1GV0A

Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
301
Chain Sequence
MKITVIGAGNVGATTAFRLAEKQLARELVLLDVVEGIPQGKALDMYESGPVGLFDTKVTGSNDYADTANSDIVVITAGLPRKPGMTLSMNAGIVREVTGRIMEHSKNPIIVVVSNPLDIMTHVAWQKSGLPKERVIGMAGVLDSARFRSFIAMELGVSMQDVTACVLGGHGDAMVPVVKYTTVAGIPVADLISAERIAELVERTRTGGAEIVNHLKQGSAFYSPATSVVEMVESIVLDRKRVLTCAVSLDGQYGIDGTFVGVPVKLGKNGVEHIYEIKLDQSDLDLLQKSAKIVDENCKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Thermophilic Protein Stability: Structures of Thermophilic and Mesophilic Malate Dehydrogenases
pubmed doi rcsb
source organism Chlorobium tepidum
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 109
structure length 301
sequence length 305
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gv0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1gv0A02
3CZRA 1K6XA 2NVBA 3GDFA 5T67A 4CR7A 2I67A 3JQ9C 2DU8A 2NU9A 1CIVA 1T4BA 4GBJA 5GMOA 1MA0A 4BVAA 1R0SA 1YQDA 3KSDO 1HDOA 1P0FA 3OP4A 4DPKA 4E5MA 1Z75A 4BNHA 4D46A 2ZTVA 4CM6A 1W0CA 1QLHA 5T57A 3MOGA 1TT5B 3AW9A 4PCVA 2PZJA 2W2KB 3W8DA 3U5TA 2TMDA 4L4RA 3KV3O 4KDFA 5TF4A 1NAIA 4B3HA 3BTOA 3DXFA 2DUWA 4Y6RA 3OHSX 1YWGO 4BKUA 4EYEA 1LQUA 4PLYA 5I8WA 5JY6A 2O3JA 3SLGA 3GN2A 2B4RO 3KM0A 2B36A 3WGIA 2VT2A 5L51A 4NK5A 3E82A 2AMFA 3ONFA 4KQXA 4TMFA 3UHAA 3WJ7A 1LBEA 4EUHA 1GQ2A 3GLQA 1JWAB 2FPGA 2O23A 4ZQFA 4AVYA 5DOVA 2X5KO 3CH6A 3B6ZA 4P38A 1BGVA 1A72A 2Z1NA 4IDAA 1UR5A 4JJFA 4PG6A 3NT5A 3W4IA 2DTDA 1PGQA 2FY8A 3E6AA 1E7WA 1DRVA 3EZLA 5EESA 1WVGA 3OA2A 4J90A 4A73A 2VOEA 4K28A 4CQLB 2HRBA 2Q1UA 1N9GA 1O94A 2VN8A 4E5NA 2ZQYA 5GZ6A 1VE9A 4QX6A 2ZB8A 1IB6A 3I4FA 3D5TA 1QYWA 4OXKA 4MVJH 3LVFO 3ASVA 2C2YA 1DHTA 3RSHA 1X1EA 1E1NA 3U49A 3GAFA 4OIMA 4AJ2A 5IDXA 1TEHA 4YTEA 2HMSA 2VRCA 2BH9A 4OMUA 2X9GA 4UVGA 1MB4A 1AHHA 1GAEO 4HY3A 2VRCD 4BO3A 3BTVA 5L3ZA 1DB3A 4EJ6A 1CJCA 1LRKA 1QG6A 2B83A 4AJ4A 4BO1A 2X8LA 4HWKA 1YBMA 4YBZA 3W8EA 4RPHA 3EGOA 2V6MA 1KVRA 1UXJA 1IOLA 2Y66A 4BNTA 4E12A 4OQZA 3G3EA 1WZIA 1VJ0A 3DMTA 2BD0A 3KSUA 4XB1A 1KEPA 2G5CA 3C1TA 3WBBA 4I9NA 2B5VA 1VM6A 1IE3A 4WNIA 4QFCA 1C1XB 1E7RA 3D5QA 1KBZA 3DO5A 3DFUA 1Q7BA 4GX1A 1PEDA 3ZHXA 1TB4A 3DBLB 3G79A 3EVNA 1SNYA 2E49A 1YB4A 1LLQA 1YONA 1ML3A 2PKQO 1P1FA 3NTRA 2VUUA 4F45A 1KETA 5TT1A 3AUTA 4MKXA 1J0XO 1JAYA 1YO6A 3PIIA 4O5OA 1QYVA 2GN4A 3FNGA 4KP7A 3WGZA 4CLRA 1PTJA 3GMDA 4P22A 3OMLA 1ADBA 3M2PA 4Y6PA 4NDNE 5ER9A 2BGMA 2Q2VA 3MWDB 2W8ZA 3GG9A 3HUDA 5TSDA 4CODB 3DOOA 5AXCA 1X7GA 3PYXA 3U4DA 2VZ9A 4FCCA 4I9HA 4BO8A 1HE4A 3NDJA 4I08A 4E2XA 1I3LA 5CDTA 1YGYA 3OJLA 1LDMA 3UKOA 4XYMA 1W6UA 4IMPA 4GQAA 4GI2A 4TRJA 1VI2A 2IZ1A 1GR0A 3HNPA 3RC2A 3OQ1A 1BW9B 1BHSA 4ESOA 4YAGA 2VHWA 2C0CA 3OJFA 1ISFA 1HYGA 4Y67A 2Q3EA 2NACA 4BO5A 1LUAA 3VPFA 2H6EA 1EUZA 1BSVA 1BTOA 1CYDA 3GZNA 4HXYA 4YA6A 4BNXA 4MP6A 3ZU5A 3SVTA 4YRBA 4M55A 3OIFA 2XPCA 1UXIA 2HJSA 2V6FA 4NBVA 1KOLA 1M2WA 5AXAA 1H9AA 1A27A 2ZYAA 3BHJA 3PLRA 1U8FO 1AE1A 3ZHYA 4BNKA 1Y9EA 2CVZA 4J43A 4XYBA 3L4SO 3RCBA 1PQWA 3H9EO 1PQUA 5DDIP 2OBYA 1NVTA 3MJVA 1MFZA 2PA3A 3BMNA 4FJ2A 3QIVA 4NBUA 4BNYA 2QZZA 4ALJA 1YVEI 1C0LA 1XG5A 2J5RA 3EVTA 2YDXA 5KKCA 4U8GA 3SJUA 5A9SB 1NX6A 1LLDA 1D3AA 2PY6A 2FRDA 2AEMA 3PJEA 3I9MA 1PS9A 3DBRA 3N74A 3I9LA 4PLZA 2ZTMA 3K73O 3EHEA 3IUPA 3MJ4A 1KS9A 2P5YA 3H9QA 1VSUA 2YYYA 3BMOA 3DBRB 4JROA 3ZWMA 2NU6A 5IF3A 4Z0TA 2GN8A 4WOJA 1M66A 4XDYA 3PZBA 4YCAA 5JCJD 4DIFA 3OQBA 4R3NA 1E1KA 1H6CA 4R41A 2EF1A 4E30A 3TZHA 1D1TA 2UUOA 8ADHA 3K9QO 1WMBA 3RKRA 1FJHA 1FK8A 1V3TA 5TRTA 2IYOA 4MIYA 3WMXA 4EITA 1IULA 3NKLA 4CLHA 1KEVA 4Z0PA 5BNFA 2FN7A 3CMCO 4EUFA 1GD1O 4I8XA 4P4NA 5L7WA 2ZQZA 2QQ5A 1W8DA 1C0PA 2R6JA 2JCXA 3U3XA 4ALMA 4DC1A 1MC4A 3JQ7A 4NFHA 4OO3A 3U4HA 1ZXBA 2POQX 1E3SA 1D7OA 4IJUA 4J7XA 4WLNA 3COSA 3PYMA 3JQBA 1SB9A 3D64A 4R54A 3OJEA 4BNVA 5I7SA 5AXDA 3WTBA 1IPEA 1OC2A 2IXBA 3B20A 4PG5A 3E48A 3ZGYA 4YRAA 3LDHA 3RUFA 4RORA 2NV6A 4BQRA 3H9UA 3RBXA 4R1SA 3ZNOA 2DKNA 4GPD1 2FPIA 2CF5A 3KBOA 3RFVA 5C7IO 1SB8A 3KVOA 4OYRA 5CEJA 5CPFA 4LCJA 2OP0A 4KTVE 3RASA 5H83A 2PTGA 1KIFA 4ID9A 1N8KA 4HUJA 4AJPA 3DQPA 3JD3A 3K31A 3QLJA 4BB5A 1F14A 1H2BA 5CAEA 3B70A 4D3SA 3BMCA 3F6YA 4L74A 1UXGA 2G82A 3BMCB 4II2A 4DTIA 5IDYA 1XKQA 3I9NA 1OZAA 4YAEA 2GN9A 3I83A 4F6LA 1P77A 2DTEA 1H6BA 2VRBA 1NFQA 1H0KA 5IZ4A 4E0BA 2AEJA 4Z0HO 4BHTA 5KTKA 3V1YA 1EMDA 4DLAA 4JN6B 2X9VA 1I2BA 5G4LA 4DC0A 1T2CA 2GDZA 3FNHA 3JD1A 1DC5A 2FR1A 3W6ZA 4CQMB 1H2HA 5COQA 2EERA 1H9BA 4J1TA 1U4OA 3N58A 3HN2A 4ND3A 1ISHA 1I3KA 4FGWA 1PWZA 3QA9A 4GL4A 2HK8A 4YRDA 1FDWA 3WJAA 2Q1WA 2OFPA 2RBEA 3JQAA 1ISJA 2EIHA 2GZ2A 1MGOA 2YQ4A 5CP8A 3DMTC 4R69A 1NTOA 4K26A 1FDUA 4ZGWA 1BMDA 2CVOA 2NTJA 3MEQA 1HDCA 1P0CA 1R66A 3GVHA 4GWGA 1AXEA 1MG5A 4JXKA 4CUJA 3MOIA 1SEVA 3RBZA 3WICA 1EDOA 3M1AA 1WW8A 1WLYA 5GZ3A 3TF5A 5G4KB 3G17A 5LC1A 3U09A 3N7UA 4CMEC 2Y1EA 4HFNA 3Q2IA 4IGFA 5TJ9A 3WX0A 5JAMA 1X0XA 1MX3A 1X7DA 2Z95A 3VZRA 1ADCA 3X2EA 3AY6A 4CMHA 1T1SA 5B37A 2IE0A 3WGQA 3F46A 2Y0DA 4R5MA 4BKQA 3OEWA 1JLLA 2P9CA 3VOSA 4D79A 1PX0A 4R4JA 3G1UA 1O89A 3ANLA 4E2WA 2GLXA 1C1XA 1T24A 3RQSA 4KWIA 5IG2A 2DC1A 1HSOA 2GASA 2X0NA 4NQZA 4DPMA 1P1IA 2O4UX 2DLDA 4FFMA 4BB6A 1PJQA 1IL0A 4Z9FA 1UXKA 4IDCA 4M86A 4NBWA 4F6CA 2IEBA 1QORA 3I9JA 4QFDA 4RVFA 4DLLA 2PD6A 2DM6A 4FBGA 3C85A 4LGVA 2Q45A 1DIBA 3V2GA 4LISA 2O48X 5G0WA 5L95A 1LLCA 2J3KA 3TFOA 3CSDA 3F5SA 4KMSA 3R6DA 1ENPA 4Y9DA 5KOIA 4IM7A 4PRLA 3JQDA 1ZSYA 4PG4A 1EZ4A 3DZJA 2BMAA 1S7CA 5U9CA 1LSUA 1Z45A 4WJZA 4R9SA 1YOVB 4L8VA 5TT0A 1YB1A 5I9MA 5JO9A 1JKFA 2VOJA 3BYZA 1PZFA 1C0KA 3P5SA 3DFZA 1E3IA 1LXCA 1U3UA 3VZSA 3HN7A 4JK3A 2AQIA 3KO8A 1Z7EA 5EJ2A 2HK9A 4IUYA 4RPGA 1BDBA 3JQAD 1G0OA 3GHHA 4PN3A 8LDHA 3IKTA 3PDJA 1FDTA 3OQ6A 4BNGA 3IIEA 3SC6A 1VKOA 4GLOA 1OFGA 3GRPA 2JCYA 4NI5A 1YDEA 2CSUA 3F4BA 4XDZA 1UP6A 3G1TA 1R0KA 5BSHA 1PR3A 2DBRA 3Q2KA 4IDFA 4DPLA 2YV2A 4UREA 4CMBA 3ZV5A 5L4NA 4OHUA 3WB9A 2WD7A 3QWAA 5DNAA 3ZU4A 2QRJA 1ZSVA 4BNJA 2C2XA 3D4NA 3H5RA 1T2DA 3DAGA 3AI1A 4ZHSA 5A9RA 4CQMA 3C7AA 4U6SA 5ENDA 3D1LA 1N9GB 3PYLA 5MDHA 4EJMA 3V8BA 1TVEA 3ADOA 4GSKA 2EEZA 1SAYA 3AFNA 3BMOB 3NT4A 3PHGA 2CDBA 2J5QA 5BNTA 3QQPA 1LTHR 3WQQA 2E82A 3DC2A 1LSSA 1RKXA 2Y1GA 2ILTA 3DB2A 4JBHA 4DUPA 1I3NA 4CM1A 1ZMTA 1X15A 3FCOA 1N1GA 3L77A 1VL0A 4MKZA 4AFNA 3INGA 4ZVVA 2W4QA 4BO7A 2B4QA 1Y8RA 5C3MA 3GG2A 2NQTA 2J3HA 1SOWA 4IZIA 2IYPA 3LF2A 3FPLA 1R4MA 2NVWA 3UN1A 4BMSA 4R1UA 4ZU3A 3HQ4O 4CQLA 5BQFA 4M54A 2CFCA 1R4MB 4RVDA 3RBVA 3IJRA 3NRCA 1Y9AA 3JCZA 3JYPA 1K0UA 2GPTA 3TZ6A 2PZKA 2QW8A 2JD0A 4LVCA 5FFFA 5A03A 3TN7A 3KHUA 3OIGA 5JMPA 1DRUA 3GFGA 5IXSA 2B37A 1LDBA 4J7UA 2ZYDA 4D3FA 3FR8A 3DR3A 4J6FA 1K6IA 5THQA 2R00C 4RV9A 2UYYA 1HXHA 4TKLA 1IHXA 1XU9A 4ZICA 4XKJA 3GZ4A 1QKIA 3RC7A 1DO8A 3WXBA 5HRUA 2X7HA 5TGDA 3RU9A 2GF2A 4OAQA 4DLBA 3TRIA 1P1HA 4TVOA 1DJNA 4XA8A 2WM3A 4CPDA 4DQXA 3HJAA 1U4SA 5AQ1A 4J1NA 4MP8A 4IZHA 2ZB7A 2AHRA 2D3TA 1PJBA 1ENZA 4EEZA 1MG0A 3DDNA 4B7UA 2BFOA 1HLDA 1YXMA 2UAGA 1I2CA 3MJTA 5LDHA 3LC1O 3PP8A 4D0SA 1TT5A 4LMPA 1E6WA 3Q9NA 4ZRMA 2YJZA 2C82A 5ILGA 5A3JA 4FJ0A 4R51A 4WCFB 2I66A 3GRKA 5JBIA 4RLSA 5I7VA 2W2KA 3TZKA 3H9GA 1M6WA 1GEGA 2FHSA 3VH3A 3AK4A 2BHLA 3S2IA 4A7PA 4K6FA 3WR5A 4MVJF 3L6EA 3GN1A 1T4DA 4YVFA 2JJYA 4GX0A 4IY1A 4JLWA 2AA3A 2P5UA 4J1SA 4M87A 4RLHA 4O6VA 5B12A 3LC2O 3EUWA 3KOUA 4YWJA 1UP7A 4M89A 4Q3AA 1HWYA 2C59A 4HFRA 1UP4A 3WFIA 4LSWA 2DFVA 4CMEA 1Y1PA 4Y98A 4CMGA 4RJTA 1CWUA 1UJMA 2OGUA 4RDHA 1OI7A 1ZK2A 2Z5LA 1PJ4A 2HDHA 4ONEA 2VWPA 3PVZA 1C3VA 5C7LO 1B8UA 3ROMA 5KVSA 3TL3A 3AM3A 5CDSA 4RZHA 3ZHZA 3FNEA 4WLEA 1NASA 4ZQEA 4GWKA 2FOIA 3QY9A 1PQPA 6ADHA 2DTXA 2VUSA 3WNQA 5K0ZA 1WDKA 2YFQA 1HZZA 3H2ZA 3B1JA 3VVBA 3VHRA 4BGVA 5MGBA 4Q3BA 5EQFA 1YB5A 2ZTLA 1LEHA 1MLDA 4FFOA 1DLIA 4DA9A 3NJ4A 4TSKA 3NAQA 1M67A 3U4IA 1QYCA 1XLTA 3F1LA 3LT1A 3RUIA 5A06A 4WPGA 3KETA 2G76A 4O63O 1Y81A 4GVLA 2V6BA 1SO8A 2BFPA 4DBZA 2AXQA 1AUPA 3D3EA 3ITDA 4FFNA 5HTOA 1T26A 3CUKA 4JP2A 1AGNA 3G0OA 3FN4A 3DZHA 3WSVA 1W4ZA 4FFRA 1YL5A 3P19A 4MVJI 4W82A 1LRJA 3D3WA 5L9AA 4IDBA 1Z82A 1SPXA 3GMSA 1LDYA 1ZCJA 1OMOA 1ZKMA 4DIBA 1VSVA 4UUNA 5T8KA 3U62A 4A26A 4B3JA 3IUSA 4WLFA 1GL3A 2G0TA 3R3SA 4NJMA 4BO0A 4BO2A 4YXFA 3H5NA 4WEQA 3I3OA 5EN4A 1PJ2A 1GUFA 4ZQBA 1XA0A 2OZPA 3PEFA 3F9IA 2Q50A 1PL8A 2PH3A 1L1FA 2PR2A 1I2ZA 3BAZA 2WWRA 3QWHA 5CFZA 3SXPA 2GZ1A 3T7EA 5FF9A 3WGOA 4GGOA 3SEFA 1BXGA 1Y8QA 4NK4A 1ZVMA 4MKRA 4L73A 3S2EA 1E3WA 4MDHA 3ZWAA 3V1TC 1Y5RA 1ZEJA 4BUCA 3B1KA 1V35A 4FSHA 4TWRA 1ZUD1 4I5DA 5KVVA 2X0IA 3UCXA 4RVHA 4EZBA 2Y0CA 4JIGA 2YY7A 4RVUA 5IDWA 1XYGA 2XXBA 2GCGA 5U4QA 1QV7A 1LSOA 2AQ8A 4XQGA 4OGWA 3DZFA 1PJTA 2YQ5A 1LA2A 2W98A 4J7CA 4WASA 2OHXA 2YUTA 4MJLA 3ZWVA 3VZQA 4RVSA 1MP0A 4NG5A 1GV0A 4KQWA 4OOEA 2OMEA 4HP8A 3TZCA 4HBGA 5G2OA 1R15A 4NFSA 2Y0EA 4NZ9A 3RROA 3PJFA 4P8RA 1QXSA 5JS6A 5AYVA 4BKOA 3C1AA 5FI5A 4FFLA 1ZK4A 2YDYA 1O95A 2NLOA 1LLUA 1FDVA 3K92A 4U6QA 5JDCA 4OKNA 6LDHA 4AJHA 4RGBA 4IIUA 1ZFNA 2O3QA 3MTJA 1E7SA 1PZGA 2O3RA 2C07A 4XQ9A 5DCWA 1DJQA 3GUCA 1L7EA 3V2UA 4KDEA 5KCZA 1P31A 1Q0HA 1Q7GA 1QSGA 3P7MA 3L4BA 4PLWA 1EVJA 5JDIA 2JFHA 4FD3A 1CQJA 1GUZA 1H93A 1HE2A 5JSFA 2CUKA 3JYNA 2ZCVA 4Z3KA 3ZW8A 2ZJ1A 1UDCA 1RM3A 4MINA 1AN9A 3A28A 1GCUA 4YQZA 3JYLA 5IN5A 3LT0A 3NV9A 4AJIA 1VJTA 3WGHA 2ZB4A 2LDBA 2P4QA 4YJFA 4BGEA 3K8ZA 1M6HA 1V9LA 4CMIB 1O6ZA 2PZMA 2NU7A 5GZ1A 4UEJA 3UAGA 5FEUA 4IDDA 1XEAA 2B0JA 3GNTA 5JMWA 2CDAA 4FJ1A 4B8WA 1UAYA 1RPNA 2JFFA 3JD0A 3L0DA 5ITVA 5THKA 4Z9YA 3UW3A 1ULUA 3TFQA 4CMIA 4P4LA 4PLCA 1DEHA 1PIWA 3FD8A 5JYDA 3FWNA 3I6IA 3H2SA 3PHIA 3QVWA 1DOHA 4JBIA 5FI3A 2ZK7A 3ENKA 1U3TA 1TI7A 3DTYA 4RF4A 4JGBA 1MXFA 2VWHA 3ANMA 3KYCB 5L7YA 3KTDA 1YQXA 2SCUA 1O0SA 1Z73A 2HK7A 2E48A 4TRRA 4CM9D 5ILOA 5J23A 4IS2A 4YT2A 3HG7A 1AHIA 3PQFA 3ICPA 1ONPA 2NUAA 2PD3A 4YQYA 1P45A 5JPIA 2JHFA 5EPOA 3TL2A 5F21A 3WIEA 1A9YA 3GZNB 2W2LA 1S6YA 4RPLA 1GDHA 2CNBA 1PU2A 2X1HA 1F8GA 3UOGA 4IQ8A 4PLVA 3H6KA 4UULA 3TSCA 1I30A 1PS8A 3RKUA 3ZU2A 2EKPA 2NNLD 1KVSA 2PGLA 4UUPA 2WJPA 4R1NA 5JXWA 1VL8A 1Q0LA 4KOAA 1LJ8A 1I01A 4IXWA 1BVUA 2H5LA 1M75A 3JQGB 4QO7A 1HDXA 4D41A 3K2BA 3WYEA 3HWRA 3E18A 2O4CA 2BLLA 2WD7B 1PJ3A 1DFHA 4D0RA 1EUCA 3PGXA 3VKUA 1XQ6A 2VYVA 3EC7A 3GEGA 2PNFA 3AM4A 3GVPA 7ADHA 4ITUA 4L9RA 4KZPA 3RC9A 4AJLA 1PGOA 2I65A 1DC4A 1WMAA 5K6AC 2A35A 4MVJA 2Q4EA 4D3DA 5KVCA 4WK6A 3L9XA 4GLLA 4Q3CA 3QW2A 3AI2A 3U9LA 3D3WB 3W6UA 4MOWA 4E5YA 3MWEB 3ZNPA 3PK0A 2OOSA 2WYVA 4DREA 2I5PO 1GEEA 1PJLA 4AJKA 3EYWA 3PJDA 3FHLA 2X58A 5BSFA 2X9NA 2YHIB 3RVDA 4JBGA 4INAA 4ND1A 2ZCUA 5IFLA 1E7YA 4WUVA 3SX2A 1B8VA 4YJHB 1GFSA 1JKJA 3PTZA 2O2SA 4QXMA 4R16A 5DT9A 2BRUA 5A3VA 3RD5A 1HYHA 2RAFA 4N54A 4CMAA 1U5CA 3R0IA 4BQPA 3WWZA 2HRZA 4GX2A 4FC7A 1U1IA 2W2LD 5FWNA 1HLPA 4NU6A 4IJVA 3AUSA 4BNMA 4KTTE 4KUGA 1HKUA 5JYEA 1I10A 3LSYA 3NYWA 4RCVA 5F1OA 4YAIA 3TOZA 3LF1A 4E32A 4E4YA 4W7HA 4YT4A 1PL7A 3H8VA 3FR7A 4Y8VA 4HNHA 4CLRB 4CM9A 3DZBA 5JDIC 5IDQA 3D0OA 5I8ZA 1HE3A 1NAHA 4A10A 1TXGA 4GX5A 3HDYA 2J5KA 2EW8A 2AW5A 4EDFA 1E3WB 1GUYA 1ZK3A 5TQVA 1RJWA 5KVQA 2AE2A 4BV8A 3ULKA 2Y1DA 5FYDA 1ONNA 4QECA 4B4OA 4EUEA 4CMCA 5HS4A 3VH4A 3DOCA 1SCUA 1E7MA 3PWZA 2RHRA 3NTQA 1HDGO 2FPPA 4JNKA 3VTZA 1NWHA 1DFIA 1UH5A 5F5NA 2X4GA 3NDRA 3S55A 4XQEA 1T2AA 4XD2A 1V0JA 2FR0A 1GU7A 1QYXA 1TLTA 2VCYA 3WFJA 2WE7A 4WOKA 3ZV6A 5ICMA 1T2FA 3WIDA 1XGKA 4JJGA 3ZI0A 2CD9A 3C1OA 1ZIDA 2Q49A 3DMYA 4ND4A 3QRWA 1F06A 1I0ZA 2R2GA 4IS3A 4WCDA 1RM0A 3OJOA 3WLFA 1H94A 2BGKA 1P3DA 1ZNQO 3OM9A 4G5HA 4GVXA 4W9NA 3PQDA 2IODA 4GKVA 1WNTA 3AUAA 5TNXA 5L53A 4CM8B 5A1TA 2D4AA 4XR4A 2WEKA 1DAOA 4I5GA 4RPKA 4ND5A 1X0VA 3Q1LA 4U0JA 3ETGA 3MTGA 5G0VA 1KY5A 2IZ0A 1YBAA 3DTTA 2DT5A 1I8TA 2PKRA 3OSUA 3RI3A 5L7TA 2P2SA 2HKIA 3WGGA 3UH1A 4DQVA 4PLTA 4DWVA 1GYPA 1BVRA 3QWIA 1VKNA 4E5PA 5AVOA 1B3RA 1XIVA 2CF6A 4B7CA 3UVEA 2DVMA 1WAMA 4BNZA 4GGPA 1BRMA 5IJZA 1X1TA 1F12A 4B4WA 4N7RA 5HA5A 1P1KA 2HQ1A 1DC3A 1ZJZA 4TVBA 3GEDA 4A27A 4DL9A 1ZEMA 3CXRA 1R6DA 2O7SA 2QRKA 1B14A 4CLOB 3OJ0A 1KVQA 3RUDA 2YV1A 3HB5X 3GOHA 1HEUA 5JLAA 4Q3NA 5H81A 3S2FA 4LRSB 5HS6A 5B4UA 5AXBA 1F0YA 4OH1A 2RCYA 1NR1A 4IGEA 3GK3A 5HM8A 2J8ZA 2X6TA 2JKVA 4URFA 1MXHA 1D1SA 3KSZO 3RIHA 3M2TA 1EVZA 2EKQA 2EP7A 3PIDA 3UICA 4BKPA 1DIHA 3ON5A 4QQRA 2WE8A 3DWFA 1E3JA 1NVMB 1R4NA 1X7HA 1HDZA 1GV1A 2BI8A 4HNGA 4CM5A 3IJPA 2J3JA 1X14A 1WXDA 1OC4A 4PG8A 4OSPA 5I7EA 4TZKA 4KWHA 4YR9A 4D45A 2QG4A 3DEYX 4OOFA 1A7AA 4UVHA 3WTCA 2Q46A 5CPBA 3KYCA 1PZEA 1QYDA 1CRWG 3UCFA 1DAPA 4ZD6A 3RWBA 1XDWA 4CUKA 1ID1A 4R9RA 5EERA 3VPHA 3O9ZA 2B69A 4E6PA 4R01A 4NHEA 1JVBA 4K9DA 4N5MA 2AEFA 4RF2A 3O38A 3I9KA 2HLPA 3T7CA 5BNIA 1I36A 3AU8A 3RUCA 3QHAA 1ENOA 4G65A 4BKRA 5IAAA 1KYQA 2UDPA 1YS4A 3ZHBA 4D43A 4YJDA 4PZEA 2IEDA 3JYQA 1Z6ZA 2XF8A 1K6JA 1P1RA 4NBRA 3EZYA 4XRRA 5JCXA 3IOYA 1ADFA 3A1NA 1H6AA 4XWYA 3VDQA 3ZCXA 1U3VA 4YB8A 2ZKLA 4UAGA 4XJTA 3H9JA 4XX0A 3LU1A 1SC6A 3H65A 4I5FA 1C1DA 4RQUA 3W8FA 4J9UE 2HSDA 2PLAA 1I3MA 5KJFA 1K5HA 3JQ8A 4RVGA 3LLVA 3WMWA 2HU2A 2WYUA 3Q3CA 3FF4A 2QYTA 1LSJA 4PFJA 2P9EA 4YJFB 4J0FA 2YV3A 1IZ0A 2AQHA 3QJ5A 2P68A 1EVYA 1T1RA 5DBIA 5BSEA 1UZMA 3B1FA 4ND2A 4CLXA 2ZIZA 1IYZA 2UUPA 4H15A 5HBRA 2A4KA 3NJ8A 5JAQA 4A03A 4GMFA 4Q3DA 2I76A 3FI9A 4RO0A 3RJ9A 4R3WA 4BIIA 4ZA2A 3W4JA 2C5EA 3KYBA 4AG3A 4WCFA 4XIJA 2PD4A 4WCFC 1AXGA 2BFAA 1KC3A 2HAEA 3GNSA 2PGJA 1NQ5A 1B2LA 1EFKA 3HDHA 5JAIA 1WPQA 2GR9A 5A9SA 5I9NA 1UZNA 1GYQA 1HYEA 2YZ7A 3BHMA 5IZCA 3AM5A 4PIVA 2LDXA 1DC6A 2GGSA 4CV0A 3L6OO 5B4TA 1DBVO 2NADA 3HSKA 4N5NA 4TROA 1LQTA 3OF2A 2C5AA 2I6TA 2C7VA 1ZK0A 4DXHA 2FR8A 3C24A 2UV8A 4IIVA 4B4VA 4C4OA 5JY1A 1VJ1A 1QRRA 3NEPX 5G4KA 3GH3A 4E2YA 2JL1A 2NQ8A 1F17A 4A5OA 5L4LA 3INTA 4AJNA 1GADO 1YH3A 4OM8A 1Y5MA 4AL4A 1OBFO 2AG5A 3PHJA 2HMVA 1H6DA 1QV6A 3WS7A 2NWQA 3DHNA 3PHLA 3R3JA 4NJMB 4TQGA 1DXYA 1SMKA 1N1EA 3BXXA 3GAZA 4M8SA 3ORFA 4F3YA 5CG1A 5CDYA 4H7PA 2H1SA 1WDMA 5BT9A 2NVUB 5JC1A 4ZN6A 1N7GA 3MJCA 1P9LA 5TC4A 1NFRA 2GN6A 5KJEA 1PJSA 1TA4A 5T5QA 4J9VA 3WGYA 3UUWA 2XAAA 5I7FA 1LI4A 3BHIA 4LW8A 1IUKA 3CE6A 1HDRA 5DP1A 4CM4B 1UDBA 4WE3A 4FC6A 2I99A 2Q99A 4WLUA 3PLNA 4XR9A 3JQAB 4XCVA 3MJSA 1WP4A 2HCTA 3DAPA 3WSWA 3GT0A 4K6CA 1FF9A 2C54A 3OBBA 4WKGA 1LX6A 1NHWA 2NSDA 3FSRA 1E3LA 3E9MA 4MVJD 5JC8A 2QYSA 2WMDA 2JFGA 4CV1A 3O8QB 4E5KA 4E3ZA 1A9ZA 4L76A 3TDKA 3KLMX 1LDGA 3FPCA 3O8QA 5BSGA 3AWDA 3FNFA 4ALKA 3NGLA 1Y6JA 3H4VA 4LCEA 3VC7A 1DPGA 1IZ9A 1GZ6A 1NWCA 4PZDA 2NM0A 4CLDA 2QHXA 2O50A 1V3UA 3GR6A 2XOXA 3M6IA 4IQ0A 3CINA 3WBFA 4BMVA 3RFXA 4AJOA 4IPTA 4XQCA 2E37A 3ZH2A 4MVJG 3GDOA 4J4HA 5DBFA 4II3A 4JQCA 3H5AA 1PGPA 5C5IA 1BXZA 4NU5A 3RC1A 1DRWA 5CDUA 3SBOA 3KYDB 3DZIA 3IC5A 5F3RA 1JWBB 5ES3A 4YAJA 1QMGA 3ONDA 1PR9A 2ZJ0A 1Q7CA 3PJGA 2E4AA 2VZ8A 3V1UA 3PFWO 1E5LA 1I5RA 4YDRA 1ISIA 4OQYA 2F1KA 4X54A 5HWSA 1A71A 4XEHA 2IDZA 3ABIA 3AOEC 4GH5A 3W1VA 4EGFA 2Z1MA 3ROQA 5CEFA 1J6UA 3LC7O 3S1LA 3ANNA 3ZWCA 4YAKA 2O3UA 4LMRA 3LQFA 2EXXA 3X2FA 2WYWA 2C7GA 3VH2A 1CQIA 1H5QA 2FSSA 3DOJA 1YQGA 1IPFA 3K5PA 4HV4A 1HF3A 1LNQA 4YACA 1ULSA 2Y68A 4K1LA 5DCUA 2B4TO 2VQ3A 5DOZA 3I23A 1ZMOA 3CIFA 2GZ3A 4NR0A 4IDGA 2P4HX 1SZJG 1P1JA 3EDMA 3ZWPA 5KWEA 4PG7A 3HDJA 3Q11A 1E6EA 2BELA 4OL9A 1BWSA 1B0AA 4R1TA 1KEWA 1ZJYA 1Q2XA 3GEMA 1R0LA 1UZLA 5I9LA 2HJRA 5IXYA 1KC1A 1PS0A 1B16A 1T2EA 1U5AA 4UVEA 2ZATA 3PDUA 4BNLA 1JN0A 4RF5A 3JQ9A 2O3TA 3OH8A 2D59A 2IRWA 5ENVA 5COAA 1UDAA 2JCVA 2DBQA 3DBLA 1EFLA 1EEHA 2OORA 3UF0A 4E21A 1JVSA 1DDOA 3JD2A 1HSZA 5KNLA 3ONEA 3E9QA 3KZVA 3HB4X 4ALLA 1CF2O 4J16A 4ZRNA 5AOVA 3GDGA 2D2IA 3JV7A 1K2WA 5T6BA 2ET6A 4BNNA 1JA9A 1EE2A 3HDQA 5G0UA 3ASUA 1HDYA 3WQSB 2VTDA 1EDZA 2X0RA 3VVCA 1K3TA 2O2YA 3ADPA 1KVUA 4L4XA 3NDIA 3SC4A 3LLSA 4CMKA 2QX7A 3WLEA 1EK5A 4EEXA 2VHXA 3ROPA 1GPDG 3CEAA 4MVJP 4GSLA 3ZWYA 3UFXA 3GGOA 3LT2A 3S8MA 5EQDA 4CV2A 3HE3A 1U9JA 3I4CA 4HADA 2FSVA 4EBFA 1PWXA 3DZGA 2WTBA 3JQ8B 4BO6A 4D44A 3PZRA 1ADGA 4BL5A 4JP3A 1N2SA 2EV9A 4XIYA 2HO5A 3CKYA 3AY7A 5A5FA 4OKIA 4QEDA 1ISMA 3F47A 4YJGB 5EMHA 3TNLA 3E1KA 4BNFA 1XR3A 1ONOA 2AE1A 4NBTA 1EE9A 3K6JA 4YJGA 1R4NB 3K30A 5LDGA 1EBFA 4J91A 3DBHA 2D0IA 3V2HA 3WYCA 4A0SA 3PGJA 1U8XX 1A4UA 3E5RA 3OICA 3G49A 4MO2A 2WDZA 5F1PA 2VZ0A 4F46A 3PFFA 4W99A 2DUUA 1HETA 1EVIA 1D8AA 5T8KC 1TT7A 3OETA 3WYBA 2VUTA 5L40A 5B4VA 3TQHA 3RUEA 3PQEA 4E13A 3I5MA 5DULA 3UGKA 3DONA 3GQVA 4ZJUA 1JKIA 3TZQA 1LU9A 5L45A 3OEYA 4G2NA 1JTVA 1LDNA 5A05A 3PXXA 2P9GA 2HMWA 1N92A 5JE8A 5K9ZA 1I32A 4FOSA 4I5EA 3GPDG 4PLHA 4WEOA 2ZYGA 1G6KA 2PZLA 2DBZA 4L0QA 4LRTB 3NT2A 5C37A 3NUGA 1EK6A 4J3FA 3H3FA 3LZ6A 5DCYA 3ZNNA 3BTUA 3ZN2A 3PI7A 1C0IA 2H9IA 3WWYA 1XELA 1C1DB 1LC3A 1F8FA 3DHYA 3OA0A 5DN9A 3ZWWA 3K2EA 3JD4A 5C7OO 1L7DA 3AI3A 1HTBA 3A4VA 4XGKA 2GYYA 4EI2A 1NNUA 4WLOA 5TJHA 2QZ9A 5ER6A 1J4AA 1CETA 2A9FA 3PWKA 1IY8A 3S2GA 5A04A 1EUDA 1NP3A 1FDSA 4J4TA 5KJ6A 4YJHA 4M49A 1R16A 3ZWNA 1N7HA 4P4GA 2JD1A 1A4IA 2IZZA 1J49A 2Y99A 1PZHA 1Z7BA 5IZCC 1LRLA 3ZDFA 3EK2A 3GF4A 2PH5A 4DQUA 4U0KA 1W73A 3WOHA 3QE3A 1NQTA 4YT8A 1OAAA 9LDTA 4CL8A 4O1MA 3RUAA 3PRJA 4XZ3A 3ZWXA 4XB2A 3WQRA 2D5AA 4YPOA 3ITKA 4R5HA 4QUKA 3VTFA 3BTSA 4BOYA 3BA1A 1JW9B 2G17A 4MIOA 2CDCA 1V6AA 4CR6A 1WWKA 3DHEA 4DMLA 1B7GO 1NHGA 4LVUA 2BGLA 3GUYA 4RL6A 5EIOA 3R1IA 1HL3A 1G1AA 2GD1O 3HHPA 5ICSA 3HADA 3D4OA 3ENNA 2E6UX 4HKTA 3NTOA 3ZW9A 4FPXA 4IINA 1U7TA 1GQQA 3A9WA 4WGGA 3E9NA 5TX7A 1Y8RB 4PVCA 3W4KA 1DLJA 3O26A 4TKMA 2QRLA 4U5QA 1M76A 2V65A 4NMHA 3TPCA 1O9BA 2NU8A 2JAHA 2O3SA 2EJVA 1ZK1A 2J6IA 3IP1A 4CM8A 1Q0QA 3KEQA 3PHHA 1DSSG 3C7CB 1BG6A 1YOVA 3L6DA 3QVXA 2FP4A 1EBUA 5KJ1A 3M1LA 2JAPA 2VHZA 2Y05A 4PLPA 3GHYA 1ZO8A 1XWFA 4MVJM 4Y6SA 4ALNA 2NTVA 4S3MA 2EJWA 3RU7A 3T4EA 2B35A 2RH8A 3F5QA 2Y93A 1DIRA 1V3VA 2X86A 5TS3A 4JCOA 3C3XA 4FN4A 4AICA 3JQEA 2I3AA 4N5LA 4OSOA 1NPDA 5GY7A 3D7LA 2I3GA 4QO8A 4CM3A 2ZB3A 3WG9A 3F1KA 3QVOA 4FQ8A 3H3JA 4XYEA 1VPDA 2GSDA 3H7AA 3UXYA 2CZCA 1O8CA 1E5QA 5F5LA 2JD2A 1Z74A 4XYLA 3Q9UA 1EQ2A 2WD8A 4MP3A 4AJ1A 3ETEA 4PLGA 3Q6IA 1KERA 2EKLA 3GVIA 3JQGA 3QV1A 1YRLA 4TRNA 1K89A 2Q2WA 2ZTUA 4DBVO 4WLVA 2DFDA 5DBGA 3A14A 3INRA 2FWMX 3ZV4A 4CV3A 4CUZA 4TZTA 1YDWA 4HFMA 5KKAA 2QIOA 5KJCA 3FTNA 3DBHB 4DIOA 4DMMA 4GKBA 4FOOA 5ITWA 3ETDA 3FBGA 2AG8A 4J0EA 1NQOA 5A9TA 4ZQGA 5DZSA 1HZJA 3SJ7A 2VWGA 1E1LA 1SBYA 3IDSA 4E2ZA 3HZZA 3ZWOA 1B15A 3IS3A 4L75A 2HMUA 3I52A 4UEOA 3BMQA 5A4DA 5G0SA 3KXDA 1I33A 2BF7A 4OJNA 4DRYA 2BFMA 1ISGA 3KLPX 3VPXA 4DYDA 4NJOA 1GPJA 1XHLA 2PWZA 3JTMA 4FGSA 4UVIA 4WECA 3VH1A 3L07A 3FTPA 3FWZA 2X0JA 4LN1A 2VTEA 3AJRA 4EJ0A 1XSEA 2NVUA 1N5DA 4XGIA 2JHGA 2C20A 3OIDA 2X23A 3O03A 3RFTA 1YBVA 3IMFA 3LK7A 1T25A 4CQMD 2VHVA 4IQGA 3VZPA 2FZEA 4LSMA 1RM4A 2O7QA 4PGFA 3RJ5A 1IHYA 1YE3A 2EHDA 4PVDA 4Z3DA 1PL6A 1YJ8A 3GPIA 4YEDA 1CERA 2Q4BA 1ZSNA 4FB5A 3IKVA 3K96A 1GY8A 2GERA 2GUGA 3F4LA 1MFPA 1QLJA 1B26A 1XU7A 2DAPA 2DQ4A 1D4FA 3QP9A 9LDBA 4ALIA 5DF1A 1RWBA 1X13A 5K6AA 3ST7A 3VKVA 4I1IA 5EL0A 1E7QA 4LK3A 1RYEA 3I1JA 1HE5A 4I9UA 4NIMA 4L4SA 4YYZA 1CEQA 1QR6A 5IN4A 2PV7A 4N18A 5KIAA 5G0TA 2Y1OA 4ILKA 3DZKA 3DBVO 4PRKA 3KRTA 4JJIA 3JSAA 4B79A 5L4SA 3QWFA 3GY0A 5CDGA 1V8BA 4CLEA 3EW7A 2EG9A 1YJQA 4BMNA 4NNJA 4R68A 3ZNQA 3V5NA 1R37A 1JU9A 4XJSA 1XCBA 2UVDA 1GTMA 3FRJA 4U7WA 3CPSA 4A2CA 3AOEA 1LDEA 4O59O 3EY4A 1QP8A 4BNUA 4BNIA 1U7HA 2CVQA 5CEEA 4M1QA 5T64A 5CG2A 3RAJA 1U2GA 3IAHA 2YHUA 1CDOA 1HRDA 2PFGA 3BIOA 5CHEA 3A06A 3VPSA 4KUEA 4BGIA 5JW6A 3DAFA 1ENYA 3ICCA 3TOXA 3GFBA 1YL7A 3IL2A 4W7IA 3JQCA 2A94A 1A5ZA 5JO0A 1BXKA 1DIGA 1YL6A 4EW6A 1J5PA 4Z6KA 3I6QA 4E31A 3GGGA 3I9OA 2YFHA 1PGJA 3EAGA 1B3BA 1KY4A 1FXSA 1WZEA 2DBVO 4W6ZA 1HT0A 2G1UA 4Z9XA 4CL3A 2OO5A 1ZH8A 1GZ4A 3BZUA 3E5MA 3QVTA 5ADHA 4CM4A 4FS3A 3PWSA 2F00A 2YHIA 3ZV3A 4D7AA 4Q9NA 1KVTA 3LT4A 2GNAA 4C7KA 3WNVA 2WSBA 4FDAA 1Q1NA 4YT5A 1BDMA 4QT0A 4ROSA 1NXQA 3ZWBA 3JQFA 2CMDA 3JQFC 3JYOA 1NQAO 1NM5A 3KB6A 4DVJA 4FW8A 3CMMA 1GZ3A 2BKAA 3JQ7B 4J2HA 1GQYA 1VLLA 4KUHA 5DP2A 1UAGA 4MVJE 2TMGA 1E6UA 3BMQB 3GNQA 2PKQP 5F1KA 4O0LA 4OXNA 5JFOA 2BI7A 4B3IA 3BMNB 1P44A 2PGDA 3QSGA 4B4UA 2X22A 1ZZEA 1EQUA 4Q39A 2EP5A 2VHYA 4WNCA 1NPYA 4CMJA 1RYDA 2Q1TA 2D1YA 3E8XA 2EWMA 1NBOA 5A02A 2H63A 3JQBC 2X5OA 4GAEA 2D8AA 4MPDA 3WDSA 5A5EA 1NVGA 3KUXA 2VNAA 1DHRA 4UEKA 1JAXA 2OBNA 1BXGB 1Y8QB 1YKFA 2CY0A 4PZCA 3UCEA 2VNSA 1MV8A 2Y1CA 3GVCA 3IQDB 4QSMA 4BV9A 2A92A 4IXTA 1UXHA 1DIAA 7MDHA 3GC6A 4RDIA 4BO4A 1NYTA 2EGHA 5U1PA 1PSDA 4JX8A 3GGPA 4C7JA 4FFPA 3OECA 3MJEA 2Q2QA 4NH4A 3AFMA 4BNWA 4FIZA 1LC0A 1A7KA 3CTMA 3OFSA 2OUIA 4G81A 3T4XA 1XQ1A 4HX5A 1U28A 5BR7A 2D5CA 2W90A 3AUUA 3PPIA 1B8PA 3O4RA 3C7DB 4NFYA 1U2DA 4E33A 2RIRA 5JDCC 4QTZA 3MCVA 2VYNA 1JQBA 4J4BA 4B7XA 3STHA 2VT3A 1DFGA 1RM5A 1Y7TA 3QWBA 4AJJA 3E03A 1GCOA 4CM7A 5B1YA 4H16A 2B5WA 1VL6A 1ARZA 1BW9A 1R12A 3VAZA 1O5IA 1E1MA 1SEPA 1OOEA 4RPJA 5EINA 3QVSA 2OL4A 1NPTO 2VYVD 2HUNA 3L9WA 4BGUA 2GO1A 3AOGA 1I24A 4Q3EA 4IBOA 1ORRA 1VRWA 4RQTA 5LCXA 4IDEA 1E77A 2V6GA 4BS9A 2EGGA 1JDJA 1ZW1A 1UUFA 2VWQA 1GYRA 4DYVA 4IJKA 1SOVA 2R00A 2DPHA 4OXYA 3P2OA 4AJEA 3VPGA 2GRAA 4RZIA 2YW9A 4CLOA 3KYDA 3GA0A 4UVDA 2RH4A 1NFFA 3P2YA 2VYND 3ZU3A 3HFSA 5TLSA 4W4TA 4J49A 2OP1A 1FMCA 3D4PA 4B8ZA 3Q0EA 2J3IA 3VDRA 1PJCA 1PGNA 4CJXA 4XRGA 4UUMA 3NGXA 1E0DA 4XGNA 3KEOA 3MZ0A 2IXAA 3HFGA 3DL2A 3U4CA 1KEUA 4J2OA 1G0NA 3ZZNA 3GVXA 1ZBQA 2RHCA 5TIIA 4D42A 2C29D 4TRMA 2I9PA 2EW2A 1E92A 2HMTA 2P91A 1NR7A 2DPGA 3FBTA 2AQKA 3L4BC 4XYGA 5JCJA 2Y1FA 2FMUA 3AY3A 3WGTA 5JAZA 5JNLA 4ZQHA 4HFJA 4PLFA 3IP3A 5COBA 4IMRA 4BO9A 1E3EA 4GMGA 4CR8A 4NPCA 4DGSA 2NTNA 2Y67A 3EMKA 3NX4A 3U0BA 2PK3A 2X5JO 4H3VA 4W9NC 4RF3A 3C8MA 3RUHA 3F3SA 4UUOA 3JQ6A 5H82A 1U3WA 1VC2A 2OXIA 3CZMA 3TJRA 1ZXLA 1MUUA 4J1QA 4MIEA 2XXJA 1MC5A 2FZWA 3AU9A 2V7PA 4IJWA 1P74A 2Q1SA 3SLKA 1C14A 3ROKA 3TWOA 1P33A 4S1VA 3LYLA 4FR5A 1WDLA
chains in the Genus database with same CATH superfamily
2ZRJA 1PL0A 2NU8B 6PFKA 1K6XA 5T67A 3GDFA 3P9XA 4G23A 3PFKA 3C6ZA 4L27A 2Z6QA 3JQ9C 2NU9A 1CP2A 2XCIA 4P93A 1QUFA 1XRMA 1XTTA 5GGYA 1MA0A 3PL5A 3DMHA 1TQ2A 2FZ4A 2H06A 1A4XA 2QD3A 1AS2A 1R0SA 2VJDA 1XTZA 2XWQA 3QPBA 4OQNA 3TTVA 1ZMXA 1C29B 4QQFA 1A8SA 1Z75A 1EFVB 3LH5A 1CB0A 4BP8A 1K8RA 2FGJA 3MOGA 2ANCA 4JWKA 1TA0A 4MPRA 3W8DA 3KR2A 3U5TA 2TMDA 2OV1A 5E2IA 1I4DD 3KV3O 1FFWA 2HV8A 4BQFA 4CFYA 3SAJA 3S27A 4HRAA 2VP6A 2CFRA 2JZNA 2B5OA 1WE2A 2R44A 1WHSB 1G8JA 1Q0RA 2YIJA 3M6XA 1USUA 3F90A 1ZLYA 2DCMA 5CVUA 1KZHA 4CIDA 4TTAA 2YC2C 3MILA 3AFHA 1E5TA 2PQ6A 4EYEA 5IC4A 5HX7A 3A6FA 3AG5A 5IK2D 5LD2B 3ELBA 1Z0FA 3NQ41 5IS2A 2REOA 3GN2A 4RK6A 2B4RO 1X77A 2O0JA 3NBKA 2FEAA 4NK5A 3E82A 5L51A 3WGIA 4KLAA 3RBAA 3ONFA 4TMFA 1QAMA 4KQXA 4KDRA 5E2BA 1LBEA 2QL6A 4LYGA 3UT5A 3WJ7A 2XT6A 3O8BA 4B46A 1A1VA 3THRA 3LZDA 2Z08A 2IHKA 2X5KO 1E4EB 1Q44A 2YYZA 3P0IA 3EQ9A 4O4IF 3CH5A 2G8LA 1CKEA 2JHAA 4P38A 5K8VA 4TYYA 5EZQA 3NP7A 4TLAA 3ANSA 3PFBA 4NMLA 1HGXA 5D01A 3D3KA 2B8EA 2PUDA 1YR6A 4ZVOA 2RK6A 1W49A 4E15A 1SC1A 2E5WA 2EFEB 3IP5A 3OA2A 2OECA 3SU8A 4IZOA 3TZLA 4K28A 1SN7A 2VPZA 3NC0C 2G7MC 1JIKA 2IU4A 2Q1UA 2HNKA 4L57A 1RYNA 3AKDA 1ZG3A 2X9QA 1FVFA 1WCIB 2O2JA 3C5CA 4I50A 1POWA 1QG4A 7ABPA 3P0HA 1Z2CA 1M72A 5TQ2B 5AM2A 1IB6A 2V3WA 3FOWA 1QK5A 2YW2A 4IDNA 4FR2A 2JJQA 4MVJH 3LVFO 1T5OA 1L7OA 1TU4A 4B81A 1ZH4A 3QE2A 1DAHA 4JI6B 1GNVA 2W71A 4WKPA 1X1EA 3KKQA 4PTYA 4TLDA 2IXTA 4KIFA 3TJMA 4KCGA 5K8UA 5IDXA 1CFZA 4HQ6A 2FW1A 1FFSA 1RJFA 2HSWA 1CUXA 1FPQA 2EC5A 2HMSA 2V7VA 2VRCA 3QLEA 1VKJA 2BH9A 2WC1A 4JL6A 4GMXA 4JMPA 4G0VA 3G8CA 1U0TA 4UVGA 3K0SA 3MB5A 4TM7A 1D2NA 1KSGA 3FROA 1NSTA 4N0MA 4S1OA 1SVIA 2IF2A 1OI3A 2RBKA 2WJJA 4EJ6A 1ESNA 1NXPA 1TKBA 1PZXA 2MHCA 2B83A 3A1TA 2XD4A 3W9UA 1JXAA 4BO1A 1YBMA 1GQFA 1YHNA 3I8OA 3EGOA 3C3BA 2O0LA 4NHOA 2O06A 2PX6A 4QDUA 5BN1A 2XDAA 3Q85A 4K9QA 3WO1A 4G84A 1JH9A 1RRMA 4XB1A 5F9FA 2BP7B 1KS2A 1KZ9A 3GELA 3M8KA 5HUQA 1V9CA 3OPYB 3EA4A 1G20A 4CCWA 1IUNA 2ADOA 3IULA 2YZNA 3H4TA 4D9MA 1GSAA 1E7RA 4AN1A 5FFNA 4QRIA 1WOYA 1ZI9A 4G5QA 5I4CA 3DFUA 3ODPA 3IV6A 3ZLUA 4GX1A 1J8MF 3ZHSA 2P1ZA 1FJXA 4HAYA 3ZZTA 2DQZA 4E7OA 1PX2A 2ZS8A 4BBJA 2GPJA 3EOAI 5LXTF 1YONA 4UBLA 5D7BA 3S44A 4B9EA 1XMXA 5BVHB 4IJQA 5TT1A 3AUTA 4KAJA 3DW3X 2JLUA 1J0XO 1YO6A 3DVRX 3HJNA 5D5PA 5LIRA 4QYTA 3WGZA 1KZ6A 4HQRA 4NDNE 1T8UA 3ISJA 1QIHA 1FW6A 1KK2A 2JFPA 1WDWB 4Y7CA 3HBNA 3DOOA 1W19A 3U4DA 1S3IA 4BX2A 2W2TA 2HDOA 2CLCX 4FCCA 2NUPB 1Q83A 3G9XA 4LJ7A 4BO8A 4E2XA 4F96A 5F3WB 1E2MA 1JNXX 1RQLA 2C0PA 4IMPA 4CIYA 4GI2A 3VZDA 4OU5A 1W2HA 1E4VA 2XCTB 1NIJA 4DA4A 4I8DA 3UEOA 2PUWA 2C7BA 4DG5A 4HAWA 4V0NA 2FUEA 2VHWA 1Z6PA 4YP6A 2CXPA 2YRXA 3QNMA 1Z8NA 2QN8A 4PAGA 3GLIA 1OFTA 3SYNA 3MWEA 1V7PC 3ZCRA 1HYGA 1RR6A 4Y67A 4BWFB 2Q3EA 2VDWA 4XWAA 3HRKA 1X74A 2YJGA 1QUEA 5EKTA 3NUZA 4BO5A 4H2DA 4ZVQA 2A78A 5FWDA 4CG0A 4FFBB 4HXYA 4BNXA 3SVTA 4YRBA 5DHFA 5DYIA 2AMVA 1E1RA 1Z7WA 2EF0A 2Q5EA 1KZYC 1G5QA 4JJ6A 3E7WA 1AHPA 3GZTB 3QG1A 4NBVA 2M32A 4RGYA 1M2WA 5F7ZA 3W6OA 1H9AA 3BHJA 3W3AA 4PX2A 3BXHA 5EJ8A 2B1IA 2CVZA 3LX6A 3KWFA 5IJ9B 3C5EA 3L7LA 2DUNA 3HRHA 3RCBA 5BR8B 2IYYA 1WZNA 2P27A 2QE7A 1KI3A 2WJAA 2QLTA 3H9EO 4NAHA 4WDRA 4YP9A 3D8TA 5JLJA 5EKSA 3U1TA 1E79D 2BZGA 4FJ2A 2CK3D 5H1YA 5B4TA 1TCUA 4Y2UA 3OJWA 1JPNA 2OBBA 5J5AA 5KYXB 4EHDA 3NYQA 1C0LA 1M8PA 3CJQA 4KR0A 4QGGA 4Y2JA 3BKWA 4U8GA 1MAWA 3CGWA 1NX6A 1M1YE 4OP3A 2QW1A 1P2TA 1DT3A 3U19A 2PRJA 2JLQA 1OB2A 1XDBA 1PS9A 2BEJA 2WG0A 3KD2A 3N74A 1DCFA 2ZVQX 2ZYVX 2ZTMA 3K73O 5B1HA 4WINA 3FUVA 3MLEA 1YA8A 2P5YA 1JG3A 2YYYA 4QARA 1B0PA 3TVYA 3HN6A 1DEKA 4OJMX 4BRZA 4X5OA 3PRHA 1V5GA 2AVNA 2NU6A 1L7NA 3L7NA 2EFCB 4WOJA 2PX0A 1X1SA 4JLOA 2I9KA 1AG9A 3CW9A 2ID4A 4DIFA 1NX9A 3OQBA 4CTOA 1RRKA 1U6KA 4M7WA 3WJ1A 4CKWA 1AHNA 1V16B 3GWGA 4OGGA 4PR0A 1D2MA 2BR3A 2Q8QA 4MWCA 2WF7A 3L1KA 2WHXA 3QKUA 1D1TA 3QVGA 3AHEA 4ZAXA 1KO4A 1WMBA 1XN4A 3RKRA 1V3TA 3OKCA 2IYOA 1VLVA 2O5CA 2GTIA 3HXPA 3NKLA 3A58B 4GOOD 1Y9DA 4Z0PA 1BGWA 2ZIXA 1TCCA 2AWOA 2D74A 3KE8A 4FMDF 3CMCO 1GD1O 4I8XA 1IEWA 4OI2A 1N6NA 2BGRA 1C0PA 3M49A 2XZDA 2JCXA 3AHIA 3OLZA 1MC4A 2PEZA 2IHJA 3JQ7A 3E0QA 3MA0A 4NV0A 3NP9A 1GFWA 1D7OA 2G6BA 3ZBQA 1Z3IX 3N2ZB 3COSA 3FUWA 4MR7B 2G0NA 3D64A 4R54A 3OJEA 4WKNA 2J6CA 4YRAA 1KQPA 5JSKA 3RWMB 3LDHA 3W5CA 4RORA 5GP1A 4IDPA 3RM3A 3H9UA 4BXOB 3FX2A 3K32A 5A5VA 7GPBA 2I4NA 4C7MA 1SB8A 3KVOA 1KMQA 3BCRA 5EGSA 1XVAA 3PFCA 4KO4S 2OP0A 2ECKA 3TG8A 1EUCB 3KZKA 1N8KA 3I04M 2ZSEA 2JG3A 3FYDA 4MYHA 1QIKA 3BT7A 3K31A 3QLJA 1A9QA 2G70A 1NW7A 1MJHA 3A4YA 1QFYA 3R6LA 4JYBA 4JUIA 4C22A 2JFUA 4DRZA 3DGFC 4QBKA 2EBHX 3BMCA 2HSEA 2C9CA 3O3MB 1C41A 3CCFA 4ENPA 4D9KA 1EQAA 4HDOB 4OIFA 1NRXA 2XTZA 3T3DA 2D7CA 1JTFA 1TADA 3SBXA 1OZAA 2G25A 3DXZA 5AJUA 1TFUA 1Y42X 3DO6A 3TLJA 4BHTA 3V9PA 3V1YA 2Z6VA 1NP6A 4JN6B 1I2BA 2ZSJA 4V1CB 1Y4SA 1HTWA 1HZZC 3WGLA 2VO1A 1OLOA 4LWZA 1J2RA 5AHRA 4GW3A 5M3BA 1OWLA 1ZXXA 3DCJA 3JD1A 3W6ZA 1D7AA 3G7UA 1H2HA 4CQMB 1FYXA 4ECAA 5C18A 4HDMB 1BX1A 1F0PA 1U4OA 2ZANA 4HDRB 3TE7A 2YVAA 2O0HA 2XB9A 3GLKA 4ND3A 4D8TA 1U98A 3D6FA 1K5GA 4EW3A 1S0UA 2ZUDA 3RYCB 1D04A 3K0CC 1G6Q1 1UFOA 2Q1WA 2VF7A 2RBEA 2ZRFA 3EIFA 2GZ2A 3CIOA 3CNNA 3CZCA 1MGOA 2X4IA 3BWCA 1T6NA 4MUJA 3ZGLA 3R7WA 1RLIA 3PC8A 1R0ZA 1I6WA 4UKDA 5IT4A 1JALA 4MCJA 3T61A 2QQEA 1JQ5A 2B4AA 2NTJA 2FG5A 2R8EA 4EUNA 4ZGWA 3ROTA 1EP2B 3IBSA 1L5HB 4JBNA 2FP3A 4B6SA 4FSXA 2AZXA 1T1JA 3D4LA 5EQTA 3W3AH 2ZGVA 1EXMA 1ADYA 2HA5A 3AEYA 2VF2A 5LYJA 3WICA 4Z99A 2AOTA 5B6IA 5BW4A 2VUHB 3T95A 4N5HX 2JJ1A 4XCQA 3TF5A 3G17A 3FUTA 1U9IC 5LC1A 5TQ0B 1JFRA 3Q9LA 3N7UA 4HDSA 3IBYA 1U90A 4UUAA 5DX8A 2Y1EA 4G0QA 5LQCA 3A6GA 4BQSA 5J1SB 1TM2A 3GPCA 4IFIA 3AG6A 3F74A 4RA9A 4ZVTA 1HM5A 1X0XA 1ZUNA 4LXXA 5TJ9A 3U39A 3Q98A 3KXPA 4ZAVA 4LZLA 1ADCA 3DXXA 3R0VA 3VZRA 4EHJA 2Z83A 1ZD4A 3EDOA 3V1KA 2FW6A 1T1SA 4AZWA 3F46A 4R5MA 4DSOA 1OSNA 2DWPA 4EH1A 4XCXA 5AICA 2H5JA 3VOSA 5BQ3A 2JZOA 1WV1A 1XAIA 2Q8PA 4MVXA 1O89A 2WIJA 1GPUA 1ONBA 3U17A 2CB0A 4AZ3A 4M76B 2G9UA 2PBLA 3TECE 3RQSA 1HSOA 1EK2A 2PZEA 3IBTA 4MA0A 1NLZA 3V80A 4AROA 1NVDA 4NQZA 3TMAA 4Z1MD 1TRKA 1ZGHA 1JG7A 1Y6FA 4N49A 1TX4B 2H2HA 4RKYA 1TMOA 1WXHA 1XZEA 4PYRA 1MAAA 3KQOA 2NSLA 4QFBA 5E6UA 3NBXX 2IEBA 1QORA 4JHXA 3PG5A 4MW7A 3FPSA 4QFDA 4RVFA 2DM6A 5CM8B 3C85A 4LGVA 4TVKA 5CX1A 1R9NA 5DM4A 4E2FA 1JIXA 4OPMA 1NC1A 1Z39A 2B1GA 2XNHA 2O48X 1JHOA 1SIUA 5CYPA 1JDVA 2G5PA 3FKQA 3TFOA 1CR1A 2MMCA 3H97A 5EEHA 2OZLB 4CEJA 3R6DA 1Q84A 2NZ2A 1WEHA 1U7ZA 3BSYA 4S04A 3JQDA 1FC0A 4BV2A 1G19A 4Y3UA 3AT1A 2JJ1D 1EZ4A 1L7QA 5U9CA 2IUYA 1LSUA 4GOKA 3PQ7A 4IIDA 3ND5A 4HQNA 1YOVB 2FFHA 4QQNA 1YB1A 2QOEA 2RI0A 2PHZA 4HO1X 1JKFA 3GCDA 4D4LA 2C7PA 1Y3DE 2VAPA 3P5SA 4AX4A 1MD9A 3DFZA 1E3IA 1LXCA 1OV4A 2BW0A 3H5WA 1R6UA 4XPZA 3HN7A 1Y4AE 1ZMRA 3VZSA 2YOGA 1TGYA 4JK3A 5GJWC 3V8RA 3DFFA 1Z7EA 2PL5A 5JMOA 3DT6A 1BOFA 4UHCA 5LB4A 4RPGA 4PN3A 2ZR7A 2PMBA 2WG1A 3U7IA 2QJOA 4ISBA 3W5IA 5LVAA 5YASA 1E2FA 5ECGC 4BNGA 5IT5A 5ECWA 1VKOA 3R7AA 4HJXA 2V59A 1OFGA 4D96A 5IF9A 3K7EA 1HTTA 4WNAB 1QDEA 3L8YA 5LOVB 4O02B 1UPUA 3P9QA 1XJWA 4RMNA 1ECCA 5AI8A 3UKJA 2CSUA 2JVJA 5G40A 2XRMA 5J4HA 5LDDC 2XCQA 1XPRA 1L8LA 3K9LA 1UP6A 4EKEA 5J2UA 3FOCA 2P2NA 5D2CA 5KYXA 1PT6A 2P67A 1ZM2A 1W85A 2H65A 3LUBA 4GHWA 3DD1A 2P62A 3AHJA 3DB1A 3PC2A 4KJZA 4QAQA 4INOA 3SHTA 3VM6A 3ZV5A 4ID3A 2NN3C 1M2VA 5K3DA 3HK2A 3P0RA 3V7UA 1Z25A 1ZSVA 4FEEA 2O2HA 3UAVA 3HKBB 5EWJB 4OGKA 5HFJA 3U40A 3ZDEA 5AVUA 3KJXA 4L6CA 4MB0A 3H5RA 3L41A 1QVRA 2FPWA 3HZOA 3WGNA 4RTSA 4BX9A 1JB1A 4G0MA 2R85A 1W0KA 1WOMA 3M3PA 2QTVB 1FVHA 5KYVA 5FH9A 2C3PA 4ZHSA 5IPFA 1TZKA 1E0AA 3H1TA 4U6SA 2MR6A 2QW0X 4I1YA 4IIHA 5C4MA 3SYLA 3OTQA 5MDHA 3L04A 2M6RA 4C4YA 3FLAA 2QJRA 5AMXA 1G6HA 4GZ5A 3FHCB 5DWDA 3ZIAD 4Q4CA 1TE2A 3I64A 2JIDA 1RYHA 5D5QA 4H7EA 5L3SA 3KPYA 5BNTA 5AP9A 3RHSA 3QQPA 1LTHR 2P9HA 1OYYA 4EMTA 2OPHA 3DC2A 3VKFA 3ER8A 1RKXA 2Y1GA 3BQMB 3GLUA 1MHPA 1PN3A 3R6WA 3W05A 1G2PA 2EQAA 4DUPA 2WY2D 3H5IA 2XRYA 4E1BA 4CM1A 3UGTA 1XD2B 3LE8A 2QAGB 1N1GA 1OX4A 3IUBA 3L77A 1VL0A 3INGA 3K35A 3GI1A 2ATEA 5CJPA 2W4QA 2H07A 1XE3A 2B4QA 1VSBA 1B23P 1YUBA 4Y2SA 5AR1A 3Q5DA 2XJ9A 5JT1A 2IYPA 3HBAA 3FPLA 3RK1A 3UN1A 1Q0SA 2VJCA 5ALEA 3SIWA 4MWTA 4R1UA 3NNDA 1AQUA 5F12A 3QU5A 3HQ4O 3KQTA 1TAQA 5BQFA 2JEZA 1RYMA 1YU6A 2F48A 3O75A 4GYKA 1NULA 3BGWA 5E7MA 3RBVA 3TOVA 3UBTA 3ZD9A 5FUVA 3N2GA 2PZKA 4UDNA 1NZDA 5HKOA 3TN7A 3DP7A 2PSJA 3CVVA 1MRZA 4G56A 1R8SA 3OIGA 4X61A 3DJFA 1IAQA 2PRKA 1LDBA 3AHHA 2ZYDA 5IXSA 3Q6MA 3FR8A 4ZHQB 1WU7A 1IWBB 1K6IA 4LYYA 4NQRA 1LW7A 4TS9A 2UYYA 2F62A 4ZJPA 4X85A 5IKXA 1XNGA 4ZICA 3EFOB 3ZTTA 2C2KA 3RC7A 3ODGA 1O3YA 1TQHA 4S0ZA 4JL8A 4FK8A 2OMKA 1G16A 1C7EA 1PEAA 4DCPA 5A6SA 3THYB 4OAQA 1D9XA 1Z34A 1FLNA 2WM3A 1XMJA 4CPDA 1HUQA 4DQXA 2ZI7A 1U4SA 4BQIA 3UK0A 3ZDCA 1EDDA 1M2KA 2ZB7A 2D3TA 3HVIA 2P6UA 1HNZB 4B7UA 4HMPA 3KR0A 2BFOA 1HLDA 4PSUA 1I2CA 4EMSA 3G2MA 3BORA 2ZJYA 3B7WA 3PP8A 1Y6GA 3MWYW 2N1BA 4ZRMA 2BT4A 2YJZA 2QBYB 1L7PA 3LFUA 4MULA 3NBFA 2HF8A 4OQPA 4W5WA 4B6JA 3C6BA 3KEFA 4FJ0A 4RS4A 4DZZA 5A3JA 4B6PA 1E79A 2B92A 1USGA 4XDHA 1GGEA 5HUJA 2RGNA 3O82A 3QLUA 3R76A 3WLRA 1OGJA 4DMKA 4F3CA 1OXSC 1WB9A 4D0LB 2H2IA 3T35A 5I7VA 5LLTA 2P3OA 2W2KA 4CF6A 2J59A 2QVYX 1Z22A 1AKWA 1GEGA 4MCHA 4NE2A 1KO8A 2FHSA 4RV4A 3VH3A 2FSVC 4EW2A 1C7QA 4A7PA 1SXJD 2JDID 1NE2A 3GN1A 3NCHA 4YVFA 3VBEA 2EW1A 1Y9ZA 4JLWA 2RKOA 5CW1A 1XZKA 3LC2O 4M7PA 5BN3B 3EUWA 2VBFA 3ND8A 3IV7A 4ABTA 1NVEA 2PLRA 1HWYA 3D5EA 4ZOLB 1U1DA 1UP4A 3WFIA 2ZYWX 4FMDB 1AUVA 1N78A 4K0RA 5AUPB 1BKYA 3IQGX 1ZQ9A 2ZPTX 2OGUA 1V45E 4EQ6B 1M6YA 4K8RB 2ON6A 1YRBA 1TD9A 6YASA 4C4TA 3KPWA 5GOTA 1ZHFA 3CLUC 1INLA 5G02A 1UKYA 3BIWA 3QPAA 5DFAA 5C7LO 5I4BA 4OBBA 4RMHA 4R3UC 5KVSA 2M6LA 2G9RA 3AM3A 3O2JA 1EUQA 4EKIA 3NIGB 4RH3A 2B1QA 4ZQEA 4OP2A 4GL2A 1PQPA 2EFJA 4EY5A 2XE4A 2QT0A 1WDKA 2YFQA 3BWVA 4V0RA 5AKYA 5K0ZA 5I45A 1XTBA 1MQ8B 1HEYA 4Q3BA 5EQFA 3HR4A 4IMIB 1EGHA 1LEHA 1H5UA 1MLDA 4FFOA 1R0BA 4XLZA 4DA9A 4ZK2A 3U4IA 3OX1A 2QBYA 2HJWA 2ZJ7A 1QYCA 1XLTA 2CNLA 2MOKA 3F78A 3RUIA 2O5VA 4KB5A 5F2KA 3ZCSA 4Y1RB 5A06A 2XWSA 1BIFA 4MVYA 1UC4B 3BGSA 1Q0TA 2WI8A 3ZK8A 3T7JA 4DCNA 4JXJA 1Y81A 2RGRA 2G4CA 1XRPA 4GVLA 2HEGA 4FOLA 1KEZA 5J58A 4XVRA 4A0FA 1ATIA 3PNMA 5E7QA 1AUPA 3BF7A 4IY1A 5AI4A 1PV4A 2XITA 4FFNA 1QGOA 5DM0A 2D6FA 3WQHA 1R18A 1TVCA 4Z8XA 4DG9A 4B48A 3RVDA 3D6JA 1E2JA 5E0OA 3U3ZA 1W5AA 2HB6A 3BG5A 4Z4IA 2AV6A 3EEYA 3ZPXA 3T5CA 4YRQA 3G6KA 4MVJI 3D2CA 2KB0A 5L9AA 4IDBA 4QOSA 1Z82A 3QEMB 1T8TA 2IP2A 2XZPA 4QUGA 1LV7A 5T4FA 2AJBA 3PU6A 3ZLVA 4EO7A 4FHCA 4DIBA 2Z6UA 3KL2A 1VSVA 1KI9A 4G0YA 5T8KA 2IQ5A 4JOQA 3W8RA 1GL3A 1GTSA 4NJMA 4ZYVA 3EDCA 1XXHA 3MB8A 3IESA 4WWHA 5AVKA 5KUTA 1KFJB 2H1LA 4LOLA 1TU0A 3F9IA 1YZFA 2Q50A 3GGSA 4BLRA 5C5CA 1OHHA 1VB3A 2PH3A 4PZLA 1I2ZA 3BAZA 3G2PA 3UMVA 2GZ1A 5JD4A 3UYKA 1H1DA 3MT0A 5IAGA 5FF9A 5F7OA 3JAMA 1C7RA 1WHTB 1BXGA 2RHHA 2GCNA 4MKRA 5J2TF 2GHQA 3S2EA 3WA7A 1QVWA 1CJVC 3ZWAA 4AZSA 1ZEJA 2XGMA 2VA8A 4KQ9A 4YRFA 3WSTA 3EXIA 3P2EA 1V35A 1TM1E 1ZUD1 4Q9JA 4XIGS 3IMEA 4I50F 2Q0SA 1D6JA 1FX1A 3N7AA 3UCXA 4EZBA 2YY7A 4RVUA 1VIYA 2BM8A 2HA4A 3VPDA 1JB9A 4KN6A 1L5GB 5DBEX 2GCGA 1QV7A 3DMNA 2Q6KA 2VI5A 3UMJA 1TQ8A 3NHRA 1TGVA 3DZFA 1PJTA 4LTNA 3BJMA 5CK5A 3RLFA 1HT3A 1LA2A 2O1WA 2BEVA 3EC2A 4F5ZA 2OHXA 2YUTA 1ZCBA 2CKDA 3DKVA 5GM1A 5H02A 5E0KB 3RJTA 4P2BA 1MP0A 1B0UA 1GV0A 1DS6A 1ZCZA 3FYUA 4OOEA 1NVWQ 2OMEA 3V3KA 1L5LA 4HBGA 5M2QA 1R15A 1SURA 1WF3A 3MGCA 3X1XA 4KYTA 1CP3A 3RROA 3PJFA 1F9AA 3T99A 5DHQA 2ZJ6A 2CE7A 4RIGA 4MUAA 1F51E 1ODCA 2BUCA 2PUVA 1AUQA 4C76A 3PPVA 2R97A 4DVGA 4C0BA 4OJQA 2Z04A 3A7DA 5FIUA 2YDYA 2JBWA 5ICFA 4YHHB 2PUGA 1UPFA 4U6QA 1APBA 3GLVA 5JDCA 4FWTA 4DDWA 5CR9A 1FFBA 2NXWA 3AERB 1RJEA 4AJHA 1U9ZA 6LDHA 2NSYA 4GUDA 1HFKA 4KDCA 3MTJA 4XQ9A 1SM4A 2D0OB 2WNIA 1NIPA 2X6QA 1I1OA 4Z54A 3P7MA 3R8FA 1FP6A 1LPPA 2WIFA 2XWJI 1U2QA 2WMYA 3TLKA 2GM4A 2C5GA 4QEZA 1RACA 3UJCA 2XE6A 3QMVA 1ANKA 3D4BA 2I62A 2QDKA 4BZXA 3ZCUA 2EKBA 2CUKA 4M0PA 5K3BA 5B1EA 3NYRA 4Z3KA 2ZJ1A 1QIJA 3PVCA 5MN6A 1X1QA 1GCUA 1S9HA 2H31A 2NAPA 3G2HA 2ERYA 1KYYA 4YQZA 3RABA 5FA8A 3WGHA 5JAOA 1JA1A 2QMQA 2LDBA 1W59A 2YCLA 2D5LA 4FD2A 1O6FA 4GKJB 5HZMA 1E9RA 1MV5A 2CHFA 4BGEA 2VH5R 2F3UA 2XWPA 2IU3A 4K9SA 1M6HA 1NNI1 1C8VB 2NU7A 4F3NA 2YQZA 5K0LA 4IDDA 4ZI5A 4A23A 1E6KA 1N2GA 2CDAA 2VTKA 1N34B 2UXBB 3E58A 3GD7A 1KZ7B 1UAYA 2JFFA 4RV5A 1T9GS 5CB4F 4CQJA 1GT91 1QS0B 1MX1A 2E4VA 1OREA 1ZGJA 2OQ2A 3KCNA 2X8BA 3SSNA 2WZCA 1D8TA 2PKWA 1UT8A 3WRVA 3EQ6A 5JYDA 5REQB 3FWNA 3I6IA 3O3OB 4RIFA 3ZU6A 3QIAA 3KIPA 4AWBA 2YKGA 4L72A 3ENKA 3O2NA 5J59A 2FRVA 4QLBA 4KE8A 4LYAA 4O4HF 5T41A 3OTIA 4D3XA 4TQUS 4EG0A 3ZD7A 3BB1A 3QG5A 1CZUA 3GP8A 2PMFA 4K05A 4UM9B 3WWEA 3P4XA 1YULA 4YRSA 2ZSKA 2CNWA 3HUEA 4IEFB 4OV6B 4EO4A 9ABPA 5J23A 3U4QB 1CJKC 3B13B 3LXMA 3PB3A 3HG7A 4IS2A 2C5LA 1AHIA 1NRJB 3PQFA 4B76A 2GJ8A 2NUAA 2DUJA 4YQYA 2QVGA 2O5EA 4FKMA 3RSFA 3VUEA 4R2JA 3UENA 3EC1A 3M82A 3G9QA 2FF7A 1JFTA 3AR8A 4G26A 5EIBC 5ENZA 1EJ2A 1EGAA 5HPYB 1OT5A 1U5BA 2DHDA 2FEXA 1GCGA 5C5EA 3GZNB 4XD7A 1YZVA 2OBMA 2W2LA 2PU7A 5KYKA 1GDHA 3RVJA 4LNUB 1PU2A 1NUQA 2X1HA 1RHUA 2OQIA 1TPYA 2EBFX 4PLVA 3DMPA 3H83A 2FAXA 2ZS7A 1K5DA 1E8DA 2XVXA 2NNLD 2PFKA 4KQJA 3L8EA 3S29A 1NU8A 1KVSA 2VDLB 2AMJA 1JEDA 1QGAA 1II9A 2VLIA 2Z9BA 3MWGA 3NW9A 4R1NA 5JXWA 1Q0LA 4KOAA 2NXJA 1JV2B 4IXWA 2IZ7A 2H5LA 1MZPA 2NO7A 1BEZA 3A1FA 3GH1A 3I0ZA 1NMQA 3TIFA 3WOVA 2I33A 2C99A 1QE5A 2XMRA 4KX5A 3W5AA 1DFHA 4FGZA 2F4NA 2GYWA 3AILA 3VKUA 2IDJA 5BV2P 4OLBA 1GRCA 2CLKB 2Q9AA 3EC7A 2HT1A 5G41A 3TBKA 7ADHA 1UK8A 3A1SA 5C0OE 3MAAC 3PXUA 3VKHA 4TV8B 4CG3A 3GFFA 3DFKA 1DC4A 3H2IA 3N2LA 1WMAA 4EA6A 2KJQA 5K6AC 2JLVA 1JH8A 2WAXA 2GZHA 1YZYA 4LC1A 3WLHA 1SHLA 4Q3CA 3QW2A 1NNLA 2OILA 3AI2A 3D3WB 5K0NA 3UFBA 3W6UA 5T7BA 3RREA 4E5YA 1ZH6A 3PUWA 2UXCB 1YUNA 2OCLA 3LOPA 2WYVA 1Q15A 1RWVA 3KHKA 3PK0A 4FP9A 4ZCPA 5JU6A 4L2IB 3RQIA 2VXYA 3WQBA 1Z4QA 3UJPA 2PH7A 3CLHA 4BU0A 5IFLA 2VT7A 5EJIA 3QMWA 2WIDA 4WUVA 3LP5A 1B8VA 2DEUA 1GFSA 1JKJA 2VSNA 2O2SA 3M34A 2WT8A 4DR6B 3VR5H 1GNRA 2N1MA 1IUPA 1HYHA 1L7VC 5IAOA 2A84A 4IKPA 5JARA 3SQDA 5LLDA 4B0OA 1ZAKA 2IPOA 4GX2A 3GJ0A 2GO7A 3CX4A 4WBXC 3MAJA 3C5WP 2XE7A 1XB2A 4RY2A 5JH7A 4KTTE 5ADUS 1T8YA 4PCAA 3ZDRA 1HKUA 4RMIA 3T15A 3JVEA 3TUZC 3NYWA 3AEZA 3PUIA 1E66A 1F4PA 3T3IA 4INJA 2BUBA 1PL7A 1N4AA 3H8VA 4Y8VA 3BH6A 3K0AA 1ZLXA 4LWOA 3DZBA 3HLTA 4OA8A 3U3JA 3LXUX 5IDQA 3CU5A 3D0OA 3EXHB 1FDIA 4J0DA 1GZVA 1HE3A 2CVPA 13PKA 4H0CA 4A10A 4D02A 1IY0A 4UMVA 5AKIA 1EESA 2AW5A 1FRFS 3DFMA 5CXSA 3ZCVA 4C7VA 1G60A 4W8OA 2HEIA 1B00A 1X1BA 1G5FA 3K0FB 1HLGA 5FYDA 3ET5A 4RYDA 4EUEA 4XVHA 4CHGA 1DBQA 1E2UA 1AZSC 1TVKA 3DOCA 3MD9A 1E7MA 4ZDWA 1NVBA 3B3QA 2SNIE 2YJ5A 5GONB 3WK4A 3OPYA 4X44A 3CNQS 4GKAA 3NTQA 2FEMA 1QE3A 2G77B 1WSWA 1TAHA 3OWOA 2ZFUA 4JNKA 8AT1A 3TX6A 3VTZA 2H5IA 2XCSB 2XGOA 3G8DA 3SHOA 5JHHB 4D8WA 2WMOB 1UH5A 4PZ9A 1DG1G 5F23A 1TZJA 4M1KA 5D1NA 1QR2A 3NDRA 1WD7A 2NSHA 1JXMA 3V55A 2DJIA 4Y7DA 4AQDA 4ASUA 1TO2E 1U3FA 3D6MA 1GU7A 1S02A 1QYXA 1II0A 2YXDA 4BZQA 4E7PA 3UMYA 4HWGA 2OM2A 2WE7A 3LCUA 3SSAA 2OYRA 2FZLA 3VISA 4YRKA 5BXYA 5H80A 5ICMA 1XGKA 4I1SA 4RHXA 4JUFA 3C1OA 3VNUA 2WWXA 4AU1A 1Z5OA 4OU4A 2EKDA 1DBIA 1AOXA 1F06A 1EWKA 4PO8A 2R2GA 2C4TA 4MIKA 5ED0A 1L5RA 2Y27A 3PA8A 3GRFA 3S70A 4F1WA 5GV7A 3D0RA 4QXAA 2JC3A 2BGKA 4G5HA 3AFOA 4GVXA 3OZRA 4W9NA 5IKOA 1PNOA 1YQUA 3N53A 3PQDA 4YRTA 2P4UA 3LOQA 1GTVA 3LRPA 5HQ3B 4D9HA 1VDZA 4B8YA 3AF6A 2D4AA 2XOKD 3QFFA 1EXVA 5AT1A 5C52B 2WVGA 3RSQA 2CXHA 4RPKA 3WBKA 3UWKA 4PWYA 1X0VA 3QA3E 3TLMA 4OGFA 1UMBB 3ETGA 1RYYA 3A27A 3LRXA 4KQKA 1KY5A 2IZ0A 2IPXA 4PBRA 3P2KA 3UMFA 2PKRA 4O8CA 1U7OA 3NAMA 4GPTA 3RJMA 4RTOA 1VJGA 3RI3A 3UMGA 4F4IA 5LMZA 1VTKA 3OLWA 1IN1A 2CMGA 1DXHA 4EJSA 2G6TA 1R9GA 5FBHA 4PLTA 1W48A 1F4VA 2O52A 3QWIA 1N32B 1SFRA 3EAQA 4GXTA 2CF6A 2JI8A 5JSQA 3AESA 4PGHA 1FW8A 2FNAA 1B1AA 5IJZA 1F12A 4ZZ1A 1TEZA 4B4WA 5HA5A 5J2TB 4DDKA 1P1KA 4RCYA 3VPBA 4RGVA 2ODAA 1KE1A 3C7KA 4A27A 2QB5A 4FHZA 3K4PA 2QI9F 1ZJ5A 1U28C 3VR6H 4B43A 3S99A 4X7BA 4EKGA 3CURA 3IIMA 1VIMA 4AF6A 3LZCA 1KVQA 1DZIA 3AEUA 2EJBA 5IU6A 2JIZD 1CY0A 4P6VF 5JLAA 1G3QA 4Q3NA 5H81A 4I36A 4LRSB 2BAGA 1UJBA 1EFRA 4KQMA 5ALXA 1NR1A 5IVKA 1N5JA 1VSTA 2G71A 3RYHB 2EHJA 2AK3A 2HWUA 1EFRD 5BOSA 4H1HA 1IN8A 1NI3A 1FNNA 4L5YA 4YCMA 5LP6B 2FDCA 1H8ED 2BMDA 5KU7A 4N76A 2WE8A 4QM6A 1AGPA 4M1WA 1NVMB 1Z9BA 4CM5A 4KIGA 4REQA 2J3JA 3EQ2A 3C6MA 4JOCA 5I7EA 2C5HA 2HJGA 3F5FA 2CEKA 4BMZA 5JATA 4KWHA 3LCVB 1RW4A 1EKXA 4D45A 1ML4A 1A7AA 3IR6A 2QM7A 2JAUA 3H11A 4UVHA 5CPBA 2F3TA 2FHPA 1CSEE 2VTVA 4FYXA 1IY2A 3BWEA 4B9AA 4HYTA 3UCFA 4AULA 1DAPA 1GITA 3GRZA 1LGYA 1DQZA 3EHDA 2NZXA 3JZIA 4E46A 1ID1A 5A5DA 2UYHA 1GVHA 1RCTE 4WGFA 1OUMA 2X8WA 4YO7A 4JEMA 1Y6RA 3BQ9A 2BRUC 4D74A 4WA8A 2DE0X 4NCHA 3O38A 4RF2A 3I9KA 2HBZA 1I36A 3QX3A 2VPPA 3AQIA 3ED1A 3R75A 2YWJA 4BKRA 4DF3A 2DR2A 3PCXA 1JEEA 2F2TA 1HV8A 3AGPA 5MN5A 3L40A 4YJDA 4PZEA 4D9GA 5KWVA 5JUWA 3EXEB 2P2GA 4A0GA 3OEHD 4WY5A 1QIEA 2XF8A 5JYBA 3C45A 2I1LA 2RFLA 2XTNA 4BBZA 4XRRA 5H9VA 5JCXA 5H8WA 2W6OA 4U2KA 3I34X 2PPLA 1UJ6A 4GPZA 2F9MA 3DE2X 2EX4A 4YB8A 2ZKLA 2V1UA 1DNPA 2CYAA 1EPUA 4YPVA 4XVQA 3AJ9A 1YCDA 3LU1A 1SU7A 4OI1A 1K7FB 1SUDA 2P8SA 3N5KA 4OYLA 1G6OA 1PW7A 5CB4A 1DO2A 2HSDA 4KN8A 1I3MA 2I4RA 1WUHS 1JSRA 2WYUA 2ALJA 3Q3CA 4HL6A 1OH7A 4K3VA 2RHTA 5IBRA 1A2BA 1E3QA 2QYTA 3L05A 4PFJA 3TLBA 1RQNA 2Z56A 3T9CA 1QHFA 1NDQA 2HCRA 1KI7A 2EZUA 2AQHA 2M1XA 3DYBA 3KKEA 4EA9A 1IB0A 5LYJF 5LB2A 1CZRA 2AUMA 3IHLA 4F5WA 5DTIA 4RESA 1U1CA 4PINA 2Q3JA 1B73A 1QDLB 4M60A 4LZOA 1BC5A 1JTEA 2ZSDA 5C2JB 2YIDA 1UKZA 2IFTA 3R7NA 3FI9A 4RO0A 3CO0S 1PT5A 3W4JA 3KC2A 1YS1X 1XBTA 2PX2A 4WCFC 1KAGA 2BFAA 4ESEA 1KC3A 2HAEA 3FPGA 3U44A 4L5CA 3GNSA 1C3OB 4Z0NA 2E18A 4G0OA 2WW8A 2KX7A 1JQLB 5ESXA 3OFVA 3QLUC 4UCXA 1KQNA 4CV0A 3L8GA 4DLPA 5KNBA 4RK1A 4AY6A 1GYQA 2YZ7A 1TLFA 1ZOSA 4PIVA 4EYKA 2C0QA 4Z7NB 1RMQA 2NADA 4LXTA 4N5NA 4TROA 3H16A 4ND7A 4C0KA 1PBNA 2I6TA 3BAFA 1CNEA 1VE5A 4HUTA 2XBMA 2WHPB 4H6PA 2FR8A 1F60A 2UV8A 5EG5A 4H7HA 3HCBA 2YV5A 4CMAA 4B4VA 1OJ7A 3KKZA 3F9RA 2PMEA 2PMWB 4F97A 4LBVA 3S6JA 1VBKA 3FZQA 1Z29A 3GH3A 4CZ2A 2IXDA 2NQ8A 1F17A 3KT3A 3G6WA 4UNPA 5KOJA 5L4LA 3K5HA 1GADO 3MD0A 3EJWA 3M5PA 4OM8A 1OBFO 4L0MA 1RAAA 1ZAYA 2HMVA 1H6DA 1QV6A 1P4AA 2R8BA 3U9SA 2NWQA 3LCCA 1GILA 1E61A 3R3JA 5BRNA 3AXTA 1G8FA 3IT1A 5AHXA 4LGMA 1SMKA 3E2IA 1CJTC 4KXNA 2DMRA 1UOQA 1DTWB 1FP4A 1P19A 1X9HA 3OPMA 2EOAA 4PQYA 4NCKA 2I7TA 4YMSA 4CI0B 3EBLA 5CDYA 5HZKA 4OHZA 1HT1E 1WF6A 1XFDA 3TNYA 3ER6A 1W7AA 4ZN6A 1EZZA 2NUTB 1NFRA 2GN6A 3N2YA 1X86B 5DTJA 4ENTA 5BT8A 1YZHA 1PJSA 1LQ2A 2QNRA 2ZJ5A 4MRSA 4KVFA 3ZEIA 3KPUA 4NOKA 2C78A 1ITZA 3KQMA 3QJGA 5FHRA 1MJ5A 4QATA 2NMVA 3K9GA 1LI4A 4LW8A 3NH9A 3EF1A 2AF4C 2I2XB 2JBAB 3P26A 4Y9RA 3GUVA 3PC4A 1NQUA 2B82A 4FC6A 4LYHA 5B58T 4BU1A 4QYMA 1G8HA 1Z2DA 3JQAB 4XCVA 3MJSA 4L2IA 3RG8A 3Q15C 1SUEA 1UM9B 5HKKA 1WP4A 2HCTA 3COPA 2O57A 4EENA 2ST1A 3CR7A 2B9VA 4NU0A 1B6GA 1SOUA 3AIMA 4K6CA 3WNDA 4CL2A 3OBBA 2XKAA 3G0BA 1FUYB 1II8A 4H6XA 4L9SA 2NSDA 3UWMA 4J3NA 3E9MA 3GLHB 4IGIA 2ZT8A 2QYSA 3AKYA 4MW2A 5JC8A 3F49S 2EFYA 3AP1A 2CYCA 4RMJA 1TJNA 4EY4A 3O8QB 4OFBA 2WWHA 1BU8A 1DT5A 3M70A