSA 4HDEA 2RUEA 2WW3A 4JE1A 4N30A 2B5YA 1FHEA 2HYXA 4TXOB 1B48A 1SVLA 3ZMLA 4EKZA 3HVXA 2H0HA 3LWAA 2V41A 3F4RA 5A4VA 4ZBBA 5H5QA 3CQFA 1AQXA 5IPHA 4IP1A 4XRDA 1SK0A 2VO4A 1XVQA 2ES7A 3A5WA 4IQAA 4ZB7A 3PH9A 4MMMA 4PI2C 2QA2A 4V2NA 1X9SB 1EV4A 1GLPA 3IPZA 4TXOA 4L5OA 1A2MA 4PNFA 5HR1A 5CP1A 1PGTA 2BTOT 2E0QA 2WW0A 3GA4A 5D96A 1GL8A 4YAPA 4J2FA 1O73A 4X43A 2DIZA 3BCIA 3O3TA 2R37A 3M1GA 3E0UA 1GH2A 2R3XA 2IMFA 4F0CA 2VL3A 5FT3A 2YZHA 3BJ5A 4MZCA 4EVMA 4POMA 2PMTA 3LG6A 3IV4A 4KH7A 3IOSA 4P3YB 1PQNA 3CTGA 3HXSA 4GRFA 3EMPA 3PPUA 1PA3A 1Y6EA 1YF0A 3RDWA 1JZRA 1O7UA 3VWVA 4MJCA 3QD9A 2VM1A 4OO4A 2H6YA 4QQ7A 22GSA 3TKSE 5J3RA 2VOCA 2GQKA 5GAPD 1TXXA 3G7YA 4Q5RA 5DALB 2LEGA 4FYUA 4N0VA 2WVXB 2VKZG 3QOUA 5HFGA 1HNAA 4RI7A 2B3SA 1SKRB 3MWHA 2GSRA 2MBSA 3GN3A 5KOXA 1MDJA 2K6VA 4CY8A 3L78A 2H6XA 1AC1A 5HFIA 1EP7A 1XWCA 3GTUB 3EURA 4EIQA 4HJMA 3KIJA 2O89A 1OC9B 5DALA 2R4VA 4QL7A 3C1SA 4O32A 2O8VB 2JSYA 2LSTA 2PVQA 2WVXA 5AIVA 1DE2A 3ED3A 4KAEA 4K7OA 4MA9A 3TKRA 6GSTA 2DBCA 5L71A 3D6IA 4WBRD 1YDKA 2ON7A 2VUPA 3BCKA 4DSSB 1B8XA 1N8JA 1JLVA 3ZYWA 3GTUA 4NHZA 5DJLA 3MNGA 4Q5NA 2J9HA 1A8LA 4XRAA 1OC9A 3HCZA 3HD5A 3UARA 1WIKA 3WGXA 5IMZA 1B9XC 2DMLA 1V2AA 2EIQA 5ECRB 4TR4A 4V2LA 3ZVJD 5IMCA 1J0FA 4YQVA 4PUAA 2YZUA 2H73A 4BL7B 3GNJA 5CAXA 5LNKe 2R0GA 4DSSA 2F9SA 1TOFA 2OBIA 3HHVA 3IAS2 3P8WA 4GWRA 4F82A 1THXA 1R5AA 5LD0A 2A4HA 2EIRA 1ERUA 2L6DA 2ZCTA 2PU9C 3GFKA 3W6GA 2D2ZA 2CZ2A 4YQMA 5J40A 5G5EA 2WRTA 5F07A 3GYKA 3VWWA 3QR6A 4EIPA 4XS1A 2YNXA 4BL7A 3IRAA 2R6KA 5GSTA 2I3YA 2GS3A 1B4PA 2JZRA 2F8AA 3QAWA 2VCXA 4F0BA 4GQCA 3H8QA 3TJJA 4JZQA 1JHBA 3P90A 1ZCPA 2H8LA 3FZ9A 4LL1B 2I1UA 2PN8A 4K6XA 2G2QA 2LNTA 3EWLA 4TRXA 5EL8A 3UL3A 2FNOA 2OJLA 2H76A 1V9WA 2H30A 5IO2A 4ZBDA 6GSVA 3TRQA 2L4QA 4AJ8A 2H0IA 2JZSA 1W4VA 1GTIA 4RQRA 3ZL5A 1GSFA 4XS6A 1OYJA 4Z7XA 2EIOA 1XWAA 5INYA 3GMFA 3LXTA 4TW5A 3LXZA 1CQHA 1THOA 5DQSA 5CREA 1HNCA 2RIIA 1GSSA 4XCSA 2HQTA 3D0ZA 3DVWA 1FG4A 3IE3A 5EPFA 3ERFA 3A2XA 2I9HA 1PD21 1C72A 2HSHA 2JADA 1A0RP 4WXTA 1T1VA 2H1GA 3IDVA 4MF6A 3KEBA 5IIZA 3QPMA 1AXDA 2TRCP 1BJXA 1USBA 2B7KA 2JU5A 4GTUA 2RM6A 4LMVA 1EOGA 1XG8A 3ZFLA 5CRGA 2H1AA 2IIYA 4BWSA 4ML1A 1Y25A 3KXOA 4K5RA 2JACA 1K0BA 2IN3A 2IL3A 2FA4A 3UAPA 3QDNA 1G6WA 3LSZA 2CAQA 4PI0C 5J9BA 1HYUA 4GDFA 3VI5A 1R26A 2ZNMA 2OADA 5IQYA 4JBBA 5JWRB 2H66A 1VGLA 3HVNA 3HKRA 2XPEA 3D22A 4MH2A 3LFLA 1TK0B 1XOAA 2CT6A 5DCHA 5B8AA 1K0CA 2DJ3A 5E4WA 4KX4A 4CDOA 3ZIJA 3BBYA 4HUAA 2VLUA 5CYYA 4F03A 3ZIVA 5LCZA 1TU7A 4ILFA 1ZYEA 2IWTA 3UOMA 3CYNA 1SK1A 4Z2TA 5A4WA 5KN1A 2PERA 3DMLA 1A2LA 4OWYA 4GXZA 2IFQB 4EF0A 2F8FA 2GSQA 17GSA 4EDYA 6GSUA 1TI1A 4K8MA 4N3ZA 2YJHA 2N5BA 1TKDB 5AIXA 4KB3A 1BG5A 2O5VA 2PUKC 2MMNA 4OCFA 5HQPA 1AAZA 2V6KA 4JRRA 2I4AA 5KN2A 1GUKA 2VM2A 1M3IA 4ULXA 2DKIA 4ZIJA 1M0UA 4TXVA 1FOVA 3LJRA 1M3JA 3HYPA 2IFQA 4HZ2A 1RQMA 1TJDA 1Z9HA 2FWEA 5AN1A 2GT6A 3G7JA 2HT9A 1PSQA 4FH8A 3CSIA 3Q19A 3VURA 2K9FA 2PVOC 14GSA 2FD3A 1WP0A 4KCAA 3FW2A 1PX6A 3GX0A 1PL1A 3F63A 3LW9A 3CWGA 4AJ6A 3HZ8A 2AJQB 3CRUA 5GAND 3FR9A 3PR8A 3C1RA 4BVYB 3ZMKA 5G1KA 3RHCA 4I2TA 2B5EA 5A1NB 3LORA 1AW9A 1GSDA 4TR1B 1JLWA 2EFDA 5DQYA 2MYGA 3KD0A 3EPTA 4XS4B 2IJYA 2VLVA 4HI7A 4KSOA 2C3NA 3GH6A 1ZOFA 4BPYA 3D4TA 4N11A 1NM3A 5BRTA 4EL1A 4K5SA 2O87A 3UEMA 3UMAA 4BVYA 4J56E 4PUFC 1R4WA 3CTFA 3R2QA 5A1NA 1Z7PA 1XW6A 3VWUA 3RGBC 3APQA 4E68A 2LQQA 4TR1A 2K8SA 3KMNA 4O5UA 3M0FA 3Q18A 3M8NA 4IJIA 4ZB6A 5J41A 4Z2UA 4XS4A 1K0NA 3PINA 3LYPA 4F9ZA 4IHUA 5ID2B 3TKQA 4MABA 3GKMA 2VCQA 2R2JA 1YKCA 2C80A 3F6DA 4LA1A 1TRUA 4A5PA 1X0RA 2O36A 1ILOA 3DGQA 1CQGA 1M7TA 2H19A 3A2VA 2AHEA 3KP8A 1F6MC 3H1NA 3NIVA 3US3A 1M2DA 3TOUA 3GX8A 4J57E 1EGOA 3F4TA 2V2GA 3DD3A 1UC7A 1WPIA 2V1MA 4DVCA 5ID2A 9GSSA 2IMDA 4L0WA 2VCVA 1B4QA 1V58A 2P0GA 1VRSD 3MDKA 3D21A 5D9TA 4K2XA 2CAIA 2KP1A 2DMMA 1QMVA 1X5CA 1YKAA 2WDUA 3C7MA 2M80A 3WGDA 3H79A 1SYRA 4NMUA 3IA1A 1GSEA 4KDXA 1BF5A 3FRCA 4K9ZA 4EXJA 3EINA 1BYEA 3HVSA 2PWJA 2EFHA 3L9UA 4IGJA 2ZUPA 20GSA 1S4BP 4V2MA 1ZYNA 3QMXA 2FWHA 3UJ1A 1TU8A 1EP8A 1YEPA 4AKHA 2L5LA 1QGVA 1G6YA 1DBYA 2XBIA 2MMAA 4TOPA 5KN3A 1Z5YE 4MLYA 4I6XA 2GTUA 2R5GA 3F3QA 4WF4A 1YQ1A 1J9BA 1SU9A 2X49A 4ZL7A 3VI7A 1EWXA 3GIXA 1SJIA 2G0FA 2O7KA 1UN2A 2H0GA 3NZNA 3M3MA 3WT1A 3ZLPA 2A2PA 1FVJA 5IO0A 2DLXA 3EYTA 3IK7A 2MMOA 2WW2A 5B8BA 3KJYA 4EO3A 5D93A 1MEKA 4K0GA 2N5AA 1MDKA 5HFKA 2QC7A 2GLRA 1URMA 2C3TA 4MJAA 1ZZYA 3FEUA 2GQMA 1T7PB 4L8EA 4NV5A 1S3AA 4KGIA 3VWXA 1JZWA 4LLRA 4IQ1A 3IXRA 4JU5A 5KN0A 3IHQA 6GSSA 3MAKA 2YN1A 3Q74A 4HOJA 4WKWA 4IVFA 18GSA 4PXOA 1T4ZA 3UBKA 3A2WA 3CMIA 2EFCA 2PGTA 1A24A 2E7PA 4ECCA 4OCEA 1A8YA 2CX3A 5D9XA 1U3IA 5GSSA 4GF0A 1GULA 1W89A 1O6JA 2YV9A 2UZ8A 3FMWA 1GTUA 1PL2A 5G31A 4ID0A 3GKNA 3IHGA 2GVPA 2H72A 8GSSA 3F9UA 5DJMA 5J5NA 2PPTA 4O7HA 1PFOA 1ABAA 5IMAA 2O3EA 1QFNA 3IK9A 3GHAA 1XW9A 2OE1A 4MF5A 5HR0A 4MPGA 2XC2A 1OC3A 4I8BA 4MDCA 2VD1A 3KTLA 5F8BA 1XWBA 3IAM2 3KH9A 1TRWA 4G2EA 2HSNB 5G5FA 1WMJA 4WEYA 3C73A 3N5OA 2JSZA 2LKUA 1ERVA 2DJJA 4MZBA 5IMFA 4OD7A 2RLIA 2QGVA 3FYGA 4CHSA 3GKKA 1Q98A 3P2AA 3GSSA 2DJ1A 2WZ9A 4EUYA 4GLTA 1K0DA 1JZOA 4AKXB 2HSNA 4IELA 1TK5B 1U3AA 1JZDA 4KW6A 3CHXC 3LEFA 2VAFA 3CXGA 3F0IA 1XOBA 3H4KA 2Z9SA 4MJBA 5IPGA 1I9DA 4IP6A 2YOIA 3HZ4A 4NPBA 1WJKA 2WULA 1ON4A 1GSUA 4HQSA 4NAXA 2PBJA 1GSYA 3KM6A 3TCOA 4YQUA 1K3YA 3TU3B 2LRCA 5BMUB 1WE0A 4G0IA 1QUWA
chains in the Genus database with same CATH topology
5F06A 3GKXA 1O8XA 2YP6A 3A5IA 2AV4A 2H1DA 2LTKA 2OT3A 2REMA 3VFIA 4X1UA 3HDCA 1FOHA 1F37A 2K18A 4MF7A 3AY8A 4NXIA 1H75A 4NWYA 1GTAA 1TI3A 1QXHA 5BMUA 3ME7A 4HZ4A 2F51A 4PQIA 3RBTA 5JCGA 1ZMAA 5ECMB 3VK9A 2P31A 5ECNB 1QUWA 1RK4A 5IOXA 4GSNA 4IBPA 4HJ2A 2BJXA 1G7EA 2CX4A 2LNSA 2MMZA 1OKDA 3FHKA 2YCDA 1VF1A 4G0KA 3IC8A 4O92A 2QKEA 5IM9A 2V6OA 4L5LA 4O5RA 5JWOB 3FR3A 5C04A 5JCWA 4MJEA 1K3LA 1OKTA 5G1LA 5FHIA 1F3BA 4OMVA 1TTZA 1YJ6A 3EE2A 1GP1A 1XIYA 1SL0B 1M9AA 3QAGA 3V1WA 1U87A 2NVLA 3O76A 1SJZA 5AGYA 2FUG2 4HQZA 2HSYA 1MDIA 2P5QA 4EDZA 3HJMA 1V40A 4ZL9A 4TKYA 4YH2A 5A5KA 1QK8A 4OFNA 3L0HA 1KEBA 1ST9A 3GV1A 1KTEA 4Z2RA 2N5FA 4ZB9A 1WWJA 5A5HB 3QFAC 5HR3A 4PGTA 3SBCA 4KNDA 5ENUA 4LL4B 2J23A 1K0MA 4ZXGA 10GSA 2H74A 3N9JA 2WB9A 1EOHA 5EVOA 2GZYA 4MPFA 3UVTA 1BG1A 1DE1A 2AUVA 3RPNA 3I43A 4ZILA 4G01A 3L9SA 5ECKB 5IMDA 1FO5A 4QL9A 4POBA 2NTOA 2L59A 4N0ZA 3FR6A 5EY6A 2H70A 5A5HA 4ZBAA 4IN0A 1PN0A 5CRHA 4X0XA 3EVIA 1M2BA 5AISA 1SVOA 3GURA 4KCEA 2GGTA 5ELAA 1DSBA 1N2AA 2GSTA 3FZ4A 1GRXA 4IKHA 2VD0A 2FGXA 3OR5A 2NDOA 1AQWA 2HNLA 1XCCA 4KSMA 1O85A 1KBNA 1VF4A 3TRXA 1HNBA 7GSSA 1JFUA 3I9V2 2X8GA 4K0NA 1SKWB 1GUMA 4HEA2 3W8JA 13GSA 4EE0A 1YEXA 4BA7A 1XBSA 3UVHA 1V57A 4AJ7A 1BEDA 2DSAA 3VPTA 2R0CA 1OVNA 2WGRA 1EGRA 1FAAA 3HA9A 4ECJA 1G7OA 4F2IA 4NHWA 3GSTA 3TJFA 4HS1A 1PN9A 2WJUA 2JL4A 1F9MA 1HD2A 2GQLA 2M46A 2VL9A 1E2YA 2DJKA 2IMEA 2YV7A 5JWQB 2LRNA 4PQ1A 4ECBA 3EMXA 1X5DA 4XIHA 1SK2A 2DC5A 1EEJA 3ZTLA 1K3OA 2QA1A 3DYRA 3DKSA 5FWGA 2FLSA 3TRPA 1NSWA 3EU4A 4KF9A 1SD8A 4LMWA 1V98A 3HY2A 1OE7A 1XXUA 3I6AA 4MK3A 5A34B 1Y1UA 2EC4A 4KDUA 1M9BA 5G2ZA 3ZRDA 3TUEA 2HRFA 1EZKA 2A2RA 4I5QA 5J9CA 4Q5QA 2L57A 3UIWA 2RUFA 3LGCA 4G10A 4KDYA 4HU7A 3MIXA 4WBJA 2HXKA 3TKSA 4BVXB 5J4YA 1VF3A 1U88A 2WCIA 4RUVA 2MBTA 2KOKA 1ERWA 4DSRA 5DCGA 5A34A 5E59A 19GSA 3E3EA 2VCWA 5H5SA 4JR6A 2H6ZA 5D8IA 1YZXA 1HQOA 2HRNA 1NHYA 4EC0A 1ZYQB 4BVXA 4W66A 2IPAA 3L4NA 2XBQA 16GSA 3C8EA 4FQUA 3ZREA 1M2AA 1OE8A 2AYTA 2GT5A 2C0DA 4KUNA 3HJOA 1SD9A 4KA0A 1OAZA 1PMTA 4AKGA 2OE3A 1SL2B 2VCZA 3KH7A 3NOFA 2C0EA 3TJGA 3E9JB 3ME8A 3KMOA 2LV3A 2C3QA 2C0FA 2YWNA 2X99A 4AI6A 5KEJA 1T8EB 2XPDA 1J08A 1RW1A 4IS0A 5F05A 1IYHA 3A3TA 5A4UA 1E6BA 2TIRA 2NBSA 1ZYPA 2HZEB 3DWVA 2CVBA 2JZTA 1SYXA 4AKIA 2M72A 2KLXA 3UBLA 5ABRA 1VF2A 2H1BA 3F4SA 1EEMA 2IMKA 4GCIA 4ACSA 3F6FA 1PKZA 2A4VA 5GZZB 4MH3A 1GTBA 1LJRA 1GWCA 2BMXA 2CVKA 5B7CA 3M9JA 2H1LA 5CRWA 4D73B 3FK8A 4OFTA 2YANA 1PX7A 4MCUA 4DEJA 1I5GA 4TR0A 2HFDA 2HZEA 3C71A 3IC4A 1O8WA 4FIWA 1TXUA 4V1Ap 2OBKA 5ECQB 2L6CA 4K7IA 4IJ3A 2LJRA 1T4YA 4G19A 3IBHA 4ICYA 4BWQA 1FB6A 1Q4JA 2LUSA 2KUCA 2EFEA 1MTCA 1TDIA 4ZL8A 4D73A 3ZITA 2LJKA 1Z7RA 2DJ2A 1FB0A 3VLNA 2XHFA 3GH9A 5ECLB 2VL2A 4PX1A 2V32A 2KP2A 5D9VA 2HZFA 4MNNA 3H93A 1AUCA 2FWGA 3FZAA 2GZZA 3P7XA 3SWLA 3J7Yk 1X9WB 3TB2A 4WETA 1R7HA 2KHPA 4K2DA 1FW1A 2RM5A 12GSA 1XWKA 2B5XA 4V1Ag 3LYKA 11GSA 4X4JA 5IMVA 3CSHA 2B7JA 3WGEA 3GL5A 3DXBA 1LU4A 2YJ7A 3PGTA 1M99A 2H71A 4FYCA 4FO5A 3KGKA 1DUGA 3MSZA 1AQVA 2HE3A 2LS5A 5KOWA 1SVMA 3GRXA 1SL1B 4ISDA 4G9HA 2LQOA 4E8EA 1Z6MA 2FY6A 1WRYA 1ZL9A 5CO3A 2VLTA 1UVZA 3RHBA 2QSIA 5ECHB 2X8CA 1T00A 4JR4A 4E8HA 3ZZXA 1G0TA 3EC3A 3DVXA 2HSMB 2WFCA 3TJBA 5CNWA 1XVWA 1A0FA 2NPBA 4KE3A 3CBUA 1X9MB 1NW2A 3KZQA 4OFMA 2FHEA 4YAVA 3WD6A 3DEXA 2C1YA 2LRTA 1SKSB 2K8VA 4TVEA 1S3CA 5D73A 1TP9A 3W8SA 2OA7A 1B9YC 3G9BA 2HSMA 4NV2A 1XPVA 2CQ9A 4TN8A 1U6TA 4RI6A 3APOA 1IYIA 3CSJA 4Q5FA 4MZWA 4ECIA 2L4CA 4L0UA 3S9FA 1LBKA 4USSA 2DIYA 1F3AA 1Z6NA 3QFBC 4WF5A 3I69A 1O81A 5DVBA 5D9WA 5DBQA 4CW9A 3FKFA 4QMKA 1PKWA 4O5QA 1KNGA 3O6TA 2IMIA 2OKAA 4TR3A 1ACVA 3BOAA 1EV9A 2LJAA 4ML6A 1X5EA 2YWOA 1YVLA 3TKSC 1TW9A 2FWFA 4HU9A 1GNWA 2X4AA 5ECIB 3HMJG 5J4VA 4WR5A 1K0AA 5DAKB 3KP9A 1GLQA 1GSQA 3BD2A 2YWMA 2H75A 2OACA 5B6NA 2X8HA 3ERWA 2VIMA 4GSTA 5DDLA 4POLA 1TRSA 2YPMA 6GSXA 3KCMA 5F0GA 2O85A 1MD3A 3D5JA 1S3DA 4POKA 5DAKA 4XHMA 5C00A 1PRXA 3MYDA 1MD4A 4JEDA 2I81A 1BQ7A 3U6VA 3RPPA 1F2EA 2AB6A 2A2SA 3WYWA 3FZ5A 1XW5A 3TJKA 1OC8A 3EU3A 3HJPA 4XTSA 3K8NA 2P5RA 4GQFA 3DRNA 4PNGA 3F3RA 3JCML 1K0OA 3Q6OA 2HRKB 2CA8A 4FYBA 2HRAA 1N25A 3IR4A 2OE0A 3GUSA 3D4MA 2FCHA 3ZFBA 2VCTA 3APSA 5ECPB 2TRXA 1A2JA 1XFLA 1SJ6A 2CV4A 2C8UA 2CZ3A 4OO5A 4YKFA 5G30A 4PURA 2C4JA 2DJ0A 1Z3EA 1YF1A 1ZGNA 2ALBA 2HRKA 3DIEA 5CRDA 1ERTA 1AIUA 4I2UA 4CY6A 2HLSA 1T3BA 2DKHA 1UA5A 3U5RE 2H01A 2E2GA 1YY7A 2YWIA 3RAZA 1GUHA 5ELGA 3TGZA 5H5RA 4K1FA 3GL3A 4MP4A 3TOTA 2FA8A 3VPQA 3WT2A 2WS2A 3FY7A 5JCUA 4N10A 4ZB8A 2MZCA 5J4UA 3CRTA 4YKGA 2L5OA 4AGSA 3M9KA 2C0GA 5IOWA 4PQHA 4K7NA 2E2MA 3ISOA 4G0LA 2R0PA 3HVVA 4DSQA 3QCPA 4RQXA 1A23A 2VL2C 3ERGA 6GSWA 1NHOA 3LQ7A 4H86A 1TRVA 1XZOA 3J7Yb 2B1LA 5HR2A 1H4OA 2GZPA 2B6MA 3ZVJA 1TK8B 4PTSA 2UV8G 2GSSA 4GSSA 2AAWA 1R5PA 3QAVA 5COHA 1XWGA 2B1KA 1BAYA 3L9VA 2X64A 3TKPA 1WOUA 4AF2A 1ML6A 4I97A 5ECOB 1BX9A 3F8UA 1FVKA 3G7IA 2ON5A 3R3EA 6GSYA 1GNEA 2F3MA 2GDRA 4WR4A 1SENA 3TDGA 1QQ2A 5J47A 2CVDA 4IW9A 5B6MA 2HI7A 5ECSA 4HDEA 2RUEA 4JE1A 4N30A 2B5YA 1FHEA 2HYXA 4TXOB 1B48A 1SVLA 3ZMLA 4EKZA 3HVXA 2H0HA 3LWAA 2V41A 3F4RA 5A4VA 4ZBBA 5H5QA 1AQXA 5IPHA 4IP1A 4XRDA 1SK0A 2VO4A 1XVQA 2ES7A 3A5WA 4IQAA 4ZB7A 3PH9A 4MMMA 2QA2A 4V2NA 1X9SB 1EV4A 1GLPA 3IPZA 4TXOA 4L5OA 1A2MA 4PNFA 5HR1A 5CP1A 1PGTA 2BTOT 2E0QA 3GA4A 5D96A 1GL8A 4YAPA 4J2FA 1O73A 4X43A 2DIZA 3BCIA 3O3TA 2R37A 3M1GA 3E0UA 1GH2A 2R3XA 2IMFA 4F0CA 2VL3A 5FT3A 2YZHA 3BJ5A 4MZCA 4EVMA 4POMA 2PMTA 3LG6A 3IV4A 4KH7A 3IOSA 4P3YB 1PQNA 3CTGA 3HXSA 4GRFA 3EMPA 3PPUA 1PA3A 1Y6EA 1YF0A 3RDWA 1JZRA 1O7UA 3VWVA 4MJCA 3QD9A 2VM1A 4OO4A 2H6YA 4QQ7A 22GSA 3TKSE 5J3RA 2VOCA 2GQKA 5GAPD 1TXXA 3G7YA 4Q5RA 5DALB 2LEGA 4FYUA 4N0VA 2VKZG 3QOUA 5HFGA 1HNAA 4RI7A 2B3SA 1SKRB 3MWHA 2GSRA 2MBSA 3GN3A 5KOXA 1MDJA 2K6VA 4CY8A 3L78A 2H6XA 1AC1A 5HFIA 1EP7A 1XWCA 3GTUB 3EURA 4EIQA 4HJMA 3KIJA 2O89A 1OC9B 5DALA 2R4VA 4QL7A 3C1SA 4O32A 2O8VB 2JSYA 2LSTA 2PVQA 5AIVA 1DE2A 3ED3A 4KAEA 4K7OA 4MA9A 3TKRA 6GSTA 2DBCA 5L71A 3D6IA 4WBRD 1YDKA 2ON7A 2VUPA 3BCKA 4DSSB 1B8XA 1N8JA 1JLVA 3ZYWA 3GTUA 4NHZA 5DJLA 3MNGA 4Q5NA 2J9HA 1A8LA 4XRAA 1OC9A 3HCZA 3HD5A 3UARA 1WIKA 3WGXA 5IMZA 1B9XC 2DMLA 1V2AA 2EIQA 5ECRB 4TR4A 4V2LA 3ZVJD 5IMCA 1J0FA 4YQVA 4PUAA 2YZUA 2H73A 4BL7B 3GNJA 5CAXA 5LNKe 2R0GA 4DSSA 2F9SA 1TOFA 2OBIA 3HHVA 3IAS2 3P8WA 4GWRA 4F82A 1THXA 1R5AA 5LD0A 2A4HA 2EIRA 1ERUA 2L6DA 2ZCTA 2PU9C 3GFKA 3W6GA 2D2ZA 2CZ2A 4YQMA 5J40A 5G5EA 2WRTA 5F07A 3GYKA 3VWWA 3QR6A 4EIPA 4XS1A 2YNXA 4BL7A 3IRAA 2R6KA 5GSTA 2I3YA 2GS3A 1B4PA 2JZRA 2F8AA 3QAWA 2VCXA 4F0BA 4GQCA 3H8QA 3TJJA 4JZQA 1JHBA 3P90A 1ZCPA 2H8LA 3FZ9A 4LL1B 2I1UA 2PN8A 4K6XA 2G2QA 2LNTA 3EWLA 4TRXA 5EL8A 3UL3A 2FNOA 2OJLA 2H76A 1V9WA 2H30A 5IO2A 4ZBDA 6GSVA 3TRQA 2L4QA 4AJ8A 2H0IA 2JZSA 1W4VA 1GTIA 4RQRA 3ZL5A 1GSFA 4XS6A 1OYJA 4Z7XA 2EIOA 1XWAA 5INYA 3GMFA 3LXTA 4TW5A 3LXZA 1CQHA 1THOA 5DQSA 5CREA 1HNCA 2RIIA 1GSSA 4XCSA 2HQTA 3D0ZA 3DVWA 1FG4A 3IE3A 5EPFA 3ERFA 3A2XA 2I9HA 1PD21 1C72A 2HSHA 2JADA 1A0RP 4WXTA 1T1VA 2H1GA 3IDVA 4MF6A 3KEBA 5IIZA 3QPMA 1AXDA 2TRCP 1BJXA 1USBA 2B7KA 2JU5A 4GTUA 2RM6A 4LMVA 1EOGA 3ZFLA 5CRGA 2H1AA 2IIYA 4BWSA 4ML1A 1Y25A 3KXOA 4K5RA 2JACA 1K0BA 2IN3A 2IL3A 2FA4A 3UAPA 3QDNA 1G6WA 3LSZA 2CAQA 5J9BA 1HYUA 4GDFA 3VI5A 1R26A 2ZNMA 2OADA 5IQYA 4JBBA 5JWRB 2H66A 1VGLA 3HKRA 2XPEA 3D22A 4MH2A 3LFLA 1TK0B 1XOAA 2CT6A 5DCHA 5B8AA 1K0CA 2DJ3A 5E4WA 4KX4A 4CDOA 3ZIJA 3BBYA 4HUAA 2VLUA 5CYYA 4F03A 3ZIVA 5LCZA 1TU7A 4ILFA 1ZYEA 2IWTA 3UOMA 3CYNA 1SK1A 4Z2TA 5A4WA 5KN1A 2PERA 3DMLA 1A2LA 4OWYA 4GXZA 2IFQB 4EF0A 2F8FA 2GSQA 17GSA 4EDYA 6GSUA 1TI1A 4K8MA 4N3ZA 2YJHA 2N5BA 1TKDB 5AIXA 4KB3A 1BG5A 2O5VA 2PUKC 2MMNA 4OCFA 5HQPA 1AAZA 2V6KA 4JRRA 2I4AA 5KN2A 1GUKA 2VM2A 4ULXA 2DKIA 4ZIJA 1M0UA 4TXVA 1FOVA 3LJRA 3HYPA 2IFQA 4HZ2A 1RQMA 1TJDA 1Z9HA 2FWEA 5AN1A 2GT6A 3G7JA 2HT9A 1PSQA 4FH8A 3CSIA 3Q19A 3VURA 2K9FA 2PVOC 14GSA 2FD3A 1WP0A 4KCAA 3FW2A 1PX6A 3GX0A 1PL1A 3F63A 3LW9A 3CWGA 4AJ6A 3HZ8A 2AJQB 3CRUA 5GAND 3FR9A 3PR8A 3C1RA 4BVYB 3ZMKA 5G1KA 3RHCA 4I2TA 2B5EA 5A1NB 3LORA 1AW9A 1GSDA 4TR1B 1JLWA 2EFDA 5DQYA 2MYGA 3KD0A 3EPTA 4XS4B 2IJYA 2VLVA 4HI7A 4KSOA 2C3NA 3GH6A 1ZOFA 4BPYA 3D4TA 4N11A 1NM3A 5BRTA 4EL1A 4K5SA 2O87A 3UEMA 3UMAA 4BVYA 4J56E 4PUFC 1R4WA 3CTFA 3R2QA 5A1NA 1Z7PA 1XW6A 3VWUA 3APQA 4E68A 2LQQA 4TR1A 2K8SA 3KMNA 4O5UA 3M0FA 3Q18A 3M8NA 4IJIA 4ZB6A 5J41A 4Z2UA 4XS4A 1K0NA 3PINA 3LYPA 4F9ZA 4IHUA 5ID2B 3TKQA 4MABA 3GKMA 2VCQA 2R2JA 1YKCA 2C80A 3F6DA 4LA1A 1TRUA 4A5PA 1X0RA 1ILOA 3DGQA 1CQGA 1M7TA 2H19A 3A2VA 2AHEA 3KP8A 1F6MC 3H1NA 3NIVA 3US3A 1M2DA 3TOUA 3GX8A 4J57E 1EGOA 3F4TA 2V2GA 3DD3A 1UC7A 1WPIA 2V1MA 4DVCA 5ID2A 9GSSA 2IMDA 4L0WA 2VCVA 1B4QA 1V58A 2P0GA 1VRSD 3MDKA 3D21A 5D9TA 4K2XA 2CAIA 2KP1A 2DMMA 1QMVA 1X5CA 1YKAA 2WDUA 3C7MA 2M80A 3WGDA 3H79A 1SYRA 4NMUA 3IA1A 1GSEA 4KDXA 1BF5A 3FRCA 4K9ZA 4EXJA 3EINA 1BYEA 3HVSA 2PWJA 2EFHA 3L9UA 4IGJA 2ZUPA 20GSA 4V2MA 1ZYNA 3QMXA 2FWHA 3UJ1A 1TU8A 1EP8A 1YEPA 4AKHA 2L5LA 1QGVA 1G6YA 1DBYA 2XBIA 2MMAA 4TOPA 5KN3A 1Z5YE 4MLYA 4I6XA 2GTUA 2R5GA 3F3QA 4WF4A 1YQ1A 1J9BA 1SU9A 2X49A 4ZL7A 3VI7A 1EWXA 3GIXA 1SJIA 2G0FA 2O7KA 1UN2A 2H0GA 3NZNA 3M3MA 3WT1A 3ZLPA 2A2PA 1FVJA 5IO0A 2DLXA 3EYTA 3IK7A 2MMOA 5B8BA 3KJYA 4EO3A 5D93A 1MEKA 4K0GA 2N5AA 1MDKA 5HFKA 2QC7A 2GLRA 1URMA 2C3TA 4MJAA 1ZZYA 3FEUA 2GQMA 1T7PB 4L8EA 4NV5A 1S3AA 4KGIA 3VWXA 1JZWA 4LLRA 4IQ1A 3IXRA 4JU5A 5KN0A 3IHQA 6GSSA 3MAKA 2YN1A 3Q74A 4HOJA 4WKWA 4IVFA 18GSA 4PXOA 1T4ZA 3UBKA 3A2WA 3CMIA 2EFCA 2PGTA 1A24A 2E7PA 4ECCA 4OCEA 1A8YA 2CX3A 5D9XA 1U3IA 5GSSA 4GF0A 1GULA 1W89A 1O6JA 2YV9A 2UZ8A 3FMWA 1GTUA 1PL2A 5G31A 4ID0A 3GKNA 3IHGA 2GVPA 2H72A 8GSSA 3F9UA 5DJMA 5J5NA 2PPTA 4O7HA 1ABAA 5IMAA 1QFNA 3IK9A 3GHAA 1XW9A 2OE1A 4MF5A 5HR0A 4MPGA 2XC2A 1OC3A 4I8BA 4MDCA 2VD1A 3KTLA 5F8BA 1XWBA 3IAM2 3KH9A 1TRWA 4G2EA 2HSNB 5G5FA 1WMJA 4WEYA 3C73A 3N5OA 2JSZA 2LKUA 1ERVA 2DJJA 4MZBA 5IMFA 4OD7A 2RLIA 2QGVA 3FYGA 4CHSA 3GKKA 1Q98A 3P2AA 3GSSA 2DJ1A 2WZ9A 4EUYA 4GLTA 1K0DA 1JZOA 4AKXB 2HSNA 4IELA 1TK5B 1U3AA 1JZDA 4KW6A 3LEFA 2VAFA 3CXGA 3F0IA 1XOBA 3H4KA 2Z9SA 4MJBA 5IPGA 1I9DA 4IP6A 2YOIA 3HZ4A 4NPBA 1WJKA 2WULA 1ON4A 1GSUA 4HQSA 4NAXA 2PBJA 1GSYA 3KM6A 3TCOA 4YQUA 1K3YA 3TU3B 2LRCA 5BMUB 1WE0A 4G0IA 3KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F06 A;  3GKX A;  1O8X A;  2YP6 A;  2AV4 A;  2H1D A;  2LTK A;  2REM A;  3VFI A;  4X1U A;  3HDC A;  1F37 A;  2K18 A;  4MF7 A;  3AY8 A;  4NXI A;  1H75 A;  4NWY A;  1GTA A;  1TI3 A;  1QXH A;  5BMU A;  3ME7 A;  4HZ4 A;  2F51 A;  4PQI A;  3RBT A;  5JCG A;  1ZMA A;  5ECM B;  3VK9 A;  2P31 A;  5ECN B;  1QUW A;  1RK4 A;  5IOX A;  4GSN A;  4IBP A;  4HJ2 A;  2BJX A;  1G7E A;  2CX4 A;  2LNS A;  2MMZ A;  1OKD A;  3FHK A;  2YCD A;  1VF1 A;  4G0K A;  3IC8 A;  4O92 A;  2QKE A;  5IM9 A;  2V6O A;  4L5L A;  4O5R A;  5JWO B;  3FR3 A;  5C04 A;  5JCW A;  4MJE A;  1K3L A;  1OKT A;  5G1L A;  5FHI A;  1F3B A;  4OMV A;  1TTZ A;  1YJ6 A;  3EE2 A;  1GP1 A;  1XIY A;  1SL0 B;  1M9A A;  3QAG A;  3V1W A;  1U87 A;  2NVL A;  3O76 A;  1SJZ A;  5AGY A;  2FUG 2;  4HQZ A;  2HSY A;  1MDI A;  2P5Q A;  4EDZ A;  3HJM A;  1V40 A;  4ZL9 A;  4TKY A;  4YH2 A;  5A5K A;  1QK8 A;  4OFN A;  3L0H A;  1KEB A;  1ST9 A;  3GV1 A;  1KTE A;  2N5F A;  4ZB9 A;  1WWJ A;  3QFA C;  5HR3 A;  4PGT A;  3SBC A;  4KND A;  5ENU A;  4LL4 B;  2J23 A;  1K0M A;  4ZXG A;  10GS A;  2H74 A;  3N9J A;  2WB9 A;  1EOH A;  5EVO A;  2GZY A;  4MPF A;  3UVT A;  1DE1 A;  2AUV A;  3RPN A;  3I43 A;  4ZIL A;  3L9S A;  5ECK B;  5IMD A;  1FO5 A;  4QL9 A;  4POB A;  2NTO A;  2L59 A;  4N0Z A;  3FR6 A;  5EY6 A;  2H70 A;  4ZBA A;  4IN0 A;  5CRH A;  4X0X A;  3EVI A;  1M2B A;  5AIS A;  3GUR A;  4KCE A;  2GGT A;  5ELA A;  1DSB A;  1N2A A;  2GST A;  3FZ4 A;  1GRX A;  4IKH A;  2VD0 A;  2FGX A;  3OR5 A;  2NDO A;  1AQW A;  2HNL A;  1XCC A;  4KSM A;  1O85 A;  1KBN A;  1VF4 A;  3TRX A;  1HNB A;  7GSS A;  1JFU A;  3I9V 2;  2X8G A;  4K0N A;  1SKW B;  1GUM A;  4HEA 2;  3W8J A;  13GS A;  4EE0 A;  1YEX A;  4BA7 A;  1XBS A;  3UVH A;  1V57 A;  4AJ7 A;  1BED A;  2DSA A;  3VPT A;  1OVN A;  2WGR A;  1EGR A;  1FAA A;  3HA9 A;  4ECJ A;  1G7O A;  4F2I A;  4NHW A;  3GST A;  3TJF A;  4HS1 A;  1PN9 A;  2WJU A;  2JL4 A;  1F9M A;  1HD2 A;  2GQL A;  2M46 A;  2VL9 A;  1E2Y A;  2DJK A;  2IME A;  2YV7 A;  5JWQ B;  2LRN A;  4PQ1 A;  4ECB A;  3EMX A;  1X5D A;  4XIH A;  1SK2 A;  2DC5 A;  1EEJ A;  3ZTL A;  1K3O A;  3DYR A;  3DKS A;  5FWG A;  2FLS A;  3TRP A;  1NSW A;  3EU4 A;  4KF9 A;  1SD8 A;  4LMW A;  1V98 A;  3HY2 A;  1OE7 A;  1XXU A;  3I6A A;  4MK3 A;  2EC4 A;  4KDU A;  1M9B A;  5G2Z A;  3ZRD A;  3TUE A;  2HRF A;  1EZK A;  2A2R A;  4I5Q A;  5J9C A;  4Q5Q A;  2L57 A;  3UIW A;  2RUF A;  3LGC A;  4G10 A;  4KDY A;  4HU7 A;  4WBJ A;  2HXK A;  3TKS A;  4BVX B;  1VF3 A;  1U88 A;  2WCI A;  4RUV A;  2MBT A;  2KOK A;  1ERW A;  4DSR A;  5DCG A;  5E59 A;  19GS A;  3E3E A;  2VCW A;  5H5S A;  4JR6 A;  2H6Z A;  5D8I A;  1YZX A;  1HQO A;  2HRN A;  1NHY A;  4EC0 A;  1ZYQ B;  4BVX A;  2IPA A;  3L4N A;  2XBQ A;  16GS A;  3C8E A;  4FQU A;  3ZRE A;  1M2A A;  1OE8 A;  2AYT A;  2GT5 A;  2C0D A;  4KUN A;  3HJO A;  1SD9 A;  4KA0 A;  1OAZ A;  1PMT A;  2OE3 A;  1SL2 B;  2VCZ A;  3KH7 A;  3NOF A;  2C0E A;  3TJG A;  3E9J B;  3ME8 A;  3KMO A;  2LV3 A;  2C3Q A;  2C0F A;  2YWN A;  2X99 A;  5KEJ A;  1T8E B;  2XPD A;  1J08 A;  1RW1 A;  4IS0 A;  5F05 A;  1IYH A;  3A3T A;  5A4U A;  1E6B A;  2TIR A;  2NBS A;  2HZE B;  3DWV A;  2CVB A;  2JZT A;  1SYX A;  2M72 A;  2KLX A;  3UBL A;  5ABR A;  1VF2 A;  2H1B A;  3F4S A;  1EEM A;  2IMK A;  4GCI A;  4ACS A;  3F6F A;  1PKZ A;  2A4V A;  5GZZ B;  4MH3 A;  1GTB A;  1LJR A;  1GWC A;  2BMX A;  2CVK A;  5B7C A;  3M9J A;  5CRW A;  4D73 B;  3FK8 A;  4OFT A;  2YAN A;  1PX7 A;  4MCU A;  4DEJ A;  1I5G A;  4TR0 A;  2HFD A;  2HZE A;  3C71 A;  3IC4 A;  1O8W A;  4FIW A;  4V1A p;  2OBK A;  5ECQ B;  2L6C A;  4K7I A;  4IJ3 A;  2LJR A;  1T4Y A;  4G19 A;  3IBH A;  4BWQ A;  1FB6 A;  1Q4J A;  2LUS A;  2KUC A;  1MTC A;  1TDI A;  4ZL8 A;  4D73 A;  3ZIT A;  2LJK A;  1Z7R A;  2DJ2 A;  1FB0 A;  3VLN A;  2XHF A;  3GH9 A;  5ECL B;  2VL2 A;  4PX1 A;  2V32 A;  2KP2 A;  5D9V A;  2HZF A;  3H93 A;  1AUC A;  2FWG A;  3FZA A;  2GZZ A;  3P7X A;  3SWL A;  3J7Y k;  1X9W B;  3TB2 A;  4WET A;  1R7H A;  2KHP A;  4K2D A;  1FW1 A;  2RM5 A;  12GS A;  1XWK A;  2B5X A;  4V1A g;  3LYK A;  11GS A;  5IMV A;  3CSH A;  2B7J A;  3WGE A;  3GL5 A;  3DXB A;  1LU4 A;  2YJ7 A;  3PGT A;  1M99 A;  2H71 A;  4FYC A;  4FO5 A;  3KGK A;  1DUG A;  3MSZ A;  1AQV A;  2HE3 A;  2LS5 A;  3GRX A;  1SL1 B;  4ISD A;  4G9H A;  2LQO A;  4E8E A;  1Z6M A;  2FY6 A;  1WRY A;  1ZL9 A;  5CO3 A;  2VLT A;  1UVZ A;  3RHB A;  2QSI A;  5ECH B;  2X8C A;  1T00 A;  4JR4 A;  4E8H A;  3ZZX A;  1G0T A;  3EC3 A;  3DVX A;  2HSM B;  2WFC A;  3TJB A;  5CNW A;  1XVW A;  1A0F A;  2NPB A;  4KE3 A;  3CBU A;  1X9M B;  1NW2 A;  3KZQ A;  4OFM A;  2FHE A;  4YAV A;  3WD6 A;  3DEX A;  2C1Y A;  2LRT A;  1SKS B;  2K8V A;  4TVE A;  1S3C A;  5D73 A;  1TP9 A;  3W8S A;  2OA7 A;  1B9Y C;  3G9B A;  2HSM A;  4NV2 A;  1XPV A;  2CQ9 A;  4TN8 A;  1U6T A;  4RI6 A;  3APO A;  1IYI A;  3CSJ A;  4Q5F A;  4MZW A;  4ECI A;  2L4C A;  4L0U A;  3S9F A;  1LBK A;  4USS A;  2DIY A;  1F3A A;  1Z6N A;  3QFB C;  4WF5 A;  3I69 A;  1O81 A;  5DVB A;  5D9W A;  5DBQ A;  4CW9 A;  3FKF A;  1PKW A;  1KNG A;  3O6T A;  2IMI A;  2OKA A;  4TR3 A;  1ACV A;  3BOA A;  1EV9 A;  2LJA A;  4ML6 A;  1X5E A;  2YWO A;  3TKS C;  1TW9 A;  2FWF A;  4HU9 A;  1GNW A;  5ECI B;  4WR5 A;  1K0A A;  5DAK B;  3KP9 A;  1GLQ A;  1GSQ A;  3BD2 A;  2YWM A;  2H75 A;  2OAC A;  5B6N A;  2X8H A;  3ERW A;  2VIM A;  4GST A;  5DDL A;  4POL A;  1TRS A;  2YPM A;  6GSX A;  3KCM A;  5F0G A;  2O85 A;  1MD3 A;  3D5J A;  1S3D A;  4POK A;  5DAK A;  4XHM A;  5C00 A;  1PRX A;  1MD4 A;  4JED A;  2I81 A;  1BQ7 A;  3U6V A;  3RPP A;  1F2E A;  2AB6 A;  2A2S A;  3WYW A;  3FZ5 A;  1XW5 A;  3TJK A;  1OC8 A;  3EU3 A;  3HJP A;  4XTS A;  3K8N A;  2P5R A;  4GQF A;  3DRN A;  4PNG A;  3F3R A;  3JCM L;  1K0O A;  3Q6O A;  2HRK B;  2CA8 A;  4FYB A;  2HRA A;  3IR4 A;  2OE0 A;  3GUS A;  3D4M A;  2FCH A;  3ZFB A;  2VCT A;  3APS A;  5ECP B;  2TRX A;  1A2J A;  1XFL A;  1SJ6 A;  2CV4 A;  2C8U A;  2CZ3 A;  4OO5 A;  5G30 A;  4PUR A;  2C4J A;  2DJ0 A;  1Z3E A;  1YF1 A;  1ZGN A;  2ALB A;  2HRK A;  3DIE A;  5CRD A;  1ERT A;  1AIU A;  4I2U A;  2HLS A;  1T3B A;  1UA5 A;  3U5R E;  2H01 A;  2E2G A;  1YY7 A;  2YWI A;  3RAZ A;  1GUH A;  5ELG A;  3TGZ A;  5H5R A;  4K1F A;  3GL3 A;  4MP4 A;  3TOT A;  2FA8 A;  3VPQ A;  3WT2 A;  2WS2 A;  3FY7 A;  5JCU A;  4N10 A;  4ZB8 A;  2MZC A;  5J4U A;  3CRT A;  2L5O A;  4AGS A;  3M9K A;  2C0G A;  5IOW A;  4PQH A;  4K7N A;  2E2M A;  3ISO A;  4G0L A;  3HVV A;  4DSQ A;  3QCP A;  4RQX A;  1A23 A;  2VL2 C;  3ERG A;  6GSW A;  1NHO A;  3LQ7 A;  4H86 A;  1TRV A;  1XZO A;  3J7Y b;  2B1L A;  5HR2 A;  1H4O A;  2GZP A;  2B6M A;  3ZVJ A;  1TK8 B;  4PTS A;  2GSS A;  4GSS A;  2AAW A;  1R5P A;  3QAV A;  5COH A;  1XWG A;  2B1K A;  1BAY A;  3L9V A;  2X64 A;  3TKP A;  1WOU A;  4AF2 A;  1ML6 A;  4I97 A;  5ECO B;  1BX9 A;  3F8U A;  1FVK A;  3G7I A;  2ON5 A;  3R3E A;  6GSY A;  1GNE A;  2F3M A;  2GDR A;  4WR4 A;  1SEN A;  3TDG A;  1QQ2 A;  2CVD A;  4IW9 A;  5B6M A;  2HI7 A;  5ECS A;  4HDE A;  2RUE A;  4JE1 A;  4N30 A;  2B5Y A;  1FHE A;  2HYX A;  4TXO B;  1B48 A;  3ZML A;  4EKZ A;  3HVX A;  2H0H A;  3LWA A;  2V41 A;  3F4R A;  5A4V A;  4ZBB A;  5H5Q A;  1AQX A;  5IPH A;  4IP1 A;  4XRD A;  1SK0 A;  2VO4 A;  1XVQ A;  2ES7 A;  3A5W A;  4IQA A;  3PH9 A;  4MMM A;  4V2N A;  1X9S B;  1EV4 A;  1GLP A;  3IPZ A;  4TXO A;  4L5O A;  1A2M A;  4PNF A;  5HR1 A;  5CP1 A;  1PGT A;  2BTO T;  2E0Q A;  3GA4 A;  5D96 A;  1GL8 A;  4YAP A;  4J2F A;  1O73 A;  4X43 A;  2DIZ A;  3BCI A;  3O3T A;  2R37 A;  3M1G A;  3E0U A;  1GH2 A;  2R3X A;  2IMF A;  4F0C A;  2VL3 A;  5FT3 A;  2YZH A;  3BJ5 A;  4MZC A;  4EVM A;  4POM A;  2PMT A;  3LG6 A;  3IV4 A;  4KH7 A;  3IOS A;  4P3Y B;  1PQN A;  3CTG A;  3HXS A;  4GRF A;  3EMP A;  3PPU A;  1PA3 A;  1Y6E A;  1YF0 A;  3RDW A;  1JZR A;  1O7U A;  3VWV A;  4MJC A;  3QD9 A;  2VM1 A;  4OO4 A;  2H6Y A;  4QQ7 A;  22GS A;  3TKS E;  5J3R A;  2VOC A;  2GQK A;  5GAP D;  1TXX A;  3G7Y A;  4Q5R A;  5DAL B;  2LEG A;  4FYU A;  4N0V A;  3QOU A;  5HFG A;  1HNA A;  4RI7 A;  2B3S A;  1SKR B;  3MWH A;  2GSR A;  2MBS A;  3GN3 A;  1MDJ A;  2K6V A;  3L78 A;  2H6X A;  1AC1 A;  5HFI A;  1EP7 A;  1XWC A;  3GTU B;  3EUR A;  4HJM A;  3KIJ A;  2O89 A;  1OC9 B;  5DAL A;  2R4V A;  4QL7 A;  3C1S A;  4O32 A;  2O8V B;  2JSY A;  2LST A;  2PVQ A;  5AIV A;  1DE2 A;  3ED3 A;  4KAE A;  4K7O A;  4MA9 A;  3TKR A;  6GST A;  2DBC A;  5L71 A;  3D6I A;  4WBR D;  1YDK A;  2ON7 A;  2VUP A;  3BCK A;  4DSS B;  1B8X A;  1N8J A;  1JLV A;  3ZYW A;  3GTU A;  4NHZ A;  5DJL A;  3MNG A;  4Q5N A;  2J9H A;  1A8L A;  4XRA A;  1OC9 A;  3HCZ A;  3HD5 A;  3UAR A;  1WIK A;  3WGX A;  5IMZ A;  1B9X C;  2DML A;  1V2A A;  2EIQ A;  5ECR B;  4TR4 A;  4V2L A;  3ZVJ D;  5IMC A;  1J0F A;  4YQV A;  4PUA A;  2YZU A;  2H73 A;  4BL7 B;  3GNJ A;  5CAX A;  5LNK e;  4DSS A;  2F9S A;  1TOF A;  2OBI A;  3HHV A;  3IAS 2;  3P8W A;  4GWR A;  4F82 A;  1THX A;  1R5A A;  5LD0 A;  2EIR A;  1ERU A;  2L6D A;  2ZCT A;  2PU9 C;  3GFK A;  3W6G A;  2D2Z A;  2CZ2 A;  4YQM A;  5G5E A;  2WRT A;  5F07 A;  3GYK A;  3VWW A;  3QR6 A;  4XS1 A;  2YNX A;  4BL7 A;  3IRA A;  2R6K A;  5GST A;  2I3Y A;  2GS3 A;  1B4P A;  2JZR A;  2F8A A;  3QAW A;  2VCX A;  4GQC A;  4F0B A;  3H8Q A;  3TJJ A;  4JZQ A;  1JHB A;  3P90 A;  1ZCP A;  2H8L A;  3FZ9 A;  4LL1 B;  2I1U A;  2PN8 A;  4K6X A;  2G2Q A;  2LNT A;  3EWL A;  4TRX A;  5EL8 A;  3UL3 A;  2FNO A;  2OJL A;  2H76 A;  1V9W A;  2H30 A;  5IO2 A;  4ZBD A;  6GSV A;  3TRQ A;  2L4Q A;  4AJ8 A;  2H0I A;  2JZS A;  1W4V A;  1GTI A;  4RQR A;  3ZL5 A;  1GSF A;  4XS6 A;  1OYJ A;  4Z7X A;  2EIO A;  1XWA A;  5INY A;  3GMF A;  3LXT A;  4TW5 A;  3LXZ A;  1CQH A;  1THO A;  5DQS A;  5CRE A;  1HNC A;  2RII A;  1GSS A;  4XCS A;  2HQT A;  3D0Z A;  3DVW A;  1FG4 A;  3IE3 A;  5EPF A;  3ERF A;  3A2X A;  2I9H A;  1PD2 1;  1C72 A;  2HSH A;  2JAD A;  1A0R P;  4WXT A;  1T1V A;  2H1G A;  3IDV A;  4MF6 A;  3KEB A;  5IIZ A;  3QPM A;  1AXD A;  2TRC P;  1BJX A;  1USB A;  2B7K A;  2JU5 A;  4GTU A;  2RM6 A;  4LMV A;  1EOG A;  3ZFL A;  5CRG A;  2H1A A;  2IIY A;  4BWS A;  4ML1 A;  1Y25 A;  3KXO A;  2JAC A;  1K0B A;  2IN3 A;  2IL3 A;  2FA4 A;  3UAP A;  3QDN A;  1G6W A;  3LSZ A;  2CAQ A;  5J9B A;  1HYU A;  3VI5 A;  1R26 A;  2ZNM A;  2OAD A;  5IQY A;  4JBB A;  5JWR B;  2H66 A;  1VGL A;  3HKR A;  2XPE A;  3D22 A;  4MH2 A;  3LFL A;  1TK0 B;  1XOA A;  2CT6 A;  5DCH A;  5B8A A;  1K0C A;  2DJ3 A;  5E4W A;  4KX4 A;  4CDO A;  3ZIJ A;  3BBY A;  4HUA A;  2VLU A;  5CYY A;  4F03 A;  3ZIV A;  5LCZ A;  1TU7 A;  4ILF A;  1ZYE A;  2IWT A;  3UOM A;  3CYN A;  1SK1 A;  5A4W A;  5KN1 A;  2PER A;  3DML A;  1A2L A;  4OWY A;  4GXZ A;  2IFQ B;  4EF0 A;  2F8F A;  2GSQ A;  17GS A;  4EDY A;  6GSU A;  1TI1 A;  4K8M A;  2YJH A;  2N5B A;  1TKD B;  5AIX A;  4KB3 A;  1BG5 A;  2PUK C;  2MMN A;  4OCF A;  5HQP A;  1AAZ A;  2V6K A;  4JRR A;  2I4A A;  5KN2 A;  1GUK A;  2VM2 A;  4ULX A;  4ZIJ A;  1M0U A;  4TXV A;  1FOV A;  3LJR A;  3HYP A;  2IFQ A;  4HZ2 A;  1RQM A;  1TJD A;  1Z9H A;  2FWE A;  5AN1 A;  2GT6 A;  3G7J A;  2HT9 A;  1PSQ A;  4FH8 A;  3CSI A;  3Q19 A;  3VUR A;  2K9F A;  2PVO C;  14GS A;  2FD3 A;  1WP0 A;  4KCA A;  3FW2 A;  1PX6 A;  3GX0 A;  1PL1 A;  3F63 A;  4AJ6 A;  3HZ8 A;  2AJQ B;  3CRU A;  5GAN D;  3FR9 A;  3PR8 A;  3C1R A;  4BVY B;  3ZMK A;  5G1K A;  3RHC A;  4I2T A;  2B5E A;  3LOR A;  1AW9 A;  1GSD A;  4TR1 B;  1JLW A;  5DQY A;  2MYG A;  3KD0 A;  4XS4 B;  2IJY A;  2VLV A;  4HI7 A;  4KSO A;  2C3N A;  3GH6 A;  1ZOF A;  4BPY A;  3D4T A;  4N11 A;  1NM3 A;  4EL1 A;  2O87 A;  3UEM A;  3UMA A;  4BVY A;  4J56 E;  4PUF C;  1R4W A;  3CTF A;  3R2Q A;  1Z7P A;  1XW6 A;  3VWU A;  3APQ A;  2LQQ A;  4TR1 A;  2K8S A;  3KMN A;  3M0F A;  3Q18 A;  3M8N A;  4IJI A;  4ZB6 A;  5J41 A;  4XS4 A;  1K0N A;  3PIN A;  3LYP A;  4F9Z A;  4IHU A;  5ID2 B;  3TKQ A;  4MAB A;  3GKM A;  2VCQ A;  2R2J A;  1YKC A;  2C80 A;  3F6D A;  4LA1 A;  1TRU A;  1X0R A;  1ILO A;  3DGQ A;  1CQG A;  1M7T A;  2H19 A;  3A2V A;  2AHE A;  3KP8 A;  1F6M C;  3H1N A;  3NIV A;  3US3 A;  1M2D A;  3TOU A;  3GX8 A;  4J57 E;  1EGO A;  3F4T A;  2V2G A;  3DD3 A;  1UC7 A;  1WPI A;  2V1M A;  4DVC A;  5ID2 A;  9GSS A;  2IMD A;  4L0W A;  2VCV A;  1B4Q A;  1V58 A;  2P0G A;  1VRS D;  3MDK A;  3D21 A;  5D9T A;  2CAI A;  2KP1 A;  2DMM A;  1QMV A;  1X5C A;  1YKA A;  2WDU A;  3C7M A;  2M80 A;  3WGD A;  3H79 A;  1SYR A;  4NMU A;  3IA1 A;  1GSE A;  4KDX A;  3FRC A;  4K9Z A;  4EXJ A;  3EIN A;  1BYE A;  3HVS A;  2PWJ A;  3L9U A;  4IGJ A;  2ZUP A;  20GS A;  4V2M A;  3QMX A;  2FWH A;  3UJ1 A;  1TU8 A;  1EP8 A;  1YEP A;  2L5L A;  1QGV A;  1G6Y A;  1DBY A;  2XBI A;  2MMA A;  4TOP A;  5KN3 A;  1Z5Y E;  4MLY A;  4I6X A;  2GTU A;  2R5G A;  3F3Q A;  4WF4 A;  1YQ1 A;  1J9B A;  1SU9 A;  4ZL7 A;  3VI7 A;  1EWX A;  3GIX A;  1SJI A;  2G0F A;  2O7K A;  1UN2 A;  2H0G A;  3NZN A;  3M3M A;  3WT1 A;  3ZLP A;  1FVJ A;  5IO0 A;  2DLX A;  3EYT A;  3IK7 A;  2MMO A;  5B8B A;  3KJY A;  4EO3 A;  5D93 A;  1MEK A;  4K0G A;  2N5A A;  1MDK A;  5HFK A;  2QC7 A;  2GLR A;  1URM A;  2C3T A;  4MJA A;  1ZZY A;  3FEU A;  2GQM A;  1T7P B;  4L8E A;  4NV5 A;  1S3A A;  4KGI A;  3VWX A;  1JZW A;  4LLR A;  4IQ1 A;  3IXR A;  4JU5 A;  5KN0 A;  3IHQ A;  6GSS A;  3MAK A;  2YN1 A;  3Q74 A;  4HOJ A;  4WKW A;  4IVF A;  18GS A;  4PXO A;  1T4Z A;  3UBK A;  3A2W A;  3CMI A;  2PGT A;  1A24 A;  2E7P A;  4ECC A;  4OCE A;  1A8Y A;  2CX3 A;  5D9X A;  1U3I A;  5GSS A;  4GF0 A;  1GUL A;  1W89 A;  1O6J A;  2YV9 A;  2UZ8 A;  1GTU A;  1PL2 A;  5G31 A;  4ID0 A;  3GKN A;  2GVP A;  2H72 A;  8GSS A;  3F9U A;  5DJM A;  5J5N A;  2PPT A;  4O7H A;  1ABA A;  5IMA A;  1QFN A;  3IK9 A;  3GHA A;  1XW9 A;  2OE1 A;  4MF5 A;  5HR0 A;  4MPG A;  2XC2 A;  1OC3 A;  4I8B A;  4MDC A;  2VD1 A;  3KTL A;  5F8B A;  1XWB A;  3IAM 2;  3KH9 A;  1TRW A;  4G2E A;  2HSN B;  5G5F A;  1WMJ A;  4WEY A;  3C73 A;  3N5O A;  2JSZ A;  2LKU A;  1ERV A;  2DJJ A;  4MZB A;  5IMF A;  4OD7 A;  2RLI A;  2QGV A;  3FYG A;  4CHS A;  3GKK A;  1Q98 A;  3P2A A;  3GSS A;  2DJ1 A;  2WZ9 A;  4EUY A;  4GLT A;  1K0D A;  1JZO A;  4IEL A;  1TK5 B;  1U3A A;  1JZD A;  4KW6 A;  3LEF A;  2VAF A;  3CXG A;  3F0I A;  1XOB A;  3H4K A;  2Z9S A;  4MJB A;  5IPG A;  4IP6 A;  1I9D A;  2YOI A;  3HZ4 A;  4NPB A;  1WJK A;  2WUL A;  1ON4 A;  1GSU A;  4HQS A;  4NAX A;  2PBJ A;  1GSY A;  3KM6 A;  3TCO A;  4YQU A;  1K3Y A;  2LRC A;  1WE0 A;  4G0I A;  3KTB A; 
#chains in the Genus database with same CATH topology
 5F06 A;  3GKX A;  1O8X A;  2YP6 A;  3A5I A;  2AV4 A;  2H1D A;  2LTK A;  2OT3 A;  2REM A;  3VFI A;  4X1U A;  3HDC A;  1FOH A;  1F37 A;  2K18 A;  4MF7 A;  3AY8 A;  4NXI A;  1H75 A;  4NWY A;  1GTA A;  1TI3 A;  1QXH A;  5BMU A;  3ME7 A;  4HZ4 A;  2F51 A;  4PQI A;  3RBT A;  5JCG A;  1ZMA A;  5ECM B;  3VK9 A;  2P31 A;  5ECN B;  1RK4 A;  5IOX A;  4GSN A;  4IBP A;  4HJ2 A;  2BJX A;  1G7E A;  2CX4 A;  2LNS A;  2MMZ A;  1OKD A;  3FHK A;  2YCD A;  1VF1 A;  4G0K A;  3IC8 A;  4O92 A;  2QKE A;  5IM9 A;  2V6O A;  4L5L A;  4O5R A;  5JWO B;  3FR3 A;  5C04 A;  5JCW A;  4MJE A;  1K3L A;  1OKT A;  5G1L A;  5FHI A;  1F3B A;  4OMV A;  1TTZ A;  1YJ6 A;  3EE2 A;  1GP1 A;  1XIY A;  1SL0 B;  1M9A A;  3QAG A;  3V1W A;  1U87 A;  2NVL A;  3O76 A;  1SJZ A;  5AGY A;  2FUG 2;  4HQZ A;  2HSY A;  1MDI A;  2P5Q A;  4EDZ A;  3HJM A;  1V40 A;  4ZL9 A;  4TKY A;  4YH2 A;  5A5K A;  1QK8 A;  4OFN A;  3L0H A;  1KEB A;  1ST9 A;  3GV1 A;  1KTE A;  4Z2R A;  2N5F A;  4ZB9 A;  1WWJ A;  5A5H B;  3QFA C;  5HR3 A;  4PGT A;  3SBC A;  4KND A;  5ENU A;  4LL4 B;  2J23 A;  1K0M A;  4ZXG A;  10GS A;  2H74 A;  3N9J A;  2WB9 A;  1EOH A;  5EVO A;  2GZY A;  4MPF A;  3UVT A;  1BG1 A;  1DE1 A;  2AUV A;  3RPN A;  3I43 A;  4ZIL A;  4G01 A;  3L9S A;  5ECK B;  5IMD A;  1FO5 A;  4QL9 A;  4POB A;  2NTO A;  2L59 A;  4N0Z A;  3FR6 A;  5EY6 A;  2H70 A;  5A5H A;  4ZBA A;  4IN0 A;  1PN0 A;  5CRH A;  4X0X A;  3EVI A;  1M2B A;  5AIS A;  1SVO A;  3GUR A;  4KCE A;  2GGT A;  5ELA A;  1DSB A;  1N2A A;  2GST A;  1S3R A;  3FZ4 A;  1GRX A;  4IKH A;  2VD0 A;  2FGX A;  3OR5 A;  2NDO A;  1AQW A;  2HNL A;  1XCC A;  4KSM A;  1O85 A;  1KBN A;  1VF4 A;  3TRX A;  1HNB A;  7GSS A;  1JFU A;  3I9V 2;  2X8G A;  4K0N A;  1SKW B;  1GUM A;  4HEA 2;  3W8J A;  13GS A;  4EE0 A;  1YEX A;  4BA7 A;  1XBS A;  3UVH A;  1V57 A;  4AJ7 A;  1BED A;  2DSA A;  3VPT A;  2R0C A;  1OVN A;  2WGR A;  1EGR A;  1FAA A;  3HA9 A;  4ECJ A;  1G7O A;  4F2I A;  4NHW A;  3GST A;  3TJF A;  4HS1 A;  1PN9 A;  2WJU A;  2JL4 A;  1F9M A;  1HD2 A;  2GQL A;  2M46 A;  2VL9 A;  1E2Y A;  2DJK A;  2IME A;  2YV7 A;  5JWQ B;  2LRN A;  4PQ1 A;  4ECB A;  3EMX A;  1X5D A;  4XIH A;  1SK2 A;  2DC5 A;  1EEJ A;  3ZTL A;  1K3O A;  2QA1 A;  3DYR A;  3DKS A;  5FWG A;  2FLS A;  3TRP A;  1NSW A;  3EU4 A;  4KF9 A;  1SD8 A;  4LMW A;  1V98 A;  3HY2 A;  1OE7 A;  1XXU A;  3I6A A;  4MK3 A;  5A34 B;  1Y1U A;  2EC4 A;  4KDU A;  1M9B A;  5G2Z A;  3ZRD A;  3TUE A;  2HRF A;  1EZK A;  2A2R A;  4I5Q A;  5J9C A;  4Q5Q A;  2L57 A;  3UIW A;  2RUF A;  3LGC A;  4G10 A;  4KDY A;  4HU7 A;  3MIX A;  4WBJ A;  2HXK A;  3TKS A;  4BVX B;  5J4Y A;  1VF3 A;  1U88 A;  2WCI A;  4RUV A;  2MBT A;  2KOK A;  1ERW A;  4DSR A;  5DCG A;  5A34 A;  5E59 A;  19GS A;  3E3E A;  2VCW A;  5H5S A;  4JR6 A;  2H6Z A;  5D8I A;  1YZX A;  1HQO A;  2HRN A;  1NHY A;  4EC0 A;  1ZYQ B;  4BVX A;  4W66 A;  2IPA A;  3L4N A;  2XBQ A;  16GS A;  3C8E A;  4FQU A;  3ZRE A;  1M2A A;  1OE8 A;  2AYT A;  2GT5 A;  2C0D A;  4KUN A;  3HJO A;  1SD9 A;  4KA0 A;  1OAZ A;  1PMT A;  4AKG A;  2OE3 A;  1SL2 B;  2VCZ A;  3KH7 A;  3NOF A;  2C0E A;  3TJG A;  3E9J B;  3ME8 A;  3KMO A;  2LV3 A;  2C3Q A;  2C0F A;  2YWN A;  2X99 A;  4AI6 A;  5KEJ A;  1T8E B;  2XPD A;  1J08 A;  1RW1 A;  4IS0 A;  5F05 A;  1IYH A;  3A3T A;  5A4U A;  1E6B A;  2TIR A;  2NBS A;  1ZYP A;  2HZE B;  3DWV A;  2CVB A;  2JZT A;  1SYX A;  4AKI A;  2M72 A;  2KLX A;  3UBL A;  5ABR A;  1VF2 A;  2H1B A;  3F4S A;  1EEM A;  2IMK A;  4GCI A;  4ACS A;  3F6F A;  1PKZ A;  2A4V A;  5GZZ B;  4MH3 A;  1GTB A;  1LJR A;  1GWC A;  2BMX A;  2CVK A;  5B7C A;  3M9J A;  2H1L A;  5CRW A;  4D73 B;  3FK8 A;  4OFT A;  2YAN A;  1PX7 A;  4MCU A;  4DEJ A;  1I5G A;  4TR0 A;  2HFD A;  2HZE A;  3C71 A;  3IC4 A;  1O8W A;  4FIW A;  1TXU A;  4V1A p;  2OBK A;  5ECQ B;  2L6C A;  4K7I A;  4IJ3 A;  2LJR A;  1T4Y A;  4G19 A;  3IBH A;  4ICY A;  4BWQ A;  1FB6 A;  1Q4J A;  2LUS A;  2KUC A;  2EFE A;  1MTC A;  1TDI A;  4ZL8 A;  4D73 A;  3ZIT A;  2LJK A;  1Z7R A;  2DJ2 A;  1FB0 A;  3VLN A;  2XHF A;  3GH9 A;  5ECL B;  2VL2 A;  4PX1 A;  2V32 A;  2KP2 A;  5D9V A;  2HZF A;  4MNN A;  3H93 A;  1AUC A;  2FWG A;  3FZA A;  2GZZ A;  3P7X A;  3SWL A;  3J7Y k;  1X9W B;  3TB2 A;  4WET A;  1R7H A;  2KHP A;  4K2D A;  1FW1 A;  2RM5 A;  12GS A;  1XWK A;  2B5X A;  4V1A g;  3LYK A;  11GS A;  4X4J A;  5IMV A;  3CSH A;  2B7J A;  3WGE A;  3GL5 A;  4BIK A;  3DXB A;  1LU4 A;  2YJ7 A;  3PGT A;  1M99 A;  2H71 A;  4FYC A;  4FO5 A;  3KGK A;  1DUG A;  3MSZ A;  1AQV A;  2HE3 A;  2LS5 A;  5KOW A;  1SVM A;  3GRX A;  1SL1 B;  4ISD A;  4G9H A;  2LQO A;  4E8E A;  1Z6M A;  2FY6 A;  1WRY A;  1YEW C;  1ZL9 A;  5CO3 A;  2VLT A;  1UVZ A;  3RHB A;  2QSI A;  5ECH B;  2X8C A;  1T00 A;  4JR4 A;  4E8H A;  3ZZX A;  1G0T A;  3EC3 A;  3DVX A;  2HSM B;  2WFC A;  3TJB A;  5CNW A;  1XVW A;  1A0F A;  2NPB A;  4KE3 A;  3CBU A;  1X9M B;  1NW2 A;  3KZQ A;  4OFM A;  2FHE A;  4YAV A;  3WD6 A;  3DEX A;  2C1Y A;  2LRT A;  1SKS B;  2K8V A;  2WZS A;  4TVE A;  1S3C A;  5D73 A;  1TP9 A;  3W8S A;  2OA7 A;  1B9Y C;  3G9B A;  2HSM A;  4NV2 A;  1XPV A;  2CQ9 A;  4TN8 A;  1U6T A;  4RI6 A;  3APO A;  1IYI A;  3CSJ A;  4Q5F A;  4MZW A;  2WVY A;  4ECI A;  2L4C A;  4L0U A;  3S9F A;  2WW1 A;  1LBK A;  4USS A;  2DIY A;  1F3A A;  1Z6N A;  3QFB C;  4WF5 A;  3I69 A;  1O81 A;  5DVB A;  5D9W A;  5DBQ A;  4CW9 A;  3FKF A;  4QMK A;  1PKW A;  4O5Q A;  1KNG A;  3O6T A;  2IMI A;  2OKA A;  4TR3 A;  1ACV A;  3BOA A;  1EV9 A;  2LJA A;  4ML6 A;  1X5E A;  2YWO A;  1YVL A;  3TKS C;  1TW9 A;  2FWF A;  4HU9 A;  1GNW A;  2X4A A;  5ECI B;  3HMJ G;  4FXY P;  5J4V A;  4WR5 A;  1K0A A;  5DAK B;  3KP9 A;  1GLQ A;  1GSQ A;  3BD2 A;  2YWM A;  2H75 A;  2OAC A;  5B6N A;  4PHZ C;  2X8H A;  3ERW A;  4HSC X;  2VIM A;  4GST A;  5DDL A;  4POL A;  1TRS A;  2YPM A;  6GSX A;  3KCM A;  5F0G A;  2O85 A;  1MD3 A;  3D5J A;  1S3D A;  4POK A;  5DAK A;  4XHM A;  5C00 A;  1PRX A;  3MYD A;  1MD4 A;  4JED A;  2I81 A;  1BQ7 A;  3U6V A;  3RPP A;  1F2E A;  2AB6 A;  2A2S A;  3WYW A;  3FZ5 A;  1XW5 A;  3TJK A;  1OC8 A;  3EU3 A;  3HJP A;  4XTS A;  3K8N A;  2P5R A;  4GQF A;  3DRN A;  4PNG A;  3F3R A;  3JCM L;  1K0O A;  3Q6O A;  2HRK B;  2CA8 A;  4FYB A;  2HRA A;  1N25 A;  3IR4 A;  2OE0 A;  3GUS A;  3D4M A;  2FCH A;  3ZFB A;  2VCT A;  3APS A;  5ECP B;  2TRX A;  1A2J A;  1XFL A;  1SJ6 A;  2CV4 A;  2C8U A;  2CZ3 A;  4OO5 A;  4YKF A;  5G30 A;  4PUR A;  2C4J A;  2DJ0 A;  1Z3E A;  1YF1 A;  1ZGN A;  2ALB A;  2HRK A;  3DIE A;  5CRD A;  1ERT A;  1AIU A;  4I2U A;  4CY6 A;  2HLS A;  1T3B A;  2DKH A;  1UA5 A;  3U5R E;  2H01 A;  2E2G A;  1YY7 A;  2YWI A;  3RAZ A;  1GUH A;  5ELG A;  3TGZ A;  3KTB A;  5H5R A;  4K1F A;  3GL3 A;  4MP4 A;  3TOT A;  2FA8 A;  3VPQ A;  3WT2 A;  2WS2 A;  3FY7 A;  5JCU A;  4N10 A;  4ZB8 A;  2MZC A;  5J4U A;  3CRT A;  4YKG A;  2L5O A;  4AGS A;  3M9K A;  2C0G A;  5IOW A;  4PQH A;  4K7N A;  2E2M A;  3ISO A;  4G0L A;  2R0P A;  3HVV A;  4DSQ A;  3QCP A;  4RQX A;  1A23 A;  2VL2 C;  3ERG A;  6GSW A;  1NHO A;  3LQ7 A;  4H86 A;  3RFR C;  1TRV A;  1XZO A;  3J7Y b;  2B1L A;  5HR2 A;  1H4O A;  2GZP A;  2B6M A;  3ZVJ A;  1TK8 B;  4PTS A;  2UV8 G;  2GSS A;  4GSS A;  2AAW A;  1R5P A;  3QAV A;  5COH A;  1XWG A;  2B1K A;  1BAY A;  3L9V A;  2WVZ A;  2X64 A;  3TKP A;  1WOU A;  4AF2 A;  1ML6 A;  4I97 A;  5ECO B;  1BX9 A;  3F8U A;  1FVK A;  3G7I A;  2ON5 A;  3R3E A;  6GSY A;  1GNE A;  2F3M A;  2GDR A;  4WR4 A;  1SEN A;  1I1I P;  3TDG A;  1QQ2 A;  5J47 A;  2CVD A;  4IW9 A;  5B6M A;  2HI7 A;  5ECS A;  4HDE A;  2RUE A;  2WW3 A;  4JE1 A;  4N30 A;  2B5Y A;  1FHE A;  2HYX A;  4TXO B;  1B48 A;  1SVL A;  3ZML A;  4EKZ A;  3HVX A;  2H0H A;  3LWA A;  2V41 A;  3F4R A;  5A4V A;  4ZBB A;  5H5Q A;  3CQF A;  1AQX A;  5IPH A;  4IP1 A;  4XRD A;  1SK0 A;  2VO4 A;  1XVQ A;  2ES7 A;  3A5W A;  4IQA A;  4ZB7 A;  3PH9 A;  4MMM A;  4PI2 C;  2QA2 A;  4V2N A;  1X9S B;  1EV4 A;  1GLP A;  3IPZ A;  4TXO A;  4L5O A;  1A2M A;  4PNF A;  5HR1 A;  5CP1 A;  1PGT A;  2BTO T;  2E0Q A;  2WW0 A;  3GA4 A;  5D96 A;  1GL8 A;  4YAP A;  4J2F A;  1O73 A;  4X43 A;  2DIZ A;  3BCI A;  3O3T A;  2R37 A;  3M1G A;  3E0U A;  1GH2 A;  2R3X A;  2IMF A;  4F0C A;  2VL3 A;  5FT3 A;  2YZH A;  3BJ5 A;  4MZC A;  4EVM A;  4POM A;  2PMT A;  3LG6 A;  3IV4 A;  4KH7 A;  3IOS A;  4P3Y B;  1PQN A;  3CTG A;  3HXS A;  4GRF A;  3EMP A;  3PPU A;  1PA3 A;  1Y6E A;  1YF0 A;  3RDW A;  1JZR A;  1O7U A;  3VWV A;  4MJC A;  3QD9 A;  2VM1 A;  4OO4 A;  2H6Y A;  4QQ7 A;  22GS A;  3TKS E;  5J3R A;  2VOC A;  2GQK A;  5GAP D;  1TXX A;  3G7Y A;  4Q5R A;  5DAL B;  2LEG A;  4FYU A;  4N0V A;  2WVX B;  2VKZ G;  3QOU A;  5HFG A;  1HNA A;  4RI7 A;  2B3S A;  1SKR B;  3MWH A;  2GSR A;  2MBS A;  3GN3 A;  5KOX A;  1MDJ A;  2K6V A;  4CY8 A;  3L78 A;  2H6X A;  1AC1 A;  5HFI A;  1EP7 A;  1XWC A;  3GTU B;  3EUR A;  4EIQ A;  4HJM A;  3KIJ A;  2O89 A;  1OC9 B;  5DAL A;  2R4V A;  4QL7 A;  3C1S A;  4O32 A;  2O8V B;  2JSY A;  2LST A;  2PVQ A;  2WVX A;  5AIV A;  1DE2 A;  3ED3 A;  4KAE A;  4K7O A;  4MA9 A;  3TKR A;  6GST A;  2DBC A;  5L71 A;  3D6I A;  4WBR D;  1YDK A;  2ON7 A;  2VUP A;  3BCK A;  4DSS B;  1B8X A;  1N8J A;  1JLV A;  3ZYW A;  3GTU A;  4NHZ A;  5DJL A;  3MNG A;  4Q5N A;  2J9H A;  1A8L A;  4XRA A;  1OC9 A;  3HCZ A;  3HD5 A;  3UAR A;  1WIK A;  3WGX A;  5IMZ A;  1B9X C;  2DML A;  1V2A A;  2EIQ A;  5ECR B;  4TR4 A;  4V2L A;  3ZVJ D;  5IMC A;  1J0F A;  4YQV A;  4PUA A;  2YZU A;  2H73 A;  4BL7 B;  3GNJ A;  5CAX A;  5LNK e;  2R0G A;  4DSS A;  2F9S A;  1TOF A;  2OBI A;  3HHV A;  3IAS 2;  3P8W A;  4GWR A;  4F82 A;  1THX A;  1R5A A;  5LD0 A;  2A4H A;  2EIR A;  1ERU A;  2L6D A;  2ZCT A;  2PU9 C;  3GFK A;  3W6G A;  2D2Z A;  2CZ2 A;  4YQM A;  5J40 A;  5G5E A;  2WRT A;  5F07 A;  3GYK A;  3VWW A;  3QR6 A;  4EIP A;  4XS1 A;  2YNX A;  4BL7 A;  3IRA A;  2R6K A;  5GST A;  2I3Y A;  2GS3 A;  1B4P A;  2JZR A;  2F8A A;  3QAW A;  2VCX A;  4F0B A;  4GQC A;  3H8Q A;  3TJJ A;  4JZQ A;  1JHB A;  3P90 A;  1ZCP A;  2H8L A;  3FZ9 A;  4LL1 B;  2I1U A;  2PN8 A;  4K6X A;  2G2Q A;  2LNT A;  3EWL A;  4TRX A;  5EL8 A;  3UL3 A;  2FNO A;  2OJL A;  2H76 A;  1V9W A;  2H30 A;  5IO2 A;  4ZBD A;  6GSV A;  3TRQ A;  2L4Q A;  4AJ8 A;  2H0I A;  2JZS A;  1W4V A;  1GTI A;  4RQR A;  3ZL5 A;  1GSF A;  4XS6 A;  1OYJ A;  4Z7X A;  2EIO A;  1XWA A;  5INY A;  3GMF A;  3LXT A;  4TW5 A;  3LXZ A;  1CQH A;  1THO A;  5DQS A;  5CRE A;  1HNC A;  2RII A;  1GSS A;  4XCS A;  2HQT A;  3D0Z A;  3DVW A;  1FG4 A;  3IE3 A;  5EPF A;  3ERF A;  3A2X A;  2I9H A;  1PD2 1;  1C72 A;  2HSH A;  2JAD A;  1A0R P;  4WXT A;  1T1V A;  2H1G A;  3IDV A;  4MF6 A;  3KEB A;  5IIZ A;  3QPM A;  1AXD A;  2TRC P;  1BJX A;  1USB A;  2B7K A;  2JU5 A;  4GTU A;  2RM6 A;  4LMV A;  1EOG A;  1XG8 A;  3ZFL A;  5CRG A;  2H1A A;  2IIY A;  4BWS A;  4ML1 A;  1Y25 A;  3KXO A;  4K5R A;  2JAC A;  1K0B A;  2IN3 A;  2IL3 A;  2FA4 A;  3UAP A;  3QDN A;  1G6W A;  3LSZ A;  2CAQ A;  4PI0 C;  5J9B A;  1HYU A;  4GDF A;  3VI5 A;  1R26 A;  2ZNM A;  2OAD A;  5IQY A;  4JBB A;  5JWR B;  2H66 A;  1VGL A;  3HVN A;  3HKR A;  2XPE A;  3D22 A;  4MH2 A;  3LFL A;  1TK0 B;  1XOA A;  2CT6 A;  5DCH A;  5B8A A;  1K0C A;  2DJ3 A;  5E4W A;  4KX4 A;  4CDO A;  3ZIJ A;  3BBY A;  4HUA A;  2VLU A;  5CYY A;  4F03 A;  3ZIV A;  5LCZ A;  1TU7 A;  4ILF A;  1ZYE A;  2IWT A;  3UOM A;  3CYN A;  1SK1 A;  4Z2T A;  5A4W A;  5KN1 A;  2PER A;  3DML A;  1A2L A;  4OWY A;  4GXZ A;  2IFQ B;  4EF0 A;  2F8F A;  2GSQ A;  17GS A;  4EDY A;  6GSU A;  1TI1 A;  4K8M A;  4N3Z A;  2YJH A;  2N5B A;  1TKD B;  5AIX A;  4KB3 A;  1BG5 A;  2O5V A;  2PUK C;  2MMN A;  4OCF A;  5HQP A;  1AAZ A;  2V6K A;  4JRR A;  2I4A A;  5KN2 A;  1GUK A;  2VM2 A;  1M3I A;  4ULX A;  2DKI A;  4ZIJ A;  1M0U A;  4TXV A;  1FOV A;  3LJR A;  1M3J A;  3HYP A;  2IFQ A;  4HZ2 A;  1RQM A;  1TJD A;  1Z9H A;  2FWE A;  5AN1 A;  2GT6 A;  3G7J A;  2HT9 A;  1PSQ A;  4FH8 A;  3CSI A;  3Q19 A;  3VUR A;  2K9F A;  2PVO C;  14GS A;  2FD3 A;  1WP0 A;  4KCA A;  3FW2 A;  1PX6 A;  3GX0 A;  1PL1 A;  3F63 A;  3LW9 A;  3CWG A;  4AJ6 A;  3HZ8 A;  2AJQ B;  3CRU A;  5GAN D;  3FR9 A;  3PR8 A;  3C1R A;  4BVY B;  3ZMK A;  5G1K A;  3RHC A;  4I2T A;  2B5E A;  5A1N B;  3LOR A;  1AW9 A;  1GSD A;  4TR1 B;  1JLW A;  2EFD A;  5DQY A;  2MYG A;  3KD0 A;  3EPT A;  4XS4 B;  2IJY A;  2VLV A;  4HI7 A;  4KSO A;  2C3N A;  3GH6 A;  1ZOF A;  4BPY A;  3D4T A;  4N11 A;  1NM3 A;  5BRT A;  4EL1 A;  4K5S A;  2O87 A;  3UEM A;  3UMA A;  4BVY A;  4J56 E;  4PUF C;  1R4W A;  3CTF A;  3R2Q A;  5A1N A;  1Z7P A;  1XW6 A;  3VWU A;  3RGB C;  3APQ A;  4E68 A;  2LQQ A;  4TR1 A;  2K8S A;  3KMN A;  4O5U A;  3M0F A;  3Q18 A;  3M8N A;  4IJI A;  4ZB6 A;  5J41 A;  4Z2U A;  4XS4 A;  1K0N A;  3PIN A;  3LYP A;  4F9Z A;  4IHU A;  5ID2 B;  3TKQ A;  4MAB A;  3GKM A;  2VCQ A;  2R2J A;  1YKC A;  2C80 A;  3F6D A;  4LA1 A;  1TRU A;  4A5P A;  1X0R A;  2O36 A;  1ILO A;  3DGQ A;  1CQG A;  1M7T A;  2H19 A;  3A2V A;  2AHE A;  3KP8 A;  1F6M C;  3H1N A;  3NIV A;  3US3 A;  1M2D A;  3TOU A;  3GX8 A;  4J57 E;  1EGO A;  3F4T A;  2V2G A;  3DD3 A;  1UC7 A;  1WPI A;  2V1M A;  4DVC A;  5ID2 A;  9GSS A;  2IMD A;  4L0W A;  2VCV A;  1B4Q A;  1V58 A;  2P0G A;  1VRS D;  3MDK A;  3D21 A;  5D9T A;  4K2X A;  2CAI A;  2KP1 A;  2DMM A;  1QMV A;  1X5C A;  1YKA A;  2WDU A;  3C7M A;  2M80 A;  3WGD A;  3H79 A;  1SYR A;  4NMU A;  3IA1 A;  1GSE A;  4KDX A;  1BF5 A;  3FRC A;  4K9Z A;  4EXJ A;  3EIN A;  1BYE A;  3HVS A;  2PWJ A;  2EFH A;  3L9U A;  4IGJ A;  2ZUP A;  20GS A;  1S4B P;  4V2M A;  1ZYN A;  3QMX A;  2FWH A;  3UJ1 A;  1TU8 A;  1EP8 A;  1YEP A;  4AKH A;  2L5L A;  1QGV A;  1G6Y A;  1DBY A;  2XBI A;  2MMA A;  4TOP A;  5KN3 A;  1Z5Y E;  4MLY A;  4I6X A;  2GTU A;  2R5G A;  3F3Q A;  4WF4 A;  1YQ1 A;  1J9B A;  1SU9 A;  2X49 A;  4ZL7 A;  3VI7 A;  1EWX A;  3GIX A;  1SJI A;  2G0F A;  2O7K A;  1UN2 A;  2H0G A;  3NZN A;  3M3M A;  3WT1 A;  3ZLP A;  2A2P A;  1FVJ A;  5IO0 A;  2DLX A;  3EYT A;  3IK7 A;  2MMO A;  2WW2 A;  5B8B A;  3KJY A;  4EO3 A;  5D93 A;  1MEK A;  4K0G A;  2N5A A;  1MDK A;  5HFK A;  2QC7 A;  2GLR A;  1URM A;  2C3T A;  4MJA A;  1ZZY A;  3FEU A;  2GQM A;  1T7P B;  4L8E A;  4NV5 A;  1S3A A;  4KGI A;  3VWX A;  1JZW A;  4LLR A;  4IQ1 A;  3IXR A;  4JU5 A;  5KN0 A;  3IHQ A;  6GSS A;  3MAK A;  2YN1 A;  3Q74 A;  4HOJ A;  4WKW A;  4IVF A;  18GS A;  4PXO A;  1T4Z A;  3UBK A;  3A2W A;  3CMI A;  2EFC A;  2PGT A;  1A24 A;  2E7P A;  4ECC A;  4OCE A;  1A8Y A;  2CX3 A;  5D9X A;  1U3I A;  5GSS A;  4GF0 A;  1GUL A;  1W89 A;  1O6J A;  2YV9 A;  2UZ8 A;  3FMW A;  1GTU A;  1PL2 A;  5G31 A;  4ID0 A;  3GKN A;  3IHG A;  2GVP A;  2H72 A;  8GSS A;  3F9U A;  5DJM A;  5J5N A;  2PPT A;  4O7H A;  1PFO A;  1ABA A;  5IMA A;  2O3E A;  1QFN A;  3IK9 A;  3GHA A;  1XW9 A;  2OE1 A;  4MF5 A;  5HR0 A;  4MPG A;  2XC2 A;  1OC3 A;  4I8B A;  4MDC A;  2VD1 A;  3KTL A;  5F8B A;  1XWB A;  3IAM 2;  3KH9 A;  1TRW A;  4G2E A;  2HSN B;  5G5F A;  1WMJ A;  4WEY A;  3C73 A;  3N5O A;  2JSZ A;  2LKU A;  1ERV A;  2DJJ A;  4MZB A;  5IMF A;  4OD7 A;  2RLI A;  2QGV A;  3FYG A;  4CHS A;  3GKK A;  1Q98 A;  3P2A A;  3GSS A;  2DJ1 A;  2WZ9 A;  4EUY A;  4GLT A;  1K0D A;  1JZO A;  4AKX B;  2HSN A;  4IEL A;  1TK5 B;  1U3A A;  1JZD A;  4KW6 A;  3CHX C;  3LEF A;  2VAF A;  3CXG A;  3F0I A;  1XOB A;  3H4K A;  2Z9S A;  4MJB A;  5IPG A;  1I9D A;  4IP6 A;  2YOI A;  3HZ4 A;  4NPB A;  1WJK A;  2WUL A;  1ON4 A;  1GSU A;  4HQS A;  4NAX A;  2PBJ A;  1GSY A;  3KM6 A;  3TCO A;  4YQU A;  1K3Y A;  3TU3 B;  2LRC A;  5BMU B;  1WE0 A;  4G0I A;  1QUW A; 
#chains in the Genus database with same CATH homology
 5F06 A;  3GKX A;  1O8X A;  2YP6 A;  3A5I A;  2AV4 A;  2H1D A;  2LTK A;  2OT3 A;  2REM A;  3VFI A;  4X1U A;  3HDC A;  1FOH A;  1F37 A;  2K18 A;  4MF7 A;  3AY8 A;  4NXI A;  1H75 A;  4NWY A;  1GTA A;  1TI3 A;  1QXH A;  5BMU A;  3ME7 A;  4HZ4 A;  2F51 A;  4PQI A;  3RBT A;  5JCG A;  1ZMA A;  5ECM B;  3VK9 A;  2P31 A;  5ECN B;  1QUW A;  1RK4 A;  5IOX A;  4GSN A;  4IBP A;  4HJ2 A;  2BJX A;  1G7E A;  2CX4 A;  2LNS A;  2MMZ A;  1OKD A;  3FHK A;  2YCD A;  1VF1 A;  4G0K A;  3IC8 A;  4O92 A;  2QKE A;  5IM9 A;  2V6O A;  4L5L A;  4O5R A;  5JWO B;  3FR3 A;  5C04 A;  5JCW A;  4MJE A;  1K3L A;  1OKT A;  5G1L A;  5FHI A;  1F3B A;  4OMV A;  1TTZ A;  1YJ6 A;  3EE2 A;  1GP1 A;  1XIY A;  1SL0 B;  1M9A A;  3QAG A;  3V1W A;  1U87 A;  2NVL A;  3O76 A;  1SJZ A;  5AGY A;  2FUG 2;  4HQZ A;  2HSY A;  1MDI A;  2P5Q A;  4EDZ A;  3HJM A;  1V40 A;  4ZL9 A;  4TKY A;  4YH2 A;  5A5K A;  1QK8 A;  4OFN A;  3L0H A;  1KEB A;  1ST9 A;  3GV1 A;  1KTE A;  4Z2R A;  2N5F A;  4ZB9 A;  1WWJ A;  5A5H B;  3QFA C;  5HR3 A;  4PGT A;  3SBC A;  4KND A;  5ENU A;  4LL4 B;  2J23 A;  1K0M A;  4ZXG A;  10GS A;  2H74 A;  3N9J A;  2WB9 A;  1EOH A;  5EVO A;  2GZY A;  4MPF A;  3UVT A;  1BG1 A;  1DE1 A;  2AUV A;  3RPN A;  3I43 A;  4ZIL A;  4G01 A;  3L9S A;  5ECK B;  5IMD A;  1FO5 A;  4QL9 A;  4POB A;  2NTO A;  2L59 A;  4N0Z A;  3FR6 A;  5EY6 A;  2H70 A;  5A5H A;  4ZBA A;  4IN0 A;  1PN0 A;  5CRH A;  4X0X A;  3EVI A;  1M2B A;  5AIS A;  1SVO A;  3GUR A;  4KCE A;  2GGT A;  5ELA A;  1DSB A;  1N2A A;  2GST A;  3FZ4 A;  1GRX A;  4IKH A;  2VD0 A;  2FGX A;  3OR5 A;  2NDO A;  1AQW A;  2HNL A;  1XCC A;  4KSM A;  1O85 A;  1KBN A;  1VF4 A;  3TRX A;  1HNB A;  7GSS A;  1JFU A;  3I9V 2;  2X8G A;  4K0N A;  1SKW B;  1GUM A;  4HEA 2;  3W8J A;  13GS A;  4EE0 A;  1YEX A;  4BA7 A;  1XBS A;  3UVH A;  1V57 A;  4AJ7 A;  1BED A;  2DSA A;  3VPT A;  2R0C A;  1OVN A;  2WGR A;  1EGR A;  1FAA A;  3HA9 A;  4ECJ A;  1G7O A;  4F2I A;  4NHW A;  3GST A;  3TJF A;  4HS1 A;  1PN9 A;  2WJU A;  2JL4 A;  1F9M A;  1HD2 A;  2GQL A;  2M46 A;  2VL9 A;  1E2Y A;  2DJK A;  2IME A;  2YV7 A;  5JWQ B;  2LRN A;  4PQ1 A;  4ECB A;  3EMX A;  1X5D A;  4XIH A;  1SK2 A;  2DC5 A;  1EEJ A;  3ZTL A;  1K3O A;  2QA1 A;  3DYR A;  3DKS A;  5FWG A;  2FLS A;  3TRP A;  1NSW A;  3EU4 A;  4KF9 A;  1SD8 A;  4LMW A;  1V98 A;  3HY2 A;  1OE7 A;  1XXU A;  3I6A A;  4MK3 A;  5A34 B;  1Y1U A;  2EC4 A;  4KDU A;  1M9B A;  5G2Z A;  3ZRD A;  3TUE A;  2HRF A;  1EZK A;  2A2R A;  4I5Q A;  5J9C A;  4Q5Q A;  2L57 A;  3UIW A;  2RUF A;  3LGC A;  4G10 A;  4KDY A;  4HU7 A;  3MIX A;  4WBJ A;  2HXK A;  3TKS A;  4BVX B;  5J4Y A;  1VF3 A;  1U88 A;  2WCI A;  4RUV A;  2MBT A;  2KOK A;  1ERW A;  4DSR A;  5DCG A;  5A34 A;  5E59 A;  19GS A;  3E3E A;  2VCW A;  5H5S A;  4JR6 A;  2H6Z A;  5D8I A;  1YZX A;  1HQO A;  2HRN A;  1NHY A;  4EC0 A;  1ZYQ B;  4BVX A;  4W66 A;  2IPA A;  3L4N A;  2XBQ A;  16GS A;  3C8E A;  4FQU A;  3ZRE A;  1M2A A;  1OE8 A;  2AYT A;  2GT5 A;  2C0D A;  4KUN A;  3HJO A;  1SD9 A;  4KA0 A;  1OAZ A;  1PMT A;  4AKG A;  2OE3 A;  1SL2 B;  2VCZ A;  3KH7 A;  3NOF A;  2C0E A;  3TJG A;  3E9J B;  3ME8 A;  3KMO A;  2LV3 A;  2C3Q A;  2C0F A;  2YWN A;  2X99 A;  4AI6 A;  5KEJ A;  1T8E B;  2XPD A;  1J08 A;  1RW1 A;  4IS0 A;  5F05 A;  1IYH A;  3A3T A;  5A4U A;  1E6B A;  2TIR A;  2NBS A;  1ZYP A;  2HZE B;  3DWV A;  2CVB A;  2JZT A;  1SYX A;  4AKI A;  2M72 A;  2KLX A;  3UBL A;  5ABR A;  1VF2 A;  2H1B A;  3F4S A;  1EEM A;  2IMK A;  4GCI A;  4ACS A;  3F6F A;  1PKZ A;  2A4V A;  5GZZ B;  4MH3 A;  1GTB A;  1LJR A;  1GWC A;  2BMX A;  2CVK A;  5B7C A;  3M9J A;  2H1L A;  5CRW A;  4D73 B;  3FK8 A;  4OFT A;  2YAN A;  1PX7 A;  4MCU A;  4DEJ A;  1I5G A;  4TR0 A;  2HFD A;  2HZE A;  3C71 A;  3IC4 A;  1O8W A;  4FIW A;  1TXU A;  4V1A p;  2OBK A;  5ECQ B;  2L6C A;  4K7I A;  4IJ3 A;  2LJR A;  1T4Y A;  4G19 A;  3IBH A;  4ICY A;  4BWQ A;  1FB6 A;  1Q4J A;  2LUS A;  2KUC A;  2EFE A;  1MTC A;  1TDI A;  4ZL8 A;  4D73 A;  3ZIT A;  2LJK A;  1Z7R A;  2DJ2 A;  1FB0 A;  3VLN A;  2XHF A;  3GH9 A;  5ECL B;  2VL2 A;  4PX1 A;  2V32 A;  2KP2 A;  5D9V A;  2HZF A;  4MNN A;  3H93 A;  1AUC A;  2FWG A;  3FZA A;  2GZZ A;  3P7X A;  3SWL A;  3J7Y k;  1X9W B;  3TB2 A;  4WET A;  1R7H A;  2KHP A;  4K2D A;  1FW1 A;  2RM5 A;  12GS A;  1XWK A;  2B5X A;  4V1A g;  3LYK A;  11GS A;  4X4J A;  5IMV A;  3CSH A;  2B7J A;  3WGE A;  3GL5 A;  3DXB A;  1LU4 A;  2YJ7 A;  3PGT A;  1M99 A;  2H71 A;  4FYC A;  4FO5 A;  3KGK A;  1DUG A;  3MSZ A;  1AQV A;  2HE3 A;  2LS5 A;  5KOW A;  1SVM A;  3GRX A;  1SL1 B;  4ISD A;  4G9H A;  2LQO A;  4E8E A;  1Z6M A;  2FY6 A;  1WRY A;  1ZL9 A;  5CO3 A;  2VLT A;  1UVZ A;  3RHB A;  2QSI A;  5ECH B;  2X8C A;  1T00 A;  4JR4 A;  4E8H A;  3ZZX A;  1G0T A;  3EC3 A;  3DVX A;  2HSM B;  2WFC A;  3TJB A;  5CNW A;  1XVW A;  1A0F A;  2NPB A;  4KE3 A;  3CBU A;  1X9M B;  1NW2 A;  3KZQ A;  4OFM A;  2FHE A;  4YAV A;  3WD6 A;  3DEX A;  2C1Y A;  2LRT A;  1SKS B;  2K8V A;  4TVE A;  1S3C A;  5D73 A;  1TP9 A;  3W8S A;  2OA7 A;  1B9Y C;  3G9B A;  2HSM A;  4NV2 A;  1XPV A;  2CQ9 A;  4TN8 A;  1U6T A;  4RI6 A;  3APO A;  1IYI A;  3CSJ A;  4Q5F A;  4MZW A;  4ECI A;  2L4C A;  4L0U A;  3S9F A;  1LBK A;  4USS A;  2DIY A;  1F3A A;  1Z6N A;  3QFB C;  4WF5 A;  3I69 A;  1O81 A;  5DVB A;  5D9W A;  5DBQ A;  4CW9 A;  3FKF A;  4QMK A;  1PKW A;  4O5Q A;  1KNG A;  3O6T A;  2IMI A;  2OKA A;  4TR3 A;  1ACV A;  3BOA A;  1EV9 A;  2LJA A;  4ML6 A;  1X5E A;  2YWO A;  1YVL A;  3TKS C;  1TW9 A;  2FWF A;  4HU9 A;  1GNW A;  2X4A A;  5ECI B;  3HMJ G;  5J4V A;  4WR5 A;  1K0A A;  5DAK B;  3KP9 A;  1GLQ A;  1GSQ A;  3BD2 A;  2YWM A;  2H75 A;  2OAC A;  5B6N A;  2X8H A;  3ERW A;  2VIM A;  4GST A;  5DDL A;  4POL A;  1TRS A;  2YPM A;  6GSX A;  3KCM A;  5F0G A;  2O85 A;  1MD3 A;  3D5J A;  1S3D A;  4POK A;  5DAK A;  4XHM A;  5C00 A;  1PRX A;  3MYD A;  1MD4 A;  4JED A;  2I81 A;  1BQ7 A;  3U6V A;  3RPP A;  1F2E A;  2AB6 A;  2A2S A;  3WYW A;  3FZ5 A;  1XW5 A;  3TJK A;  1OC8 A;  3EU3 A;  3HJP A;  4XTS A;  3K8N A;  2P5R A;  4GQF A;  3DRN A;  4PNG A;  3F3R A;  3JCM L;  1K0O A;  3Q6O A;  2HRK B;  2CA8 A;  4FYB A;  2HRA A;  1N25 A;  3IR4 A;  2OE0 A;  3GUS A;  3D4M A;  2FCH A;  3ZFB A;  2VCT A;  3APS A;  5ECP B;  2TRX A;  1A2J A;  1XFL A;  1SJ6 A;  2CV4 A;  2C8U A;  2CZ3 A;  4OO5 A;  4YKF A;  5G30 A;  4PUR A;  2C4J A;  2DJ0 A;  1Z3E A;  1YF1 A;  1ZGN A;  2ALB A;  2HRK A;  3DIE A;  5CRD A;  1ERT A;  1AIU A;  4I2U A;  4CY6 A;  2HLS A;  1T3B A;  2DKH A;  1UA5 A;  3U5R E;  2H01 A;  2E2G A;  1YY7 A;  2YWI A;  3RAZ A;  1GUH A;  5ELG A;  3TGZ A;  5H5R A;  4K1F A;  3GL3 A;  4MP4 A;  3TOT A;  2FA8 A;  3VPQ A;  3WT2 A;  2WS2 A;  3FY7 A;  5JCU A;  4N10 A;  4ZB8 A;  2MZC A;  5J4U A;  3CRT A;  4YKG A;  2L5O A;  4AGS A;  3M9K A;  2C0G A;  5IOW A;  4PQH A;  4K7N A;  2E2M A;  3ISO A;  4G0L A;  2R0P A;  3HVV A;  4DSQ A;  3QCP A;  4RQX A;  1A23 A;  2VL2 C;  3ERG A;  6GSW A;  1NHO A;  3LQ7 A;  4H86 A;  1TRV A;  1XZO A;  3J7Y b;  2B1L A;  5HR2 A;  1H4O A;  2GZP A;  2B6M A;  3ZVJ A;  1TK8 B;  4PTS A;  2UV8 G;  2GSS A;  4GSS A;  2AAW A;  1R5P A;  3QAV A;  5COH A;  1XWG A;  2B1K A;  1BAY A;  3L9V A;  2X64 A;  3TKP A;  1WOU A;  4AF2 A;  1ML6 A;  4I97 A;  5ECO B;  1BX9 A;  3F8U A;  1FVK A;  3G7I A;  2ON5 A;  3R3E A;  6GSY A;  1GNE A;  2F3M A;  2GDR A;  4WR4 A;  1SEN A;  3TDG A;  1QQ2 A;  5J47 A;  2CVD A;  4IW9 A;  5B6M A;  2HI7 A;  5ECS A;  4HDE A;  2RUE A;  4JE1 A;  4N30 A;  2B5Y A;  1FHE A;  2HYX A;  4TXO B;  1B48 A;  1SVL A;  3ZML A;  4EKZ A;  3HVX A;  2H0H A;  3LWA A;  2V41 A;  3F4R A;  5A4V A;  4ZBB A;  5H5Q A;  1AQX A;  5IPH A;  4IP1 A;  4XRD A;  1SK0 A;  2VO4 A;  1XVQ A;  2ES7 A;  3A5W A;  4IQA A;  4ZB7 A;  3PH9 A;  4MMM A;  2QA2 A;  4V2N A;  1X9S B;  1EV4 A;  1GLP A;  3IPZ A;  4TXO A;  4L5O A;  1A2M A;  4PNF A;  5HR1 A;  5CP1 A;  1PGT A;  2BTO T;  2E0Q A;  3GA4 A;  5D96 A;  1GL8 A;  4YAP A;  4J2F A;  1O73 A;  4X43 A;  2DIZ A;  3BCI A;  3O3T A;  2R37 A;  3M1G A;  3E0U A;  1GH2 A;  2R3X A;  2IMF A;  4F0C A;  2VL3 A;  5FT3 A;  2YZH A;  3BJ5 A;  4MZC A;  4EVM A;  4POM A;  2PMT A;  3LG6 A;  3IV4 A;  4KH7 A;  3IOS A;  4P3Y B;  1PQN A;  3CTG A;  3HXS A;  4GRF A;  3EMP A;  3PPU A;  1PA3 A;  1Y6E A;  1YF0 A;  3RDW A;  1JZR A;  1O7U A;  3VWV A;  4MJC A;  3QD9 A;  2VM1 A;  4OO4 A;  2H6Y A;  4QQ7 A;  22GS A;  3TKS E;  5J3R A;  2VOC A;  2GQK A;  5GAP D;  1TXX A;  3G7Y A;  4Q5R A;  5DAL B;  2LEG A;  4FYU A;  4N0V A;  2VKZ G;  3QOU A;  5HFG A;  1HNA A;  4RI7 A;  2B3S A;  1SKR B;  3MWH A;  2GSR A;  2MBS A;  3GN3 A;  5KOX A;  1MDJ A;  2K6V A;  4CY8 A;  3L78 A;  2H6X A;  1AC1 A;  5HFI A;  1EP7 A;  1XWC A;  3GTU B;  3EUR A;  4EIQ A;  4HJM A;  3KIJ A;  2O89 A;  1OC9 B;  5DAL A;  2R4V A;  4QL7 A;  3C1S A;  4O32 A;  2O8V B;  2JSY A;  2LST A;  2PVQ A;  5AIV A;  1DE2 A;  3ED3 A;  4KAE A;  4K7O A;  4MA9 A;  3TKR A;  6GST A;  2DBC A;  5L71 A;  3D6I A;  4WBR D;  1YDK A;  2ON7 A;  2VUP A;  3BCK A;  4DSS B;  1B8X A;  1N8J A;  1JLV A;  3ZYW A;  3GTU A;  4NHZ A;  5DJL A;  3MNG A;  4Q5N A;  2J9H A;  1A8L A;  4XRA A;  1OC9 A;  3HCZ A;  3HD5 A;  3UAR A;  1WIK A;  3WGX A;  5IMZ A;  1B9X C;  2DML A;  1V2A A;  2EIQ A;  5ECR B;  4TR4 A;  4V2L A;  3ZVJ D;  5IMC A;  1J0F A;  4YQV A;  4PUA A;  2YZU A;  2H73 A;  4BL7 B;  3GNJ A;  5CAX A;  5LNK e;  2R0G A;  4DSS A;  2F9S A;  1TOF A;  2OBI A;  3HHV A;  3IAS 2;  3P8W A;  4GWR A;  4F82 A;  1THX A;  1R5A A;  5LD0 A;  2A4H A;  2EIR A;  1ERU A;  2L6D A;  2ZCT A;  2PU9 C;  3GFK A;  3W6G A;  2D2Z A;  2CZ2 A;  4YQM A;  5J40 A;  5G5E A;  2WRT A;  5F07 A;  3GYK A;  3VWW A;  3QR6 A;  4EIP A;  4XS1 A;  2YNX A;  4BL7 A;  3IRA A;  2R6K A;  5GST A;  2I3Y A;  2GS3 A;  1B4P A;  2JZR A;  2F8A A;  3QAW A;  2VCX A;  4F0B A;  4GQC A;  3H8Q A;  3TJJ A;  4JZQ A;  1JHB A;  3P90 A;  1ZCP A;  2H8L A;  3FZ9 A;  4LL1 B;  2I1U A;  2PN8 A;  4K6X A;  2G2Q A;  2LNT A;  3EWL A;  4TRX A;  5EL8 A;  3UL3 A;  2FNO A;  2OJL A;  2H76 A;  1V9W A;  2H30 A;  5IO2 A;  4ZBD A;  6GSV A;  3TRQ A;  2L4Q A;  4AJ8 A;  2H0I A;  2JZS A;  1W4V A;  1GTI A;  4RQR A;  3ZL5 A;  1GSF A;  4XS6 A;  1OYJ A;  4Z7X A;  2EIO A;  1XWA A;  5INY A;  3GMF A;  3LXT A;  4TW5 A;  3LXZ A;  1CQH A;  1THO A;  5DQS A;  5CRE A;  1HNC A;  2RII A;  1GSS A;  4XCS A;  2HQT A;  3D0Z A;  3DVW A;  1FG4 A;  3IE3 A;  5EPF A;  3ERF A;  3A2X A;  2I9H A;  1PD2 1;  1C72 A;  2HSH A;  2JAD A;  1A0R P;  4WXT A;  1T1V A;  2H1G A;  3IDV A;  4MF6 A;  3KEB A;  5IIZ A;  3QPM A;  1AXD A;  2TRC P;  1BJX A;  1USB A;  2B7K A;  2JU5 A;  4GTU A;  2RM6 A;  4LMV A;  1EOG A;  3ZFL A;  5CRG A;  2H1A A;  2IIY A;  4BWS A;  4ML1 A;  1Y25 A;  3KXO A;  4K5R A;  2JAC A;  1K0B A;  2IN3 A;  2IL3 A;  2FA4 A;  3UAP A;  3QDN A;  1G6W A;  3LSZ A;  2CAQ A;  5J9B A;  1HYU A;  4GDF A;  3VI5 A;  1R26 A;  2ZNM A;  2OAD A;  5IQY A;  4JBB A;  5JWR B;  2H66 A;  1VGL A;  3HKR A;  2XPE A;  3D22 A;  4MH2 A;  3LFL A;  1TK0 B;  1XOA A;  2CT6 A;  5DCH A;  5B8A A;  1K0C A;  2DJ3 A;  5E4W A;  4KX4 A;  4CDO A;  3ZIJ A;  3BBY A;  4HUA A;  2VLU A;  5CYY A;  4F03 A;  3ZIV A;  5LCZ A;  1TU7 A;  4ILF A;  1ZYE A;  2IWT A;  3UOM A;  3CYN A;  1SK1 A;  4Z2T A;  5A4W A;  5KN1 A;  2PER A;  3DML A;  1A2L A;  4OWY A;  4GXZ A;  2IFQ B;  4EF0 A;  2F8F A;  2GSQ A;  17GS A;  4EDY A;  6GSU A;  1TI1 A;  4K8M A;  4N3Z A;  2YJH A;  2N5B A;  1TKD B;  5AIX A;  4KB3 A;  1BG5 A;  2O5V A;  2PUK C;  2MMN A;  4OCF A;  5HQP A;  1AAZ A;  2V6K A;  4JRR A;  2I4A A;  5KN2 A;  1GUK A;  2VM2 A;  4ULX A;  2DKI A;  4ZIJ A;  1M0U A;  4TXV A;  1FOV A;  3LJR A;  3HYP A;  2IFQ A;  4HZ2 A;  1RQM A;  1TJD A;  1Z9H A;  2FWE A;  5AN1 A;  2GT6 A;  3G7J A;  2HT9 A;  1PSQ A;  4FH8 A;  3CSI A;  3Q19 A;  3VUR A;  2K9F A;  2PVO C;  14GS A;  2FD3 A;  1WP0 A;  4KCA A;  3FW2 A;  1PX6 A;  3GX0 A;  1PL1 A;  3F63 A;  3LW9 A;  3CWG A;  4AJ6 A;  3HZ8 A;  2AJQ B;  3CRU A;  5GAN D;  3FR9 A;  3PR8 A;  3C1R A;  4BVY B;  3ZMK A;  5G1K A;  3RHC A;  4I2T A;  2B5E A;  5A1N B;  3LOR A;  1AW9 A;  1GSD A;  4TR1 B;  1JLW A;  2EFD A;  5DQY A;  2MYG A;  3KD0 A;  3EPT A;  4XS4 B;  2IJY A;  2VLV A;  4HI7 A;  4KSO A;  2C3N A;  3GH6 A;  1ZOF A;  4BPY A;  3D4T A;  4N11 A;  1NM3 A;  5BRT A;  4EL1 A;  4K5S A;  2O87 A;  3UEM A;  3UMA A;  4BVY A;  4J56 E;  4PUF C;  1R4W A;  3CTF A;  3R2Q A;  5A1N A;  1Z7P A;  1XW6 A;  3VWU A;  3APQ A;  4E68 A;  2LQQ A;  4TR1 A;  2K8S A;  3KMN A;  4O5U A;  3M0F A;  3Q18 A;  3M8N A;  4IJI A;  4ZB6 A;  5J41 A;  4Z2U A;  4XS4 A;  1K0N A;  3PIN A;  3LYP A;  4F9Z A;  4IHU A;  5ID2 B;  3TKQ A;  4MAB A;  3GKM A;  2VCQ A;  2R2J A;  1YKC A;  2C80 A;  3F6D A;  4LA1 A;  1TRU A;  4A5P A;  1X0R A;  1ILO A;  3DGQ A;  1CQG A;  1M7T A;  2H19 A;  3A2V A;  2AHE A;  3KP8 A;  1F6M C;  3H1N A;  3NIV A;  3US3 A;  1M2D A;  3TOU A;  3GX8 A;  4J57 E;  1EGO A;  3F4T A;  2V2G A;  3DD3 A;  1UC7 A;  1WPI A;  2V1M A;  4DVC A;  5ID2 A;  9GSS A;  2IMD A;  4L0W A;  2VCV A;  1B4Q A;  1V58 A;  2P0G A;  1VRS D;  3MDK A;  3D21 A;  5D9T A;  4K2X A;  2CAI A;  2KP1 A;  2DMM A;  1QMV A;  1X5C A;  1YKA A;  2WDU A;  3C7M A;  2M80 A;  3WGD A;  3H79 A;  1SYR A;  4NMU A;  3IA1 A;  1GSE A;  4KDX A;  1BF5 A;  3FRC A;  4K9Z A;  4EXJ A;  3EIN A;  1BYE A;  3HVS A;  2PWJ A;  2EFH A;  3L9U A;  4IGJ A;  2ZUP A;  20GS A;  4V2M A;  1ZYN A;  3QMX A;  2FWH A;  3UJ1 A;  1TU8 A;  1EP8 A;  1YEP A;  4AKH A;  2L5L A;  1QGV A;  1G6Y A;  1DBY A;  2XBI A;  2MMA A;  4TOP A;  5KN3 A;  1Z5Y E;  4MLY A;  4I6X A;  2GTU A;  2R5G A;  3F3Q A;  4WF4 A;  1YQ1 A;  1J9B A;  1SU9 A;  2X49 A;  4ZL7 A;  3VI7 A;  1EWX A;  3GIX A;  1SJI A;  2G0F A;  2O7K A;  1UN2 A;  2H0G A;  3NZN A;  3M3M A;  3WT1 A;  3ZLP A;  2A2P A;  1FVJ A;  5IO0 A;  2DLX A;  3EYT A;  3IK7 A;  2MMO A;  5B8B A;  3KJY A;  4EO3 A;  5D93 A;  1MEK A;  4K0G A;  2N5A A;  1MDK A;  5HFK A;  2QC7 A;  2GLR A;  1URM A;  2C3T A;  4MJA A;  1ZZY A;  3FEU A;  2GQM A;  1T7P B;  4L8E A;  4NV5 A;  1S3A A;  4KGI A;  3VWX A;  1JZW A;  4LLR A;  4IQ1 A;  3IXR A;  4JU5 A;  5KN0 A;  3IHQ A;  6GSS A;  3MAK A;  2YN1 A;  3Q74 A;  4HOJ A;  4WKW A;  4IVF A;  18GS A;  4PXO A;  1T4Z A;  3UBK A;  3A2W A;  3CMI A;  2EFC A;  2PGT A;  1A24 A;  2E7P A;  4ECC A;  4OCE A;  1A8Y A;  2CX3 A;  5D9X A;  1U3I A;  5GSS A;  4GF0 A;  1GUL A;  1W89 A;  1O6J A;  2YV9 A;  2UZ8 A;  3FMW A;  1GTU A;  1PL2 A;  5G31 A;  4ID0 A;  3GKN A;  3IHG A;  2GVP A;  2H72 A;  8GSS A;  3F9U A;  5DJM A;  5J5N A;  2PPT A;  4O7H A;  1ABA A;  5IMA A;  1QFN A;  3IK9 A;  3GHA A;  1XW9 A;  2OE1 A;  4MF5 A;  5HR0 A;  4MPG A;  2XC2 A;  1OC3 A;  4I8B A;  4MDC A;  2VD1 A;  3KTL A;  5F8B A;  1XWB A;  3IAM 2;  3KH9 A;  1TRW A;  4G2E A;  2HSN B;  5G5F A;  1WMJ A;  4WEY A;  3C73 A;  3N5O A;  2JSZ A;  2LKU A;  1ERV A;  2DJJ A;  4MZB A;  5IMF A;  4OD7 A;  2RLI A;  2QGV A;  3FYG A;  4CHS A;  3GKK A;  1Q98 A;  3P2A A;  3GSS A;  2DJ1 A;  2WZ9 A;  4EUY A;  4GLT A;  1K0D A;  1JZO A;  4AKX B;  2HSN A;  4IEL A;  1TK5 B;  1U3A A;  1JZD A;  4KW6 A;  3LEF A;  2VAF A;  3CXG A;  3F0I A;  1XOB A;  3H4K A;  2Z9S A;  4MJB A;  5IPG A;  1I9D A;  4IP6 A;  2YOI A;  3HZ4 A;  4NPB A;  1WJK A;  2WUL A;  1ON4 A;  1GSU A;  4HQS A;  4NAX A;  2PBJ A;  1GSY A;  3KM6 A;  3TCO A;  4YQU A;  1K3Y A;  3TU3 B;  2LRC A;  5BMU B;  1WE0 A;  4G0I A;  3KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...