1GV0A

Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
301
Chain Sequence
b'MKITVIGAGNVGATTAFRLAEKQLARELVLLDVVEGIPQGKALDMYESGPVGLFDTKVTGSNDYADTANSDIVVITAGLPRKPGMTLSMNAGIVREVTGRIMEHSKNPIIVVVSNPLDIMTHVAWQKSGLPKERVIGMAGVLDSARFRSFIAMELGVSMQDVTACVLGGHGDAMVPVVKYTTVAGIPVADLISAERIAELVERTRTGGAEIVNHLKQGSAFYSPATSVVEMVESIVLDRKRVLTCAVSLDGQYGIDGTFVGVPVKLGKNGVEHIYEIKLDQSDLDLLQKSAKIVDENCKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Chlorobium tepidum
publication title Structural Basis for Thermophilic Protein Stability: Structures of Thermophilic and Mesophilic Malate Dehydrogenases
pubmed doi rcsb
total genus 109
structure length 301
sequence length 305
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gv0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1gv0A02
2EWMA 1BGVA 3JYOA 5KWEA 4BGEA 5DF1A 5ICMA 2WDZA 3A4VA 5ICSA 2CDCA 2IZ1A 5J23A 4OMUA 4OIMA 3OICA 3ZWWA 1NHGA 1E3EA 3C85A 4MVJI 1NYTA 4PLCA 3AWDA 3HDJA 2P5YA 4R1TA 1NFFA 4WGGA 3KHUA 1YDWA 2B4TO 3D0OA 3O03A 2I3GA 2Y05A 4IPTA 2C5EA 2FRDA 2ZYAA 3UCFA 1RKXA 4E33A 5TS3A 4NBVA 2YHIA 5DCWA 4PN3A 3VPHA 4E5KA 4IMPA 4D7AA 5A04A 3EY4A 3JD3A 4YXFA 1NAIA 2H6EA 2VNAA 4CMIA 1LEHA 3OJ0A 1U4SA 2H5LA 4ZRNA 2HK9A 2WD7A 2JD0A 3PHHA 4BNUA 1NR7A 4DIFA 1LTHR 3UKOA 3AUTA 3FNEA 2J3KA 3MWEB 4UVDA 4WJZA 5GZ6A 2DBRA 2RCYA 2I3AA 4HWKA 3OETA 4KP7A 1SC6A 3RFXA 3B6ZA 2GN9A 3ZWAA 5TX7A 1TT5A 3GGPA 1O6ZA 2BI7A 1U4OA 4DLBA 5HS4A 4H16A 4J43A 2EGGA 1PZFA 4ALKA 4J1NA 4MP3A 4YT8A 2DFDA 4XB2A 4ZVVA 3K31A 4HBGA 4YJDA 3AY6A 1FDTA 3V2GA 4DPMA 1EDZA 4Z6KA 3PGXA 4YRBA 5JC8A 3U4HA 5AOVA 3W8DA 4B4WA 2AEJA 3NYWA 3RI3A 4UEKA 4NG5A 3DZHA 3ZWPA 1GYQA 5A9TA 3TRIA 4PRLA 3TZ6A 1HZZA 1N1EA 1QV7A 2IYOA 2ZTUA 2NV6A 3MTJA 4CMBA 1NAHA 5K9ZA 1ZUD1 1GCUA 4PZDA 4AJHA 3M6IA 5IZ4A 1HDRA 2FSVA 1HZJA 3TQHA 3WYBA 4D41A 2H1SA 5JO9A 4EW6A 2CF6A 2ZIZA 2X58A 1WXDA 5K6AA 3FN4A 2VZ8A 3K9QO 4CM8B 2V7PA 3INRA 4NH4A 4DIOA 3D5TA 2WYWA 4GLOA 4WLVA 1GQYA 1I3NA 3CIFA 1O5IA 1NQ5A 2VHZA 5TJ9A 5KIAA 3F9IA 1ORRA 2B37A 3Q9UA 1EVYA 1QLJA 2AHRA 3P5SA 1XKQA 2WTBA 4YQYA 4B7XA 3U4CA 4BVAA 2EGHA 3Q2KA 1R4NB 2GERA 3PJDA 3IAHA 1JWAB 4FB5A 1PGOA 3A14A 4E0BA 1VL0A 2J5QA 4DC0A 4E5PA 1HE2A 4R9RA 4RGBA 4O1MA 1F8GA 4CUZA 4CQMB 4WCFC 5G2OA 3ZCXA 2HAEA 2ZQZA 2C2XA 1VE9A 2QG4A 3HADA 2POQX 4U0JA 3ZNNA 1DDOA 3BTSA 4CV2A 2CVQA 4CMKA 4D3DA 1EMDA 1OMOA 1X13A 1J5PA 1PJ2A 2E6UX 3H6KA 3IUSA 3GMSA 4BO6A 3DBHA 5A9RA 1MXFA 3BHJA 3HWRA 3WGHA 1M6WA 1YRLA 4FN4A 2NQTA 4RL6A 5KVSA 1O0SA 3JQ6A 3WICA 1WMBA 5FI5A 5TNXA 2FR8A 2P91A 4ONEA 2JKVA 4UUMA 2OOSA 4PLTA 1Y5MA 1LLDA 3JQ9C 1UUFA 3DBLA 5F21A 4R69A 1X7HA 3FBGA 1EUDA 4BKUA 4U6QA 1NPTO 2ZJ0A 2JAHA 4XGNA 5JXWA 1PL8A 4DTIA 3WS7A 3G79A 1E7MA 4CPDA 4CM7A 3N74A 2H63A 4EJ6A 4NFYA 3JQGB 4XQCA 1DJQA 1P33A 4ILKA 3VKVA 1A9YA 4E5YA 3S1LA 2Q1WA 4QECA 3ZI0A 2G82A 2JFHA 4FJ0A 1WZEA 5COQA 3AY7A 4HNGA 5G4LA 1N9GA 1ZK2A 4KWIA 4WLEA 3ZWOA 5ENDA 1GU7A 3KXDA 1ARZA 5LDGA 3T7CA 4BNWA 3JCZA 4BKPA 5JFOA 5FEUA 3VH2A 4WLUA 1UAYA 4BQRA 1WMAA 3C8MA 3U09A 3TZKA 3KUXA 4RF2A 2YZ7A 2DLDA 2HK7A 3GHYA 2I67A 4RPJA 4Q39A 5I9NA 2X7HA 2X5KO 4XRRA 3ZU2A 3DTYA 2Y0CA 3GMDA 8LDHA 1I3MA 3AUSA 5EJ2A 5EL0A 4QO8A 4OL9A 1K6JA 5L3ZA 4UUNA 1NPDA 1YVEI 1DIAA 2BFPA 2WYUA 3FI9A 3WR5A 1HDGO 2BH9A 4GWGA 4XR9A 3W6ZA 2GASA 5JYEA 4ZQEA 1KEVA 4O6VA 5DCYA 2NUAA 2X22A 1DPGA 3DBRB 4CQLA 4JJGA 3WIDA 4I9UA 4KTTE 2EJWA 4YB8A 1Y6JA 3EDMA 1Q7CA 4AVYA 4TRJA 4CM4B 1UAGA 1LDBA 1UXHA 2BGKA 1P44A 1XQ6A 4I8XA 1X0XA 4EBFA 4RORA 3NX4A 5BNIA 5IG2A 5JW6A 4CMEA 4W82A 2FR1A 1B8PA 1VKOA 3BMQA 3AM3A 2IZ0A 3EZYA 3JQFC 4EUHA 3OF2A 4BNFA 5BNTA 2VWGA 3FR8A 1FF9A 7ADHA 4GLLA 1OI7A 2C5AA 4IDDA 3PPIA 5EIOA 3WGZA 3JQ8B 4HFRA 1UDBA 4E12A 1PWXA 1R0KA 1E92A 1X15A 2YY7A 3WJAA 1LDMA 4OJNA 3ORFA 1KETA 1OBFO 4LGVA 4Z0HO 1NVGA 3UCEA 4RJTA 5A4DA 5B4TA 2NTJA 2GN8A 1OC4A 1KERA 2HO5A 1NXQA 4ND4A 2BELA 3H9EO 1Q7BA 5A5FA 1ZJZA 2EKPA 3RSHA 3TZHA 4CR8A 3DAGA 1EUZA 2Y0EA 5T5QA 2D2IA 2QZZA 1HYEA 1H9AA 1RWBA 3BMOA 2A35A 4RF3A 1D1TA 3BTUA 1F8FA 3M2TA 3DQPA 4LK3A 3QWFA 3LT0A 3BTOA 1C14A 4PG6A 4NK5A 3IC5A 4NU5A 2W2LA 4Z9XA 4CL3A 2UDPA 4CMCA 1QG6A 3F1KA 5ILGA 2OO5A 3GFBA 4WEOA 4I5FA 1YWGO 5TT0A 4A7PA 5IZCA 3MJVA 1K3TA 4FIZA 3H5AA 4L74A 1N8KA 5DT9A 1RJWA 4A27A 3QP9A 4XRGA 4J2OA 1BMDA 2EIHA 4LCEA 4YWJA 3NGLA 2DBZA 4L0QA 3AI2A 4GAEA 1ZVMA 1VRWA 2G5CA 4QX6A 5JDCC 1KOLA 2Y93A 4IJVA 4LVCA 1G0OA 3DHEA 3L4BC 3NAQA 1PX0A 3ZDFA 3A9WA 1LDNA 1NP3A 1F0YA 1SEPA 2X9VA 4JNKA 1ISFA 2VRCD 1PZHA 4FGWA 4GQAA 1IZ9A 1YOVA 3B20A 4YAKA 4A10A 2JL1A 2OHXA 2B5VA 4OXKA 4P4GA 3WBFA 1YB5A 2Z1MA 1R12A 4HP8A 1YH3A 1PEDA 4YACA 3S2FA 3GRPA 3GG2A 1C0LA 5KNLA 2NTNA 1JKIA 1BVRA 1FXSA 3JD1A 5TIIA 2B4RO 4PZCA 3I9KA 1UP4A 1N9GB 3INTA 5F5LA 2AG5A 3PJGA 4LSMA 3W4JA 1RYEA 1HE4A 3AUUA 5CDSA 2NU7A 3HG7A 4YDRA 1GEEA 3KOUA 4MDHA 4XQGA 3FNHA 3CSDA 4GL4A 1HWYA 2DTDA 4QT0A 1DC3A 2A4KA 3E6AA 3TPCA 4XR4A 4B3HA 3I1JA 1TT5B 4R4JA 1Y7TA 1TVEA 3C7CB 2Q4BA 2YV1A 3H9UA 4L4SA 4N5LA 2EF1A 4IDBA 1Z6ZA 2AEFA 3F4LA 4S3MA 3GZNB 5IF3A 2X5JO 1R66A 1T1SA 4WUVA 4CQMD 3UN1A 3VTFA 1BDMA 2VYVD 2QQ5A 1MV8A 1IULA 4MIEA 3GQVA 5F1KA 2JFFA 1Q0HA 3AJRA 5GMOA 4OGWA 1AE1A 1XQ1A 3E5MA 5A5EA 3CMCO 4YQZA 1P1HA 3OIFA 2VUUA 4BO0A 3PI7A 1LSUA 4ID9A 3WLFA 1D8AA 1FDVA 1XR3A 4QQRA 5G0SA 3JD0A 2YV3A 3OP4A 1C1DB 4BO4A 4BNLA 2IYPA 4OH1A 4PG4A 4W4TA 3W4KA 2X6TA 3DEYX 4W7HA 2VWPA 1W8DA 4RVSA 9LDBA 2B36A 3KYCB 3QVWA 5KKAA 2PZLA 3ZWVA 3C1OA 5IDXA 4IDCA 3WWYA 3BZUA 2VRBA 3W6UA 1U3WA 1XU7A 5FYDA 3TZQA 3H5RA 4YJHA 4N5MA 2GGSA 2D5CA 2NU8A 4J0FA 4TMFA 4UULA 3SLGA 1EBFA 1M75A 3F47A 4XEHA 3GNTA 4WLFA 2P9CA 1KVSA 5TSDA 2E37A 1Y8QB 2PH3A 3X2FA 2EKQA 4J7UA 1EVJA 3PWSA 1ONOA 3C7DB 4CQMA 5KJEA 4E2YA 5U4QA 4J3FA 2QW8A 3DOJA 1GCOA 8ADHA 3K30A 1ZEJA 4Y8VA 3TFOA 2O3UA 1T24A 2ZB4A 4G81A 2JD2A 1JAYA 2ZTLA 4JX8A 4CM5A 3CE6A 5JDIA 2ZTVA 4XYMA 5KCZA 2DFVA 5T57A 2ZB8A 3X2EA 3PVZA 5JDIC 4OXYA 3PDUA 4RZHA 4JN6B 1Z74A 1M66A 1ZXBA 3OA2A 3SEFA 1H5QA 4F3YA 1XG5A 1Y1PA 3GVPA 1U8XX 1DEHA 4N54A 4FPXA 2W2LD 1BW9A 3DMTC 3R3SA 5DULA 4AJEA 1WVGA 4TZTA 2DT5A 3WGQA 5C3MA 1J4AA 1RYDA 3WXBA 2PV7A 1I0ZA 3PLNA 3PXXA 3AFNA 1SBYA 3PDJA 2EW8A 1WPQA 3ICPA 2W2KA 5EQFA 4EI2A 2B69A 1NHWA 5KJFA 4IDEA 1R0LA 4EUFA 4OSOA 3DHYA 1YQDA 3WMXA 2VOEA 1DHTA 4FS3A 4H3VA 2WE7A 3OSUA 4RVGA 1T2FA 1HETA 1R16A 1GZ4A 4BNNA 4INAA 4E6PA 4LSWA 4XYEA 1ISHA 5U9CA 2BI8A 3L07A 4DLAA 5C7LO 3VVBA 2DKNA 2NVUA 4C7KA 5JNLA 2EKLA 3OJOA 1N1GA 1U7HA 3OECA 2O3TA 2EXXA 5JCJA 3ONFA 3ULKA 5A9SB 2VZ9A 2EW2A 4GMFA 3VPFA 2DUUA 3PZBA 3KTDA 2C0CA 4J4HA 4UEJA 4W9NA 2E48A 1OFGA 2W98A 1YL5A 1HTBA 2AW5A 2PZKA 1FK8A 1GR0A 4EZBA 5TLSA 4ND5A 3DZKA 2Y68A 5KVCA 3PEFA 5BT9A 2D4AA 3RFVA 1G6KA 2PWZA 4IXTA 3WSWA 4EJ0A 4IINA 3CZRA 4DXHA 5DNAA 3KV3O 4NJMA 1DHRA 3GEDA 4O59O 5T8KC 1LQTA 3T4XA 4MKXA 4YJHB 1MC5A 4DL9A 3UOGA 4YT2A 2C07A 5BNFA 2BGMA 3E82A 3A28A 3HB5X 3NDIA 2PTGA 1NQOA 4A5OA 1SO8A 3UW3A 4ALLA 3I9NA 3S2EA 1P77A 3AOGA 4KZPA 4WK6A 4L8VA 3KBOA 3ROMA 2WD7B 4GWKA 1DFIA 3OEWA 2C29D 1VSUA 2EP7A 2OP1A 2AQKA 3JSAA 4RO0A 1GADO 1E0DA 1PQUA 1YB4A 2WE8A 4BNTA 3PIDA 1I24A 3PQDA 5JPIA 2FMUA 2OGUA 4D44A 5BSHA 5IAAA 3PK0A 4QTZA 2JCVA 2VTDA 3HJAA 3O9ZA 4MOWA 1C1DA 2G17A 4AJKA 2IE0A 4AJ1A 1O94A 4R1SA 4J9VA 1YB1A 4MINA 1V3TA 1VSVA 1ZSVA 2Q4EA 2NM0A 4E3ZA 5L40A 2PD6A 4CLOB 5G0UA 4DIBA 2DVMA 3JV7A 2P2SA 5CDTA 3GVHA 4CQLB 3RKUA 7MDHA 3U62A 1R15A 3R6DA 4MJLA 1F14A 5JO0A 4FBGA 2EP5A 3GUCA 1P3DA 3ANMA 4NNJA 3SC6A 4LW8A 1ZSNA 3E18A 1GUYA 4CM4A 5B4UA 3GDOA 4AJIA 4B4VA 4H15A 2ZKLA 1SEVA 3BMCA 4NBTA 4K9DA 4D42A 3GAZA 3PP8A 1WDKA 3OH8A 1E1LA 1TT7A 4IJUA 1P1JA 2B83A 2RHCA 3M2PA 4TWRA 4W7IA 3CXRA 5HM8A 4PVCA 5I7EA 1ISMA 1TI7A 3LF2A 2VN8A 3ZN2A 4BMNA 3BMNA 1EVIA 1XEAA 6ADHA 3C1TA 3WOHA 2O4UX 2RH4A 3C24A 1Z7EA 3CINA 3DMYA 4FFPA 5B12A 4Z0TA 1XELA 3JQBC 2TMDA 4KTVE 2NU6A 2C82A 3H9GA 3WQQA 1JLLA 1KVUA 4Q3BA 3GF4A 1E1MA 1VL6A 3NDRA 2VUSA 3GG9A 4LVUA 1U28A 4P22A 2Q3EA 1GYPA 4P38A 2VWQA 1B0AA 1DO8A 1A72A 2Q45A 1X14A 2A92A 3LT1A 5A3VA 5JY1A 3PHLA 1GYRA 2HUNA 4IMRA 3I3OA 3RUIA 4D0RA 5HRUA 4U7WA 2XXJA 3OQBA 1U8FO 4NMHA 1PGNA 2CVOA 2O23A 4RDIA 5A03A 1GV0A 3T4EA 3ZU5A 1E3WB 1UZNA 3AW9A 5AXDA 4IJKA 1SOVA 3B1KA 4WCDA 4BNIA 2BHLA 3LQFA 4EUEA 4P4LA 1E5QA 4J91A 1QRRA 2AMFA 4AJJA 5JAIA 2HMVA 1NX6A 3DTTA 4J1QA 3OJEA 4ND1A 1T2DA 4E5NA 3WBBA 1Y5RA 2P4QA 2D59A 2F1KA 1SPXA 4CM3A 4GSKA 4RPKA 1KEWA 1I32A 5BSFA 3GH3A 2X8LA 2WEKA 2HDHA 3GDGA 4MVJF 1SOWA 4Q3EA 3CH6A 3G1UA 4ZRMA 1I2BA 2Y1CA 3IS3A 1A5ZA 5ILOA 2FPIA 5IZCC 2ZJ1A 3HFSA 5AYVA 1IHXA 4UVIA 3RASA 3UXYA 5CAEA 3NDJA 2Y1OA 4DC1A 1Y81A 3LVFO 4RPHA 5JYDA 4GX2A 3VZRA 3ZGYA 1K89A 3FRJA 1Y9EA 3JYNA 4MVJE 3DXFA 1BG6A 1HYHA 2Y1DA 1U9JA 3NEPX 3F3SA 1QSGA 2E4AA 3HNPA 1DC6A 1DJNA 3ETGA 4GBJA 4NZ9A 1B26A 3ZV4A 1JVSA 1L7DA 2IODA 3I83A 1NR1A 1I30A 2Q2QA 4NFSA 4Q3NA 4R1NA 4TZKA 1Y9AA 4GX5A 3ZHBA 4AJ2A 1LQUA 4J2HA 4EEXA 1LJ8A 4BO8A 4OM8A 3LDHA 3NJ4A 1I8TA 4YA6A 3ZV5A 3RWBA 3I4CA 1A9ZA 2R2GA 1LLUA 3IJRA 3VH3A 4I1IA 4I5GA 4AL4A 3H3FA 1ENZA 3VPXA 4W9NC 4H7PA 3GDFA 3KETA 1BVUA 2PK3A 5JCJD 3RU9A 3Q2IA 4MO2A 4JP2A 2ZYDA 1HL3A 3I4FA 3S55A 4YJFB 4BV9A 1X1TA 1YDEA 4II3A 4MP8A 1QXSA 4CMAA 3O4RA 4EITA 2PY6A 1GQQA 3FWNA 3KYBA 4L75A 2NNLD 3K5PA 2Z1NA 4AJ4A 1JN0A 3ABIA 2P9EA 1UXIA 1KVQA 4CR6A 1ZK0A 4DVJA 1IHYA 4R68A 4U8GA 4NPCA 5L53A 3RJ5A 4HX5A 4GKBA 3WX0A 1I36A 3QY9A 2YQ4A 2Q46A 4M8SA 4MPDA 3OBBA 2HJRA 4YVFA 3PHIA 3RC9A 2I65A 2RIRA 3B1FA 1JKFA 3SXPA 1M76A 3E8XA 3ASVA 4XDYA 5GZ3A 1QYDA 4N5NA 2PGLA 3FPCA 2Y66A 3ZU4A 3WJ7A 1DOHA 4Y6SA 1HE5A 4IM7A 1G0NA 3PYMA 1MXHA 2DQ4A 4Q9NA 2O3RA 3JD2A 3MOIA 3Q1LA 2DTXA 1XIVA 4NU6A 2A94A 1KY5A 4IZIA 3CPSA 3Q3CA 1H2HA 2V6MA 1HDXA 3BMOB 3Q11A 4IQGA 3MJTA 4YT4A 1MB4A 1LSSA 4BO5A 4BNXA 1HDCA 1PJBA 3EAGA 4JGBA 3QWIA 3SJUA 5C7IO 2VTEA 2OUIA 2QRLA 2SCUA 4NBUA 1AUPA 1FMCA 4UVHA 2Q1SA 1OZAA 3ANNA 4XQEA 3V1TC 2J3JA 1FDSA 3PHGA 4UAGA 4E31A 3L6OO 4GVLA 4RVFA 5ITVA 3LC1O 2DPGA 3U4IA 4YBZA 1PQPA 1XA0A 3L77A 4DUPA 5B1YA 3D4OA 4UUPA 2UYYA 2ZCUA 1YXMA 4J9UE 4PLYA 2Y99A 3K6JA 4E5MA 2X4GA 2HQ1A 3I9LA 4NJOA 3QE3A 1E3IA 1MUUA 2JHFA 1VKNA 1QKIA 3U4DA 4F6LA 1NWHA 4CUJA 4RZIA 4Q3DA 3BIOA 3ZHZA 1ZJYA 3VZPA 4HFMA 3GZ4A 1WWKA 2QHXA 1Q2XA 1U3UA 4ZU3A 3NV9A 5T67A 1I2ZA 3K73O 1CDOA 3IJPA 2NVWA 1E3LA 4NK4A 3QWHA 5DBGA 3HDYA 2XOXA 4W99A 2X0RA 2V6BA 4MKRA 3ZWCA 3PJEA 4M86A 3PLRA 1DBVO 3AM5A 2ZB3A 1UP6A 1ONPA 2O2SA 1EQ2A 1LA2A 5TF4A 4PZEA 2RAFA 4YCAA 3QRWA 4WEQA 1HDOA 3DZFA 9LDTA 5JAZA 4Y67A 2YJZA 2CDAA 3AOEA 3RVDA 4M55A 3DO5A 1J49A 2NVUB 3WG9A 5CDYA 3JQ7B 3LYLA 1NVMB 2Z5LA 4K6FA 3AOEC 5IN5A 5KJ6A 3DWFA 4IGFA 2J3HA 3GN1A 4ZQHA 3DB2A 1A7KA 3JQGA 1O95A 1DIHA 4J7CA 3O8QB 1D4FA 1YQGA 3AK4A 4CM9A 1E3WA 4FFOA 1ONNA 1T2AA 3ZHXA 3WYEA 1MX3A 3KYDB 3P7MA 4Z9FA 1GL3A 4CV3A 3F1LA 3HFGA 4ZHSA 2H9IA 2WM3A 3C1AA 3E03A 4JP3A 1W73A 4PLHA 2FZEA 3UICA 3FR7A 4B4OA 1MG5A 4CR7A 5EERA 1HDZA 4NJMB 1YS4A 3MJ4A 5EESA 3HQ4O 3DBRA 1IYZA 4MVJA 5L45A 3FSRA 4ZN6A 3V8BA 3WMWA 1XCBA 4Z0PA 4KUEA 2B5WA 2B4QA 5G0TA 1TA4A 4RVHA 1PL7A 4RPLA 2BFOA 2VOJA 5L95A 2GN6A 4YRDA 3RUDA 4DLLA 3WFIA 3FBTA 5CDGA 4OQYA 3FTPA 3WNQA 3PFWO 1UXJA 2YFQA 1X7GA 1P45A 1QYXA 4ZJUA 1CQIA 3PWZA 4Y6PA 1K0UA 4L4XA 1VL8A 3UFXA 4PG7A 4E32A 3AUAA 2RBEA 1VJ1A 2X23A 3HUDA 4XZ3A 3RROA 3EK2A 1BRMA 1LC3A 5KVVA 3N58A 4AJLA 5K0ZA 4JJFA 2Y1EA 2Q50A 1Y8RB 2AE2A 5A1TA 1T26A 2D5AA 4IJWA 3GN2A 1YO6A 2VHWA 2FN7A 4PFJA 4LISA 3COSA 3V1YA 1GEGA 4YT5A 1A4IA 1V6AA 3WFJA 2O3SA 3ZW9A 1ENOA 2IEDA 2P4HX 2P68A 3NJ8A 5FFFA 5KTKA 1PGPA 1UDAA 2ET6A 3OEYA 3C3XA 1P0FA 2GPTA 1DB3A 3GAFA 2NLOA 4LN1A 3ENKA 5JAQA 3Q6IA 4D79A 4NBRA 5THQA 2BD0A 1M6HA 2D0IA 2IRWA 4R01A 4F6CA 5IFLA 3SVTA 3ZWXA 2CDBA 4RF5A 4YYZA 1ADFA 5CFZA 3NTOA 1GPDG 1IOLA 2CD9A 4OSPA 1EEHA 3MJCA 2AXQA 4NR0A 2OZPA 2HSDA 5ER9A 5COBA 2C20A 4WCFB 2OP0A 4DBZA 4R5MA 4IXWA 5LC1A 4FC6A 4CLRA 1ADGA 4OKIA 1YONA 2GCGA 1HEUA 2X0JA 2X9GA 3VKUA 1MFZA 4YRAA 1O89A 3EW7A 3MCVA 2BRUA 3R1IA 5KJCA 5IDWA 3SJ7A 1D3AA 1VLLA 1DRWA 3AY3A 1B14A 4CMIB 3WTCA 1FDUA 3BXXA 1ZMOA 4ALJA 3WWZA 1JQBA 1NVTA 3QVOA 1M67A 3GFGA 3DL2A 4KMSA 1LNQA 1LU9A 2WJPA 3AFMA 1DC5A 1WDLA 2I5PO 3BTVA 3ROPA 1HKUA 1HSOA 3G3EA 4OOEA 3BA1A 4XCVA 3H5NA 4OO3A 3O8QA 4XGKA 2FWMX 3KLMX 5G4KB 4XB1A 4J1TA 1IE3A 1ML3A 1CJCA 1EZ4A 3RAJA 3KO8A 4FC7A 3ZV6A 1LI4A 4UVEA 1DRVA 4MVJD 3WIEA 4S1VA 4IY1A 4KWHA 3NRCA 3TJRA 3I9MA 1VI2A 3UUWA 3FTNA 4W6ZA 3ZZNA 3OJFA 1C0PA 2D1YA 5F1OA 2RH8A 5L7YA 2EG9A 4YPOA 1HF3A 2CSUA 1UXGA 3ZHYA 1NQTA 1V8BA 4ALIA 4R3WA 5A05A 3RC1A 3D7LA 2CMDA 3BHIA 2VNSA 4BO2A 2YUTA 1PIWA 3STHA 4BO3A 4C4OA 1YOVB 4BQPA 3GVIA 4Y98A 5B4VA 1PWZA 4TSKA 5L4LA 1E6UA 3KZVA 4ZQGA 5I8WA 4OHUA 3IOYA 2PD4A 1ZNQO 2AEMA 3L9XA 4PLPA 3RUCA 4NBWA 4HFJA 3KYDA 4GGOA 4UUOA 4DBVO 1I10A 2VQ3A 2XAAA 4EYEA 4WOJA 1PJSA 1P31A 2VZ0A 3IQDB 2CNBA 4R1UA 1UJMA 1JWBB 4EJMA 5CEEA 3UHAA 1PZEA 5MGBA 3E5RA 1XYGA 3ADOA 1K6IA 2V6FA 1RPNA 3HSKA 3LU1A 5L9AA 4TKLA 2GD1O 3FCOA 4JJIA 4YAGA 2WD8A 2WWRA 1D7OA 2HRBA 5TC4A 1PJLA 1X0VA 4A26A 4YR9A 3G49A 1PR3A 3MZ0A 3JQ9A 3PYLA 4BGIA 2FR0A 2PD3A 1TLTA 3RIHA 3LC2O 2Q99A 3ZV3A 4GPD1 3V2UA 4GGPA 5I7VA 2DBVO 2DU8A 3DZIA 2GSDA 4RVDA 5ITWA 1N5DA 4BGUA 2PGJA 4KQWA 2Z95A 3LSYA 3FNGA 1DXYA 1CF2O 3RQSA 1V9LA 1VJ0A 4BKQA 5FI3A 3UVEA 5HS6A 3D3WA 1SZJG 3F46A 4YTEA 1BW9B 3KSZO 1W0CA 3JTMA 5AXCA 1GY8A 1E7SA 2C59A 3WYCA 3ZWMA 1ENPA 3K2BA 3WB9A 1HE3A 4WKGA 4ZD6A 3OJLA 4XGIA 1E6EA 1M2WA 2YHUA 4BNKA 5I7SA 3VPGA 1SCUA 1W4ZA 2AQHA 4M89A 1IPEA 1H6AA 4D3SA 1B8VA 4Z3KA 4QEDA 4B8WA 2F00A 1U5AA 2VRCA 1N92A 2JD1A 1LC0A 4JLWA 1XU9A 2UAGA 4LMRA 4AICA 4X54A 3TOZA 3PWKA 5T6BA 4BS9A 3WQSB 4J7XA 1GTMA 4Q3CA 3VC7A 4RQUA 5JMWA 3FF4A 1BXZA 3A06A 4ZQBA 3WSVA 3OA0A 4NQZA 3ADPA 4FOOA 4E4YA 4TVBA 3RUHA 4WECA 4IS2A 2PKQP 4R16A 4B3IA 1GFSA 4FCCA 4K26A 1XHLA 5JLAA 4CMJA 1Q1NA 2FP4A 3QV1A 2C2YA 4KQXA 4IS3A 5IN4A 3KB6A 1DIGA 1BDBA 3KRTA 4C7JA 4WLOA 1QLHA 3GNSA 5THKA 3NT4A 4PVDA 2FY8A 1DRUA 1F06A 4K28A 4TVOA 4E2XA 3BAZA 1GD1O 4TROA 1IB6A 5I7FA 4L9RA 2GRAA 1U3VA 4D3FA 2O48X 4A73A 5ENVA 1ZCJA 2O3JA 3VH4A 3H8VA 4CMEC 3JQBA 3PGJA 1P1RA 1ZKMA 3VHRA 4MKZA 1J6UA 1ZO8A 3MTGA 2YYYA 3RU7A 1P1FA 3PHJA 2UV8A 4RVUA 3EYWA 1S7CA 3VDRA 1R37A 3FWZA 2O7SA 3GPDG 4KDEA 4IQ0A 4ND2A 4QO7A 1FJHA 3I9OA 1GPJA 1WW8A 5TGDA 1PJCA 4R41A 2VCYA 1Z75A 1PS8A 4LMPA 2B0JA 3D3EA 3I52A 4FD3A 1ENYA 2X0NA 3OQ1A 4O5OA 4L73A 4UEOA 5JBIA 1LUAA 5CHEA 3ETEA 4WLNA 1SNYA 3DFUA 4CMHA 3I6QA 3JYLA 4II2A 1JKJA 3GEMA 1IL0A 5JS6A 4DPKA 3V2HA 4XWYA 3ZH2A 3QIVA 1EFKA 1VC2A 1E3SA 1QR6A 3OM9A 2JHGA 1EVZA 3TF5A 1N7HA 1QYVA 2OBNA 3GRKA 3H3JA 4XQ9A 4L4RA 1AHHA 2UUPA 1KVRA 1KBZA 5DBIA 5HWSA 1XLTA 2BMAA 1B7GO 5C7OO 1PJTA 1QV6A 3AU8A 3ONEA 4RPGA 5EMHA 3DAPA 4D45A 4CLOA 3LLSA 1JU9A 3L4BA 4GX1A 3MWDB 4L76A 1EFLA 1JVBA 2HK8A 3N7UA 2JJYA 4IGEA 3QSGA 4QSMA 1GV1A 1MA0A 2AA3A 4RLHA 3VPSA 2I76A 3NTRA 4FJ1A 4UVGA 6LDHA 3L9WA 4MIOA 3DBVO 4EGFA 4FQ8A 3ZWBA 4FSHA 1Y8QA 5DOVA 2R00A 1ZEMA 1CEQA 3AU9A 4EDFA 3SBOA 5EN4A 4E2WA 2PKQO 3H65A 2QRJA 1F17A 2XXBA 4RV9A 4XD2A 1H6DA 4E2ZA 1I33A 3D64A 1OC2A 3K96A 3PIIA 5DP2A 3KSUA 1TXGA 1PQWA 4YJGB 3TFQA 4HV4A 1Z82A 3EVNA 4J0EA 4WOKA 1YBAA 3D4PA 5F5NA 3RUFA 1U7TA 1KC1A 4PLGA 4WCFA 1T4BA 4O0LA 3TOXA 3NTQA 1I2CA 4OAQA 2G76A 2V65A 3K2EA 3B70A 3L0DA 1BXGB 4A0SA 3H9QA 4HADA 1L7EA 4XYBA 5A02A 1Q7GA 1GZ3A 1RM0A 3F6YA 3L4SO 2EHDA 3M1LA 4XYGA 4BO1A 4DRYA 4E13A 4AG3A 1DFGA 3NGXA 4CM6A 1ID1A 2DM6A 2GZ3A 3L6DA 4AJPA 4N7RA 1LX6A 4JCOA 3ETDA 2GNAA 2QYSA 2O3QA 4O63O 2Y1GA 4QUKA 3DC2A 1I3LA 3GNQA 1NTOA 4DGSA 1JAXA 1UDCA 1U5CA 3RUAA 4DQXA 1OOEA 1KIFA 3U0BA 2CUKA 2J6IA 1VM6A 3TDKA 4NDNE 1Q0LA 3G1TA 1KEPA 2HMUA 2XPCA 4RLSA 4BO9A 1PGQA 4CMGA 3H9JA 3Q0EA 4YJFA 4E21A 3IKVA 2LDBA 4PIVA 4QFDA 1YL6A 3AI1A 2C7GA 4CLEA 3IDSA 4BMSA 3ZWNA 4IIUA 4XJTA 5JC1A 4JXKA 3AI3A 3LZ6A 2EJVA 3ZWYA 2HLPA 3D3WB 1B8UA 1O9BA 3ST7A 3KVOA 3LC7O 4YAIA 1T4DA 3WGYA 1VPDA 1DSSG 3DZBA 1ZK1A 3TN7A 4HUJA 4I9HA 3TWOA 1AN9A 5A3JA 2CFCA 2IDZA 1BTOA 4GMGA 2NACA 3QW2A 1GAEO 2O4CA 4DQUA 5AQ1A 3GGGA 3E1KA 5C5IA 4WNIA 4CM9D 2PH5A 1QYWA 2J5RA 1TB4A 2O50A 3G0OA 4MP6A 2VT3A 4BKOA 4MVJG 5G4KA 4NHEA 2NSDA 1UR5A 2GYYA 3I6IA 1YE3A 3QWAA 1T25A 3EUWA 3F5SA 4DMMA 1PS0A 5MDHA 3B1JA 4BKRA 1K2WA 2A9FA 2W2KB 4PLWA 5BR7A 3JQAD 2VT2A 5CEJA 1LDEA 1KY4A 2BKAA 1QP8A 2OBYA 3DMTA 3JD4A 4I08A 2BF7A 4PLVA 4D46A 1NFRA 1BHSA 1IZ0A 3RKRA 3D1LA 4CLXA 2UVDA 4ESOA 3DBHB 1W6UA 2DTEA 2EEZA 3DZJA 4K6CA 4WNCA 2C54A 1SAYA 2FHSA 1DLIA 1V0JA 1LRKA 5HBRA 3TNLA 3INGA 1YQXA 3GOHA 3H2SA 2HKIA 1E7YA 4R9SA 3KM0A 2JFGA 5CPFA 2X86A 2OMEA 5JE8A 1PJ3A 2PNFA 1NASA 5CG1A 1C3VA 4JROA 1JA9A 4JBHA 4KOAA 3MOGA 2CF5A 1L1FA 3RBXA 2PR2A 3DOOA 1U3TA 1WLYA 3OQ6A 1WNTA 1AXGA 1EE2A 4PCVA 4BB6A 4Z9YA 2IXBA 1T1RA 1ZMTA 1U2DA 1NNUA 5AXBA 4TQGA 5IDYA 1JDJA 3ROKA 1PR9A 3IIEA 5JSFA 2UUOA 1X1EA 4R5HA 1PU2A 2P5UA 4BNGA 3GUYA 3W1VA 1AGNA 4FR5A 4BO7A 1RM4A 4CM1A 1A27A 2C7VA 1QORA 2PZJA 3FNFA 1YKFA 3OHSX 1H6BA 2OORA 4BNJA 1ADCA 4BUCA 2HRZA 4CUKA 1LSJA 4KUGA 1LBEA 2ILTA 1ISGA 4HNHA 4G5HA 4K1LA 5F3RA 1PGJA 3HHPA 1PS9A 3I23A 3QHAA 3U49A 3GK3A 2X5OA 3I5MA 1OAAA 3BMQB 1FDWA 1Z73A 1GUZA 2WYVA 3R0IA 3CKYA 1DIRA 2Q1UA 3WNVA 2GR9A 2X9NA 4ND3A 4BL5A 3GA0A 1XDWA 5C37A 3DR3A 3A1NA 3JQ7A 3GY0A 3QLJA 3ZW8A 1XWFA 3GPIA 3JQAA 1MLDA 3TZCA 3HZZA 4B4UA 2VYNA 1H2BA 2YV2A 1H6CA 2HCTA 3BYZA 3L6EA 4J16A 4P4NA 3QJ5A 2LDXA 4HKTA 2P9GA 4ITUA 5LCXA 1LSOA 4IDAA 5CDUA 4M49A 1UP7A 4TRMA 4DA9A 2HMWA 4HXYA 1PSDA 4XA8A 5JCXA 2Y67A 3DONA 1MG0A 5TQVA 3HN2A 2VHXA 4I5DA 5AVOA 5IXYA 1CIVA 5L7TA 1CETA 1JW9B 2HMSA 2IXAA 5CP8A 3P2YA 4FFLA 2CZCA 2QZ9A 3MJSA 4WE3A 3IP1A 2HJSA 3VVCA 4J6FA 3OFSA 5ES3A 4CV1A 3E9MA 1YJQA 3NKLA 3PZRA 4BMVA 1E6WA 1A4UA 3UCXA 3FHLA 1DAPA 5H81A 3CEAA 3WGGA 2NVBA 1IPFA 2CVZA 5H83A 1HYGA 3PJFA 1CYDA 4EEZA 4U0KA 1E77A 4ROSA 3SLKA 1AHIA 3MEQA 1Q0QA 2DUWA 3CTMA 1UXKA 3JQDA 3O26A 4MVJP 4RDHA 5JMPA 1WP4A 4PGFA 3EGOA 3RUEA 5BQFA 1IUKA 1E1NA 3I9JA 5G0WA 2BGLA 2I99A 3R3JA 3GZNA 1DLJA 2YHIB 4AJOA 3GR6A 4OXNA 1S6YA 4B7UA 1ISIA 1V3VA 3RJ9A 2Q2WA 1IY8A 1LLCA 2VYND 3LF1A 3QVXA 2QIOA 2J3IA 2FZWA 4JBGA 1WZIA 4WPGA 1B3RA 3P2OA 4F46A 4Y9DA 2DBQA 5L51A 1SB9A 1HDYA 1T2CA 3BMCB 3HB4X 3ITDA 4XYLA 3KYCA 1Z7BA 4BNMA 2GN4A 2GZ1A 3GHHA 5KOIA 5IXSA 4XX0A 1P1KA 2VWHA 3VZQA 1TEHA 1NQAO 1ZFNA 1ZK3A 4JIGA 5DZSA 1BXKA 1BSVA 1RM3A 4KUHA 4BNVA 1G1AA 4Q3AA 2B35A 1LRLA 4YEDA 5DP1A 2X1HA 3ZNPA 4G2NA 2BFMA 1EUCA 4E30A 3OIDA 3HDHA 1LLQA 4I5EA 1C0IA 2I66A 2ZK7A 3VTZA 3TL3A 1MP0A 1EE9A 2D3TA 2JAPA 3WGOA 3T7EA 1I5RA 4YAEA 4BGVA 3LT4A 1JTVA 2BLLA 3JQCA 4MVJH 1K5HA 4ALMA 4DMLA 1MFPA 1E5LA 1XGKA 4JBIA 3WTBA 4XKJA 4DYDA 3IMFA 3ASUA 4TRRA 1HLDA 1WAMA 2GLXA 2NU9A 4IZHA 4IIVA 3W8FA 3CMMA 4RF4A 3GGOA 1UH5A 1E3JA 5B37A 4F45A 1H9BA 4XDZA 5DN9A 5L4SA 1ZZEA 3UH1A 4YAJA 5EQDA 4BNYA 2W90A 2PGDA 3K92A 1B15A 5K6AC 2I6TA 4IQ8A 1PTJA 1WDMA 1ZBQA 4PLZA 4U6SA 2PZMA 3NUGA 4U5QA 4GX0A 1PZGA 4B8ZA 4PG8A 1KYQA 1PJQA 3SC4A 2EV9A 2O2YA 3PYXA 4QXMA 3OMLA 2O7QA 2PFGA 4TKMA 1P1IA 1BWSA 5IJZA 1RM5A 3H4VA 2PA3A 3PQEA 3DDNA 3FD8A 4R54A 5F1PA 2AE1A 1SMKA 4BOYA 4Z3DA 3RBZA 1YBVA 4AJNA 4GKVA 1XSEA 3OIGA 4IDFA 4IDGA 4TRNA 3GVXA 1ZW1A 2R00C 3VAZA 1HSZA 1KVTA 2Y1FA 2J5KA 1DC4A 4CLRB 3UF0A 4KDFA 1NPYA 5ER6A 1R0SA 5L7WA 2YQ5A 2FSSA 1YL7A 1GZ6A 4PLFA 1HXHA 1NWCA 4DPLA 3DOCA 2TMGA 4YJGA 5DOZA 3DBLB 3NT5A 4CJXA 1DFHA 1AXEA 5U1PA 1J0XO 1GQ2A 4J4TA 4RQTA 3ZNOA 3CZMA 2E49A 1QMGA 2ZB7A 1CERA 5TT1A 4MVJM 1BXGA 3EMKA 3H7AA 1LDGA 3ITKA 2GDZA 4FJ2A 3PQFA 2NQ8A 1U2GA 2OXIA 1I3KA 5JY6A 2CY0A 1X7DA 1Z45A 2OFPA 2R6JA 4FOSA 5KVQA 4PG5A 4CM8A 3ROQA 3RC2A 1DIBA 2VHYA 5T8KA 2WSBA 3ANLA 3D5QA 4G65A 3GLQA 2V6GA 3ICCA 1UZMA 1CRWG 5FF9A 3JQEA 1KEUA 5EPOA 3CUKA 5CEFA 5BSEA 5A06A 3RCBA 4GVXA 4BHTA 3GVCA 2NTVA 5I9LA 3WGIA 1P9LA 1C1XB 3ON5A 3RBVA 2YDXA 3LT2A 1EK5A 3VZSA 4ZQFA 1YBMA 3UGKA 4OQZA 4A2CA 3QQPA 2W4QA 4LRTB 4URFA 4I9NA 4BNZA 3KLPX 4IBOA 1E7QA 2Q49A 4HY3A 1NFQA 3IP3A 1R4MB 2JCYA 3BHMA 1SB8A 3U9LA 5JAMA 4RCVA 4GI2A 4CLDA 4CODB 4D43A 2QRKA 4MIYA 3S2GA 2Q2VA 4FDAA 1B2LA 3EC7A 3F5QA 4OKNA 4FFRA 3P19A 1PJ4A 4M54A 1ADBA 1MGOA 4UREA 3RFTA 3QWBA 2NWQA 1V35A 4D0SA 1A7AA 2GO1A 1HRDA 1VJTA 4FW8A 2ZCVA 4NIMA 3EHEA 3HN7A 1ZIDA 3WGTA 4XIJA 4B7CA 4NI5A 4AFNA 4WASA 1H93A 3KEQA 1U1IA 2VHVA 2DPHA 1PL6A 2FOIA 4A03A 4ALNA 5BSGA 1B16A 3Q9NA 4ZA2A 3M1AA 4LRSB 5TJHA 4P8RA 2EERA 2IZZA 4J1SA 1N2SA 5CPBA 4IUYA 2RHRA 4BV8A 4DWVA 5CG2A 1H94A 5LDHA 3DFZA 2NADA 3JQFA 3V5NA 4GH5A 3H2ZA 4OYRA 4FFNA 1DAOA 3ONDA 3UAGA 1R4NA 1CQJA 3DHNA 2Y0DA 3RD5A 4J4BA 1R6DA 4J49A 4OOFA 3QVTA 2PKRA 1N7GA 3KSDO 3TSCA 2JCXA 2BFAA 2G0TA 3VDQA 1HLPA 1A71A 1ZXLA 2G1UA 3FPLA 1O8CA 3VH1A 2XF8A 5A9SA 5KJ1A 4ZICA 2PLAA 3E9NA 4FGSA 1HT0A 3GC6A 1ZK4A 4N18A 1KC3A 4XIYA 3IUPA 3JQ8A 2ZQYA 5HTOA 1E7WA 1LRJA 3JQAB 3W4IA 1D1SA 1Y8RA 2AQ8A 1ZH8A 1ZSYA 3EVTA 4JK3A 5G0VA 1I01A 1ISJA 3JYPA 1LDYA 3GT0A 5T64A 4PRKA 2IEBA 3C7AA 1LXCA 5TRTA 1P74A 4BB5A 5KKCA 3E9QA 3PRJA 3ZNQA 2GZ2A 3BMNB 5AXAA 2DC1A 2AQIA 5GY7A 4CV0A 1E7RA 2YFHA 3K8ZA 4J90A 2HMTA 3PTZA 3MJEA 3S2IA 4M87A 5DBFA 1E1KA 1EK6A 2VUTA 3WLEA 3DZGA 4BIIA 1B3BA 2ZATA 5FWNA 1QYCA 2FPGA 3TL2A 1YGYA 3U5TA 1CWUA 2ZTMA 5JDCA 1NM5A 1YJ8A 5ADHA 3G17A 3HDQA 3DAFA 1H0KA 1ULUA 3LK7A 3O38A 5EINA 3GEGA 1UZLA 3QA9A 1K6XA 4DREA 2D8AA 2VYVA 4FFMA 2AG8A 4GSLA 4R51A 4CLHA 3NT2A 2DAPA 4LCJA 2WMDA 1NBOA 1V3UA 2OL4A 1GUFA 1F12A 2W8ZA 5L4NA 5H82A 3ZU3A 3V1UA 2I9PA 2QX7A 3E48A 3WDSA 1KS9A 1GDHA 3HE3A 5DCUA 4DYVA 3U3XA 1P0CA 3IKTA 3ENNA 2FPPA 5COAA 2GUGA 2Q1TA 3SX2A 5IDQA 1C0KA 2YDYA 1MC4A 1EDOA 3S8MA 3LLVA 4CL8A 4DQVA 3RC7A 3IL2A 4JQCA 1EBUA 3W8EA 5DDIP 4QFCA 3JYQA 3QVSA 4HFNA 3EZLA 5I8ZA 2QYTA 3F4BA 4Y6RA 4B79A 2X0IA 3AM4A 2YW9A 3KEOA 3WQRA 2GF2A 4ZGWA 5HA5A 3VOSA 4BNHA 4M1QA 1ULSA 2HU2A 1EQUA 3D4NA 5GZ1A 4B3JA 3PFFA 2ZYGA 1T2EA 4NFHA 5I9MA 1R4MA 2J8ZA 4R3NA 4XJSA 1C1XA 2E82A
chains in the Genus database with same CATH superfamily
4CKBB 4KXLA 3GEBA 3F5DA 3O4IA 3P9RA 3JZMA 2EWMA 3HCFA 5CVTA 1J0AA 2AMLA 1VCMA 2WDZA 4EO4A 2OZEA 1BAPA 4LWQA 5ICSA 5K5EA 1EWTA 2ZJBA 1MTZA 3UUGA 4ZOCA 3S7TA 4IIXA 4AUKA 2GK6A 1OY1A 4A8PA 1RQ7A 3ND9A 4RTOA 2PJUA 2B8WA 3LM8A 4HHEA 3RYFB 1NYTA 2HRCA 3I34X 3TI7A 4WOPA 4PLCA 3SZ3A 3AWDA 3W1WA 3HDJA 3HXOA 3F9RA 4WGGA 1QRUA 1FUYB 1N78A 3PG5A 1YDWA 2PL1A 3B6EA 1Q1EA 3EFHA 1K66A 1WMDA 2W22A 2JDID 4FR2A 1YQEA 2Y05A 2C5EA 2FRDA 2JK0A 2WM8A 4DV2B 4ZANA 3VPHA 1HH4A 4QOJA 3ZY2A 4D7AA 4TKVB 4B3RB 4YMWA 3UOWA 2BDUA 2WJ6A 3CY6A 4M8KA 3OO1A 3UJPA 2HA3A 3O4HA 5FUXA 3ABOB 4CG1A 4CMIA 3OJ0A 3T38A 2H5LA 1U65A 1V95A 2HK9A 2JVIA 3AIIA 4ZRNA 4EF6A 4BN4A 1WHTB 1LBHA 3H19A 1C3OA 1MJ5A 3SSOA 2C61A 1IY1A 4BNUA 4MWTA 4DIFA 4KK4A 1D1QA 4MVCA 5CNIA 3K0BA 3SY8A 5FR1A 1V5FA 3L0YA 4UUAA 4ER3A 5IBCA 5KYYB 2I3AA 2OG1A 3AVPA 4HWKA 4I4NA 4C3VA 3T5PA 2O8NA 2XQJA 3O8OB 4FFDA 3KR1A 2ZI7A 5TX7A 4K5QA 2BI7A 4MDFA 2FPIB 5HS4A 1VYHA 1PZFA 3IJ5A 4YT8A 3W5DA 1ULTA 3LVBA 4L2IB 2PEZA 4RKWA 3TMAA 1QF9A 1M7GA 2F4NA 3MT9A 4LQDA 3Q85A 3VGJA 5T3YA 1FDTA 4OMCA 4X1IB 4F4UA 1EDZA 4Z6KA 4JMLA 2QTHA 4YRBA 1QHHA 3U4HA 1ZOPA 3TW8A 4B4WA 3V32A 3NYWA 2GEUA 1JQ5A 1XCOA 4UHCA 4QREA 1QV7A 1N1EA 2ZTUA 1U5BA 3V1LA 2ZBDA 1KOGA 3BWEA 3FOZA 2XQFA 3KWFA 4L28A 3ROXA 3UJ3X 5K9ZA 2PWAA 4PZDA 1DUIA 3UGJA 4ZKDA 2A9QA 3VSCA 1NNEA 2P30A 3NBZC 5E1OA 5LZ8A 1DKOA 3ZHRA 1VP3A 5FL7D 1ZS9A 3RKSA 3QEJA 3KE9A 4EW6A 2ZDHA 1CUAA 1GN9A 1M0TA 1GQFA 3QEMA 4B5LA 1REQB 1VBKA 2E4XA 3FN4A 2VZ8A 3UAZA 4S24A 2J9XB 4XX1A 3INRA 4QDJA 1GKYA 4WN9B 5FBKA 2WYWA 3S5JA 1PZXA 2G7ZA 3RGWS 3T1OA 4FT2A 1I3NA 3CIFA 4PBTA 4Z51A 1YKGA 2QMEA 1NQ5A 2VHZA 4MQMA 4DHEA 3GRAA 5KTSA 2XDQA 4D57A 1ORRA 2P9TA 1ACMA 3UTCA 2FA9A 5AFSA 4R9VA 4MV4A 2O2IA 3UH0A 5EGNA 4YQYA 3OJXA 5ALTA 4PYQA 3E3OA 3PFHA 1ODFA 3PC7A 3ZHSA 3PJDA 3IOBA 3LTNC 1JWAB 1EFVB 4MRSA 4RTLA 1QFYA 4DC0A 5AK6A 5D3MB 2WUVA 1HE2A 4RGBA 5DHPA 3SFTA 2XW6A 4FGJA 4QDXA 4LC1A 3HADA 2QAIA 2ACVA 3ECCA 4CMKA 3EPKA 1DEXA 3H6KA 4AP5A 3QM1A 1ZW6A 5DHRA 3TTXA 2WMYA 3LHFA 1SCNE 1OXSC 4GPTA 2H4WA 3BWBA 3BC1A 4DUGA 1Y5IA 4FN4A 2NQTA 3RODA 3VYTB 1O0SA 1EX1A 5K8VA 1IN4A 1WMBA 4LYGA 5EQTA 1W75A 4JA0A 4GDFA 1WXXA 3FDZA 1V1RB 1WDWB 1DOZA 1VHWA 4ONEA 2AK2A 4ND8A 3GLIB 1UUFA 5GONA 3VYSB 3F0TA 2XIJA 4IV5A 1YQUA 4U6QA 2F4VB 1CZKA 2ZJ0A 5DSZA 1LV8A 3QOWA 1ZU5A 2DR2A 2ERYA 3FH0A 4ARUA 1F8XA 2RGXA 3WS7A 3A1TA 1BOOA 1ZVJA 3GLHB 2J3DA 4RPCA 3NCTA 4CPDA 4UHDA 3FOCA 1X92A 3CB2A 3FCYA 4EJ6A 3GV0A 4RX1A 3I6YA 1S7GA 4MWDA 4YUWA 3ZKAA 1DJQA 1P33A 4D9CA 4YJ2A 4E5YA 1XMPA 2HF7A 1VPEA 1KMHB 1YK0A 4X6UA 3VDMA 3RB8A 2J9YB 4IIBA 4MMXB 1ZI6A 1CF4A 3SQDA 4FJ0A 3KE8A 1ODIA 4HNGA 2GJSA 4D5GA 4EKEA 1ZK2A 2A7XA 4P83A 1QDLB 3T7CA 4LG1A 4BWYA 2A1TR 4OLFA 3EDRA 4F3CA 1AKRA 3GBVA 3MF4A 3C2QA 1VP9A 4TVSA 1LZKA 4WLUA 4Q02A 1Q5PA 3KWMA 4UMDA 1ZH2A 3ZLVA 5K2OA 1PKEA 5CFLA 1HT1E 1P4GA 3HSYA 2WT8A 4LYYA 4YAWA 3LSTA 2W2PA 3KUXA 3VNRA 1YRQA 2Y9PB 4IHJF 5CBPA 2CHFA 2DLDA 2B7BA 3GHYA 1JL3A 3SFVA 2XXAA 1FS5A 1XZMA 3QU4A 2QTAA 5LP6A 2X7HA 1P7CA 1QGUB 3OE7D 2H1FA 3QX7A 4I81A 4IF4A 4BCDA 1SXJA 2FEPA 1EDDA 2G9UA 2OENG 3P0RA 3AUSA 5EJ2A 3LCCA 2ERCA 3PC6A 4YP7A 1PR4A 1TMOA 4IFEA 3RVNA 1Z47A 3ZIAA 2XB2A 1YVEI 2P35A 2RKWA 2WYUA 4RLQA 2BH9A 5EZYA 3WR5A 1K7YA 4DRXA 2GASA 3V7NA 3H3XA 4RIEA 5DYGA 4P0TA 5LYYA 4P31A 3CO5A 5K3BA 3PT5A 1LVGA 4JJGA 1N25A 2IV7A 4KQ6A 2YN0A 3LLCA 4BBJA 1NW4A 1P29A 4I8IA 4M21A 3AHDA 4N5IX 4TTQA 4E88A 4UPEA 3Q7PA 2VCEA 3NBQA 4TRJA 1D0IA 1PFKA 3SHQA 5FYQA 4UMEA 2FEAA 1UXHA 2R68A 4XWTA 5HQTA 1AS2A 5AOCA 1P44A 2FZ5A 4KXYA 2ZSEA 3TZEA 4I8XA 1FY2A 4EBFA 1CQPA 3IPRA 2WJWA 3NX4A 3JVDA 1SU4A 2FR1A 4ZJYA 4Q01A 3BMQA 4F71A 2O2XA 3EZYA 3JQFC 1N9ZA 3OTQA 4G8JA 4Q00A 1RE0A 3Q5GA 4D9KA 3OOYA 4HX2A 3I2KA 1PWHA 1KFBB 2VWGA 1FF9A 7ADHA 1WW2A 3ILVA 4RY8A 1VFNA 2C5AA 5EWJB 3TLGA 3NNDA 3D1VA 3K05A 2FX5A 3RF6A 4C89A 3L7IA 5IJXA 1T2UA 4NYIQ 3INYA 2RGUA 1UOEA 4ZVSA 3WGZA 4ARSA 1K7XB 2A5GA 2G88A 3ED1A 1R0KA 5A4KA 1QR2A 3ER9A 1NIPA 4FHEA 2QMUA 3O6VA 1O94D 1GL9B 4KU4A 3WJAA 1XZEA 1U8TA 4OJNA 2XZOA 3IEKA 4TN5A 1OBFO 1ZD5A 3OAAD 1TK9A 4KO8A 4UNSA 2AF4C 3T5DA 3HWX1 2GUWA 5JMOA 1ODTC 3EVGA 4D0LB 4DKJA 3RLIA 2EFJA 4GIBA 4ND4A 3L7DA 2ZUDA 2QUHA 3AUJB 2J45A 3H1EA 1OYWA 3RABA 16PKA 2EKPA 1UK7A 5LD2C 4MIKA 2C4MA 3Q3GE 4RD0A 2PUCA 1EUZA 5DIZA 2C7RA 4YRIA 3D5EA 4RANA 1OFIA 3BMOA 4H1TA 2A35A 3BTUA 1F8FA 5F23A 2CBXA 2NTEA 3KPWA 3MQ4A 4PSKA 3LT0A 3B6KA 4CGYA 3E2IA 4M83A 4PG6A 1PJ8A 1V9CA 4NU5A 4Z9XA 4CF5A 4Z49A 3KT6A 5DBEX 4IQFA 3S2UA 4CMCA 2RHMA 5ESXA 3RRXA 3I30X 1TTTA 2CMGA 2OO5A 4WEOA 2C58A 1HZZC 4YFVA 1C4XA 4F2HA 2PRYA 3L5OA 1EWRA 3TR6A 1N8KA 1RJWA 1VB3A 2WKSA 4QJIA 4IIJB 4YJ2B 1JEDA 3CSUA 2Q27A 4XJXA 3I01M 1JFFA 1X94A 2FI1A 2G5PA 3AI2A 2EX0A 2HCFA 1W76A 3C70A 3EPJA 1Z0UA 5AKKA 4DS3A 4ETNA 1EU1A 3L4BC 1O8BA 1TZMA 1XZGA 2QG9A 2QMZA 3IO3A 2B4KA 3NH6A 4WCVA 3SR0A 5JQGB 1SEPA 1KAQA 1PD1A 1V4NA 5LBIA 1JE1A 5DO9A 1PZHA 5EE5B 3UTDA 2IT1A 1IZ9A 2XHZA 3B20A 1Z6PA 4LZJA 4A10A 2MSDB 3D8BA 5B3AA 2OQIA 4ND8B 1RAGA 1TMGE 4P4GA 3KB1A 5IRCD 3DFKA 2QD2A 4Z9BA 1CY1A 2G6TA 3GRPA 4YACA 1IXRC 4XX0B 1WW3A 5KNLA 3QVGA 1CUJA 2NTNA 2Q6TA 3LCMA 4K6KA 2VTBA 4EMUA 1Z83A 4D9MA 2I8LA 4OIFA 4XJVA 3D0RA 3JD1A 4Q47A 3RRMA 2HQOA 1ZRNA 3M1IA 4DVGA 5BMVB 4V0LA 4PZCA 2D1RA 1AQYA 1G8GA 1UP4A 5F5LA 2CEAA 1W36C 4MW6A 4X3CA 1HE4A 1FB5A 3B5IA 2Q9AA 2QL7A 4JB3A 3OQNA 4DQLA 2GAOA 3KOUA 4XQGA 2OZVA 3L79A 3FNHA 1P39A 1CDDA 1HWYA 1JBEA 2DTDA 4QT0A 3ESRA 3EPPA 1TZJA 2BM9A 4B3HA 4HLUC 4R4JA 3TTWA 2OLKA 1DV1A 1G21B 3PDWA 2Q4BA 4H6XA 4L4SA 3L0IB 4IRUB 1SZCA 4N5LA 4UNQA 3HDVA 5TPWA 2WJAA 3ZE0B 4B3XA 2EF1A 3BGWA 4IDBA 4F85A 3EZ9A 2QTZA 3QA3E 1OJLA 4URWR 5A1JA 1G60A 1T1SA 4OATA 5HRCA 4RACA 4QTYA 4C22A 2QX8A 2AI3A 2QUBA 4OFZA 3V8PA 3BM5A 2HPVA 4GS5A 5GMOA 5JQGF 1WD7A 3E5MA 4NEHB 4B74A 2JNWA 1E9DA 3VGPA 1CS0B 2VEOA 1XN4A 4WACA 5LJIA 4IMIB 1P1HA 4YRJA 4LXIA 2ZBRA 3PI7A 4B48A 5C8DA 4B3SB 2XXAB 4ID9A 1NUHA 3WLFA 4Q4AB 5J59A 1ISRA 1IAQA 4Y9UA 1T8UA 5DFAA 3N1UA 5F7XA 4IDOA 4XWGA 5E1BA 1TKRA 5GM2A 2WKQA 1XZQA 4QQRA 1FP1D 4RKRA 4D9BA 3JD0A 4IIEA 4EM6A 1C1DB 1J70A 3G13A 5EHGA 3VNBA 5L3QB 4OH1A 2GTHA 1I3OA 2QLNA 3ENVA 2YJ5A 2IKQA 2RDMA 5JMTA 1N6LA 3B2QA 2X6TA 3DEYX 3VYWA 2VWPA 4GOJA 2FLWA 2Q7OE 2AMVA 5D2CA 2B36A 2L18A 1FXWF 2AYYA 3QVWA 4IOKA 4XM2A 3K4HA 4JVMA 1T0IA 2C92A 4ASUD 2IOYA 5EWLA 3ZWVA 3C1OA 5IDXA 1DKQA 4FONA 2VRBA 1F4LA 3W6UA 5IANA 4JGGA 2PJZA 1QBKC 4DCCA 3TZQA 4E4RA 1JRLA 4YJHA 5ERGB 1T8WA 2GGSA 2WSSD 4WXMA 1JLRA 1NG1A 4TV8F 2NU8A 3RW9A 1QGDA 3DDHA 3VISA 2HJWA 2IYVA 4HGNA 5KMGA 3MCZA 1JQEA 1XVTA 2HA5A 2PXHA 3KSRA 5C8YF 2BH2A 1KVSA 4HJXA 4R2XA 3TTVA 1TAUA 5D5HA 4J7UA 1DAHA 2ZITA 3O83A 1UJ4A 4Q12A 4QBKA 3K70D 2X7XA 4E2YA 2XYQA 1NATA 1QNLA 2O06A 1F0KA 5C1OA 4OHBA 5JD4A 8ADHA 1JQLB 3ETJA 3HCPA 5EHNA 3QFCA 1CKEA 4RQAA 1YUMA 3TFOA 2ZYVX 3UY4A 3AF2A 4OYHA 1PG5A 1Z4OA 5BOSA 4G81A 5LMNB 2ZTLA 1MAVA 4G0VA 4FNAA 3CE6A 4K03A 4ZK2A 4HQRA 4UQOA 1L5OA 4FOLA 5A4MS 2C2KA 4GFDA 2ZB8A 4GBMA 3SYRA 4N12A 4A2QA 3X2EA 3P9NA 5FXMA 3PVZA 1FE8A 5AW2A 2P3LA 3LBFA 3NM4A 3E9DA 3R5JA 3A6DA 4HTAA 3WIBA 3X1MA 2R44A 2AJBA 3MT0A 5KX5A 3EBPA 4GZ5A 1DEHA 3QUBA 1ZRHA 3HWSA 1F1JA 3MWJA 4I9GA 4M0EA 3BGSA 3Q8MA 2W2LD 1BW9A 2PSSA 3DMTC 5JXIA 4XARA 4LDPA 5AJYA 5C3MA 1J4AA 1CLEA 2CLIB 2RARA 2W8BB 4FS8A 4JDUA 4LJAA 4YROA 5D5QA 2PSEA 1AKQA 1MC8A 3K1AB 4DV7B 1WVMA 1MOPA 3AFNA 1Y4DE 3PDJA 1WPQA 5BUZA 3VV2A 2W2TA 2W2KA 1UM9A 4HNQA 4EI2A 4O25A 3CQ9A 4RAOA 4JI1B 4DR7B 1YQDA 1TA0A 3VR3D 4ZZ0A 3HVIA 1ZJ4A 2VOEA 3ORRA 5D85A 4FS3A 2GF0A 1UKAA 2NO9A 2R7LA 1RHKA 1G3MA 2O7VA 2V0NA 1ZUNB 2JLVA 4QULA 2R6FA 1XDSA 4HGYA 5LQSA 4X3PA 2QOEA 4BNNA 1E0KA 4L51A 4MB2A 4RM3A 1WKVA 4XYEA 2X5NA 2I7DA 4DLAA 1GPWB 2C1ZA 2DGDA 5F3DA 2VPTA 1GCAA 1RAIA 2PFKA 1AO0A 5JNLA 1LTKA 4NAUA 4KNWA 2OXTA 3VMFA 5A3RA 1N1GA 1IQ0A 3OECA 4DSNA 3ELWA 1IOZA 3ONFA 1R8XA 1X87A 3ULKA 2I6SA 2JGNA 1C9NA 3NATA 3P2KA 4TYQA 1ZJWA 4AKIA 5SYMA 3VYRB 3BERA 3JARB 4W9NA 2CV0A 1YL5A 4BTVA 3ESXA 1E96A 3PPWA 2QJWA 1PX2A 2AFHA 2QDXA 4X6XA 1GR0A 4U9HS 3CF6R 4IVNA 4ND5A 4D74A 4RKYA 3CCBA 1Q1BA 2Y68A 1E61A 3DZKA 3PUYA 5FPHA 1DL5A 1Z2NX 1NOIA 3RLFA 3CS3A 4MI6A 1JH9A 2VYFA 1Z36A 1G6KA 4GLBA 3WSWA 2EZ9A 4BQNA 1Z2AA 4BX3A 2Y1KA 4ISCA 2Z2YA 2DSTA 2ZI3A 1QHNA 3KKNA 3KV3O 4NESA 2V7BA 5DCLA 4C3UA 4F0JA 4F4IA 1N8SA 4YRMA 1MC5A 2W6CX 4JNCA 3ZXYA 4I4IA 3VR5A 4R2HA 3E82A 3ZGVA 2DRIA 3GUZA 1Z25A 3KHKA 4L4YA 3LX4A 3KZ1E 1BYUA 3AOGA 1IY0A 2XAUA 4UJ3A 4P3PA 1GDTA 1E1QA 4GWKA 2P4UA 2FHPA 3DA8A 3NVDA 1V2HE 4GEGA 2DECA 1Y6ZA 4MQEB 5DNVA 3RSCA 4B3TB 2H8KA 2OP1A 3GZJA 4UQLA 2JIMA 1CUUA 1S9DA 5KNDD 2PRKA 2A0KA 4MX8A 1UZUA 1YB4A 2SCUB 4LJ7A 2PT5A 1MN6A 3PIDA 5BVHA 3UAWA 2GPBA 3PQDA 3G2JA 2FMUA 1JEQB 4D44A 5TGTA 3EOAI 1GGHA 3E35A 3EHDA 4M7WA 4YP6A 2VTDA 3HJAA 3O9ZA 3D3QA 2HV9A 5B58C 5AVRA 2YVQA 3LC0A 4WBSA 4AJ1A 1KI2A 4R1SA 5K8TA 5F3WB 1YB1A 4MINA 3L41A 1V5GA 1T6XA 3OHMA 1OBVA 4P6VF 3S5UA 1C1YA 3D6UA 4DRXB 5I7WA 4KIWA 4DIBA 4Q4AA 5JJIA 4JLJA 5J1TB 3JV7A 1NA5A 3DXZA 4MA5A 1JB1A 5TY0A 1KDVA 3GVHA 2C96A 7MDHA 2JAUA 2G70A 3L7AA 3C1UA 1G5TA 4YV2A 4MJLA 2EX4A 3EIHA 2I2CA 2ZRMA 4JI8B 3O2JA 2PLNA 1KI8A 2KPOA 5E1MA 2P62A 4JVNA 3EFOB 3I9V6 1GUYA 5B7GA 4I55B 4AJIA 2ZT8A 1QIJA 2ZKLA 3LPMA 4F5YA 5JISA 1NIJA 4NBTA 5JSHA 3M6AA 4I0WB 1YZYA 3T5GA 3TGWA 2R1UA 3IE0A 3L7YA 4RHYA 3ZR4B 4D42A 4EY3A 4EKYA 2CV1A 1G3UA 1KP2A 1KI7A 2BFFA 3TIVA 2RHCA 1A98A 4X8MA 4ENVA 1V8ZA 3L06A 4QYTA 4NCJA 3SVLA 1Q15A 2XDAA 4MYSA 4EMSA 1TI7A 1EM8A 3LF2A 4LJSA 3M5DA 4PC7A 5EJ8A 5JV5A 3WXMA 1EVIA 4D1YA 1VGQA 4TMTA 1RC1A 4KPFC 3C1TA 3HXPA 5A4FS 1QU3A 3E9CA 5GINE 2PO5A 4CGZA 1NMYA 1O77A 1XELA 2XOKD 3HJGA 4N0PA 4Q21A 4RXUA 2X8JA 1K88A 1HOXA 1OWPA 2O8VA 3FUWA 2J9FA 2VXYA 1JMYA 4J0CA 2O2DA 4MUJA 4WK4B 2OXFA 4Q3BA 3GF4A 1E1MA 1UKBA 2GCOA 4IXMA 1A1VA 3ZZ1A 4KQ2A 1G38A 2OZLA 1BYIA 1F48A 3GG9A 1U28A 4LVUA 2D7CA 1R2QA 1TF5A 4P38A 4YRSA 1LF0A 4GM0A 3T12A 1A72A 5EJ7A 2AB0A 2A92A 3JY6A 5A3VA 3A10A 3PHLA 1ZDMA 3LPLA 4IMRA 5SZKB 3OM1A 1YHYA 4KG7A 4CL2A 1KFCB 2Q6VA 3AHJA 4I36A 4I19A 1PGNA 5C9ZA 5B53A 5K0NA 1NQXA 1YR7A 2WQZA 4V0KA 2O8CA 2FWIA 3K9GA 5JCPA 1U8AA 5AXDA 4WZBB 1SOVA 3B1KA 5KTOA 3D81A 1XAGA 2YWDA 2B98A 1O5OA 3QLTA 2WYOA 3CZ4A 3R7NA 3KQMA 1XKXA 2JGFA 3K1AA 2BEWB 4P4LA 5E6UB 1WLSA 3SMQA 3NV7A 2UZ3A 2O8BA 2HQRA 1ZAYA 1O96B 1QZXA 1OPRA 2HMVA 1A9SA 2P6NA 3DTTA 3NC1C 3OJEA 3P52A 4J1QA 4JT9A 1P3JA 1Y5RA 2DFNA 1ZUWA 2P4QA 1K3UB 4JQSA 4KN9S 1Z4MA 3QKRA 1LNSA 3PFCA 2F1KA 2IH5A 1CYEA 1FS4A 4Y2XA 4EG8A 4RPKA 4FMBB 1ZVQA 1I32A 5BSFA 1Z33A 1XLTC 3ZE7A 2WEKA 4EFKA 4H7FA 3OC6A 3TQTA 1I2BA 2Y6UA 3IS3A 3OEED 1Z62A 1LLFA 3GARA 4RA6B 2DQSA 3IERA 1DQNA 1U0BB 5FBQB 1QOZA 2YWEA 3NDJA 3Q8KA 2GAAA 3U3ZA 3T1HB 2F43B 1XPJA 4MQ6A 1YE8A 4RPHA 3UHOA 4RTJA 1R8QA 3OWXA 3VZRA 4DF3A 4DYHA 1UBLS 2GFHA 2PVCA 1FVFA 2J07A 2V03A 3H99A 3UWMA 1Y9EA 4I6GA 2FVXA 1BG6A 1R10A 1HYHA 2ODNA 4UNNA 3BUSA 4CT4B 3GB9A 5CB6A 4NCBA 1B23P 1TZCA 3NEPX 2E4AA 3WHIA 5EZ5A 1H2FA 4GBJA 2X1MA 4NZ9A 4IXNA 1B26A 2VH5R 3EPRA 1JVSA 3ZV4A 3L05A 2PUTA 1URPA 3NWEA 4GE0A 5T4EA 4R1NA 3SE0A 4TZKA 2NUPB 1LQUA 3EEFA 4HAOA 1T36B 2MYTA 2ZJAA 3CUEF 1W85B 4J2HA 2HI0A 1UKVY 3UT0A 3EVEA 3GCXA 4DSZA 3W3AD 1ZCFA 5BRNA 5BVGA 3HCAA 1FLNA 1N0VC 2R2GA 3A36A 4V3CA 3IRVA 4S2UA 5FT9A 3SQXA 1E8MA 4I5GA 1XO1A 4AMYA 4GKJB 4UHKA 3KXLA 1SHJA 1NN3A 2FMFA 1M8JA 2PN1A 2YV4A 3M0EA 2R2AA 4W9NC 1P5JA 3VPXA 4CF3A 3GDFA 2C2MA 3KETA 2PK3A 5DEOA 3FZYA 5JCJD 3RU9A 1RPTA 3T41A 4AAYA 3Q0TA 4M46A 3OQOA 5KDLA 2N47A 4GNKA 3S55A 1B43A 4B81A 1X1TA 3FMGA 4II3A 4MP8A 5IM4A 3HVUA 1EP3B 1YOBA 4AZWA 1EHCA 1S01A 1YR1A 2M32A 5K05A 4TV9F 2PY6A 2J48A 3CM0A 4QT4A 3CX8A 5WRFA 4OM7A 1I94B 1M2NA 4AJ4A 2P9EA 2FN4A 1RLTA 4CVNA 2E6KA 1DQYA 3S2SA 5F9MA 3RAFC 4OK6A 3IIKA 2GFQA 4PPQA 1CJMA 4WVFA 2JJMA 2OWDA 3NBYC 4U8GA 3UMVA 2WHRA 3KL4A 3RJ5A 3C3PA 4KOEC 5G1NA 3EVZA 3QHPA 1QTQA 1CNFA 4PNZA 3TX6A 3ZLTA 5M34A 2HV8A 1I36A 1EBBA 1U04A 3QY9A 3E7FA 4M8SA 4QJ4A 5CFOA 3EEIA 4BLUA 3GLFE 2YJTD 1R50A 1TCBA 5BW6B 5C34B 4LKRA 1T0UA 1N2CA 5AP9A 1GNPA 1GG8A 3BXPA 4QTXA 1JKFA 1FBTA 2QRPA 1DAEA 1NJ1A 4UCWA 5C8YA 5GZ3A 3L4KA 4TXMA 2PGLA 5E4TA 10MHA 2JH8A 4ZCPA 3WJ7A 5JECA 2UYOA 4Y6SA 1B1CA 4B71A 3SR4A 1C3OB 1TCUA 1YJBA 1IJBA 2ADFA 3PYMA 4IM7A 4TXNA 1MXHA 3DGFC 4P4UA 1MX9A 2DWPA 2P2NA 4M9UA 2O3RA 4IRXA 5FPTA 4I4LA 3V8RA 5A7FA 4XWOA 1XIVA 2FYTA 2OPHA 2HW8A 2KJQA 3A7EA 2JFVA 3TINA 1KY5A 1SUPA 3KQOA 3Q3CA 1CR6A 2FUEA 3EIFA 4GMHA 4L8LA 4IZ6A 2J0UA 4TL6A 4TV9B 4YT4A 1FW8A 2GXSA 1P80A 3A6GA 3MPOA 2QZSA 1ZC3A 1AQIA 4M0FA 2OAEA 1H05A 4HDSB 1HDCA 5CA1F 3SR3A 4JGBA 2HHJA 1BJRE 1XVLA 3CWCA 2P2ZA 2RGWA 4JT2A 2CCGA 4YV1A 4UVHA 3CUSA 3FYUC 5TQ0A 1OZAA 1ULAA 2YYSA 4N3CA 2A9PA 3MD9A 1KZHA 2J3JA 4E31A 2X7JA 3P8ZA 1XRMA 3EMBA 1KDTA 1BS9A 1A5SB 4H7DA 4F97A 5L3SA 2Y76A 2ZAYA 2DPGA 3U4IA 3FUTA 4R7ZA 3MINA 4DUPA 3I37X 2QN8A 5FUYA 1WMEA 1S4MA 1OFHA 3NHWA 2HF2A 1YXMA 1GJRA 1XTIA 4PLYA 1YDGA 4IHKA 4ABYA 1FZQA 3OKCA 2HA7A 3AEZA 3A9UA 4BN5A 1A88A 1E3IA 3K4QA 3RTAA 4HNAA 3WLKX 1SUCA 1GGVA 4XDHA 5JRZA 1KAEA 1QKIA 5CK4A 3U4DA 2NZ2A 4X5OA 4CUJA 3KV1A 1WXFA 5JEEA 3BDAA 1DJLA 3OCJA 5DWQA 3U7JA 2IHZA 1W2WB 1KR5A 5ALVA 4INZA 4ZDWA 3TEMA 1PDVA 5D8DA 3GZ4A 1SQFA 3ZHUA 4XGRA 3K6KA 1WWKA 2AN3A 3WMEA 4ZU3A 3R0JA 5T67A 2HBYA 1KMCA 1YV9A 3I2HA 1PHPA 1HQDA 5JSQA 3K3PA 1WBBA 1VHQA 2A6PA 3IUBA 3C16C 3NIGB 2X0RA 2V6BA 3F49S 4UE3S 4IGAA 4PNPA 3PJEA 4W99A 4HQOA 4C76A 3L4EA 3PLRA 4L5CA 4XWWA 3DR5A 3AM5A 1I2AA 1P7PA 5CB4B 3HGMA 3IEVA 3R9XA 3ZDCA 3FTQA 3PRYA 1L1EA 1UP6A 4LHZA 2I7TA 3OMXA 3QXCA 3HY4A 1Z5PA 2X8AA 4J0KA 5KCMA 3VSBA 3IKLA 2PL3A 3RS3A 3W6NA 1HDOA 4FHGA 1N2BA 1L5WA 1YC5A 3CLRC 3OIWA 4LTMA 3EIWA 3O8BA 1GL7A 4LHWA 3DMRA 5HF9A 1E4EA 3FYDA 1VG8A 3DO5A 3UKDA 2QM8A 2IS2A 1E1CB 1XXLA 1Z38A 3FIUA 3IX7A 3ZBQA 3T9EA 3BFVA 4JSRA 2I80A 2GDJA 2J3HA 2QP9X 3GN1A 2D1TA 3VC2A 3T34A 3HCBA 1OROA 1G66A 3X0DA 3PEVA 3S68A 3ZIUA 3E3AA 4CKEA 3LWBA 4J7CA 2OK8A 3DCJA 4RZXA 1YQGA 3AK4A 2HSGA 1P73A 1E3WA 4FFOA 5LOVA 5E6SB 1EFTA 1CZLA 2YH2A 1UODA 4QYIA 3VTKA 3E9YA 4BDSA 1GXSB 2ECPA 4R40A 4Z9FA 4ZA2A 4MV3A 4LKOA 3SDBA 1CRQA 1HLGA 1Q22A 1T36A 2I6UA 2ZGVA 4RY9A 2Q7DA 2RHGB 4G4IA 4PLHA 3UENA 3C6KA 3UICA 2YY6A 2IE8A 2Q2NA 4UQPA 4ZIRA 4NP6A 1P4AA 4XH9B 5EERA 1HDZA 1SBZA 3WK7A 2QW1A 5GV8A 1IYZA 4MV7A 4M0PA 2GPAA 3AVUA 3QEAZ 1ZUIA 3VOTA 3AINA 1OTYA 3BE4A 2QF7A 2XIQA 3OT4A 1U8UA 1WMSA 4FYWA 4LWOA 4U39A 1XBTA 4GC9A 4DLYA 1TA4A 1BD3A 1UWCA 1VSBA 3PRHA 3EUEA 4BPRA 3BRCA 1UWLA 2CHGA 3NEJA 4I4TF 5E1DA 3A6EA 3FOFC 3FBTA 3PL5A 5AI8A 5LLSA 3KOXA 1R9MA 1X7GA 4EY4A 1QYXA 1UAAA 1UCFA 2IOHA 3A37A 4Y6PA 1D6MA 1NL3A 3T54A 3WRYC 2H8GA 4FNGA 4YN3A 4BB9A 3N53A 1K0FA 1NLZA 4OF4A 3WLNA 2Q9UA 2NNWB 1BE0A 1PFYA 2XBLA 3I73A 4KV9A 4PG7A 2RGDA 4E32A 2PZFA 4FX2A 2LPMA 4QYXA 3LP8A 1UMDA 3LVQE 2AUMA 3P9XA 3PQ3A 1D4ZA 2DPLA 2FW8A 1JZQA 3CF0A 1Q7EA 1ZNWA 1Q0SA 3L46A 1VTKA 3N07A 3RROA 2HBQA 3ZY4A 1LC3A 3K5IA 3AXTA 2UYHA 3WB2A 4QRIA 2E55A 3D7NA 4ZAXA 5A1TA 2R7NA 3GN2A 4MA0A 5BRJA 1KF0A 2YJGA 3COSA 4PHHA 3V1YA 1U8CB 2EDCA 4P80A 3VR1A 4NMWA 2R87A 4YT5A 2X6QA 1IN8A 1A4IA 3WFJA 4ZVRA 1ENOA 1YVPA 1R1DA 1W9HA 1YNSA 3O84A 1WXQA 4QBFA 3SI7A 2B3DA 1BMFA 5FFFA 1WSAA 4J03A 4RMHA 1PGPA 1UDAA 2EBUA 3OEYA 2PKYX 1CV2A 1P0FA 4G67A 1DB3A 2C98A 5J58A 4KXMA 3JALB 2ZSIA 3Q6IA 2LV8A 5HCIA 3L1IA 3KXIA 2LIVA 4MHTA 4ZT5A 3HZRA 1KARA 3ZJ4A 4AY2A 3QVUA 4R01A 4F6CA 1M7BA 4N7BA 4NYJR 1MPTA 2XMCA 3VNVA 2EBWA 4I66A 3FVVA 3VC3A 4P9NA 4RF5A 1QG0A 4FE4A 1D03A 1EXMA 4HZUB 4C29A 5CFZA 1AQ6A 2JJ1D 4OAOA 1SUWA 3GLGB 2GXAA 3WZ2A 4NR0A 4JI5B 1BH2A 2VDUE 3EEOA 2OZPA 4MEJA 2JFQA 4MCIA 4GVPA 5COBA 4ZPJA 2C20A 4WCFB 4M0KA 2RG7A 5CX4A 3OPVA 3T7SA 2IF0A 4IXWA 3REFA 4KLNA 1HQKA 2P41A 3HUFA 4CLRA 5EHXA 3FYHA 1ADGA 3L0PA 3EQ6A 5K7SA 1GTRA 5B36A 2LGJA 2GCGA 1S02A 2M1XA 3GGCA 5ADWA 4WTOA 4G2TA 3OO0A 1O89A 2IYXA 3EW7A 4MI3A 4F5DA 2BRUA 1KJYA 2JC3A 4B17A 1SQGA 1QVWA 3LY9A 3AIKA 4ILEA 3HXMA 1DRWA 2QYOA 2R751 3AY3A 4LY9A 3S1AA 4RTNA 1RWKA 2IVFA 4CXMA 4LFCB 3JWGA 3WWZA 5T4FA 3S8EA 4NU8X 2X1VA 3D6FA 3DEJA 3DL2A 2G0AA 2WICA 3VSEA 2F3UA 3WLSA 2AZXA 1N6KA 1DC5A 1WDLA 4ECAA 3BTVA 3ROPA 1HKUA 4JZYA 3V97A 1HSOA 4EB8A 2JFPA 3FSEA 3TMKA 3KLMX 1U7DA 3QVGB 4XB1A 4RAQA 3I6ZA 1ML3A 1CJCA 1EZ4A 1MB9A 2RH9B 3HNRA 3KO8A 2GK3A 4FC7A 3RAJA 4EG5A 1RJDA 3QFSA 4EHNA 2DPXA 5IYZF 5TXGA 2V4MA 1N8NA 4PSDA 4S1VA 3LCJA 1Z63A 1GRRA 3NRCA 1XZAA 4KJXA 3I9MA 4FWTA 3FTNA 3D2LA 2FDCA 4EG3A 3DM5A 3K9CA 2WG0A 5K8IA 1ESMA 4DDTA 5G40A 1U8EA 4QDOA 2W6QA 3DAHA 1C0PA 3RC3A 2OD9A 2B78A 2RH8A 4BV2A 5IM4F 1CQWA 4DY4A 1AQJA 3DKIA 1A97A 2ATXA 1JPVA 1NQTA 4FZ5A 3ZHYA 1LS6A 4MAAA 4ALIA 1KY2A 3T5BA 3ZY3A 4B3JA 2QRHA 1L4BA 2Y2UA 5FO0A 1H66A 4ZALA 2VNSA 3MCTA 1RLOA 1OREA 1N6HA 2DY0A 1CNEA 4M98A 5HILA 1SBCA 2IZ5A 4BQPA 2EW1A 1OA1A 3GVIA 4K7JA 4Y98A 4S04A 2XE6A 3W3ZB 3GPLA 3FWYA 3RYHB 3FUXA 3DWEX 3OE5A 5AIBA 4OBBA 2VTBB 1Q0RA 2X13A 4PLPA 3RUCA 1Z0SA 5LQJA 3H1AA 3M6XA 4BMXA 4RXTA 2O07A 3DYBA 1I10A 1QONA 1ZIYA 3QLUC 4IFTA 4DBVO 2EU8A 1O9GA 2GO7A 2NV2B 2XAAA 1AJEA 4EYEA 4ARBA 3CVJA 4PO3X 3LKZA 1IZZA 1UJMA 1LK5A 5CEEA 1CT9A 1FFXA 2V7VA 4OQFA 1BDHA 3A6JA 1E0AA 5KYGA 1U7OA 3ROZA 4ZO4A 1K92A 2X1LA 1XYGA 4FNMA 4ZAFA 1N2IA 4ENRA 4XSVA 2V6FA 4G9BA 2PWBA 3BXHA 3LU1A 2YWCA 3X1XA 4EO7A 4F1KA 5L9AA 5DTRA 2NMVA 3G88A 3NM5A 5TC4A 3CRQA 3PPXA 2FQXA 4ZARA 4XOIA 2FR8C 2XCIA 1IRIA 5A62A 3HP4A 1BCRA 1VJ5A 4DDMA 4X62B 1D6SA 3GJTA 3T99A 1WA5A 1M1YA 5I7VA 1JXAA 2Z1DA 4HRYA 2IOFA 1Y1RA 4GGPA 2DBVO 4XM0A 3DZIA 3GELA 5ITWA 3IKMB 3V8VA 1K2VN 1KYVA 4PZUA 1L5HA 2WA1A 3ZZTA 2YCLA 3P9PA 1V7ZA 1X1QA 2F17A 1JGTA 2B6NA 2F1IA 2UVPB 3P71T 3DKVA 1CF2O 2BY4A 2ZRDA 3QG5A 3RQSA 4DV0B 1FYEA 1YJ5A 1BXRB 3EE6A 3VHXA 4P5PA 4BKQA 3BJIC 1F2TA 5FI3A 3UVEA 5CB8A 3D3WA 1NVDA 4S1NA 2IYTA 2PBFA 1X1AA 2Q4TA 1QGOA 3BMXA 3IEUA 4NCAA 1NVBA 4OBEA 4YMTA 3G0CA 1QH0A 1E7SA 3B1VA 5ALFA 1TGYA 2C59A 1KK2A 1ENPA 4O1IA 4QASA 4EGQA 3NHFA 4Q03A 1HE3A 1I6WA 4YLYA 2H06A 1J07A 1NXSA 4DB4A 1Q12A 2WA2A 1RP1A 2RHDA 5I4KA 3V8NA 4KREA 3VPGA 3EVBA 4M89A 5DWVA 1H2WA 6REQB 1YKSA 2XRZA 4LF8B 1S3IA 4O2BB 2X3YA 3E1SA 4U7TB 4AMVA 4D3SA 1HX7A 2II6A 3PQ2A 4Z3KA 5HE8A 3GIWA 2Z6QA 2ZJ5A 4B8WA 3DTNA 4EL0A 1UJCA 4HT3B 2O14A 4G3XA 1MMFB 1IQUA 3AYXB 4LMRA 5P21A 4AICA 3E0QA 4TT8A 3RVMA 3TOZA 5KQGA 3DEKA 1TAHA 3PWKA 5FTKA 1XL0A 1GTMA 5J63A 3EY9A 3VC7A 2R6DA 4IUBS 1A5BB 2QPAA 1L5YA 3FPSA 4WA8A 4P34A 3EEBA 2R3SA 3OA0A 2GN2A 4JL5A 2BOVA 4E4YA 3TQCA 1II0A 3CWQA 5KYXB 4WECA 1AC5A 2GBLA 2PKQP 3G2MA 2BFEA 4R16A 4K26A 5FOVA 6AT1A 3MELA 5C5DA 2YASA 3NHBA 3P9SA 4XLLA 5L3SB 4BPBA 2QV7A 1D2NA 3KB6A 4IYJA 4RIIA 1P5RA 4QJ3A 3MS4A 4C7JA 4WLOA 2LCFA 2ZSFA 5CHYA 3ZUGA 1N5OX 2GI4A 5THKA 3L93A 3KEFA 1DRUA 3NVKI 4JVLA 3C8HA 1F06A 3TW4A 1AB5A 4B73A 4W5OA 1IB6A 2WFAA 1ZAKA 4EYKA 2WDPA 1QIFA 1CEEA 2RK3A 1N9KA 4B46A 4MDYA 2JGLA 1AGYA 4JLNA 1U3VA 4DCJA 5KOYA 1BVHA 1VE3A 1W19A 3V4VB 2ZSDA 2PIDA 1OBOA 2XVMA 3HKCA 5ENVA 5CXQA 2ZUFA 1U0RA 3D6VA 5FHQA 1K7SN 4JB8A 3TB6A 2YXEA 4OK5A 4CMEC 3JQBA 3QF7A 3UIEA 3PGJA 2DBYA 1EHYA 3KKKA 4YMGA 1FNMA 4FWIB 4MKZA 4KC0A 1ZO8A 3VSDA 5C8VA 3MTGA 1TW3A 3C98A 4V1CB 3OI7A 1P1FA 1I6MA 2BGUA 4H1VA 1RRVA 5G1PA 3ZGOA 5MFPA 1Z16A 4BMCA 1J9ZA 2X14A 3GPDG 3MB8A 2HMYB 4XD7A 4M8NE 4QO7A 1CZUA 4BX9A 3I9OA 5C32A 4P5DA 5JAIA 2B7LA 3KD2A 2ZIVB 1BA3A 1PS8A 5LA6B 3CR7A 1K