1GUXA

Rb pocket bound to e7 lxcxe motif
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
177
Chain Sequence
NTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSENFSKLLNDNIFHMSLLACALEVVMATYSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RETINOBLASTOMA PROTEIN
publication title Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transcription reg/peptide)
total genus 67
structure length 177
sequence length 198
ec nomenclature
pdb deposition date 1997-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01858 RB_A Retinoblastoma-associated protein A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1guxA00
4EC9B 1E9HB 3EIDB 3TNHB 2UUEB 2UZDB 4CXAB 1D3UB 2WMAB 5LQFB 1JSTB 1H28B 4YOZA 4BCIB 4BCNB 3QHWB 3BHUB 1KXUA 3BHVB 3O0GD 3TNWB 2C6TB 2WEVB 4BCKB 2UZBB 1UNHD 2UZLB 4F7SB 5IDPB 1VYWB 1OIUB 4CRLB 4EOKB 2WHBB 4UN0A 1UNLD 4OGRB 2CCHB 1GY3B 2WIHB 2G9XB 3TNIB 4CFNB 3G33B 3BHTB 4BCJB 1AISB 1QMZB 1G3NC 1ZP2A 1H26B 3EJ1B 3MIAB 5ICPB 2R7GA 4YOSA 2BPMB 4BCND 5CEIB 1OGUB 2C5NB 2B9RA 3F5XB 4CFXB 1JOWA 2X1NB 4KRCB 3MI9B 4BCMB 2W96A 4FX3B 3POMA 1C9BA 2PHGA 2V22B 1H25B 4EORB 3DDQB 1OKVB 4RODA 4NSTB 1H1QB 2CJMB 2WXVB 1OI9B 4CFMB 2PMIB 4ELJA 3BLRB 4I3ZB 1W98B 1TFBA 4BCPB 4EOOB 5L2WB 3M03A 2CCIB 5HVYB 1OL2B 4YOOA 4ROEA 5HNBB 1GUXA 5HBHB 4CFUD 4BCOB 1O9KA 2BKZB 2PK9B 4CFUB 4IMYB 1H1RB 4EOQB 1VINA 4ROCA 2I53A 2UZEB 4TTHA 3DDPB 1N4MA 4YC3B 2WFYB 3LQ5B 3EOCB 2I40B 1H1PB 3TN8B 4EONB 1JSUB 2C5VB 4F7NB 3DOGB 1AD6A 4BCMD 4ELLA 5IF1B 1FVVB 5EFQB 4EOPB 1PKDB 1F5QB 1H24B 4II5B 1H4LD 4OR5B 4F7JB 4EC8B 3QHRB 5HQ0B 2IW9B 2W99A 1GH6B 2C5OB 3H4CA 4BCFB 1OKWB 2W9ZA 2C4GB 2WMBB 4KRDB 5I5ZB 4EOMB 1VOLA 4BCHB 1UNGD 2PK2A 2IVXA 2W9FA 3MY1B 5HBJB 2IW6B 2WPAB 2F2CA 1OL1B 4F70B 4EOJB 4F6UB 1JKWA 1P5EB 5FGKB 4CFWB 4F6SB 4F6WB 2JGZB 4EOSB 4BCGB 3BLQB 4CFVB 5CYIB 5HBEB 1GUXB 4G6LB 4BCQD 4Y72B 1URCB 3BLHB 1O9KB 1OIYB 4BCQB 1H27B 2C5XB 5BNJB 5LMKB 2IW8B 3MY5B 5ACBA 1FINB 3RGFB 2EUFA 4EOIB 5IDNB 2QDJA 1H1SB 2WIPB 3K7AM 4F7LB 4EOLB 1BU2A 2W2HA 1XO2A
chains in the Genus database with same CATH superfamily
2ZPHB 2DXBB 2UZDB 1D3UB 2WMAB 5LQFB 4M6VA 3TW7A 4BCIB 2ZZDB 3PO3S 3QHWB 3O0GD 3BHVB 2CZ7B 2WEVB 3VYHB 4BCKB 2DPPB 3HB9A 4UN0A 1UGRB 2IN3A 3G33B 3BHTB 3BG3A 4AKHA 1AISB 1QMZB 1ZP2A 3TW6A 3DTOA 1OGUB 2C5NB 2B9RA 4CFXB 1JOWA 3MI9B 4BCMB 4FX3B 3HO8A 1TD6A 1OKVB 4RODA 3WVDB 2ZPIB 2WXVB 1QLBA 4CFMB 4I3ZB 5HVYB 4MFDA 1OL2B 1O9KA 5DQVA 4CFUB 3QZ9B 3X26B 2UZEB 4YC3B 3EOCB 2I40B 1H1PB 4EONB 3DOGB 4BCMD 1FVVB 2DD5B 4F7JB 2KMGA 3QHRB 3QYBA 3A8MB 4LOCA 3A8GB 1UGSB 2C4GB 2PK2A 3MY1B 2IW6B 2WPAB 2CZ6B 2F2CA 5FGKB 2CZ1B 4BCGB 4CFVB 1GUXB 3VKHA 1ENWA 5EJCA 1H27B 4JX5A 3X28B 5LMKB 1E7PA 2ZCFB 1UGQB 3HHTB 4BCJB 4ZGDB 4BY7X 2UUEB 3BG9A 3TNWB 3NDQA 1OIUB 2QGSA 3X25B 3DJBA 2G9XB 4BBSM 3B57A 3EJ1B 5ICPB 2DD4B 5CEIB 2QDYB 4HNUA 3HBLA 2ZPFB 4EORB 3DDQB 3M03A 2CCIB 3VYGB 4ROEA 5HNBB 1GUXA 4BCOB 4EOQB 1VINA 4ROCA 2I53A 3DDPB 3TN8B 5DQWA 2C5VB 1AD6A 1PKDB 4OR5B 4EC8B 5HQ0B 2C5OB 1OKWB 5I5ZB 4EOMB 1VOLA 2PJQA 2IVXA 2W9FA 5HBJB 2ZPEB 4CFWB 4EOSB 4G6LB 1URCB 1OIYB 4OB0B 4OB2B 3BG5A 3QYHB 4EOIB 4ZGEB 4F7LB 3K7AM 2D0QB 4ZGJB 1H4LD 4CXAB 1JSTB 4YOZA 1KXUA 2LW4A 1UNHD 4F7SB 2WHBB 1UNLD 2CCHB 3QYEA 2WIHB 2KR6A 4CFNB 1G3NC 1H26B 3MIAB 3QYGB 4OB3B 3A8HB 4HNTA 4KRCB 2W96A 2ZPBB 1H25B 4QSHA 4NSTB 1H1QB 2CJMB 4ELJA 3BLRB 1TFBA 2AHJB 4YOOA 5HBHB 4IMYB 1H1RB 1V29B 2QQ8A 3WVEB 1N4MA 2WFYB 3LQ5B 4JX6A 1JSUB 4ELLA 5IF1B 1F5QB 1H24B 2W99A 1GH6B 3GTMS 3H4CA 4BCFB 2W9ZA 1UNGD 4AKIA 3HZJA 1OL1B 4F70B 4EOJB 4F6UB 1JKWA 4F6SB 2JGZB 5CYIB 5HBEB 4AKGA 3VKGA 4BCQD 1AHJB 2C5XB 4MFEA 5BNJB 5ACBA 4HL4A 3RGFB 3QZ5B 2QDJA 4BBRM 4OB1B 4EOLB 2W2HA 1XO2A 4EC9B 4BY1X 1E9HB 3EIDB 3TNHB 2BS4A 1H28B 4BCNB 2QFZA 3BHUB 2C6TB 2UZBB 3X24B 2UZLB 5IDPB 1IREB 1VYWB 4CRLB 4EOKB 4Z6YA 2BS3A 4OGRB 1GY3B 3TNIB 3KHIA 2R7GA 4YOSA 4AI6A 2BPMB 2WJ9A 4BCND 3F5XB 3QXEB 2X1NB 4JX4A 2DMEA 4BXXX 3POMA 1C9BA 2PHGA 2V22B 2DXCB 1OI9B 1W98B 4BCPB 4EOOB 5L2WB 4CFUD 2BKZB 2PK9B 4TTHA 4MIMA 4F7NB 4NC6A 5EFQB 4EOPB 4II5B 1FKMA 2IW9B 2ZPGB 2WMBB 4KRDB 4HNVA 2CZ0B 4BCHB 1UGPB 4HLQA 1P5EB 3X20B 4F6WB 3BLQB 3DL1A 5IHYA 2CYZB 4Y72B 3BLHB 1O9KB 4BCQB 2IW8B 3MY5B 1FINB 2BS2A 4FM4B 2EUFA 3QWLA 5IDNB 1H1SB 2G77A 2WIPB 3A8OB 3A8LB 2QF7A 1BU2A 2PMIB
chains in the Genus database with same CATH topology
4EC9B 1E9HB 3EIDB 3TNHB 2UUEB 2UZDB 4CXAB 1D3UB 2WMAB 5LQFB 1JSTB 1H28B 4YOZA 4BCIB 4BCNB 3QHWB 3BHUB 1KXUA 3BHVB 3O0GD 3TNWB 2C6TB 2WEVB 4BCKB 2UZBB 1UNHD 2UZLB 4F7SB 5IDPB 1VYWB 1OIUB 4CRLB 4EOKB 2WHBB 4UN0A 1UNLD 4OGRB 2CCHB 1GY3B 2WIHB 2G9XB 3TNIB 4CFNB 3G33B 3BHTB 4BCJB 1AISB 1QMZB 1G3NC 1ZP2A 1H26B 3EJ1B 3MIAB 5ICPB 2R7GA 4YOSA 2BPMB 4BCND 5CEIB 1OGUB 2C5NB 2B9RA 3F5XB 4CFXB 1JOWA 2X1NB 4KRCB 3MI9B 4BCMB 2W96A 4FX3B 3POMA 1C9BA 2PHGA 2V22B 1H25B 4EORB 3DDQB 1OKVB 4RODA 4NSTB 1H1QB 2CJMB 2WXVB 1OI9B 4CFMB 2PMIB 4ELJA 3BLRB 4I3ZB 1W98B 1TFBA 4BCPB 4EOOB 5L2WB 3M03A 2CCIB 5HVYB 1OL2B 4YOOA 4ROEA 5HNBB 1GUXA 5HBHB 4CFUD 4BCOB 1O9KA 2BKZB 2PK9B 4CFUB 4IMYB 1H1RB 4EOQB 1VINA 4ROCA 2I53A 2UZEB 4TTHA 3DDPB 1N4MA 4YC3B 2WFYB 3LQ5B 3EOCB 2I40B 1H1PB 3TN8B 4EONB 1JSUB 2C5VB 4F7NB 3DOGB 1AD6A 4BCMD 4ELLA 5IF1B 1FVVB 5EFQB 4EOPB 1PKDB 1F5QB 1H24B 4II5B 1H4LD 4OR5B 4F7JB 4EC8B 3QHRB 5HQ0B 2IW9B 2W99A 1GH6B 2C5OB 3H4CA 4BCFB 1OKWB 2W9ZA 2C4GB 2WMBB 4KRDB 5I5ZB 4EOMB 1VOLA 4BCHB 1UNGD 2PK2A 2IVXA 2W9FA 3MY1B 5HBJB 2IW6B 2WPAB 2F2CA 1OL1B 4F70B 4EOJB 4F6UB 1JKWA 1P5EB 5FGKB 4CFWB 4F6SB 4F6WB 2JGZB 4EOSB 4BCGB 3BLQB 4CFVB 5CYIB 5HBEB 1GUXB 4G6LB 4BCQD 4Y72B 1URCB 3BLHB 1O9KB 1OIYB 4BCQB 1H27B 2C5XB 5BNJB 5LMKB 2IW8B 3MY5B 5ACBA 1FINB 3RGFB 2EUFA 4EOIB 5IDNB 2QDJA 1H1SB 2WIPB 3K7AM 4F7LB 4EOLB 1BU2A 2W2HA 1XO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC9 B;  1E9H B;  3EID B;  3TNH B;  2UUE B;  2UZD B;  4CXA B;  1D3U B;  2WMA B;  5LQF B;  1JST B;  1H28 B;  4YOZ A;  4BCI B;  4BCN B;  3QHW B;  3BHU B;  1KXU A;  3BHV B;  3O0G D;  3TNW B;  2C6T B;  2WEV B;  4BCK B;  2UZB B;  1UNH D;  2UZL B;  4F7S B;  5IDP B;  1VYW B;  1OIU B;  4CRL B;  4EOK B;  2WHB B;  4UN0 A;  1UNL D;  4OGR B;  2CCH B;  1GY3 B;  2WIH B;  2G9X B;  3TNI B;  4CFN B;  3G33 B;  3BHT B;  4BCJ B;  1AIS B;  1QMZ B;  1G3N C;  1ZP2 A;  1H26 B;  3EJ1 B;  3MIA B;  5ICP B;  2R7G A;  4YOS A;  2BPM B;  4BCN D;  5CEI B;  1OGU B;  2C5N B;  2B9R A;  3F5X B;  4CFX B;  1JOW A;  2X1N B;  4KRC B;  3MI9 B;  4BCM B;  2W96 A;  4FX3 B;  3POM A;  1C9B A;  2PHG A;  2V22 B;  1H25 B;  4EOR B;  3DDQ B;  1OKV B;  4ROD A;  4NST B;  1H1Q B;  2CJM B;  2WXV B;  1OI9 B;  4CFM B;  2PMI B;  4ELJ A;  3BLR B;  4I3Z B;  1W98 B;  1TFB A;  4BCP B;  4EOO B;  5L2W B;  3M03 A;  2CCI B;  5HVY B;  1OL2 B;  4YOO A;  4ROE A;  5HNB B;  1GUX A;  5HBH B;  4CFU D;  4BCO B;  1O9K A;  2BKZ B;  2PK9 B;  4CFU B;  4IMY B;  1H1R B;  4EOQ B;  1VIN A;  4ROC A;  2I53 A;  2UZE B;  4TTH A;  3DDP B;  1N4M A;  4YC3 B;  2WFY B;  3LQ5 B;  3EOC B;  2I40 B;  1H1P B;  3TN8 B;  4EON B;  1JSU B;  2C5V B;  4F7N B;  3DOG B;  1AD6 A;  4BCM D;  4ELL A;  5IF1 B;  1FVV B;  5EFQ B;  4EOP B;  1PKD B;  1F5Q B;  1H24 B;  4II5 B;  1H4L D;  4OR5 B;  4F7J B;  4EC8 B;  3QHR B;  5HQ0 B;  2IW9 B;  2W99 A;  1GH6 B;  2C5O B;  3H4C A;  4BCF B;  1OKW B;  2W9Z A;  2C4G B;  2WMB B;  4KRD B;  5I5Z B;  4EOM B;  1VOL A;  4BCH B;  1UNG D;  2PK2 A;  2IVX A;  2W9F A;  3MY1 B;  5HBJ B;  2IW6 B;  2WPA B;  2F2C A;  1OL1 B;  4F70 B;  4EOJ B;  4F6U B;  1JKW A;  1P5E B;  5FGK B;  4CFW B;  4F6S B;  4F6W B;  2JGZ B;  4EOS B;  4BCG B;  3BLQ B;  4CFV B;  5CYI B;  5HBE B;  1GUX B;  4G6L B;  4BCQ D;  4Y72 B;  1URC B;  3BLH B;  1O9K B;  1OIY B;  4BCQ B;  1H27 B;  2C5X B;  5BNJ B;  5LMK B;  2IW8 B;  3MY5 B;  5ACB A;  1FIN B;  3RGF B;  2EUF A;  4EOI B;  5IDN B;  2QDJ A;  1H1S B;  2WIP B;  3K7A M;  4F7L B;  4EOL B;  1BU2 A;  2W2H A;  1XO2 A; 
#chains in the Genus database with same CATH topology
 2ZPH B;  2DXB B;  2UZD B;  1D3U B;  2WMA B;  5LQF B;  4M6V A;  3TW7 A;  4BCI B;  2ZZD B;  3PO3 S;  3QHW B;  3O0G D;  3BHV B;  2CZ7 B;  2WEV B;  3VYH B;  4BCK B;  2DPP B;  3HB9 A;  4UN0 A;  1UGR B;  2IN3 A;  3G33 B;  3BHT B;  3BG3 A;  4AKH A;  1AIS B;  1QMZ B;  1ZP2 A;  3TW6 A;  3DTO A;  1OGU B;  2C5N B;  2B9R A;  4CFX B;  1JOW A;  3MI9 B;  4BCM B;  4FX3 B;  3HO8 A;  1TD6 A;  1OKV B;  4ROD A;  3WVD B;  2ZPI B;  2WXV B;  1QLB A;  4CFM B;  4I3Z B;  5HVY B;  4MFD A;  1OL2 B;  1O9K A;  5DQV A;  4CFU B;  3QZ9 B;  3X26 B;  2UZE B;  4YC3 B;  3EOC B;  2I40 B;  1H1P B;  4EON B;  3DOG B;  4BCM D;  1FVV B;  2DD5 B;  4F7J B;  2KMG A;  3QHR B;  3QYB A;  3A8M B;  4LOC A;  3A8G B;  1UGS B;  2C4G B;  2PK2 A;  3MY1 B;  2IW6 B;  2WPA B;  2CZ6 B;  2F2C A;  5FGK B;  2CZ1 B;  4BCG B;  4CFV B;  1GUX B;  3VKH A;  1ENW A;  5EJC A;  1H27 B;  4JX5 A;  3X28 B;  5LMK B;  1E7P A;  2ZCF B;  1UGQ B;  3HHT B;  4BCJ B;  4ZGD B;  4BY7 X;  2UUE B;  3BG9 A;  3TNW B;  3NDQ A;  1OIU B;  2QGS A;  3X25 B;  3DJB A;  2G9X B;  4BBS M;  3B57 A;  3EJ1 B;  5ICP B;  2DD4 B;  5CEI B;  2QDY B;  4HNU A;  3HBL A;  2ZPF B;  4EOR B;  3DDQ B;  3M03 A;  2CCI B;  3VYG B;  4ROE A;  5HNB B;  1GUX A;  4BCO B;  4EOQ B;  1VIN A;  4ROC A;  2I53 A;  3DDP B;  3TN8 B;  5DQW A;  2C5V B;  1AD6 A;  1PKD B;  4OR5 B;  4EC8 B;  5HQ0 B;  2C5O B;  1OKW B;  5I5Z B;  4EOM B;  1VOL A;  2PJQ A;  2IVX A;  2W9F A;  5HBJ B;  2ZPE B;  4CFW B;  4EOS B;  4G6L B;  1URC B;  1OIY B;  4OB0 B;  4OB2 B;  3BG5 A;  3QYH B;  4EOI B;  4ZGE B;  4F7L B;  3K7A M;  2D0Q B;  4ZGJ B;  1H4L D;  4CXA B;  1JST B;  4YOZ A;  1KXU A;  2LW4 A;  1UNH D;  4F7S B;  2WHB B;  1UNL D;  2CCH B;  3QYE A;  2WIH B;  2KR6 A;  4CFN B;  1G3N C;  1H26 B;  3MIA B;  3QYG B;  4OB3 B;  3A8H B;  4HNT A;  4KRC B;  2W96 A;  2ZPB B;  1H25 B;  4QSH A;  4NST B;  1H1Q B;  2CJM B;  4ELJ A;  3BLR B;  1TFB A;  2AHJ B;  4YOO A;  5HBH B;  4IMY B;  1H1R B;  1V29 B;  2QQ8 A;  3WVE B;  1N4M A;  2WFY B;  3LQ5 B;  4JX6 A;  1JSU B;  4ELL A;  5IF1 B;  1F5Q B;  1H24 B;  2W99 A;  1GH6 B;  3GTM S;  3H4C A;  4BCF B;  2W9Z A;  1UNG D;  4AKI A;  3HZJ A;  1OL1 B;  4F70 B;  4EOJ B;  4F6U B;  1JKW A;  4F6S B;  2JGZ B;  5CYI B;  5HBE B;  4AKG A;  3VKG A;  4BCQ D;  1AHJ B;  2C5X B;  4MFE A;  5BNJ B;  5ACB A;  4HL4 A;  3RGF B;  3QZ5 B;  2QDJ A;  4BBR M;  4OB1 B;  4EOL B;  2W2H A;  1XO2 A;  4EC9 B;  4BY1 X;  1E9H B;  3EID B;  3TNH B;  2BS4 A;  1H28 B;  4BCN B;  2QFZ A;  3BHU B;  2C6T B;  2UZB B;  3X24 B;  2UZL B;  5IDP B;  1IRE B;  1VYW B;  4CRL B;  4EOK B;  4Z6Y A;  2BS3 A;  4OGR B;  1GY3 B;  3TNI B;  3KHI A;  2R7G A;  4YOS A;  4AI6 A;  2BPM B;  2WJ9 A;  4BCN D;  3F5X B;  3QXE B;  2X1N B;  4JX4 A;  2DME A;  4BXX X;  3POM A;  1C9B A;  2PHG A;  2V22 B;  2DXC B;  1OI9 B;  1W98 B;  4BCP B;  4EOO B;  5L2W B;  4CFU D;  2BKZ B;  2PK9 B;  4TTH A;  4MIM A;  4F7N B;  4NC6 A;  5EFQ B;  4EOP B;  4II5 B;  1FKM A;  2IW9 B;  2ZPG B;  2WMB B;  4KRD B;  4HNV A;  2CZ0 B;  4BCH B;  1UGP B;  4HLQ A;  1P5E B;  3X20 B;  4F6W B;  3BLQ B;  3DL1 A;  5IHY A;  2CYZ B;  4Y72 B;  3BLH B;  1O9K B;  4BCQ B;  2IW8 B;  3MY5 B;  1FIN B;  2BS2 A;  4FM4 B;  2EUF A;  3QWL A;  5IDN B;  1H1S B;  2G77 A;  2WIP B;  3A8O B;  3A8L B;  2QF7 A;  1BU2 A;  2PMI B; 
#chains in the Genus database with same CATH homology
 4EC9 B;  1E9H B;  3EID B;  3TNH B;  2UUE B;  2UZD B;  4CXA B;  1D3U B;  2WMA B;  5LQF B;  1JST B;  1H28 B;  4YOZ A;  4BCI B;  4BCN B;  3QHW B;  3BHU B;  1KXU A;  3BHV B;  3O0G D;  3TNW B;  2C6T B;  2WEV B;  4BCK B;  2UZB B;  1UNH D;  2UZL B;  4F7S B;  5IDP B;  1VYW B;  1OIU B;  4CRL B;  4EOK B;  2WHB B;  4UN0 A;  1UNL D;  4OGR B;  2CCH B;  1GY3 B;  2WIH B;  2G9X B;  3TNI B;  4CFN B;  3G33 B;  3BHT B;  4BCJ B;  1AIS B;  1QMZ B;  1G3N C;  1ZP2 A;  1H26 B;  3EJ1 B;  3MIA B;  5ICP B;  2R7G A;  4YOS A;  2BPM B;  4BCN D;  5CEI B;  1OGU B;  2C5N B;  2B9R A;  3F5X B;  4CFX B;  1JOW A;  2X1N B;  4KRC B;  3MI9 B;  4BCM B;  2W96 A;  4FX3 B;  3POM A;  1C9B A;  2PHG A;  2V22 B;  1H25 B;  4EOR B;  3DDQ B;  1OKV B;  4ROD A;  4NST B;  1H1Q B;  2CJM B;  2WXV B;  1OI9 B;  4CFM B;  2PMI B;  4ELJ A;  3BLR B;  4I3Z B;  1W98 B;  1TFB A;  4BCP B;  4EOO B;  5L2W B;  3M03 A;  2CCI B;  5HVY B;  1OL2 B;  4YOO A;  4ROE A;  5HNB B;  1GUX A;  5HBH B;  4CFU D;  4BCO B;  1O9K A;  2BKZ B;  2PK9 B;  4CFU B;  4IMY B;  1H1R B;  4EOQ B;  1VIN A;  4ROC A;  2I53 A;  2UZE B;  4TTH A;  3DDP B;  1N4M A;  4YC3 B;  2WFY B;  3LQ5 B;  3EOC B;  2I40 B;  1H1P B;  3TN8 B;  4EON B;  1JSU B;  2C5V B;  4F7N B;  3DOG B;  1AD6 A;  4BCM D;  4ELL A;  5IF1 B;  1FVV B;  5EFQ B;  4EOP B;  1PKD B;  1F5Q B;  1H24 B;  4II5 B;  1H4L D;  4OR5 B;  4F7J B;  4EC8 B;  3QHR B;  5HQ0 B;  2IW9 B;  2W99 A;  1GH6 B;  2C5O B;  3H4C A;  4BCF B;  1OKW B;  2W9Z A;  2C4G B;  2WMB B;  4KRD B;  5I5Z B;  4EOM B;  1VOL A;  4BCH B;  1UNG D;  2PK2 A;  2IVX A;  2W9F A;  3MY1 B;  5HBJ B;  2IW6 B;  2WPA B;  2F2C A;  1OL1 B;  4F70 B;  4EOJ B;  4F6U B;  1JKW A;  1P5E B;  5FGK B;  4CFW B;  4F6S B;  4F6W B;  2JGZ B;  4EOS B;  4BCG B;  3BLQ B;  4CFV B;  5CYI B;  5HBE B;  1GUX B;  4G6L B;  4BCQ D;  4Y72 B;  1URC B;  3BLH B;  1O9K B;  1OIY B;  4BCQ B;  1H27 B;  2C5X B;  5BNJ B;  5LMK B;  2IW8 B;  3MY5 B;  5ACB A;  1FIN B;  3RGF B;  2EUF A;  4EOI B;  5IDN B;  2QDJ A;  1H1S B;  2WIP B;  3K7A M;  4F7L B;  4EOL B;  1BU2 A;  2W2H A;  1XO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...