1GV0A

Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
301
Chain Sequence
MKITVIGAGNVGATTAFRLAEKQLARELVLLDVVEGIPQGKALDMYESGPVGLFDTKVTGSNDYADTANSDIVVITAGLPRKPGMTLSMNAGIVREVTGRIMEHSKNPIIVVVSNPLDIMTHVAWQKSGLPKERVIGMAGVLDSARFRSFIAMELGVSMQDVTACVLGGHGDAMVPVVKYTTVAGIPVADLISAERIAELVERTRTGGAEIVNHLKQGSAFYSPATSVVEMVESIVLDRKRVLTCAVSLDGQYGIDGTFVGVPVKLGKNGVEHIYEIKLDQSDLDLLQKSAKIVDENCKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Thermophilic Protein Stability: Structures of Thermophilic and Mesophilic Malate Dehydrogenases
pubmed doi rcsb
source organism Chlorobium tepidum
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 109
structure length 301
sequence length 305
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gv0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1gv0A02
1GUYA 3AI1A 4YB8A 3OJEA 3EZLA 4J0EA 5F1OA 1N1EA 4W82A 4CUJA 1R4NB 1E3EA 1YONA 3QLJA 1YOVB 2JFFA 3FTPA 2BKAA 1ADFA 1PJTA 4IJWA 3BMNA 1NXQA 3G0OA 3GPIA 4HFMA 1DB3A 3DBRB 3RUIA 1NQAO 2I3AA 1GR0A 2VUTA 3FPCA 4CQMD 3E9NA 3KSDO 4CMIA 1P1FA 3K30A 2X0RA 3OIGA 3NX4A 1Y1PA 2PZLA 1PJ2A 3OFSA 2C0CA 1KVTA 3OA2A 3F47A 3GH3A 5T64A 5I8ZA 2EP7A 1YB5A 3AFMA 4L73A 1I10A 2WE8A 2DBZA 4XGKA 2Y1OA 3K8ZA 2CZCA 3KLPX 3ZU4A 3RUHA 1PGOA 3LU1A 4Y98A 3GF4A 3FBTA 3L6EA 3WIEA 4UAGA 2BGMA 1D1SA 4WGGA 5BQFA 1EFLA 4E5YA 5MGBA 3AY7A 4URFA 4FFRA 3UF0A 3U3XA 2R2GA 3MJ4A 4FOOA 3E5MA 3AJRA 3KEOA 5U9CA 1UZMA 4AJIA 2JHFA 1FF9A 1DRWA 3DOJA 1R0KA 4UVGA 1DAPA 4O6VA 2FN7A 3U0BA 1U8XX 2V6FA 3RFTA 7ADHA 4GPD1 1NYTA 4YT2A 3JQ9A 3PJDA 3DOOA 4BNMA 3BMCB 1O6ZA 2EW8A 3D4PA 2J3HA 1WXDA 4NG5A 3HHPA 1SMKA 5IZCC 4MKXA 4JN6B 1ZK4A 1PJ4A 1QRRA 4CM3A 4RF5A 2IEBA 3H5RA 4BNTA 2BFOA 3EW7A 1Z73A 1U3UA 3OBBA 1P3DA 4NK5A 4TRJA 4EI2A 5TLSA 1G1AA 1F14A 2XOXA 2D5AA 3QA9A 4NZ9A 2CNBA 3C7DB 1E7RA 3GDGA 4R1TA 4XKJA 1NM5A 3CMMA 4FC7A 1Z74A 4ZN6A 1EE9A 3KRTA 1YWGO 2DTXA 5A4DA 1R4NA 3A9WA 5JW6A 4A03A 4WPGA 5T5QA 3INTA 3NGXA 4BB5A 3HN2A 3L4SO 1YS4A 4NNJA 3HN7A 1GZ4A 4YTEA 1PQPA 5AXBA 4CV3A 3QVSA 1NR7A 3W4JA 2X9GA 3EVNA 3GT0A 3GEMA 4QSMA 4JQCA 1O94A 5KJFA 3V2UA 3CTMA 4XRGA 1BHSA 1KYQA 5JDCC 3FSRA 2AEFA 2LDXA 4PLGA 4ZQGA 4BNUA 1A71A 1DRUA 2B35A 3W6UA 3QWFA 1IHYA 1BRMA 3KYBA 1V3TA 2Y66A 2HCTA 5IAAA 5IXYA 5TGDA 4ND4A 2HUNA 1LEHA 2AQ8A 4ZRMA 3N7UA 2I99A 2JCVA 2W2KB 1HYEA 4DIOA 3ZCXA 2RCYA 3D3WA 1K2WA 4JNKA 4R54A 2NQ8A 3ROMA 5BSHA 3RC1A 2I76A 4RZHA 3OA0A 5EJ2A 3JCZA 2RH8A 2XXJA 4RGBA 5EESA 1EQUA 3AOEC 3ZHZA 4R3NA 3D4OA 1ZH8A 2LDBA 4GVXA 1YVEI 1DPGA 3Q2IA 4NH4A 4WJZA 1Y8RA 1ZCJA 3E5RA 5CP8A 3PIIA 4E5NA 1JWBB 3GGGA 5A3VA 1OAAA 3DHEA 3TF5A 2ZCUA 4A10A 1XIVA 1B16A 3GAZA 4MDHA 4R1UA 3VPXA 1ISIA 3WFJA 4B7CA 2P9GA 4Z9XA 2I66A 2B69A 5H82A 2IXBA 5C7OO 3H9EO 2PGDA 3ONFA 3D64A 1UZLA 1T4BA 4TSKA 4ZQHA 4KDFA 2VTDA 3GHYA 3WOHA 5G4KB 4GSKA 4W99A 2D8AA 3I6QA 1XKQA 3G49A 3JQEA 4PLWA 3JQFA 3RUCA 2AEMA 2X9NA 3F46A 3EAGA 4HNGA 4P4LA 2EJWA 4Q9NA 5DBGA 5JBIA 2NACA 4LK3A 4GVLA 4YR9A 2FRDA 1CYDA 1JTVA 2AQKA 3DTTA 4J9VA 4J1TA 1D3AA 4NFHA 4KOAA 4CLRB 1P44A 2O3JA 3JD1A 1QYCA 2GO1A 3NDRA 2ZK7A 1EVIA 4WLEA 3ORFA 4CLOB 2H5LA 2HAEA 1I2CA 4ND5A 2NUAA 4CMHA 2DBRA 3KUXA 4R69A 4L4RA 4K1LA 4GMGA 4NBTA 1V35A 2G0TA 3NT4A 5LC1A 5KTKA 3OF2A 5B4TA 3VKUA 3ON5A 1UP7A 3PGJA 2VRBA 2JAPA 4D79A 3H4VA 3WGYA 1B8PA 1N9GA 3ZDFA 4J7UA 4E13A 5FI3A 5JXWA 4DLBA 3H5AA 4DPMA 2C5AA 3O8QB 5ENVA 2PWZA 2GASA 3DR3A 4U0JA 1KS9A 3E9MA 4LW8A 5HRUA 1RWBA 2WSBA 4GAEA 3WSVA 1AHHA 2EP5A 1CRWG 2IYPA 3AI3A 3CKYA 4J1SA 5AQ1A 1Z82A 4IINA 3AUSA 1PZEA 3G17A 5I9NA 3CH6A 3OH8A 1WW8A 5JY1A 4O5OA 1HDCA 3BXXA 1I3NA 1HLDA 3QW2A 3VKVA 3GVCA 1DIBA 2IDZA 2O3RA 3R3SA 5TSDA 3BA1A 1DFIA 1X1EA 1MXFA 3FNHA 3GEGA 3WBFA 3ZWBA 3G1UA 3LYLA 4IZIA 3OICA 4XQ9A 2ET6A 3ZHYA 4CM4A 3F6YA 1I5RA 3R3JA 4D3SA 3VZSA 3QQPA 2Q2VA 1Q0LA 1KERA 3PYMA 4M1QA 3DONA 1NHWA 3C1TA 1MV8A 3PZBA 1E3WA 3WJ7A 1CQIA 5KKAA 3IUSA 3FR7A 4S1VA 4XWYA 3DAGA 2FR0A 1EUCA 5JAQA 5CEJA 4C7KA 3LT4A 1TLTA 4KTVE 2HRZA 1DFGA 2VCYA 3H9JA 3E6AA 4Z3KA 1FMCA 1TI7A 4II3A 4U8GA 3EDMA 1LDYA 4E31A 5TT1A 4CM9A 1E5QA 3DQPA 4TVBA 2P5UA 1VE9A 4DIBA 4E4YA 2NU9A 2GZ3A 2Y93A 4B8ZA 1YDEA 1VJ1A 1C1XA 1A4UA 4KQXA 2B83A 2ZATA 2PKQP 4PN3A 2HLPA 1GPDG 4OMUA 2PFGA 1PS9A 5BNTA 5AYVA 4FJ1A 2D0IA 4BGVA 6LDHA 2PZJA 4J91A 3ITDA 4XDYA 4MKRA 1LRLA 1Z75A 1V3UA 4KTTE 2BHLA 3GRPA 4KWIA 2CDBA 4PRKA 4D43A 1MXHA 3LQFA 1KOLA 5CDTA 2ILTA 3DB2A 3GDOA 4U6SA 4E30A 4IZHA 3VTFA 5CDYA 3H6KA 3NJ8A 1F06A 2NQTA 4G2NA 3PRJA 3F1LA 3DMTC 2WJPA 4CLOA 1C14A 3LLSA 1HYGA 1ULUA 5G0SA 1XDWA 1L1FA 4R9RA 4RPKA 1ZSYA 4G5HA 2VOEA 3QVTA 1C3VA 3MWDB 2UDPA 3RFVA 3RAJA 1I2ZA 3L77A 2W2LA 1HE3A 4DGSA 2QQ5A 3GLQA 1PGPA 3RVDA 2HMSA 1C1DB 3PZRA 2O4UX 1NNUA 3O03A 3M1LA 1N8KA 4ALLA 4LCJA 2EWMA 4RPJA 5GMOA 3JQ7B 3OSUA 2A35A 5ES3A 2YZ7A 1PL8A 3HWRA 1VL0A 3DFZA 3D5TA 1Q7BA 3NTRA 4CLDA 1PL6A 1TXGA 4TVOA 1E6EA 2G76A 1E7MA 4PLVA 1PX0A 2PZKA 1EVJA 3JQ6A 2JAHA 3TZKA 3ZWPA 4J1NA 4CMJA 3LC7O 3AI2A 4BNXA 4J2HA 1EVYA 4BKQA 1UXKA 3MWEB 4CPDA 3ZZNA 2DBVO 4H7PA 3GHHA 3GN1A 3ASUA 3E1KA 4XIJA 4ZA2A 1CEQA 1XWFA 1YDWA 2O3TA 4D3FA 4XGNA 4JBIA 2ZB7A 3NUGA 2YHUA 1PU2A 1G6KA 3F4LA 2QRJA 5DBFA 1Z7EA 3OIFA 3H65A 5CG2A 4J1QA 3VDQA 1I33A 3PLRA 1T26A 3ONDA 4LVUA 1HE5A 3JQAB 4GX1A 2ZJ1A 1HSZA 3EY4A 4PLYA 2YYYA 3T7EA 1GY8A 4Y67A 4U0KA 4BNWA 5T57A 3QWAA 3JD4A 5F1PA 2Q49A 3K73O 3HADA 1ISMA 1MFZA 3GUYA 2BMAA 3AU9A 2ZJ0A 1BTOA 3OHSX 4ND3A 4MP6A 3F5SA 4AJJA 1SEPA 5C7LO 1VLLA 1Z7BA 2VHVA 3VZQA 5G0TA 3FNGA 1DC4A 1DSSG 1CIVA 4LN1A 5DN9A 2AW5A 2R00C 4DLAA 1LDMA 4EUHA 2PR2A 1I8TA 3QJ5A 1I30A 3MTJA 2RHRA 3GNTA 3JQCA 3HG7A 4GX2A 1S7CA 4WEQA 1NFQA 3U09A 3GMDA 1PJ3A 1UXHA 4B4VA 4BO9A 1LDGA 3L6DA 1Y5MA 1YB1A 1RM3A 1UZNA 1CWUA 3I3OA 4LMRA 4TWRA 4QEDA 2EJVA 3KEQA 4NMHA 4GX0A 3WYCA 1O5IA 1O89A 4CL8A 3PFWO 2UV8A 2VQ3A 3O38A 2WD7B 1OI7A 1ZVMA 1PGQA 5JE8A 1SBYA 2R00A 2VNAA 1ZBQA 1LLDA 2JD2A 2GNAA 3GA0A 4YCAA 3LLVA 1B0AA 3BTUA 4BNIA 2ZTVA 1X1TA 4D42A 3D4NA 3AOGA 3W1VA 4CM9D 5JDIC 1R0SA 2JFHA 3LT0A 4MKZA 4WEOA 3E03A 4IY1A 4I08A 5I8WA 3U4HA 3PHHA 1ZXLA 3IKTA 2O50A 2DUUA 4IDDA 4RCVA 2GSDA 3DZIA 4OJNA 1DC6A 4DPKA 1ZKMA 2H6EA 5GZ6A 1T2AA 4MJLA 4MVJH 4XR4A 3KLMX 5DZSA 4CQMA 4RVUA 4A5OA 1KVRA 3SXPA 1KVUA 4IJVA 4OIMA 5CAEA 4DTIA 3I9KA 4QFDA 3WSWA 3L07A 1LLUA 3B6ZA 2ZQYA 3RKRA 4E32A 3GY0A 3MCVA 4R9SA 4OOEA 2P91A 3PPIA 1HDOA 5JDIA 5JYDA 5EQDA 4IQ0A 1BXGB 4O0LA 5ITWA 2WDZA 4DQUA 4B4UA 3ZNNA 5TT0A 1NVMB 3PXXA 4WASA 2V6BA 1DEHA 2ZYDA 4TROA 1E3IA 1H6BA 2CDCA 2AEJA 3ICPA 4XGIA 7MDHA 5TC4A 1QV7A 3AM5A 3VPGA 4CLHA 1HE4A 2I9PA 3F5QA 3HDYA 4GSLA 5FI5A 4NPCA 4DXHA 3KM0A 4OHUA 1LSJA 1QYDA 1WDLA 2EF1A 4YEDA 1G0NA 4YAGA 4BO3A 3OEYA 4OKIA 5JSFA 1R12A 3PP8A 2X6TA 3U62A 2EHDA 1GQQA 3T7CA 1WPQA 3PFFA 4GMFA 4QXMA 2GN8A 5EINA 4ZQEA 5GZ1A 3AWDA 2PD3A 3STHA 3MTGA 1PR3A 3CZMA 4TRRA 2VHZA 3DBHB 4I9NA 1I3KA 4I5DA 2WMDA 3DMYA 3BAZA 3TOZA 5G0WA 4B3HA 4BNLA 1GD1O 2YHIA 1E77A 1FJHA 1UP6A 2POQX 3CMCO 3A14A 5BR7A 1DJQA 4YT8A 5B12A 2JD0A 1NQTA 1EVZA 2OBNA 3WYBA 3DXFA 3GQVA 3WMWA 1V8BA 2OORA 4JX8A 4EBFA 3SC4A 3RWBA 5GZ3A 3I5MA 3CUKA 3TL3A 4YAKA 1FDVA 1M2WA 1X0VA 3WG9A 4ALKA 4R5HA 1BXZA 3PVZA 4OGWA 4A0SA 4CQLA 4EUFA 5F3RA 1Y8QA 4CQMB 3GNQA 3RC2A 2B4TO 2FWMX 2W4QA 1YO6A 1E1LA 1NQ5A 4A73A 1XCBA 4IS2A 1B26A 5ILOA 3V2GA 4XYBA 3UUWA 3OJ0A 4PLHA 1V3VA 2I6TA 4BO1A 3GG9A 4OKNA 3RASA 4ZD6A 2AQIA 3PEFA 3IP1A 4FQ8A 1VC2A 2OP1A 4FIZA 3OJOA 3AUTA 4E21A 4QO8A 2NV6A 5A1TA 1E1NA 1DXYA 2NM0A 3PDUA 1IULA 3KB6A 3R1IA 2WD7A 3NEPX 3DBLB 2EXXA 4NFYA 2B37A 4U7WA 2VYVD 4IXTA 3UCFA 2GR9A 5EERA 1ZMTA 1NBOA 4ILKA 4NJOA 1ISGA 3ANLA 1U5CA 3GMSA 1SC6A 3Q2KA 1NFFA 1GDHA 2J5RA 4LMPA 3DEYX 4UEJA 2O3SA 1DLJA 1K6IA 2Q1TA 3PHLA 1B8UA 5L40A 2X86A 4HX5A 1E7SA 3JYOA 1GAEO 3IJPA 3KV3O 4RVGA 4EJ0A 2X22A 2Q4EA 4HBGA 4CM8B 4XEHA 3UAGA 2VWPA 3TJRA 2VYNA 1MA0A 2BI7A 5TRTA 5JC1A 2EKLA 1YBVA 3JQBC 4JJGA 4Q3AA 3RBVA 1ZNQO 1YL7A 3WBBA 1VL6A 4EW6A 5K6AC 2RBEA 3BMCA 4DC0A 1AGNA 2ZYGA 3U4IA 1H5QA 3F9IA 1LNQA 1E92A 2AA3A 1AXGA 2BRUA 3RC7A 5C5IA 1WMAA 4HFJA 3S2IA 3V8BA 2OP0A 1JA9A 4IS3A 4XB2A 1DRVA 1W6UA 4EJMA 4P38A 4PRLA 5KVSA 4CUKA 3VAZA 1NPTO 4Z9FA 1NAHA 4L4SA 2GN6A 3QWIA 2FPIA 3F3SA 4CMAA 4F3YA 5IG2A 1WVGA 2C2XA 2I5PO 1PL7A 4F6CA 1M6HA 2O2SA 5DOVA 3WQSB 2G1UA 4CQLB 1KC1A 4AJLA 2NSDA 5DF1A 2VHYA 4CR8A 5L4SA 3PQEA 4PFJA 1CF2O 3ANMA 5A04A 1KY4A 1B2LA 3OIDA 1E3SA 1HZJA 3AM3A 4Q3DA 3JQGB 1U3WA 1LRJA 4DYVA 5JAMA 2OMEA 2G17A 2NTNA 4AJKA 5KKCA 1YBAA 2H1SA 4BNGA 3IDSA 3BHIA 1WNTA 5L51A 4FPXA 1CERA 4BO7A 4BUCA 3HJAA 2A92A 2E82A 4PZEA 4GH5A 5L9AA 3BMNB 4H16A 4WCDA 1TT7A 2VWGA 1UAGA 3LT1A 3TZHA 1UJMA 3WB9A 1KC3A 4BO8A 3JQ7A 3NTQA 4HP8A 4YAIA 3WFIA 5I7FA 3B20A 1P1HA 4QUKA 1T24A 2HMWA 2YV3A 3W4IA 3WICA 2DTDA 4PZDA 1WDMA 3WXBA 3BMOA 4DMLA 1HTBA 3RKUA 1HSOA 1KBZA 2AMFA 3DL2A 3IP3A 2C82A 2ZTUA 5TJHA 3DZHA 4DC1A 1B15A 5B4VA 5IN5A 2E4AA 4ND2A 1P74A 4ALJA 5TF4A 4IQGA 3WS7A 3NT5A 3JV7A 2AE2A 3CEAA 4IQ8A 4CMEC 1BW9A 3VPFA 4WECA 3GGOA 2VZ9A 3QWHA 1DC5A 1DLIA 4IM7A 3S2EA 4MIYA 4J0FA 3HDQA 3A4VA 1CJCA 1H2BA 2X7HA 3ZWAA 1M66A 3R0IA 5T67A 3UGKA 2X0NA 3JYQA 3UH1A 3WMXA 4E6PA 3TL2A 4IDAA 4L75A 3C24A 2BGKA 4E3ZA 1E6UA 5KOIA 2FY8A 2YDYA 3P5SA 1U8FO 3PHGA 1P1IA 1JAYA 2CVOA 4Z6KA 1CQJA 2H9IA 2Q1UA 3WYEA 4BNHA 1P1JA 4J4BA 4D0SA 4M87A 1ORRA 4B7XA 3ZWVA 1FK8A 2HDHA 1TEHA 3H3JA 3JD3A 1VSVA 4R4JA 4MOWA 4BO6A 1E0DA 1ULSA 2TMDA 1ENPA 1D1TA 1Q0QA 1GFSA 1GV1A 4BNNA 5EQFA 5KNLA 2DT5A 3EYWA 1ENZA 3L4BA 4XQEA 5AXCA 4KP7A 4GGPA 2VWQA 1EK6A 4Q3CA 5KVQA 1EFKA 3LVFO 1KEVA 4FFPA 4W4TA 4JCOA 1VJTA 1MC4A 1PJBA 1XU7A 3DAPA 3C3XA 5ILGA 2QRLA 4EEZA 1LLCA 5FYDA 3TZQA 1L7EA 1Y7TA 2GZ2A 3U4DA 4DQXA 4UUMA 4YVFA 5JMWA 1HDGO 2SCUA 3H2SA 4DREA 3HUDA 3NT2A 4DBZA 1A9ZA 1T4DA 4NJMA 1MGOA 4PZCA 2WYVA 3DC2A 2WD8A 4IGFA 4JIGA 2Y1GA 4Q3BA 5BSEA 3ENNA 2D1YA 2QIOA 3H7AA 4GWKA 1RYDA 4L76A 4F6LA 2AQHA 4BO5A 2DKNA 2X58A 4YJFA 4RPGA 3SX2A 3RUFA 2O7SA 3S1LA 4CV1A 3DZBA 3LDHA 3VHRA 5AXAA 3RU9A 1H9BA 3DFUA 1PR9A 2F1KA 4FJ2A 2HRBA 1JLLA 1GADO 2ZKLA 1LC3A 4XD2A 2FP4A 2FMUA 1X7DA 2CF6A 2X1HA 4RQUA 2Z1NA 2JD1A 1JKFA 3L6OO 4IPTA 4R41A 3ZWYA 2DPHA 2UYYA 3ZNQA 4B3IA 3QP9A 3INRA 3M2TA 5HBRA 4CMBA 4MVJA 1PJCA 3JTMA 3PQFA 4AJOA 4DQVA 4TZKA 1NWHA 2P9EA 3O8QA 3RCBA 1JN0A 2CY0A 1JW9B 2A94A 1Y8QB 4LVCA 2IEDA 3WNVA 1RPNA 2JCYA 2V6MA 4WKGA 1KIFA 1V0JA 4FFOA 3KETA 1U4OA 3AOEA 5AVOA 3PWZA 3HSKA 3JQDA 4N54A 4HNHA 4BO2A 5KCZA 4YYZA 1GYQA 4FJ0A 4DUPA 4OXYA 5A05A 1IOLA 2D2IA 3ETDA 3G3EA 3ZN2A 4BKOA 2BH9A 2FSSA 2QX7A 2QW8A 3ZU3A 3HFGA 1ZUD1 1RM4A 5CEFA 4EZBA 4CMEA 3GNSA 2YUTA 3EMKA 4MO2A 1C0IA 3T4XA 2AE1A 1P33A 4Z9YA 4E33A 2Y67A 1T1RA 4CUZA 4W7HA 2G82A 2Q2WA 4RORA 2EIHA 1D8AA 3U5TA 4IIUA 1P1KA 4XIYA 4CL3A 1DJNA 3PHIA 5COAA 3ZNOA 1NTOA 4JJIA 4M55A 4S3MA 3WGGA 4DRYA 5FWNA 4JGBA 2J5QA 1OC4A 4Y8VA 1NVTA 1PEDA 3FR8A 1ADCA 3PK0A 4IJUA 4AG3A 4ID9A 3UHAA 3EGOA 4KWHA 3OQ6A 3GZNB 1HLPA 5ITVA 2JCXA 1SO8A 2Y1EA 5IDYA 1YB4A 1F17A 3GN2A 3MJSA 1AHIA 1ENOA 1QYVA 1T2FA 4BO4A 4XYEA 5L7TA 1M6WA 4EITA 3C1OA 3ADPA 1YJQA 1WLYA 4HY3A 4AJEA 4U6QA 3LC1O 3GVHA 1IUKA 1T2DA 1K0UA 3LF1A 1EEHA 2C07A 1QORA 3GVIA 5L7WA 4I5FA 1NQOA 5B37A 3P2OA 5T8KA 4BKUA 1NX6A 3H3FA 4YAJA 5IDQA 5IZCA 5C7IO 3GK3A 1YH3A 2UVDA 4BNKA 3ZH2A 2JJYA 5I7EA 4IJKA 2D5CA 4J3FA 3VZRA 3FNFA 3TWOA 4MIOA 1M67A 3KO8A 3NV9A 3LK7A 1P77A 3GEDA 3PQDA 3QSGA 2IYOA 1ARZA 1ZXBA 1W0CA 1DC3A 2HO5A 1LSSA 3PGXA 3EUWA 5EPOA 4F45A 1XGKA 4FFNA 4IIVA 4ZQFA 5JNLA 4MP8A 1MC5A 4RF2A 2ZTLA 4NR0A 4GWGA 1I3LA 3TDKA 4K9DA 3P7MA 4YACA 2FR1A 1M76A 2H63A 3D1LA 4UVDA 4NBWA 3H8VA 2B36A 3H9QA 1XSEA 5KVVA 3FBGA 1DDOA 3KSZO 4KUGA 2X5KO 4LRSB 4WCFA 3PLNA 1UAYA 3AUAA 3RBZA 2B4QA 1QKIA 4EDFA 4W9NA 1HZZA 4R01A 4CM7A 1YGYA 5IFLA 1BDMA 3W4KA 4BNFA 2DC1A 2IZ1A 1J49A 3TQHA 4ZJUA 3UN1A 5LCXA 3P19A 1V9LA 3VPHA 3WTBA 1K3TA 1KVQA 2YDXA 3RUAA 4CM4B 1VPDA 5ICSA 5L4LA 5I9MA 1I01A 4J9UE 4MINA 3FCOA 3PWSA 4HXYA 4OSOA 5CPFA 4AJ1A 1GEGA 3WGHA 3Q9NA 1E7QA 2X8LA 4YJDA 1VJ0A 3K31A 4LISA 3F1KA 3NGLA 4I1IA 3HZZA 1DIAA 1R37A 1Z45A 3PJGA 4UVHA 2TMGA 4D45A 2OFPA 4YQZA 1PTJA 5G0VA 3INGA 5A06A 2CVZA 1UXGA 3VH1A 3D5QA 1N1GA 5MDHA 3PWKA 2FPPA 1LQTA 1YXMA 1GQYA 1EUDA 2YQ5A 1I2BA 4XJTA 1UP4A 4Y6SA 1A27A 1D7OA 3I83A 3I4FA 1HT0A 2X5OA 4YJGA 4DLLA 2HJRA 1JU9A 4G65A 4CLXA 1XELA 1I0ZA 1KEPA 3RD5A 4FGSA 2Y1FA 3DTYA 1LRKA 1CDOA 4TRMA 5TNXA 1R6DA 3WGTA 1ZJYA 3VH4A 2GERA 2GZ1A 3B1KA 2DFVA 3H9GA 1BDBA 3C1AA 3KSUA 2I67A 3DMTA 4WLOA 2ZB3A 3HDHA 4M54A 3GGPA 2NTVA 3V2HA 3W8EA 2VRCA 4OQYA 4FW8A 3TN7A 3HE3A 4GI2A 1N7HA 3E82A 5JAZA 1YBMA 4BNYA 1B3RA 2VHWA 4R5MA 1XYGA 3GDFA 5L53A 3PTZA 2CUKA 3NJ4A 3FD8A 1LXCA 2IZ0A 1EZ4A 4BGEA 1WMBA 3FI9A 5T8KC 5I7SA 3ROQA 2AXQA 4QFCA 5JFOA 2GD1O 2HMTA 4GL4A 4KDEA 4L74A 5IXSA 3VPSA 2O4CA 1N7GA 5HM8A 4RO0A 2YFQA 1HL3A 2VYVA 1I3MA 1RM0A 5AXDA 1HDXA 2O2YA 2G5CA 1LTHR 3KXDA 1E7WA 3AFNA 3BMOB 5EL0A 3GG2A 1GCUA 1BXKA 4AJNA 2EG9A 4H3VA 3BZUA 4L4XA 1LDEA 2NWQA 1XHLA 4CM5A 1ZO8A 1ADGA 1MB4A 1MUUA 1ZJZA 4G81A 4MVJM 5JAIA 4IDBA 2Y0CA 4BO0A 4DL9A 1AN9A 2C7GA 3PIDA 3GAFA 4J16A 4EJ6A 2W90A 2VWHA 4NHEA 4M86A 2Y1DA 2O7QA 3G79A 4FR5A 1MLDA 3TSCA 3ZV3A 4MVJG 4PVDA 4R16A 1ZZEA 3UCXA 2JHGA 1QXSA 4ALNA 2EW2A 3ROKA 1E1MA 5K9ZA 4PCVA 3OEWA 1T2EA 1X0XA 1PGJA 3UXYA 1WZIA 1ZK1A 4NQZA 1KVSA 3PJFA 1H6AA 4W7IA 1FDTA 4D3DA 1ZK2A 1OC2A 4XYGA 1H2HA 2W8ZA 4DVJA 5B4UA 3WX0A 1F8GA 4J7XA 4ESOA 3D3WB 5COQA 1RM5A 3WJAA 1NP3A 1P45A 3CZRA 2VN8A 1XG5A 3OQBA 1BSVA 4RVHA 2FHSA 4HFRA 3ADOA 3KHUA 5KIAA 2PD6A 3JQ8A 2PZMA 4KMSA 2RAFA 3FPLA 4O59O 1BVRA 4J6FA 3PDJA 1GYRA 3VVCA 1DIHA 3ZHBA 2OZPA 2E49A 4RLSA 1FDUA 1NHGA 4ZU3A 3MJTA 3W6ZA 1KEUA 4PLFA 4JBGA 3JQAD 3RROA 1HXHA 4GKBA 3A28A 1ZW1A 2Q50A 3ZWXA 4BKRA 2HK9A 1FDSA 5H83A 3RC9A 2WYWA 3QVOA 1PJSA 4E12A 4XDZA 5F5NA 1E3LA 3C8MA 3GZ4A 2RIRA 4K6CA 3O9ZA 4AJ4A 3BMQB 4R51A 3EZYA 4YAEA 4JP3A 1NR1A 1H6DA 4P22A 3C7CB 4MVJI 1L7DA 5CFZA 5G4LA 2GN9A 3AUUA 2IRWA 4TMFA 4E0BA 3H2ZA 4FN4A 4P4NA 2D59A 1SB9A 3E8XA 1V6AA 2DU8A 1JDJA 4PG6A 5F21A 3TPCA 4BMSA 1R66A 2C29D 1ZK3A 1P0CA 5I7VA 2VHXA 4IBOA 1PGNA 3EVTA 1IPEA 3SEFA 2OOSA 2OHXA 1D4FA 5THQA 4YJHA 4YRDA 4F46A 1PZFA 3PHJA 4UULA 3WQQA 3HB4X 2GN4A 1U3TA 3UICA 2GUGA 4XCVA 3Q1LA 2RHCA 4NK4A 1NVGA 3TOXA 2NU7A 5FFFA 4J4TA 1O95A 5BSFA 1OFGA 2PH3A 3HFSA 1IL0A 3K96A 4HADA 1FXSA 5HTOA 3A06A 4NI5A 5HS4A 3ASVA 3RJ5A 2VNSA 4IDCA 2BD0A 4N5LA 3S55A 1I24A 4TRNA 4OO3A 1SZJG 3QY9A 1HWYA 5EN4A 1ML3A 4BB6A 1BGVA 4IDFA 2DAPA 4J2OA 1XQ1A 4A7PA 9LDBA 1U28A 3DHNA 1GL3A 2GF2A 3CINA 1VI2A 4J90A 5JLAA 4PGFA 2Q45A 1EMDA 3ZWWA 4ZGWA 2BI8A 1J0XO 1WWKA 4FC6A 2OO5A 4WOJA 3LT2A 4CMIB 3ZGYA 5IDWA 5BNIA 2Q1SA 1RYEA 3AY3A 3KYDB 1J5PA 1E5LA 3DBRA 4BNJA 3FWZA 4RDIA 3QV1A 4CMKA 5HWSA 2YHIB 5JY6A 1SCUA 4BGUA 5A3JA 4CLRA 3TFQA 3TNLA 4D46A 1GEEA 2GGSA 4DIFA 2CF5A 3BMQA 3OQ1A 4PG5A 4TKMA 2Z95A 3GFBA 2QHXA 3S2GA 3ZU5A 1JKJA 1HYHA 5TJ9A 1LC0A 2PGJA 1YOVA 1OZAA 4RLHA 3LSYA 3U4CA 4RF3A 5L3ZA 5TX7A 1XQ6A 2NVWA 4MPDA 5DCWA 3K5PA 1OOEA 3VZPA 1Q0HA 1UUFA 5JO0A 4MP3A 4CR6A 3VDRA 3ZHXA 3GVXA 2NVBA 3BHJA 1YRLA 3RSHA 3L9XA 4FBGA 3U49A 1W4ZA 5JYEA 3ENKA 4KUEA 4XR9A 5HS6A 3WLEA 3GFGA 1GU7A 5JMPA 2GPTA 2Y68A 4CJXA 1EDOA 3NDIA 4XYLA 3QWBA 4WNCA 3KYCA 4FSHA 2J3IA 3TFOA 1A7KA 5EMHA 1KEWA 1UXIA 2IXAA 4XRRA 1E1KA 1HF3A 1LA2A 3MZ0A 5JCXA 3JQGA 3BYZA 5BSGA 3DO5A 4WLUA 1BXGA 3GR6A 1LSOA 2VRCD 4OYRA 2IE0A 4Z0TA 3JD2A 2NLOA 3WNQA 3OETA 1IZ9A 1DHTA 1YL5A 5L7YA 4FOSA 1I36A 3QVXA 3M2PA 3BTOA 3ZWMA 2WTBA 3NTOA 4Z0HO 3KBOA 4RJTA 3I4CA 2DPGA 5JCJA 4WLFA 2O48X 4N5MA 2YW9A 3NDJA 1PZHA 4HWKA 1JQBA 4FFLA 2HJSA 4WK6A 3Q0EA 5F1KA 4M89A 4ZVVA 5A5EA 3NKLA 3TRIA 1AE1A 1LI4A 1PJLA 2AG5A 4Z3DA 4PG8A 3Q11A 1PWXA 1DAOA 1ZEMA 1KY5A 4I5EA 5U1PA 2O3QA 2Y1CA 1LUAA 4K26A 1A4IA 4K6FA 3ZV6A 3ZWNA 4FB5A 4FDAA 4P8RA 2BF7A 2O3UA 4BV9A 2C54A 1PS8A 5L45A 3ZW9A 3I9LA 2W2LD 1X7HA 1HDRA 4BMNA 5KWEA 2JKVA 1SNYA 3VOSA 2DVMA 3RBXA 5CEEA 3IL2A 3E48A 3V1TC 5F5LA 4IUYA 2EEZA 4OL9A 4XX0A 5KJ6A 4GGOA 2Z5LA 4NIMA 5IN4A 2BFAA 2PK3A 3OJFA 3QHAA 3U9LA 1YJ8A 1PSDA 3RU7A 2P68A 3R6DA 4BQPA 5JCJD 2PLAA 3ZI0A 5B1YA 3JYNA 4JJFA 4KZPA 2PKQO 1NFRA 3BTVA 5AOVA 5TQVA 3B1FA 3M6IA 4XQGA 3ZWOA 3DBLA 5CG1A 3DZKA 4IXWA 3Q6IA 4ALIA 2FZWA 1EQ2A 1Q7GA 3ROPA 2OGUA 4D44A 2NU6A 2YFHA 4FFMA 3EK2A 3VH2A 4AVYA 4D41A 1BWSA 3X2EA 2C20A 5TS3A 3ANNA 4Y6RA 3HNPA 2FSVA 2UAGA 3IUPA 4CM1A 2VUUA 3A1NA 3L0DA 4WLNA 3O26A 1B7GO 3NAQA 1H6CA 4EGFA 3FNEA 4RF4A 5HA5A 3FF4A 3FRJA 4BGIA 2VOJA 3JQ9C 1H9AA 1XU9A 1O0SA 1VRWA 5KJCA 3SC6A 3JQAA 1NASA 2J8ZA 2NVUB 4RPLA 4HFNA 2HU2A 4DA9A 4YA6A 2RH4A 4YJHB 3UCEA 2ZIZA 4CV2A 3K6JA 3ULKA 4W6ZA 5FF9A 1LBEA 4NFSA 4XA8A 2CDAA 3L9WA 4H15A 4TKLA 3PI7A 4YT5A 3ETEA 3ZU2A 4NU5A 1GQ2A 3K9QO 4BL5A 3KVOA 3RUEA 4OXKA 2Q99A 5K0ZA 4FGWA 8LDHA 1R4MB 1LSUA 1ADBA 3IAHA 2PGLA 2XXBA 4J49A 2BELA 2PV7A 3Q3CA 4X54A 3DBHA 2JL1A 1C0KA 1TVEA 4BOYA 2UUPA 3RUDA 4D0RA 3W8DA 5A5FA 4Q3EA 4A26A 3FTNA 1IE3A 1EUZA 4M8SA 1HRDA 1P9LA 2Q3EA 5BT9A 2DBQA 4EYEA 2DM6A 5JO9A 2WYUA 1ZSVA 1W8DA 1H94A 2HSDA 5IJZA 4ZICA 5A02A 1BG6A 1PS0A 1N5DA 1GTMA 1P1RA 1U7HA 2OXIA 4EUEA 5ICMA 4AFNA 4O1MA 1EE2A 2HMUA 1G0OA 2JFGA 4YQYA 3MEQA 3PYLA 1J6UA 1VKNA 4DWVA 4B3JA 4JK3A 2XPCA 4O63O 5C3MA 3DDNA 3IOYA 4XYMA 3BIOA 4OQZA 3EC7A 2YV2A 4AJPA 2WM3A 2PKRA 2VT3A 3OECA 3MJEA 5G2OA 1YQXA 4N5NA 3HDJA 1VKOA 3EHEA 4PIVA 5THKA 2CVQA 4YWJA 4QTZA 1UDAA 4R1SA 2XAAA 4GBJA 3WWYA 1Q7CA 1N2SA 1VM6A 2BGLA 1IB6A 4GX5A 1T25A 3UFXA 4DPLA 2HQ1A 3QE3A 4P4GA 1LX6A 2V6GA 3CE6A 1X7GA 4PG7A 2E48A 3JYLA 4QO7A 2YV1A 4C4OA 4TQGA 2HKIA 3D7LA 4ITUA 5A03A 1TA4A 1QYWA 3D3EA 2BFPA 5IDXA 4NBVA 3MOIA 3IJRA 1ID1A 3BHMA 4RVSA 1A5ZA 4I5GA 2PH5A 4OSPA 4I9HA 2PD4A 3M1AA 1EK5A 1OMOA 3C85A 4PVCA 2CFCA 3IKVA 4Y6PA 1S6YA 1LDBA 4DBVO 2DTEA 4HV4A 1ZMOA 1Y6JA 3E18A 4LCEA 1XA0A 3C7AA 4N7RA 1BVUA 4BMVA 3VC7A 1SPXA 2NADA 4E5KA 4IGEA 3RFXA 3CXRA 4QT0A 3SBOA 2EGGA 1CETA 2ZQZA 3PYXA 1U5AA 1PIWA 3RJ9A 3K92A 3ZW8A 1QG6A 2HK8A 4YXFA 3VTZA 3I52A 4KQWA 1E3WB 2FOIA 4WE3A 4DMMA 3COSA 1PQWA 2NU8A 2NNLD 4UVIA 4GQAA 2QZ9A 5ENDA 4WUVA 4UUNA 4ZQBA 4UUOA 2EGHA 4FS3A 4NBRA 3T4EA 1F12A 1HKUA 3AY6A 5KJ1A 4FCCA 1NPDA 3I9MA 4AICA 3ZNPA 3SVTA 4PG4A 4CR7A 1B8VA 3KOUA 2HMVA 1GZ3A 2V65A 1LDNA 3DZJA 4A27A 5JPIA 1R16A 2A4KA 8ADHA 4YJGB 5TIIA 1IHXA 2P5YA 3UKOA 2J6IA 3JYPA 4BV8A 5A9SB 3K2BA 4YPOA 1GZ6A 4HKTA 1E7YA 1ENYA 3D0OA 3S2FA 4OXNA 1ONOA 1EBUA 2EERA 1K5HA 3MOGA 2Z1MA 4E2ZA 5A9SA 4QX6A 2DFDA 4RL6A 1A9YA 4LGVA 3V5NA 5IF3A 1FDWA 1UR5A 1PQUA 2ZCVA 3GOHA 2WEKA 3SLKA 3WIDA 4XZ3A 3VH3A 5CDSA 4C7JA 1QR6A 2FR8A 4II2A 1N9GB 4ROSA 5J23A 1GYPA 3H5NA 4J43A 4YDRA 1ISHA 5COBA 3UOGA 1Z6ZA 4PLZA 5DP2A 1AUPA 3IMFA 2QRKA 4UUPA 4JLWA 1J4AA 2O23A 2PY6A 1ONPA 4UEKA 2AHRA 1GUFA 2WWRA 5L4NA 1VL8A 1H0KA 2VUSA 4XQCA 4YJFB 3JD0A 1EBFA 1DHRA 4B8WA 4MVJD 2OL4A 1TT5B 2P2SA 1XEAA 2Y0DA 4NJMB 5CHEA 3OMLA 1TB4A 3PJEA 3IQDB 1Y9AA 3WR5A 2Q4BA 5U4QA 2YY7A 4XJSA 3FHLA 3GRKA 1DIGA 1O8CA 2X9VA 3LZ6A 3GVPA 4RVDA 4WCFB 1DFHA 2BLLA 2OBYA 1SB8A 4OAQA 4Q3NA 3G1TA 5I9LA 3DBVO 1SAYA 5C37A 1HDZA 3N58A 2VYND 3JQBA 1C1DA 4CM6A 3ITKA 3DOCA 3DHYA 1WAMA 3UW3A 2HK7A 3JQFC 3ETGA 2X0IA 2X5JO 2PTGA 1T1SA 3WQRA 4NBUA 3WGIA 3L4BC 5L95A 1XLTA 2I65A 3HB5X 4HUJA 3NYWA 4LSMA 4TZTA 3F4BA 4WLVA 4BNVA 1NAIA 1QYXA 3CPSA 1K6JA 4XB1A 3TZCA 1GCOA 5CDUA 2XF8A 4R68A 1UXJA 5FEUA 3DZGA 3LC2O 4BS9A 1VSUA 1Y8RB 5DT9A 4ZHSA 4U5QA 1QLHA 2BFMA 3I1JA 2GDZA 1YQGA 4N18A 5DCUA 3ZV4A 1MFPA 2ZB4A 3I9NA 4L0QA 4M49A 3GPDG 3OJLA 4INAA 1MX3A 2PA3A 5KVCA 2FPGA 1EDZA 2GCGA 3TZ6A 1U2DA 1X15A 1YL6A 5DBIA 1N92A 3V1UA 4UVEA 3BTSA 4CV0A 3AK4A 4BKPA 2P9CA 1JVBA 1SOWA 2B5VA 4WOKA 5JDCA 3KYCB 1BW9B 4K28A 4L9RA 4ONEA 4CODB 2X4GA 4B4OA 1C1XB 4QQRA 1B14A 1RKXA 1P0FA 2UUOA 3GZNA 4J7CA 4GKVA 4R1NA 5DOZA 2A9FA 4MVJE 1NPYA 1P31A 1ZIDA 2F00A 4IMRA 5DULA 4CMCA 1BMDA 1MP0A 5JC8A 2ZTMA 4JXKA 1NWCA 4ND1A 5IZ4A 4YBZA 2DLDA 2I3GA 2V7PA 4AL4A 5DP1A 3ZV5A 1C0LA 4NDNE 2R6JA 3WGOA 1UH5A 1E3JA 4L8VA 1HDYA 1ZFNA 2GLXA 4BVAA 5DCYA 4QECA 2NTJA 1F8FA 2B5WA 2GRAA 3IS3A 3KZVA 1K89A 2C7VA 1YE3A 1RJWA 2IZZA 4JBHA 4GLOA 3VVBA 2C59A 3MJCA 4Z0PA 1TT5A 4MIEA 1YQDA 3KYDA 1UDBA 4D7AA 1OBFO 4RVFA 1R15A 4JP2A 5ER9A 1IYZA 4W9NC 4RQTA 4DYDA 1U2GA 3FWNA 3GC6A 5H81A 1R4MA 4A2CA 4E2WA 1DIRA 1SOVA 1MG0A 3DZFA 1U3VA 5DDIP 1JAXA 2IODA 1R0LA 4Y9DA 2GYYA 3S8MA 4YRAA 1PWZA 3CIFA 4KUHA 3RQSA 4ALMA 9LDTA 1WDKA 2YJZA 2C2YA 2QZZA 2W98A 1JVSA 3X2FA 2X0JA 4J4HA 2CSUA 1C0PA 1M75A 3B1JA 4OH1A 4AJHA 3AW9A 1X13A 4AJ2A 3ICCA 2NVUA 4I8XA 4UREA 2QG4A 5A9RA 4B4WA 1JKIA 1IY8A 1ONNA 1UDCA 4YT4A 3KTDA 1ZEJA 4EEXA 1X14A 2OUIA 3GUCA 4R3WA 4PLPA 1ZSNA 4Q39A 2CD9A 2AG8A 3WGZA 4IDEA 1LQUA 1K6XA 1KETA 1E6WA 2Y05A 1B3BA 1LJ8A 3LF2A 1GV0A 2VZ8A 3ABIA 1DO8A 5KJEA 2C5EA 3HQ4O 1LLQA 2P4QA 4LRTB 4ZRNA 5K6AA 3Q9UA 1IPFA 1QV6A 2B4RO 1GPJA 1HETA 1I32A 2J3JA 4UEOA 1O9BA 5LDGA 3ST7A 3DAFA 2ZYAA 2Q46A 5JS6A 1Y9EA 2CMDA 1T2CA 1XR3A 2X23A 3RIHA 4CM8A 1U1IA 3O4RA 5ER6A 4WNIA 3P2YA 2PNFA 3WTCA 2J3KA 4BHTA 1Y5RA 5T6BA 4BIIA 4MVJF 5DNAA 3W8FA 1SEVA 4BQRA 4B7UA 4BNZA 1DBVO 3SJ7A 5A9TA 3JSAA 2E37A 3OP4A 2QYSA 4FD3A 2EKPA 4IMPA 1PZGA 1A7AA 2J5KA 2FZEA 3QVWA 5G4KA 2D3TA 1YKFA 2DUWA 4NU6A 3WDSA 4OOFA 1U4SA 3B70A 4PLCA 3I9OA 3K2EA 2DQ4A 3AU8A 3QIVA 3IC5A 1PJQA 3WWZA 4YRBA 3NRCA 3I23A 1MG5A 3WGQA 2VTEA 1QP8A 3CSDA 3JQ8B 4IDGA 4I9UA 4LSWA 1U9JA 1AXEA 3DWFA 1IZ0A 1LU9A 3QRWA 3ZWCA 4WCFC 1GUZA 3H9UA 2ZB8A 3IIEA 1HE2A 1ISJA 3AM4A 5G0UA 2Q2QA 1WP4A 3OM9A 3V1YA 1Q2XA 5ADHA 1W73A 1Y81A 3E9QA 1Q1NA 4OM8A 1ZK0A 1A72A 1F0YA 1QMGA 1U7TA 1QSGA 4RDHA 3UVEA 1H93A 4MVJP 2W2KA 1HEUA 4GLLA 4CMGA 1DOHA 5GY7A 1QLJA 4RZIA 2EV9A 4JROA 4CLEA 2Y99A 4E5MA 1ISFA 4PLTA 3WLFA 5LDHA 4E2YA 6ADHA 2D4AA 2Q1WA 5CPBA 2YQ4A 3SLGA 5EIOA 3RI3A 2VT2A 3I6IA 3ONEA 2VZ0A 4RPHA 2E6UX 5BNFA 4B79A 3MJVA 3N74A 2B0JA 3I9JA 3SJUA 2WE7A 2P4HX 4E2XA 1WZEA 2QYTA 4E5PA 4RV9A 2EKQA 1JWAB 5CDGA 3FN4A 2Y0EA
chains in the Genus database with same CATH superfamily
4C4PA 1NJSA 1GRQA 2VP6A 3EZLA 3OBIA 1N1EA 1QGUB 4J0EA 4QUBA 3UTDA 3ZHOA 4CUJA 3HCAA 4IHQA 5K3AA 4PO1A 3GARA 4QA9A 3GJZA 5NLLA 5IUNC 3SFTA 3FTPA 1MQSA 3QXGA 3BH6A 2HM7A 1VPLA 2FSGA 4FI3C 4KXXA 3BMNA 4ADSG 1ABBA 3EHDA 3WLMA 1NXQA 3G0OA 3GPIA 1UMDA 1KBOA 5EY5B 5F78A 2CKDA 1WU8A 1CR6A 3DBRB 3RUIA 1OW3B 1GR0A 1TVMA 4FR0A 4UTOA 3E9NA 1F51E 3WGMA 2QVBA 1TM5E 4RFSB 5E7QA 4CMIA 1Q20A 2QRMA 2XAUA 3EY9A 4ZVOA 3VR5H 1YASA 1OCEA 2HT6A 3AVVA 4RTSA 1IBRA 3A10A 3N59A 1QF6A 1OILA 1NMEA 1PJ2A 5AW9A 3OA2A 2XCUA 4FS8A 3IUMA 3V8QA 3GH3A 2RGRA 3WSTA 2A9JA 2MIIA 4RD1A 1W4LA 1N6HA 1YB5A 1ZLXA 3BE8A 3LA6A 4PYOA 5I8ZA 2HSEA 3VV3A 2DBZA 1BZYA 4BE7B 2XB2A 4DSUA 5EOVA 2IHJA 3K8ZA 4OK5A 4Q4LA 4ZVPA 3TK1A 3KLPX 3ZU4A 4ARVA 1L7OA 3JAKA 4Y98A 3RUHA 1JXMA 5KC8A 1Y6QA 4TXMA 3UATA 3W2FA 5BQFA 4WGGA 5BQOA 2OZLA 2GEDA 2IXGA 2JBWA 1AHPA 1I1NA 3WDMA 5MGBA 2C5BA 3AY7A 1UPFA 5BNWA 2ZULA 5TQ2B 3A1WA 4NENB 2UXCB 1USGA 4DOMA 2HT1A 2PVCA 4EYSA 4AJIA 1N9ZA 4IVQA 1DRWA 2V7QD 1R0KA 4UVGA 4F4HA 3GIDA 3EVDA 4N01A 4D92A 4K03A 2NZ2A 4UDYX 2FN7A 3U0BA 2BYTA 1XTKA 2O8NA 2QMUA 4GPD1 1V8FA 1EVEA 1G98A 5HM6A 2YWGA 3DOOA 3E7DA 4BNMA 3EIWA 3BF8A 1OPRA 2JLSA 1CX9B 2EGUA 2J3HA 3D4PA 3QEJA 4AECA 3DDCA 4R1OA 5LZ2A 5F4ZA 1TDJA 4UBIA 2PCJA 5IZCC 1LNZA 4D9FA 3ZS9A 4JN6B 3QUAA 1SXJD 4N9WA 4NK5A 1ZM3A 4Y2RA 1WQ3A 1QZUA 4OMFG 3I58A 3NHFA 3PWTA 2Z3ZA 2H5EA 1AF4A 4LRXA 1NXOA 1VPEA 4LZPA 2X4IA 4XKJA 1NM5A 4FC7A 1RYYA 1IPHA 4IKOA 1EE9A 1G3IA 4KR9A 3EWAA 4Q1AA 2DTXA 2PM8A 2A0FA 2HWXA 3A9WA 1QGUA 2NYAA 3R7AA 5JW6A 3OURA 2A0UA 1E5DA 1QIJA 4A03A 1Z5UA 4WPGA 3SMVA 4AKIA 1A95A 3NGXA 1IOWA 3E23A 2ZSBA 2PO7A 1PQYA 3BL6A 3NBXX 1PQPA 1NVFA 1FP4A 2Z30A 3BS4A 3I3SR 1JR3A 3IUYA 4H77A 4OA8A 1NR7A 4FFBA 3PUIA 3UWPA 5HIAA 5CFRA 2O0HA 1RFGE 3HCRA 2C77A 1CVRA 5AM4A 3ZLUA 3C41J 3EH2A 3L8CA 2QU7A 2W2OA 4QSMA 3V2UA 1KYQA 5DRTA 1Y8CA 3EVZA 5FWDA 4C4XA 1G8PA 3VPBA 2LDXA 3DD1A 4YLGA 1VE3A 3I1FA 1OBVA 1A71A 1DRUA 3THXB 4C2UA 3Q4GA 1IHYA 1MTZA 1RPJA 3EGDA 4M0PA 4MLDA 3OEED 3RVBA 1ZCAA 3SS7X 2Y66A 2HCTA 5I7RA 2OBBA 1L4YA 1ZC4A 4PPYA 2CMFA 3L4KA 5A7FA 1LEHA 2V5VA 1AT1A 1PFYA 3AFGA 3EWSA 5JNUA 3N7UA 2AK2A 4UHEA 1YTUA 3FUUA 4COOA 1Q2UA 3L79A 1MDFA 4XWTA 2Z8YM 1W44A 2RCYA 4MS3A 5A4IS 3RC1A 4QQFA 4BMXA 4JKYA 3K6KA 1IDN1 1ZRMA 1W1WA 3IVXA 1QK3A 4L4UA 1HYQA 1GKKA 3TD6A 2QGNA 3KD3A 2NZJA 3JCZA 4TYWA 2RH8A 3LKBA 2HW8A 5EESA 1EQUA 1KFJB 3HVRA 4O4LB 3GUZA 1RWMA 4PO3X 2BFFB 4R3NA 3DOUA 3OPVA 1INLA 2X6RA 2B4YA 3B8EA 4NH4A 1ZUWA 2JH9A 4DSTA 1JAHA 1QH1A 3K09C 4BJ3A 3VZDA 2P2CA 1OAAA 4JZYA 3U7HB 4A10A 1B16A 4MDHA 4NONA 4R1UA 2WSLA 3PITA 1ISIA 3UNXA 5BW6B 2H31A 3LM8A 3SQNA 3VPXA 2P9GA 3WFJA 5H82A 3VO1A 5BSKA 4X45A 1S1MA 4X85A 2I2CA 1VBFA 3ONFA 1JJIA 1NQXA 1T4BA 3LH5A 1OPXA 4YRGA 1SHKA 2I78A 4ZQHA 1I7PA 2YIMA 3GLGA 3KPUA 2HBQA 1EHIA 4I4IA 4KKVA 4YDHB 2AEMA 2X9NA 3QFFA 4HNGA 3ROZA 2P65A 1OH8A 1MEOA 9MHTA 3K32A 3HCOA 4C89A 4JYAB 4LK3A 4U7DA 4YR9A 1YQEA 4MYSA 5DLEA 3RREA 3S0JA 5J9FA 1Z0KA 2KS6A 4KR2A 4JV5B 1H2AS 1SXHA 1YJCA 1GPMA 2A59A 4U2FA 1RRVA 1I5EA 4RW0A 1Y8ZA 1GRCA 3BH7A 4N0EA 5ALFA 1NVXQ 2ZBEA 3JD1A 1C3OA 1JQ3A 2Z83A 4A8JA 1SG0A 5DNCA 3USES 4DTCA 3PJRA 4WLEA 5BP7A 2JKZA 1XTBA 3LUDA 1REQB 2XIJA 1QOQB 1G1MA 2AJBA 2FSUA 4P58A 3P4UA 4DZZA 1VHTA 2NUAA 4KJZA 2DBRA 4LXTA 1OAOA 2JJ2A 4FNGA 4R69A 4F4IA 2Z4RA 4G26A 4GMGA 4U7PB 1WXQA 4NBTA 4UD6A 5LC1A 1QAMA 2FU5C 1USUA 2NUPA 4RE6A 3OF2A 4YGXB 1R74A 4JI6B 1LS1A 3VKUA 5B4TA 1QHHB 3ON5A 1RRGA 4KMMA 2ENUA 2Z9BA 1P81A 3AIKA 4D79A 2JAPA 3H4VA 4TTTS 1N9GA 2C04A 3PUYA 2Q4TA 4J7UA 1G9XA 3MPOA 4LY0A 3OZVA 5ECYA 4DCCA 4OKSA 3S28A 2C5AA 2RBGA 2PWZA 4ZAGA 1JALA 2WJHA 1IHPA 4LFCB 3T54A 2ZAYA 2B8JA 4BKMA 1A97A 1YR7A 3E9MA 4DLXA 4LW8A 3A6LA 4PC7A 1AHHA 3VDMA 1Z6YA 2NO7A 4QAQA 1GPUA 2K87A 3ZY3A 4A0GA 2B9VA 1PZEA 1I4EB 5JY1A 1LWOA 5HCNA 3CW2A 3BXXA 1TJYA 5T4BA 2VDPB 3G85A 4N5IX 3UENA 2AOUA 1MRNA 2QJWA 2IDZA 3R3SA 3AR6A 5AVKA 5TSDA 1O5TA 2WU8A 3I2GA 3QH4A 3BA1A 3GJRA 1YE5A 3A05A 3C74A 4RHUA 1XJQA 3SHOA 3WBFA 3ZE7A 3G1UA 5B58T 2AFHA 4ZI7B 3PS9A 1S9HA 3OICA 2P2ZA 1N75A 4GR4A 2ET6A 1RPTA 2BEVB 4QYIA 3FHJA 4CM4A 3F6YA 1I5RA 1A8PA 2A1UA 5IMSA 5HKOA 5T41A 3N2EA 1RLJA 4NZPA 4FM9A 3LGXA 4B34A 5AM1A 1I7LA 4M1QA 4JR2A 1KZYC 1T6XA 4HQFA 4YRIA 1QKKA 2OMKA 2M2IA 4O3FA 2J4DA 1CQIA 3H2KA 4I6GA 1PR5A 4L2IB 4LHEA 4M8IA 5CVVA 4CKXA 1ZWLA 3DAGA 2HYIC 1H0RA 4AW9A 4I1PA 1L9KA 1PNVA 2WIKA 5ESRA 5JAQA 4KX5A 3PXBA 3QJYA 4B74A 5CEJA 1Z2AA 3UJAA 4Y1GA 2HRZA 1DFGA 3KT8A 4EHNA 3GFRA 5F2KA 5MN4A 3OO1A 3H9JA 4MW9A 4Z3KA 3EF3A 1N2JA 1NUUA 1TI7A 4ZDWA 3AILA 4YUXA 3EDMA 5EWJB 4LXXA 5EEGA 4E31A 1V5IA 1E5QA 2QUZA 2VNJA 5CFMA 3BK2A 3IMKA 4UDXX 1F4LA 1NVEA 1Q50A 1RMTA 3C3KA 2BP7A 2OOKA 2Y93A 1YDEA 2HIGA 4Z4QA 1VJ1A 4MRVA 4CIYA 2HADA 4BRZA 1E8DA 1QPGA 1C9JA 1GUBA 1UK7A 2C92A 4IG9A 1LFDB 2ZVJA 3AL2A 2WSIA 4EF4A 5EXSA 4AO7A 2HLPA 1B2RA 4P4SB 5DNWA 4HGYA 4OMUA 1ZN8A 2ZWIA 2HV9A 3INYA 4WKPA 3NOOA 2PFGA 2CEKA 4WWHA 3CVYA 1PS9A 4P5EA 5AYVA 3KIPA 2AXEA 2D0IA 1GAQA 4LQ4A 3TQTA 2F17A 5DGXA 3E1GA 3QIAA 4R1QA 1T2NA 1BEEA 3K20A 3DVSX 4MRNA 3TAXA 2G25A 1OB2A 1SUFA 4RAOA 4KTTE 1A9TA 4KWIA 2JGRA 2Z43A 3ESXA 4OB8A 5B2ZA 2JDID 2Q5FA 4DEVA 3GDOA 3KZCA 3QPVA 4PSAA 1F06A 4ZZ2A 5AW2A 2EBHX 5I3CA 3PRJA 5EE1A 4A1OA 4EG6A 1RQGA 3TSYA 4EY7A 2DBYA 2QTVB 2PZBA 2R8EA 1U90A 1UCFA 3V8EA 3WYDA 3IUBA 1G7TA 4XTRA 4F92B 1L1FA 1BWQA 3NJRA 1P39A 4G5HA 2NQ2C 1FLDA 1H23A 1UEJA 2VOEA 2XYVA 5CBPB 3IEPA 3FPBA 4KFCA 1U0RA 1K7XB 3JVDA 3L77A 3CHYA 3CJTA 5HNKA 4EY6A 1D4ZA 4YMVA 4HB3A 1M83A 2QTFA 3K1AA 2ZZMA 3B2QA 4PYKA 5H3CA 3ED1A 5ARCA 2VSYA 1LPPA 1U2EA 5IJAA 3AJEA 1SQSA 4PAQA 1N8KA 2QAJA 4JIMA 2A7QA 1ZVKA 3K71B 4UZFA 1FMFA 4RPJA 1NUTA 1V8PA 4ITRC 5K3SA 1GGJA 1V6CA 2DFKB 3KV1A 3HWRA 1VL0A 2R48A 4UPEA 3D5TA 2XBLA 1T13A 4CLDA 1PL6A 3H0KA 3SKXA 2H4FA 2OHIA 4JI4B 2QTVA 4H7EA 1E7MA 5EE3A 1LBHA 1JX6A 3AB7A 3T5TA 5IWCA 2PZKA 2A1IA 4TSFA 2PCLA 3JQ6A 1FQJA 3TZKA 1W5AA 5AR1A 3LC7O 4HDMB 1O9GA 3F5DA 4J2HA 3LX4A 3V34A 4B8YA 1KWGA 1FS5A 3HBAA 4NOJA 5F73A 4PNHA 3HXMA 3ZZNA 4AYXA 2WYHA 4WTOA 4P3OA 2P9HA 1GSOA 4ZV9A 1F9EA 1NY6A 1RZUA 1K8RA 4JBNA 3DP9A 1VTKA 3O8NA 4OY3A 1XWFA 1FSSA 2O3TA 1I3CA 4IJQA 5E7IA 4ZA2A 4D3FA 5B2FA 3NUGA 3DE2X 4DIKA 2EP8A 3H6HA 4KPUA 4YGYA 5HK8A 1Y4ZA 2CHEA 2YXLA 2A9PA 2VJOA 4P2BA 1NJ2A 4JJKA 4CT4B 1IVSA 4L5BA 1HE5A 2R97A 1KK3A 1HSZA 2O8DA 4ND8B 4YPFA 3KQHA 1E2IA 4NU0A 5DLDA 3T7EA 2EQ5A 2EFEB 1BGXT 1CSEE 1IAVA 3L8GA 4U0KA 4Y67A 3RYFA 3KUCA 4QU8A 4BNWA 2OZKA 2GVZC 5EWJA 3KVYA 1JEAA 2VDMB 1ODJA 3F49S 3JD4A 3QWAA 3K73O 2OUKA 3HADA 4TV8F 5F1PA 1GARA 3VRHA 3WJ1A 2QN6A 1VJRA 2QIPA 2ZJ0A 5HF9A 3QHPA 5EP3A 1HQDA 3VGJA 2FEMA 3UKDA 1H2EA 4MYTA 3QFHA 2VVTA 1VLLA 1Z7BA 2VHVA 4XVUA 3VZQA 2IQ5A 1XWIA 3LUKA 3VMFA 4LN1A 3SIWA 4IL5A 4ENWA 2QJOA 4DQ0A 4UC0A 4QTXA 3DCIA 4RMHA 3MTJA 4JLDA 4MW7A 4C6TA 1NXTA 4ER0A 1EA5A 1XMIA 3AH8A 2D4HA 5CGZA 1S7CA 2COKA 2N1MA 3GJ4A 1UXHA 4CEIA 4EUSA 1LDGA 3AT1A 5I8PA 1GM5A 4Z3OA 4CEJB 3ZJ5A 3BD6A 4MV9A 2EJVA 4FYJA 4GX0A 4CL8A 5LVAA 1O89A 4JC0A 3PFWO 1R6TA 2UV8A 3O38A 3P9IA 1OFIA 3R8CA 2WD7B 3OOHA 1Q17A 1GGHA 2Q3CA 1YMUA 1SBYA 2R00A 2NO4A 2ODBA 4QXPA 4ZO8A 1LLDA 2P3OA 1QFYA 3GA0A 4BNIA 2ZTVA 1X2BA 2WUFA 2JJMA 3AGQA 2ZWPA 3D4NA 5JDIC 3FGPA 4RIEA 1R0SA 4AQ7A 2X8AA 2YJTD 4MKZA 2DFTA 2MOKA 4I08A 5I8WA 4NMMA 3HYCA 1US8A 4R2LA 4S2UA 4XSHA 4YH1A 3WK4A 2GEJA 3AXSA 1ZNYA 2O50A 5JSYA 2BEUB 2C2OA 1ZM4A 2OCDA 2GSDA 3I64A 3DZIA 2I87A 1QGAA 4YP6A 4DPKA 4OYYA 4HGQA 4HRXA 3EIHA 4HNVA 5GZ6A 5TPZD 3E3NA 4MVJH 5JJKA 5BUCA 4KLAA 4XR4A 3KLMX 4Y6OA 5DZSA 3E5NA 4A5OA 4UTVA 2RHGB 5KI6A 1P91A 2QMZA 2VP4A 4OIMA 4HS9A 4WMLA 3UPDA 4GVPA 2C97A 1M5RA 1UMCB 1B41A 3WSWA 1UKYA 3EEIA 2NUAB 4F1KA 3SF8B 1WOYA 3ISVA 3PPIA 1CC1S 1HDOA 1YULA 3QJGA 4LYDA 1KAQA 2Y3IA 3FNBA 2IIQA 3UWOA 1VBMA 4I8DA 4EY8A 4IRUB 2HQRA 1XKTA 1QVVA 4RU1A 4A8JB 5IAOA 1H9CA 5IAJA 2D7CA 4FFVA 4TKVA 4ZVRA 1WS6A 3FDIA 4Q9LA 1DQZA 4X1KA 5E3HA 1W7AA 5KYKA 3PXXA 2ZLBA 4HL6A 2PFSA 1DEHA 2HEGA 3LVRE 4Q1BA 1H6BA 1ZOLA 1Q0ZA 2AEJA 2B7LA 1GTZA 4DB4A 4EUNA 3A2KA 1VKZA 3VPGA 2C57A 1OASA 1VXOA 4FNMA 4MMXB 5LOVF 3L41A 1P19A 2FX2A 2L17A 2Z58A 1RXYA 1JIUA 2GYVA 2HQSA 1LSJA 1WDLA 2JJ1A 3OIVA 4YEDA 3FB1A 3FLMA 2BHNA 1RE0A 4LX8A 3RARA 2Z3WA 5KOHB 3IB3A 1AQLA 4BO3A 4G56A 2FMFA 1A9RA 1U9CA 2UVPA 1BFUA 3HUFA 1R12A 1S01A 3EGEA 3PP8A 4MS1A 2X6TA 4ZFNA 1SH7A 4TMKA 3BGSA 3H75A 1GQQA 3T7CA 2QUIA 13PKA 3O0DA 1DXQA 4JC5A 1TFRA 4MS4B 1ND5A 3RTBA 3R24A 1KH2A 3MTGA 1EX9A 4REOA 1RHUA 5CXSA 3X1MA 3CZMA 2AHOA 2VTKA 3O3OB 3FOFC 3NANA 1FTWA 5I7AA 3CUTA 4HF7A 2F7SA 4B3HA 4G4SP 4LYAA 2VUHB 1EXVA 2Y1WA 2ZIGA 2IELA 1N2CB 1C8LA 2D3WA 4X20B 1MB3A 2H0RA 3NVMB 4W63A 4L9WA 1NQTA 3JU3A 1U0GA 2DCMA 4IHJA 4JLPA 4YECA 2GCNA 3DYVA 3WYBA 2G3YA 3GQVA 4G23A 5BSVA 2XWSA 3SC4A 1GLVA 4MS3B 2JA2A 3NVDA 4YAKA 1M2OB 4KQHA 2XTJA 4GLFA 3OZIA 2EARA 4JT9A 1M2WA 3EFHA 5IJ0B 4L6CA 7REQB 4ALKA 2DKFA 2C9YA 4R5HA 4BZQA 4CTOA 4YDQA 1P73A 1EHYA 1N4DA 1H5NA 3HVHA 3T5CA 3WE7A 3M4ZA 1OQAA 2VBIA 5F35A 4CQMB 3ILHA 1YO6A 2DYKA 1XCBA 4IS2A 3G8DA 2GPJA 1PKEA 2OC4A 1IMOA 2VF5X 5E3IA 3V2GA 1W4RA 4DJEC 5EMJA 1PD1A 5AI4A 2I6TA 4BO1A 4OKNA 2WU3A 1N2XA 3PEFA 1V48A 4ZI2A 3IP1A 4FQ8A 1TTTA 4FIZA 2FPMA 1LZLA 3B1WA 2WJVA 3VR6H 2XNHA 3DDZX 4GP9A 2I6XA 4E21A 1VYHA 4ZI3A 2PJDA 5CVCA 5EZQA 2H2WA 2R62A 3UMFA 4I4TA 3DYIA 3V4LA 5C8VA 1L8XA 1L7QA 3GUHA 3NEPX 2V74B 3DBLB 4NFYA 3G0HA 2JK1A 1I4LD 1JRLA 3G7UA 4ZC1A 4HVAA 1ZMTA 4F04A 1S4MA 3CUWA 1VKJA 3TUIC 1ISGA 5B3AA 3F5FA 2H65A 3ADKA 1NFFA 3VYTB 1RWWA 4KBYA 3DE1X 2GBCA 3LQYA 1DLJA 2Q1TA 1KJNA 5AHRA 5TMPA 4Z4EA 5H4GA 4PX9A 5L40A 2AI1A 4HX5A 5JXGA 1XF1A 3I9V1 4D9BA 2J48A 4XEHA 3HABA 4MUXA 4E2FA 1ISRA 4KGZA 2OLEA 3HA5A 5B3LA 2VYNA 3IR5A 2C7QA 3UV6A 4C08A 4PCUA 1VMDA 2W0SA 3DT8A 4RD0A 4FHDA 5A4MS 3VNQA 4C6HA 3OU6A 4LVOA 5DM4A 4XD7A 1IG3A 2QNBA 2JIOA 4I55A 3U3MA 5BMVA 2YS6A 1KIMA 4DEXA 2R87A 1XMPA 3W2HA 1E92A 4LYHA 4JZKA 4ZO6A 1FRZA 4HFJA 2RKBA 3S2IA 1QDUA 2HFKA 1JA9A 1WQ1R 4IS3A 2VATA 4XB2A 1DRVA 4FLFA 4J0JA 1ZWKA 2R1UA 2FZ5A 3TZBA 3ZWKA 4EENA 1YB7A 3K2QA 3IBGA 2VPQA 5E7JA 3VAZA 5HDQA 3VYUB 4OM7A 4CUKA 3NBYC 3WIBA 4YMWA 4J07A 1ZGBA 4BN0A 1NW9B 3KT3A 1AS2A 1K8ZB 3BBPA 2FPIA 5C80A 3FYDA 3OTQA 5IG2A 2C2XA 4Q05A 4F6CA 2GDJA 1ODSA 1IFXA 2O2SA 2XVMA 3HN6A 3P96A 4TMWA 1AUVA 1GSIA 1U04A 1KI8A 3AUFA 5K0NA 4CQLB 1WJGA 5FWXA 4I99A 5DF1A 1RKBA 2C5FA 3EMDA 4KWCA 4ZT2A 3RDPA 3PQEA 3WGVA 1WHTB 3BERA 4D82A 2FPSA 1FP2A 3EG5A 3ANMA 4DFDA 2RGNC 1UBNA 3OKFA 4OFXA 1KY4A 1F38A 1XZAA 4G4SO 3OIDA 1K92A 4MRRA 1HZJA 1P9RA 3CWQA 2CB0A 3DL7A 4IIJA 5IKOA 4Q3DA 1LRJA 4AWAA 4QOJA 3WL7A 2QL6A 3NHLA 4QGAA 4U3JA 4MQEB 3NM6B 1AQIA 3EPKA 1YFJA 3UAVA 1N2CA 4BO7A 4KSBA 4EYKA 4LNAA 1GN8A 4L27A 2A92A 2E82A 1T9CA 4PZEA 4CI9A 1RACA 2GA9A 4PR3A 1XXLA 2FUCA 2Y76A 2FFJA 4WCDA 3UB4A 1DRJA 3TB6A 1H5UA 1X74A 4I19A 1GZVA 3D6FA 3FRHA 4LJKA 3ZBUA 2OYCA 3FX2A 5BN1A 3L0OA 1ZP6A 2J6BA 3JQ7A 4ENSA 3T5PA 1VBNA 1OREA 4IKPA 4U7JA 4IWYA 4HC4A 2OWEA 3D4IA 1P1HA 3LDFA 4RVOA 2YV3A 4LDJA 1H66A 4Q18A 4QBIA 3VNAA 2YINC 5A6VA 5KOHA 5LKRA 2M6RA 3K15A 1I1HA 5HKKD 1XUOA 3MUEA 1HSOA 3V46A 2UVPB 1SUAA 2HTEA 2SBTA 2Y71A 3DL2A 4C22A 1UDWA 3WKAA 3JZDA 2C82A 3EVAA 2IS1A 1WCYA 3PFHA 4BEJA 3KFXA 3QXSA 2CCJA 4YFYA 1FRFS 4EWLA 5K51A 2DY1A 1DKOA 3EODA 4K1XA 5TF4A 2R25B 4H08A 1QNLA 4PHCA 4QPZA 1ZIPA 2IJGX 2AE2A 3CEAA 1UJNA 4IQ8A 1G8HA 2CE2X 4G0QA 3QWHA 4A1FA 1PFWA 4IM7A 4DLVA 1Y4SA 3PEYA 3I0NA 1V7QA 2FRXA 4MIYA 1D0IA 1G6HA 3A4VA 1ZQ9A 3MCTA 4RTKA 1WU7A 2YOFA 5AOCA 1DEKA 4K6HA 1AZTA 3R0IA 5GJCA 5HIJA 1O03A 4AP6A 7GPBA 3VO2A 2OAEA 1OR8A 3QZUA 4H27A 2X0NA 2XUIA 3B2EA 4RV4A 1UMCA 3IXQA 3L7LA 4E6PA 3A27A 4MKIA 3RT9A 2WOJA 2NO9A 4E3ZA 2VAVA 3NH6A 1QVWA 1QQBA 2HF8A 4PY2A 4QFMA 2ZXEA 1TA9A 2XDYA 2DPXA 3C70A 3DVAB 3PTAA 2H1CA 1QO0D 3EAFA 3IT3A 2CVOA 4OMDA 4DDWA 1Y82A 1N2ZA 2H9IA 2YICA 5IYZB 1PEYA 3PQ7A 4JFRA 1N5LA 1XOIA 4M87A 3RIEA 5HUQA 1Z62A 4R4JA 4HSGA 1D8TA 2COEA 1R8YA 1LI7A 1NLMA 4XQEA 1MIHA 1P2BA 3ZHSA 4DAOA 2X5NA 1FFXB 3GT3A 1PI3A 2OPHA 1EX7A 1F2UA 1GFSA 1GPKA 3ITEA 4BJ1A 3BRQA 2YC2C 3IAM1 2PUGA 2FCRA 1CD5A 4AUMA 5KBYA 2RH5A 2BRUC 1VRVA 4GU5A 3RSCA 4YMIA 1UFKA 1EFKA 4HAWA 1RRPA 5EXPA 2DHEA 2PSHA 1TM4E 3LVFO 1DQSA 4UHDA 1NG9A 2WTMA 4WOCA 1OX4A 3DE7X 4Q6BA 2QUBA 4NYIQ 1X8LA 4AAYA 4F5DA 1XU7A 3DAPA 3C3XA 1LLCA 3TZQA 2JFYA 2GZ2A 3UT5A 1VIAA 4DQXA 4QJBA 2B92A 3QX7A 1SCIA 3JARB 2H48A 4GR5A 4HX2A 1X80A 2SCUA 3FETA 2VA8A 3NT2A 1V5GA 4JR1A 4NJMA 1MGOA 2V58A 3F98A 1YU9A 3DC2A 2WD8A 3L7MA 2C4UA 2GFQA 4LOJA 1KBQA 2QIOA 3QKWA 3H7AA 5A3SA 4GWKA 4F6LA 3DUWA 3T61A 2UVQA 2DKNA 5CFNA 5JYBA 4PE5B 4YJFA 4H3SA 4LJAA 5E9WA 3RUFA 3S1LA 4DWWA 1YVRA 3V55A 3CC8A 1G16A 1XP5A 2WWIA 4FDMA 3RU9A 2BFEB 3ILVA 4MEBA 3EPHA 2ZJBA 1PR9A 3LCUA 1W19A 4FJ2A 4YXWA 4HDKB 2XMZA 1QYIA 3MXOA 3R0JA 3B5EA 5ALLA 3W6OA 1VG8A 2CF6A 4IOLA 3L92A 3ZE1B 1T9KA 3CGWA 3L6OO 1X9GA 2GJ9A 4Q1EA 4PZPA 4R41A 1ODKA 3IERA 2DPHA 1JP7A 1TMYA 1T4GA 3ESQA 1QVAA 4DLNA 3FRIA 1AZSC 3L7DA 2X3YA 5FBHA 3AVUA 2EZ9A 4PYNA 2YJ4A 4MVJA 5FYQA 4B2YA 4YRZA 3AHGA 5BQ5A 1NWHA 4A8PA 2OGZA 3PEUA 1A9OA 3G8CA 3O8QA 1CQZA 3RCBA 5FJJA 2QP3A 2XMQA 5AW4A 3VR2A 2CY0A 5FA6A 4ETWA 1N57A 3KOWA 2IXFA 1ULBA 1ZESA 3IT0A 4OLHA 2NO0A 2V6MA 2QZPA 3V7NA 3MAGA 4AUNA 1FOEB 2G8NA 1UDXA 3HSKA 4B81A 2YOHA 1FVXA 3CW9A 4BO2A 2A33A 1VLVA 3PFKA 1TEZA 4MQFA 2ALJA 4KAFA 5GWXA 2GCOB 1JHPA 2YCLA 3LVQE 4X71A 4YJ3F 2D2IA 3P0RA 2GCEA 4RGQA 2Q28A 1N0IA 1L3BA 4NPAA 3IAS6 2BH9A 2QX7A 3AHEA 1D5CA 4Q6WA 3QPUA 1P8AA 3WI7A 1XTRA 3D31A 5E6SA 4H2DA 4MO2A 4PBTA 4RANA 1B74A 2WWFA 2J3DA 1KQOA 4E33A 4UU1A 2XH8A 3TRDA 4DZTA 3F7OA 4CUZA 2G82A 2EYQA 3CTPA 3IAEA 4FCVA 4RORA 1DCMA 4II7A 1EA7A 5H3HA 4OHPA 4DRZA 2MU1A 4YAOA 2Q8NA 1T34A 5K3OA 1JHQA 4JGBA 4Y8VA 3QEBZ 5LOVB 1XLTC 5F7OA 5F98A 1F1JA 4AG3A 3PK0A 2PMBA 1NI4A 3OJWA 5ARBA 5GOZA 5JISA 1JFFB 2WTNA 3KZXA 4YJ2F 4WZAE 5F7JA 1HLPA 1E96A 2NTEA 2JCXA 4HXEB 1LI5A 1XTIA 1YB4A 2Y1EA 1F17A 2YWBA 3MJSA 5EKTA 5ESWA 3WL8A 4YAWA 3ZC3A 2P1RA 1AS0A 4NNPA 5IWAB 1ECBA 5LQAA 3C1OA 3TI7A 4ZJZA 1WLYA 3H04A 3HXKA 4HY3A 4OXIA 3MJRA 3LC1O 5FKJA 5K8JB 4M1KA 4EB6A 3RVNA 3GJTA 3DWIA 1K0UA 1QJ4A 1WEKA 2Q3FA 3CLSD 1U9YA 4PC1A 4WX2B 1GGNA 2VP2A 1QORA 2VZLA 1UINA 3VU3A 4I5FA 1HYBA 2D1RA 3P9RA 5B37A 4PQYA 1MVLA 3HCCA 4EH1A 3RRBA 1CUYA 1R8QA 4ZZ1A 4IX1A 5C53B 1U2QA 1GQFA 3MRSA 1IUPA 2HHAA 5D3ZA 1MW8X 3FPKA 4A6DA 2W8BB 1BMTA 2W6QA 1JKMA 2AB0A 2H85A 3GEIA 3GK3A 3HEMA 4NBNA 1NOJA 2HGZA 1TVKA 2D5CA 5JBNA 3KR9A 1KQFA 4MIOA 3GAMA 3SYMA 4YRAA 1U3GA 5HGJA 4IH4A 3QKRB 3RS4A 4MUFA 2IYOA 3T15A 5FBVB 1MT0A 5EMNA 1L7PA 1ARZA 5FPPA 3FPHA 2QR5A 3IAAA 2FOLA 2XOKA 3C45A 3EUWA 4BFZA 4F45A 1K2VN 2GXQA 1GKYA 1MJGA 4ZQFA 5JNLA 1RWQA 4FMDB 1MC5A 2AN3A 2BP7B 2PL3A 2PRSA 5AD1A 3O90A 1YZYA 2ZTLA 3L0SA 4AYWA 5LP6A 6AT1A 3KXKA 3OWOA 3RGGA 4DUGD 3IR7A 3P7MA 3ENVA 3FVWA 4J7AA 4Z2YA 1WIWA 2PEZA 3D1LA 4UVDA 3SHFA 3S5UA 5J4YA 4AX4A 1XRLA 3H9QA 4FZRA 4L6IA 3D8BA 4FYXA 1C8BA 1XSEA 4Q7KA 2X0DA 4NDAA 4WZBA 3FROA 1O9HA 3LXUX 2IIPA 2I3BA 2NXWA 4MKGA 2RG7A 3K0KA 1UAYA 1HA3A 4G41A 2YNMC 3TLGB 4EDFA 1HZZA 2VXYA 4R01A 3W7AA 4PCAA 4TKUA 4D4IA 5AVZA 1SBTA 2IZ1A 2YY5A 4MUKA 5HG0A 2SICE 2QTMA 3O1HB 4K9MA 4MLZA 4HH0A 1N1MA 4M0MA 5IP5A 5LCXA 3LFTA 1V9LA 1TZJA 1U8AA 1GZHB 2D2XA 2G09A 5DXJA 4CM4B 1VPDA 1HNWB 1CHDA 1I01A 1ZGGA 4O2AF 4UCWA 4UU8A 4X7BA 2IQIA 2N0SA 3FCOA 5DIFA 2ZM6B 3QEAZ 3DEIA 3FLEA 3SEQA 1R7RA 3Q5DA 3H1BA 1Q7EA 1RI2A 3V4OA 3V1MA 1AKNA 2OV1A 3HZZA 3RS8A 4WINA 1BMFD 3CE9A 1GWNA 1V1RB 3PJGA 4YIHA 5ISMA 2YXPX 3DC7A 5C5CA 3QITA 2A58A 4YQZA 1UC9A 2FW8A 1E63A 4LDRA 3HO6A 1AKWA 3D2CA 4KYUA 3UMBA 1AMUA 2AOUB 1VXRA 4Z49A 4QVIA 3INGA 4KK3A 3VH1A 4HPXB 4M1MA 3L43A 3D5QA 4DLLA 2I2BA 3TW4A 2WJ4A 5IUJC 4QL3A 1TECE 5MDHA 4Q66C 2FPPA 1P7ZA 1DO0A 1GQYA 1QE0A 4P7JA 1I2BA 5LU8A 2P6NA 1FRNA 4Y6SA 3ZYCA 1RZRD 2WPDD 4WOBA 5HOEA 2P2YA 4K8RB 4G0NA 1CHNA 1PX2A 5JLJA 3GLIA 3I83A 5BYKA 1HT0A 1RQRA 2HJRA 2ISSD 1RABA 3LQ4A 1XU4A 4HN4B 1Y63A 1ZMBA 4P92A 3D7NA 4IJMA 3W06A 4Z4CA 1E9CA 3DTYA 1CDOA 1EI9A 2ZW9A 2C9ZA 3WGTA 3ICOA 3Q5EA 5DPMA 2ATIA 2IOFA 5FX2A 2GZ1A 2QN8A 3B1KA 5TQ0B 1WY5A 1QHHA 2ZWOA 3ESRA 3C1AA 3HB1A 1QHXA 5GPBA 3TLYA 2GPSA 4B87A 1GTRA 3DMTA 2VC2B 1J07A 3IQFA 4DMRA 2PX3A 4WLOA 2ZB3A 3HDHA 4QOIA 5CXQA 2FVXA 3ESZA 4N7BA 2OK8A 3OLVA 2Q4RA 2QTLA 3TCXB 4GD3Q 4FW8A 3TN7A 5CDFE 1N7HA 1NW5A 1XI2A 1PNOA 2GAIA 4JLMA 3B3GA 4UD2A 2WIGA 1XYGA 3N6XA 2QYOA 3Q85A 3SYNA 2JEZA 3NJ4A 3X1DA 3FD8A 4XCQA 2J5BA 3GP8A 3JVEA 2AFIE 3PD0A 4MV4A 2XUFA 1QH8A 1PTKA 1V39A 4UM9B 2NZYA 2VCEA 4WFJA 1RWVA 2C3PA 3AEYA 4EZEA 4ZCIA 2GD1O 4UJ5A 1D07A 3LOUA 4JLAA 5SZJA 3RYIA 1YRWA 1N7GA 4RO0A 2VYVA 5AXDA 1E0JA 1I3MA 1RM0A 2Z2KA 3KTFA 5JANA 2B21A 1LTHR 3UPTA 4ENRA 1DELA 5CUQA 3AFNA 4KOEC 2IL1A 1DL5A 2LBPA 3F67A 5ETJA 1Z6QA 1J42A 2FUG6 4J0KA 2MHCA 3RRXA 2EG9A 3NUZA 2OO5C 2Q9AA 2G8LA 4FX5A 4URZR 3R8FA 3BIFA 4G81A 1J9ZA 1T8WA 2V7BA 3F7MA 5K0TA 4NARA 3PIDA 2WDPA 1S89A 5FL3A 2JJ2D 3F8TA 3KL4A 3VPAA 3H2YA 1PAUA 4MVWA 5B30A 4XH9B 3B6EA 4DQLA 2O7QA 3GAAA 5B1SA 4J0IA 2G80A 4MROA 2AFHE 3WIVA 1ZZEA 4JOCA 3LY9A 4L8LA 4POAA 4Q01A 4UTRA 4C30A 1OFUX 4DT1B 4MWCA 4LBYA 1AU9A 2JFUA 2JF0A 2QW1A 4ZVTA 3FVQA 2SKDA 3O9VA 1ZONA 1PGJA 3NPMA 2J9ZB 3V8NA 3PJFA 4W7IA 4ARIA 3F2VA 1ZK2A 4AURA 1W5SA 2KPOA 2J6CA 1OC2A 1HE8B 1KMHA 3BEDA 1LBSA 2ZT8A 2HF9A 2FVYA 4J7XA 3O8OA 2P9JA 3URMA 5JPCA 1Z7GA 1RM5A 2V5AA 4GMKA 4PAWA 3VR5D 1VYVA 3ZI4A 2B8NA 3CZRA 2VN8A 4RVHA 1FFYA 4PSVA 2GPWA 3KU4A 5ELMA 2FHSA 1VSBA 3UJ8A 4TSFD 2CMKA 1EINA 3ADOA 2FB9A 4XGQA 3UQZA 2YJ5A 2WV7A 2F4VB 1G63A 3DZCA 3JQ8A 1JYEA 5KNBH 1DT3A 1K08A 1ZHFA 3THXA 1BVRA 4J6FA 2XUQA 3AF3A 3CGGA 2EJTA 1DIHA 3PDJA 3DBIA 4RLSA 1WA5A 2FEAA 2WYOA 4CTKA 1G5TA 3GJ5A 4JWKA 1O97C 1Z2OX 1GXSB 1KEUA 4PLFA 1EVLA 8ATCA 1MO2A 4KGVA 2YS7A 3RROA 1HXHA 2IH2A 3ZWXA 5JVDF 2RARA 1FDSA 3RC9A 5LMUB 5FTKA 2HBYA 1Z2NX 4U7HA 5E8JA 3RS7A 4BV3A 2QM3A 4XDZA 3TLMA 4ARSA 4RTNA 2ZSFA 1DBRA 2FKAA 3FCUB 4HUQA 3GZ4A 5FUXA 2RIRA 2GBLA 1B0ZA 1G5QA 2WAOA 4IICA 1VSTA 1Y3AA 5T3YA 2X9LA 4AJ4A 4P36A 1TEVA 5CM9C 4W5QA 3KC2A 3T99A 1Y1LA 3NYIA 2WNHA 4IIDA 4E88A 4YLEA 6CHYA 2EJBA 3QEMA 5AESA 4P22A 2XYRA 2JG3A 1XKLA 3C7CB 1TRKA 2JPDA 1DTEA 3GEPA 3Q8WA 1UIRA 2GN9A 4G2TA 1DI0A 1KMIY 3COPA 3H2ZA 3IFSA 5U4XA 3N2NA 5KX5A 4O4JA 3DMGA 1JDJA 1NJGA 5KEIA 3A3KA 1P0CA 2I8CA 4DGQA 4FW9A 1N2GA 4UHBA 5FBLB 2ZCJA 1Z5PA 1D9ZA 3LD9A 4D9CA 1LQ2A 4BFVA 3I09A 1P2VA 4WY5A 3QNUA 5AO9A 5M34A 2GAJA 5EKDA 2PG3A 1NSFA 2C8LA 2HU7A 1KMQA 2XNCA 3A9CA 4YRDA 4WXHA 1G7SA 1ZM2A 4JOBA 3IOCA 2FK8A 1BDHA 1RXUA 4CFYA 1UQUA 4XCVA 5EWLA 3HXOA 2HCJB 4YCLA 1CUSA 1YUBA 3JWGA 3DDWA 3W9BA 5DEOA 2W6JD 2H3HA 5BSFA 1BU8A 1NRIA 3PC7A 3LPLA 2XVAA 1EQAA 1Y3CE 1IL0A 2G28A 4HADA 1FXSA 1WBJB 3IRVA 4NPHA 4Y1FA 2NT3A 3ASVA 1KK1A 5JWRA 2GK4A 2P0AA 1ITZA 1SZJG 3E5HA 2WUWE 1ML3A 2X41A 3TBFA 3TM5A 4DCGA 3WZ2A 3L7NA 1Z0UA 1SXJB 4PHGA 9LDBA 4U2EA 1U28A 3CRRA 1SU8A 4QELA 4YO8A 1WUYA 2BGWA 2ZAIA 4LJ4A 5AK3A 1M2OA 5LD2C 1TJPB 3ZWWA 3T1TA 1L1EA 2PRIA 3DFFA 5BUZA 3UWKA 3WFZA 4WOJA 5IDWA 1T1IA 4CMIB 4EHJA 2J0QA 3AY3A 3W5CA 2GD2A 2AOTA 3EGIA 3UWSA 4CMKA 4DR4B 4RDIA 3LBIA 3QV1A 4OQMA 2QX8A 4MQBA 4MPTA 3IAM6 1SCUA 3R0VA 2NP6A 3LRPA 3P1JA 5A3JA 1EP9A 1IRIA 4PYIA 1PVOA 3TNLA 3C5EA 2GGSA 2QYHA 1HO3A 5AW6A 2CF5A 3V8RA 1TAGA 4PG5A 1UC5B 2YNMD 4Q12A 4PZ0A 3S2GA 3VOBA 4GI1A 4O4IF 1JKJA