1GUVA

Structure of human chitotriosidase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
364
structure length
361
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRSGAAASLNVDAAVQQWLEKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Chitotriosidase - Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 121
structure length 361
sequence length 364
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1guvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1guvA01
1LL4A 2BHZA 4N0RA 1XRVA 5I79A 5ECUA 1CDGA 2DDXA 1UKPA 1MW3A 1VIWA 3BGAA 3W27A 3EYPA 1R86A 4B3KA 4KH2A 4WKFA 3VGGA 2VX4A 2VQTA 2J7DA 2WMJA 3GNOA 3OGSA 1QI5A 2W4XA 1R85A 2E40A 2D3LA 3VDCA 5D4YA 1ZBCA 3WSUA 5CGMA 2IXVA 2UY5A 2CPUA 4AZBA 5D9NA 3W29A 3CHDA 2PWGA 2V38A 4TOQA 4D72A 1CNVA 4AY1A 3GH4A 1D7FA 1UWTA 2GJPA 3WL0A 2O92A 5A6MA 2J8FA 5GNXA 1CLVA 4MNKA 1QPKA 2YLLA 3K4AA 4U31A 4FLSA 5E09A 4B9ZA 3G6LA 1E56A 2PC8A 2D24A 2OYLA 6TAAA 1BGGA 2WC7A 2VURA 3II1A 1JF5A 4A3YA 2E0PA 3GNRA 1QNPA 2VJXA 4HPHA 1S46A 3IJ8A 1J01A 5M3WA 3WEZA 1I75A 1W1VA 3ALFA 1OBAA 1UHVA 2EPMX 2FDMA 1QNOA 4CKQA 1EOMA 1V6YA 1E1EA 1UR0A 2V3FA 2CERA 5C71A 1XSKA 4CD8A 3SEPA 5A3HA 4IPNB 3ARYA 2VR4A 1SMAA 4FLRA 4M80A 1DWHM 4KWUA 1HP4A 4V27A 1JD9A 1N82A 1CWYA 3EDKA 1E6NA 2VL4A 4A4AA 5EB8A 4AZ7A 4Z2KA 1GOWA 1XYZA 2WVVB 2GK1A 1CXKA 1P6WA 4BF7A 3CZKA 3WD2A 1JYXA 3MS8A 1JZ2A 3WF1A 3G6MA 2J7FA 1BVNP 1H41A 4W5UA 2BNJA 2ZWYA 2QV4A 1QI4A 1JG9A 1AQHA 2XM2A 3MUIA 4AD4A 3VGHA 2W61A 1KB3A 4PCTA 1E3ZA 4AWEA 4MB5A 3FAXA 2WM0A 2EEXA 3A3HA 1XV8A 5BWFA 3MMWA 1G1YA 4M8UA 4HP5A 1E6ZA 3I3BA 4UZUA 4P8WA 1OIMA 4CU8A 2XVNA 2X1IA 3ECQA 2W5FA 4D6CA 3DYMA 3QGVA 1JXKA 3S6TA 2BFGA 3NDYA 3B8SA 3T0AA 1AQMA 3AXXA 4CD5A 1SFSA 1E0VA 1UR2A 1E72M 1V02E 1EDQA 4XV0A 1FA2A 2C7FA 3HMCA 3K8KA 3PTKA 3UG3A 4ZXLA 1D3CA 2VUYA 3FW6A 3D5HA 4MDOA 3ZR6A 1B3ZA 4QFUA 1BFNA 1DTUA 1M03A 1NP0A 1EIBA 3B9EA 1J0YA 4AD2A 2DT3A 2XFYA 3CUGA 3AS3A 3AIVA 2ESCA 1UD8A 5LYRA 3N13A 4J28A 4CCDA 2WBGA 3WDHA 3KE0A 3GXDA 5D8WA 1UD6A 4X0VA 2WXDM 3EMZA 1IV8A 2OSWA 4MNMA 3CLWA 2YA0A 4W93A 2NT0A 5IFPA 5HOSA 1VJZA 2WHKA 1WE5A 2A3CA 3WDRA 4U2YA 5BXTA 3IAPA 1BGAA 1GCYA 2DSZA 3KL0A 4TUFA 2PBOA 1U30A 3SCWA 3VM7A 1CGWA 1J10A 1EO7A 5HPCA 4UQEA 5EFDA 3PZVA 2PWDA 3BAWA 1MQPA 3OLDA 1PX8A 3VD4A 4WJXA 5JBEA 3PZTA 3L4YA 2JE8A 4PSPA 4J3SA 3AHYA 2D23A 1G9HA 2JIEA 4PYSA 3WQVA 4AZHA 1KR0A 3UCQA 4H7VA 3GH5A 4R5EA 2HVMA 4PTXA 4H2CA 1TZ7A 4NSBA 4ATLA 4ATWA 4LXFA 2FH8A 2Q8XA 1CGUA 3VDBA 2QPUA 3SUWA 2J7HA 2VX6A 1GVIA 2J7BA 4RE2A 4UOZA 4XZWA 1E73M 1H49A 5ABFA 2G8ZA 4PMRA 5JH8A 4D6IA 3L4XA 2CBVA 3WNNA 1QNRA 3AQUA 2DSVA 1EH9A 1JL8A 4TX6A 4Q7NA 3AHTA 4FMVA 3W26A 3WD3A 3AXIA 1L0PA 1VFMA 2A3HA 2VZUA 3MV11 3OB8A 3CHEA 3SURA 4JCMA 1WDPA 2ZUVA 1E15A 3DYPA 3UERA 1W9PA 1VB9A 3CUJA 2WBKA 1LG2A 2O9OA 4GZIA 4UQDA 2VZSA 5DEZA 5AYBA 4OZOA 1JAKA 2FHCA 2W63A 1UKSA 1W3KA 1V6UA 4HTYA 3EDJA 4JKMA 1ISXA 4CN4A 1Q6EA 3AISA 1PX3A 4PN2A 1C92A 1W1YA 1ITCA 4DWSA 1V3MA 3CUIA 4PMDA 4F9JA 3QOKA 3CH9A 4ZEPA 1NP2A 4DWSB 1EO5A 4PTVA 1EGZA 3CMJA 4CD4A 3AIUA 5DO8A 1UD5A 5A1AA 3T2QA 1V3HA 3BAJA 1XSIA 2XTKA 1LLOA 2VZOA 4OJYA 1DP0A 3VX0A 2GDUA 5F7UA 2YL9A 2YBTA 1US3A 1B1YA 3EDFA 3SCRA 2WHMA 1TR1A 2ZX9A 2XG9A 1DEDA 1WZKA 4KGLA 1J18A 3AFBA 1HKKA 1QNSA 4HMDA 4J3TA 3KL3A 2FH6A 4W8LA 4UZSA 2DGAA 4B9YA 1Y7VA 2WSKA 3AZTA 2J7EA 1WO2A 1RP8A 2O9TA 1XH2A 3ZT7A 2VRQA 1UWSA 4ZE4A 1QNQA 4DWSC 3GXFA 5A2CA 1QBAA 3EDEA 1B3WA 3WQ4A 4EK7A 5IFTA 1UUQA 4QCFA 1TVPA 4ACZA 3VNZA 4AC1X 1NARA 3HJEA 2RGMA 3BAIA 5ABEA 4PUEA 4D6GA 3PZGA 4HZ6A 2O9PA 2VMFA 4JHOA 3PHAA 1IZJA 1B2YA 1KXTA 5FL1A 2Y4SA 4AZIA 5CSUA 5GNYA 2CEQA 4ZENA 1JIBA 1UD2A 2JIWA 3EBVA 1CGXA 3ZJ6A 3MKKA 3W4RA 1H1NA 1XSJA 2Z1SA 3CHFA 3E1F1 2NT1A 1CENA 3SUVA 5DT5A 4AXNA 5I5RA 2F61A 3WH8A 5KEZA 2WMIB 5JUVA 4WLCA 1KGUA 3WMCA 4ML4A 1OWQA 1WDSA 1VF8A 2G4FA 4RL3A 4TTUA 1B3XA 1H3GA 3PN8A 1W32A 4LYRA 4LYPA 4C7GA 1M04A 1DHKA 3QR3A 3AJ7A 4HA3A 1H09A 5JBFA 2BVDA 1CIUA 3GM8A 2EJ1A 2OWWA 1C7SA 4P7QA 3WIJA 4GPNA 4OOZA 4M29A 1QBBA 3SCSA 4MADA 2GJXB 3WH7A 2ZE0A 4AMCA 2WB5A 3VIMA 2YL8A 3VMPA 2BHUA 5M5DA 3GTNA 2D2OA 1CBGA 3MSGA 2YBUA 1JYWA 1Q6DA 1LF1A 3W37A 4UCFA 3VD7A 3UEQA 2AOSA 2DT0A 3VM5A 5LA0A 1KXQA 5A95A 1CLXA 2D0HA 1OM0A 5A94A 4QDMA 1QHOA 4CCCA 2J74A 2PI6A 4CVWA 4JIEA 1GJUA 3M07A 2GDVA 1TE1A 2X0YA 3PTMA 3TTYA 1HJSA 2ZX6A 2WC3A 1G0CA 4FLQA 4QAWA 5D9MA 3NDZA 3VGDA 3ZOAA 1QHPA 1NM9A 5A6BA 2EPOA 3UESA 1SR0A 2YA1A 3FHQA 2Z1KA 2VVSA 1GOQA 3ARWA 4H04A 3VGFA 1LWJA 4IISA 1SMDA 1R7OA 5C70A 2WMGA 4M1RA 3SCVA 1EDTA 4DUXA 2WMIA 1TA3A 1UA3A 2E3ZA 1XYFA 4F66A 5E6YA 3SCPA 5GPRA 2WHJA 4PMOA 5A6LA 1KR1A 1TG7A 1CYGA 3WMSA 2WZHA 4NRSA 1IT0A 1Z32X 4P8VA 1BLIA 1BTCA 4BQ2A 4UOQA 3WH5A 1MYRA 3WD4A 3W28A 5HBFA 2UY4A 2YL5A 3EMCA 2EBNA 3K46A 2F8QA 3MUAA 1MQQA 2CITA 3N1AA 3WNOA 3WL1A 1VFOA 2XIIA 1QI2A 4E8DA 2QF8A 2GSJA 2YDSA 1OINA 3AIQA 1W9XA 1W3JA 2EQDA 3K8LA 5M17A 3WH6A 2BHYA 1UKOA 3L2MA 2F2HA 4JHZA 3A4XA 4YPJA 2XYLA 4WIWA 1H0GA 4WSKA 1GJWA 4URIA 2ZXBA 2O9RA 1L8NA 3HN3A 3KL5A 1MFUA 3U7VA 9CGTA 1NWSA 1HKIA 4J3XA 4IM4A 4CU6A 2WLYA 3PZIA 3MO4A 4JAWA 4GI9A 3DHUA 3FN9A 4MB4A 4GO8A 3PZQA 4M24A 3WEOA 5A6KA 3W38A 1V6XA 3L4WA 4PEEA 1JD7A 1W1PA 1HJWA 3MMUA 5CLWA 1U2YA 5CSYA 1HP5A 3AMDA 4TX8A 1BAGA 4GKLA 4X0NA 1B30A 1CXEA 1M7XA 3OGVA 4JFTA 7A3HA 2J47A 1BG4A 4UFIA 4CVUA 5CPSA 3TTSA 3MSDA 2GVYA 2W67A 1TVNA 1O7AA 1B90A 3CIVA 1XCWA 1PZ3A 2WSPA 3ZQ9A 1JZ6A 2V5CA 3DHPA 3CMGA 4UFKA 3VKKA 1E1FA 3RJYA 1E71M 3IK2A 4KRTA 5DT7A 2QHAA 5ABFB 3I3EA 4YHGA 1DWIM 3RILA 4GO9A 5BROA 3AHZA 3K1DA 1WDQA 4DUWA 3ALGA 3KEHA 4PCSA 4MNJA 1MW2A 1XD0A 1QVBA 3TA9A 2J25A 5AC4A 2QMKA 1JZ4A 1V0MA 3W53A 3DYOA 4XUYA 5CG0A 4Y7EA 3W6LA 1OGGA 2PB1A 2WKLA 1J0KA 1UWUA 1UWIA 3N15A 3ARVA 3WEMA 2G41A 2CKRA 3AIBA 1EA9C 5E6ZA 2ZX5A 3IAQA 1PIGA 4TVDA 2BY1A 4JZ5A 1R7AA 3D3AA 2CHOA 1TUXA 1UH3A 3LPGA 3ZMRA 1TFVA 3CGTA 2E8ZA 3RIKA 2VOTA 1GUVA 1ZBKA 1EOKA 5CQ1A 2OYKA 2XSAA 2D3NA 4HA4A 4WF7A 1AVAA 1GQKA 3VNYA 3WFZA 5CPTA 2XJ7A 4PMUA 1ZJAA 3RDKA 2CBJA 3WNLA 4W88A 3ARRA 1GQLA 1KBBA 1PJ9A 5A6SA 1GONA 2VZVA 4M56A 3B9AA 4P8UA 1NOUA 2WCAA 1MWOA 4NRRA 1UR9A 4JL1A 3RJXA 1HT6A 1UR1A 1CTNA 1BSIA 2WYSA 1CXHA 1CEOA 2ZICA 3EMQA 1W3LA 3VIJA 1ZU8A 4LYQA 1J0IA 2E9MA 3UG4A 2XVGA 3SUTA 1LL7A 3WENA 1BPLB 3WUEA 3ARXA 1VEPA 3IJ7A 1GQIA 1V3JA 2JFEX 1KXHA 4PMVA 3MU7A 1HJVA 5I23A 2YDQA 1WPCA 1MXGA 4HZ8A 2J8GA 1E5JA 3GYCA 5I6SA 3F5JA 4P7RA 2XWEA 4EKJA 2XVPA 1LG1A 3WQ8A 1HJQA 3A4AA 1GOOA 5I24A 2VVNA 1TA3B 3GBDA 3TONA 1EQCA 4AW7A 4J3UA 1V0NA 1VBRA 4UFHA 1HL8A 4NZCA 3KZSA 1OGBA 3U7BA 3K4DA 4W86A 3SUSA 1EQPA 4AD3A 1QOXA 1FH9A 3VX1A 3KWXA 4QCEA 2BY0A 2GUYA 4D1JA 1E3XA 5E9AA 1KCKA 1WZLA 3NUKA 3ARTA 4GQRA 4CGTA 3B9DA 3FY1A 3ZJ7A 2YKKA 1JI1A 5I2UA 1RH9A 1H0IA 1JDAA 4PUDA 1KWGA 1OGSA 1MVYA 1RP9A 2Y5EA 4H8HA 5CPQA 3ZSSA 4JFUA 4UFLA 2GK1B 4AD0A 3OIHA 1WB0A 4J27A 1E70M 1OB0A 2FGZA 3WBEA 5HDRA 3BMVA 1B0IA 3LPPA 3WDJA 3FXYA 3MUY1 2WC4A 1C7TA 3APGA 3OBAA 4OKDA 3BCDA 1XD1A 1JFXA 3M46A 4J3VA 2WW5A 2VNCA 5AC5A 2CKSA 1FHDA 1HXJA 2WHLA 2DH2A 3AICA 4OBSA 4MJ4A 4YHEA 1HF6A 4HMEA 1E9LA 4V2XA 3N04A 1MW1A 1PZ2A 1UWQA 3BCFA 5DFAA 1C8QA 1CXFA 3T2OA 4MB1A 1JDDA 1CXLA 3UETA 3WUGA 4MB3A 3CO4A 2BY2A 1R87A 1JZ8A 2WPGA 2X0HA 2VX7A 4U5KA 4UFMA 4DUVA 1CPUA 3WNPA 1PAMA 1KFWA 1FP8A 3WBAA 4BCEA 4WKAA 5A6AA 5IXEA 2DSUA 2WLZA 1V03A 2BXZA 3VIKA 3AS2A 4AYSA 3AS0A 1UG6A 4IPLA 3AS1A 1KGXA 2WWCA 1BF2A 1XHGA 2VQUA 4B16A 1M53A 2D20A 3QHOA 1OD0A 3LPOA 1U33A 4Z2LA 2J78A 3WDIA 2CBUA 2VT0A 4CD7A 4A3HA 1BYDA 1C8XA 1FH7A 3THCA 1NWRA 3AMCA 4UFJA 1KWKA 1MFVA 1ISWA 3VGEA 2ZUSA 2WVUA 7TAAA 3W6MA 4TTGA 1W9VA 1JYVA 3MUZ1 3PZ9A 4JFVA 5IHRA 1NWTA 3VGBA 3JUGA 2X2YA 3F5KA 3VDAA 1H11A 1K9EA 3L4TA 4UQCA 2E8YA 1JI2A 3O6AA 5A8OA 1ISZA 3TP4A 4HU8A 3ZIZA 1X1NA 4P7OA 4AZCB 1HJXA 5C8BB 2G3NA 4FK9A 5A8MA 1E4IA 3O9NA 5GNZA 4MDPA 1JYNA 2UWFA 3AMGA 2XUCA 3L2LA 3OLEA 3AHXA 2XFFA 6CGTA 5ABGA 4Q22A 5FIPA 4GZJA 1E43A 3U5UA 1WKYA 4X9YA 3A47A 4CCEA 1B3VA 2J77A 1J9YA 3UR8A 3AZSA 1VEOA 2WKGA 2Y24A 4C7FA 4S3KA 3BSHA 5D9OA 4W5ZA 4U3AA 2WWDA 1EDGA 1ZBWA 4EE9A 2VRJA 3BC9A 1GZJA 5IDIA 5I78A 2DSKA 5TD4A 2WAGA 5BYWA 3SCQA 3OGRA 3RO8A 2OLHA 2EO7A 3VDHA 4LGXA 1GPFA 1UR4A 2ZIDA 2VZTA 2CYGA 1HL9A 2NW0A 3ZJKA 2YL6A 4UQAA 3UR7A 2CXGA 2W62A 3VMOA 2DT2A 3BLPX 3VIGA 1KBKA 2XIBA 4KRUA 4P7NA 1W91A 4HPGA 3AMLA 3ZSTA 4PTMA 1VAHA 4MPKA 1JDCA 5BCAA 1B9ZA 4AZ6A 3WF2A 4B15A 3POHA 1JXJA 4U3CA 4J3WA 3AIEA 4UNIA 2VRKA 4ACYA 3K8MA 1E6XM 2WVSA 2JALA 4MJ2A 4WK9A 1V02A 4CN1A 1UH2A 5IHSA 1NOWA 3PZMA 1G01A 1UKQA 2GFTA 4E4PA 4GXPA 2IUZA 1VENA 2E9LA 2V3EA 2DEPA 5E0FA 4C7DA 4E8CA 1WP6A 4HMCA 5CZKA 2A3AA 4WSJA 5FCZA 4W89A 3FNDA 2V5DA 1VFUA 2PWEA 5I77A 1JZ7A 3N18A 1UYQA 2VCCA 5CXPA 2VO5A 4PMQA 3ARZA 1ZB5A 5I3DA 1NWUA 4MNLA 1AMYA 4R27A 3CZLA 1HKMA 4E2OA 2D1ZA 3WQ6A 2CESA 1X6NA 2YJQA 1ESWA 3VINA 3NSMA 3WELA 3FHAA 4D6EA 3CHCA 1OD8A 1UA7A 2YA2A 5BXSA 3WNKA 4BQ5A 1DWJM 2PBGA 2QPSA 4L4PA 3ZT5A 1NQ6A 4PBGA 3WDPP 4KGJA 5HNNA 4P8XA 2XVKA 3TOPA 2VCBA 2VR5A 4CN6A 3WH9A 3OLGA 1VJSA 4PMYA 3OA5A 8A3HA 1RPKA 4W84A 4AIEA 3GH7A 1VEMA 1V3LA 3VOCA 1NOFA 5AYIA 2BXYA 2V3GA 5I0DA 3WN6A 1YHTA 4OBRA 4D1IA 4AIOA 1LWHA 1VBUA 3N11A 1UQYA 1C3FA 1E55A 3WFLA 1E40A 2ZUNA 1KCLA 1ODUA 1KGWA 3VMNA 2CCRA 1X6LA 1UD4A 4IUGA 3ARUA 5BXPA 3BAKA 3AI0A 1UKTA 1US2A 3NSNA 3SUUA 1JNDA 1GW1A 4PTWA 1QW9A 3OZPA 4EANA 3VIHA 2OWXA 5AY7A 1V3KA 4UQ9A 3WMBA 1NH6A 1PEZA 1JFHA 1H4PA 5A6BD 4Z2JA 4W8AA 1JGIA 3AIRA 2Y2WA 4PMNA 2BS9A 1OCQA 3I3DA 2CNCA 1R8LA 3GXIA 1KXVA 2DIJA 1E4MM 2HISA 2IXUA 2WMKA 3QOMA 2J4GA 2YIHA 3ZO9A 4U2ZA 1CGVA 4N42A 3NCOA 1PX4A 2CHNA 3HU7A 4GQQA 5A6JA 1DWAM 3CZJA 3ZJ8A 3AZRA 2FHFA 3VD3A 5A8PA 1V0KA 3BXWA 1UH4A 3IJ9A 3WQWA 2VTFA 2ZXAA 2CIPA 1ZJBA 2ZXQA 5D9PA 4LQ1A 3SIMA 2EPKX 1MQRA 3N17A 1I1WA 3U57A 2X8RA 4D6DA 1XCXA 2J62A 3ZM8A 4TVCA 2Y8KA 2WANA 1UQZA 2XWDA 5FD0A 1UD3A 5FOOA 1OT1A 3PZUA 3LMYA 1C8YA 3GZAA 4YN5A 1JNEA 1GHRA 3ZT6A 3L4UA 1JAEA 1ZS2A 3VPLA 3OG2A 1ZL1A 1SYTA 5E70A 3VTRA 1V08A 3CBWA 3RM9A 1DWFM 1AQ0A 1H5VA 2D0GA 5M03A 1UR8A 4MAZA 3CZGA 4UOJA 2EXOA 1UZ1A 3F5LA 1QI3A 4H8VA 4W87A 5LA1A 3RM8A 4L4OA 1I1XA 4M81A 4UTFA 3WKZA 1XH1A 2EPNA 2PWHA 1J11A 2QMJA 2WMHA 3CTTA 5CLTA 3WUFA 1D2KA 4CD6A 1GOMA 4F79A 6A3HA 4AZCA 1J12A 5KZ6A 1CZ1A 3IANA 3VVGA 3L4ZA 1J0JA 2VI0A 2ZUMA 4MTVA 2J7GA 4JKKA 5CGTA 2G3MA 5BRPA 1VFFA 1PIFA 1ISVA 4J7RA 1E6RA 3NYDA 4Z2GA 3PTQA 2A3EA 1JZ5A 1MXDA 4AD1A 5CJ5A 3GBEA 2YDRA 2W92A 1OIFA 1Q6CA 3WF0A 4UQBA 4AZ5A 3AROA 5EBAA 2WCSA 1ISYA 2OYMA 4ATDA 3U5YA 1YQ2A 4AZGA 4HOZA 2X05A 3BAXA 2W66A 3N9KA 4DWSD 2WVTA 3AYSA 5ABHA 4W8BA 4HOWA 1ECEA 3WUBA 4WKHA 3GNPA 1IZKA 3WD1A 2QLYA 5A8NA 4H8UA 5JIWA 4QLJA 1FH8A 1K9DA 4BZYA 2AAAA 3A6OA 4GZEA 1XC6A 4Z2HA 4JKLA 2C0HA 1V6VA 5FL0A 4TXEA 5EFFA 2XHYA 1J0ZA 1W9BM 2XSBA 2BV9A 3W81A 2X09A 2JF7A 5DF0A 1GOIA 1OT2A 3WY1A 3VIIA 2XPKA 5BRQA 1QW8A 4OOUA 3WF3A 1CGTA 1PPIA 2XM1A 4NI3A 3LPFA 3WD0A 1W2VA 4JFSA 4BS0A 1LQ0A 4W7WA 4K68A 5FKYA 4AISA 1BG9A 3WF4A 2VX5A 2GJRA 2VC9A 3PZNA 2Y8VA 2ZX7A 2XFRA 3AOFA 4UR9A 1Q6GA 3AXHA 3NSXA 4NF7A 4GINA 3RM4A 2D0FA 2XVLA 3M6DA 3UG5A 1K9TA 3PBGA 4LX4A 2WCGA 2FHBA 4FF5A 1W9DM 3M7SA 2UY3A 4W85A 1GHSA 2ZUUA 3AYRA 4W7UA 1XGZA 3A4WA 1CGYA 5LA2A 2WZEA 3RPMA 4GI6A 1RD6A 3F4VA 1A47A 2PF0A 4P7LA 1LL6A 2DPEA 3W25A 4HOXA 3T0BA 2JF6A 5EMYA 4PMXA 3T09A 2NSXA 3VD9A 2XGIA 3GDBA 3PZOA 3VILA 2WK2A 2V3DA 3VD5A 1E0XA 1GVYA 2E9BA 1QHZA 4V28A 4F8XA 1WCGA 2G3JA 4ZE5A 4D71A 1WDRA 3VUPA 3TTOA 1HVQA 4F9DA 3BAYA 5HPOA 4GI8A 4XZBA 3WQ5A 1BYCA 3SCNA 4XX6A 1BYAA 1WZAA 2D22A 3CUHA 3DECA 3SCUA 3ZR5A 2BVYA 3NIYA 1B31A 1HJUA 1E6SM 3FAWA 3AMKA 3NJ3A 1F4AA 2TAAA 2WZIA 5BXRA 1E6QM 4XB3A 1ZBVA 5A8QA 4S3JA 4CU7A 1BQCA 2DQXA 2J75A 1E4NA 1ODZA 2JEQA 1E4LA 3GXMA 1DWGM 4LPCA 1K6AA 5HXMA 1OSEA 4M82A 3DC0A 1O6IA 4PSRA 3CZEA 4CUCA 4W7VA 3VO0A 1BYBA 1WAWA 2DT1A 1V3IA 2OSXA 1J0HA 2OWCA 4BA0A 4B3LA 4AEEA 3VIFA 2JEPA 3VU2A 3BLKA 2BY3A 3VIOA 4GIAA 3T2PA 4RE4A 1W3HA 4BQ3A 3CUFA 2ZXDA 3EDDA 1V6WA 2EPLX 1CXIA 4JL2A 4FLOA 1CECA 2ZWZA 4HA1A 1VRXA 1GQJA 4JFWA 1WZMA 2RGLA 5E0CA 3THDA 1G94A 3MANA 5DMYA 5A69A 3AHVA 3VIPA 1V0LA 1ITXA 4HZ7A 3W0KA 4ACZB 1H2JA 3MMDA 1XH0A 3W82A 2YLAA 4U33A 5JBDA 3QHNA 3SCTA 4DM2A 2B31A 4OUEA 4PMZA 1HX0A 4ZFMA 3J7HA 1W2PA 3T08A 1E5NA 4QP0A 3POCA 2OSYA 2G3IA 3BSGA 1TMQA 4QLKA 3WDQA 1A3HA 2WVVA 3SCOA 4MAVA 3W24A 4JCLA 3ARSA 3T0DA 2AMGA 3OZOA 1GNXA 3OLIA 2MANA 1LJYA 1UWRA 1EXPA 2DSWA 1QI0A 3RMEA 1KQYA 1GOKA 1W9UA 1FOBA 1G5AA 1BVZA 2C8NA 1FP9A 3BMWA 5D8ZA 1E6PA 3WNMA 1GORA 1UOKA 1WNOA 2WNWA 4RE3A 2W91A 1KQZA 1EHNA 1UZ4A 4D6FA 2XGBA 1BHGA 2J79A 2E4TA 2A3BA 2GJXA 1B3YA 1M01A 1C93A 2ZOXA 4DM1A 4TVUA 4OIFA 4AIUA 4PRWA 1C91A 1HKJA 1HNYA 1EHAA 3O2LA 2CETA 2PWFA 1JF6A 1C90A 1W1TA 1Q6FA 1FHLA 2ZUWA 2ZUTA 4D6HA 4D6JA 2UY2A 1PBGA 2WMFA 2J7CA 3QHMA 8CGTA 3CZ8A 3N12A 2VCAA 3CPUA 5GQBA 3ARPA 1TCMA 3AIWA 4AEFA 4BQ4A 1FFQA 2YOCA 3MV01 3RCNA 1JZ3A 2ZX8A 4EAMA 4ZXOA 1E0WA 4H41A 1K9FA 3L4VA 3S2CA 5JIPA 1Q4NX 4U5IA 2BVTA 4Z2IA 1HIZA 4KMQA 3ARQA 3BH4A 5A2AA 4QLLA 7CGTA 1HN1A 4HU0A 1FFRA 1MW0A 2FGLA 3TTQA 1F4HA 2DIEA 2DH3A 5A2BA 1HVXA 4AD5A 2CBIA
chains in the Genus database with same CATH superfamily
4Z42C 4ERIA 4XG1A 3EYPA 3ITVA 5MKGA 4KH2A 4WKFA 3BOFA 3ZYZA 2WMJA 3CJPA 3MI6A 2D3LA 1ZBCA 3ITOA 2IXVA 2AL2A 2CPUA 2IKHA 2VC6A 4IX0A 4GCAA 2PV3A 2PFHA 3OA3A 4GH3A 1XGEA 3BW4A 2BMBA 2Z7GA 1Q2RA 4UDMA 1UWTA 1JCJA 3W1PA 2GYIA 2EAWA 4FNQA 1PTDA 1PBKA 3M44A 1G4EA 1D8WA 5GNXA 2PLJA 1DTNA 1S38A 3E2VA 1RA0A 1VPQA 1KFLA 4O8AA 3SN1A 3GDRA 5LHFA 1FKXA 3O6CA 2PPNA 4RLIA 3MDYB 1JF5A 1QNPA 4NY2A 5F1UA 2P5NA 4IMAA 3LOTA 1S46A 2QT3A 1J01A 4QT3A 3U0HA 3CH0A 5TIMA 4Y9NA 3SY8A 3TH6A 1V6YA 3L23A 2NUYA 4HPXA 4IPNB 3TDBA 2PMQA 3ARYA 3EOOA 4ICMA 2NXIA 1R3TA 1KT1A 1DWHM 5HJYA 2P0OA 3LA4A 4QITA 5IOBA 2PZ0A 1J6YA 1HP4A 2L5HA 3IIOA 3NZQA 3SFWA 2ZRZA 1A3XA 5EY5A 4A4AA 5EB8A 4AZ7A 1OFRA 1XYZA 2V9DA 1SO4A 2C15A 3VE7A 1BVNP 1CX9A 4DF2A 4LF1A 3NQ6A 3NOYA 4FAPA 1AQHA 4NZ3A 1SO3A 3KS5A 4AD4A 1T8XA 5BU6A 3PPCA 3UZWA 2X1RA 1CLKA 4QIBA 1E3ZA 4H9TA 2V81A 3IGXA 3FAXA 3QKEA 4J40A 1XV8A 2PV1A 1IQ8A 1G1YA 3SJ3A 1GKRA 3VCRA 3NQGA 3ELFA 2GOUA 1H60A 4O0KA 3HGJA 1OIMA 3BLOA 1S5WA 2XVNA 4OU1A 4LVFA 1WBHA 4AG0A 4DHGA 5AVNA 4D6CA 4LNCA 1OG0A 4HZMA 2W27A 2BFGA 3KS6A 5HMDA 3B8SA 3T0AA 3EWCA 1N8IA 5DMLA 1SFSA 3K1GA 1UR2A 4HSNA 3I7RA 4XV0A 1FA2A 3PUEA 3HMCA 3WK0A 3PTKA 4ZXLA 1LT7A 4IF2A 4QFUA 2HPMA 1DTUA 1NP0A 3LTSA 3QR1A 4PODA 3IS4A 1YE6A 2JGQA 2VFGA 3B9EA 4XIMA 4JY8A 2DT3A 2XFYA 3CUGA 4RDVA 1FTXA 4FNUA 4J28A 2R1PA 3WDHA 3N34A 3HQ1A 3EMZA 4DBEA 4M3PA 4W93A 1M68A 3IUIA 3H2FA 2ICSA 1XUZA 4UB9A 1EZ2A 4XZIA 3NEHA 3D46A 1OZQA 2QGHA 5CSRA 3MZ2A 4UTWA 4JTIA 3H2CA 4KWVA 2QJIA 4D8AA 4QTGA 3P8IA 3SCWA 2NQLA 1J10A 3LBCA 4Z1BA 2CZEA 3SY1A 1KD0A 4MOZA 3PZTA 1ZPTA 1EF2A 3EZ4A 2HZGA 3TMQA 3JW7A 3UCQA 4H7VA 3GH5A 4H2CA 4CQAA 2GWGA 1TZ7A 4NSBA 4ATWA 2Q8XA 4R85A 3TWAA 2ZTJA 1FCUA 2CLIA 4RE2A 3QMTA 4GQBA 4R34A 4XZWA 2F38A 1R3SA 1XIEA 3Q67A 3BUVA 2G8ZA 5JH8A 2Q5AA 3WNNA 3W7NA 3M4HA 4DRNA 1F40A 4ZQNA 2P1FA 1EH9A 1JL8A 2Y89A 5C9RA 4FMVA 3VFCA 3TQKA 4PTNA 3MA8A 3W7CA 1L0PA 2VZUA 3OB8A 3HMJG 1F6KA 3LTPA 1V77A 4XQ6A 2ZE3A 2UV8G 1VB9A 2WBKA 1LG2A 4AY7A 4S39A 3RMJA 1VP5A 4AFYA 1XPYA 2VZSA 3TR9A 5BXJA 1JAKA 4AX6A 4Y9OA 3I4KA 1FRBA 1UKSA 3VCNA 4DYJA 3VNIA 3KCLA 2AKMA 3K30A 5HAOA 4JKMA 4IQDA 5DIVA 4XKYB 5G2IA 1VFHA 2X42A 3TFXA 4XUGA 3N2BA 1JULA 2E1WA 4LYKA 4ADSA 4PRTA 1C92A 4DZ3A 3M5YA 1W1YA 1ITCA 3MI3A 3PRBA 1GYLA 3QOKA 1RLCL 3QYSA 1X7FA 3O1NA 5G4WA 2AQOA 4AMAA 3QEZA 4GOAA 3CMJA 4IG2B 3AIUA 1JUKA 4YL2A 1TPC1 5A1AA 3UXAA 1V3HA 1TTPA 2J9XA 2Z6IA 4GY7A 1ELSA 1LLOA 1TR9A 2ZZ2A 1A5AA 3NL3A 5F7UA 2YBTA 3EOUA 3QFEA 2PDCA 4K8GA 1XLMA 1TR1A 1DXEA 2XG9A 1DEDA 1EWEA 4KGLA 4DF0A 1O5RA 4LAWA 3AFBA 2BOEX 1FKKA 3CAVA 3TN4A 3LTYA 4B9YA 4FHAA 2BWGA 3WQOA 4HSHA 4LOCA 4Q8WA 4DI9A 1RP8A 1EJXC 1XH2A 4EVZA 2I7GA 3I68A 1HXVA 3GXFA 3EDEA 1B3WA 2MF9A 4ITZA 5DITA 1U1JA 3VNZA 3PVFA 4K39A 4GFSA 4KWSA 4C1LA 3IIZA 2O9PA 2F2DA 2WZTA 3O5PA 1KXTA 2Y4SA 4AZIA 5CSUA 2QJGA 4JTTA 3VCCA 4DWDA 3GXTA 1UD2A 1QJWA 3BV7A 1ICPA 3EBVA 2QGYA 1CGXA 3MKKA 4PB4A 1H1NA 1L8PA 3CHFA 1XG3A 3E1F1 4HHMA 4AXNA 3GU9A 1U83A 2WMIB 3S2NA 1NDZA 5JUVA 1P0EA 4WLCA 4DJFD 1WDSA 3TC3A 2NQJA 4TTUA 1B3XA 3OVPA 4LYRA 2QJHA 1M04A 1KTBA 5HANA 3AJ7A 1O95A 1H09A 3GM8A 3E12A 3U48A 4ZSTA 2WQPA 4OOZA 3L0NA 5D02A 5HQMA 2FPTA 1KM4A 4MADA 3SCSA 1H62A 2A7PA 3WH7A 3KP1A 3O5EA 3VKAA 4AMCA 3E74A 3VIMA 4HCHA 3VMPA 4HCDA 5F2MA 4I6VA 1T5AA 2Y7GA 1CBGA 2NXGA 3C3UA 1LF1A 2FZNA 1LLZA 4UCFA 3E6EA 3UEQA 2ABBA 4AQLA 5HWCA 5A95A 2DIKA 1R9HA 5F2IA 2J74A 2PI6A 4CVWA 3OHIA 2V5LA 3LLFA 3M07A 3KBNA 5D09A 4FNTA 1UCWA 5BOOA 3WLIA 1J4EA 4R7JA 2WC3A 2RQSA 1AD4A 3QPYA 4POCA 4FLQA 4QAWA 2HNHA 5D9MA 5CAKA 3NDZA 1HGYA 1VD6A 4DYKA 3VGDA 3ZOAA 3CL8A 3HGRA 5A6BA 4YCOA 2UZ5A 2YGYA 4ZOCA 4JNMA 3QTPA 1GOQA 1SW3A 4WGXA 3W7LA 2EULA 1GEHA 1EDTA 1TA3A 2YCKX 5E6YA 3DBNA 3SCPA 4PMOA 3V3WA 5A6LA 1TJRA 1MDLA 4QDPA 1CYGA 5FF0A 2VR2A 2D2HA 1Z32X 4P8VA 4FXRA 4V15A 3WD4A 1UP0A 2UY4A 1N8WA 1B9BA 1HL2A 3STCA 4IIEA 3PB0A 3EAUA 4CNNA 4BK9A 4E8DA 4BF8A 2Z26A 3H26A 2QF8A 1K4HA 4YTUA 2XZ7A 2EQDA 5M17A 5FACA 3GFYA 1PKMA 3L2MA 4YPJA 1GJWA 2VGGA 4MZ8A 4N4QA 3H8AA 1OADA 3Q58A 1HKIA 4IM4A 4CU6A 2WLYA 3PZIA 3ANYA 4HK7A 4TMCA 3CAWA 4MB4A 1T7LA 2Y0FA 1Z44A 1N55A 5CBJA 1JD7A 2FJUB 5K9DA 3FS2A 3BK0A 4LTSA 1U2YA 3AMDA 1M7JA 1MEIA 2E6YA 1B30A 3L9CA 1M7XA 2CWXA 3O8AA 1BG4A 4UFIA 3JU2A 3H2EA 1PDZA 4IZGA 3TTSA 1UOZA 4DRQA 3MSDA 4LANA 2A85A 3CU2A 4XD6A 1O7AA 2E28A 4PE8A 4NI8A 1WDWA 3L5AA 3ZQ9A 1I4NA 1JZ6A 3DHPA 3L68A 4XZLX 3RJYA 3W74A 4Q4QA 2JKAA 1QNVA 2OODA 3CYVA 3M0ZA 1XDJA 5BROA 1A5SA 4H6EA 3HJZA 3UBPC 1WDQA 4DUWA 4GNVA 4PCSA 4IL0A 2QVHA 2QMKA 1JZ4A 1V0MA 3DYOA 4XUYA 1S2AA 2A3LA 3ES8A 4B4FA 5D2TA 1S3HA 4H01A 2QAPA 3GUGA 1UWIA 1JUEA 3ARVA 4YWSA 3C86A 2TPSA 4PULA 4Q4SA 2G41A 2CKRA 5E6ZA 1QK2A 4M6UA 2GVLA 2BY1A 1FUYA 1TUXA 3LPGA 3EWBX 1UUMA 4L5ZA 3RIKA 4K7VA 1GUVA 2YR1A 1ZBKA 5B8IC 3MKVA 5CQ1A 4HA4A 3H4WA 1GQKA 2GJNA 3S83A 2V68A 1KKRA 2QUTA 1MRAA 3WFZA 3SI9A 2X41A 3OOBA 5I3JA 3F4NA 5LNUA 2CBJA 1HKWA 4W88A 3EX4A 4N6EA 4DBDA 5A6SA 3C0LA 1W37A 2VZVA 3OHMB 4NRRA 3W83A 3H24A 1L6GA 3RJXA 1CTNA 1BSIA 2WYSA 3GPKA 1DBTA 4AWUA 3M64A 1Y0EA 3EMQA 2PDIA 4V1YA 4GA8A 5AHMA 1J0IA 1FXPA 3UG4A 4ML9A 3RHGA 5C9XA 3XISA 4TIMA 3UP8A 1BQGA 3IJ7A 4NKCA 2JFEX 3W7EA 1KXHA 4PMVA 1WPCA 1MXGA 2E6DA 2J8GA 4JTSA 2Y62A 2DZTA 3W7DA 4MGVA 1XBYA 3S5SA 1HJQA 3A64A 2QCDA 4MLJA 1FWSA 4U10A 3TONA 4J3UA 5D38A 1UWAA 2Z1WA 1TTQA 3C2FA 3P5ZA 3DN5A 5B80A 1EQPA 4G2DA 4AD3A 1QOXA 3B3DA 3VX1A 1VLIA 2BY0A 2R1KA 5EYWA 4D1JA 1K4GA 3ARTA 2F6KA 4CGTA 3B9DA 2BODX 4MPQA 3W7PA 3EY6A 1JI1A 4ICNA 5BWAA 1KWGA 2J6XA 1MVYA 1RP9A 1TWWA 2Y5EA 1EL3A 3CASA 4JTRA 3UYIA 1F07A 5D75A 1BEUA 2GK1B 3B0YA 4AD0A 2GJLA 1WB0A 4FP1A 2H8ZA 3MQTA 2FGZA 4LEQA 1VQTA 5CG7A 3BMVA 4W9OA 3H53A 3LPPA 2P50A 3FXYA 1R2TA 2WC4A 1C7TA 1F8IA 3B8TA 5DMNA 3LRMA 1RLDA 1TV7A 4OKDA 3IJ6A 3VYLA 3G0UA 4PFHA 3M46A 2FVLA 1FHDA 2DH2A 1IXPA 5F2LA 5T91A 1HF6A 4PUNA 1E9LA 1OK4A 4EXBA 1MW1A 1TX0A 3BPWA 5DFAA 4O12A 5EA9A 4LS0A 1XISA 5C2CA 3PF3A 3N25A 4MB3A 2WPGA 3QMRA 4E6MA 3L0KA 4AVNA 4QG8A 2QDEA 3PAJA 1L6YA 1PAMA 4I90A 3WBAA 2OZTA 5IXEA 4QEEA 5A6AA 1ME9A 4F0KA 2BGSA 3GNXA 3LCIA 3RLGA 4DEFA 1V03A 2DW6A 4PRRA 3AS0A 1W1ZA 1KGXA 1J79A 4LUTB 2D20A 3F7JA 3QHOA 2C16A 1SSDA 3DFSA 3GD6A 3WDIA 4GXMA 2CBUA 4C6PA 2VP8A 4CD7A 4A3HA 4FO4A 4M1BA 1N2VA 4ZQMA 1NWRA 4UFJA 2ZZ7A 5DCBA 1MFVA 1KFCA 4Q7BA 2Q8ZA 3QSRA 4TTGA 3LGEA 4B3ZA 1XG4A 2BTMA 3PZ9A 3CO8A 5IHRA 1NWTA 3UR2A 3G5EA 3VDAA 4S2BA 3N2MA 1KFKA 2G5WA 2EG7A 4DYEA 5C7VA 4EAYA 4HK5A 1QRQA 1Z48A 4OFCA 4A3RA 5AZ0A 3EPNA 2R24A 2P76A 5DO2A 4HU8A 1PSCA 3UGRA 2E1DA 3QGAC 1X1NA 1XCFA 1HJXA 3R8HA 3N4FA 4NHVA 5GNZA 4KRZA 4ZPVR 4R3UA 4QRNA 1RXOB 4Q8UA 2XUCA 3IVUA 4Q22A 1G67A 3LGGA 1E43A 4HHPA 1JEZA 4H6QA 3SQSA 3GR7A 2F9RA 3UR8A 2WKGA 3H23A 2NXHA 3I10A 1D7JA 2M08A 4QE1A 4Q4RA 1AH3A 1HO1A 1FKBA 4EE9A 3UG8A 1PDYA 1FJDA 2QYGA 2DSKA 3W1LA 3CGNA 2QJNA 3RO8A 4AXKA 4HJWA 4H9ZA 2VDIA 1FKDA 2ZIDA 1UR4A 3NGJA 2VZTA 2X1TA 2F4EA 4MHBA 3P2VA 1L1PA 4H1ZA 3TSMA 1P5QA 1KRCC 2V8ZA 1BWLA 4KESA 2ZZ6A 3C2YA 1UPPA 3MBFA 1M6JA 4HPGA 3AMLA 2V5BA 1B5TA 1F2JA 3WLHA 3WF2A 3EB2A 2Z27A 3DFHA 4U3CA 4UNIA 2I5IA 1X1ZA 1L6SA 3C4UA 2Z0IA 4WK9A 1IE7C 2XINA 3TXVA 4FB7A 1VENA 2E9LA 3BQ6A 1R9XA 1TPWA 3S47A 4K36A 3VDGA 2Q02A 4HMCA 5CZKA 2WJZA 2A3AA 4KR0B 4AC7C 2VWTA 2PWEA 2GGIA 2VFHA 3NO3A 3CNYA 1EJRC 2VCCA 2VO5A 1ZB5A 4LU0A 4H9UA 3RFWA 2ADAA 4O15A 1D6OA 4RR4A 2D1ZA 3B8WA 3OVGA 3WQ6A 4ODQA 3URNA 4U28A 3NSMA 3W7RA 3FHAA 2XFWA 3VNDA 3T40A 1UA7A 2YA2A 2ZA3A 3CV6A 4PCNA 3E49A 5DBTA 2ZA1A 4ZBCA 3IHZA 5C6MA 1PIIA 4GCXA 4L4PA 3ZT5A 3R8GA 4GI4A 1FXQA 1P0KA 2XVKA 3EKGA 1W26A 3WH9A 1XIMA 3OLGA 4OECA 1UMYA 4XAFA 4PMYA 4FS9A 4W84A 4QX4A 4AIEA 4LEFA 1VEMA 1V3LA 5AYIA 4ADTA 3ITLA 2BXYA 2ABAA 1BTMA 2V3GA 1M7PA 5I0DA 4OBRA 2RKXA 4AIOA 4S2CA 3N11A 5LGXA 1UQYA 1XFBA 3RXZA 1E40A 4AB4A 4QDWA 1J96A 3VMNA 3PSVA 5FJIA 1BXCA 1UD4A 3S2LA 2FIQA 1M7OA 1ZALA 5BXPA 3GIQA 3O5JA 1EF3A 3W3OA 1US2A 3N9RA 3NSNA 4AHPA 2C91A 3A9IA 2E77A 1YW1A 4TX0A 5LIXX 5DELA 5AY7A 2OEJA 2WJFA 4UQ9A 3T05A 2NZLA 1W5QA 1NH6A 2OQLA 3N6JA 2Q01A 1VBHA 4PMNA 3TOYA 3TIMA 1KXVA 2HISA 2DJLA 9XIMA 3TEVA 4A05A 1BVWA 3TLLA 2QDDA 2ISSA 4PA8A 1SU5A 3U3HA 1L9WA 1ZUAX 1LOQA 4HU4A 3TUUA 4EF8A 4U2ZA 4JTQA 4H7CA 3NCOA 3CB8A 3CUXA 3QV6A 1LORA 4DPPA 1XKJA 3HU7A 4JN8A 1HFBA 2E5BA 2FHFA 3VD3A 3GTHA 1U5HA 2E25A 1VHNA 1LOLA 2ZXAA 1ZJBA 2ZXQA 3NO5A 1W54A 4LQ1A 3SIMA 1L6FA 1MQRA 4NJGA 3U57A 3GVWA 2FPYA 3G1FA 3ZM8A 4HB7A 3PS7A 3WLSA 1UQZA 2AKZA 4NT0A 1VYPX 1S3TC 1OT1A 3O6DA 4K1GA 3LMYA 3MO7A 1C8YA 4JQ1A 3W73A 1GHRA 2GGGA 1I2QA 3EWZA 2KGJA 3WO8A 1JAEA 3G18A 1ZS2A 4HNCA 2MNTA 4B5XA 1Z69A 1FKGA 3IVSA 4MZ1A 3TC7A 3R10A 4HPNA 2QS8A 4DXVA 1ZAJA 4XK2A 2V82A 3UXLA 4XZHA 2EXOA 2QDGA 5LA1A 4L4OA 1I1XA 2RUSA 3FDGA 3WKZA 1XH1A 1DPMA 1D7KA 4B91A 4QM1A 3DH7A 3GIPA 2WMHA 3S1UA 3APTA 1H1YA 3N14A 4CD6A 2IW0A 3NG3A 5KZ6A 3L4ZA 2VI0A 5XIAA 1LUCB 4WSHA 3W2JA 4MTVA 5I00A 1EX5A 2J7GA 1R0MA 1BXNA 1I0DA 4X22A 3W02A 3CWNA 4XISA 1PIFA 5D2YA 2VGIA 4Z2GA 1DJYA 2P10A 2A3EA 4W9PA 3UZJA 2PP1A 1VIZA 1NSJA 3WF0A 3UWVA 1FWDC 5H8MA 4KCUA 2WCSA 3S3GA 1DXIA 3MPGA 3O7UA 2P4VA 2OYMA 4ES4A 3VA8A 3BAXA 3PJTA 3W7JA 3O3RA 5FEZA 3GC2A 5C5YA 3O5FA 2QCCA 1EIXA 1DJXA 1K9DA 3TCEA 2AAAA 7ENLA 2PGFA 1G6CA 3FCPA 1I2NA 2ZC1A 2C0HA 3A3WA 4JTFA 3SRFA 2XSBA 1J0ZA 3B0VC 3W81A 1UZHA 1EA0A 3F03K 3M41A 3PANA 1GOIA 1OT2A 5JU6A 2Q6ZA 3W23A 3W85A 2WJDA 3WF3A 2FFIA 4NI3A 3EKLA 1QW7A 3KHJA 1NF7A 5DIUA 3WF4A 4F48A 1YYAA 3OBKA 2VC9A 4X60A 3MB9A 3PZNA 2Y8VA 3QZAA 3JR2A 4GD0A 3AOFA 5DBUA 3QY6A 1ZLPA 3PPFA 5KTLA 3UG5A 3M6DA 1IWPA 1TREA 4EOUA 1K9TA 3PBGA 1AW1A 1F61A 3M7SA 3QM3A 2ZUUA 3AYRA 4GIRA 2NX3A 3A4WA 3SFKA 3NQAA 2WZEA 3RPMA 4GI6A 4NVTA 5T26A 3LLDA 4JYFA 4DBSA 2PF0A 4Y8FA 5HR6A 3BMXA 2JF6A 2QW5A 4PMXA 5EMYA 3T09A 3BV4A 1FWBC 3SR7A 3LXBA 1ONWA 4BI7A 4E2DA 2XGIA 1HGWA 1THFD 3HG3A 1QHZA 1XP3A 4UMCA 3JRKA 1YEYA 3R8RA 1HVQA 4F9DA 2WKJA 5KSWA 3LCXA 3WQ5A 3PUDA 3UQAA 1BYCA 1I0BA 4KCWA 4N9DA 2QEZA 1LBLA 3CUHA 3W7KA 1Q6RA 3OU8A 1B31A 1HJUA 1E6SM 2QUVA 4WDTA 4C5ZA 3O5OA 5BXRA 3NR0A 4GJIA 4PEKA 1ZFJA 4O0QA 3R12A 4CU7A 1BQCA 3HG4A 1E4NA 3IJLA 1K8YA 1E4LA 1VH7A 3Q37A 5CC6A 5G1YA 3PBMA 4IH3A 2RURA 5HXMA 4PSRA 3CZEA 4JTKA 4CUCA 3EA1A 1BYBA 1Z9AA 3HTWA 1UC4A 3ID7A 5HULA 1TZZA 1KFEA 1PV8A 1EYEA 3DGBA 2JEPA 3KWSA 4UCGA 5H8PA 5CBBA 5JVLA 4GIAA 4RE4A 1QPLA 1W3HA 3SRDA 1QFEA 2ZXDA 1V6WA 2XP6A 4WX2A 1S5MA 1H7RA 4C6KA 3H9RB 2C13A 1OCBA 1GQJA 2YCIX 2NWRA 4GH1A 2NVDA 1A4LA 3PTDA 3KRZA 5A69A 2Y78A 1V0LA 4IP7A 4ACZB 2OXNA 5HUPA 1R3YA 2E6AA 5EU9A 4AWSA 1UIOA 4DI8A 4HMNA 1H2JA 4Z0SA 3H6OA 5JBDA 3SCTA 1Q7QA 3P5YA 2B31A 3FVDA 3TMLA 3HG5A 1GRJA 4PCFA 2FVKA 4KEMA 1TELA 1X8FA 4BJHA 2OSYA 1TV2A 3LHZA 3WDQA 4MYXA 3VOHA 3SCOA 2OU4A 1MZHA 3QTGA 2AMGA 1GNXA 1Q6OA 2MANA 2OFJA 2QCLA 3PK7A 4O1FA 3H4XA 5I3HA 1GOKA 1W9UA 1DE5A 2AL1A 1G5AA 3BMWA 2X0SA 1E6PA 3GDTA 4RXGA 1WNOA 2W91A 1UZ4A 2G95A 4KIEA 1QPQA 4JIRA 5CJNA 2NV9A 3CL6A 1M1BA 1PTGA 1XLCA 2A3BA 3I6RA 3CAKA 2I17A 4G56A 1C93A 3M9YA 3NEVA 1XI3A 3LM7A 1EYMA 2ZRXA 1JF6A 1U5JA 2FZ8A 1W1TA 1Q6FA 2ZUWA 4D6HA 4D6JA 2UY2A 4GABA 1PBGA 4MWAA 3VKDA 2WMFA 2J7CA 2Y5JA 4HD5A 3UPMA 2PE4A 1FCVA 3FJ4A 3SBFA 3NXLA 5GQBA 3ARPA 4AEFA 3MV01 4C6EA 3RCNA 2XH0A 4ZXOA 1RQHA 1K9FA 3LBOA 4CCZA 4WJEA 5JIPA 5FJJA 1AW5A 3WX7A 5DXYA 1Q4NX 5CSSA 3M5XA 3V16A 4CLMA 4HNUA 1XRFA 3ARQA 4LVDA 5A2AA 5T8GA 4XTIA 2EKGA 3P67A 4MM1A 4AD5A 1A53A 2CBIA 5I79A 4OVXA 5ECUA 2DDXA 1UKPA 5HR7A 4UBPC 3SRKA 1QATA 3QVQA 4JQ2A 1K8ZA 3H7RA 5AC8A 1DVJA 2NUWA 3C0SA 3LM3A 3VGGA 1KFJA 3NQVA 4JQ3A 2W4XA 2E40A 3VDCA 2RH9A 4Z1AA 3WSUA 2H8XA 5CGMA 3G1HA 4AZBA 4B92A 5D9NA 4DT4A 3Q2DA 1D7FA 2O92A 5K4XA 4NXSA 2J8FA 4MNKA 4U31A 3K4AA 4AEOA 3N3MA 3V7PA 1RK6A 2BZNA 4FLSA 4NU7A 2R82A 4WEVX 5D32A 1HG3A 2EPHA 1E56A 2P8BA 3UXKA 2PC8A 3IPWA 2D24A 1WAUA 1FQ0A 6TAAA 1W8GA 1BGGA 3NURA 1TIWA 3II1A 2DJXA 4JS3A 3FJLA 4A3YA 2E0PA 2EHHA 2VJXA 1M65A 3AALA 4HPHA 3CQKA 4JFKA 4MUPA 4HARA 4NJIA 1RUSA 2ZQ0A 3AJXA 1FWTA 2EPMX 4YYCA 1QNOA 4WVXA 4CKQA 1LQAA 4G1NA 2CERA 4DJDA 4CD8A 4Q4MA 3SEPA 4GRSA 4S23A 1SFTA 1FHVA 2JQXA 4D9PA 3E2QA 1Z3NA 4OE7A 1IHIA 4KWUA 3TJLA 4V27A 4V1XA 3SGGA 4C6FA 3UNTA 2GQAA 1E6NA 2VL4A 3QKZA 4LBRA 1GOWA 2QCHA 2GK1A 2JGYA 4WQ6A 1JZ2A 1S5NA 4W5UA 2QV4A 2YZ5A 3T6CA 2HMCA 3QLDA 1JG9A 3V4BA 1JPHA 3L21A 4IGSA 4B5TA 4G7EA 3VGHA 2W61A 2HBVA 2IKIA 5E5CA 3U4FA 4A35A 2EEXA 1R9YA 4M8UA 2PWUA 2XN0A 3RN6A 4HP5A 1E6ZA 3I3BA 4UZUA 4P8WA 4ZQRA 2FFCA 2W5FA 3DYMA 3T0CA 4IMDA 1AQMA 5HKGA 4DJDD 2ZQTA 4CD5A 1E0VA 4GC4A 4QR6A 2KAUC 1E72M 3LUOA 1V02E 3BGGA 3AXMA 3K8KA 4AVFA 3QN3A 3WQFA 2I5QA 2VUYA 3FW6A 3GHUA 3D5HA 3BW2A 3GLCA 2Z1XA 2PURA 1EIBA 2DVXA 1O5QA 3ME3A 2PV2A 3AS3A 4UMAA 4DLMA 3AIVA 3TQPA 2WBGA 3W1UA 4CNSA 1UD6A 1H51A 2Z25A 1JQXA 1ECQA 2OSWA 3W2NA 3CLWA 2QCEA 1AG1O 4L4MA 3T44A 5HW7A 3S1XA 3RAOA 2VHLA 3CMFA 5BXTA 4IG2A 1BGAA 1PL9A 4GG9A 3KL0A 3ZZ1A 3VM7A 1CGWA 3O5IA 3WJXA 2EGZA 4I7VA 3BAWA 4EX4A 3L7RA 1KRBC 4KERA 1MQPA 3OLDA 3VD4A 4WJXA 3P80A 2JE8A 1M41A 1H50A 3LHUA 3AHYA 4Y9MA 4O16A 1G9HA 2JIEA 3TWBA 3LSBA 3SDOA 3N6HA 4I9TA 1NFPA 7TIMA 4AZHA 1KR0A 1O12A 2E67A 3KZPA 1ZCOA 3O5GA 1ICQA 2HVMA 4RZ4A 3OVQA 3W00A 1W5MA 3Q4DA 2J7HA 1GVIA 1DJNA 4R9OA 2XH7A 4OQVA 1H49A 3FSTA 5CZ0A 4PMRA 2XZ9A 4O17A 4GMEA 3FYOA 2A6LA 5HK4A 4C1KA 3AQUA 3P82A 4XWUA 4HSOA 4Q7NA 1JCHB 3WD3A 1ME7A 1I6NA 1SZNA 2BP1A 1VFMA 2A3HA 2DW7A 2D73A 3NZRA 3CHEA 3PFMA 5G5IA 4MWAD 2ZUVA 1V93A 3EB4A 3CUJA 4XBSA 4GZIA 5GJNA 4OZOA 2ZR6A 1CW2A 2YW3A 4I7WA 2ALDA 2W63A 5LIKX 5AC6A 1WKDA 3LU2A 1V6UA 3KZ7A 3EDJA 4FZIA 4RNJA 3W1AA 1ISXA 1Q6EA 4JIPA 1PX3A 2E5DA 2R94A 2Z1BA 3O5MA 1OEPA 2Y1HA 3CUIA 4ZEPA 1NP2A 3NDOA 2INZA 1DJGA 2W0UA 4DWSB 2A7RA 4B5UA 4ZS6A 3SN4A 4PTVA 4I5XA 3MCMA 1EGZA 5KETA 2YB4A 3KHDA 4DO5A 3AUJA 4DRMA 1TV4A 1XSIA 4DRSA 5CGQA 2YL9A 4KIRA 3T4CA 3NZPA 3OZMA 1KV8A 2F6UA 4QG9A 5BW6A 3B0UX 2ZX9A 5EMLA 1WZKA 1I2RA 1F5ZA 5HWJA 1HKKA 4C6IA 3BICA 2ZC8A 3KL3A 2A4AA 2FH6A 2OX4A 2DGAA 2HRWA 1Y7VA 2J27A 3GZ3A 2QDHA 3WQDA 2WSKA 4C6CA 1XIFA 1J2WA 4CQ9A 3GB6A 3ZT7A 2VRQA 4KETA 4ZE4A 1P5BA 3A21A 4JX4A 4Q4PA 4B5SA 5IFTA 3B8DA 3I6EA 1TVPA 4ACZA 4RV8A 4AC1X 1NARA 1VLWA 2RGMA 2ZDSA 4D6GA 4IPXA 4O1AA 4JHOA 5AHIA 2HEJA 4G9PA 1IZJA 1TQJA 3K5XA 4NNCA 4O54A 3HPXA 3LI0A 1JIBA 3MP3A 3W4RA 1XSJA 2KO7A 2NT1A 1QO5A 5E1QA 2CXEA 2VGFA 2F61A 3WH8A 3BCJA 1RJQA 4A3UA 5FEWA 4J2MA 1KGUA 3WMCA 1OWQA 3HV8A 4LUJA 1GZGA 3ES7A 3PN8A 1F9CA 2P8CA 4LYPA 4PBFA 3PAOA 4C7GA 1I8JA 4ZOEA 4BF9A 2FTPA 2K8IA 3WIJA 4GPNA 3EX3A 2GPTA 1A5LC 4M29A 4M51A 4ZA0A 4C6QA 1QBBA 2GJXB 3H2NA 4PMJA 2ZE0A 2WB5A 4AU0A 3Q65A 1REQB 5M5DA 3GTNA 4O50A 1Q6DA 3T07A 4ZO9A 4C65A 1US0A 4F3HA 1MUWA 3UPBA 1CLXA 1OM0A 4KFNA 5A94A 3TYBA 8XIAA 4Z1YA 1TWDA 3YPIA 3W88A 4JIEA 1GJUA 1LLWA 1TE1A 2X0YA 1MUCA 2PDYA 5I07A 3TX9A 1HJSA 2ZX6A 3V0UA 4UTTC 3IK4A 1EC7A 1RQEA 3GY1A 1GTHA 3MWCA 1TPFA 1EB3A 2FZBA 1ZZMA 1E0TA 2YA1A 2HDJA 3R7MA 4FR1A 2VDHA 1JNTA 4GYPC 2VVSA 4NILA 1UP3A 3ARWA 1LWJA 1SMDA 3G1XA 4TU1A 4IIBA 4DUXA 4JD4A 3NFUA 3RGCA 2CWNA 3MDWA 3EOSA 5GPRA 1M5WA 5I3GA 3KOXA 1KR1A 1TG7A 2BBFA 3FLUA 1XLFA 4NRSA 4ODKA 2DQWA 3SQLA 4LSBA 1IT0A 4JQ4A 1U5VA 2PP3A 4H9XA 2YL5A 2HBXA 3EMCA 3T0TA 2BSLA 3GK0A 3K46A 4MJZA 5EMUA 5HUOA 4C6DA 1VFOA 2XIIA 3FV9A 4WXZA 3VZXA 4Z1DA 3MHFA 2X16A 2YDSA 3GYEA 1OINA 3G3DA 4J9JA 4IIHA 2HXUA 1K70A 1W3JA 2NV1A 5HUAA 1BKSA 2M2AA 4UC5A 3STEA 3WH6A 4JHZA 4Q8PA 4WIWA 1SM9A 2ZXBA 2O9RA 1S1PA 3HN3A 5C9UA 2FZMA 3FEQA 3QY7A 2PBCA 3MO4A 4GI9A 2D2GA 3AXKA 3TW7A 5DX7A 3O5DA 3FN9A 2OGYA 3S6OA 4GO8A 3T78A 3P8JA 4PEEA 1DJIA 1W1PA 3A22A 1HJWA 1OF8A 5BMXA 3TU9A 3T4WA 4UTMA 4TX8A 4DROA 1BAGA 4X0NA 4GKLA 4AYGA 1AK5A 4JFTA 4TW7A 5T9CE 7A3HA 2J47A 2A1YA 2ZR5A 4ODRA 4L65A 1J4IA 4DO7A 3GNDA 4H9MA 3UVIA 3CIVA 3VAWA 1A5UA 2YXXA 2C14A 5A5WA 4YNGA 1PZ3A 3REQB 3UJ2A 3CIWA 3WBYA 5F4SA 2A7NA 3CMGA 1E1FA 5LXXA 3NQ8A 1E71M 4FR6A 1YDOA 3B03A 4KRTA 2PODA 3LN3A 5ABFB 5LNRA 4E0CA 1VBGA 5RUBA 3AHZA 5HNRA 1P48A 3RPTA 1XD0A 1QVBA 5AHNA 3W53A 4Q6JA 3LV6A 4GIYA 1OVDA 1VYRA 1OGGA 1OFOA 1UWUA 5LSMA 3N15A 1YBQB 3BZGA 2B5UB 1LRTA 4GVFA 3IAQA 3EA2A 4B90A 1PB0A 1R7AA 5IBXC 1UH3A 3UCCA 1E9YB 3ZMRA 3CGTA 1Z89A 2XIOA 4XAKA 3RFAA 2DVTA 2XSAA 2D3NA 4FXJA 1IT7A 1PWMA 4HHLA 1YBQA 3TE9A 1J4HA 2XJ7A 3GVGA 3E0IA 4ZB0A 1PKYA 4AWTA 1GQLA 1KBBA 4IX2A 2X30A 1I2OA 4GUJA 3T42A 4M56A 4P8UA 1NOUA 4F0SA 3T81A 4JL1A 3URAA 1UR1A 1CXHA 1XYLA 2Q3OA 2XP5A 1CEOA 4LAMA 1YX1A 4J4KA 1OFQA 2AAMA 1ZU8A 2XVGA 3SUTA 2HVOA 1LL7A 4WY0B 1HUVA 2GL5A 1UR3M 1GQIA 3UJFA 4GYKA 1HJVA 4FA3A 1QU4A 4AX7A 4EWJA 4HZ8A 1RCQA 4P7RA 4CEXC 4O19A 2XWEA 2XVPA 1LG1A 1EPVA 3A4AA 1GOOA 2OZ3A 3NTYA 5DY2A 1PE1A 1TA3B 1EQCA 2IPWA 1XLAA 2PTZA 1VBRA 3SADA 4TR9A 4UFHA 1MNSA 1Z7AA 1OGBA 3U7BA 1YNYA 4W86A 4DRHA 4K3ZA 1FCQA 2GQ9A 1KTCA 2WSYA 2GUYA 1KCKA 1WZLA 2VDGA 4DRIA 1XIJA 3FY1A 2YKKA 4PB5A 4DZAA 5I2UA 1RH9A 1PUDA 3QQ1A 1UB3A 5D33A 4MY9A 4KPLA 3LLXA 4UFLA 3OIHA 1EJVC 1UBSA 3TV8A 1OK6A 2RUDA 2W9MA 1XYCA 1B0IA 3UY8A 4PUMA 4HNNA 3EPMA 1MNZA 3E9AA 4DUOA 4O53A 1JFXA 4QG6A 1XC4A 4JFLA 2WW5A 5AC5A 4RDZA 4OBSA 5C9WA 4Y96A 5FJUA 2B4GA 4HMEA 1K7EA 1PZ2A 1PWLA 1SUXA 3B7XA 1C8QA 1XGDA 1CXFA 4MB1A 1JDDA 3WK2A 2M1IA 4GUFA 3NWRA 3KVMA 1N1AA 3LNMA 2Y7EA 4C60A 2QUMA 4MYAA 4X2RA 2ZZ5A 4FNSA 1IX5A 4BCEA 1QK0A 3BLDA 4HTBA 3NQFA 2FB3A 3B97A 4I9JA 1XIDA 2BXZA 4KFPA 4AYSA 2B7PA 4IPLA 3QGKC 2WWCA 2VQUA 1U33A 4Z2LA 5FF3A 3DI0A 2VT0A 4GX8A 1BYDA 1C8XA 2C18A 3THCA 1C8VA 4H6KA 1ISWA 4IXXA 3BMBA 4LBSA 1W9VA 5KITA 1JYVA 1X7IA 3VGBA 4XIAA 1KO0A 4OHQA 2CU0A 4MVAA 3N73A 4QS6A 1IEVA 1JI2A 2Z24A 1J5SA 3LG3A 1UMLA 3C2OA 1UW9A 1LOSA 2OCZA 5BZAA 3ZIZA 5CBIA 1KRAC 4RXFA 4P7OA 3LZ5A 1RA5A 3REQA 4QJ3B 3SO7A 4MDPA 3WQGA 3UWZA 2H9AB 1S2UA 3L2LA 3OLEA 2YYUA 3AHXA 2XFFA 4OT7A 1K02A 4NZJA 4G5DA 1WKYA 5LIUX 3C61A 4CCEA 1B3VA 3FYPA 2VFEA 3GS6A 2Q8LA 1KM6A 3QC3A 2Y24A 3M6YA 4HYRA 2FZDA 3BSHA 4DELA 3V18A 4IMGA 1ZBWA 3B40A 4HKPA 3BG5A 1EEPA 1TUFA 2OJPA 3N2CA 4LAXA 2ON3A 2ZCGA 2ZZ3A 4O1DA 4UTIA 3SCQA 2Z4GA 3NM3A 1TPVA 1TYGA 1IIHA 2P3ZA 4LGXA 2CYGA 1W56A 2HK0A 2IQ0A 4DRPA 2YL6A 3UR7A 3RF9A 2IPFA 4R0XA 1TWSA 4NZ4A 1RHCA 2DT2A 3BLPX 1KBKA 4PTDA 1Q6HA 1K8CA 1JPKA 4KRUA 4HBEA 4QNWA 1W91A 4IICA 3TA6A 1T0OA 3CB3A 2PCEA 1BKFA 3KW3A 1JDCA 4XTDA 5BCAA 1B9ZA 4AZ6A 5AHEA 4B15A 4C1NB 1SZRA 3POHA 3PJUA 1JXJA 4J3WA 3GG7A 3USBA 2VRKA 3THQA 4ACYA 3K8MA 1EP3A 2JALA 2UBPC 4MJ2A 1V02A 1NOWA 1G01A 4E4PA 4MSPA 4DAFA 4O18A 3GKFA 1QXLA 6ALDA 2DEPA 2CZVA 3O15A 1YPFA 1WP6A 3IGUA 2VEMA 4Q3MA 5FCZA 3IWPA 3FNDA 2V5DA 5I77A 1S2VA 4N7QA 4DVOA 5I3FA 1Q6UA 4E3VA 1A5CA 2H6RA 1VC4A 4MNLA 1Q6QA 3CZLA 1HKMA 1JVNA 4FX7A 4HYVA 1X6NA 3TLQA 4U86A 5TBOA 3HURA 3VINA 3WELA 3ZWTA 2PBGA 2QPSA 5C7HA 4NAFB 1NQ6A 1F3EA 4PBGA 1PCWA 1QOQA 5HNNA 2VCBA 5J5DA 3PM6A 5LKYA 3UYCA 3DXIA 3VI2A 1AJZA 3LX9A 7ODCA 3UWYA 1RPKA 3UW6A 2ZRWA 2ZVIA 1IYXA 3WH0A 4LH8A 2LPVA 1RSCA 2OLSA 1YHTA 3G1AA 4D1IA 1AUSL 5FJTA 1LWHA 1VBUA 1LRNA 3N19B 3HA1A 4JDYA 1E55A 4K8EA 3GHSA 5DXXA 1KCLA 1WOAA 1DQXA 2R1LA 1YW5A 4IUGA 3ARUA 2CLMA 4QXIA 3VOGA 1GKPA 1XBXA 4PB3A 1GW1A 4HCLA 1NF0A 3CPRA 3M1ZA 4BI5A 3OZPA 2AL2B 3VIHA 4A2SA 1V7AA 4IQ2A 2ISWA 4IWWA 3L12A 1ROTA 5D05A 3F2BA 1NDVA 1JFHA 4Z2JA 1OFEA 5SWUA 6ENLA 2Y2WA 2BS9A 3G0SA 1OCQA 3W86A 4NASA 1S39A 1YNQA 4Y90A 2DIJA 1E4MM 5ENLA 3N29A 3KCJA 1OFDA 4KEVA 1KBJA 3V5FA 5J5RA 2PDWA 2WMKA 4LAZA 2YIHA 1WYIA 1RK5A 3ZO9A 2IF4A 4QIUA 4PCPA 1AJ2A 4IMEA 4LCQA 4N42A 3TC6A 2PGWA 9XIAA 4GQQA 1QUMA 1DWAM 2HS6A 4LAOA 2YFOA 5I3KA 5A8PA 1EYWA 4LUYA 3ZR4A 2IMRA 3WQWA 4DH0A 2PA6A 3WQCA 1TSIA 1R46A 4K6AA 2X8RA 4D6DA 3I6CA 4MFDA 2MLYA 4K8HA 3GDKA 4TVCA 2ZQSA 2XWDA 4S1FA 5FOOA 3W1TA 7REQB 1QAPA 3OO2A 3R6IA 3T9PA 2DZBA 3ZT6A 1D3HA 3SGUA 3L4UA 1PXGA 3WLJA 3V5OA 1YNPA 3VPLA 5CAHA 1ZL1A 1GJPA 2QPXA 3C5QA 3FDKA 3VTRA 3HQPA 4S3AA 4XVDA 3RR1A 3RM9A 3JS3A 3TYUA 2D0GA 1OFPA 5BOEA 5TAOA 3ABXA 5M03A 3KTCA 4MAZA 4H8VA 3QSTA 3R58A 3MW7A 3JZEA 3FX4A 5REQB 4M81A 1XIGA 1SFJA 3VFLA 4Q6XA 2PWHA 1VHCA 3EXSA 4U85A 4MWAE 3WUFA 3LCLA 1D2KA 3W7IA 2BDQA 3EWYA 1LWIA 3MBDA 4F79A 4AZCA 2ODOA 4A22A 2GUUA 3IANA 2W3ZA 5K9CA 1J0JA 1D9EA 1XF0A 2PLCA 2A5HA 3MVTA 5CZSA 2G3FA 4MKVA 2A6NA 3G22A 2YDAA 2G3MA 4ZQOA 2J24A 1VFFA 1E6RA 1G4TA 3R11A 4C6OA 1B57A 1MXDA 3M0YA 4OUIA 3GSMA 3HV9A 3GBEA 2PDXA 3OYXA 1OIFA 1Q6CA 4JTUA 4NYYA 2FB2A 1VCFA 1ISYA 3AUOA 4ATDA 3IIPA 4NYUA 4YLWA 1YQ2A 2X05A 3VUSA 2WVTA 1LYXA 1VGAA 4HOWA 1ECEA 4HK6A 3WUBA 3GNPA 3V0SA 1IZKA 5A8NA 3GW3A 5AOUA 3B4YA 5C54A 4BZYA 3W1XA 1TPDA 2OEKA 1XC6A 3ABOA 2GUBA 2TODA 5H2ZA 3S46A 4GNKB 1TJ2A 4TXEA 3WMLA 1Q6LA 3OBEA 2XHYA 4AHQA 4ODLA 1DOSA 4J4NA 2X09A 2FQIA 3CEPA 5F2GA 2JF7A 2P88A 3WY1A 2XPKA 3CTLA 3KVJA 2PTXA 2PP0A 4OOUA 1JQVA 4GE8A 1CGTA 3R0DA 4CQCA 1MEHA 3L0GA 3GTFA 1YXYA 1K8XA 3BLIA 4INFA 3LPFA 3DC8A 3C52A 3FGCA 4W7WA 4PGLA 1KFBA 1YXCA 4H9YA 1BG9A 1IGWA 3EXRA 3G1YA 1BWVA 3COTA 2ZX7A 3TW6A 2CFFA 3G0XA 5GPGA 1Q6GA 1TPH1 2V67A 4NF7A 3AWNA 5FEXA 1SZGA 4A21A 2WCGA 1QTWA 5FF4A 4O57A 2UY3A 3QRHA 1GHSA 3WBWA 5B7YA 2NLYA 2QCMA 4TYOA 2R1NA 4ZQPA 1KBLA 4HYWA 2I57A 3T0BA 1X8CA 3FA5A 3BZJA 5T9BG 2ISVA 2NSXA 1UJQA 2QKFA 1XL9A 3GDBA 1AODA 3VILA 3VD5A 1GVYA 3O5LA 4V28A 4F8XA 4XZ9A 4MUZA 5HWNA 3VUPA 3BAYA 1NELA 5I03A 4LS1A 5HPOA 4GISA 3A12A 1TKKA 5HQEA 3GAYA 2X40A 1BYAA 1WZAA 2V69A 2D22A 4ZB5A 2ANUA 3DECA 3SCUA 1NDYA 5AYYA 2QUUA 2DORA 3N6QA 1QPFA 1R3RA 3FOKA 2TAAA 2D9FA 2WZIA 4M7TA 1E6QM 1Y8BA 3BVJA 3CK5A 3UQBA 4G7FA 4EPDC 1B6CA 3HGSA 4LPCA 3KCOA 4JYDA 4XD3A 4ZOBA 3DC0A 1O6IA 5CEWA 3LY0A 4W7VA 2RDTA 2DT1A 3N2XA 2PD5A 4O1EA 1BWKA 2OWCA 1XLGA 4BA0A 1FWFC 2A2IA 1Y5WA 3OTRA 4AEEA 3G1RA 2PDQA 3BLKA 4OV9A 1SGJA 2NQZA 1GYMA 4GUHA 5AZ1A 3VC5A 3UXDA 1VRXA 4IFRA 5E0CA 3THDA 3MTWA 3VAVA 2HROA 4LT9A 3S8HA 4Q33A 3L2IA 1P1MA 3VIPA 2VWSA 1RBOB 2C71A 2GQ8A 4CEUC 3MMDA 4ZGYA 3KTXA 3ENLA 4OUEA 1EKOA 1AL8A 1FKSA 1XDLA 1W2PA 3N4EA 2DZXA 1ME8A 1ZQ5A 3QV7A 1H5YA 3UGVA 1UASA 3POCA 4YTTA 2E7FA 1SZFA 3MY9A 3BSGA 1TMQA 2C3ZA 1Q85A 2J88A 2WVVA 4JQAA 1DIOA 1XYBA 4MAVA 3W24A 2OG9A 4GXWA 3T0DA 3JXVA 3HPAA 1EGVA 2B7OA 4F40A 2C1GA 1EXPA 1V5XA 3TJIA 4LS2A 4C6MA 4YXGA 3M0IA 5JH1A 1FOBA 3WLKX 2C8NA 3ABSA 1LZOA 1GORA 1IXQA 1UOKA 2ZRVA 4RE3A 4IPPA 4H9VA 5EMMA 3W75A 1SPQA 3ITGA 5AFDA 5HW6A 2GVEA 2XGBA 1BHGA 1AZ2A 1ZK6A 2PDJA 3ZLHA 3O5QA 2QF7A 5DQPA 3KFTA 2DVUA 4DM1A 4AIUA 1K3UA 4RPQA 1EHAA 3B8IA 4H3DA 4HBKA 1C90A 4US5D 4O13A 2HNEA 5CPOA 3T8QA 1YDVA 4N19A 1P6BA 2HVNA 4QBXA 3RX2A 3NVTA 3BL3A 4A6GA 3NPVA 3QYQA 2QCNA 1TCMA 4M19A 1JZ3A 2D2JA 4H41A 3L4VA 1R3VA 4F4RA 2FAPA 4ZO7A 4ODOA 4B2DD 3ITTA 5C0QA 4KMQA 2L2SA 2AMXA 1W6TA 4HU0A 1Q8JA 3DG6A 3LUTA 4OV4A 4X3ZA 1MW0A 3DG3A 1F4HA 2DIEA 4JIQA 1R38A 3WK1A 2DH3A 1IF2A 3WFAA 1LL4A 2BHZA 4N0RA 1XRVA 2RJHA 3TAOA 3OEXA 1ZAIA 3MWAA 5JMUA 4UUIA 3VZZA 3GTYX 1Q6IA 3ERPA 3UA4A 3DFOA 1TCDA 5HMEA 3GNOA 2J7DA 4JTEA 3QLLA 4GJ1A 4L4LA 1R85A 3C6CA 5D4YA 2DZUA 4DZ5A 3E5PA 3SAZA 3KVLA 5D04C 2Q3RA 1C29A 3MVIA 4KKXA 3W29A 3W6YA 2PWGA 2V38A 4TOQA 4D72A 1CNVA 3VOFA 3NI6A 3WLRA 4E3TA 3M0XA 5A6MA 1CLVA 4FNRA 2YLLA 4RDWA 2LLEA 1IEXA 4R7WA 4GGHA 4B9ZA 4QAIA 2NX1A 4G1KA 4L61A 1S1RA 2X7WA 2WC7A 3QZEA 1DXFA 2VURA 7PTDA 3S0CA 1TMLA 4ECLA 2LJ4A 3STGA 4ZL1A 4WCJA 3IJ8A 4RE0A 5M3WA 4KF1A 3WEZA 3LB0A 1I75A 3W7OA 1W1VA 1XWYA 3ALFA 3RYSA 1OBAA 1CCWB 3EWDA 2FDMA 2ZZ1A 3MUCA 2F21A 4IGMA 3L5MA 1VR6A 1XSKA 3HO8A 3STPA 3E0WA 2VR4A 3QQ0A 1SMAA 3HGOA 4FLRA 5G1TA 1NSGA 4XD5A 4IT6A 2XIQA 2W6RA 1JD9A 2HQAA 4IJRA 3D6NA 3EDKA 4OGZA 4GQ0A 2WVVB 1CXKA 3BJFA 3WD2A 3CZKA 3PR2A 3ZLFA 4MJMA 3WF1A 3PULA 1MSSA 2J7FA 1H41A 1NU5A 1T41A 2FTWA 1QI4A 4HA0A 4F2TA 3BDKA 4ODNA 2UZ9A 4J5NA 2XPAA 4CNOA 3PB2A 1M3UA 1KB3A 2DZVA 3U2ZA 3H12A 3E96A 3B9OA 4MB5A 4QHRA 1ADSA 2WM0A 3EOEA 4UTKA 5BWFA 3E3HA 5GJMA 3MMWA 3WLPA 3GG8A 2Z00A 2XGZA 5AB3A 1EUAA 4LUSB 4L64A 4WUIA 3P62A 4CU8A 4Q8MA 4UIOA 2X1IA 5FF7A 4JEJA 4W9QA 3S6TA 4GJJA 4DJED 3EXTA 2H90A 3FEMA 2FKPA 5FJOA 1PVNA 2BASA 2JZVA 3UG3A 3A9BA 3ZR6A 4MDOA 4N9CA 5K2ZA 1M03A 1Q45A 3GFXA 4XKMA 1G4PA 1IWBA 1Q8AA 2ESCA 3TYDA 3RO6A 5FF2A 3TK7A 3KE0A 3GXDA 5D03A 4MIMA 2WXDM 2ZZ4A 5HINA 1C9HA 1IV8A 2NT0A 3E38A 5IFPA 3NQBA 3LK6A 2MLXA 3KAGA 3VNKA 5HOSA 1VJZA 4NAEB 2WHKA 1WE5A 4HNVA 4IPIA 1YPXA 2A3CA 3WDRA 2HS8A 4U2YA 1U1HA 1GCYA 2DSZA 2IQDA 4TUFA 4M6VA 2NQHA 2PBOA 1U30A 2RDXA 4MZYA 3IRSA 4UQEA 5EFDA 4ZVJA 3L4YA 3LSCA 2FDSA 1TJ1A 1I45A 4PYSA 1SJCA 1WX0A 1N7KA 2OO6A 1KM5A 1AJ0A 3V1PA 2QCDB 3O16A 1BD0A 1TQXA 4ATLA 2PDPA 2VD9A 3UI5A 2FH8A 1CGUA 1OX4A 2QPUA 3CGMA 2PDMA 3KOZA 1OC5A 1K7XA 4S3BA 3SUWA 5EBUA 2VX6A 2GGJA 4GY0A 2J7BA 3FKKA 1MO0A 4UOZA 1E73M 4Z17A 1TV8A 2FLIA 5ABFA 4YCPA 4D6IA 1M5YA 2DP3A 1WV2A 3OODA 4BEUA 1F76A 2DSVA 3BW3A 4TX6A 2DU2A 2Q71A 3O0FA 1EC9A 4O28A 1TV5A 1RV8A 4JCMA 1E15A 4ICCX 4TW6A 2Z1VA 1AW2A 3GR4A 3LI1A 3IEBA 2O9OA 4ZPWR 4NP7A 4UQDA 1DJZA 5DEZA 4EPKA 4Q32A 3WLTA 1W3KA 1YPIA 4HTYA 4HNTA 2WQDA 3HFTA 4JTGA 3FAPA 3O5KA 2R91A 4CNPA 3AISA 2NQ9A 4LF2A 1V3MA 2HWGA 3IIVA 3NYZA 4XO7A 1QO2A 4F9JA 3G2GA 2X2GA 2RDWA 3P0XA 3NQ7A 2RSEA 4G8TA 3V1HA 4CD4A 2FMOA 1UD5A 2VYOA 3CWOX 1DP0A 3VX0A 2GDUA 3WBXA 4Q4KA 2HCVA 3GXNA 2KZHA 1OG6A 1X38A 4O11A 1J18A 2F6XA 2GDQA 4HMDA 4J3TA 3AWOA 2Z7KA 4D2JA 2E6FA 4ZTYA 3AZTA 3TKFA 3EOLA 1WO2A 4JN7A 2O9TA 1QZ2A 1XLEA 4XVEA 3OZYA 1EJSC 1H1ZA 3F2DA 3WQ4A 3BANA 3GQYA 4BY3A 2E68A 3BAIA 1Q2SA 5ABEA 4PUEA 2AWGA 1A0CA 2VMFA 4DJEA 3PHAA 1B2YA 1JGMA 5GNYA 1RJRA 1QCWA 4ODMA 2XH4A 2B81A 1ZAHA 2NLIA 3ZJ6A 3GUWA 1O5KA 2CLPA 5DT5A 1G7VA 5LZLA 3A5VA 3MT1A 4O4WA 4DBUA 2Y85A 2XP7A 5E93A 1VF8A 1YLVA 3GVRA 3C3NA 3SB0A 5EMJA 4KEZA 4BKNA 1H3GA 1ONXA 4PR4A 1W32A 4FXSA 5IBXA 4HA3A 3DGRA 4MKNA 1CIUA 2NV2A 1C7SA 4YTSA 4O0ZA 1UIPA 3ZFHA 5CCZA 1T99A 1V7YA 2BHUA 1MZRA 1VCVA 3WQPA 1RVKA 3VD7A 4PL2A 2AOSA 2DT0A 3R5EA 1NAL1 4UNLA 4REQA 2XP8A 1KXQA 3THAA 1VYSX 6REQB 1VS1A 4QDMA 3M5VA 4R9XA 4CCCA 1F7BA 3E0VA 8XIMA 1F3WA 3PTMA 3W7GA 2Z2UA 2REQA 5FI8A 2PRLA 4I8DA 4L1XA 3MP5A 1JCLA 1ONEA 4JIIX 1QHPA 4MG4A 1EEXA 1NM9A 2EPOA 1IZCA 4E2BA 3L66A 3FHQA 4LAKA 2Z1KA 1UZDA 1CT5A 3CAQA 1IXOA 4H04A 4BEQA 4IISA 1R7OA 5C70A 2WMGA 2PGEA 4M1RA 3SCVA 1O5XA 4JOMA 2WMIA 4GIEA 3GDMA 1UA3A 4FXFA 3NPWA 2E3ZA 2WHJA 3GU2A 3LHTA 4YWIA 1DL3A 4UTUA 1C9WA 3URQA 4L80A 4ZO8A 4KQNA 1TZ9A 2RHGA 1GQNA 3BJSA 1TRDA 1BTCA 2JBMA 4UOQA 3WH5A 1MYRA 3W28A 2EBNA 2XU2A 1DE6A 3DFNA 3PWGA 3CV1A 1NVMA 5MKGB 2F8QA 3IV8A 4X61A 3MUAA 2GSEA 3N1AA 3B06A 3WL1A 5FA5A 1FX6A 2GSJA 1JDEA 3T8LA 1W9XA 4LV4A 4RZ6A 2BHYA 3TCZA 1EZWA 1UKOA 2F2HA 4O10A 2XYLA 1H0GA 3FGCB 4JHMA 4URIA 1YXDA 4HNOA 1MFUA 1VJIA 9CGTA 4RX0A 1NWSA 4J3XA 5ECVA 2V0TA 4QEHA 2PU0A 2XISA 3MUXA 3PY2A 2ISFA 4LC8A 1YDNA 3CQJA 5KZDA 3L4WA 4OTKA 4ILSA 3ZVHA 3MMUA 4E38A 1ENUA 3RRAA 3S2JA 1EP1A 5CLWA 4QQ3A 1F3XA 5CSYA 3VC6A 2J9ZA 2C1IA 4GK8A 4UNKA 2FKEA 1CXEA 3MC5A 5CZJA 3TCSA 3WCZA 4UTLA 4L6DA 3CS2A 3TFCA 1Y65A 1QPRA 2GVYA 1VFLA 3A13A 5CC7A 1V8EA 1TVNA 1XCWA 3E02A 4JY9A 3W70A 1QT1A 4W4QA 2WSPA 2ZRYA 4A2RA 1J2BA 2HJPA 1F05A 3QF0A 3IK2A 5DT7A 3IVTA 1A5MC 2QHAA 1XX1A 4L3NA 3I3EA 4YHGA 3FKRA 1OYBA 1DWIM 3CT7A 3RILA 2QJJA 1GT8A 4GO9A 3KAIA 5CPNA 4A8RA 1BSLA 5DMMA 1Q7MA 1OX4B 2WOQA 1MW2A 3W72A 1POKA 2J25A 5AC4A 5H91A 5L6UA 2OQYA 4TX9A 4Y7EA 2H3DA 3H21A 1GEQA 2PB1A 2V63A 3OG3A 3NPXA 3EGJA 1XLIA 1OFAA 1EA9C 2ZX5A 3LCGA 5EL1A 1KNWA 4CNTA 4HHHA 4RUBA 2KE0A 3O6YX 1VRDA 3IARA 5BRBA 1TFVA 4Q8NA 2E8ZA 3P7YA 4XAPA 4KEUA 2MLZA 3GU0A 3KOFA 2QUNA 4P5UA 1JPDX 2OYKA 4WF7A 1XRTA 5AYZA 1ZHAA 4LCRA 3HG2A 1D7HA 3MJYA 1FD9A 4FSAA 3GAKA 1OHLA 4L56A 1ZJAA 1A5BA 4WD0A 3WNLA 2ZFAA 3ARRA 3IGHX 2XDFA 2VEIA 1PJ9A 4IPJA 2POTA 3B9AA 1E1CA 2WCAA 1MWOA 3B8VA 2P0IA 4Y9AA 2IKGA 3N3TA 2WO5A 3B9NA 1YE4A 4H4IA 3BARA 2Y8UA 3R89A 3VIJA 2E9MA 3WENA 2KR7A 3TROA 3HPFA 4NQ1A 3ORWA 4KCVA 3MU7A