1GUVA

Structure of human chitotriosidase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
364
structure length
361
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRSGAAASLNVDAAVQQWLEKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Structure of Human Chitotriosidase - Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins
pubmed doi rcsb
molecule tags Hydrolase
total genus 121
structure length 361
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1guvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1guvA01
2J8FA 1E1FA 2DIJA 3AROA 4GPNA 1LL6A 1BLIA 1W3KA 1V3MA 1E6XM 3CZGA 3VIFA 3EBVA 4BZYA 1ZJBA 2OWCA 3HN3A 4CD6A 2DSVA 1H41A 1E4LA 2JF7A 2XYLA 3ARSA 1V6XA 1IZKA 1XD0A 1CXEA 2DGAA 1V3JA 4AD0A 2JEPA 1HL9A 3RJYA 2G4FA 4PUEA 3WNNA 3AIVA 4LGXA 3SCRA 4XUYA 3VTRA 3ZJ7A 3OZPA 1MQPA 1NOUA 4BA0A 3SCPA 2PWFA 4J3TA 1C90A 1FA2A 4D6GA 4ZXLA 1E6RA 3CHFA 3S2CA 1O6IA 1NOWA 4KGJA 5HPCA 2CERA 4AISA 3UCQA 3DC0A 4P7RA 4M1RA 3GNRA 3ZSSA 1ZBWA 2XFFA 4P8WA 1VBRA 5A2CA 3VX0A 5FL0A 2XVNA 4TX6A 1FFQA 3WH7A 3QHOA 2G41A 1MW1A 2CNCA 2VC9A 1JDDA 2XWEA 2GJXB 4LYRA 6A3HA 4AZGA 2UY4A 3T08A 3T09A 3K46A 2WMIB 5D9NA 3SCQA 3O6AA 2Q8XA 3QGVA 1BG4A 4AW7A 4WIWA 1GOKA 4MADA 1E40A 1GHSA 3AISA 4PSPA 2XWDA 3NIYA 4JZ5A 4PTXA 3VUPA 4FLSA 1IV8A 1QI3A 2J7DA 3W53A 1G5AA 3UG3A 2JIWA 5E6ZA 2E0PA 1C93A 5A69A 4JKLA 2WCAA 2WCGA 4QFUA 3WNKA 4J3SA 5IHRA 2J25A 2D0FA 2E3ZA 1HVQA 3ARTA 1QBBA 4MB5A 1CENA 4PN2A 3O2LA 1B90A 1V6YA 3KWXA 1B31A 3AS1A 4V28A 2XM1A 1MXDA 2E40A 2OSYA 1EOKA 1UWRA 3MUZ1 2FHFA 2J78A 4QLKA 1AVAA 3WQWA 1GUVA 4PRWA 1FHDA 3G6MA 3PZUA 3A6OA 1JZ5A 2V5DA 4JCLA 4B3KA 2GDVA 2YL8A 2PI6A 3ZSTA 2DT3A 3BCFA 3CUHA 3WNOA 1TMQA 1BGGA 2CBUA 3A4XA 1A47A 1CEOA 2QPSA 3K8LA 2WKGA 3EMCA 3VIIA 4WKAA 3PTMA 2FHBA 5IFTA 1OSEA 3S6TA 5A6LA 3AHXA 3QOMA 3WUGA 5FCZA 2AMGA 3AYSA 2D0GA 1RPKA 1HJVA 3AMDA 2ZUWA 4TVUA 1N82A 2W66A 2BHYA 5I3DA 2WSKA 3PN8A 4D6HA 2IXUA 3WBAA 5M17A 2CKRA 3BLKA 2YDSA 3O9NA 4UQAA 5GPRA 4F66A 2XM2A 4MAVA 3VM5A 1V6UA 2YBTA 1QNOA 3MANA 1K9TA 4DWSD 5DFAA 2WWCA 4ATWA 1UR1A 5E09A 1ODUA 4TVCA 2OWXA 3A3HA 1GHRA 4DM2A 3WF1A 5JUVA 1E56A 2XG9A 3W24A 4WLCA 2J77A 1EA9C 2W67A 3IJ9A 4DUVA 1GW1A 1V3HA 3U57A 4GI6A 4JFWA 1KWKA 2ZIDA 5HDRA 4PMYA 2JFEX 3WMSA 2BVYA 3RMEA 2E9BA 1QNRA 1W9UA 2WMHA 2EBNA 4EAMA 1CLVA 1OBAA 2WZIA 3BGAA 1Q4NX 3KZSA 1BYCA 4QCFA 1ZJAA 2QMJA 3T0DA 4EANA 5DMYA 2JF6A 4J27A 4BF7A 1HJXA 1W1PA 2ZXBA 4X9YA 1NARA 4UQDA 5CGMA 2D22A 4GIAA 5FD0A 3AI0A 2XUCA 5A8MA 5ABFA 1C8YA 3K1DA 2FGLA 3F5JA 2WHMA 4CN4A 5JIWA 1KBBA 3AHVA 4MNKA 7CGTA 3ECQA 4MNJA 2BY1A 4M80A 1E15A 3ARVA 2ZXDA 2DQXA 1B3WA 4MNMA 1UD8A 1JI2A 3W38A 2O9TA 3B9AA 5A6KA 3NSNA 1KQYA 1M53A 1H5VA 1UD4A 5IDIA 1EO5A 1B30A 2WMFA 2X0YA 3U7VA 2DH3A 1BQCA 1WP6A 4WKFA 2QHAA 5JBDA 1CXFA 4JAWA 3LPPA 4XV0A 4CD7A 2J7GA 4ACZB 2GK1A 1JGIA 1KR1A 3TTSA 2YKKA 1E6ZA 4EE9A 4JHZA 1GJUA 3KE0A 1KB3A 1HNYA 3WF3A 2XSBA 5BROA 3VDCA 4QAWA 1UWIA 1XH1A 1JZ4A 3OLDA 4UQ9A 3OLEA 4BQ3A 1E9LA 3PTQA 1VFUA 2VNCA 2YBUA 1QHPA 1PBGA 4B3LA 3AIRA 2QPUA 1VBUA 1MQQA 2VZUA 3IAQA 4MB3A 1J0YA 3II1A 4U2ZA 1PEZA 2J7FA 5BCAA 5CPQA 1QPKA 1CXIA 2BHZA 5IHSA 5HOSA 4B9YA 3BSHA 2ESCA 4Z2JA 2EO7A 4HU8A 3MV01 3WD1A 1H11A 5ABEA 4D6JA 1UKSA 2MANA 2VX5A 4PEEA 4CCEA 4GZJA 4W86A 1VEOA 1HKKA 4BQ4A 3CZKA 4W8AA 1BF2A 2YDQA 5IFPA 4JHOA 1R8LA 1JD7A 1TG7A 1AMYA 4C7DA 3GH7A 4PUDA 2TAAA 3W82A 1XCXA 1OWQA 1WO2A 1UH3A 2J75A 4HMEA 3W26A 1XGZA 4H8HA 3VGDA 3DYPA 3UG4A 2VURA 1RH9A 5KZ6A 2YDRA 4ZFMA 4AZCB 5BYWA 1WDRA 4PMZA 2YLAA 4LPCA 3UESA 2E4TA 4DUWA 1JI1A 1KGUA 2VX4A 3VD7A 4GQQA 3WBEA 3VIMA 3CHCA 1SMAA 3WQ6A 1OT1A 3ZT6A 4D71A 2NT1A 4FF5A 1K9FA 4GXPA 2F2HA 2ZWZA 2EQDA 4KRUA 1J11A 5A8OA 3W27A 1JDCA 5GNYA 3GH5A 1CNVA 1O7AA 3AIBA 3TTYA 5FOOA 2EJ1A 1GQJA 4LYQA 2F61A 3VGEA 1QW9A 2CEQA 1K9DA 2WNWA 1GONA 1W3HA 1A3HA 4UTFA 1WNOA 2VOTA 4IISA 3SCSA 1RD6A 1QHOA 2ZUUA 3FHQA 1EGZA 4MB4A 4HOZA 4P7OA 2WK2A 2V3DA 1GPFA 2VQUA 4AEFA 2Y8KA 2VZSA 3BAYA 5M03A 4OUEA 4WJXA 2DEPA 1KXTA 1DWAM 5D4YA 3AS0A 3WEMA 3F5LA 1V3KA 2BXZA 2OWWA 1W91A 3WQ8A 2X2YA 3WDRA 1HP5A 2WZEA 1W9DM 1QI5A 1MFUA 2OYLA 3MUY1 1J9YA 3PZTA 1ZS2A 1J0ZA 3ARQA 3RCNA 1EHAA 2FH6A 2YA1A 3OBAA 1GZJA 4TUFA 4E8DA 2EEXA 3CZJA 3GTNA 3RM8A 3AHYA 3BC9A 2ZICA 7A3HA 1C3FA 2PWDA 1W3JA 3NCOA 5KEZA 3WNMA 4OKDA 5I6SA 4UCFA 2V38A 4A4AA 1CGWA 4TTGA 5DT7A 1TR1A 5I79A 3GNOA 2BV9A 3WDHA 1JAEA 4UOZA 1BG9A 1WE5A 4UQCA 5A2BA 1V08A 3CH9A 2PB1A 1E1EA 4MTVA 4KRTA 2WC7A 3N04A 2WVSA 3AYRA 3VD3A 1HXJA 4D6FA 1VIWA 1W9BM 3MMDA 2G8ZA 2O92A 2J4GA 4U5IA 4CCDA 3MMWA 1WAWA 4AIEA 2VCAA 1EHNA 3ARUA 4WSJA 2X09A 2W62A 4U31A 2WZHA 3SURA 3TA9A 3W25A 4M29A 2DDXA 2YL9A 2GJPA 5E0FA 1J10A 2XTKA 4N0RA 3ZOAA 1ZBKA 1H1NA 4JFVA 3MSGA 3VIKA 3ALGA 1XV8A 3WIJA 1UWQA 3L4TA 2F8QA 3OIHA 2XFRA 1C7TA 2IUZA 2DSWA 3VOCA 2EPNA 2WMJA 2VX6A 1QNSA 3FXYA 1UA7A 3BH4A 4BQ5A 5DF0A 3MMUA 3CMJA 2UWFA 1ODZA 4AZ7A 2XVLA 2D3LA 4AZ6A 2WHLA 1TFVA 1JG9A 1FP9A 4Q22A 4M56A 1KXQA 5D8WA 1Z32X 5GNZA 2J7EA 4BQ2A 1FH8A 1J18A 4DM1A 1XSJA 1DHKA 1WCGA 3G6LA 2PC8A 1OIMA 1WZMA 3PZOA 1TA3A 5CJ5A 3THDA 3N1AA 1EH9A 2WC3A 1UYQA 2DSKA 3VIOA 1US2A 2UY5A 4FMVA 1KXHA 1OIFA 1V3IA 4E8CA 5C71A 1GOWA 4PMRA 4JCMA 4JFTA 4UFMA 1KGWA 3ARXA 2BNJA 4W89A 2D2OA 3T0AA 4D6EA 5AC5A 3AJ7A 3ZIZA 1DP0A 4K68A 3L4UA 5BXPA 3DECA 1PX4A 2EXOA 1EDTA 3W28A 4FLQA 2VRJA 3L4XA 3WQ5A 5HNNA 4GZEA 1JNEA 2A3HA 3VILA 2HVMA 2WAGA 1E70M 1JNDA 2VZVA 3W6MA 3VNYA 4QP0A 1X6NA 5JH8A 1HL8A 5E9AA 1FP8A 5GNXA 2NW0A 4UFLA 2WC4A 4LX4A 3WUFA 5HXMA 4YHGA 1LL4A 2QMKA 2D23A 1QI2A 3NUKA 3AXHA 1LG2A 1OGSA 4V2XA 3WEOA 5IXEA 2D20A 4H7VA 4MJ2A 2Y5EA 5A6BA 2YA2A 1CXKA 1CWYA 2CHOA 2RGMA 2WMGA 1H09A 2DT1A 1E71M 1OT2A 3HJEA 3WFLA 1GQKA 3EDDA 1SMDA 1C8QA 3WFZA 3DYOA 1W1VA 3WH5A 4AWEA 1UWTA 3AHTA 2O9OA 4AZ5A 3U5UA 4JKKA 1R85A 2J47A 2RGLA 1UUQA 3QHNA 2GFTA 3N12A 1X1NA 4OZOA 3MUIA 5A3HA 4F79A 5CXPA 5CGTA 1R7OA 3D3AA 2G3IA 2ZX8A 1ITXA 5BRPA 1SFSA 4DWSB 3QOKA 1YHTA 2WKLA 2DIEA 3SCNA 2Y8VA 3ZJ6A 4CKQA 1BTCA 1V6VA 4ZE5A 2DT0A 4YN5A 2VUYA 5M3WA 3AIEA 1CGXA 4JIEA 1KR0A 3UR8A 3SUVA 4CU6A 2HISA 1LWJA 2JIEA 4UOJA 4W5ZA 2X0HA 4UOQA 2EPOA 2J79A 3WENA 1GCYA 2AAAA 1ISYA 1QW8A 2PWEA 1E72M 1QI4A 1QNPA 5BRQA 2VX7A 3ZMRA 4OOUA 1DWFM 2GJRA 2XIIA 4HPHA 1PZ2A 3AIUA 2WPGA 5LA1A 4TVDA 3I3DA 1ZL1A 2FDMA 2XGIA 2BVTA 2CBIA 2PF0A 4H8VA 2VR4A 2J62A 3WD0A 3ZM8A 2ZOXA 2XGBA 3WN6A 1VJZA 2E8ZA 2JEQA 2WVUA 3AFBA 2WWDA 4GO8A 4PMDA 2WBGA 1JDAA 3T2QA 3A47A 1GOOA 3B8SA 1QVBA 2VTFA 4W8LA 3LPFA 3CZLA 3EMQA 5LA0A 3SUSA 5FIPA 2JE8A 4P8UA 4YHEA 1MYRA 2XIBA 3GXDA 2O9PA 3VGFA 1ZBVA 3ZR5A 1P6WA 1W3LA 5CZKA 1JF6A 1G0CA 1UKTA 2AOSA 1NWSA 1RP9A 2WSPA 4LXFA 3IJ8A 2GSJA 4DUXA 4BS0A 1DTUA 2O9RA 5D9MA 1Q6GA 1E0WA 5I78A 1EQCA 4Y7EA 1KWGA 4J28A 2FHCA 1AQ0A 3DHUA 2ZX9A 1VFFA 1M03A 4U2YA 4HPGA 3ZT7A 3WH8A 5I77A 1NQ6A 1NWUA 1E3XA 1FFRA 2CBVA 3NDZA 1JFXA 5AYIA 1I75A 4AYSA 1CLXA 3FAXA 1HP4A 3N11A 3M6DA 4CU7A 3D5HA 1NP2A 1E3ZA 4M8UA 5JBFA 4P7LA 4UFIA 3K8KA 2WB5A 3KL3A 1NP0A 1EDGA 3WD4A 5I23A 4F9JA 3ALFA 3B9EA 3ZT5A 1E43A 2WVVB 4AD1A 3SUWA 4F8XA 1G94A 4AMCA 3TOPA 4IPNB 4NRSA 4AZBA 1FOBA 1ECEA 2WLYA 3BAKA 1WZAA 4AEEA 3CZ8A 1OGBA 4Z2KA 2WMKA 3K8MA 3EMZA 4W7VA 3EDEA 4H2CA 1OGGA 2BS9A 3UERA 2VR5A 4B16A 2QV4A 4B15A 1UD2A 4HOWA 1UA3A 5HPOA 4D1JA 4CN6A 1MW3A 1E6NA 1HJQA 2D3NA 4N42A 2W91A 3CIVA 1BSIA 2ZUSA 4ZEPA 4DWSC 1BPLB 1EDQA 4OIFA 3RPMA 1HIZA 4GO9A 1Q6FA 2X8RA 5A6AA 1UH4A 3VIJA 3ARYA 1ISWA 1LWHA 3BAJA 3ZJKA 1V02E 1VEPA 1HVXA 2Z1KA 3IJ7A 2GJXA 1E0VA 2XSAA 1CPUA 1CIUA 1V0KA 3SCTA 4AD4A 2B31A 4IM4A 7TAAA 3MO4A 3PZGA 2WMIA 4CGTA 1ISXA 2OLHA 3W29A 3WY1A 1VENA 3AIWA 1BVZA 3WD3A 3QR3A 4AIOA 2X1IA 1DEDA 1RP8A 1UG6A 3AHZA 2XJ7A 4EKJA 4Q7NA 4AD2A 1B2YA 1GJWA 3EDKA 5A6JA 5A8PA 4M81A 3OGSA 5DO8A 2C8NA 2VCBA 4URIA 1GORA 2YLLA 1U30A 3EDJA 4MDOA 3WNLA 3OA5A 4PYSA 4FLRA 4OBSA 3L4VA 1BYAA 1PJ9A 3AMCA 4AXNA 5I0DA 2E8YA 1XHGA 1B0IA 1V0MA 5CLWA 1BFNA 3IAPA 8CGTA 5I2UA 3A4AA 1E4IA 4AZIA 1UZ4A 2V3EA 3GXFA 2J74A 3WSUA 4W84A 5AC4A 3OZOA 1D7FA 4MDPA 3L4YA 3LPOA 3SUUA 4GINA 3AS3A 1MW0A 3WELA 4W88A 5A94A 1HX0A 3VINA 1C92A 1CXLA 1F4HA 1CYGA 2WYSA 2G3NA 1GVYA 4AD5A 3UETA 1UD5A 1Q6CA 2CETA 2WCSA 1CBGA 4MJ4A 1NWTA 3BAIA 1JF5A 3ARRA 1QHZA 3GH4A 3AMGA 3WDPP 3EDFA 3AQUA 4S3KA 5A6MA 4GI8A 4WF7A 2PWGA 1UQYA 6TAAA 3VD5A 3OLIA 1G01A 5D9PA 3T2PA 5ABHA 1BVNP 3THCA 3FN9A 3CHEA 1B3YA 3L4ZA 3GYCA 3KL0A 1H3GA 6CGTA 1XH0A 3PZ9A 3VD9A 1UD6A 3VKKA 5BXTA 1EXPA 3T2OA 4HA4A 4J7RA 4U3CA 4XB3A 4PMUA 3RJXA 1CGVA 1XSKA 4KMQA 2WHKA 5A6BD 2J7CA 5I24A 1UD3A 4AD3A 1H2JA 2WXDM 2W4XA 3F4VA 3VDBA 1KGXA 3BMWA 2BVDA 2D0HA 4JKMA 2CCRA 3POHA 4HP5A 3CTTA 1JIBA 5A1AA 4CD5A 3RM4A 4M24A 1U33A 1UR2A 2J8GA 2VZOA 2X05A 3VD4A 4XX6A 1GVIA 1M01A 3ZQ9A 4U5KA 1QNQA 5TD4A 4X0NA 4JL2A 2WBKA 3CLWA 1ISVA 4HZ6A 1OM0A 1W1TA 3VMPA 2V3GA 3U7BA 1UHVA 2UY3A 3WQ4A 4E4PA 2GVYA 1TZ7A 3AZTA 2ZX5A 1MWOA 2CESA 3WUEA 3ZJ8A 4D6CA 4L4OA 2UY2A 4P8XA 2W63A 4WK9A 1VRXA 5CPTA 3F5KA 2W5FA 4QLLA 2CPUA 3EYPA 5C70A 1D3CA 3GBDA 4R5EA 3UR7A 1W32A 2OYKA 5JBEA 1E73M 1VF8A 1B3XA 4IUGA 3NYDA 4ACZA 2OSXA 1E4NA 2WVTA 4F9DA 1IT0A 1J0KA 3MU7A 4X0VA 1VAHA 3MUAA 3CUJA 4W93A 4HOXA 3ARPA 1GQIA 3VVGA 1XRVA 1UKPA 3AZSA 2YJQA 1HF6A 5FL1A 3GNPA 1LJYA 2ZXAA 3ARWA 2ZUNA 2A3AA 3I3EA 2Y2WA 5ABFB 1B1YA 4PMXA 4A3YA 2XVPA 2D1ZA 3A4WA 4P8VA 1WDSA 4ML4A 3WF4A 4FLOA 1OB0A 3AXIA 1NOFA 3OLGA 1FH9A 2BY2A 1X6LA 1EQPA 4AZHA 4C7FA 4H8UA 1BAGA 1KBKA 3AS2A 2OYMA 3N9KA 1UZ1A 2PBGA 1W1YA 1LF1A 4NI3A 3GBEA 5CSYA 3N15A 2FH8A 4CD8A 1HJWA 4UFHA 1E6PA 3DYMA 1TCMA 1HKMA 1H4PA 3VIGA 3AIQA 1MXGA 2DSUA 1H0GA 1IZJA 2GK1B 3VDAA 3LMYA 4LYPA 1R87A 3RO8A 4QCEA 1AQMA 1UWUA 2VL4A 1R86A 1MVYA 1ZBCA 1K6AA 1US3A 1MW2A 2XHYA 1PPIA 2YOCA 4PTWA 5CPSA 1JL8A 4AZCA 4MAZA 3WL0A 2YIHA 4RL3A 1W2VA 1G1YA 4CN1A 1J01A 1B9ZA 2GUYA 4HU0A 1HKJA 2XVGA 4QLJA 4PCTA 1MFVA 3K4DA 3SCWA 3PZIA 4GI9A 1FH7A 4CUCA 2BXYA 3N13A 2WW5A 1CGYA 1B3VA 3PBGA 3VX1A 5HBFA 3NJ3A 1VJSA 4U3AA 5CG0A 3OG2A 1S46A 1XSIA 2V3FA 2YA0A 3WDIA 3HU7A 1ESWA 4TTUA 4E2OA 4WSKA 2A3EA 5BXRA 4HA3A 2ZUMA 3GXMA 1PX3A 3IK2A 3CMGA 4D6DA 1BGAA 4L4PA 1DWGM 3MV11 1WZLA 1HKIA 1JZ6A 3WDQA 2C0HA 1UQZA 5BXSA 1JYWA 1E4MM 1WZKA 5ECUA 5CLTA 1W9XA 3WUBA 3KL5A 3CUFA 2ZE0A 1UOKA 3M7SA 1Q6EA 2CKSA 3AXXA 3RILA 1MQRA 4AIUA 4UNIA 1CGTA 2XFYA 2VZTA 1OINA 1I1XA 3VMNA 2J7BA 1HT6A 1BYDA 2VO5A 3T0BA 2ZUVA 3L4WA 1WB0A 1JXKA 1DWJM 3I3BA 3L2LA 3SIMA 1XYFA 1CXHA 3LPGA 1HN1A 2YL6A 5LA2A 2ZX7A 5A8NA 1XC6A 4MB1A 1E6QM 3SEPA 5AY7A 3BAXA 2VJXA 3PZVA 2DSZA 5EFFA 4HA1A 4NRRA 1TVPA 1JFHA 2E9LA 3BLPX 4MNLA 3VO0A 4Z2LA 1VB9A 3VGBA 2BHUA 4GKLA 2BY3A 3PTKA 5D8ZA 3WQVA 4J3UA 1Y7VA 3TONA 3VIPA 3SCOA 5F7UA 1UWSA 4NF7A 4P7NA 1EOMA 2E9MA 1KCKA 3TTOA 3GZAA 1E5NA 2VMFA 2YL5A 1OCQA 4ATLA 4HMCA 1U2YA 4OBRA 4RE3A 1G9HA 2CHNA 4BCEA 4TOQA 1V0LA 5A8QA 5A95A 3WF0A 2CITA 4H04A 3SCUA 1H0IA 1I1WA 1JD9A 3VMOA 3APGA 2EPKX 4HTYA 1Q6DA 3WEZA 2DPEA 4GQRA 3B9DA 1LQ0A 3WMCA 2A3BA 1E55A 4UR9A 5DT5A 3WL1A 4PCSA 1JZ8A 3VDHA 4HMDA 2W92A 2CXGA 4PMVA 2PWHA 1V0NA 3VNZA 3WD2A 4D1IA 3M46A 2VCCA 1W9PA 4UZSA 3FHAA 1DWHM 3SCVA 4J3VA 4Z2GA 3U5YA 2Y24A 4JFSA 3L2MA 1LG1A 2Z1SA 5EFDA 2DH2A 2Y4SA 2IXVA 2XVKA 3CO4A 2QLYA 3CUIA 4J3XA 3WKZA 3FW6A 2GDUA 1PZ3A 4C7GA 1E5JA 1R7AA 1KFWA 4TXEA 1PIGA 4CD4A 1E6SM 5M5DA 4UFKA 2WANA 1CGUA 4OJYA 4ZXOA 1ZB5A 2VT0A 1L0PA 4RE4A 5C8BB 4PTVA 3TTQA 5FKYA 3W81A 1V03A 4JFUA 4OOZA 1GOQA 1HJSA 3WNPA 4Z2HA 4KH2A 3ZO9A 1QBAA 3NSXA 4V27A 4P7QA 3VIHA 2VVSA 3N18A 2ZWYA 2VVNA 3ZR6A 5D9OA 1JXJA 1ZU8A 5BWFA 3KEHA 5CSUA 3CBWA 5DEZA 1VFOA 4ACYA 1M7XA 2BFGA 4UQBA 3PZQA 1UR8A 1V3LA 3POCA 1TA3B 4AC1X 5CQ1A 4R27A 3W4RA 5LYRA 4D72A 4ATDA 4ZE4A 2WHJA 3WH6A 3GDBA 3QHMA 2EPLX 4PMOA 1VEMA 1TE1A 3HMCA 3OGRA 4W8BA 3AMLA 1SR0A 1NWRA 1ISZA 1D2KA 4UZUA 5A2AA 1B3ZA 3CZEA 1V6WA 2PBOA 3PZNA 4CVWA 1SYTA 5EMYA 4CU8A 1WPCA 2NSXA 1JYXA 3AMKA 4J3WA 3MSDA 1JZ2A 5E70A 1XH2A 1QI0A 4HZ8A 1KQZA 3AOFA 2XPKA 2G3JA 3FY1A 3BMVA 3CPUA 4GZIA 3RDKA 3ARZA 1OD8A 2G3MA 3W6LA 3GM8A 1NM9A 4PBGA 4DWSA 4FK9A 3OB8A 3WF2A 4B9ZA 1LL7A 1K9EA 4W7UA 5A6SA 3JUGA 1GNXA 1J12A 1UKOA 1CECA 1WDQA 4U33A 1W9VA 3BSGA 1EO7A 4PMNA 3SUTA 3GXIA 2DT2A 1XCWA 3UEQA 2A3CA 3PZMA 3VM7A 1C7SA 3W37A 3WH9A 4W87A 1WDPA 1GOIA 2VI0A 1J0IA 4KWUA 1AQHA 2JALA 3WMBA 2EPMX 4Z2IA 1UH2A 3J7HA 4S3JA 2D24A 3RIKA 5GQBA 4W5UA 1JYNA 1UR0A 3E1F1 1UR4A 5EBAA 3TP4A 1JYVA 2CBJA 2QF8A 1PX8A 4PTMA 1HJUA 1WKYA 5JIPA 4H41A 2VQTA 1C8XA 3MKKA 3BXWA 1GQLA 4W85A 3VPLA 4A3HA 4AY1A 3AICA 3NSMA 4PSRA 1F4AA 3NDYA 3MS8A 4LQ1A 1XD1A 3IANA 1V02A 4PMQA 4CCCA 1H49A 3UG5A 8A3HA 2FGZA 2WM0A 1NH6A 4NZCA 3CGTA 2WLZA 1C91A 4JL1A 3CHDA 1PAMA 4HZ7A 5EB8A 1XYZA 3W0KA 3AZRA 1CDGA 9CGTA 1BHGA 1VFMA 4WKHA 2NT0A 4ZENA 2VRQA 4UFJA 1GOMA 4KGLA 2J7HA 2BY0A 3RM9A 4W7WA 1UKQA 3VGGA 4EK7A 1PIFA 4RE2A 3FNDA 3WDJA 1UR9A 1LLOA 4D6IA 2ZXQA 1TUXA 3CUGA 2OSWA 1KCLA 2CIPA 3N17A 1M04A 1ITCA 4CVUA 1E0XA 2CYGA 2WVVA 5I5RA 5AYBA 2VRKA 1J0HA 2C7FA 3K4AA 3BAWA 1JZ7A 4NSBA 4XZWA 1W2PA 1TVNA 2ZUTA 1EIBA 5ABGA 3BCDA 2W61A 4TX8A 1L8NA 1OD0A 3OGVA 1CZ1A 1DWIM 4IPLA 3M07A 1BYBA 3PHAA 1JZ3A 4UQEA 3DHPA 1KXVA 1QOXA 4QDMA 4YPJA 1YQ2A 3VU2A 1JAKA 5E0CA 4XZBA 2ZX6A 3FAWA 4MPKA 5E6YA 1J0JA 4M82A 1FHLA 3VGHA 1CTNA 2V5CA
chains in the Genus database with same CATH superfamily
4OUIA 4Q6JA 4K38A 4O14A 2EHHA 1D8CA 4FAPA 1ADDA 3UWEA 4GPNA 1BLIA 1V3MA 5D32A 2AAMA 1DQXA 2RKXA 4CD6A 4QJ1A 2XYLA 3ARSA 1IEWA 5J8LA 1XD0A 1TIMA 1CXEA 1XQLA 4A29A 4XVDA 2ACUA 3RJYA 1S2TA 3WNNA 2CHRA 3TSMA 3SCRA 5I09A 4HPJA 3M5XA 4C6PA 3OZPA 3HPFA 2PWFA 4J40A 2YR1A 4IMAA 4J3TA 4ORMA 4GCXA 5F2MA 1ZENA 5H1WA 5HPCA 2P4VA 3UCQA 1NMWA 4HBOA 2BGNE 2PRHA 2PLMA 4XD5A 1VBRA 3M0KA 5A2CA 2H9AB 2VGFA 2XVNA 3PSVA 2FZBA 3QHOA 1DOSA 2G41A 3RU6A 4K2SA 3U9IA 1JDDA 2C13A 4DQWA 4LYRA 1XYCA 1FKTA 2GSHA 3W2LA 3FXGA 2WMIB 1OZQA 3LEPA 4AW7A 4WIWA 3O5DA 1GOKA 3BGJA 1E40A 4MADA 3IJ6A 1W5QA 3PBVA 4DT4A 3RO6A 3LLFA 4ZMGA 4Y8EA 5C9WA 4PTXA 4IMGA 3VUPA 4FLSA 2J7DA 5HAOA 3WLLA 2CLPA 2V63A 5IHRA 1Q66A 3NAVA 2E3ZA 2O7QA 1HVQA 4DJDD 2Z25A 4M6QA 4J2PA 3AS1A 1JGMA 1MXDA 4GKTA 2JBMA 4QS6A 1UWRA 3MKCA 3TCEA 4NVTA 3W87A 2VDHA 5FEWA 1AVAA 1GUVA 4Y90A 1XIFA 4F0KA 3XIMA 2HROA 3DERA 4TMBA 3IV3A 2GDVA 4JIRA 3BCFA 4ODOA 3VNLA 2CBUA 2PBCA 4NNRA 1FBAA 2NLIA 4WKAA 3PTMA 3H9RB 2FHBA 5IFTA 5GVJA 3AHXA 1YPFA 3WUGA 4DZ3A 5JVLA 3KBJA 4WD0A 2ZRYA 3GG8A 4O1AA 4QJ5B 2WSKA 3PN8A 1ZAHA 3LXCA 2C15A 2X42A 3O9NA 2PN0A 4E3VA 1K1DA 1Z42A 2PLJA 3MANA 2C19A 4H9VA 5AHNA 1XC4A 2CLHA 2WWCA 4ATWA 1ODUA 3QTGA 3A3HA 1GHRA 4GVIA 5I7GA 2XG9A 1EA9C 2W67A 1TR9A 4JFWA 5LZLA 2CZDA 4G7EB 2QNEA 4L4MA 3WMSA 2BVYA 3ENLA 3T81A 3N6QA 4NNCA 4IH3A 4K7YA 2Y1HA 1L6YA 3GRIA 4XTIA 2HTMA 1OBAA 3BGAA 2DIKA 3BZJA 3T42A 2ZXBA 2HSAA 3AI0A 3GAKA 4N6EA 3RAOA 4E4UA 2DFAA 3F5JA 3AWNA 3WLHA 2QVHA 1YLVA 2DZWA 7CGTA 1W1B1 3WMLA 3DFOA 4M80A 4ECLA 1X97A 5C5YA 1BEUA 4MNMA 3NG3A 3OVRA 1XIGA 2FKEA 2O9TA 3MSYA 1EJUC 3EOSA 3E0VA 3H22A 3JVAA 1BWLA 1EF3A 3R58A 3URAA 1KTBA 4Q7IA 2X0YA 3PFMA 1NFGA 5K3VA 2O4MA 1NSGA 2XP7A 2IPWA 4PB4A 3HIJA 3TTSA 2OPJA 1E6ZA 3WQGA 4BKNA 2ISDA 3W7NA 4QAWA 2YBVA 2I5IA 2QF7A 4WJ8A 1XH1A 4NG3A 3SN0A 4XBSA 3S1UA 3SRHA 4UQ9A 1E9LA 4PTDA 6XIMA 1ZLPA 1XF0A 1MQQA 2VZUA 3DIPA 3UBPC 3VABA 3H2EA 3DKJA 1EBGA 4U2ZA 2J7FA 1KV8A 2EF9A 4DZ2A 4OVXA 5DRCA 1TPWA 1O1HA 1QOQA 3W1TA 3L9CA 1CXIA 3R10A 1XLLA 1LT7A 4B5VA 4DO7A 2ZTJA 5MKGB 4LVDA 4LSBA 2VX5A 4PEEA 2R91A 4C65A 2XH0A 1J79A 5IFPA 1TJ1A 3R8RA 5FI8A 3GH7A 4HTBA 3TR9A 1IEXA 3TROA 4PUDA 4DZAA 1FWAC 3W82A 1OWQA 1UOZA 2NV1A 2PMQA 1F6YA 4MYXA 1L1PA 2V8ZA 2QJGA 1ICPA 3H2OA 3LNMA 3OZMA 3QY8A 1KA9F 3PBMA 3TWAA 3O16A 3UESA 1QUMA 1O94A 1F05A 3CHCA 2DG4A 3WQ6A 1M3UA 3TJLA 3PPCA 3TTEA 4AWUA 2XN0A 1ZGDA 2DZPA 1K9FA 1ZP3A 1EC9A 2PPPA 2POTA 2EQDA 4FNUA 5LXXA 3AIBA 4RLIA 2H6RA 1FY6A 1P48A 3VGEA 2CEQA 4JDYA 3GXTA 5BW6A 1GONA 3ES7A 4IISA 3TQVA 4O10A 3SCSA 3I6TA 3VKDA 5B7YA 3QC3A 3W1NA 2ZUUA 1SW0A 1EGZA 4HOZA 3CB8A 4UXDA 4P7OA 1Q8AA 4NZFA 5GJMA 3UP8A 4AEFA 4L9YA 2Y8KA 3TQKA 4WDTA 3C52A 4L9ZA 5KZMA 1FKFA 4GQGA 4O15A 4UB9A 3PPGA 4Q8OA 4FXSA 1XI3A 2OWWA 3WQ8A 2NWSA 3WDRA 1SUXA 4I7WA 2WZEA 1ZZMA 1QI5A 3DG3A 3OEXA 3OHIA 1VC4A 3O5EA 4QJ3B 1EHAA 3OBAA 4GG9A 2V2DA 1X39A 1F8MA 4IQLA 3N34A 4O13A 1OG6A 5FJJA 4Y9OA 4GOAA 4H83A 2Z00A 2PDIA 1EYWA 2MNTA 3M0VA 2ZICA 2PWDA 1CI1A 2NQHA 3V35A 2WPBA 3U4FA 4ERAA 1M7JA 5KEZA 3C3NA 2PRMA 4UCFA 1Q6QA 3HA1A 3AYVA 3EKLA 1FHVA 1TR1A 3CWNA 4FB7A 4JN8A 1BG9A 3C4UA 4UQCA 3HG2A 4J2MA 4UTLA 3H7RA 3CH9A 2QQ6A 4KRTA 1XUUA 1IT7A 4D6FA 1VIWA 3MMDA 1CX9A 2G8ZA 2O92A 2D2GA 3CIWA 4U5IA 3SY5A 4DAFA 1XBVA 1ZFJA 3UT0A 2XH2A 4AIEA 2Q8ZA 1EHNA 4WSJA 4C6EA 2QIIA 2X09A 4U31A 4RDZA 2MLZA 2QS8A 5C2XA 3G1YA 4IT4A 2XH7A 3MVTA 2DDXA 2GJPA 2XTKA 3ZOAA 1ZBKA 2OO0A 4MWAD 4XSLA 2EG7A 4IPXA 3WIJA 1UWQA 3D47A 2F8QA 2SFPA 1XLDA 2XFRA 3T0TA 1SO3A 1KM6A 4A3UA 1RXOB 3E0IA 3VOCA 5AC8A 1O60A 1EC8A 3FEMA 2VX6A 3AO0A 1PKMA 2J9XA 3MUXA 3GVVA 3CMJA 4AZ7A 3LN3A 3CL8A 3VNKA 3ODKA 1SJBA 1NMVA 2BG5A 4KIRA 3TYUA 4AVNA 4UTKA 1IXPA 4PUUA 1AH0A 4M56A 1Z32X 2J7EA 4BQ2A 4TW7A 3ZYZA 4S3DA 1V79A 2PD5A 3GHSA 5H8UA 3G6LA 4RPQA 1JUEA 1I2PA 2F84A 4XZHA 2V82A 5B8IC 3F7JA 1EH9A 4PRRA 1D3GA 3WQDA 1Z7AA 4FMVA 2UY5A 4NJJA 1OIFA 4QG6A 4ROQA 4W89A 5AC5A 4DELA 4N6FA 1TWDA 4AF0B 3N2OA 1PX4A 1DVJA 5HR6A 4YU1A 2X41A 1S5VA 3QW3A 4KCVA 3GW0A 4GZEA 3SZ8A 4PL1A 2ALDA 5CGQA 3LCFA 5C54A 1X8CA 2BVWA 2V9DA 4QP0A 3QZEA 3VCRA 2NW0A 1FP8A 5GNXA 2J88A 1EX1A 3FJ6A 2WC4A 4B5NA 4PFHA 5HXMA 1IIGA 4YHGA 3EOEA 2KI3A 2D23A 3C0SA 3N6HA 4M19A 3AXHA 5FEPA 1ADSA 1K77A 3RCMA 2XN1A 2RGMA 1H09A 1OT2A 3WCZA 2DG9A 3KZPA 3QKEA 4MWAC 1C8QA 3LTPA 4GX9A 4KEUA 4AVFA 4RV8A 4AX6A 1GTEA 1U22A 3VXGA 3BLLA 3WH5A 3GNNA 3VKAA 5J6EA 2Y8UA 2QT3A 4JKKA 2J47A 3QHNA 3QFWA 2GFTA 3S2JA 4OZOA 4AVOA 2ZZ5A 5A3HA 3W7GA 3DBPA 3R94A 1GG0A 5CXPA 3UWQA 4N7QA 1OQFA 5CGTA 3REQA 5KTLA 2HQAA 4HYVA 5BRPA 3EAUA 2WKLA 1YHTA 3I6CA 2Y8VA 1T5AA 2RFGA 5FEXA 4NASA 1GGOA 3GNDA 4K6AA 4I8DA 2FB2A 3LBOA 4J4OA 4S2CA 2V0TA 3LX9A 1LWJA 4UOJA 9XIAA 4JPGA 1LWIA 2GQ8A 4AMAA 3H8AA 3ZMRA 1IF2A 1DWFM 5DMLA 2GJRA 3P60A 3RN6A 1DTNA 1F7BA 3NXFA 5T91A 5F2IA 3V7PA 3M0IA 2BVTA 4H6EA 4LANA 4WSHA 4IWWA 5L6UA 2ICSA 3NA8A 3L0NA 2ZOXA 1VJZA 4IGSA 3C8FA 4ZOAA 5D2WA 1OFOA 3EZ4A 2VHLA 2PODA 2WBGA 5DIVA 4GUJA 3A47A 1LDCA 3TLLA 1TTQA 3VNMA 4JR5A 1S2AA 2B4GA 3CLMA 1MO0A 4CLMA 3VCCA 1PKLA 5GJPA 3L67A 2ADAA 2PDXA 1P6WA 1R47A 2E5CA 4HCLA 4PFMA 1XJBA 2VEPA 1JR1A 5CZKA 1G0CA 2IKIA 1IEVA 4HSNA 1FCVA 3BL3A 1OG0A 3JS3A 1RP9A 2WSPA 4LXFA 4JFJA 2GSJA 4ODRA 3LYEA 4BS0A 1KFLA 2O9RA 4I5XA 3WG6A 2VYOA 4U85A 3NZ1A 5EYWA 3KCEA 2OEMA 5BOFA 1QK2A 4J28A 2FHCA 1IGSA 3CU2A 1M03A 5FF4A 5IOBA 4ZOEA 4H9ZA 3NDZA 3CV2A 4Q3MA 4HYWA 1SU5A 2NXHA 1I75A 3FAXA 1HP4A 3PUOA 1TVLA 2DZUA 4A3QA 2PZ0A 4LS2A 5HA7A 3FSTA 1VHCA 2BTMA 4UFIA 4HNOA 3K8KA 3DI0A 4AH7A 3S4TA 1KCZA 2QCGA 5I23A 4F9JA 3ALFA 2Y89A 1XICA 2WVVB 4UBPC 3P2VA 2Y0FA 3NO5A 4ES4A 3KLKA 4WOQA 1LOLA 4IPNB 1FWDC 1AQFA 2X16A 2V5CA 3F4WA 1H51A 2BGSA 3K8MA 4ERGA 1OGGA 2ON3A 2VKZG 3PG8A 2JGYA 3O1NA 3RMJA 3WX7A 1UD2A 4KWSA 2W91A 1F9CA 2VFHA 4RDWA 1NSJA 5H91A 2WSQA 5FEZA 3RPMA 2GVEA 3QPZA 1X7IA 2G96A 4CNNA 3VIJA 1AZ1A 4GFIA 4WXYA 1LWHA 3BAJA 1V02E 4HK6A 2GJXA 4N02A 1FKRA 4E38A 4YYFA 5LSMA 2ZRWA 3GG1A 4DLMA 2B31A 2FKPA 3MO4A 3EIPA 3PZGA 4EAYA 2C0AA 2ZQSA 3LQLA 4K1WA 3WY1A 4NAFB 2VELA 1DEDA 1RP8A 5FJPA 3BZGA 4EKJA 5I02A 4MZYA 1HFBA 3LXAA 4ZO7A 3VFCA 4C6QA 1GORA 3FFSA 2VEKA 4MDOA 4DPQA 5CC7A 4PYSA 2C3ZA 4UTTC 1QPFA 1RJQA 1MI3A 5G1MA 1SM9A 2VEGA 3PJWA 6XIAA 5I2UA 1UZ4A 2V3EA 4KWVA 3WSUA 3FOKA 3C0LA 3CYJA 3URBA 4S38A 3KW3A 4XAKA 3UFYA 4X22A 3LPOA 3ANVA 3M0MA 3WJYA 3BMXA 4W88A 4WQ6A 1CYGA 2WYSA 4LAZA 2V2CA 1GVYA 3H4WA 2CLLA 4AD5A 2CETA 1CBGA 3HGJA 1KKOA 4M1BA 5AC7A 4EPEC 1OF8A 3BAIA 4RNHA 4M0XA 3NDOA 1JF5A 3G3MA 4CQ9A 4HK5A 5HW7A 4XZNX 4FNRA 4IQ2A 3AQUA 1K7XA 3M5VA 4S3KA 3EKZA 4KKXA 3W7PA 3OLIA 2DQWA 2PDLA 5LIUX 2QKFA 1QZ2A 3LMZA 3TN5A 1Q5MA 1RAKA 1H3GA 1XH0A 2TRSA 4MLRA 3VKKA 1A7XA 5FJRA 1FAPA 3ABXA 3LCHA 3P14A 4XB3A 3BLDA 3QVQA 1TRIA 2IQDA 3B4UA 4DJEA 4AD3A 3UJEA 4FXRA 1DIKA 3F1QA 2P10A 2WXDM 1KGXA 3E3HA 4I5RA 1BXNA 1K03A 2D0HA 4KF1A 4NZ3A 2YCEA 3IACA 4M7TA 4NXSA 2ZE3A 1DBTA 2X05A 4N2YA 1FRBA 1M01A 3QSTA 1QNQA 4X0NA 3RRAA 3KTSA 2WBKA 3WLQA 3CUZA 4I6KA 1W1TA 4ZODA 3U7BA 1UHVA 4L4OA 4GYPA 2UY2A 1W3NA 4CNSA 1S5TA 4I6VA 3QMRA 3TN3A 3HO8A 1LUCB 5LXEA 1D3CA 1TELA 3XISA 1W32A 4FX7A 1TX0A 2FFCA 1I8JA 3R6IA 3U2CA 3R43A 1HKVA 3I7SA 3E38A 1B3XA 4IUGA 1VD6A 2LGOA 2ISVA 4ACZA 3LSBA 4NAEB 2WVTA 2BZNA 1IT0A 2OEJA 4X0VA 3GVQA 4WDUA 2CZ5A 1YBQB 3L5LA 2E6YA 2IKJA 3GR8A 2YJQA 3C8NA 4K8HA 1AD4A 5FL1A 1L6FA 3GNPA 3GKAA 4HHMA 4LVFA 2OT1A 4ADSA 2D1ZA 4HJWA 2M2AA 4P8VA 4QRNA 3ES8A 3B0PA 3WF4A 4FLOA 4XUGA 4JQ3A 4MM1A 1K8YA 2YPIA 1NOFA 3M6YA 4MWAE 1FH9A 3BGGA 1ICQA 3S42A 3CK5A 2OCZA 2F9RA 3N9KA 3M43A 3T44A 5C7VA 1W8SA 3LGDA 1LF1A 4NI3A 1KLYA 4QSFA 1KRBC 3DBNA 3NI6A 1HKMA 3IVUA 1MEIA 1NDVA 4C6LA 4CQ8A 3WYZA 1TUFA 1MXGA 1H0GA 3H2MA 5CPNA 4LYPA 2EKGA 2FDSA 4MVAA 1PHWA 1UWUA 2VL4A 1R86A 4RZBA 1ZBCA 3VC5A 1MW2A 4L80A 5RUBA 3MBDA 2YOCA 3NM3A 3ATYA 1JL8A 3B0XA 3A9BA 3PJTA 2DP3A 3IJIA 4RDVA 1J01A 3O5GA 2GUYA 1HKJA 3V5CA 3M0HA 1XIHA 3SCWA 3C5QA 3W7RA 3GIPA 3FK4A 3DFYA 3PBGA 5HBFA 2R24A 1REQA 3MDWA 4DRIA 3NJ3A 3USZA 2P8BA 3OG2A 3E02A 2EPHA 3ZLGA 4Q8TA 2FZMA 2V3FA 3WDIA 1JQVA 2LKNA 5BXRA 2ZUMA 3CMGA 5HNTA 1JCTA 1E51A 4IFKA 1Z6KA 1BGAA 2UZ5A 2ZR4A 3N4EA 4IQJA 3RITA 4GVHA 4ZQPA 1EJRC 3WDQA 3DHFA 2C0HA 5K9XA 2C14A 1LBFA 1JCHB 3KL5A 1YDNA 4KQNA 3M7SA 3BK0A 4XTDA 1MQRA 2PDQA 5HWNA 1OINA 3NTPA 3W85A 3CV7A 1HT6A 1BYDA 3DFSA 5REQA 2ZUVA 1WB0A 1JXKA 1XYFA 4DRNA 1FQ0A 3UGRA 1CXHA 4QEHA 2YL6A 4NHVA 2ZX7A 2PTZA 4OBTA 3W84A 3B9NA 1EP1A 4L9XA 3AU2A 5AY7A 3BAXA 2A21A 1GYLA 1I2RA 5EFFA 5DMMA 2H3BA 2OZ0A 4R0XA 3C3UA 3BLPX 3T7VA 4Z2LA 4PUMA 5FSEC 1VB9A 5DX7A 4IIFA 1G67A 3CXOA 3GFZA 5D8ZA 3WQVA 1Y7VA 2P50A 4BWLA 4NF7A 3GDTA 2E9MA 2TYSA 5M1TA 1E5NA 4O53A 2BP1A 2VMFA 3C0JA 3O0KA 3IKGA 4ATLA 4B5SA 4HMCA 3TC7A 4OBRA 4BCEA 5BU9A 4WGXA 1QPOA 3DEQA 3TYDA 2QCDA 5D33A 3SCUA 2F21A 4S3CA 3APGA 4JFKA 5G4WA 2XFWA 2EPKX 4HTYA 1XLEA 1JNTA 3WEZA 1VFSA 1XX1A 1L6SA 4EIVA 3B9DA 3IV8A 4REQA 2OO6A 2A3BA 4HBEA 3VOFA 2XPAA 1PDYA 3RU8X 4HMDA 2P3ZA 2W92A 2CXGA 2PWHA 1V0NA 1HQTA 3VNZA 4DRKA 3QJAA 3FHAA 1FKKA 4LAOA 5CH9A 1PV8A 3SECA 1HXVA 2QAPA 1HO4A 3LCLA 4LU0A 3B8VA 4Z2GA 3R25A 4YS1A 1FWHC 1F3XA 2WZTA 5CKSA 1LG1A 1TV2A 2Z1SA 3B05A 2QR6A 5EFDA 1QNVA 6ALDA 4Y2WA 1ITUA 2XVKA 3CO4A 3WK2A 4UUIA 4MHBA 2OGYA 3GC4A 5EPDA 1V8EA 2ZA3A 1PZ3A 4TXEA 4Z1AA 1KFWA 4CD4A 1C9WA 4NX5A 4UFKA 3UY7A 3O6DA 3PR2A 4HMNA 4WY0B 3R4IA 2J66A 3PS7A 3RX3A 3DX5A 1IEQA 2GQ9A 2QCCA 3WNPA 2J24A 3SRFA 2RJGA 3KCJA 3NSXA 3OVGA 3ZR4A 3PBWA 3KCOA 3N18A 2ZWYA 3ZR6A 5BU6A 1JXJA 1JRCA 5CSUA 3QR1A 5CAKA 3APYA 1M7XA 1UPMB 2ZTKA 3PZQA 4FN2A 3TWBA 3ID7A 1TA3B 1JVWA 5LYRA 3W4RA 2I56A 4ZE4A 3W7MA 2WHJA 3GDBA 4RK8A 2INEA 1YE4A 2HMCA 3HMCA 4W8BA 3MYPA 3GTYX 1D2KA 3UXAA 3GVRA 1R2RA 3CZEA 4CVWA 3LNPA 1Z69A 1RR2A 1WPCA 1TWSA 1U5VA 4JTLA 3LUTA 1JYXA 1XXXA 4I9MA 3KADA 1JZ2A 2LLEA 1NQKA 4HZ8A 1ZSXA 3AOFA 1Y5VA 3STEA 1W8GA 2FFIA 3WF2A 4Z1YA 4B9ZA 3GVGA 2NSOA 2B7OA 4A35A 4IQEA 4MUPA 1LL7A 5A6SA 4GABA 1IQ8A 1I9CB 1UKOA 3AWOA 4PULA 1C9HA 1WDQA 5CG7A 1M6JA 3BSGA 3PAOA 4PMNA 1Y5WA 1VCGA 3GXNA 1DJWA 2A3CA 2JKAA 1PO9A 2MNRA 2YZRA 2VEFA 1O66A 4IPPA 2YB1A 1AQHA 1QR7A 2JALA 3BWWA 2EPMX 4ZS6A 3HV9A 3Q2DA 1UH2A 5DIUA 4YVVA 4DJFA 2D24A 3W9ZA 3RIKA 2NV2A 1DJIA 3TP4A 5EBAA 4W9PA 2CBJA 4P61A 4D8ZA 2VQTA 4H01A 3DFHA 2F6XA 1C8XA 2HBVA 3TW6A 3MKKA 3KCLA 4IXHA 3AICA 3LHTA 3MS8A 3IANA 4E2BA 3UG5A 5I3KA 8A3HA 4ZVJA 3FYOA 4QJ4B 3STCA 4JQAA 4HHHA 3SJ3A 2HE5A 1K4HA 3HM7A 3CHDA 2GVLA 3BW4A 3H24A 1X7FA 5AZ1A 9CGTA 2OQLA 2AQVA 4R34A 1TV7A 1PCWA 4NT0A 3O5QA 3KWSA 2F4EA 4HNCA 4OV4A 2Q02A 1Q65A 2J7HA 2BY0A 4A8LA 1LRQA 3CAVA 4EK7A 1L9WA 3FNDA 4IMFA 1TUXA 4TNSA 5AOUA 5DY3A 3K4WA 3MZ2A 3N17A 7PTDA 2PDHA 1E0XA 2CYGA 4MY9A 3THQA 4FOKA 1KTNA 4PGLA 1A5SA 3PUDA 3K4AA 4LS1A 1JZ7A 5CSSA 3QZ6A 4R33A 4B92A 3EY6A 1ONRA 3BG9A 1XRFA 3LUOA 3TJ4A 5ABGA 3V75A 4LCQA 5FJTA 1OD0A 3GVWA 4CQAA 4V1XA 5JH1A 1DWIM 4NUWA 3O5IA 3SGUA 4S3FA 1JZ3A 4IIGA 1AMKA 4LFYA 3NL6A 3BLEA 1KXVA 2RUQA 5G1YA 3NNTA 4ICNA 1VPYA 4MPKA 2XIJA 3H54A 4LUTA 9XIMA 5D03A 2PEVA 4I3GA 4PRTA 4QNWA 3VGHA 1FKJA 1ZNNA 4GUIA 2QGYA 3PNUA 1TV3A 4MSSA 5CSRA 2DUAA 3DENA 3EA3A 1GVFA 4JFLA 3UNTA 3V0SA 1TJ2A 1W3KA 3KXQA 3M44A 1XDMA 5LNUA 5HW8A 3VIFA 4E8GA 3E5BA 4BZYA 2OWCA 1AA1B 1ZJHA 3HN3A 1XLHA 2PV2A 1QK0A 5DO2A 4H6KA 3T1GA 3CJPA 1H41A 1E4LA 2JF7A 1V6XA 5D2VA 4ZA0A 1FXPA 1PYFA 3KAFA 3SAZA 4LRTA 5IBXA 2Q01A 1EYMA 2DGAA 4LB4A 4L6OA 5I3FA 4AD0A 4PR4A 2JEPA 1TWWA 3PUEA 3AIVA 2A6NA 4JHMA 3ZJ7A 1LLWA 1O5KA 2C1GA 3B0VC 3BDKA 1NOUA 3KHJA 4BA0A 3SCPA 5LIKX 3M5ZA 5DITA 4HZMA 4DH0A 3GTIA 3OHMB 1MZHA 1O6IA 1R3RA 4KGJA 3N6JA 5LIWX 4NJKA 2CERA 3PTDA 3G22A 2V5LA 3DC0A 1ZBWA 2XFFA 4TX6A 4ZSTA 1FFQA 3WH7A 3L66A 1RLDA 3NPWA 1MW1A 5HKGA 1GYMA 4IMEA 2VC9A 3ANUA 3NQ7A 3RPTA 1VS1A 2XWEA 1H63A 2Q8LA 1QFEA 3LHWA 5H8MA 3M0JA 6A3HA 2UY4A 3T08A 9RUBA 3K46A 3HOJA 5D9NA 3JYJA 2E6FA 3SCQA 3QGVA 4O0QA 1GHSA 3AISA 1SZEA 4PSPA 2XWDA 4JZ5A 1IV8A 3W53A 1G5AA 3UG3A 1R2SA 4OT7A 5E6ZA 3HQPA 1C93A 1LT8A 1I45A 3EKGA 4QFUA 5HULA 3WNKA 2IF4A 2D0FA 1ELSA 4R7OA 2RDUA 3B97A 1QBBA 4ONVA 4F2TA 1YMYA 1CENA 3O2LA 1V6YA 2F7FA 1DIOA 3LV5A 5I98A 1BKSA 1F8IA 4UMCA 3SGGA 3HG5A 1IXNA 4K37A 1EOKA 4J5NA 3F2BA 4QLKA 4BJHA 1GW9A 1SSDA 5KETA 3KOYA 1FHDA 1FWRA 3V4BA 4C60A 3PZUA 4TO8A 1TPC1 2V5DA 3LRMA 1S2VA 3RYSA 2YCKX 2YL8A 1UIOA 1Q6LA 4HD5A 1HW6A 3WNOA 1BGGA 3A4XA 4R88A 1A47A 4GY7A 2KX9A 3TUUA 4ZGYA 2P0OA 5K7JA 4H00A 1XYMA 5HW6A 4DWDA 3NZRA 5FCZA 3AYSA 1EB3A 1S5WA 1RPKA 1HJVA 2QUUA 3AMDA 2QCEA 2W66A 3MMTA 3TW9A 5I3DA 4Q8VA 4R7JA 1ME9A 5D09A 3GG7A 2EAWA 2I17A 3VM5A 3IVSA 3MJMA 1Q6HA 1QNOA 4DWSD 1G4PA 5E09A 4O1EA 1XR2A 4K8GA 4JIHA 1H61A 5JUVA 1E56A 3W24A 4LAYA 4WLCA 4DUVA 4A2SA 1IHIA 2QUNA 1KWKA 3GO2A 3NQ8A 4PMYA 2JFEX 3RMEA 3EA2A 2E9BA 2VFFA 2ZC1A 1QNRA 3JRKA 5G2WA 4L65A 4MMWA 1W9UA 5LNWA 2WMHA 2EBNA 2BSLA 3WK1A 2WZIA 3GHUA 1Q4NX 3AXKA 3KZSA 2I16A 4B2DA 3BUVA 5AN7A 3KTXA 2GQ3A 3T0DA 4EANA 2FQIA 1XRTA 1L8PA 4FOJA 1ME8A 2JF6A 4J27A 4BF7A 2YYUA 3NTYA 3TVAA 1J2WA 2D22A 4GIAA 5FD0A 1I0BA 2HS6A 3UZWA 1KBBA 4FEZA 4JOMA 4ZFCA 3IUDA 1UZDA 1JCLA 3ARVA 2A79A 1B3WA 2J8TA 4PCPA 1LBLA 1R0MA 4NL1A 1M53A 1H5VA 1KRMA 3KVKA 3S1WA 2WMFA 1B30A 2GUUA 2DH3A 4GD0A 1WP6A 5JBDA 1LM1A 2YFNA 3LPPA 4CD7A 2J7GA 4KIEA 2QJJA 1HKWA 1KR1A 5IRPA 2YKKA 2O56A 5J5DA 3KE0A 1F2JA 2XSBA 5BROA 4NJIA 1UWIA 4Z1BA 3SI9A 1U5JA 3OLDA 4HIBA 3TFXA 4ASTA 4DB7A 3KM8A 2VNCA 1ITQA 1PBGA 4B3LA 3AIRA 2QPUA 5CC6A 1IWAA 4N9DA 3SGZA 5I3GA 1HUVA 4Z17A 3MW7A 3H55A 1SO5A 3L7RA 5BCAA 2DJLA 3RR1A 3FAPA 3SSJA 1XP3A 1WKDA 1E9ZB 4QISA 1QPKA 1UUOA 5HOSA 4B9YA 4D6JA 1UKSA 4XAZA 3WO8A 2EULA 1JQXA 3KS6A 1VEOA 4BQ4A 4DXXA 1BF2A 4LBRA 5C0QA 2ZBTA 2ZZ4A 4ODQA 3WH0A 2LPVA 3ZVHA 1WO2A 1UH3A 6TIMA 4WCJA 4H8HA 1RJRA 3VGDA 1M41A 4Y9MA 1UROA 1TWIA 1TRDA 2XP4A 3IJQA 4PUNA 2YDRA 3S8HA 4ZFMA 1PCKA 5BYWA 3B06A 3TQPA 1AH4A 4DUWA 3VD7A 3WBEA 2CWNA 3VIMA 3PNZA 1SMAA 3QN3A 4RKAA 1OT1A 2H8ZA 4D71A 4O50A 2ZR6A 4O0KA 3W74A 3NQFA 4TR9A 4QT3A 4DJEC 2F2HA 2C79A 3CHVA 2R1KA 4HGXA 4OV9A 1JDCA 2WZMA 4YTRA 4DBUA 1CNVA 1I0DA 1O7AA 4IG2B 5FOOA 2QEZA 4LYQA 3HZ3A 3UU0A 4H9XA 1K9DA 4B4HA 1WNOA 4NJGA 3S1XA 2INFA 3B40A 2X1UA 1RD6A 3LLXA 1EZWA 5FJIA 3KZ7A 5F1UA 4BF9A 2QYGA 1NVMA 5SWUA 4GYPC 3W22A 3IUHA 1WBHA 4O1BA 4Q8UA 1F61A 1EPVA 3MQTA 5CCZA 5D4YA 3AS0A 4QSHA 1N55A 5DRIA 1W9DM 4ICMA 3IARA 2OYLA 3MUY1 1J9YA 1J0ZA 3S3GA 3RCNA 5EMUA 1GKRA 3T6CA 3IK4A 2V5JA 4E8DA 2EEXA 3CZJA 1LRNA 1R9YA 3LLDA 3BC9A 5EY5A 2W0UA 1KBLA 2PDYA 4FR1A 3C2EA 1K7FA 2V38A 1EZ2A 4INFA 1FWEC 3HBLA 5FJOA 4TTGA 2G95A 4LNYA 3WDHA 1Q13A 4UOZA 5A2BA 2OELA 1GT8A 1V08A 4FF7A 3T40A 1E1EA 4MTVA 2WC7A 1EGMA 3GDKA 5AHFA 1HXJA 3URQA 3WJZA 2J4GA 3MMWA 3HF3A 5KINA 1ONXA 3C2RA 4IUOA 2W6RA 2W62A 3TA9A 4EF8A 3B9OA 3W25A 1J10A 4QQUA 3ORWA 4UTJA 1H1NA 3VIKA 3ALGA 1J4IA 1XV8A 4LAWA 1WAUA 3R13A 1C7TA 3L68A 1LZOA 3KRBA 3MHGA 2DSWA 2E77A 1D7IA 5D75A 4HNVA 5A5WA 2EPNA 3KAIA 1R38A 5FJUA 2GJLA 5FAGA 1UA7A 4ICCX 3MHUA 4DF1A 2UWFA 4GYJA 3DKLA 3FVMA 2WJDA 3TZNA 4DBSA 1UJQA 3P80A 3HJZA 5GNZA 1FH8A 2PCQA 1J18A 4OHQA 4DM1A 3N3TA 3FCPA 1XSJA 2PC8A 1OIMA 7TIMA 3S5SA 3RHGA 3PZOA 1UYQA 2DSKA 4I7UA 3Q67A 4E8CA 2D2OA 2ATSA 1DP0A 4EXBA 3DECA 4Q4MA 2EXOA 3W28A 4XVEA 5TNVA 4C02B 4FLQA 2VRJA 3L4XA 4AXKA 4RPPA 3U2EA 3WQ5A 1SO6A 1JNEA 5AHMA 3TJXA 2WAGA 3W76A 1E70M 3TNBA 3W1XA 2VZVA 3W6MA 3AALA 3VNYA 4S1FA 2TPSA 3GFYA 1X6NA 3UPBA 5XIMA 5E9AA 3WUFA 1GEHA 2QCNA 2B5UB 3WQOA 4ODPA 4GY0A 1KM2A 4H9TA 2QMKA 5HQLA 5FF0A 1LG2A 1OGSA 4H7VA 5A6BA 4ZQNA 2CHOA 3LENA 2J13A 2DT1A 5BRBA 3WFLA 1GQKA 1SMDA 2XPBA 3L21A 1J8VA 4PCNA 2O7SA 4IQDA 3LXBA 1FKBA 2O9OA 1VLIA 4AZ5A 2A6LA 1Z44A 4JNZA 3QV6A 4S3BA 1ZCNA 3N12A 4LWWA 1X1NA 1T7LA 1A50A 5DCDA 2Y62A 4F79A 4GHRA 2W3ZA 3UYCA 4Q8PA 3AUOA 3CB3A 3AYTA 4BWLC 1TREA 1JJKA 3D3AA 3ABQA 4DWSB 3VYLA 3QOKA 3KBMA 5EMJA 3CWHA 3FDGA 1AK5A 3TA6A 1S2WA 2VUYA 3G18A 1XLBA 1CGXA 1Y0EA 3T0CA 4CU6A 3HV8A 4G1NA 3IIZA 4GX8A 3CV6A 5U4NA 3GUGA 4UOQA 1GCYA 4JIPA 2E7FA 3TLQA 2PWEA 2KO7A 1QI4A 1WXYA 3FJLA 5BRQA 3QV8A 4JTTA 3A5FA 1E1CB 4GIRA 5TQLA 4Z08A 3T4WA 1SQ7A 2ONEA 1R9XA 2YCLA 3I3DA 2OLSA 3AU6A 1XYLA 2FDMA 3ITLA 3TMLA 4EWND 4H8VA 2VR4A 3WD0A 1ZAIA 3ZM8A 4KEZA 3KHDA 2XGBA 2E8ZA 1JPKA 4TMCA 4ZTXA 4ZB5A 4PMDA 3RUBL 3HGSA 3B8SA 3CZLA 1Q8JA 3SUSA 3EWUA 3EX2A 5FIPA 5C2CA 5AYZA 1Q2SA 2CLFA 3I4KA 4JNMA 3S5ZA 3UR5A 3W2MA 5I00A 4FNSA 1A3WA 1HZYA 1JF6A 3BOFA 3LB0A 4C5ZA 3I7RA 1S1RA 1NWSA 4DRSA 2O55A 1FKSA 1OADA 3CH0A 5CZSA 4XBJA 1Q6GA 1B9BA 4C6OA 3CEPA 3VCNA 5I78A 1I2OA 1JRBA 1F3WA 1XM3A 3H26A 3W02A 1AQ0A 4DJFD 2WKJA 3TZFA 2ZX9A 3QY7A 4HPGA 4RZ5A 3ZT7A 3WH8A 1DQWA 1NWUA 4RR4A 1W1IE 1CLXA 4DO4A 1O5XA 4CU7A 5DXYA 3BLFA 1NP2A 1E3ZA 4M8UA 3QGKC 3IWPA 3JZUA 4KWWA 2TODA 4QT2A 1KT0A 3KL3A 1EDGA 1XWYA 4IIDA 1FWWA 1E43A 4B5XA 3SUWA 2HBXA 4XZMX 4XKMA 3UJ2A 3TOPA 1F74A 1OC7A 4NRSA 1FOBA 4GXMA 2BBFA 1FWBC 4ZO6A 2NXGA 3MWCA 1QATA 3CQ0A 4W7VA 3EDEA 4H2CA 3P74A 3DI1A 1FWIC 4DPPA 3S5YA 2ZRVA 1XS2A 1P43A 3UERA 4QEEA 2GOUA 3CL7A 4CN6A 1MW3A 1HJQA 1ZRQA 2D3NA 2G50A 7ODCA 1BSIA 3RLGA 4HK7A 1FWJC 3CWOX 2H9AA 3A12A 4GO9A 1Q6FA 4Q7BA 1V51A 3TIMA 4F48A 1XBZA 1OX6A 3TDFA 4TX0A 1RY0A 2Z1KA 1RV8A 1E0VA 2ACRA 1EUAA 4OE7A 3W1PA 4QHRA 2KE0A 3LV6A 4IM4A 2WMIA 4DBWA 2OLHA 3HG4A 1I60A 1J4EA 1BVZA 8XIMA 3AHZA 2XJ7A 4IIHA 2I5GA 2OFJA 4AD2A 1W1ZA 1B2YA 1GJWA 1UJPA 3LHZA 5A6JA 4A3RA 3F03K 2C8NA 4DI8A 4OBSA 1ECQA 3L4VA 1BYAA 3E96A 2X1SA 3SR7A 4DJFC 3AMCA 4AXNA 4DRHA 5I0DA 4LW7A 5IDZA 1B0IA 1BFNA 3UXIA 4C6IA 1E4IA 4AZIA 2NQZA 1A5OC 5DMNA 5ENLA 1S5MA 1YE6A 4XIMA 1A5AA 1DJHA 4MDPA 7ENLA 3L4YA 2ZQ0A 3AS3A 3RGCA 3BJSA 2ISSA 3WELA 8XIAA 3VINA 1C92A 2Z2UA 1F4HA 3QH2A 1UW9A 2G3NA 1VPQA 3R0UA 1UD5A 1Q6CA 2C18A 2F23A 4JX4A 5MHBA 4ROPA 3PPFA 4FZIA 3GH4A 5AYXA 1YPXA 5A6MA 2ZRUA 2QIWA 4WF7A 1AJ0A 1UQYA 3VD5A 4JN6A 1YNYA 3T2PA 1X1ZA 4UTTA 3THCA 3WQPA 1K70A 3CHEA 4FIRA 3GYCA 3KL0A 6CGTA 3AC0A 2RURA 3PZ9A 4IP5A 4US5A 1RALA 3UJSA 1EXPA 3T8LA 4M3PA 4G7EA 4Y9NA 5EMLA 5G4EA 1CGVA 2GZXA 1WYIA 2WHKA 3UJRA 3NEVA 1OX4B 3LK6A 1H2JA 1FWNA 5T9BG 3BMWA 2BVDA 4IT6A 4JKMA 1NELA 3RM4A 3DHDA 3HQOA 3KRSA 1NDYA 2GLKA 1EEPA 3SO7A 2AL2A 2IKHA 4XX6A 2WM1A 5LIXX 4YJ5A 1O95A 1ISVA 3KAHA 2WOQA 2PPOA 1GVEA 3WUEA 1H50A 2W63A 2AKZA 3F5KA 2W5FA 1G4EA 4IIBA 3EYPA 3GBDA 4GNKB 1UC4A 2HCVA 2J6XA 4UNKA 1AH3A 3A22A 4GJIA 1E73M 1P6CA 3H4XA 2HV5A 5TF0A 4W9TA 2OSXA 4XZIA 5IBXC 4F9DA 1J0KA 1QPQA 3OJGA 4Y8FA 4IPJA 3VVGA 1Z8AA 4C6NA 1XRVA 1UKPA 2F2KA 3L5MA 1HF6A 2ZXAA 3V1HA 3OVQA 2I9EA 2Z0IA 4A2RA 3M0LA 4B5TA 1UCWA 2PDFA 2Y2WA 5ABFB 1B1YA 4YWIA 1FWCC 1AG1O 4A3YA 2XVPA 4Q4QA 4JGDA 4DX3A 3VOIA 1ZAJA 4MZ8A 5AHEA 3AXIA 4GACA 1L2UA 1I2QA 1EQPA 2VWTA 4C7FA 4H8UA 2OYMA 5AC6A 3D3FA 1UZ1A 1FKXA 2PBGA 5MKGA 1L6GA 1EWEA 2FH8A 2ATMA 3NQ2A 3EWWA 4OU1A 1HJWA 2X7WA 5H2ZA 4NI8A 1UR3M 2PGRA 3DYMA 3ITYA 3VIGA 1P0BA 1AW2A 3W1LA 5AHIA 3Q58A 4B2DD 3DC8A 1IZJA 2GK1B 3VDAA 3LMYA 3N2CA 1IZCA 1W3TA 4QE5A 3TW7A 2OZTA 3WBYA 2HXTA 4IHCA 5K2ZA 4GUFA 4AB4A 4HSOA 1UP3A 3NYZA 3W07A 2XHYA 6ENLA 2G97A 4PTWA 1GOXA 5CPSA 3WL0A 1HG3A 2Y7EA 1ADOA 3VUSA 3BANA 1FX6A 2E67A 2RDXA 4FHAA 1KM3A 1WUEA 2XVGA 3GC2A 4PCTA 1MFVA 3LHYA 3LOTA 4GI9A 3ABOA 1FH7A 3O5FA 2C91A 5DN1A 2WW5A 5CAHA 3LCIA 1CGYA 5TAOA 4DVOA 2CZFA 1UMLA 2YA0A 1ESWA 1SPQA 3DGBA 3USBA 2A3EA 1LORA 4HA3A 1DJQA 3FJNA 4ZBCA 3MCOA 1PX3A 3IK2A 1L2QA 5C55A 3ZLFA 3OW1A 1DWGM 4N19A 1WZLA 3LCWA 3NQAA 2ZVIA 2B81A 1UQZA 5BXSA 1JYWA 1TTPA 5F4XA 1RJPA 3LHUA 2BGQA 2CLKA 3CUFA 4IJCA 4O4VA 2ZE0A 1UOKA 4PB3A 1PWLA 3UGVA 2ISWA 3M9YA 2CKSA 1M1BA 4KERA 4AIUA 3MY9A 4KQZA 2EJAA 1CGTA 3VZXA 1I1XA 2J7BA 5LGZA 4O19A 3RR4A 2NX3A 4Q8NA 2GVGA 4ML9A 4RZ6A 1BF6A 2I1OA 3SIMA 2R1MA 4XAPA 1KW1A 3LPGA 5LA2A 3N2MA 2OQHA 1XC6A 4ZSUA 1FCBA 3E74A 4IL0A 2DSZA 2KFWA 3OP2A 2NQ5A 4NRRA 1NU5A 1JFHA 3LTYA 4F4RA 3K30A 4MNLA 1QT1A 4LV4A 3UVAA 2OOGA 4GY1A 4AU0A 2BHUA 1SFTA 3NVTA 4MUZA 4F2BA 2GQAA 3S46A 3LM7A 4J3UA 3TONA 3VIPA 3SCOA 3TFCA 2ZR5A 2OX4A 3VOGA 3EEGA 3UXDA 3O63A 1EOMA 3GDRA 1IWPA 4DY1A 2W27A 2RAGA 2X1RA 3GYEA 3IIVA 1U2YA 3OYZA 4RE3A 1UBPC 4TOQA 1V0LA 4L6DA 5A8QA 1OFDA 3A21A 2CITA 3FVDA 1I1WA 2F6UA 3VMOA 4AHOA 2VEIA 5U7SA 2HJPA 3C61A 5LNRA 2DPEA 1LQ0A 3EOUA 1Q85A 1Q6OA 3G1FA 4UR9A 5HK4A 3H70A 5FESA 4PCSA 1IR2A 1JZ8A 3VDHA 3EWBX 2WO5A 4PMVA 4QG9A 3P67A 4D1IA 2VCCA 4UZSA 5JMUA 4RJEA 3BV7A 4ZPVR 4J3VA 3U5YA 4JFSA 1YADA 4OQVA 1PIIA 1LRTA 2Y4SA 3Q45A 2ABBA 2QLYA 3QMTA 3CUIA 3IK8A 2GWGA 5E1QA 3FA4A 3UWWA 5K4ZA 4L5ZA 4AAJA 2QDEA 3ITCA 1OC5A 1E5JA 1R7AA 5CJNA 2B7PA 3S83A 2WANA 4AF0A 1RBOB 5CC3A 4OJYA 3ZLHA 5CBBA 2PURA 5I03A 1L0PA 1SSGA 3SRKA 3NQ6A 4GI4A 4RE4A 4R9OA 1XDLA 4PTVA 2VC5A 3PK7A 1R9HA 1K8XA 3IGHX 4BK9A 4V27A 3VIHA 1V4YA 4DJDA 1KBJA 3KAGA 4HU3A 4HNLA 2PLCA 3NVDA 2VVNA 4KBXA 5D9OA 4KW2A 2OMAA 4GUHA 4HYRA 1ZU8A 3KEHA 2CLEA 4JYSA 5DLCA 3M4HA 1LOSA 3W23A 4LC8A 1PDZA 2Y5JA 1UR8A 4QIBA 4LY8A 2KAUC 1V3LA 5AKQA 4IX2A 2PTYA 3VKBA 1OCNA 3QHMA 3FLUA 4Y6GA 4B5WA 4V1YA 1X38A 4ZO9A 1UPPA 3BARA 4GH3A 4UZUA 4ORIA 1JCXA 1Q4WA 2ZADA 4R3UA 1TZ9A 2B7NA 1BKFA 5EU9A 2PD9A 3U0HA 3QKZA 3LG3A 4J3WA 2DVUA 3H2NA 3OVPA 5HNRA 3WLOA 2PF8A 3A3WA 4XKYB 3MP5A 3CPUA 2QJNA 3GM8A 1NM9A 4FK9A 4JEJA 4QNEA 2CWXA 3KDNA 1W31A 4J35A 4W7UA 2F2DA 4JYDA 4YVXA 3N9RA 1NFBA 4FPSA 1CECA 3IIPA 1DJGA 4EXQA 3GSMA 1US0A 4GK8A 3LERA 5EMKA 4U33A 1LCOA 3FGCB 1XIIA 1EO7A 3SUTA 3GXIA 1XCWA 4N4QA 2NQ9A 3LCXA 3PZMA 1XG3A 2QJMA 5BOEA 3W7OA 3TKFA 3I4EA 2OGJA 3U48A 5CEWA 1MZRA 1TQXA 1GVSA 1YXDA 3EB4A 4HJFA 1WDPA 4W87A 4BI5A 1HO1A 1TJPA 4KWUA 3WLSA 1U79A 4KEMA 2IPGA 1I2NA 1V5XA 2EGZA 3QRHA 3E2QA 5LHFA 1VH7A 4L4LA 1X1OA 2H3DA 1RZMA 1UR4A 4PEKA 2QF8A 4PTMA 4C1NB 1WXJA 3W7LA 4JDBA 3IUIA 5JIPA 3KP0A 1OFPA 1S39A 3PJUA 2QV5A 3UZXA 5JXQA 2DW7A 3O5OA 1HL2A 3VPLA 1F4AA 4MKNA 4O1FA 3P0WA 4O57A 1V02A 5H8PA 4PMQA 4XAFA 3TXZA 3UA4A 1TQJA 3OG3A 4C6KA 1Q7ZA 3CGTA 4DXKA 2CC0A 4C6BA 1C91A 3P62A 4LAMA 3NQVA 7XIMA 4JL1A 4HZ7A 4RCXA 4CQDA 1G69A 4C6DA 3UW6A 1CDGA 3HB9A 1MUWA 3RCYA 3TDBA 1W5OA 4F40A 3TR2A 1A5CA 1GOMA 4LBSA 5D30A 3TN4A 4IFRA 2PWUA 1O5QA 5HATA 3SY1A 4HQVA 5CZJA 1P7TB 3WDJA 1LLOA 2ZXQA 1NF0A 4JX5A 2PGFA 1KCLA 2FB3A 3GNXA 3NEHA 1P1XA 1ITCA 3VDGA 3TEVA 3OOBA 3A4JA 1T99A 2FPVA 2WVVA 2FYMA 2JZVA 3P5YA 3W72A 1A5NC 4NXKA 2PAJA 1TVNA 2Q5AA 2PDUA 1KM5A 4RV3A 1O1ZA 4YLWA 2E25A 2QPXA 2W61A 4TX8A 1L8NA 4JTFA 2FTPA 1BYBA 4AEOA 3G1DA 4UQEA 1QOXA 4QDMA 4EVZA 1YQ2A 1XIMA 5E0CA 4RUBA 1YTEA 1W17A 3ABZA 2ZX6A 3FAWA 2YW3A 1D7JA 1BVWA 1TPEA 1R3YA 3QBUA 1VFLA 4LUSB 1FTXA 3BO9A 1E1FA 1KM4A 3H21A 3GTFA 3AROA 3N4FA 4KS0A 4BEQA 1LL6A 4BF5A 3W71A 1E6XM 1E9IA 3CZGA 1TIWA 1ZJBA 3UI4A 2JK2A 4NAFA 5BOOA 1XYAA 2OKOA 3QV7A 3O8AA 3MZNA 3KUMA 1G4SA 3IJLA 1DV7A 3GS6A 2G4FA 5DY2A 4LGXA 1W6TA 4XUYA 4GVFA 2FZDA 4X61A 2PDJA 1C90A 1J5TA 3NPUA 3NFUA 4FXFA 3CHFA 3OTRA 4GIEA 4AISA 1NF7A 3W2NA 4P7RA 4ZR8A 1WQ5A 1FKGA 4GCAA 2AQOA 3BMBA 3ZSSA 3VX0A 5FL0A 1YNQA 4LCRA 5M2FX 4XG1A 2CNCA 2E1DA 3DH7A 1P0DA 2OG9A 3UNDA 4PMJA 4QROA 3RLVA 2YXGA 4AZGA 3FV9A 4H9MA 3B0YA 3NQMA 3T09A 2L5HA 1GVQA 3H7UA 4ZQMA 2Q8XA 1BG4A 4XWUA 1OK6A 1KKRA 2CXEA 4JFIA 3VI2A 1QTWA 3INPA 2JIWA 4RNJA 3UQNA 5A69A 1NDWA 2YCIX 2WCAA 3N4AA 4GH1A 4HCDA 1SJCA 1H7NA 5HUOA 2PTDA 3V0UA 4XQ6A 1S38A 4MB5A 5HUPA 1FWSA 1B90A 2KR7A 5HINA 1B31A 4TU1A 1M68A 2E40A 2OSYA 5HNUA 3RK8A 1A4MA 4U28A 3R8GA 2FHFA 2VUNA 3WQWA 5C2GA 4NKCA 4CEUC 2DORA 2G3FA 1V6TA 3NL2A 4MJZA 3A6OA 3TH6A 1JZ5A 4PUKA 2V69A 4JCLA 4B3KA 3G2GA 2FVMA 3L23A 2PI6A 3ZSTA 2DT3A 3VKJA 3V16A 3CUHA 4K39A 3QW4B 5FAJA 2QPSA 1EBHA 3K8LA 1TV4A 4Y96A 5HR7A 4E4FA 2VGBA 2ZQUA 4WY0F 1F07A 5CBIA 5A6LA 2R6OA 4GYKA 3HG3A 3DUGA 2PPGA 3QEZA 3VNIA 2D0GA 3M41A 2ZUWA 1N82A 2BHYA 4GQBA 2IXUA 3BLKA 4E2DA 2YDSA 2G5WA 4UQAA 5GPRA 3WLKX 4JTIA 1OFQA 3G77A 1K9TA 1DXIA 3CAWA 3M0YA 1V93A 3SW6A 1LUCA 4TVCA 2OWXA 5LHEA 4WRHA 4DM2A 3SRDA 3IJ9A 1BKHA 3IPWA 1H7PA 1BRLB 1V3HA 2XP8A 4GI6A 3U57A 1YW1A 3UQBA 1U83A 3W7DA 4JTRA 1TYGA 4NAEA 4MJMA 3AAMA 1DQUA 3CT2A 1Q63A 3DG6A 4EAMA 1CLVA 1CW2A 4G8TA 3E2RA 1VGAA 1YBQA 3FYYA 3GG0A 1BYCA 5CJMA 1ZJAA 4LVBA 3TX9A 5G4HC 3CGMA 1L6WA 1QO5A 1HJXA 1W1PA 4X9YA 3OO2A 1PBKA 1FWGC 4UQDA 5CGMA 2PU0A 5A8MA 2BX7A 1C8YA 3K1DA 4YTTA 2FGLA 2WHMA 2ZRZA 4CN4A 3AHVA 1R3WA 4MNJA 3OYXA 4GVGA 1E15A 4LYKA 3UI6A 2ZXDA 2DQXA 1UIPA 3NSNA 1KQYA 5DXXA 5FF2A 3P8JA 4CNTA 5BXJA 1YTDA 1EO5A 4JXCA 5HWMA 3U7VA 1BQCA 3WBXA 4WKFA 1CXFA 4JAWA 1BL4A 4O12A 3H12A 1JGIA 4EE9A 4JHZA 1GJUA 3G1HA 5ECVA 3GB6A 1KB3A 3LU2A 3VDCA 3PPHA 1T40A 3KDOA 2J27A 1XLAA 3BOLA 5B7ZA 1GEQA 2XIMA 3NRKA 2BOFX 3VC6A 3CQHA 2YBUA 4IL2A 4XD3A 1VBUA 3QMSA 3IAQA 4MB3A 3II1A 1PEZA 1SFLA 3KS5A 1VZWA 1V7AA 5CPQA 3U4AA 3OIXA 4L61A 4Z2JA 3E2SA 2EO7A 4HU8A 3WD1A 1H11A 2MANA 3LHVA 1OFEA 4CCEA 2HPIA 5HJLA 4JTDA 4GZJA 4W86A 4FR6A 2RSEA 4K8EA 3S2NA 4W8AA 4FSAA 4A6GA 5DANA 1JD7A 1W1A1 1TG7A 1AMYA 1ONEA 3T05A 3CQJA 3BOXA 1H7XA 1XCXA 4F3HA 4I9TA 2J75A 1IIHA 4CCZA 4ODKA 5F4SA 3W26A 1XGZA 5T8GA 3UXLA 2NV9A 3DYPA 3TC3A 3B04A 4G2DA 3TSDA 4LH8A 1RH9A 4MKSA 3W6YA 1BTMA 2FZNA 2Y7GA 4AZCB 1WDRA 4H6RA 3K13A 3V5FA 2E4TA 3ITGA 1JI1A 1KGUA 4GQQA 3G8EA 1AJZA 1PKYA 1P0EA 2H8XA 2NT1A 1TJRA 4GXPA 4KRZA 3ITTA 1BWVA 3UG8A 2VC6A 2W9MA 4MF4A 4KRUA 1J11A 2NQLA 2R14A 5A8OA 3UQAA 3W27A 1FJDA 4LRSA 1W3IA 3GH5A 3TTYA 2PLKA 1ZPTA 1XINA 1B4KA 1GQJA 3UWVA 1QW9A 2XIQA 3S6DA 3T4CA 1YX1A 2QW5A 1T96A 2FPTA 3AJXA 3KRZA 2VOTA 2OJPA 4S39A 4MB4A 5BWAA 2OEKA 4HCHA 3URNA 1N2VA 2WK2A 2V3DA 2VQUA 1UASA 2VZSA 4HN4A 5M03A 5DELA 2MLXA 1FUYA 2DEPA 1EJXC 1V3KA 4YTUA 1W91A 2X2YA 1UC5A 3W3OA 3O0FA 2FJKA 4S2BA 3TOYA 1MFUA 1JNSA 3PZTA 1UZHA 3ARQA 4YVPA 2FH6A 1IT8A 3UQIA 4AWSA 4AY7A 5LKYA 1Y0OA 2BDQA 4KPLA 3UZ5A 2HVNA 3E6EA 3GTNA 2P76A 3O06A 4TV6A 7A3HA 1C3FA 4MWAB 1W3JA 3C0QA 2FMNA 4I9AA 5I6SA 3PANA 2HK1A 4QGCA 4A4AA 2ZZ1A 1CGWA 4I9JA 2YCLB 1OCBA 1TB3A 3ANYA 5I79A 3GNOA 4KCUA 3KVJA 4MOZA 1JAEA 1WE5A 4YYCA 1A0DA 2PB1A 4S3AA 2ASHA 4FXJA 3T55A 2WJFA 3N04A 2WVSA 3AYRA 3VD3A 1B57A 1W9BM 1H7WA 4CCDA 3NWRA 2VCAA 1PVNA 4MY8A 3ARUA 2YCJA 2NVAA 4G56A 4NJHA 2WZHA 4XIAA 1R9ZA 2ZKMX 3Q37A 4M29A 1BXCA 2IQ0A 2YL9A 5E0FA 1DJYA 3QLLA 1XLKA 1K3UA 2BWGA 4JFVA 3MSGA 3FDKA 4YTQA 2N87A 4GISA 3L4TA 3APTA 4WY0A 2GWNA 1FKHA 2IUZA 4LBUA 3P5ZA 4O17A 2IS7A 2WMJA 1R5YA 2C71A 5K4XA 1QNSA 3FXYA 1PZ1A 3BH4A 3MUCA 4BQ5A 1EJWC 2R1PA 3MMUA 3KBSA 1ZK6A 2FAPA 3PR9A 4AZ6A 2OR2A 2WHLA 1TFVA 1JG9A 4R53A 1SFJA 3BW3A 4Q22A 5D8WA 2WJEA 3PUGA 4NILA 3WQFA 4RZ4A 4BFAA 4JBRA 1XG4A 2Y7FA 1WZMA 3T8QA 1TA3A 2Y5SA 3THDA 3EA1A 2WC3A 3JR2A 4C1LA 4HNNA 1US2A 1KXHA 3IIOA 1V3IA 3S0CA 4PA8A 1GOWA 4PMRA 2NUWA 1YW5A 4JCMA 4UFMA 1KGWA 3ARXA 2BNJA 4LV9A 3T0AA 4D6EA 3AJ7A 4XBKA 3ZIZA 4K68A 3N9SA 1T6MA 3L4UA 3GW3A 5BXPA 1OYAA 4KWOA 3D0CA 1PE1A 3M0ZA 2VD8A 3QR0A 3UWZA 5HNNA 1M7OA 2A3HA 3VILA 2HVMA 3QC0A 3M47A 3UF8A 4M5PA 5BNKA 2HNEA 2OOFA 3H2FA 5JH8A 1HL8A 1XDJA 4UFLA 4WGHA 3HQNA 1LL4A 2DY3A 2XN2A 3V36A 4HT3A 2Z6IA 4ODLA 4LC6A 4BI6A 1T8QA 1SGJA 1QCWA 2GUBA 4LNCA 4V2XA 3WEOA 2ALRA 4O11A 2D20A 2YA2A 1PWMA 4X2RA 1CXKA 2WMGA 1E71M 1FCUA 4JN7A 1FKDA 1WBJA 3EDDA 6REQB 3WK3A 3M7WA 2PP1A 3MI2A 3DYOA 3G1AA 3M0XA 4LUYA 3JXVA 3PAJA 1KT1A 3G3DA 3HTWA 4B4FA 1XLIA 3AHTA 4UCGA 4QDWA 1PKNA 4DHGA 3U5UA 1R85A 3IEBA 2XISA 3CAKA 3HFTA 4ODNA 1JULA 5HQEA 3U2OA 1MMFA 1AFSA 1ITXA 4JTAA 3KOFA 3ZJ6A 4CKQA 3G1SA 1BTCA 4ZE5A 2Z2AA 3GDMA 2DT0A 3GWQA 5M3WA 3AIEA 1JEZA 3H53A 1LTDA 4JIEA 2BOEX 3UCCA 3GK0A 7REQB 2QJIA 1WA3A 1XISA 2X0HA 2EPOA 2J79A 3WENA 1PTDA 2AAAA 1ISYA 1QW8A 3UD6A 3SADA 4UR8A 3N73A 1QNPA 2OZ8A 3QQWA 3BQ5A 2XIIA 4O8AA 3TYCA 2G37A 1PZ2A 4HPHA 2XP9A 1CB7B 5LA1A 4TVDA 4KFNA 1XIJA 1RA0A 1F6KA 2FGBA 2PF0A 3TYZA 2J62A 2B0MA 2QCLA 2JEQA 4G5DA 2WWDA 3UXKA 3GU1A 4GO8A 3V0TA 1JDAA 4S23A 3T2QA 1GOOA 1GTHA 2VTFA 3FIGA 4JS3A 1EWDA 4ADTA 5HJYA 3TK