1GULA

Human glutathione transferase a4-4 complex with iodobenzyl glutathione
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
217
structure length
217
Chain Sequence
b'RPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE A4-4
publication title Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gulA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gulA01
2VOCA 4K1FA 3FW2A 2CZ2A 1T3BA 2YZUA 4O7HA 5KN0A 1X9SB 3ZVJA 4G9HA 2ES7A 2H6XA 3KH9A 2B6MA 4KDYA 3Q6OA 4KUNA 1GTAA 2DJ3A 2TRXA 4GSNA 5ECLB 4NHZA 1GUMA 3UBLA 1JZRA 4X43A 1V9WA 1GUHA 4ID0A 3EVIA 3FYGA 3F3QA 4E8EA 4I2UA 4OFMA 1G7OA 3JCML 3CRTA 4PQIA 2OBKA 3GH6A 5ELGA 5HQPA 1PQNA 2GVPA 5HR0A 1DE1A 5C04A 2GZPA 4G2EA 4HS1A 5EY6A 4YAPA 2KHPA 5HFKA 2LRNA 2HSYA 2ZUPA 3DD3A 4HQSA 1Z7PA 5ELAA 4CHSA 3F0IA 1TP9A 2H66A 1K0DA 3RPPA 4JZQA 2CAIA 4OWYA 4J56E 2V6KA 5D93A 5DQSA 1X9WB 3ISOA 19GSA 1OC9B 1TDIA 2H19A 3U6VA 1PX7A 2DMMA 1IYIA 5J41A 1XWAA 2B7KA 5AN1A 5GAPD 2MMZA 3FZ5A 2H6YA 1PL2A 2IFQA 5C00A 4V2MA 2R37A 4XIHA 1WWJA 3IOSA 2LTKA 4G0KA 2H71A 4ECIA 1BEDA 3HY2A 1XWCA 2VCWA 4H86A 1B9YC 4JEDA 5CRHA 3TJFA 4BVXB 1R5PA 4NV2A 3IE3A 3LORA 2DIZA 1SK0A 3HZ4A 4MPGA 1PX6A 3HHVA 5IMAA 4KE3A 3QAVA 1ACVA 4XTSA 1SK1A 3MNGA 5IMVA 3UJ1A 3HXSA 3GTUB 2JADA 3ED3A 3RAZA 4BL7A 1XCCA 3GX0A 3W8JA 2H74A 4MZBA 3VI5A 4TKYA 2GGTA 3KIJA 1G6YA 4D73B 3BCKA 1GULA 4POMA 1RW1A 1A2LA 1EGOA 4TRXA 2MBTA 1M2AA 2QSIA 1XVWA 5IMCA 3D6IA 1Y6EA 5L71A 1TI3A 2HRKB 2VLTA 1PN9A 4RQRA 2V2GA 1ERVA 3A2WA 3DRNA 4EDZA 1B9XC 5CREA 1N8JA 1V58A 1I5GA 1OVNA 2GZZA 4XS1A 3GNJA 5D9VA 4ZB9A 4G0IA 2VCTA 2X64A 6GSTA 4HOJA 4CDOA 1AXDA 3NIVA 5CO3A 5LD0A 4EC0A 2YOIA 5ABRA 2MMNA 3U5RE 1XWBA 1F3BA 1EV9A 2E2GA 1ZMAA 3FK8A 4DVCA 2K9FA 1T00A 4EXJA 3H4KA 3ZRDA 4KA0A 1V2AA 2X8HA 4K7IA 1G0TA 1KBNA 4HJ2A 2K8VA 3HVSA 1UVZA 3TJBA 1B4QA 1XOAA 1YY7A 2MZCA 2DJ0A 4DSSA 2WZ9A 2V41A 1OE8A 1BG5A 1M2BA 1YKCA 2MYGA 4OMVA 3PPUA 3QCPA 3EINA 4Q5NA 1AQXA 3KP8A 4MJCA 2PU9C 1SENA 2VAFA 1USBA 4MLYA 2C80A 4GQFA 4NMUA 3WGDA 2C3TA 2H1DA 5FHIA 1OYJA 2PVQA 2B5YA 5A4WA 4BVYB 2DC5A 4GCIA 2DSAA 2A4VA 4WBJA 5G5EA 5J3RA 1K0CA 1TRUA 4EUYA 1AAZA 1EOHA 2IPAA 2VM1A 1A23A 4F82A 3TOTA 4ZXGA 4XRAA 1B48A 2L6CA 4KSOA 4ISDA 4MZCA 1EOGA 1JLWA 1NSWA 3IK9A 3UVTA 4GSTA 3QAWA 3F8UA 2AHEA 1FVKA 1OAZA 4MF7A 4EO3A 1ZZYA 5ECIB 2IN3A 4DSRA 1FOVA 3C71A 4Q5QA 2PERA 1KEBA 1RK4A 4NV5A 2GSTA 5B6NA 4BWQA 3M0FA 3ZFBA 4LA1A 1J0FA 4NHWA 4MPFA 5F0GA 1MDKA 2IL3A 4TXOA 3GSSA 4V1Ag 1K0BA 2OACA 3D4TA 6GSYA 1CQGA 1M9BA 2YV9A 2NBSA 17GSA 4N10A 2O85A 2LNSA 1X5CA 2JZRA 3VFIA 4ZL8A 3UMAA 3MAKA 4K0GA 4K7OA 3F4SA 3ERWA 4G10A 3FR9A 1M0UA 2O87A 3ZLPA 3GIXA 3KTBA 3L4NA 2QGVA 2QC7A 4OFNA 2R2JA 3IBHA 4ZB8A 3UOMA 4V1Ap 2H72A 1TI1A 3GH9A 5G31A 3HCZA 1V57A 5H5QA 3WT1A 5DAKA 4K8MA 4TR1A 3N5OA 1EGRA 4EE0A 4ILFA 1EP8A 3KM6A 4DEJA 5HFIA 1A0FA 2IJYA 1GSYA 2OKAA 3TKSE 2HRNA 1YZXA 4X1UA 1K0NA 3EC3A 1ERWA 3HJOA 3FHKA 3TKQA 1FB6A 4ECJA 3DKSA 4Q5FA 3FKFA 5JWRB 3UBKA 4WXTA 2AJQB 3SWLA 4HI7A 4J57E 1ILOA 3W8SA 4L8EA 2XHFA 2GT6A 3S9FA 2IFQB 18GSA 3UIWA 1PD21 1AQVA 2LSTA 2C1YA 1KTEA 3CRUA 3P8WA 3IC8A 2M72A 2HSHA 2LKUA 3Q19A 3LXTA 2YNXA 3IHQA 2YP6A 2DJ1A 4AJ7A 2M46A 3CTGA 2GQKA 4WETA 3TRPA 5IOXA 3IK7A 1GNWA 2ZNMA 1WMJA 3E9JB 2HQTA 4FIWA 3H1NA 3IR4A 4GXZA 2Z9SA 3TOUA 3D0ZA 2RLIA 2YJ7A 3LYKA 2FWFA 2JSZA 3CYNA 3C8EA 3HKRA 1U87A 2DJJA 4QL7A 1AC1A 4EKZA 4I6XA 3VK9A 2OE1A 5IOWA 1YF1A 4MABA 1GSDA 1FW1A 1FHEA 3WGXA 3HD5A 1EWXA 1DBYA 3WGEA 3UVHA 3ERGA 1FAAA 3GMFA 2I1UA 4ZB6A 2A2SA 4XS6A 1O6JA 2DLXA 2G0FA 2IMDA 2VD0A 1HNBA 3KTLA 4L0WA 2CV4A 1R4WA 1SD9A 5BMUA 4G19A 3LWAA 5G5FA 3R3EA 3H8QA 5COHA 3UAPA 2HYXA 4EF0A 3VPTA 3WT2A 2C8UA 1ML6A 3MWHA 3DXBA 2H0GA 3C7MA 1LBKA 4KF9A 4MZWA 3F6DA 3VWWA 1MD3A 2H1BA 4IJ3A 1XIYA 1N2AA 5J9BA 3VWUA 4E8HA 1XWGA 4AJ8A 2YZHA 4GF0A 2VL9A 2YJHA 1TW9A 4HU9A 5DCHA 2PBJA 1OC3A 2LRTA 1RQMA 4IJIA 4N0VA 1AQWA 4QL9A 3KMOA 3CSHA 4DSSB 2N5FA 3IC4A 2CAQA 1K0MA 2YWIA 4ML1A 2HZEB 5H5RA 5GZZB 2NDOA 5IO0A 1F2EA 1A2JA 6GSSA 3KD0A 9GSSA 2A2RA 2B3SA 2LJKA 1R26A 3HYPA 2GQMA 1PRXA 3LSZA 4IVFA 4ZILA 3CTFA 4POLA 4KNDA 11GSA 2LS5A 1XWKA 1GRXA 3DVWA 3F63A 5ECHB 3DVXA 1TRVA 1MEKA 6GSWA 1ERUA 4GRFA 3NZNA 2HLSA 4N30A 12GSA 2HFDA 3ZMLA 2C3QA 2GS3A 2G2QA 5JCGA 3KP9A 4TR3A 4TN8A 1SYRA 3GL3A 5H5SA 1GL8A 5IMZA 1URMA 2V32A 3UARA 5ECQB 1QQ2A 4IKHA 1GTIA 1EV4A 1NW2A 5HR2A 3TKSC 1R5AA 4KSMA 1M9AA 3CBUA 2DMLA 1ST9A 4Z7XA 2D2ZA 2GLRA 1OKTA 4HZ4A 2J9HA 4MK3A 2GT5A 4TXOB 4USSA 1HQOA 1NHOA 1PKZA 2VL3A 4JE1A 4GWRA 2HE3A 1U88A 2ON7A 5A4UA 3ZYWA 3K8NA 2XC2A 3FZ9A 3M3MA 2KP1A 4FQUA 3GUSA 4MA9A 5D9WA 3GKNA 4TR0A 2GTUA 4P3YB 1OC8A 2H30A 3D22A 1XW9A 2P5RA 4TR1B 1SKSB 1YDKA 2OA7A 1K3LA 3KJYA 4YH2A 2PN8A 2B1LA 2I4AA 1SKWB 10GSA 4IQ1A 5JWOB 3RHBA 2I9HA 2C0DA 2H6ZA 3R2QA 2FLSA 2IMKA 4MJAA 1HYUA 1T7PB 2R4VA 1VGLA 5KEJA 1FO5A 3LEFA 1ZYEA 2ALBA 2OBIA 1G6WA 1VF3A 1UC7A 2I81A 4PQ1A 1K0AA 3BD2A 1PMTA 2N5AA 5ENUA 4HQZA 4PTSA 1X5DA 1E6BA 2MMAA 1SJ6A 3GYKA 1FVJA 3ZZXA 1ZOFA 4KX4A 3N9JA 2YWNA 2E7PA 3EU4A 1QXHA 5KN1A 1XFLA 2K8SA 5KN2A 4HUAA 2LJAA 1XZOA 3TB2A 2QKEA 2LQOA 1BQ7A 1XW5A 4JR4A 4OO5A 5A4VA 3E3EA 4F9ZA 6GSXA 3PR8A 1JZOA 5GSSA 3EMXA 1Y25A 1ZGNA 4O5RA 2HSNB 1DE2A 3EURA 3TJKA 1TK0B 3RDWA 2WB9A 5IIZA 2TIRA 3A2VA 2DBCA 2YV7A 4PNFA 2K6VA 4XS4A 1THOA 4NWYA 3QOUA 3EU3A 2WCIA 5CP1A 4OFTA 1EEJA 1ON4A 5G1KA 4YQVA 5DALB 2LJRA 5EL8A 2FUG2 1MD4A 2VUPA 4PX1A 5E4WA 5CRDA 2XBIA 1OE7A 3APOA 2OJLA 2AUVA 3HVXA 3AY8A 1WJKA 1Z6NA 1T1VA 4IHUA 1OC9A 3VWXA 1SJIA 1TXXA 4K0NA 1MTCA 1ABAA 3ZTLA 4K7NA 4NPBA 3RHCA 2VCQA 4KH7A 1F3AA 2CQ9A 2FA8A 1M99A 2CZ3A 3IRAA 3L9SA 3BCIA 2FWHA 1U3AA 4KDUA 3DWVA 3ZL5A 1X9MB 3CMIA 1GSSA 3TKSA 5J9CA 3TGZA 1TRSA 1A0RP 1SJZA 3LGCA 4YAVA 1Q4JA 1PSQA 4ZBBA 1AUCA 1O8WA 5IM9A 2FD3A 4WF5A 2NVLA 3FY7A 4O32A 2CA8A 3FZAA 5IMFA 2L5LA 5B7CA 4JRRA 4TW5A 2H1AA 4WEYA 1BAYA 1GSQA 1Q98A 2FWEA 3HZ8A 2R6KA 3GX8A 2LQQA 3E0UA 5JCWA 2H70A 4POBA 3I43A 4PUAA 3J7Yk 4WBRD 4OO4A 1A24A 5IMDA 3QDNA 3MDKA 2FWGA 5B8AA 3TJJA 1F9MA 3HA9A 2L4CA 5DJLA 2WRTA 2XBQA 4WKWA 1W89A 3QAGA 3CSIA 3F6FA 2GSQA 3A5WA 2L4QA 4N11A 4L0UA 5JWQB 1JHBA 4TVEA 1EP7A 1LJRA 2B5EA 4MDCA 1GLPA 4JR6A 2P31A 4BA7A 1GLQA 5CRWA 1XBSA 1SL1B 4GSSA 2RM5A 4LL4B 2JZSA 2HSMA 1LU4A 3F9UA 3CSJA 4KCAA 5F06A 2E2MA 4OCFA 1EZKA 1SKRB 1AIUA 1B8XA 4TOPA 3F4TA 3CXGA 1A2MA 1THXA 1TRWA 1BX9A 2OE3A 1WOUA 2F8FA 5HFGA 1SL2B 3QPMA 4LL1B 1SL0B 4KGIA 5EPFA 4ZBDA 3TCOA 2IMIA 2X8GA 2YCDA 1K3YA 1JFUA 4K2DA 2AB6A 2VCZA 4BL7B 5IQYA 1QGVA 4HEA2 1GTUA 3TJGA 4ZIJA 2NTOA 1F37A 3KMNA 3US3A 4TXVA 1R7HA 4WF4A 3L78A 3D21A 4HJMA 4TR4A 2CX3A 2HRFA 5CAXA 1WPIA 3LYPA 3L0HA 1OKDA 2CX4A 2HXKA 3TRXA 5LNKe 3IPZA 1QUWA 5F8BA 4POKA 2C0EA 3ZVJD 1JLVA 5DBQA 1YJ6A 1QFNA 4LMVA 3QR6A 3TKPA 2N5BA 1A8YA 5AGYA 1H75A 1NHYA 3V1WA 4LLRA 4CW9A 5F07A 4FYCA 4KW6A 2R5GA 4NAXA 3G7IA 2O8VB 1GTBA 4KDXA 2FCHA 3GSTA 8GSSA 5J4UA 3UEMA 3D4MA 3P2AA 4IN0A 2LV3A 3PGTA 5ECNB 2H75A 2RIIA 3VWVA 5G30A 3A2XA 3DGQA 5DCGA 4I97A 2IWTA 1K3OA 4FYUA 4ZBAA 4EL1A 2MMOA 4ECCA 4NXIA 1T8EB 4F2IA 4PQHA 1XXUA 2VLVA 3DIEA 3BJ5A 2LNTA 3FR6A 1FG4A 3IA1A 1PL1A 1ZYQB 2O89A 4XHMA 5ECMB 2R3XA 5DJMA 2H1GA 5FWGA 2KLXA 4PGTA 3MSZA 1ZL9A 1Z3EA 1GNEA 4F0CA 5G2ZA 4GTUA 1T4ZA 3P90A 4XS4B 1B4PA 4MF5A 3TUEA 2WS2A 4N0ZA 13GSA 5E59A 4ULXA 4BWSA 1O81A 2JSYA 1JZWA 2GQLA 2JL4A 3ME7A 3EE2A 2H01A 14GSA 1GP1A 3GV1A 2KOKA 3GN3A 5D9XA 5GSTA 1O8XA 4DSQA 3GA4A 4ZL7A 2H76A 1MDJA 2V1MA 4X0XA 4OCEA 2IMFA 2YN1A 2C3NA 2WGRA 3ERFA 1SD8A 3LQ7A 4ECBA 4RUVA 22GSA 4FO5A 2CT6A 1VF1A 2EIRA 5ECRB 4QQ7A 2IMEA 3GURA 2B7JA 5G1LA 1PA3A 2K18A 2REMA 4KCEA 1GH2A 1J9BA 4EVMA 1O85A 1NM3A 5ECPB 3G7JA 1FB0A 2MBSA 2OADA 7GSSA 2OE0A 4AGSA 2XPEA 4HU7A 2JZTA 1TOFA 3LJRA 3GFKA 3IAM2 2FGXA 3NOFA 2WDUA 3SBCA 2F3MA 4XCSA 2JU5A 5JCUA 4GLTA 5B8BA 2HZFA 1U6TA 1SYXA 2CVBA 4OD7A 2GSRA 3RPNA 4PURA 1TK5B 2XPDA 3IXRA 3DYRA 5ECOB 5DAKB 1Z7RA 1EEMA 2PVOC 3APQA 3F4RA 4ACSA 4G0LA 1YKAA 2FY6A 1V40A 6GSUA 20GSA 1YEPA 1V98A 3FRCA 1WIKA 1X0RA 1O73A 3I9V2 1ZCPA 5ID2A 4F03A 2JACA 5AIXA 4PXOA 2X8CA 1YF0A 2YPMA 5D9TA 4IELA 4YQMA 1I9DA 3C73A 2DJ2A 2H0HA 5KN3A 4RQXA 4L5OA 4PUFC 2NPBA 1GWCA 2B1KA 3LFLA 1H4OA 4V2NA 4FH8A 5CYYA 1HD2A 2DJKA 1TJDA 2HSMB 2X99A 1J08A 4IP6A 1DSBA 1QMVA 4K9ZA 2IIYA 3ME8A 3KGKA 3M9JA 4I5QA 3FR3A 2C0FA 3TKRA 5CNWA 2WFCA 5DVBA 3GRXA 1WP0A 2L6DA 3BOAA 2AYTA 4MJEA 2VO4A 3FEUA 2RM6A 3APSA 1SU9A 3C1SA 2EIOA 3KH7A 1S3AA 2LEGA 3DEXA 2P0GA 1M7TA 4K6XA 3KEBA 2YWOA 2PGTA 4Q5RA 1PGTA 2HZEA 2ON5A 3HJPA 1A8LA 3H79A 3PH9A 3GHAA 1HNCA 3A3TA 3ZIVA 5HR1A 2VL2C 3D5JA 4MH3A 1G7EA 2KP2A 4I8BA 4EDYA 1X5EA 5LCZA 4MJBA 2LUSA 3QD9A 3M8NA 3L9VA 2PMTA 2FNOA 2HT9A 5GAND 2FHEA 2YWMA 2B5XA 3DMLA 1DUGA 3G9BA 1TKDB 3RBTA 1GSEA 4RI6A 3ZFLA 1VF4A 1JZDA 2RUEA 6GSVA 4IGJA 4WR5A 2E0QA 3P7XA 4FYBA 3EWLA 1Z9HA 2YANA 2L59A 2V6OA 1K0OA 4PNGA 1GSUA 2VCXA 3GKMA 1UA5A 2VIMA 4IW9A 2DIYA 3ZIJA 4F0BA 2J23A 3PINA 2FA4A 2BTOT 2H0IA 4BVXA 4J2FA 1SK2A 2RUFA 4IQAA 2VLUA 2AV4A 1WE0A 1TU8A 1CQHA 3GKKA 3M9KA 3LG6A 3W6GA 5ECKB 1PKWA 1S3CA 4AJ6A 1Z6MA 2F51A 3EYTA 4IS0A 5J5NA 3O3TA 1M2DA 4IP1A 4JBBA 3O76A 1TU7A 2EIQA 3GTUA 1TK8B 1BJXA 1WRYA 1ERTA 5B6MA 2P5QA 3HVVA 1VRSD 4D73A 4BPYA 2TRCP 2VCVA 4RI7A 5IPGA 4AF2A 3O6TA 3IAS2 5DDLA 2WULA 3F3RA 2F8AA 3HDCA 3IV4A 2EC4A 2L5OA 3C1RA 1UN2A 2I3YA 1MDIA 2GSSA 4XRDA 3VURA 3QFBC 2HRKA 4YQUA 4HZ2A 1HNAA 2VD1A 1GSFA 4MCUA 3VLNA 1Z5YE 3H93A 1VF2A 1AW9A 3L9UA 1C72A 2BMXA 4O92A 1YEXA 3GL5A 5A5KA 1XW6A 2H8LA 5FT3A 2F9SA 1IYHA 2PWJA 2CVDA 5CRGA 3VPQA 5D8IA 3IDVA 5INYA 3VI7A 4KAEA 2GZYA 1GUKA 3KXOA 3OR5A 1YQ1A 1TTZA 5D96A 4HDEA 3M1GA 2L57A 3I6AA 2H73A 3UL3A 1E2YA 2BJXA 2M80A 4V2LA 5IPHA 5D73A 16GSA 3G7YA 4ZL9A 2GDRA 2HI7A 3ZMKA 2UZ8A 3WD6A 5HR3A 3TRQA 4IBPA 1QK8A 3FZ4A 1XVQA 4MMMA 4JU5A 4I2TA 1T4YA 3I69A 1O7UA 3KZQA 3Q74A 3TDGA 5F05A 4WR4A 3ZITA 2CVKA 1XOBA 2AAWA 5ECSA 2WJUA 2PUKC 5DQYA 5AIVA 2HRAA 3BBYA 4MP4A 1W4VA 3KCMA 2O7KA 3QMXA 5IO2A 4L5LA 4ML6A 1S3DA 2ZCTA 1BYEA 2VL2A 2LRCA 3WYWA 4MF6A 4BVYA 5DALA 3ZREA 5AISA 4GQCA 3LXZA 2PPTA 2C4JA 3QFAC 3HJMA 2VM2A 4MH2A 1U3IA 4LMWA 3EMPA 4KB3A 2C0GA 1XPVA 5ID2B 3Q18A 5EVOA 2KUCA 1KNGA 3GKXA 3J7Yb 2HNLA 1F6MC
chains in the Genus database with same CATH superfamily
2VOCA 4K1FA 3FW2A 1ZYNA 1M3IA 2CZ2A 1T3BA 2YZUA 4O7HA 5KN0A 1X9SB 3ZVJA 4G9HA 2ES7A 2H6XA 3KH9A 2B6MA 4KDYA 3Q6OA 4KUNA 1GTAA 2DJ3A 2TRXA 4GSNA 5ECLB 4NHZA 1GUMA 5A5HB 3UBLA 1JZRA 4X43A 1V9WA 1GUHA 4ID0A 3EVIA 3FYGA 3F3QA 4E8EA 5BRTA 4I2UA 4OFMA 1G7OA 3JCML 3CRTA 4PQIA 2OBKA 3GH6A 5ELGA 5HQPA 1PQNA 2GVPA 1S3RA 5HR0A 1DE1A 5C04A 2GZPA 4G2EA 4HS1A 5EY6A 4YAPA 2KHPA 5HFKA 2LRNA 2HSYA 2ZUPA 3DD3A 4HQSA 4AKGA 1Z7PA 5ELAA 4CHSA 3F0IA 1TP9A 2H66A 1K0DA 3RPPA 4JZQA 2CAIA 4OWYA 4J56E 2V6KA 2O36A 2DKHA 5D93A 5DQSA 1X9WB 3ISOA 19GSA 1OC9B 1TDIA 2H19A 3U6VA 1PX7A 2DMMA 1IYIA 5J41A 1XWAA 2B7KA 5AN1A 5GAPD 2MMZA 3FZ5A 2H6YA 1PL2A 2IFQA 5C00A 4V2MA 2R37A 4XIHA 1WWJA 3IOSA 2LTKA 4G0KA 4AKXB 2H71A 4ECIA 1BEDA 3HY2A 1XWCA 2VCWA 4H86A 1B9YC 4JEDA 5CRHA 3TJFA 2EFCA 2EFHA 4BVXB 1R5PA 4NV2A 3IE3A 3LORA 3RFRC 2DIZA 1SK0A 3HZ4A 4MPGA 1PX6A 3HHVA 5IMAA 4KE3A 3QAVA 1ACVA 4XTSA 1SK1A 3MNGA 5IMVA 3UJ1A 3HXSA 3GTUB 2JADA 3ED3A 3RAZA 4BL7A 1XCCA 3GX0A 3W8JA 2H74A 4MZBA 3VI5A 4TKYA 2GGTA 3KIJA 1G6YA 4D73B 3BCKA 1GULA 4POMA 1RW1A 1A2LA 1EGOA 4TRXA 2MBTA 1M2AA 2QSIA 1XVWA 5IMCA 3D6IA 1Y6EA 5L71A 1TI3A 2HRKB 2VLTA 1PN9A 4RQRA 2V2GA 1ERVA 3A2WA 3DRNA 4EDZA 1B9XC 5CREA 2WVYA 1N8JA 1V58A 1I5GA 1OVNA 2GZZA 4XS1A 3GNJA 5D9VA 4ZB9A 4G0IA 3CHXC 2VCTA 2X64A 6GSTA 4HOJA 4CDOA 1AXDA 3NIVA 5CO3A 5LD0A 4EC0A 2YOIA 5ABRA 2MMNA 3U5RE 1XWBA 1F3BA 1EV9A 2E2GA 1ZMAA 3FK8A 4DVCA 2K9FA 1T00A 4EXJA 3H4KA 3ZRDA 4KA0A 1V2AA 2X8HA 4K7IA 1G0TA 1KBNA 4HJ2A 2WVXB 2K8VA 3HVSA 1UVZA 3TJBA 1B4QA 2A2PA 1XOAA 1YY7A 2MZCA 2DJ0A 4CY6A 4DSSA 2QA2A 2WZ9A 2V41A 2UV8G 1OE8A 1BG5A 1M2BA 1YKCA 2MYGA 2O3EA 4OMVA 3PPUA 3QCPA 3EINA 4Q5NA 1AQXA 3KP8A 4MJCA 2PU9C 1SENA 2VAFA 1USBA 4MLYA 2C80A 4GQFA 4NMUA 3WGDA 2C3TA 2H1DA 5FHIA 1OYJA 2PVQA 2B5YA 4W66A 5A4WA 4BVYB 2DC5A 4GCIA 2DSAA 2A4VA 4WBJA 5G5EA 5J3RA 1K0CA 1TRUA 4EUYA 1AAZA 1EOHA 2IPAA 2VM1A 1A23A 4F82A 3TOTA 4ZXGA 4XRAA 4FXYP 1B48A 2L6CA 4KSOA 4ISDA 4MZCA 1EOGA 1JLWA 1NSWA 3IK9A 3UVTA 4GSTA 3QAWA 3F8UA 3A5IA 2AHEA 1FVKA 1OAZA 4MF7A 4EO3A 1ZZYA 5ECIB 2IN3A 4DSRA 1FOVA 3C71A 4Q5QA 2PERA 1KEBA 1RK4A 4NV5A 2GSTA 5B6NA 4BWQA 3M0FA 3ZFBA 4LA1A 1J0FA 4NHWA 4MPFA 5F0GA 1MDKA 2IL3A 4TXOA 3GSSA 4V1Ag 1K0BA 2OACA 3D4TA 6GSYA 1CQGA 1M9BA 2YV9A 2NBSA 17GSA 4N10A 2O85A 2LNSA 1X5CA 2JZRA 3VFIA 5J4VA 4ZL8A 3UMAA 3MAKA 4K0GA 4K7OA 3F4SA 3ERWA 4G10A 3FR9A 1M0UA 2O87A 3ZLPA 3GIXA 2DKIA 4X4JA 3KTBA 3L4NA 2QGVA 2QC7A 4OFNA 2R2JA 3IBHA 4ZB8A 3UOMA 4V1Ap 2H72A 1TI1A 3GH9A 5G31A 3HCZA 1V57A 5H5QA 3WT1A 5DAKA 4K8MA 4TR1A 3N5OA 4AKHA 1EGRA 4EE0A 4ILFA 1EP8A 2WW2A 3KM6A 4DEJA 5HFIA 1A0FA 2IJYA 1GSYA 2OKAA 3TKSE 2HRNA 1YZXA 4X1UA 1K0NA 5A1NB 3EC3A 1ERWA 3HJOA 3FHKA 3TKQA 1FB6A 4ECJA 3DKSA 4Q5FA 3FKFA 5JWRB 3UBKA 4WXTA 2AJQB 3SWLA 4HI7A 4J57E 1ILOA 3W8SA 4L8EA 2XHFA 2GT6A 4AI6A 3S9FA 2IFQB 18GSA 3UIWA 2QA1A 1PD21 1AQVA 4Z2TA 5KOWA 2LSTA 2C1YA 1KTEA 3CRUA 3P8WA 3IC8A 2M72A 2HSHA 2LKUA 3Q19A 3LXTA 2YNXA 3IHQA 2YP6A 2DJ1A 4AJ7A 2M46A 3CTGA 2GQKA 4WETA 3TRPA 4E68A 5IOXA 3IK7A 1GNWA 2ZNMA 1WMJA 3E9JB 2HQTA 4FIWA 3H1NA 3IR4A 4GXZA 2Z9SA 3TOUA 3D0ZA 2RLIA 2YJ7A 3LYKA 2FWFA 2JSZA 3CYNA 3C8EA 3HKRA 1U87A 2DJJA 4QL7A 3EPTA 1AC1A 4EKZA 1BG1A 4I6XA 3VK9A 2OE1A 5IOWA 1YF1A 4MABA 1GSDA 1FW1A 1FHEA 3WGXA 3HD5A 1EWXA 1DBYA 3WGEA 3UVHA 3ERGA 4N3ZA 1FAAA 3GMFA 2I1UA 4PI0C 4ZB6A 2A2SA 4XS6A 1O6JA 2DLXA 2G0FA 2IMDA 2VD0A 1HNBA 3KTLA 4L0WA 2CV4A 1R4WA 1SD9A 5BMUA 4G19A 3LWAA 3MIXA 5G5FA 3R3EA 3H8QA 5COHA 3UAPA 2HYXA 4EF0A 3VPTA 3WT2A 2C8UA 1ML6A 3MWHA 3DXBA 2H0GA 3C7MA 1LBKA 4KF9A 4MZWA 3F6DA 3VWWA 1MD3A 2H1BA 4IJ3A 1XIYA 1N2AA 5J9BA 3VWUA 4E8HA 1XWGA 3TU3B 4AJ8A 2YZHA 4GF0A 2VL9A 4YKGA 2YJHA 1TW9A 4HU9A 5DCHA 2PBJA 1OC3A 3HVNA 2LRTA 1RQMA 4IJIA 4N0VA 1AQWA 4QL9A 3KMOA 3CSHA 4DSSB 2N5FA 3IC4A 2CAQA 1K0MA 2YWIA 4ML1A 2HZEB 5H5RA 5GZZB 2NDOA 5IO0A 1F2EA 1A2JA 6GSSA 3KD0A 2OT3A 9GSSA 2A2RA 2B3SA 2LJKA 3HYPA 1R26A 2GQMA 1PRXA 3LSZA 4IVFA 4ZILA 3CTFA 4POLA 4KNDA 11GSA 2LS5A 1XWKA 1GRXA 3DVWA 3F63A 5ECHB 3DVXA 1TRVA 1MEKA 6GSWA 1ERUA 4GRFA 3NZNA 2HLSA 4N30A 12GSA 2HFDA 3ZMLA 2C3QA 2GS3A 2G2QA 5JCGA 3KP9A 4TR3A 4TN8A 1SYRA 3GL3A 5H5SA 1GL8A 5IMZA 1URMA 2V32A 3UARA 5ECQB 1QQ2A 4IKHA 1YEWC 1GTIA 1EV4A 1NW2A 5HR2A 3TKSC 1R5AA 4KSMA 1M9AA 3CBUA 4PI2C 2DMLA 1ST9A 4Z7XA 2D2ZA 2GLRA 1I1IP 1OKTA 4HZ4A 2J9HA 4MK3A 2GT5A 4TXOB 4USSA 1HQOA 1NHOA 1PKZA 2VL3A 4JE1A 4GWRA 2HE3A 1U88A 2ON7A 5A4UA 3ZYWA 3K8NA 2XC2A 3FZ9A 3M3MA 2KP1A 4FQUA 3GUSA 4MA9A 5D9WA 3GKNA 4K5SA 4TR0A 2GTUA 4P3YB 1OC8A 4G01A 2H30A 3D22A 1XW9A 2P5RA 2WW1A 4TR1B 1SKSB 1YDKA 2OA7A 1K3LA 3KJYA 4YH2A 2PN8A 2B1LA 2I4AA 1SKWB 10GSA 4IQ1A 5JWOB 3RHBA 2I9HA 2C0DA 2H6ZA 3R2QA 2FLSA 2IMKA 4MJAA 1HYUA 1T7PB 2R4VA 1VGLA 5KEJA 1FO5A 3LEFA 1ZYEA 2ALBA 2OBIA 1G6WA 1VF3A 1UC7A 2I81A 4PQ1A 1K0AA 3BD2A 1PMTA 2N5AA 5ENUA 4HQZA 4PTSA 4BIKA 2WW3A 1X5DA 1E6BA 2MMAA 1SJ6A 3GYKA 1FVJA 3ZZXA 1ZOFA 4KX4A 3N9JA 2YWNA 2E7PA 3EU4A 1QXHA 5KN1A 4CY8A 1XFLA 2K8SA 5KN2A 4HUAA 2LJAA 1XZOA 3TB2A 2QKEA 2LQOA 1BQ7A 1XW5A 4JR4A 4OO5A 5A4VA 3E3EA 4F9ZA 6GSXA 3PR8A 1JZOA 5GSSA 3EMXA 1Y25A 1ZGNA 4O5RA 2HSNB 1DE2A 3EURA 3TJKA 1TK0B 3RDWA 2WB9A 5IIZA 2TIRA 3A2VA 4HSCX 2WZSA 2DBCA 2YV7A 4PNFA 2K6VA 4XS4A 1THOA 4NWYA 3QOUA 3EU3A 5J4YA 4EIPA 2WCIA 5CP1A 4OFTA 1EEJA 1ON4A 5G1KA 4YQVA 5DALB 2LJRA 5EL8A 2FUG2 1ZYPA 2WW0A 1MD4A 2VUPA 4PX1A 5E4WA 5CRDA 2XBIA 1OE7A 3APOA 1N25A 2OJLA 2AUVA 3HVXA 3AY8A 2R0PA 1WJKA 1Z6NA 4K5RA 1T1VA 4IHUA 1OC9A 3VWXA 1SJIA 1TXXA 5BMUB 4K0NA 1MTCA 1ABAA 3ZTLA 4K7NA 4NPBA 3RHCA 2VCQA 4KH7A 1F3AA 2CQ9A 2FA8A 1M99A 2CZ3A 3IRAA 3L9SA 3BCIA 2FWHA 1U3AA 4KDUA 3DWVA 3ZL5A 1X9MB 3CMIA 1GSSA 3TKSA 5J9CA 3TGZA 1PFOA 1TRSA 1A0RP 1SJZA 3LGCA 4YAVA 1Q4JA 1PSQA 4ZBBA 1AUCA 1O8WA 5IM9A 2FD3A 4WF5A 2NVLA 3FY7A 4O32A 2CA8A 1SVOA 3FZAA 5IMFA 2L5LA 5B7CA 4JRRA 4TW5A 2H1AA 4WEYA 4QMKA 1BAYA 1GSQA 1Q98A 2FWEA 1XG8A 3HZ8A 2R6KA 3GX8A 2LQQA 3E0UA 5JCWA 2H70A 4POBA 3I43A 4PUAA 3J7Yk 5KOXA 4WBRD 4OO4A 1A24A 4ICYA 5IMDA 3QDNA 3MDKA 2FWGA 5B8AA 3TJJA 1F9MA 3HA9A 2L4CA 5DJLA 2WRTA 2XBQA 4WKWA 1W89A 3QAGA 3CSIA 3F6FA 2GSQA 3A5WA 2L4QA 2R0CA 4N11A 4L0UA 5JWQB 1JHBA 4TVEA 1EP7A 1LJRA 2H1LA 2B5EA 4MDCA 1GLPA 4JR6A 2P31A 4BA7A 1GLQA 5CRWA 1XBSA 1SL1B 4GSSA 2RM5A 4LL4B 2JZSA 2HSMA 1LU4A 3F9UA 3CSJA 4KCAA 5F06A 4AKIA 2E2MA 1EZKA 4OCFA 1SKRB 1AIUA 1B8XA 4TOPA 3F4TA 3CXGA 1A2MA 1THXA 1TRWA 1BX9A 2OE3A 1WOUA 2F8FA 5HFGA 1SL2B 3QPMA 4LL1B 1SL0B 4KGIA 5EPFA 4ZBDA 3TCOA 3CWGA 2IMIA 2X8GA 2YCDA 4EIQA 1K3YA 1JFUA 4K2DA 2AB6A 2VCZA 4BL7B 5IQYA 1QGVA 4HEA2 1GTUA 3TJGA 4ZIJA 2NTOA 1F37A 3KMNA 3US3A 4TXVA 1R7HA 4WF4A 5J47A 3L78A 3D21A 4HJMA 4TR4A 2CX3A 2HRFA 5CAXA 1WPIA 3LYPA 3L0HA 1OKDA 2CX4A 2HXKA 3TRXA 5LNKe 3IPZA 1QUWA 3RGBC 5F8BA 4POKA 2C0EA 3ZVJD 1JLVA 5DBQA 1YJ6A 1QFNA 4LMVA 3QR6A 3TKPA 2N5BA 1A8YA 5AGYA 1H75A 1NHYA 3V1WA 1YVLA 4LLRA 4CW9A 5F07A 4FYCA 4KW6A 2R5GA 4NAXA 3G7IA 2O8VB 1GTBA 4KDXA 2FCHA 3GSTA 8GSSA 5J4UA 3CQFA 3UEMA 3D4MA 3P2AA 4IN0A 2LV3A 3PGTA 5ECNB 2H75A 2RIIA 3VWVA 5G30A 3A2XA 3DGQA 5DCGA 4I97A 2IWTA 1K3OA 3MYDA 4FYUA 4ZBAA 4EL1A 2MMOA 4ECCA 4NXIA 1T8EB 4F2IA 4PQHA 1XXUA 2VLVA 3DIEA 3BJ5A 2LNTA 3FR6A 1FG4A 3IA1A 1PL1A 1ZYQB 2O89A 4XHMA 5ECMB 2R3XA 5DJMA 2H1GA 5FWGA 2KLXA 4PGTA 3MSZA 1ZL9A 1Z3EA 1GNEA 4F0CA 5G2ZA 4GTUA 1T4ZA 3P90A 4XS4B 1B4PA 4MF5A 3TUEA 2WS2A 4N0ZA 13GSA 5E59A 4ULXA 4BWSA 1O81A 2JSYA 1JZWA 2GQLA 2JL4A 3ME7A 3EE2A 2H01A 14GSA 1GP1A 3GV1A 2KOKA 3GN3A 5D9XA 5GSTA 1O8XA 4DSQA 3GA4A 4ZL7A 4Z2RA 2H76A 1MDJA 5A1NA 2V1MA 4X0XA 4OCEA 2IMFA 2YN1A 2C3NA 4YKFA 2WGRA 3ERFA 1SD8A 3LQ7A 4ECBA 4RUVA 22GSA 4FO5A 2CT6A 1VF1A 2EIRA 3FMWA 5ECRB 4QQ7A 2IMEA 3GURA 2B7JA 5G1LA 1PA3A 2K18A 2X4AA 2REMA 4KCEA 1GH2A 1J9BA 4EVMA 2EFEA 1O85A 5A34A 1NM3A 5ECPB 3G7JA 1FB0A 2MBSA 2OADA 7GSSA 2OE0A 4AGSA 2XPEA 4HU7A 2JZTA 1TOFA 3LJRA 3GFKA 3IAM2 2FGXA 3NOFA 2WDUA 3LW9A 3SBCA 2F3MA 4XCSA 1SVLA 2JU5A 5JCUA 4GLTA 5B8BA 2HZFA 1U6TA 1SYXA 2CVBA 4OD7A 2GSRA 3RPNA 4PURA 1TK5B 2XPDA 3IXRA 3DYRA 5ECOB 5DAKB 1Z7RA 1EEMA 2PVOC 3APQA 3F4RA 4ACSA 2A4HA 4G0LA 1YKAA 2FY6A 1V40A 6GSUA 20GSA 1YEPA 1V98A 3FRCA 1WIKA 1X0RA 1O73A 3I9V2 1ZCPA 5ID2A 4GDFA 4F03A 2JACA 5J40A 5AIXA 4PXOA 2WVZA 1YF0A 2X8CA 2YPMA 5D9TA 4IELA 4YQMA 1I9DA 3C73A 2DJ2A 2H0HA 5KN3A 4RQXA 4L5OA 4PUFC 2NPBA 1GWCA 2B1KA 3LFLA 1H4OA 4O5UA 4V2NA 4FH8A 5CYYA 1HD2A 2DJKA 1TJDA 2HSMB 2X99A 1J08A 2O5VA 4IP6A 1DSBA 1QMVA 4K9ZA 2IIYA 3ME8A 3KGKA 3M9JA 4I5QA 5A5HA 3FR3A 2C0FA 3TKRA 5CNWA 2WFCA 5DVBA 3GRXA 1WP0A 2L6DA 3BOAA 2AYTA 4MJEA 2VO4A 3FEUA 2RM6A 2X49A 3APSA 1SU9A 3C1SA 2EIOA 1S3AA 2LEGA 3DEXA 3KH7A 2P0GA 1M7TA 4K6XA 3KEBA 2YWOA 2PGTA 4Q5RA 1PGTA 2HZEA 2ON5A 3HJPA 1A8LA 3H79A 3PH9A 3GHAA 1HNCA 3A3TA 3ZIVA 5HR1A 2VL2C 3D5JA 4MH3A 1G7EA 2KP2A 4I8BA 4EDYA 1X5EA 5LCZA 4MJBA 2LUSA 3QD9A 3M8NA 3L9VA 2PMTA 2FNOA 2HT9A 5GAND 2FHEA 2YWMA 3HMJG 2B5XA 3DMLA 1DUGA 2VKZG 3G9BA 1TKDB 3RBTA 1GSEA 4RI6A 3ZFLA 1VF4A 1SVMA 1JZDA 2RUEA 6GSVA 4IGJA 4WR5A 2E0QA 3P7XA 4FYBA 1FOHA 3EWLA 1Z9HA 2YANA 2L59A 2V6OA 4K2XA 1K0OA 4PNGA 1GSUA 2VCXA 3GKMA 1UA5A 2VIMA 4IW9A 2DIYA 3ZIJA 4F0BA 2J23A 3PINA 2FA4A 2BTOT 2H0IA 4BVXA 4J2FA 4ZB7A 1SK2A 2RUFA 4IQAA 2VLUA 2AV4A 1WE0A 1TU8A 2R0GA 1CQHA 3GKKA 3M9KA 2EFDA 3LG6A 3W6GA 5ECKB 1PKWA 1S3CA 4AJ6A 1Z6MA 2F51A 3EYTA 4IS0A 5J5NA 3O3TA 1M2DA 4IP1A 4JBBA 3O76A 1TU7A 2EIQA 3GTUA 1TK8B 1BJXA 1WRYA 1ERTA 1Y1UA 5B6MA 2P5QA 3HVVA 1VRSD 4D73A 4BPYA 2TRCP 2VCVA 4RI7A 5IPGA 4AF2A 3O6TA 3IAS2 5DDLA 2WULA 3F3RA 2F8AA 3HDCA 3IV4A 2EC4A 2L5OA 3C1RA 1UN2A 2I3YA 4A5PA 1MDIA 2GSSA 4XRDA 3VURA 3QFBC 2HRKA 4YQUA 4HZ2A 3IHGA 1HNAA 2VD1A 1GSFA 4MCUA 3VLNA 1Z5YE 3H93A 1VF2A 1AW9A 3L9UA 4MNNA 1C72A 1S4BP 2BMXA 4O92A 1YEXA 3GL5A 5A5KA 1XW6A 2H8LA 5FT3A 2F9SA 1IYHA 2PWJA 2CVDA 5CRGA 3VPQA 5D8IA 3IDVA 5INYA 3VI7A 4KAEA 2GZYA 1GUKA 3KXOA 4O5QA 3OR5A 1YQ1A 1TTZA 5D96A 4HDEA 3M1GA 2L57A 3I6AA 2H73A 4Z2UA 3UL3A 1E2YA 2BJXA 2M80A 2WVXA 4V2LA 5IPHA 5D73A 16GSA 3G7YA 4ZL9A 2GDRA 2HI7A 3ZMKA 1BF5A 2UZ8A 3WD6A 5HR3A 3TRQA 4IBPA 1QK8A 3FZ4A 5A34B 1XVQA 4MMMA 4JU5A 4I2TA 1T4YA 3I69A 1O7UA 3KZQA 3Q74A 3TDGA 5F05A 4WR4A 1TXUA 3ZITA 2HSNA 2CVKA 1PN0A 1XOBA 1M3JA 2AAWA 5ECSA 2WJUA 2PUKC 5DQYA 4PHZC 5AIVA 2HRAA 3BBYA 4MP4A 1W4VA 3KCMA 2O7KA 3QMXA 5IO2A 4L5LA 4ML6A 1S3DA 2ZCTA 1BYEA 2VL2A 2LRCA 3WYWA 4MF6A 4BVYA 5DALA 3ZREA 5AISA 4GQCA 3LXZA 2PPTA 2C4JA 3QFAC 3HJMA 2VM2A 4MH2A 1U3IA 4LMWA 3EMPA 4KB3A 2C0GA 1XPVA 5ID2B 3Q18A 5EVOA 2KUCA 1KNGA 3GKXA 3J7Yb 2HNLA 1F6MC
chains in the Genus database with same CATH topology
2VOCA 4K1FA 3FW2A 1ZYNA 2CZ2A 1T3BA 2YZUA 4O7HA 5KN0A 1X9SB 3ZVJA 4G9HA 2ES7A 2H6XA 3KH9A 2B6MA 4KDYA 3Q6OA 4KUNA 1GTAA 2DJ3A 2TRXA 4GSNA 5ECLB 4NHZA 1GUMA 5A5HB 3UBLA 1JZRA 4X43A 1V9WA 1GUHA 4ID0A 3EVIA 3FYGA 3F3QA 4E8EA 5BRTA 4I2UA 4OFMA 1G7OA 3JCML 3CRTA 4PQIA 2OBKA 3GH6A 5ELGA 5HQPA 1PQNA 2GVPA 5HR0A 1DE1A 5C04A 2GZPA 4G2EA 4HS1A 5EY6A 4YAPA 2KHPA 5HFKA 2LRNA 2HSYA 2ZUPA 3DD3A 4HQSA 4AKGA 1Z7PA 5ELAA 4CHSA 3F0IA 1TP9A 2H66A 1K0DA 3RPPA 4JZQA 2CAIA 4OWYA 4J56E 2V6KA 2DKHA 5D93A 5DQSA 1X9WB 3ISOA 19GSA 1OC9B 1TDIA 2H19A 3U6VA 1PX7A 2DMMA 1IYIA 5J41A 1XWAA 2B7KA 5AN1A 5GAPD 2MMZA 3FZ5A 2H6YA 1PL2A 2IFQA 5C00A 4V2MA 2R37A 4XIHA 1WWJA 3IOSA 2LTKA 4G0KA 4AKXB 2H71A 4ECIA 1BEDA 3HY2A 1XWCA 2VCWA 4H86A 1B9YC 4JEDA 5CRHA 3TJFA 2EFCA 2EFHA 4BVXB 1R5PA 4NV2A 3IE3A 3LORA 2DIZA 1SK0A 3HZ4A 4MPGA 1PX6A 3HHVA 5IMAA 4KE3A 3QAVA 1ACVA 4XTSA 1SK1A 3MNGA 5IMVA 3UJ1A 3HXSA 3GTUB 2JADA 3ED3A 3RAZA 4BL7A 1XCCA 3GX0A 3W8JA 2H74A 4MZBA 3VI5A 4TKYA 2GGTA 3KIJA 1G6YA 4D73B 3BCKA 1GULA 4POMA 1RW1A 1A2LA 1EGOA 4TRXA 2MBTA 1M2AA 2QSIA 1XVWA 5IMCA 3D6IA 1Y6EA 5L71A 1TI3A 2HRKB 2VLTA 1PN9A 4RQRA 2V2GA 1ERVA 3A2WA 3DRNA 4EDZA 1B9XC 5CREA 1N8JA 1V58A 1I5GA 1OVNA 2GZZA 4XS1A 3GNJA 5D9VA 4ZB9A 4G0IA 2VCTA 2X64A 6GSTA 4HOJA 4CDOA 1AXDA 3NIVA 5CO3A 5LD0A 4EC0A 2YOIA 5ABRA 2MMNA 3U5RE 1XWBA 1F3BA 1EV9A 2E2GA 1ZMAA 3FK8A 4DVCA 2K9FA 1T00A 4EXJA 3H4KA 3ZRDA 4KA0A 1V2AA 2X8HA 4K7IA 1G0TA 1KBNA 4HJ2A 2K8VA 3HVSA 1UVZA 3TJBA 1B4QA 2A2PA 1XOAA 1YY7A 2MZCA 2DJ0A 4CY6A 4DSSA 2QA2A 2WZ9A 2V41A 2UV8G 1OE8A 1BG5A 1M2BA 1YKCA 2MYGA 4OMVA 3PPUA 3QCPA 3EINA 4Q5NA 1AQXA 3KP8A 4MJCA 2PU9C 1SENA 2VAFA 1USBA 4MLYA 2C80A 4GQFA 4NMUA 3WGDA 2C3TA 2H1DA 5FHIA 1OYJA 2PVQA 2B5YA 4W66A 5A4WA 4BVYB 2DC5A 4GCIA 2DSAA 2A4VA 4WBJA 5G5EA 5J3RA 1K0CA 1TRUA 4EUYA 1AAZA 1EOHA 2IPAA 2VM1A 1A23A 4F82A 3TOTA 4ZXGA 4XRAA 1B48A 2L6CA 4KSOA 4ISDA 4MZCA 1EOGA 1JLWA 1NSWA 3IK9A 3UVTA 4GSTA 3QAWA 3F8UA 3A5IA 2AHEA 1FVKA 1OAZA 4MF7A 4EO3A 1ZZYA 5ECIB 2IN3A 4DSRA 1FOVA 3C71A 4Q5QA 2PERA 1KEBA 1RK4A 4NV5A 2GSTA 5B6NA 4BWQA 3M0FA 3ZFBA 4LA1A 1J0FA 4NHWA 4MPFA 5F0GA 1MDKA 2IL3A 4TXOA 3GSSA 4V1Ag 1K0BA 2OACA 3D4TA 6GSYA 1CQGA 1M9BA 2YV9A 2NBSA 17GSA 4N10A 2O85A 2LNSA 1X5CA 2JZRA 3VFIA 5J4VA 4ZL8A 3UMAA 3MAKA 4K0GA 4K7OA 3F4SA 3ERWA 4G10A 3FR9A 1M0UA 2O87A 3ZLPA 3GIXA 2DKIA 4X4JA 3KTBA 3L4NA 2QGVA 2QC7A 4OFNA 2R2JA 3IBHA 4ZB8A 3UOMA 4V1Ap 2H72A 1TI1A 3GH9A 5G31A 3HCZA 1V57A 5H5QA 3WT1A 5DAKA 4K8MA 4TR1A 3N5OA 4AKHA 1EGRA 4EE0A 4ILFA 1EP8A 3KM6A 4DEJA 5HFIA 1A0FA 2IJYA 1GSYA 2OKAA 3TKSE 2HRNA 1YZXA 4X1UA 1K0NA 5A1NB 3EC3A 1ERWA 3HJOA 3FHKA 3TKQA 1FB6A 4ECJA 3DKSA 4Q5FA 3FKFA 5JWRB 3UBKA 4WXTA 2AJQB 3SWLA 4HI7A 4J57E 1ILOA 3W8SA 4L8EA 2XHFA 2GT6A 4AI6A 3S9FA 2IFQB 18GSA 3UIWA 2QA1A 1PD21 1AQVA 4Z2TA 5KOWA 2LSTA 2C1YA 1KTEA 3CRUA 3P8WA 3IC8A 2M72A 2HSHA 2LKUA 3Q19A 3LXTA 2YNXA 3IHQA 2YP6A 2DJ1A 4AJ7A 2M46A 3CTGA 2GQKA 4WETA 3TRPA 4E68A 5IOXA 3IK7A 1GNWA 2ZNMA 1WMJA 3E9JB 2HQTA 4FIWA 3H1NA 3IR4A 4GXZA 2Z9SA 3TOUA 3D0ZA 2RLIA 2YJ7A 3LYKA 2FWFA 2JSZA 3CYNA 3C8EA 3HKRA 1U87A 2DJJA 4QL7A 3EPTA 1AC1A 4EKZA 1BG1A 4I6XA 3VK9A 2OE1A 5IOWA 1YF1A 4MABA 1GSDA 1FW1A 1FHEA 3WGXA 3HD5A 1EWXA 1DBYA 3WGEA 3UVHA 3ERGA 4N3ZA 1FAAA 3GMFA 2I1UA 4ZB6A 2A2SA 4XS6A 1O6JA 2DLXA 2G0FA 2IMDA 2VD0A 1HNBA 3KTLA 4L0WA 2CV4A 1R4WA 1SD9A 5BMUA 4G19A 3LWAA 3MIXA 5G5FA 3R3EA 3H8QA 5COHA 3UAPA 2HYXA 4EF0A 3VPTA 3WT2A 2C8UA 1ML6A 3MWHA 3DXBA 2H0GA 3C7MA 1LBKA 4KF9A 4MZWA 3F6DA 3VWWA 1MD3A 2H1BA 4IJ3A 1XIYA 1N2AA 5J9BA 3VWUA 4E8HA 1XWGA 3TU3B 4AJ8A 2YZHA 4GF0A 2VL9A 4YKGA 2YJHA 1TW9A 4HU9A 5DCHA 2PBJA 1OC3A 2LRTA 1RQMA 4IJIA 4N0VA 1AQWA 4QL9A 3KMOA 3CSHA 4DSSB 2N5FA 3IC4A 2CAQA 1K0MA 2YWIA 4ML1A 2HZEB 5H5RA 5GZZB 2NDOA 5IO0A 1F2EA 1A2JA 6GSSA 3KD0A 2OT3A 9GSSA 2A2RA 2B3SA 2LJKA 3HYPA 1R26A 2GQMA 1PRXA 3LSZA 4IVFA 4ZILA 3CTFA 4POLA 4KNDA 11GSA 2LS5A 1XWKA 1GRXA 3DVWA 3F63A 5ECHB 3DVXA 1TRVA 1MEKA 6GSWA 1ERUA 4GRFA 3NZNA 2HLSA 4N30A 12GSA 2HFDA 3ZMLA 2C3QA 2GS3A 2G2QA 5JCGA 3KP9A 4TR3A 4TN8A 1SYRA 3GL3A 5H5SA 1GL8A 5IMZA 1URMA 2V32A 3UARA 5ECQB 1QQ2A 4IKHA 1GTIA 1EV4A 1NW2A 5HR2A 3TKSC 1R5AA 4KSMA 1M9AA 3CBUA 2DMLA 1ST9A 4Z7XA 2D2ZA 2GLRA 1OKTA 4HZ4A 2J9HA 4MK3A 2GT5A 4TXOB 4USSA 1HQOA 1NHOA 1PKZA 2VL3A 4JE1A 4GWRA 2HE3A 1U88A 2ON7A 5A4UA 3ZYWA 3K8NA 2XC2A 3FZ9A 3M3MA 2KP1A 4FQUA 3GUSA 4MA9A 5D9WA 3GKNA 4K5SA 4TR0A 2GTUA 4P3YB 1OC8A 4G01A 2H30A 3D22A 1XW9A 2P5RA 4TR1B 1SKSB 1YDKA 2OA7A 1K3LA 3KJYA 4YH2A 2PN8A 2B1LA 2I4AA 1SKWB 10GSA 4IQ1A 5JWOB 3RHBA 2I9HA 2C0DA 2H6ZA 3R2QA 2FLSA 2IMKA 4MJAA 1HYUA 1T7PB 2R4VA 1VGLA 5KEJA 1FO5A 3LEFA 1ZYEA 2ALBA 2OBIA 1G6WA 1VF3A 1UC7A 2I81A 4PQ1A 1K0AA 3BD2A 1PMTA 2N5AA 5ENUA 4HQZA 4PTSA 1X5DA 1E6BA 2MMAA 1SJ6A 3GYKA 1FVJA 3ZZXA 1ZOFA 4KX4A 3N9JA 2YWNA 2E7PA 3EU4A 1QXHA 5KN1A 4CY8A 1XFLA 2K8SA 5KN2A 4HUAA 2LJAA 1XZOA 3TB2A 2QKEA 2LQOA 1BQ7A 1XW5A 4JR4A 4OO5A 5A4VA 3E3EA 4F9ZA 6GSXA 3PR8A 1JZOA 5GSSA 3EMXA 1Y25A 1ZGNA 4O5RA 2HSNB 1DE2A 3EURA 3TJKA 1TK0B 3RDWA 2WB9A 5IIZA 2TIRA 3A2VA 2DBCA 2YV7A 4PNFA 2K6VA 4XS4A 1THOA 4NWYA 3QOUA 3EU3A 5J4YA 4EIPA 2WCIA 5CP1A 4OFTA 1EEJA 1ON4A 5G1KA 4YQVA 5DALB 2LJRA 5EL8A 2FUG2 1ZYPA 1MD4A 2VUPA 4PX1A 5E4WA 5CRDA 2XBIA 1OE7A 3APOA 1N25A 2OJLA 2AUVA 3HVXA 3AY8A 2R0PA 1WJKA 1Z6NA 4K5RA 1T1VA 4IHUA 1OC9A 3VWXA 1SJIA 1TXXA 5BMUB 4K0NA 1MTCA 1ABAA 3ZTLA 4K7NA 4NPBA 3RHCA 2VCQA 4KH7A 1F3AA 2CQ9A 2FA8A 1M99A 2CZ3A 3IRAA 3L9SA 3BCIA 2FWHA 1U3AA 4KDUA 3DWVA 3ZL5A 1X9MB 3CMIA 1GSSA 3TKSA 5J9CA 3TGZA 1TRSA 1A0RP 1SJZA 3LGCA 4YAVA 1Q4JA 1PSQA 4ZBBA 1AUCA 1O8WA 5IM9A 2FD3A 4WF5A 2NVLA 3FY7A 4O32A 2CA8A 1SVOA 3FZAA 5IMFA 2L5LA 5B7CA 4JRRA 4TW5A 2H1AA 4WEYA 4QMKA 1BAYA 1GSQA 1Q98A 2FWEA 3HZ8A 2R6KA 3GX8A 2LQQA 3E0UA 5JCWA 2H70A 4POBA 3I43A 4PUAA 3J7Yk 5KOXA 4WBRD 4OO4A 1A24A 4ICYA 5IMDA 3QDNA 3MDKA 2FWGA 5B8AA 3TJJA 1F9MA 3HA9A 2L4CA 5DJLA 2WRTA 2XBQA 4WKWA 1W89A 3QAGA 3CSIA 3F6FA 2GSQA 3A5WA 2L4QA 2R0CA 4N11A 4L0UA 5JWQB 1JHBA 4TVEA 1EP7A 1LJRA 2H1LA 2B5EA 4MDCA 1GLPA 4JR6A 2P31A 4BA7A 1GLQA 5CRWA 1XBSA 1SL1B 4GSSA 2RM5A 4LL4B 2JZSA 2HSMA 1LU4A 3F9UA 3CSJA 4KCAA 5F06A 4AKIA 2E2MA 1EZKA 4OCFA 1SKRB 1AIUA 1B8XA 4TOPA 3F4TA 3CXGA 1A2MA 1THXA 1TRWA 1BX9A 2OE3A 1WOUA 2F8FA 5HFGA 1SL2B 3QPMA 4LL1B 1SL0B 4KGIA 5EPFA 4ZBDA 3TCOA 3CWGA 2IMIA 2X8GA 2YCDA 4EIQA 1K3YA 1JFUA 4K2DA 2AB6A 2VCZA 4BL7B 5IQYA 1QGVA 4HEA2 1GTUA 3TJGA 4ZIJA 2NTOA 1F37A 3KMNA 3US3A 4TXVA 1R7HA 4WF4A 5J47A 3L78A 3D21A 4HJMA 4TR4A 2CX3A 2HRFA 5CAXA 1WPIA 3LYPA 3L0HA 1OKDA 2CX4A 2HXKA 3TRXA 5LNKe 3IPZA 1QUWA 5F8BA 4POKA 2C0EA 3ZVJD 1JLVA 5DBQA 1YJ6A 1QFNA 4LMVA 3QR6A 3TKPA 2N5BA 1A8YA 5AGYA 1H75A 1NHYA 3V1WA 1YVLA 4LLRA 4CW9A 5F07A 4FYCA 4KW6A 2R5GA 4NAXA 3G7IA 2O8VB 1GTBA 4KDXA 2FCHA 3GSTA 8GSSA 5J4UA 3UEMA 3D4MA 3P2AA 4IN0A 2LV3A 3PGTA 5ECNB 2H75A 2RIIA 3VWVA 5G30A 3A2XA 3DGQA 5DCGA 4I97A 2IWTA 1K3OA 3MYDA 4FYUA 4ZBAA 4EL1A 2MMOA 4ECCA 4NXIA 1T8EB 4F2IA 4PQHA 1XXUA 2VLVA 3DIEA 3BJ5A 2LNTA 3FR6A 1FG4A 3IA1A 1PL1A 1ZYQB 2O89A 4XHMA 5ECMB 2R3XA 5DJMA 2H1GA 5FWGA 2KLXA 4PGTA 3MSZA 1ZL9A 1Z3EA 1GNEA 4F0CA 5G2ZA 4GTUA 1T4ZA 3P90A 4XS4B 1B4PA 4MF5A 3TUEA 2WS2A 4N0ZA 13GSA 5E59A 4ULXA 4BWSA 1O81A 2JSYA 1JZWA 2GQLA 2JL4A 3ME7A 3EE2A 2H01A 14GSA 1GP1A 3GV1A 2KOKA 3GN3A 5D9XA 5GSTA 1O8XA 4DSQA 3GA4A 4ZL7A 4Z2RA 2H76A 1MDJA 5A1NA 2V1MA 4X0XA 4OCEA 2IMFA 2YN1A 2C3NA 4YKFA 2WGRA 3ERFA 1SD8A 3LQ7A 4ECBA 4RUVA 22GSA 4FO5A 2CT6A 1VF1A 2EIRA 3FMWA 5ECRB 4QQ7A 2IMEA 3GURA 2B7JA 5G1LA 1PA3A 2K18A 2X4AA 2REMA 4KCEA 1GH2A 1J9BA 4EVMA 2EFEA 1O85A 5A34A 1NM3A 5ECPB 3G7JA 1FB0A 2MBSA 2OADA 7GSSA 2OE0A 4AGSA 2XPEA 4HU7A 2JZTA 1TOFA 3LJRA 3GFKA 3IAM2 2FGXA 3NOFA 2WDUA 3LW9A 3SBCA 2F3MA 4XCSA 1SVLA 2JU5A 5JCUA 4GLTA 5B8BA 2HZFA 1U6TA 1SYXA 2CVBA 4OD7A 2GSRA 3RPNA 4PURA 1TK5B 2XPDA 3IXRA 3DYRA 5ECOB 5DAKB 1Z7RA 1EEMA 2PVOC 3APQA 3F4RA 4ACSA 2A4HA 4G0LA 1YKAA 2FY6A 1V40A 6GSUA 20GSA 1YEPA 1V98A 3FRCA 1WIKA 1X0RA 1O73A 3I9V2 1ZCPA 5ID2A 4GDFA 4F03A 2JACA 5J40A 5AIXA 4PXOA 2X8CA 1YF0A 2YPMA 5D9TA 4IELA 4YQMA 1I9DA 3C73A 2DJ2A 2H0HA 5KN3A 4RQXA 4L5OA 4PUFC 2NPBA 1GWCA 2B1KA 3LFLA 1H4OA 4O5UA 4V2NA 4FH8A 5CYYA 1HD2A 2DJKA 1TJDA 2HSMB 2X99A 1J08A 2O5VA 4IP6A 1DSBA 1QMVA 4K9ZA 2IIYA 3ME8A 3KGKA 3M9JA 4I5QA 5A5HA 3FR3A 2C0FA 3TKRA 5CNWA 2WFCA 5DVBA 3GRXA 1WP0A 2L6DA 3BOAA 2AYTA 4MJEA 2VO4A 3FEUA 2RM6A 2X49A 3APSA 1SU9A 3C1SA 2EIOA 3KH7A 1S3AA 2LEGA 3DEXA 2P0GA 1M7TA 4K6XA 3KEBA 2YWOA 2PGTA 4Q5RA 1PGTA 2HZEA 2ON5A 3HJPA 1A8LA 3H79A 3PH9A 3GHAA 1HNCA 3A3TA 3ZIVA 5HR1A 2VL2C 3D5JA 4MH3A 1G7EA 2KP2A 4I8BA 4EDYA 1X5EA 5LCZA 4MJBA 2LUSA 3QD9A 3M8NA 3L9VA 2PMTA 2FNOA 2HT9A 5GAND 2FHEA 2YWMA 3HMJG 2B5XA 3DMLA 1DUGA 2VKZG 3G9BA 1TKDB 3RBTA 1GSEA 4RI6A 3ZFLA 1VF4A 1SVMA 1JZDA 2RUEA 6GSVA 4IGJA 4WR5A 2E0QA 3P7XA 4FYBA 1FOHA 3EWLA 1Z9HA 2YANA 2L59A 2V6OA 4K2XA 1K0OA 4PNGA 1GSUA 2VCXA 3GKMA 1UA5A 2VIMA 4IW9A 2DIYA 3ZIJA 4F0BA 2J23A 3PINA 2FA4A 2BTOT 2H0IA 4BVXA 4J2FA 4ZB7A 1SK2A 2RUFA 4IQAA 2VLUA 2AV4A 1WE0A 1TU8A 2R0GA 1CQHA 3GKKA 3M9KA 2EFDA 3LG6A 3W6GA 5ECKB 1PKWA 1S3CA 4AJ6A 1Z6MA 2F51A 3EYTA 4IS0A 5J5NA 3O3TA 1M2DA 4IP1A 4JBBA 3O76A 1TU7A 2EIQA 3GTUA 1TK8B 1BJXA 1WRYA 1ERTA 1Y1UA 5B6MA 2P5QA 3HVVA 1VRSD 4D73A 4BPYA 2TRCP 2VCVA 4RI7A 5IPGA 4AF2A 3O6TA 3IAS2 5DDLA 2WULA 3F3RA 2F8AA 3HDCA 3IV4A 2EC4A 2L5OA 3C1RA 1UN2A 2I3YA 4A5PA 1MDIA 2GSSA 4XRDA 3VURA 3QFBC 2HRKA 4YQUA 4HZ2A 3IHGA 1HNAA 2VD1A 1GSFA 4MCUA 3VLNA 1Z5YE 3H93A 1VF2A 1AW9A 3L9UA 4MNNA 1C72A 2BMXA 4O92A 1YEXA 3GL5A 5A5KA 1XW6A 2H8LA 5FT3A 2F9SA 1IYHA 2PWJA 2CVDA 5CRGA 3VPQA 5D8IA 3IDVA 5INYA 3VI7A 4KAEA 2GZYA 1GUKA 3KXOA 4O5QA 3OR5A 1YQ1A 1TTZA 5D96A 4HDEA 3M1GA 2L57A 3I6AA 2H73A 4Z2UA 3UL3A 1E2YA 2BJXA 2M80A 4V2LA 5IPHA 5D73A 16GSA 3G7YA 4ZL9A 2GDRA 2HI7A 3ZMKA 1BF5A 2UZ8A 3WD6A 5HR3A 3TRQA 4IBPA 1QK8A 3FZ4A 5A34B 1XVQA 4MMMA 4JU5A 4I2TA 1T4YA 3I69A 1O7UA 3KZQA 3Q74A 3TDGA 5F05A 4WR4A 1TXUA 3ZITA 2HSNA 2CVKA 1PN0A 1XOBA 2AAWA 5ECSA 2WJUA 2PUKC 5DQYA 5AIVA 2HRAA 3BBYA 4MP4A 1W4VA 3KCMA 2O7KA 3QMXA 5IO2A 4L5LA 4ML6A 1S3DA 2ZCTA 1BYEA 2VL2A 2LRCA 3WYWA 4MF6A 4BVYA 5DALA 3ZREA 5AISA 4GQCA 3LXZA 2PPTA 2C4JA 3QFAC 3HJMA 2VM2A 4MH2A 1U3IA 4LMWA 3EMPA 4KB3A 2C0GA 1XPVA 5ID2B 3Q18A 5EVOA 2KUCA 1KNGA 3GKXA 3J7Yb 2HNLA 1F6MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VOC A;  4K1F A;  3FW2 A;  2CZ2 A;  1T3B A;  2YZU A;  4O7H A;  5KN0 A;  1X9S B;  3ZVJ A;  4G9H A;  2ES7 A;  2H6X A;  3KH9 A;  2B6M A;  4KDY A;  3Q6O A;  4KUN A;  1GTA A;  2DJ3 A;  2TRX A;  4GSN A;  5ECL B;  4NHZ A;  1GUM A;  3UBL A;  1JZR A;  4X43 A;  1V9W A;  1GUH A;  4ID0 A;  3EVI A;  3FYG A;  3F3Q A;  4E8E A;  4I2U A;  4OFM A;  1G7O A;  3JCM L;  3CRT A;  4PQI A;  2OBK A;  3GH6 A;  5ELG A;  5HQP A;  1PQN A;  2GVP A;  5HR0 A;  1DE1 A;  5C04 A;  2GZP A;  4G2E A;  4HS1 A;  5EY6 A;  4YAP A;  2KHP A;  5HFK A;  2LRN A;  2HSY A;  2ZUP A;  3DD3 A;  4HQS A;  1Z7P A;  5ELA A;  4CHS A;  3F0I A;  1TP9 A;  2H66 A;  1K0D A;  3RPP A;  4JZQ A;  2CAI A;  4OWY A;  4J56 E;  2V6K A;  5D93 A;  5DQS A;  1X9W B;  3ISO A;  19GS A;  1OC9 B;  1TDI A;  2H19 A;  3U6V A;  1PX7 A;  2DMM A;  1IYI A;  5J41 A;  1XWA A;  2B7K A;  5AN1 A;  5GAP D;  2MMZ A;  3FZ5 A;  2H6Y A;  1PL2 A;  2IFQ A;  5C00 A;  4V2M A;  2R37 A;  4XIH A;  1WWJ A;  3IOS A;  2LTK A;  4G0K A;  2H71 A;  4ECI A;  1BED A;  3HY2 A;  1XWC A;  2VCW A;  4H86 A;  1B9Y C;  4JED A;  5CRH A;  3TJF A;  4BVX B;  1R5P A;  4NV2 A;  3IE3 A;  3LOR A;  2DIZ A;  1SK0 A;  3HZ4 A;  4MPG A;  1PX6 A;  3HHV A;  5IMA A;  4KE3 A;  3QAV A;  1ACV A;  4XTS A;  1SK1 A;  3MNG A;  5IMV A;  3UJ1 A;  3HXS A;  3GTU B;  2JAD A;  3ED3 A;  3RAZ A;  4BL7 A;  1XCC A;  3GX0 A;  3W8J A;  2H74 A;  4MZB A;  3VI5 A;  4TKY A;  2GGT A;  3KIJ A;  1G6Y A;  4D73 B;  3BCK A;  1GUL A;  4POM A;  1RW1 A;  1A2L A;  1EGO A;  4TRX A;  2MBT A;  1M2A A;  2QSI A;  1XVW A;  5IMC A;  3D6I A;  1Y6E A;  5L71 A;  1TI3 A;  2HRK B;  2VLT A;  1PN9 A;  4RQR A;  2V2G A;  1ERV A;  3A2W A;  3DRN A;  4EDZ A;  1B9X C;  5CRE A;  1N8J A;  1V58 A;  1I5G A;  1OVN A;  2GZZ A;  4XS1 A;  3GNJ A;  5D9V A;  4ZB9 A;  4G0I A;  2VCT A;  2X64 A;  6GST A;  4HOJ A;  4CDO A;  1AXD A;  3NIV A;  5CO3 A;  5LD0 A;  4EC0 A;  2YOI A;  5ABR A;  2MMN A;  3U5R E;  1XWB A;  1F3B A;  1EV9 A;  2E2G A;  1ZMA A;  3FK8 A;  4DVC A;  2K9F A;  1T00 A;  4EXJ A;  3H4K A;  3ZRD A;  4KA0 A;  1V2A A;  2X8H A;  4K7I A;  1G0T A;  1KBN A;  4HJ2 A;  2K8V A;  3HVS A;  1UVZ A;  3TJB A;  1B4Q A;  1XOA A;  1YY7 A;  2MZC A;  2DJ0 A;  4DSS A;  2WZ9 A;  2V41 A;  1OE8 A;  1BG5 A;  1M2B A;  1YKC A;  2MYG A;  4OMV A;  3PPU A;  3QCP A;  3EIN A;  4Q5N A;  1AQX A;  3KP8 A;  4MJC A;  2PU9 C;  1SEN A;  2VAF A;  1USB A;  4MLY A;  2C80 A;  4GQF A;  4NMU A;  3WGD A;  2C3T A;  2H1D A;  5FHI A;  1OYJ A;  2PVQ A;  2B5Y A;  5A4W A;  4BVY B;  2DC5 A;  4GCI A;  2DSA A;  2A4V A;  4WBJ A;  5G5E A;  5J3R A;  1K0C A;  1TRU A;  4EUY A;  1AAZ A;  1EOH A;  2IPA A;  2VM1 A;  1A23 A;  4F82 A;  3TOT A;  4ZXG A;  4XRA A;  1B48 A;  2L6C A;  4KSO A;  4ISD A;  4MZC A;  1EOG A;  1JLW A;  1NSW A;  3IK9 A;  3UVT A;  4GST A;  3QAW A;  3F8U A;  2AHE A;  1FVK A;  1OAZ A;  4MF7 A;  4EO3 A;  1ZZY A;  5ECI B;  2IN3 A;  4DSR A;  1FOV A;  3C71 A;  4Q5Q A;  2PER A;  1KEB A;  1RK4 A;  4NV5 A;  2GST A;  5B6N A;  4BWQ A;  3M0F A;  3ZFB A;  4LA1 A;  1J0F A;  4NHW A;  4MPF A;  5F0G A;  1MDK A;  2IL3 A;  4TXO A;  3GSS A;  4V1A g;  1K0B A;  2OAC A;  3D4T A;  6GSY A;  1CQG A;  1M9B A;  2YV9 A;  2NBS A;  17GS A;  4N10 A;  2O85 A;  2LNS A;  1X5C A;  2JZR A;  3VFI A;  4ZL8 A;  3UMA A;  3MAK A;  4K0G A;  4K7O A;  3F4S A;  3ERW A;  4G10 A;  3FR9 A;  1M0U A;  2O87 A;  3ZLP A;  3GIX A;  3KTB A;  3L4N A;  2QGV A;  2QC7 A;  4OFN A;  2R2J A;  3IBH A;  4ZB8 A;  3UOM A;  4V1A p;  2H72 A;  1TI1 A;  3GH9 A;  5G31 A;  3HCZ A;  1V57 A;  5H5Q A;  3WT1 A;  5DAK A;  4K8M A;  4TR1 A;  3N5O A;  1EGR A;  4EE0 A;  4ILF A;  1EP8 A;  3KM6 A;  4DEJ A;  5HFI A;  1A0F A;  2IJY A;  1GSY A;  2OKA A;  3TKS E;  2HRN A;  1YZX A;  4X1U A;  1K0N A;  3EC3 A;  1ERW A;  3HJO A;  3FHK A;  3TKQ A;  1FB6 A;  4ECJ A;  3DKS A;  4Q5F A;  3FKF A;  5JWR B;  3UBK A;  4WXT A;  2AJQ B;  3SWL A;  4HI7 A;  4J57 E;  1ILO A;  3W8S A;  4L8E A;  2XHF A;  2GT6 A;  3S9F A;  2IFQ B;  18GS A;  3UIW A;  1PD2 1;  1AQV A;  2LST A;  2C1Y A;  1KTE A;  3CRU A;  3P8W A;  3IC8 A;  2M72 A;  2HSH A;  2LKU A;  3Q19 A;  3LXT A;  2YNX A;  3IHQ A;  2YP6 A;  2DJ1 A;  4AJ7 A;  2M46 A;  3CTG A;  2GQK A;  4WET A;  3TRP A;  5IOX A;  3IK7 A;  1GNW A;  2ZNM A;  1WMJ A;  3E9J B;  2HQT A;  4FIW A;  3H1N A;  3IR4 A;  4GXZ A;  2Z9S A;  3TOU A;  3D0Z A;  2RLI A;  2YJ7 A;  3LYK A;  2FWF A;  2JSZ A;  3CYN A;  3C8E A;  3HKR A;  1U87 A;  2DJJ A;  4QL7 A;  1AC1 A;  4EKZ A;  4I6X A;  3VK9 A;  2OE1 A;  5IOW A;  1YF1 A;  4MAB A;  1GSD A;  1FW1 A;  1FHE A;  3WGX A;  3HD5 A;  1EWX A;  1DBY A;  3WGE A;  3UVH A;  3ERG A;  1FAA A;  3GMF A;  2I1U A;  4ZB6 A;  2A2S A;  4XS6 A;  1O6J A;  2DLX A;  2G0F A;  2IMD A;  2VD0 A;  1HNB A;  3KTL A;  4L0W A;  2CV4 A;  1R4W A;  1SD9 A;  5BMU A;  4G19 A;  3LWA A;  5G5F A;  3R3E A;  3H8Q A;  5COH A;  3UAP A;  2HYX A;  4EF0 A;  3VPT A;  3WT2 A;  2C8U A;  1ML6 A;  3MWH A;  3DXB A;  2H0G A;  3C7M A;  1LBK A;  4KF9 A;  4MZW A;  3F6D A;  3VWW A;  1MD3 A;  2H1B A;  4IJ3 A;  1XIY A;  1N2A A;  5J9B A;  3VWU A;  4E8H A;  1XWG A;  4AJ8 A;  2YZH A;  4GF0 A;  2VL9 A;  2YJH A;  1TW9 A;  4HU9 A;  5DCH A;  2PBJ A;  1OC3 A;  2LRT A;  1RQM A;  4IJI A;  4N0V A;  1AQW A;  4QL9 A;  3KMO A;  3CSH A;  4DSS B;  2N5F A;  3IC4 A;  2CAQ A;  1K0M A;  2YWI A;  4ML1 A;  2HZE B;  5H5R A;  5GZZ B;  2NDO A;  5IO0 A;  1F2E A;  1A2J A;  6GSS A;  3KD0 A;  9GSS A;  2A2R A;  2B3S A;  2LJK A;  1R26 A;  3HYP A;  2GQM A;  1PRX A;  3LSZ A;  4IVF A;  4ZIL A;  3CTF A;  4POL A;  4KND A;  11GS A;  2LS5 A;  1XWK A;  1GRX A;  3DVW A;  3F63 A;  5ECH B;  3DVX A;  1TRV A;  1MEK A;  6GSW A;  1ERU A;  4GRF A;  3NZN A;  2HLS A;  4N30 A;  12GS A;  2HFD A;  3ZML A;  2C3Q A;  2GS3 A;  2G2Q A;  5JCG A;  3KP9 A;  4TR3 A;  4TN8 A;  1SYR A;  3GL3 A;  5H5S A;  1GL8 A;  5IMZ A;  1URM A;  2V32 A;  3UAR A;  5ECQ B;  1QQ2 A;  4IKH A;  1GTI A;  1EV4 A;  1NW2 A;  5HR2 A;  3TKS C;  1R5A A;  4KSM A;  1M9A A;  3CBU A;  2DML A;  1ST9 A;  4Z7X A;  2D2Z A;  2GLR A;  1OKT A;  4HZ4 A;  2J9H A;  4MK3 A;  2GT5 A;  4TXO B;  4USS A;  1HQO A;  1NHO A;  1PKZ A;  2VL3 A;  4JE1 A;  4GWR A;  2HE3 A;  1U88 A;  2ON7 A;  5A4U A;  3ZYW A;  3K8N A;  2XC2 A;  3FZ9 A;  3M3M A;  2KP1 A;  4FQU A;  3GUS A;  4MA9 A;  5D9W A;  3GKN A;  4TR0 A;  2GTU A;  4P3Y B;  1OC8 A;  2H30 A;  3D22 A;  1XW9 A;  2P5R A;  4TR1 B;  1SKS B;  1YDK A;  2OA7 A;  1K3L A;  3KJY A;  4YH2 A;  2PN8 A;  2B1L A;  2I4A A;  1SKW B;  10GS A;  4IQ1 A;  5JWO B;  3RHB A;  2I9H A;  2C0D A;  2H6Z A;  3R2Q A;  2FLS A;  2IMK A;  4MJA A;  1HYU A;  1T7P B;  2R4V A;  1VGL A;  5KEJ A;  1FO5 A;  3LEF A;  1ZYE A;  2ALB A;  2OBI A;  1G6W A;  1VF3 A;  1UC7 A;  2I81 A;  4PQ1 A;  1K0A A;  3BD2 A;  1PMT A;  2N5A A;  5ENU A;  4HQZ A;  4PTS A;  1X5D A;  1E6B A;  2MMA A;  1SJ6 A;  3GYK A;  1FVJ A;  3ZZX A;  1ZOF A;  4KX4 A;  3N9J A;  2YWN A;  2E7P A;  3EU4 A;  1QXH A;  5KN1 A;  1XFL A;  2K8S A;  5KN2 A;  4HUA A;  2LJA A;  1XZO A;  3TB2 A;  2QKE A;  2LQO A;  1BQ7 A;  1XW5 A;  4JR4 A;  4OO5 A;  5A4V A;  3E3E A;  4F9Z A;  6GSX A;  3PR8 A;  1JZO A;  5GSS A;  3EMX A;  1Y25 A;  1ZGN A;  4O5R A;  2HSN B;  1DE2 A;  3EUR A;  3TJK A;  1TK0 B;  3RDW A;  2WB9 A;  5IIZ A;  2TIR A;  3A2V A;  2DBC A;  2YV7 A;  4PNF A;  2K6V A;  4XS4 A;  1THO A;  4NWY A;  3QOU A;  3EU3 A;  2WCI A;  5CP1 A;  4OFT A;  1EEJ A;  1ON4 A;  5G1K A;  4YQV A;  5DAL B;  2LJR A;  5EL8 A;  2FUG 2;  1MD4 A;  2VUP A;  4PX1 A;  5E4W A;  5CRD A;  2XBI A;  1OE7 A;  3APO A;  2OJL A;  2AUV A;  3HVX A;  3AY8 A;  1WJK A;  1Z6N A;  1T1V A;  4IHU A;  1OC9 A;  3VWX A;  1SJI A;  1TXX A;  4K0N A;  1MTC A;  1ABA A;  3ZTL A;  4K7N A;  4NPB A;  3RHC A;  2VCQ A;  4KH7 A;  1F3A A;  2CQ9 A;  2FA8 A;  1M99 A;  2CZ3 A;  3IRA A;  3L9S A;  3BCI A;  2FWH A;  1U3A A;  4KDU A;  3DWV A;  3ZL5 A;  1X9M B;  3CMI A;  1GSS A;  3TKS A;  5J9C A;  3TGZ A;  1TRS A;  1A0R P;  1SJZ A;  3LGC A;  4YAV A;  1Q4J A;  1PSQ A;  4ZBB A;  1AUC A;  1O8W A;  5IM9 A;  2FD3 A;  4WF5 A;  2NVL A;  3FY7 A;  4O32 A;  2CA8 A;  3FZA A;  5IMF A;  2L5L A;  5B7C A;  4JRR A;  4TW5 A;  2H1A A;  4WEY A;  1BAY A;  1GSQ A;  1Q98 A;  2FWE A;  3HZ8 A;  2R6K A;  3GX8 A;  2LQQ A;  3E0U A;  5JCW A;  2H70 A;  4POB A;  3I43 A;  4PUA A;  3J7Y k;  4WBR D;  4OO4 A;  1A24 A;  5IMD A;  3QDN A;  3MDK A;  2FWG A;  5B8A A;  3TJJ A;  1F9M A;  3HA9 A;  2L4C A;  5DJL A;  2WRT A;  2XBQ A;  4WKW A;  1W89 A;  3QAG A;  3CSI A;  3F6F A;  2GSQ A;  3A5W A;  2L4Q A;  4N11 A;  4L0U A;  5JWQ B;  1JHB A;  4TVE A;  1EP7 A;  1LJR A;  2B5E A;  4MDC A;  1GLP A;  4JR6 A;  2P31 A;  4BA7 A;  1GLQ A;  5CRW A;  1XBS A;  1SL1 B;  4GSS A;  2RM5 A;  4LL4 B;  2JZS A;  2HSM A;  1LU4 A;  3F9U A;  3CSJ A;  4KCA A;  5F06 A;  2E2M A;  4OCF A;  1EZK A;  1SKR B;  1AIU A;  1B8X A;  4TOP A;  3F4T A;  3CXG A;  1A2M A;  1THX A;  1TRW A;  1BX9 A;  2OE3 A;  1WOU A;  2F8F A;  5HFG A;  1SL2 B;  3QPM A;  4LL1 B;  1SL0 B;  4KGI A;  5EPF A;  4ZBD A;  3TCO A;  2IMI A;  2X8G A;  2YCD A;  1K3Y A;  1JFU A;  4K2D A;  2AB6 A;  2VCZ A;  4BL7 B;  5IQY A;  1QGV A;  4HEA 2;  1GTU A;  3TJG A;  4ZIJ A;  2NTO A;  1F37 A;  3KMN A;  3US3 A;  4TXV A;  1R7H A;  4WF4 A;  3L78 A;  3D21 A;  4HJM A;  4TR4 A;  2CX3 A;  2HRF A;  5CAX A;  1WPI A;  3LYP A;  3L0H A;  1OKD A;  2CX4 A;  2HXK A;  3TRX A;  5LNK e;  3IPZ A;  1QUW A;  5F8B A;  4POK A;  2C0E A;  3ZVJ D;  1JLV A;  5DBQ A;  1YJ6 A;  1QFN A;  4LMV A;  3QR6 A;  3TKP A;  2N5B A;  1A8Y A;  5AGY A;  1H75 A;  1NHY A;  3V1W A;  4LLR A;  4CW9 A;  5F07 A;  4FYC A;  4KW6 A;  2R5G A;  4NAX A;  3G7I A;  2O8V B;  1GTB A;  4KDX A;  2FCH A;  3GST A;  8GSS A;  5J4U A;  3UEM A;  3D4M A;  3P2A A;  4IN0 A;  2LV3 A;  3PGT A;  5ECN B;  2H75 A;  2RII A;  3VWV A;  5G30 A;  3A2X A;  3DGQ A;  5DCG A;  4I97 A;  2IWT A;  1K3O A;  4FYU A;  4ZBA A;  4EL1 A;  2MMO A;  4ECC A;  4NXI A;  1T8E B;  4F2I A;  4PQH A;  1XXU A;  2VLV A;  3DIE A;  3BJ5 A;  2LNT A;  3FR6 A;  1FG4 A;  3IA1 A;  1PL1 A;  1ZYQ B;  2O89 A;  4XHM A;  5ECM B;  2R3X A;  5DJM A;  2H1G A;  5FWG A;  2KLX A;  4PGT A;  3MSZ A;  1ZL9 A;  1Z3E A;  1GNE A;  4F0C A;  5G2Z A;  4GTU A;  1T4Z A;  3P90 A;  4XS4 B;  1B4P A;  4MF5 A;  3TUE A;  2WS2 A;  4N0Z A;  13GS A;  5E59 A;  4ULX A;  4BWS A;  1O81 A;  2JSY A;  1JZW A;  2GQL A;  2JL4 A;  3ME7 A;  3EE2 A;  2H01 A;  14GS A;  1GP1 A;  3GV1 A;  2KOK A;  3GN3 A;  5D9X A;  5GST A;  1O8X A;  4DSQ A;  3GA4 A;  4ZL7 A;  2H76 A;  1MDJ A;  2V1M A;  4X0X A;  4OCE A;  2IMF A;  2YN1 A;  2C3N A;  2WGR A;  3ERF A;  1SD8 A;  3LQ7 A;  4ECB A;  4RUV A;  22GS A;  4FO5 A;  2CT6 A;  1VF1 A;  2EIR A;  5ECR B;  4QQ7 A;  2IME A;  3GUR A;  2B7J A;  5G1L A;  1PA3 A;  2K18 A;  2REM A;  4KCE A;  1GH2 A;  1J9B A;  4EVM A;  1O85 A;  1NM3 A;  5ECP B;  3G7J A;  1FB0 A;  2MBS A;  2OAD A;  7GSS A;  2OE0 A;  4AGS A;  2XPE A;  4HU7 A;  2JZT A;  1TOF A;  3LJR A;  3GFK A;  3IAM 2;  2FGX A;  3NOF A;  2WDU A;  3SBC A;  2F3M A;  4XCS A;  2JU5 A;  5JCU A;  4GLT A;  5B8B A;  2HZF A;  1U6T A;  1SYX A;  2CVB A;  4OD7 A;  2GSR A;  3RPN A;  4PUR A;  1TK5 B;  2XPD A;  3IXR A;  3DYR A;  5ECO B;  5DAK B;  1Z7R A;  1EEM A;  2PVO C;  3APQ A;  3F4R A;  4ACS A;  4G0L A;  1YKA A;  2FY6 A;  1V40 A;  6GSU A;  20GS A;  1YEP A;  1V98 A;  3FRC A;  1WIK A;  1X0R A;  1O73 A;  3I9V 2;  1ZCP A;  5ID2 A;  4F03 A;  2JAC A;  5AIX A;  4PXO A;  2X8C A;  1YF0 A;  2YPM A;  5D9T A;  4IEL A;  4YQM A;  1I9D A;  3C73 A;  2DJ2 A;  2H0H A;  5KN3 A;  4RQX A;  4L5O A;  4PUF C;  2NPB A;  1GWC A;  2B1K A;  3LFL A;  1H4O A;  4V2N A;  4FH8 A;  5CYY A;  1HD2 A;  2DJK A;  1TJD A;  2HSM B;  2X99 A;  1J08 A;  4IP6 A;  1DSB A;  1QMV A;  4K9Z A;  2IIY A;  3ME8 A;  3KGK A;  3M9J A;  4I5Q A;  3FR3 A;  2C0F A;  3TKR A;  5CNW A;  2WFC A;  5DVB A;  3GRX A;  1WP0 A;  2L6D A;  3BOA A;  2AYT A;  4MJE A;  2VO4 A;  3FEU A;  2RM6 A;  3APS A;  1SU9 A;  3C1S A;  2EIO A;  3KH7 A;  1S3A A;  2LEG A;  3DEX A;  2P0G A;  1M7T A;  4K6X A;  3KEB A;  2YWO A;  2PGT A;  4Q5R A;  1PGT A;  2HZE A;  2ON5 A;  3HJP A;  1A8L A;  3H79 A;  3PH9 A;  3GHA A;  1HNC A;  3A3T A;  3ZIV A;  5HR1 A;  2VL2 C;  3D5J A;  4MH3 A;  1G7E A;  2KP2 A;  4I8B A;  4EDY A;  1X5E A;  5LCZ A;  4MJB A;  2LUS A;  3QD9 A;  3M8N A;  3L9V A;  2PMT A;  2FNO A;  2HT9 A;  5GAN D;  2FHE A;  2YWM A;  2B5X A;  3DML A;  1DUG A;  3G9B A;  1TKD B;  3RBT A;  1GSE A;  4RI6 A;  3ZFL A;  1VF4 A;  1JZD A;  2RUE A;  6GSV A;  4IGJ A;  4WR5 A;  2E0Q A;  3P7X A;  4FYB A;  3EWL A;  1Z9H A;  2YAN A;  2L59 A;  2V6O A;  1K0O A;  4PNG A;  1GSU A;  2VCX A;  3GKM A;  1UA5 A;  2VIM A;  4IW9 A;  2DIY A;  3ZIJ A;  4F0B A;  2J23 A;  3PIN A;  2FA4 A;  2BTO T;  2H0I A;  4BVX A;  4J2F A;  1SK2 A;  2RUF A;  4IQA A;  2VLU A;  2AV4 A;  1WE0 A;  1TU8 A;  1CQH A;  3GKK A;  3M9K A;  3LG6 A;  3W6G A;  5ECK B;  1PKW A;  1S3C A;  4AJ6 A;  1Z6M A;  2F51 A;  3EYT A;  4IS0 A;  5J5N A;  3O3T A;  1M2D A;  4IP1 A;  4JBB A;  3O76 A;  1TU7 A;  2EIQ A;  3GTU A;  1TK8 B;  1BJX A;  1WRY A;  1ERT A;  5B6M A;  2P5Q A;  3HVV A;  1VRS D;  4D73 A;  4BPY A;  2TRC P;  2VCV A;  4RI7 A;  5IPG A;  4AF2 A;  3O6T A;  3IAS 2;  5DDL A;  2WUL A;  3F3R A;  2F8A A;  3HDC A;  3IV4 A;  2EC4 A;  2L5O A;  3C1R A;  1UN2 A;  2I3Y A;  1MDI A;  2GSS A;  4XRD A;  3VUR A;  3QFB C;  2HRK A;  4YQU A;  4HZ2 A;  1HNA A;  2VD1 A;  1GSF A;  4MCU A;  3VLN A;  1Z5Y E;  3H93 A;  1VF2 A;  1AW9 A;  3L9U A;  1C72 A;  2BMX A;  4O92 A;  1YEX A;  3GL5 A;  5A5K A;  1XW6 A;  2H8L A;  5FT3 A;  2F9S A;  1IYH A;  2PWJ A;  2CVD A;  5CRG A;  3VPQ A;  5D8I A;  3IDV A;  5INY A;  3VI7 A;  4KAE A;  2GZY A;  1GUK A;  3KXO A;  3OR5 A;  1YQ1 A;  1TTZ A;  5D96 A;  4HDE A;  3M1G A;  2L57 A;  3I6A A;  2H73 A;  3UL3 A;  1E2Y A;  2BJX A;  2M80 A;  4V2L A;  5IPH A;  5D73 A;  16GS A;  3G7Y A;  4ZL9 A;  2GDR A;  2HI7 A;  3ZMK A;  2UZ8 A;  3WD6 A;  5HR3 A;  3TRQ A;  4IBP A;  1QK8 A;  3FZ4 A;  1XVQ A;  4MMM A;  4JU5 A;  4I2T A;  1T4Y A;  3I69 A;  1O7U A;  3KZQ A;  3Q74 A;  3TDG A;  5F05 A;  4WR4 A;  3ZIT A;  2CVK A;  1XOB A;  2AAW A;  5ECS A;  2WJU A;  2PUK C;  5DQY A;  5AIV A;  2HRA A;  3BBY A;  4MP4 A;  1W4V A;  3KCM A;  2O7K A;  3QMX A;  5IO2 A;  4L5L A;  4ML6 A;  1S3D A;  2ZCT A;  1BYE A;  2VL2 A;  2LRC A;  3WYW A;  4MF6 A;  4BVY A;  5DAL A;  3ZRE A;  5AIS A;  4GQC A;  3LXZ A;  2PPT A;  2C4J A;  3QFA C;  3HJM A;  2VM2 A;  4MH2 A;  1U3I A;  4LMW A;  3EMP A;  4KB3 A;  2C0G A;  1XPV A;  5ID2 B;  3Q18 A;  5EVO A;  2KUC A;  1KNG A;  3GKX A;  3J7Y b;  2HNL A;  1F6M C; 
#chains in the Genus database with same CATH topology
 2VOC A;  4K1F A;  3FW2 A;  1ZYN A;  1M3I A;  2CZ2 A;  1T3B A;  2YZU A;  4O7H A;  5KN0 A;  1X9S B;  3ZVJ A;  4G9H A;  2ES7 A;  2H6X A;  3KH9 A;  2B6M A;  4KDY A;  3Q6O A;  4KUN A;  1GTA A;  2DJ3 A;  2TRX A;  4GSN A;  5ECL B;  4NHZ A;  1GUM A;  5A5H B;  3UBL A;  1JZR A;  4X43 A;  1V9W A;  1GUH A;  4ID0 A;  3EVI A;  3FYG A;  3F3Q A;  4E8E A;  5BRT A;  4I2U A;  4OFM A;  1G7O A;  3JCM L;  3CRT A;  4PQI A;  2OBK A;  3GH6 A;  5ELG A;  5HQP A;  1PQN A;  2GVP A;  1S3R A;  5HR0 A;  1DE1 A;  5C04 A;  2GZP A;  4G2E A;  4HS1 A;  5EY6 A;  4YAP A;  2KHP A;  5HFK A;  2LRN A;  2HSY A;  2ZUP A;  3DD3 A;  4HQS A;  4AKG A;  1Z7P A;  5ELA A;  4CHS A;  3F0I A;  1TP9 A;  2H66 A;  1K0D A;  3RPP A;  4JZQ A;  2CAI A;  4OWY A;  4J56 E;  2V6K A;  2O36 A;  2DKH A;  5D93 A;  5DQS A;  1X9W B;  3ISO A;  19GS A;  1OC9 B;  1TDI A;  2H19 A;  3U6V A;  1PX7 A;  2DMM A;  1IYI A;  5J41 A;  1XWA A;  2B7K A;  5AN1 A;  5GAP D;  2MMZ A;  3FZ5 A;  2H6Y A;  1PL2 A;  2IFQ A;  5C00 A;  4V2M A;  2R37 A;  4XIH A;  1WWJ A;  3IOS A;  2LTK A;  4G0K A;  4AKX B;  2H71 A;  4ECI A;  1BED A;  3HY2 A;  1XWC A;  2VCW A;  4H86 A;  1B9Y C;  4JED A;  5CRH A;  3TJF A;  2EFC A;  2EFH A;  4BVX B;  1R5P A;  4NV2 A;  3IE3 A;  3LOR A;  3RFR C;  2DIZ A;  1SK0 A;  3HZ4 A;  4MPG A;  1PX6 A;  3HHV A;  5IMA A;  4KE3 A;  3QAV A;  1ACV A;  4XTS A;  1SK1 A;  3MNG A;  5IMV A;  3UJ1 A;  3HXS A;  3GTU B;  2JAD A;  3ED3 A;  3RAZ A;  4BL7 A;  1XCC A;  3GX0 A;  3W8J A;  2H74 A;  4MZB A;  3VI5 A;  4TKY A;  2GGT A;  3KIJ A;  1G6Y A;  4D73 B;  3BCK A;  1GUL A;  4POM A;  1RW1 A;  1A2L A;  1EGO A;  4TRX A;  2MBT A;  1M2A A;  2QSI A;  1XVW A;  5IMC A;  3D6I A;  1Y6E A;  5L71 A;  1TI3 A;  2HRK B;  2VLT A;  1PN9 A;  4RQR A;  2V2G A;  1ERV A;  3A2W A;  3DRN A;  4EDZ A;  1B9X C;  5CRE A;  2WVY A;  1N8J A;  1V58 A;  1I5G A;  1OVN A;  2GZZ A;  4XS1 A;  3GNJ A;  5D9V A;  4ZB9 A;  4G0I A;  3CHX C;  2VCT A;  2X64 A;  6GST A;  4HOJ A;  4CDO A;  1AXD A;  3NIV A;  5CO3 A;  5LD0 A;  4EC0 A;  2YOI A;  5ABR A;  2MMN A;  3U5R E;  1XWB A;  1F3B A;  1EV9 A;  2E2G A;  1ZMA A;  3FK8 A;  4DVC A;  2K9F A;  1T00 A;  4EXJ A;  3H4K A;  3ZRD A;  4KA0 A;  1V2A A;  2X8H A;  4K7I A;  1G0T A;  1KBN A;  4HJ2 A;  2WVX B;  2K8V A;  3HVS A;  1UVZ A;  3TJB A;  1B4Q A;  2A2P A;  1XOA A;  1YY7 A;  2MZC A;  2DJ0 A;  4CY6 A;  4DSS A;  2QA2 A;  2WZ9 A;  2V41 A;  2UV8 G;  1OE8 A;  1BG5 A;  1M2B A;  1YKC A;  2MYG A;  2O3E A;  4OMV A;  3PPU A;  3QCP A;  3EIN A;  4Q5N A;  1AQX A;  3KP8 A;  4MJC A;  2PU9 C;  1SEN A;  2VAF A;  1USB A;  4MLY A;  2C80 A;  4GQF A;  4NMU A;  3WGD A;  2C3T A;  2H1D A;  5FHI A;  1OYJ A;  2PVQ A;  2B5Y A;  4W66 A;  5A4W A;  4BVY B;  2DC5 A;  4GCI A;  2DSA A;  2A4V A;  4WBJ A;  5G5E A;  5J3R A;  1K0C A;  1TRU A;  4EUY A;  1AAZ A;  1EOH A;  2IPA A;  2VM1 A;  1A23 A;  4F82 A;  3TOT A;  4ZXG A;  4XRA A;  4FXY P;  1B48 A;  2L6C A;  4KSO A;  4ISD A;  4MZC A;  1EOG A;  1JLW A;  1NSW A;  3IK9 A;  3UVT A;  4GST A;  3QAW A;  3F8U A;  3A5I A;  2AHE A;  1FVK A;  1OAZ A;  4MF7 A;  4EO3 A;  1ZZY A;  5ECI B;  2IN3 A;  4DSR A;  1FOV A;  3C71 A;  4Q5Q A;  2PER A;  1KEB A;  1RK4 A;  4NV5 A;  2GST A;  5B6N A;  4BWQ A;  3M0F A;  3ZFB A;  4LA1 A;  1J0F A;  4NHW A;  4MPF A;  5F0G A;  1MDK A;  2IL3 A;  4TXO A;  3GSS A;  4V1A g;  1K0B A;  2OAC A;  3D4T A;  6GSY A;  1CQG A;  1M9B A;  2YV9 A;  2NBS A;  17GS A;  4N10 A;  2O85 A;  2LNS A;  1X5C A;  2JZR A;  3VFI A;  5J4V A;  4ZL8 A;  3UMA A;  3MAK A;  4K0G A;  4K7O A;  3F4S A;  3ERW A;  4G10 A;  3FR9 A;  1M0U A;  2O87 A;  3ZLP A;  3GIX A;  2DKI A;  4X4J A;  3KTB A;  3L4N A;  2QGV A;  2QC7 A;  4OFN A;  2R2J A;  3IBH A;  4ZB8 A;  3UOM A;  4V1A p;  2H72 A;  1TI1 A;  3GH9 A;  5G31 A;  3HCZ A;  1V57 A;  5H5Q A;  3WT1 A;  5DAK A;  4K8M A;  4TR1 A;  3N5O A;  4AKH A;  1EGR A;  4EE0 A;  4ILF A;  1EP8 A;  2WW2 A;  3KM6 A;  4DEJ A;  5HFI A;  1A0F A;  2IJY A;  1GSY A;  2OKA A;  3TKS E;  2HRN A;  1YZX A;  4X1U A;  1K0N A;  5A1N B;  3EC3 A;  1ERW A;  3HJO A;  3FHK A;  3TKQ A;  1FB6 A;  4ECJ A;  3DKS A;  4Q5F A;  3FKF A;  5JWR B;  3UBK A;  4WXT A;  2AJQ B;  3SWL A;  4HI7 A;  4J57 E;  1ILO A;  3W8S A;  4L8E A;  2XHF A;  2GT6 A;  4AI6 A;  3S9F A;  2IFQ B;  18GS A;  3UIW A;  2QA1 A;  1PD2 1;  1AQV A;  4Z2T A;  5KOW A;  2LST A;  2C1Y A;  1KTE A;  3CRU A;  3P8W A;  3IC8 A;  2M72 A;  2HSH A;  2LKU A;  3Q19 A;  3LXT A;  2YNX A;  3IHQ A;  2YP6 A;  2DJ1 A;  4AJ7 A;  2M46 A;  3CTG A;  2GQK A;  4WET A;  3TRP A;  4E68 A;  5IOX A;  3IK7 A;  1GNW A;  2ZNM A;  1WMJ A;  3E9J B;  2HQT A;  4FIW A;  3H1N A;  3IR4 A;  4GXZ A;  2Z9S A;  3TOU A;  3D0Z A;  2RLI A;  2YJ7 A;  3LYK A;  2FWF A;  2JSZ A;  3CYN A;  3C8E A;  3HKR A;  1U87 A;  2DJJ A;  4QL7 A;  3EPT A;  1AC1 A;  4EKZ A;  1BG1 A;  4I6X A;  3VK9 A;  2OE1 A;  5IOW A;  1YF1 A;  4MAB A;  1GSD A;  1FW1 A;  1FHE A;  3WGX A;  3HD5 A;  1EWX A;  1DBY A;  3WGE A;  3UVH A;  3ERG A;  4N3Z A;  1FAA A;  3GMF A;  2I1U A;  4PI0 C;  4ZB6 A;  2A2S A;  4XS6 A;  1O6J A;  2DLX A;  2G0F A;  2IMD A;  2VD0 A;  1HNB A;  3KTL A;  4L0W A;  2CV4 A;  1R4W A;  1SD9 A;  5BMU A;  4G19 A;  3LWA A;  3MIX A;  5G5F A;  3R3E A;  3H8Q A;  5COH A;  3UAP A;  2HYX A;  4EF0 A;  3VPT A;  3WT2 A;  2C8U A;  1ML6 A;  3MWH A;  3DXB A;  2H0G A;  3C7M A;  1LBK A;  4KF9 A;  4MZW A;  3F6D A;  3VWW A;  1MD3 A;  2H1B A;  4IJ3 A;  1XIY A;  1N2A A;  5J9B A;  3VWU A;  4E8H A;  1XWG A;  3TU3 B;  4AJ8 A;  2YZH A;  4GF0 A;  2VL9 A;  4YKG A;  2YJH A;  1TW9 A;  4HU9 A;  5DCH A;  2PBJ A;  1OC3 A;  3HVN A;  2LRT A;  1RQM A;  4IJI A;  4N0V A;  1AQW A;  4QL9 A;  3KMO A;  3CSH A;  4DSS B;  2N5F A;  3IC4 A;  2CAQ A;  1K0M A;  2YWI A;  4ML1 A;  2HZE B;  5H5R A;  5GZZ B;  2NDO A;  5IO0 A;  1F2E A;  1A2J A;  6GSS A;  3KD0 A;  2OT3 A;  9GSS A;  2A2R A;  2B3S A;  2LJK A;  3HYP A;  1R26 A;  2GQM A;  1PRX A;  3LSZ A;  4IVF A;  4ZIL A;  3CTF A;  4POL A;  4KND A;  11GS A;  2LS5 A;  1XWK A;  1GRX A;  3DVW A;  3F63 A;  5ECH B;  3DVX A;  1TRV A;  1MEK A;  6GSW A;  1ERU A;  4GRF A;  3NZN A;  2HLS A;  4N30 A;  12GS A;  2HFD A;  3ZML A;  2C3Q A;  2GS3 A;  2G2Q A;  5JCG A;  3KP9 A;  4TR3 A;  4TN8 A;  1SYR A;  3GL3 A;  5H5S A;  1GL8 A;  5IMZ A;  1URM A;  2V32 A;  3UAR A;  5ECQ B;  1QQ2 A;  4IKH A;  1YEW C;  1GTI A;  1EV4 A;  1NW2 A;  5HR2 A;  3TKS C;  1R5A A;  4KSM A;  1M9A A;  3CBU A;  4PI2 C;  2DML A;  1ST9 A;  4Z7X A;  2D2Z A;  2GLR A;  1I1I P;  1OKT A;  4HZ4 A;  2J9H A;  4MK3 A;  2GT5 A;  4TXO B;  4USS A;  1HQO A;  1NHO A;  1PKZ A;  2VL3 A;  4JE1 A;  4GWR A;  2HE3 A;  1U88 A;  2ON7 A;  5A4U A;  3ZYW A;  3K8N A;  2XC2 A;  3FZ9 A;  3M3M A;  2KP1 A;  4FQU A;  3GUS A;  4MA9 A;  5D9W A;  3GKN A;  4K5S A;  4TR0 A;  2GTU A;  4P3Y B;  1OC8 A;  4G01 A;  2H30 A;  3D22 A;  1XW9 A;  2P5R A;  2WW1 A;  4TR1 B;  1SKS B;  1YDK A;  2OA7 A;  1K3L A;  3KJY A;  4YH2 A;  2PN8 A;  2B1L A;  2I4A A;  1SKW B;  10GS A;  4IQ1 A;  5JWO B;  3RHB A;  2I9H A;  2C0D A;  2H6Z A;  3R2Q A;  2FLS A;  2IMK A;  4MJA A;  1HYU A;  1T7P B;  2R4V A;  1VGL A;  5KEJ A;  1FO5 A;  3LEF A;  1ZYE A;  2ALB A;  2OBI A;  1G6W A;  1VF3 A;  1UC7 A;  2I81 A;  4PQ1 A;  1K0A A;  3BD2 A;  1PMT A;  2N5A A;  5ENU A;  4HQZ A;  4PTS A;  4BIK A;  2WW3 A;  1X5D A;  1E6B A;  2MMA A;  1SJ6 A;  3GYK A;  1FVJ A;  3ZZX A;  1ZOF A;  4KX4 A;  3N9J A;  2YWN A;  2E7P A;  3EU4 A;  1QXH A;  5KN1 A;  4CY8 A;  1XFL A;  2K8S A;  5KN2 A;  4HUA A;  2LJA A;  1XZO A;  3TB2 A;  2QKE A;  2LQO A;  1BQ7 A;  1XW5 A;  4JR4 A;  4OO5 A;  5A4V A;  3E3E A;  4F9Z A;  6GSX A;  3PR8 A;  1JZO A;  5GSS A;  3EMX A;  1Y25 A;  1ZGN A;  4O5R A;  2HSN B;  1DE2 A;  3EUR A;  3TJK A;  1TK0 B;  3RDW A;  2WB9 A;  5IIZ A;  2TIR A;  3A2V A;  4HSC X;  2WZS A;  2DBC A;  2YV7 A;  4PNF A;  2K6V A;  4XS4 A;  1THO A;  4NWY A;  3QOU A;  3EU3 A;  5J4Y A;  4EIP A;  2WCI A;  5CP1 A;  4OFT A;  1EEJ A;  1ON4 A;  5G1K A;  4YQV A;  5DAL B;  2LJR A;  5EL8 A;  2FUG 2;  1ZYP A;  2WW0 A;  1MD4 A;  2VUP A;  4PX1 A;  5E4W A;  5CRD A;  2XBI A;  1OE7 A;  3APO A;  1N25 A;  2OJL A;  2AUV A;  3HVX A;  3AY8 A;  2R0P A;  1WJK A;  1Z6N A;  4K5R A;  1T1V A;  4IHU A;  1OC9 A;  3VWX A;  1SJI A;  1TXX A;  5BMU B;  4K0N A;  1MTC A;  1ABA A;  3ZTL A;  4K7N A;  4NPB A;  3RHC A;  2VCQ A;  4KH7 A;  1F3A A;  2CQ9 A;  2FA8 A;  1M99 A;  2CZ3 A;  3IRA A;  3L9S A;  3BCI A;  2FWH A;  1U3A A;  4KDU A;  3DWV A;  3ZL5 A;  1X9M B;  3CMI A;  1GSS A;  3TKS A;  5J9C A;  3TGZ A;  1PFO A;  1TRS A;  1A0R P;  1SJZ A;  3LGC A;  4YAV A;  1Q4J A;  1PSQ A;  4ZBB A;  1AUC A;  1O8W A;  5IM9 A;  2FD3 A;  4WF5 A;  2NVL A;  3FY7 A;  4O32 A;  2CA8 A;  1SVO A;  3FZA A;  5IMF A;  2L5L A;  5B7C A;  4JRR A;  4TW5 A;  2H1A A;  4WEY A;  4QMK A;  1BAY A;  1GSQ A;  1Q98 A;  2FWE A;  1XG8 A;  3HZ8 A;  2R6K A;  3GX8 A;  2LQQ A;  3E0U A;  5JCW A;  2H70 A;  4POB A;  3I43 A;  4PUA A;  3J7Y k;  5KOX A;  4WBR D;  4OO4 A;  1A24 A;  4ICY A;  5IMD A;  3QDN A;  3MDK A;  2FWG A;  5B8A A;  3TJJ A;  1F9M A;  3HA9 A;  2L4C A;  5DJL A;  2WRT A;  2XBQ A;  4WKW A;  1W89 A;  3QAG A;  3CSI A;  3F6F A;  2GSQ A;  3A5W A;  2L4Q A;  2R0C A;  4N11 A;  4L0U A;  5JWQ B;  1JHB A;  4TVE A;  1EP7 A;  1LJR A;  2H1L A;  2B5E A;  4MDC A;  1GLP A;  4JR6 A;  2P31 A;  4BA7 A;  1GLQ A;  5CRW A;  1XBS A;  1SL1 B;  4GSS A;  2RM5 A;  4LL4 B;  2JZS A;  2HSM A;  1LU4 A;  3F9U A;  3CSJ A;  4KCA A;  5F06 A;  4AKI A;  2E2M A;  1EZK A;  4OCF A;  1SKR B;  1AIU A;  1B8X A;  4TOP A;  3F4T A;  3CXG A;  1A2M A;  1THX A;  1TRW A;  1BX9 A;  2OE3 A;  1WOU A;  2F8F A;  5HFG A;  1SL2 B;  3QPM A;  4LL1 B;  1SL0 B;  4KGI A;  5EPF A;  4ZBD A;  3TCO A;  3CWG A;  2IMI A;  2X8G A;  2YCD A;  4EIQ A;  1K3Y A;  1JFU A;  4K2D A;  2AB6 A;  2VCZ A;  4BL7 B;  5IQY A;  1QGV A;  4HEA 2;  1GTU A;  3TJG A;  4ZIJ A;  2NTO A;  1F37 A;  3KMN A;  3US3 A;  4TXV A;  1R7H A;  4WF4 A;  5J47 A;  3L78 A;  3D21 A;  4HJM A;  4TR4 A;  2CX3 A;  2HRF A;  5CAX A;  1WPI A;  3LYP A;  3L0H A;  1OKD A;  2CX4 A;  2HXK A;  3TRX A;  5LNK e;  3IPZ A;  1QUW A;  3RGB C;  5F8B A;  4POK A;  2C0E A;  3ZVJ D;  1JLV A;  5DBQ A;  1YJ6 A;  1QFN A;  4LMV A;  3QR6 A;  3TKP A;  2N5B A;  1A8Y A;  5AGY A;  1H75 A;  1NHY A;  3V1W A;  1YVL A;  4LLR A;  4CW9 A;  5F07 A;  4FYC A;  4KW6 A;  2R5G A;  4NAX A;  3G7I A;  2O8V B;  1GTB A;  4KDX A;  2FCH A;  3GST A;  8GSS A;  5J4U A;  3CQF A;  3UEM A;  3D4M A;  3P2A A;  4IN0 A;  2LV3 A;  3PGT A;  5ECN B;  2H75 A;  2RII A;  3VWV A;  5G30 A;  3A2X A;  3DGQ A;  5DCG A;  4I97 A;  2IWT A;  1K3O A;  3MYD A;  4FYU A;  4ZBA A;  4EL1 A;  2MMO A;  4ECC A;  4NXI A;  1T8E B;  4F2I A;  4PQH A;  1XXU A;  2VLV A;  3DIE A;  3BJ5 A;  2LNT A;  3FR6 A;  1FG4 A;  3IA1 A;  1PL1 A;  1ZYQ B;  2O89 A;  4XHM A;  5ECM B;  2R3X A;  5DJM A;  2H1G A;  5FWG A;  2KLX A;  4PGT A;  3MSZ A;  1ZL9 A;  1Z3E A;  1GNE A;  4F0C A;  5G2Z A;  4GTU A;  1T4Z A;  3P90 A;  4XS4 B;  1B4P A;  4MF5 A;  3TUE A;  2WS2 A;  4N0Z A;  13GS A;  5E59 A;  4ULX A;  4BWS A;  1O81 A;  2JSY A;  1JZW A;  2GQL A;  2JL4 A;  3ME7 A;  3EE2 A;  2H01 A;  14GS A;  1GP1 A;  3GV1 A;  2KOK A;  3GN3 A;  5D9X A;  5GST A;  1O8X A;  4DSQ A;  3GA4 A;  4ZL7 A;  4Z2R A;  2H76 A;  1MDJ A;  5A1N A;  2V1M A;  4X0X A;  4OCE A;  2IMF A;  2YN1 A;  2C3N A;  4YKF A;  2WGR A;  3ERF A;  1SD8 A;  3LQ7 A;  4ECB A;  4RUV A;  22GS A;  4FO5 A;  2CT6 A;  1VF1 A;  2EIR A;  3FMW A;  5ECR B;  4QQ7 A;  2IME A;  3GUR A;  2B7J A;  5G1L A;  1PA3 A;  2K18 A;  2X4A A;  2REM A;  4KCE A;  1GH2 A;  1J9B A;  4EVM A;  2EFE A;  1O85 A;  5A34 A;  1NM3 A;  5ECP B;  3G7J A;  1FB0 A;  2MBS A;  2OAD A;  7GSS A;  2OE0 A;  4AGS A;  2XPE A;  4HU7 A;  2JZT A;  1TOF A;  3LJR A;  3GFK A;  3IAM 2;  2FGX A;  3NOF A;  2WDU A;  3LW9 A;  3SBC A;  2F3M A;  4XCS A;  1SVL A;  2JU5 A;  5JCU A;  4GLT A;  5B8B A;  2HZF A;  1U6T A;  1SYX A;  2CVB A;  4OD7 A;  2GSR A;  3RPN A;  4PUR A;  1TK5 B;  2XPD A;  3IXR A;  3DYR A;  5ECO B;  5DAK B;  1Z7R A;  1EEM A;  2PVO C;  3APQ A;  3F4R A;  4ACS A;  2A4H A;  4G0L A;  1YKA A;  2FY6 A;  1V40 A;  6GSU A;  20GS A;  1YEP A;  1V98 A;  3FRC A;  1WIK A;  1X0R A;  1O73 A;  3I9V 2;  1ZCP A;  5ID2 A;  4GDF A;  4F03 A;  2JAC A;  5J40 A;  5AIX A;  4PXO A;  2WVZ A;  1YF0 A;  2X8C A;  2YPM A;  5D9T A;  4IEL A;  4YQM A;  1I9D A;  3C73 A;  2DJ2 A;  2H0H A;  5KN3 A;  4RQX A;  4L5O A;  4PUF C;  2NPB A;  1GWC A;  2B1K A;  3LFL A;  1H4O A;  4O5U A;  4V2N A;  4FH8 A;  5CYY A;  1HD2 A;  2DJK A;  1TJD A;  2HSM B;  2X99 A;  1J08 A;  2O5V A;  4IP6 A;  1DSB A;  1QMV A;  4K9Z A;  2IIY A;  3ME8 A;  3KGK A;  3M9J A;  4I5Q A;  5A5H A;  3FR3 A;  2C0F A;  3TKR A;  5CNW A;  2WFC A;  5DVB A;  3GRX A;  1WP0 A;  2L6D A;  3BOA A;  2AYT A;  4MJE A;  2VO4 A;  3FEU A;  2RM6 A;  2X49 A;  3APS A;  1SU9 A;  3C1S A;  2EIO A;  1S3A A;  2LEG A;  3DEX A;  3KH7 A;  2P0G A;  1M7T A;  4K6X A;  3KEB A;  2YWO A;  2PGT A;  4Q5R A;  1PGT A;  2HZE A;  2ON5 A;  3HJP A;  1A8L A;  3H79 A;  3PH9 A;  3GHA A;  1HNC A;  3A3T A;  3ZIV A;  5HR1 A;  2VL2 C;  3D5J A;  4MH3 A;  1G7E A;  2KP2 A;  4I8B A;  4EDY A;  1X5E A;  5LCZ A;  4MJB A;  2LUS A;  3QD9 A;  3M8N A;  3L9V A;  2PMT A;  2FNO A;  2HT9 A;  5GAN D;  2FHE A;  2YWM A;  3HMJ G;  2B5X A;  3DML A;  1DUG A;  2VKZ G;  3G9B A;  1TKD B;  3RBT A;  1GSE A;  4RI6 A;  3ZFL A;  1VF4 A;  1SVM A;  1JZD A;  2RUE A;  6GSV A;  4IGJ A;  4WR5 A;  2E0Q A;  3P7X A;  4FYB A;  1FOH A;  3EWL A;  1Z9H A;  2YAN A;  2L59 A;  2V6O A;  4K2X A;  1K0O A;  4PNG A;  1GSU A;  2VCX A;  3GKM A;  1UA5 A;  2VIM A;  4IW9 A;  2DIY A;  3ZIJ A;  4F0B A;  2J23 A;  3PIN A;  2FA4 A;  2BTO T;  2H0I A;  4BVX A;  4J2F A;  4ZB7 A;  1SK2 A;  2RUF A;  4IQA A;  2VLU A;  2AV4 A;  1WE0 A;  1TU8 A;  2R0G A;  1CQH A;  3GKK A;  3M9K A;  2EFD A;  3LG6 A;  3W6G A;  5ECK B;  1PKW A;  1S3C A;  4AJ6 A;  1Z6M A;  2F51 A;  3EYT A;  4IS0 A;  5J5N A;  3O3T A;  1M2D A;  4IP1 A;  4JBB A;  3O76 A;  1TU7 A;  2EIQ A;  3GTU A;  1TK8 B;  1BJX A;  1WRY A;  1ERT A;  1Y1U A;  5B6M A;  2P5Q A;  3HVV A;  1VRS D;  4D73 A;  4BPY A;  2TRC P;  2VCV A;  4RI7 A;  5IPG A;  4AF2 A;  3O6T A;  3IAS 2;  5DDL A;  2WUL A;  3F3R A;  2F8A A;  3HDC A;  3IV4 A;  2EC4 A;  2L5O A;  3C1R A;  1UN2 A;  2I3Y A;  4A5P A;  1MDI A;  2GSS A;  4XRD A;  3VUR A;  3QFB C;  2HRK A;  4YQU A;  4HZ2 A;  3IHG A;  1HNA A;  2VD1 A;  1GSF A;  4MCU A;  3VLN A;  1Z5Y E;  3H93 A;  1VF2 A;  1AW9 A;  3L9U A;  4MNN A;  1C72 A;  1S4B P;  2BMX A;  4O92 A;  1YEX A;  3GL5 A;  5A5K A;  1XW6 A;  2H8L A;  5FT3 A;  2F9S A;  1IYH A;  2PWJ A;  2CVD A;  5CRG A;  3VPQ A;  5D8I A;  3IDV A;  5INY A;  3VI7 A;  4KAE A;  2GZY A;  1GUK A;  3KXO A;  4O5Q A;  3OR5 A;  1YQ1 A;  1TTZ A;  5D96 A;  4HDE A;  3M1G A;  2L57 A;  3I6A A;  2H73 A;  4Z2U A;  3UL3 A;  1E2Y A;  2BJX A;  2M80 A;  2WVX A;  4V2L A;  5IPH A;  5D73 A;  16GS A;  3G7Y A;  4ZL9 A;  2GDR A;  2HI7 A;  3ZMK A;  1BF5 A;  2UZ8 A;  3WD6 A;  5HR3 A;  3TRQ A;  4IBP A;  1QK8 A;  3FZ4 A;  5A34 B;  1XVQ A;  4MMM A;  4JU5 A;  4I2T A;  1T4Y A;  3I69 A;  1O7U A;  3KZQ A;  3Q74 A;  3TDG A;  5F05 A;  4WR4 A;  1TXU A;  3ZIT A;  2HSN A;  2CVK A;  1PN0 A;  1XOB A;  1M3J A;  2AAW A;  5ECS A;  2WJU A;  2PUK C;  5DQY A;  4PHZ C;  5AIV A;  2HRA A;  3BBY A;  4MP4 A;  1W4V A;  3KCM A;  2O7K A;  3QMX A;  5IO2 A;  4L5L A;  4ML6 A;  1S3D A;  2ZCT A;  1BYE A;  2VL2 A;  2LRC A;  3WYW A;  4MF6 A;  4BVY A;  5DAL A;  3ZRE A;  5AIS A;  4GQC A;  3LXZ A;  2PPT A;  2C4J A;  3QFA C;  3HJM A;  2VM2 A;  4MH2 A;  1U3I A;  4LMW A;  3EMP A;  4KB3 A;  2C0G A;  1XPV A;  5ID2 B;  3Q18 A;  5EVO A;  2KUC A;  1KNG A;  3GKX A;  3J7Y b;  2HNL A;  1F6M C; 
#chains in the Genus database with same CATH homology
 2VOC A;  4K1F A;  3FW2 A;  1ZYN A;  2CZ2 A;  1T3B A;  2YZU A;  4O7H A;  5KN0 A;  1X9S B;  3ZVJ A;  4G9H A;  2ES7 A;  2H6X A;  3KH9 A;  2B6M A;  4KDY A;  3Q6O A;  4KUN A;  1GTA A;  2DJ3 A;  2TRX A;  4GSN A;  5ECL B;  4NHZ A;  1GUM A;  5A5H B;  3UBL A;  1JZR A;  4X43 A;  1V9W A;  1GUH A;  4ID0 A;  3EVI A;  3FYG A;  3F3Q A;  4E8E A;  5BRT A;  4I2U A;  4OFM A;  1G7O A;  3JCM L;  3CRT A;  4PQI A;  2OBK A;  3GH6 A;  5ELG A;  5HQP A;  1PQN A;  2GVP A;  5HR0 A;  1DE1 A;  5C04 A;  2GZP A;  4G2E A;  4HS1 A;  5EY6 A;  4YAP A;  2KHP A;  5HFK A;  2LRN A;  2HSY A;  2ZUP A;  3DD3 A;  4HQS A;  4AKG A;  1Z7P A;  5ELA A;  4CHS A;  3F0I A;  1TP9 A;  2H66 A;  1K0D A;  3RPP A;  4JZQ A;  2CAI A;  4OWY A;  4J56 E;  2V6K A;  2DKH A;  5D93 A;  5DQS A;  1X9W B;  3ISO A;  19GS A;  1OC9 B;  1TDI A;  2H19 A;  3U6V A;  1PX7 A;  2DMM A;  1IYI A;  5J41 A;  1XWA A;  2B7K A;  5AN1 A;  5GAP D;  2MMZ A;  3FZ5 A;  2H6Y A;  1PL2 A;  2IFQ A;  5C00 A;  4V2M A;  2R37 A;  4XIH A;  1WWJ A;  3IOS A;  2LTK A;  4G0K A;  4AKX B;  2H71 A;  4ECI A;  1BED A;  3HY2 A;  1XWC A;  2VCW A;  4H86 A;  1B9Y C;  4JED A;  5CRH A;  3TJF A;  2EFC A;  2EFH A;  4BVX B;  1R5P A;  4NV2 A;  3IE3 A;  3LOR A;  2DIZ A;  1SK0 A;  3HZ4 A;  4MPG A;  1PX6 A;  3HHV A;  5IMA A;  4KE3 A;  3QAV A;  1ACV A;  4XTS A;  1SK1 A;  3MNG A;  5IMV A;  3UJ1 A;  3HXS A;  3GTU B;  2JAD A;  3ED3 A;  3RAZ A;  4BL7 A;  1XCC A;  3GX0 A;  3W8J A;  2H74 A;  4MZB A;  3VI5 A;  4TKY A;  2GGT A;  3KIJ A;  1G6Y A;  4D73 B;  3BCK A;  1GUL A;  4POM A;  1RW1 A;  1A2L A;  1EGO A;  4TRX A;  2MBT A;  1M2A A;  2QSI A;  1XVW A;  5IMC A;  3D6I A;  1Y6E A;  5L71 A;  1TI3 A;  2HRK B;  2VLT A;  1PN9 A;  4RQR A;  2V2G A;  1ERV A;  3A2W A;  3DRN A;  4EDZ A;  1B9X C;  5CRE A;  1N8J A;  1V58 A;  1I5G A;  1OVN A;  2GZZ A;  4XS1 A;  3GNJ A;  5D9V A;  4ZB9 A;  4G0I A;  2VCT A;  2X64 A;  6GST A;  4HOJ A;  4CDO A;  1AXD A;  3NIV A;  5CO3 A;  5LD0 A;  4EC0 A;  2YOI A;  5ABR A;  2MMN A;  3U5R E;  1XWB A;  1F3B A;  1EV9 A;  2E2G A;  1ZMA A;  3FK8 A;  4DVC A;  2K9F A;  1T00 A;  4EXJ A;  3H4K A;  3ZRD A;  4KA0 A;  1V2A A;  2X8H A;  4K7I A;  1G0T A;  1KBN A;  4HJ2 A;  2K8V A;  3HVS A;  1UVZ A;  3TJB A;  1B4Q A;  2A2P A;  1XOA A;  1YY7 A;  2MZC A;  2DJ0 A;  4CY6 A;  4DSS A;  2QA2 A;  2WZ9 A;  2V41 A;  2UV8 G;  1OE8 A;  1BG5 A;  1M2B A;  1YKC A;  2MYG A;  4OMV A;  3PPU A;  3QCP A;  3EIN A;  4Q5N A;  1AQX A;  3KP8 A;  4MJC A;  2PU9 C;  1SEN A;  2VAF A;  1USB A;  4MLY A;  2C80 A;  4GQF A;  4NMU A;  3WGD A;  2C3T A;  2H1D A;  5FHI A;  1OYJ A;  2PVQ A;  2B5Y A;  4W66 A;  5A4W A;  4BVY B;  2DC5 A;  4GCI A;  2DSA A;  2A4V A;  4WBJ A;  5G5E A;  5J3R A;  1K0C A;  1TRU A;  4EUY A;  1AAZ A;  1EOH A;  2IPA A;  2VM1 A;  1A23 A;  4F82 A;  3TOT A;  4ZXG A;  4XRA A;  1B48 A;  2L6C A;  4KSO A;  4ISD A;  4MZC A;  1EOG A;  1JLW A;  1NSW A;  3IK9 A;  3UVT A;  4GST A;  3QAW A;  3F8U A;  3A5I A;  2AHE A;  1FVK A;  1OAZ A;  4MF7 A;  4EO3 A;  1ZZY A;  5ECI B;  2IN3 A;  4DSR A;  1FOV A;  3C71 A;  4Q5Q A;  2PER A;  1KEB A;  1RK4 A;  4NV5 A;  2GST A;  5B6N A;  4BWQ A;  3M0F A;  3ZFB A;  4LA1 A;  1J0F A;  4NHW A;  4MPF A;  5F0G A;  1MDK A;  2IL3 A;  4TXO A;  3GSS A;  4V1A g;  1K0B A;  2OAC A;  3D4T A;  6GSY A;  1CQG A;  1M9B A;  2YV9 A;  2NBS A;  17GS A;  4N10 A;  2O85 A;  2LNS A;  1X5C A;  2JZR A;  3VFI A;  5J4V A;  4ZL8 A;  3UMA A;  3MAK A;  4K0G A;  4K7O A;  3F4S A;  3ERW A;  4G10 A;  3FR9 A;  1M0U A;  2O87 A;  3ZLP A;  3GIX A;  2DKI A;  4X4J A;  3KTB A;  3L4N A;  2QGV A;  2QC7 A;  4OFN A;  2R2J A;  3IBH A;  4ZB8 A;  3UOM A;  4V1A p;  2H72 A;  1TI1 A;  3GH9 A;  5G31 A;  3HCZ A;  1V57 A;  5H5Q A;  3WT1 A;  5DAK A;  4K8M A;  4TR1 A;  3N5O A;  4AKH A;  1EGR A;  4EE0 A;  4ILF A;  1EP8 A;  3KM6 A;  4DEJ A;  5HFI A;  1A0F A;  2IJY A;  1GSY A;  2OKA A;  3TKS E;  2HRN A;  1YZX A;  4X1U A;  1K0N A;  5A1N B;  3EC3 A;  1ERW A;  3HJO A;  3FHK A;  3TKQ A;  1FB6 A;  4ECJ A;  3DKS A;  4Q5F A;  3FKF A;  5JWR B;  3UBK A;  4WXT A;  2AJQ B;  3SWL A;  4HI7 A;  4J57 E;  1ILO A;  3W8S A;  4L8E A;  2XHF A;  2GT6 A;  4AI6 A;  3S9F A;  2IFQ B;  18GS A;  3UIW A;  2QA1 A;  1PD2 1;  1AQV A;  4Z2T A;  5KOW A;  2LST A;  2C1Y A;  1KTE A;  3CRU A;  3P8W A;  3IC8 A;  2M72 A;  2HSH A;  2LKU A;  3Q19 A;  3LXT A;  2YNX A;  3IHQ A;  2YP6 A;  2DJ1 A;  4AJ7 A;  2M46 A;  3CTG A;  2GQK A;  4WET A;  3TRP A;  4E68 A;  5IOX A;  3IK7 A;  1GNW A;  2ZNM A;  1WMJ A;  3E9J B;  2HQT A;  4FIW A;  3H1N A;  3IR4 A;  4GXZ A;  2Z9S A;  3TOU A;  3D0Z A;  2RLI A;  2YJ7 A;  3LYK A;  2FWF A;  2JSZ A;  3CYN A;  3C8E A;  3HKR A;  1U87 A;  2DJJ A;  4QL7 A;  3EPT A;  1AC1 A;  4EKZ A;  1BG1 A;  4I6X A;  3VK9 A;  2OE1 A;  5IOW A;  1YF1 A;  4MAB A;  1GSD A;  1FW1 A;  1FHE A;  3WGX A;  3HD5 A;  1EWX A;  1DBY A;  3WGE A;  3UVH A;  3ERG A;  4N3Z A;  1FAA A;  3GMF A;  2I1U A;  4ZB6 A;  2A2S A;  4XS6 A;  1O6J A;  2DLX A;  2G0F A;  2IMD A;  2VD0 A;  1HNB A;  3KTL A;  4L0W A;  2CV4 A;  1R4W A;  1SD9 A;  5BMU A;  4G19 A;  3LWA A;  3MIX A;  5G5F A;  3R3E A;  3H8Q A;  5COH A;  3UAP A;  2HYX A;  4EF0 A;  3VPT A;  3WT2 A;  2C8U A;  1ML6 A;  3MWH A;  3DXB A;  2H0G A;  3C7M A;  1LBK A;  4KF9 A;  4MZW A;  3F6D A;  3VWW A;  1MD3 A;  2H1B A;  4IJ3 A;  1XIY A;  1N2A A;  5J9B A;  3VWU A;  4E8H A;  1XWG A;  3TU3 B;  4AJ8 A;  2YZH A;  4GF0 A;  2VL9 A;  4YKG A;  2YJH A;  1TW9 A;  4HU9 A;  5DCH A;  2PBJ A;  1OC3 A;  2LRT A;  1RQM A;  4IJI A;  4N0V A;  1AQW A;  4QL9 A;  3KMO A;  3CSH A;  4DSS B;  2N5F A;  3IC4 A;  2CAQ A;  1K0M A;  2YWI A;  4ML1 A;  2HZE B;  5H5R A;  5GZZ B;  2NDO A;  5IO0 A;  1F2E A;  1A2J A;  6GSS A;  3KD0 A;  2OT3 A;  9GSS A;  2A2R A;  2B3S A;  2LJK A;  3HYP A;  1R26 A;  2GQM A;  1PRX A;  3LSZ A;  4IVF A;  4ZIL A;  3CTF A;  4POL A;  4KND A;  11GS A;  2LS5 A;  1XWK A;  1GRX A;  3DVW A;  3F63 A;  5ECH B;  3DVX A;  1TRV A;  1MEK A;  6GSW A;  1ERU A;  4GRF A;  3NZN A;  2HLS A;  4N30 A;  12GS A;  2HFD A;  3ZML A;  2C3Q A;  2GS3 A;  2G2Q A;  5JCG A;  3KP9 A;  4TR3 A;  4TN8 A;  1SYR A;  3GL3 A;  5H5S A;  1GL8 A;  5IMZ A;  1URM A;  2V32 A;  3UAR A;  5ECQ B;  1QQ2 A;  4IKH A;  1GTI A;  1EV4 A;  1NW2 A;  5HR2 A;  3TKS C;  1R5A A;  4KSM A;  1M9A A;  3CBU A;  2DML A;  1ST9 A;  4Z7X A;  2D2Z A;  2GLR A;  1OKT A;  4HZ4 A;  2J9H A;  4MK3 A;  2GT5 A;  4TXO B;  4USS A;  1HQO A;  1NHO A;  1PKZ A;  2VL3 A;  4JE1 A;  4GWR A;  2HE3 A;  1U88 A;  2ON7 A;  5A4U A;  3ZYW A;  3K8N A;  2XC2 A;  3FZ9 A;  3M3M A;  2KP1 A;  4FQU A;  3GUS A;  4MA9 A;  5D9W A;  3GKN A;  4K5S A;  4TR0 A;  2GTU A;  4P3Y B;  1OC8 A;  4G01 A;  2H30 A;  3D22 A;  1XW9 A;  2P5R A;  4TR1 B;  1SKS B;  1YDK A;  2OA7 A;  1K3L A;  3KJY A;  4YH2 A;  2PN8 A;  2B1L A;  2I4A A;  1SKW B;  10GS A;  4IQ1 A;  5JWO B;  3RHB A;  2I9H A;  2C0D A;  2H6Z A;  3R2Q A;  2FLS A;  2IMK A;  4MJA A;  1HYU A;  1T7P B;  2R4V A;  1VGL A;  5KEJ A;  1FO5 A;  3LEF A;  1ZYE A;  2ALB A;  2OBI A;  1G6W A;  1VF3 A;  1UC7 A;  2I81 A;  4PQ1 A;  1K0A A;  3BD2 A;  1PMT A;  2N5A A;  5ENU A;  4HQZ A;  4PTS A;  1X5D A;  1E6B A;  2MMA A;  1SJ6 A;  3GYK A;  1FVJ A;  3ZZX A;  1ZOF A;  4KX4 A;  3N9J A;  2YWN A;  2E7P A;  3EU4 A;  1QXH A;  5KN1 A;  4CY8 A;  1XFL A;  2K8S A;  5KN2 A;  4HUA A;  2LJA A;  1XZO A;  3TB2 A;  2QKE A;  2LQO A;  1BQ7 A;  1XW5 A;  4JR4 A;  4OO5 A;  5A4V A;  3E3E A;  4F9Z A;  6GSX A;  3PR8 A;  1JZO A;  5GSS A;  3EMX A;  1Y25 A;  1ZGN A;  4O5R A;  2HSN B;  1DE2 A;  3EUR A;  3TJK A;  1TK0 B;  3RDW A;  2WB9 A;  5IIZ A;  2TIR A;  3A2V A;  2DBC A;  2YV7 A;  4PNF A;  2K6V A;  4XS4 A;  1THO A;  4NWY A;  3QOU A;  3EU3 A;  5J4Y A;  4EIP A;  2WCI A;  5CP1 A;  4OFT A;  1EEJ A;  1ON4 A;  5G1K A;  4YQV A;  5DAL B;  2LJR A;  5EL8 A;  2FUG 2;  1ZYP A;  1MD4 A;  2VUP A;  4PX1 A;  5E4W A;  5CRD A;  2XBI A;  1OE7 A;  3APO A;  1N25 A;  2OJL A;  2AUV A;  3HVX A;  3AY8 A;  2R0P A;  1WJK A;  1Z6N A;  4K5R A;  1T1V A;  4IHU A;  1OC9 A;  3VWX A;  1SJI A;  1TXX A;  5BMU B;  4K0N A;  1MTC A;  1ABA A;  3ZTL A;  4K7N A;  4NPB A;  3RHC A;  2VCQ A;  4KH7 A;  1F3A A;  2CQ9 A;  2FA8 A;  1M99 A;  2CZ3 A;  3IRA A;  3L9S A;  3BCI A;  2FWH A;  1U3A A;  4KDU A;  3DWV A;  3ZL5 A;  1X9M B;  3CMI A;  1GSS A;  3TKS A;  5J9C A;  3TGZ A;  1TRS A;  1A0R P;  1SJZ A;  3LGC A;  4YAV A;  1Q4J A;  1PSQ A;  4ZBB A;  1AUC A;  1O8W A;  5IM9 A;  2FD3 A;  4WF5 A;  2NVL A;  3FY7 A;  4O32 A;  2CA8 A;  1SVO A;  3FZA A;  5IMF A;  2L5L A;  5B7C A;  4JRR A;  4TW5 A;  2H1A A;  4WEY A;  4QMK A;  1BAY A;  1GSQ A;  1Q98 A;  2FWE A;  3HZ8 A;  2R6K A;  3GX8 A;  2LQQ A;  3E0U A;  5JCW A;  2H70 A;  4POB A;  3I43 A;  4PUA A;  3J7Y k;  5KOX A;  4WBR D;  4OO4 A;  1A24 A;  4ICY A;  5IMD A;  3QDN A;  3MDK A;  2FWG A;  5B8A A;  3TJJ A;  1F9M A;  3HA9 A;  2L4C A;  5DJL A;  2WRT A;  2XBQ A;  4WKW A;  1W89 A;  3QAG A;  3CSI A;  3F6F A;  2GSQ A;  3A5W A;  2L4Q A;  2R0C A;  4N11 A;  4L0U A;  5JWQ B;  1JHB A;  4TVE A;  1EP7 A;  1LJR A;  2H1L A;  2B5E A;  4MDC A;  1GLP A;  4JR6 A;  2P31 A;  4BA7 A;  1GLQ A;  5CRW A;  1XBS A;  1SL1 B;  4GSS A;  2RM5 A;  4LL4 B;  2JZS A;  2HSM A;  1LU4 A;  3F9U A;  3CSJ A;  4KCA A;  5F06 A;  4AKI A;  2E2M A;  1EZK A;  4OCF A;  1SKR B;  1AIU A;  1B8X A;  4TOP A;  3F4T A;  3CXG A;  1A2M A;  1THX A;  1TRW A;  1BX9 A;  2OE3 A;  1WOU A;  2F8F A;  5HFG A;  1SL2 B;  3QPM A;  4LL1 B;  1SL0 B;  4KGI A;  5EPF A;  4ZBD A;  3TCO A;  3CWG A;  2IMI A;  2X8G A;  2YCD A;  4EIQ A;  1K3Y A;  1JFU A;  4K2D A;  2AB6 A;  2VCZ A;  4BL7 B;  5IQY A;  1QGV A;  4HEA 2;  1GTU A;  3TJG A;  4ZIJ A;  2NTO A;  1F37 A;  3KMN A;  3US3 A;  4TXV A;  1R7H A;  4WF4 A;  5J47 A;  3L78 A;  3D21 A;  4HJM A;  4TR4 A;  2CX3 A;  2HRF A;  5CAX A;  1WPI A;  3LYP A;  3L0H A;  1OKD A;  2CX4 A;  2HXK A;  3TRX A;  5LNK e;  3IPZ A;  1QUW A;  5F8B A;  4POK A;  2C0E A;  3ZVJ D;  1JLV A;  5DBQ A;  1YJ6 A;  1QFN A;  4LMV A;  3QR6 A;  3TKP A;  2N5B A;  1A8Y A;  5AGY A;  1H75 A;  1NHY A;  3V1W A;  1YVL A;  4LLR A;  4CW9 A;  5F07 A;  4FYC A;  4KW6 A;  2R5G A;  4NAX A;  3G7I A;  2O8V B;  1GTB A;  4KDX A;  2FCH A;  3GST A;  8GSS A;  5J4U A;  3UEM A;  3D4M A;  3P2A A;  4IN0 A;  2LV3 A;  3PGT A;  5ECN B;  2H75 A;  2RII A;  3VWV A;  5G30 A;  3A2X A;  3DGQ A;  5DCG A;  4I97 A;  2IWT A;  1K3O A;  3MYD A;  4FYU A;  4ZBA A;  4EL1 A;  2MMO A;  4ECC A;  4NXI A;  1T8E B;  4F2I A;  4PQH A;  1XXU A;  2VLV A;  3DIE A;  3BJ5 A;  2LNT A;  3FR6 A;  1FG4 A;  3IA1 A;  1PL1 A;  1ZYQ B;  2O89 A;  4XHM A;  5ECM B;  2R3X A;  5DJM A;  2H1G A;  5FWG A;  2KLX A;  4PGT A;  3MSZ A;  1ZL9 A;  1Z3E A;  1GNE A;  4F0C A;  5G2Z A;  4GTU A;  1T4Z A;  3P90 A;  4XS4 B;  1B4P A;  4MF5 A;  3TUE A;  2WS2 A;  4N0Z A;  13GS A;  5E59 A;  4ULX A;  4BWS A;  1O81 A;  2JSY A;  1JZW A;  2GQL A;  2JL4 A;  3ME7 A;  3EE2 A;  2H01 A;  14GS A;  1GP1 A;  3GV1 A;  2KOK A;  3GN3 A;  5D9X A;  5GST A;  1O8X A;  4DSQ A;  3GA4 A;  4ZL7 A;  4Z2R A;  2H76 A;  1MDJ A;  5A1N A;  2V1M A;  4X0X A;  4OCE A;  2IMF A;  2YN1 A;  2C3N A;  4YKF A;  2WGR A;  3ERF A;  1SD8 A;  3LQ7 A;  4ECB A;  4RUV A;  22GS A;  4FO5 A;  2CT6 A;  1VF1 A;  2EIR A;  3FMW A;  5ECR B;  4QQ7 A;  2IME A;  3GUR A;  2B7J A;  5G1L A;  1PA3 A;  2K18 A;  2X4A A;  2REM A;  4KCE A;  1GH2 A;  1J9B A;  4EVM A;  2EFE A;  1O85 A;  5A34 A;  1NM3 A;  5ECP B;  3G7J A;  1FB0 A;  2MBS A;  2OAD A;  7GSS A;  2OE0 A;  4AGS A;  2XPE A;  4HU7 A;  2JZT A;  1TOF A;  3LJR A;  3GFK A;  3IAM 2;  2FGX A;  3NOF A;  2WDU A;  3LW9 A;  3SBC A;  2F3M A;  4XCS A;  1SVL A;  2JU5 A;  5JCU A;  4GLT A;  5B8B A;  2HZF A;  1U6T A;  1SYX A;  2CVB A;  4OD7 A;  2GSR A;  3RPN A;  4PUR A;  1TK5 B;  2XPD A;  3IXR A;  3DYR A;  5ECO B;  5DAK B;  1Z7R A;  1EEM A;  2PVO C;  3APQ A;  3F4R A;  4ACS A;  2A4H A;  4G0L A;  1YKA A;  2FY6 A;  1V40 A;  6GSU A;  20GS A;  1YEP A;  1V98 A;  3FRC A;  1WIK A;  1X0R A;  1O73 A;  3I9V 2;  1ZCP A;  5ID2 A;  4GDF A;  4F03 A;  2JAC A;  5J40 A;  5AIX A;  4PXO A;  2X8C A;  1YF0 A;  2YPM A;  5D9T A;  4IEL A;  4YQM A;  1I9D A;  3C73 A;  2DJ2 A;  2H0H A;  5KN3 A;  4RQX A;  4L5O A;  4PUF C;  2NPB A;  1GWC A;  2B1K A;  3LFL A;  1H4O A;  4O5U A;  4V2N A;  4FH8 A;  5CYY A;  1HD2 A;  2DJK A;  1TJD A;  2HSM B;  2X99 A;  1J08 A;  2O5V A;  4IP6 A;  1DSB A;  1QMV A;  4K9Z A;  2IIY A;  3ME8 A;  3KGK A;  3M9J A;  4I5Q A;  5A5H A;  3FR3 A;  2C0F A;  3TKR A;  5CNW A;  2WFC A;  5DVB A;  3GRX A;  1WP0 A;  2L6D A;  3BOA A;  2AYT A;  4MJE A;  2VO4 A;  3FEU A;  2RM6 A;  2X49 A;  3APS A;  1SU9 A;  3C1S A;  2EIO A;  3KH7 A;  1S3A A;  2LEG A;  3DEX A;  2P0G A;  1M7T A;  4K6X A;  3KEB A;  2YWO A;  2PGT A;  4Q5R A;  1PGT A;  2HZE A;  2ON5 A;  3HJP A;  1A8L A;  3H79 A;  3PH9 A;  3GHA A;  1HNC A;  3A3T A;  3ZIV A;  5HR1 A;  2VL2 C;  3D5J A;  4MH3 A;  1G7E A;  2KP2 A;  4I8B A;  4EDY A;  1X5E A;  5LCZ A;  4MJB A;  2LUS A;  3QD9 A;  3M8N A;  3L9V A;  2PMT A;  2FNO A;  2HT9 A;  5GAN D;  2FHE A;  2YWM A;  3HMJ G;  2B5X A;  3DML A;  1DUG A;  2VKZ G;  3G9B A;  1TKD B;  3RBT A;  1GSE A;  4RI6 A;  3ZFL A;  1VF4 A;  1SVM A;  1JZD A;  2RUE A;  6GSV A;  4IGJ A;  4WR5 A;  2E0Q A;  3P7X A;  4FYB A;  1FOH A;  3EWL A;  1Z9H A;  2YAN A;  2L59 A;  2V6O A;  4K2X A;  1K0O A;  4PNG A;  1GSU A;  2VCX A;  3GKM A;  1UA5 A;  2VIM A;  4IW9 A;  2DIY A;  3ZIJ A;  4F0B A;  2J23 A;  3PIN A;  2FA4 A;  2BTO T;  2H0I A;  4BVX A;  4J2F A;  4ZB7 A;  1SK2 A;  2RUF A;  4IQA A;  2VLU A;  2AV4 A;  1WE0 A;  1TU8 A;  2R0G A;  1CQH A;  3GKK A;  3M9K A;  2EFD A;  3LG6 A;  3W6G A;  5ECK B;  1PKW A;  1S3C A;  4AJ6 A;  1Z6M A;  2F51 A;  3EYT A;  4IS0 A;  5J5N A;  3O3T A;  1M2D A;  4IP1 A;  4JBB A;  3O76 A;  1TU7 A;  2EIQ A;  3GTU A;  1TK8 B;  1BJX A;  1WRY A;  1ERT A;  1Y1U A;  5B6M A;  2P5Q A;  3HVV A;  1VRS D;  4D73 A;  4BPY A;  2TRC P;  2VCV A;  4RI7 A;  5IPG A;  4AF2 A;  3O6T A;  3IAS 2;  5DDL A;  2WUL A;  3F3R A;  2F8A A;  3HDC A;  3IV4 A;  2EC4 A;  2L5O A;  3C1R A;  1UN2 A;  2I3Y A;  4A5P A;  1MDI A;  2GSS A;  4XRD A;  3VUR A;  3QFB C;  2HRK A;  4YQU A;  4HZ2 A;  3IHG A;  1HNA A;  2VD1 A;  1GSF A;  4MCU A;  3VLN A;  1Z5Y E;  3H93 A;  1VF2 A;  1AW9 A;  3L9U A;  4MNN A;  1C72 A;  2BMX A;  4O92 A;  1YEX A;  3GL5 A;  5A5K A;  1XW6 A;  2H8L A;  5FT3 A;  2F9S A;  1IYH A;  2PWJ A;  2CVD A;  5CRG A;  3VPQ A;  5D8I A;  3IDV A;  5INY A;  3VI7 A;  4KAE A;  2GZY A;  1GUK A;  3KXO A;  4O5Q A;  3OR5 A;  1YQ1 A;  1TTZ A;  5D96 A;  4HDE A;  3M1G A;  2L57 A;  3I6A A;  2H73 A;  4Z2U A;  3UL3 A;  1E2Y A;  2BJX A;  2M80 A;  4V2L A;  5IPH A;  5D73 A;  16GS A;  3G7Y A;  4ZL9 A;  2GDR A;  2HI7 A;  3ZMK A;  1BF5 A;  2UZ8 A;  3WD6 A;  5HR3 A;  3TRQ A;  4IBP A;  1QK8 A;  3FZ4 A;  5A34 B;  1XVQ A;  4MMM A;  4JU5 A;  4I2T A;  1T4Y A;  3I69 A;  1O7U A;  3KZQ A;  3Q74 A;  3TDG A;  5F05 A;  4WR4 A;  1TXU A;  3ZIT A;  2HSN A;  2CVK A;  1PN0 A;  1XOB A;  2AAW A;  5ECS A;  2WJU A;  2PUK C;  5DQY A;  5AIV A;  2HRA A;  3BBY A;  4MP4 A;  1W4V A;  3KCM A;  2O7K A;  3QMX A;  5IO2 A;  4L5L A;  4ML6 A;  1S3D A;  2ZCT A;  1BYE A;  2VL2 A;  2LRC A;  3WYW A;  4MF6 A;  4BVY A;  5DAL A;  3ZRE A;  5AIS A;  4GQC A;  3LXZ A;  2PPT A;  2C4J A;  3QFA C;  3HJM A;  2VM2 A;  4MH2 A;  1U3I A;  4LMW A;  3EMP A;  4KB3 A;  2C0G A;  1XPV A;  5ID2 B;  3Q18 A;  5EVO A;  2KUC A;  1KNG A;  3GKX A;  3J7Y b;  2HNL A;  1F6M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...