1GV0A

Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
301
Chain Sequence
MKITVIGAGNVGATTAFRLAEKQLARELVLLDVVEGIPQGKALDMYESGPVGLFDTKVTGSNDYADTANSDIVVITAGLPRKPGMTLSMNAGIVREVTGRIMEHSKNPIIVVVSNPLDIMTHVAWQKSGLPKERVIGMAGVLDSARFRSFIAMELGVSMQDVTACVLGGHGDAMVPVVKYTTVAGIPVADLISAERIAELVERTRTGGAEIVNHLKQGSAFYSPATSVVEMVESIVLDRKRVLTCAVSLDGQYGIDGTFVGVPVKLGKNGVEHIYEIKLDQSDLDLLQKSAKIVDENCKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
publication title Structural Basis for Thermophilic Protein Stability: Structures of Thermophilic and Mesophilic Malate Dehydrogenases
pubmed doi rcsb
source organism Chlorobium tepidum
molecule tags Oxidoreductase
total genus 109
structure length 301
sequence length 305
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gv0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1gv0A02
4GVXA 3NRCA 1PZGA 3MEQA 5DDIP 1ZSVA 3S2IA 3D7LA 3RC1A 3RC2A 3LT1A 5EIOA 3FSRA 2IEDA 5MDHA 2VQ3A 2BD0A 2NTVA 5JY6A 3ROMA 1ADFA 2W90A 2DFVA 4U6SA 1SMKA 1P1IA 5L7WA 3AM4A 1LSOA 4P4LA 3FHLA 2FOIA 4OQZA 1C0LA 4XJTA 4BNJA 1PJLA 2C07A 2X5OA 3DZJA 2ZB4A 1Q7BA 4YAEA 3NGLA 3OHSX 2JCXA 2ZTVA 4N5NA 5IFLA 4RF5A 3GA0A 3FR7A 4IDGA 1VSVA 4BOYA 1IL0A 4OSOA 2WYUA 3RJ5A 4Q9NA 4A0SA 4XEHA 3V2UA 2D2IA 2Y0EA 1NR1A 4OJNA 4TVOA 2FSVA 1I3KA 5EQDA 1E0DA 4HXYA 5BQFA 2Q1SA 3ZWWA 2RHCA 5JMPA 1JAXA 1MFZA 1PR3A 1KVRA 2HMUA 1L7DA 4MIEA 4WUVA 4CM8A 1IE3A 2CDAA 3WGZA 4BNFA 1EVJA 1ZK0A 2EIHA 4MP3A 3D3WA 3ZW9A 4J0EA 4CV2A 3CPSA 4E5MA 1HL3A 1TEHA 3GDOA 2H9IA 3RJ9A 1H6CA 2TMGA 4MPDA 2PFGA 4NJMB 4FJ2A 2VYVA 1KVSA 1PR9A 4FBGA 1CIVA 3ZU2A 4NH4A 4ZN6A 2ZYAA 3GPIA 3ZWVA 3PZBA 3ADOA 2NTNA 2D4AA 1WZEA 3K2BA 4J0FA 4EBFA 3JCZA 5B37A 1LNQA 2NWQA 3QRWA 2WM3A 3RKUA 1UDAA 2Y68A 4CLOA 4IZHA 3MZ0A 3BA1A 1SB9A 2PGDA 3BHJA 5CDSA 3ANLA 1XELA 4XR9A 5JE8A 3I23A 4M89A 3MOIA 5G4KA 1YB4A 3ZWNA 3RAJA 1DLJA 3LLSA 4BO0A 1K0UA 3D4OA 1QYCA 5ER6A 3VOSA 1FMCA 1VJ0A 3D1LA 2HK7A 2B5WA 2R00A 5GMOA 2W2LD 1HRDA 4XGIA 2BGKA 2HUNA 2PV7A 2Y99A 1B2LA 4HP8A 1WZIA 1LLUA 5BNIA 2EP7A 2X86A 5F5NA 5ER9A 5U9CA 3GRKA 4B4VA 3G0OA 3UUWA 4UUMA 4NK5A 2PH3A 4IGEA 4IGFA 3RUIA 1EE2A 2VWQA 1A5ZA 5ES3A 1PL8A 3ZU3A 3PWSA 1W0CA 4FSHA 4MVJD 2ZATA 3DL2A 1GD1O 1YRLA 2W2KB 1IPFA 4JJFA 3WGHA 1N7GA 1N1GA 1LDGA 3WDSA 2VRBA 3WFIA 1X15A 3WQSB 3GVIA 4Z6KA 1ZK1A 4BS9A 1IZ0A 1P74A 2ZK7A 3JYOA 2D8AA 5A4DA 5JW6A 3JQ7B 1ZZEA 3DAFA 3TOZA 5C5IA 2Y1DA 3RUFA 3V5NA 4F6LA 4R1UA 3WNVA 5G0SA 4GX1A 1BRMA 2VRCA 3D3EA 5JXWA 4OH1A 1XQ1A 3C7CB 3EHEA 1T2CA 5TIIA 1RM4A 4GSKA 4AJEA 4CM5A 4HFNA 4L9RA 2PLAA 2AEFA 1SAYA 2X0NA 3U09A 1S6YA 4ID9A 5KNLA 4CMIA 5CHEA 3HDQA 1KY4A 5JNLA 4XIJA 1VLLA 4NHEA 1SOVA 3MWEB 2H1SA 1UXHA 3PFWO 1PZHA 3HQ4O 2NV6A 4QXMA 4IDFA 1YOVA 4B7XA 4DQXA 4OOFA 4R9SA 2X5JO 1G0OA 1UP7A 3K6JA 2YDXA 3TJRA 3ENKA 3DXFA 1EUDA 2Q3EA 3EVTA 4ZHSA 1YE3A 4QFCA 2VZ0A 4D7AA 3OIDA 1I2ZA 2NVBA 5TSDA 1PU2A 2BH9A 4LK3A 1VPDA 2BFOA 2VOEA 1O95A 2JFGA 3JYPA 4E2ZA 4AJ2A 2RH4A 3FCOA 3DDNA 3I6IA 1PZFA 1HTBA 1N9GA 1A9ZA 1Q0QA 2HJRA 1XKQA 4NZ9A 4RZIA 4B79A 3OQ6A 1LTHR 2AE1A 2PNFA 3QVXA 4D44A 2VHVA 5LCXA 4E12A 4AJHA 5I7VA 4GI2A 1WW8A 4QEDA 3INTA 3HFGA 1IUKA 1ENOA 3D4NA 4IXTA 3MJVA 3D64A 2EGGA 5CEEA 3HHPA 4ILKA 1RM0A 1D7OA 4FC7A 3BTVA 3KLMX 4NQZA 3RFVA 1A9YA 5JAQA 1ISFA 1C0PA 1I24A 2YHUA 3G49A 5DBGA 3WGYA 3JQBA 3RU9A 2BFMA 4CMAA 1QYXA 2OZPA 3OJLA 3ZNQA 4AJ1A 4Z9XA 4RJTA 3VVBA 1KERA 3LZ6A 2WSBA 4TZTA 3I3OA 4YQZA 3RCBA 3I9LA 4XB2A 3JQ9A 4KUHA 3AUTA 3H3FA 5EJ2A 1TT5A 4BNLA 4CQMA 3OSUA 2YV1A 4RVDA 1LLQA 1I5RA 3NTRA 1W4ZA 2O7SA 1YQDA 2Q4BA 2AA3A 2RAFA 4D3FA 2CVZA 2GD1O 3P2YA 5DNAA 2AG8A 2VOJA 1C0KA 4CLHA 1M67A 1P33A 3QE3A 3QVWA 3E1KA 4J4BA 4PLWA 3UKOA 3ZNPA 2HMWA 5GZ6A 4XQ9A 3QWAA 3ROPA 4WCFC 4XDZA 2CY0A 4TMFA 4S3MA 2RH8A 2G0TA 3ZNNA 4ZU3A 2AEJA 1VL0A 3ZWCA 4GAEA 2J3KA 1H9BA 4P4NA 5KJCA 3H5NA 3DBHA 4GLLA 4CQLA 3DMTC 5I8WA 1D8AA 1ENYA 4Y8VA 3VH3A 3HJAA 1HDOA 3GLQA 4H16A 2OL4A 5IN4A 3SC6A 5LC1A 3AFNA 4UVEA 1AUPA 2NVUB 3L77A 3V2GA 4PLHA 2CD9A 4E33A 3P2OA 1R4NB 2IRWA 1YL7A 4FB5A 3P7MA 4YXFA 3TZKA 4CLDA 1U7TA 3GC6A 4UEJA 5B4VA 1O9BA 1OC4A 1VKOA 4W9NA 4UUNA 3C85A 1DFIA 4KDFA 3BMNB 3WLFA 4LVCA 3WOHA 1X7HA 1YVEI 1TA4A 5F1KA 5JCXA 3L6EA 4FOSA 2QZZA 4JBGA 4KUEA 2UVDA 3RBXA 5COQA 4C7JA 1U3TA 1GZ4A 3F5SA 4E13A 1AN9A 3UGKA 2ZTUA 2NU7A 3BTUA 3JQCA 1UAGA 3QV1A 4QUKA 4FJ1A 2ZYDA 3GG9A 4R3WA 4NJOA 1DLIA 4CM4A 2QW8A 5DP1A 1WNTA 4IQGA 2FZWA 3UXYA 4A73A 3FPLA 3OA0A 4A27A 1M6HA 5CDUA 3OIGA 4FCCA 1DFHA 1U3UA 3PHGA 3S2FA 3IAHA 4DA9A 5A06A 3ZH2A 2GZ1A 2PZKA 2J5QA 4YTEA 3NTOA 1SEVA 3JQGB 3GY0A 4C4OA 1OOEA 2QRJA 1SC6A 4ZJUA 3HDHA 5KKCA 4IUYA 3F4BA 3KOUA 4PZCA 1E7WA 1IB6A 3ZWOA 5ILOA 3BXXA 4FC6A 4XQCA 1C1XB 1T4BA 4BNZA 2VZ9A 3RBZA 3AOEC 4A10A 1BXGB 3QLJA 3VTFA 1EZ4A 1V3VA 4BNNA 1EBUA 3MCVA 4J49A 4A03A 4AJOA 1PEDA 4Z0HO 2Y05A 3AFMA 1JKFA 3O03A 1A4UA 1ZXBA 4MJLA 3SJ7A 4R5MA 4IDBA 4BO4A 3RWBA 3RBVA 3KYDA 4QT0A 3TDKA 3WBFA 3GZNB 3KYCB 1E77A 3BYZA 4Q3EA 4F46A 4EZBA 3DQPA 2O50A 3ZV5A 1XYGA 1CWUA 3TSCA 3C3XA 4RDIA 3NDIA 3PJGA 1NPDA 1EQUA 5A3JA 4HV4A 1A27A 1XWFA 1NQOA 4D0SA 2X22A 3COSA 4NU6A 3T7EA 5T5QA 4CPDA 5DOZA 3FD8A 5T64A 5A9RA 1XCBA 4YQYA 3RFTA 5C7LO 4NBWA 1N7HA 2NU9A 4ALJA 1P0FA 3G79A 4O63O 2P4HX 1N2SA 2LDXA 2PR2A 4PLYA 2P9EA 3WYBA 3G1TA 3O8QA 3DWFA 5C7IO 1ZIDA 1UXGA 3F5QA 1SO8A 4LGVA 1EFLA 4MKXA 3BIOA 5U1PA 1GQQA 1LRKA 2Z1NA 2R6JA 5C37A 3E03A 2WD8A 1XHLA 3JSAA 5IN5A 3PYXA 2VNSA 2O2SA 3VHRA 1DFGA 1MXFA 1Q7GA 3PHIA 4JP3A 9LDTA 3KO8A 4HY3A 3I1JA 4RPJA 1ZO8A 5HTOA 1RYDA 2Q49A 3GHHA 1GDHA 3IDSA 2GSDA 3OJOA 1EEHA 1PS8A 4MP8A 5F1OA 4UVHA 2VT2A 3KV3O 4Z0PA 4IQ0A 1U3WA 2XF8A 1EVIA 4FJ0A 3VTZA 2GRAA 1JKIA 1U4SA 4PN3A 4UEKA 5I7EA 3DB2A 1QYVA 1ISJA 4D42A 4WECA 4WNCA 1IOLA 4WOKA 1BVUA 3ONDA 2Y1GA 4YJGB 4J1TA 3MTGA 3WLEA 4PLPA 1YBAA 3DTTA 4CM1A 1SPXA 1OC2A 3R3JA 1NYTA 2FPGA 2WE8A 2ZJ0A 4N5LA 1KVUA 4J9VA 1ISMA 1NVMB 4KQXA 4AG3A 3DHYA 5EL0A 3ZU4A 1X1TA 4RPKA 5DCWA 3BMCA 3GMSA 4E2XA 5BSEA 1I8TA 1YWGO 3AUAA 3CINA 3U9LA 1E5LA 4I9UA 2Q50A 3KYBA 3DZFA 3PLRA 3QWBA 3WWZA 4PLGA 3GH3A 3NKLA 5C7OO 1H6DA 4XYEA 1GADO 4N7RA 4GH5A 1HSOA 1EUZA 1B14A 2C2XA 5A9SA 4NBUA 3PIIA 1ZK3A 4MO2A 3DOCA 3SLGA 1XSEA 1E92A 1AGNA 5BSGA 4XYLA 3AI2A 4FFNA 2Y1OA 4BNIA 2C5EA 2Z1MA 5FI3A 1UH5A 1ID1A 3L6DA 4P38A 1D1TA 4J6FA 4TRNA 5HBRA 9LDBA 3I4CA 1DIRA 4F45A 2H6EA 1DIGA 3LT4A 3V1UA 2EERA 4NMHA 4DQUA 1X0XA 3GRPA 2VWHA 3NJ4A 1ONOA 4IIVA 1QRRA 2HK8A 1GV0A 2X8LA 3NAQA 4PG6A 2C59A 4ZQEA 1ZMOA 4IXWA 2RBEA 2X1HA 4XGKA 3ICCA 4XGNA 1N92A 1I32A 1LDBA 2WD7B 1H94A 1E3SA 3FR8A 2VWGA 5F21A 3KM0A 1KEWA 4YA6A 3UCFA 2G17A 1ZEJA 4YYZA 1VKNA 1N5DA 1YO6A 3ZWBA 4I5GA 2EV9A 1VJ1A 2PA3A 3PEFA 4NI5A 3GN1A 4ZQBA 5HS6A 1LX6A 2DAPA 5C3MA 2YYYA 4CUKA 8ADHA 1P0CA 1HE3A 4MIYA 3CKYA 4Z9FA 2C29D 3K92A 2W8ZA 1LSJA 1NTOA 3PXXA 4O59O 2QHXA 1C1DA 4NDNE 1WDMA 4WLUA 5EESA 3ZN2A 1O94A 2DBVO 5G0VA 3WXBA 3E9QA 1ZW1A 3F47A 4BGUA 1ARZA 2AW5A 4DPKA 1DSSG 2P2SA 5KVSA 1R0SA 3JQ8B 4ZRNA 3C1OA 2X0RA 2EKLA 2Y66A 2FR0A 3S55A 3B6ZA 3JQAB 4OYRA 1A7AA 1BW9A 3WX0A 3TFOA 5ICMA 4GX5A 5IDQA 5G0UA 1TI7A 4J1SA 4GMGA 2EXXA 1A71A 2P5UA 4JBHA 1T2EA 3PQDA 4WCDA 5L40A 1ONPA 4KWHA 4PLZA 1PL7A 2C5AA 4UVDA 3OQ1A 1QORA 4RLHA 4PLCA 3L07A 4MP6A 2P4QA 3LDHA 3O38A 3AOGA 3PDJA 4OKNA 3RI3A 3W4IA 3WJAA 2XXJA 3KSZO 5T8KC 4OHUA 2Q1WA 1K6XA 3AWDA 3RUHA 3W6UA 3D0OA 1WP4A 4OOEA 2OBNA 3KHUA 3CSDA 1TT7A 3Q11A 3ABIA 3GQVA 2NTJA 4M1QA 2I3GA 1LLDA 1U7HA 4IM7A 4XYBA 3G1UA 3L4BA 2NADA 1U1IA 3GNQA 5IXSA 4IINA 3VH2A 3KZVA 1KEPA 4R41A 1V9LA 2D1YA 2Y1CA 1K3TA 3GPDG 3JQEA 1PQWA 5TT1A 5IZ4A 2YFHA 4MVJF 4O0LA 1E3IA 3CH6A 2GUGA 1T2FA 4UAGA 2Y0CA 1EDOA 1PX0A 5KKAA 4BIIA 1RJWA 2CVQA 2OORA 3GF4A 1SOWA 2BI8A 4JBIA 3FF4A 4RF2A 1ZK4A 2WWRA 4CM8B 1ORRA 4CM7A 1GUZA 3IP1A 1V35A 2D59A 3D3WB 1Z82A 2YHIA 1JQBA 4J3FA 4MKRA 1KEUA 5L7YA 1BMDA 5HRUA 3F3SA 2PKRA 5IDWA 4PLVA 5JFOA 3E48A 4WE3A 3H9JA 4OGWA 1Y5RA 2C2YA 1V8BA 5G0WA 3NYWA 1ZNQO 3AI1A 1GL3A 2EEZA 3ZV4A 2Y1EA 1MA0A 4JQCA 1DHRA 5DULA 3AU9A 3PGXA 2VTEA 3ZV6A 2P91A 1F06A 5L95A 1OMOA 2DM6A 4IBOA 1D1SA 1PQUA 1NQAO 1QKIA 1XR3A 1UAYA 2NSDA 4EITA 3NV9A 4CLOB 3OFSA 1QMGA 4I9HA 3JYNA 1VRWA 2YDYA 1ZH8A 1E5QA 2NQTA 1FDWA 2OXIA 5JBIA 1X0VA 4BB6A 1FJHA 2WYVA 5G4KB 2QIOA 3PTZA 1J4AA 1HT0A 2J5RA 1X7DA 4BO5A 1HZJA 1QXSA 3FNHA 4CM9A 3JD0A 4E2WA 3ZNOA 3L6OO 3DR3A 2GCGA 5DBIA 4W7IA 2GLXA 4KUGA 2GN4A 1Z75A 2HMVA 3E82A 2DBRA 2G76A 3NJ8A 1D4FA 5I8ZA 1YB1A 4YJFA 4J9UE 4XX0A 4DIBA 1HDYA 4PG5A 4O5OA 2VZ8A 1OZAA 2OP0A 4PFJA 4B4WA 4WASA 2VYND 3CMMA 3INRA 5G2OA 5KVQA 2I66A 1K6IA 3QVOA 5K6AC 2V6BA 5AOVA 1ZSYA 3Q1LA 2Q4EA 1J0XO 3D4PA 3GNSA 1E3LA 2DC1A 3X2FA 1F0YA 1OI7A 4K26A 4RCVA 3M2PA 1KC3A 3W4KA 4EW6A 3AUSA 5A02A 3H8VA 3DAGA 5A1TA 3KEOA 1KIFA 3UHAA 4HFRA 4E30A 4EUEA 1T1SA 2PK3A 3G17A 3I9JA 3ZWAA 1XLTA 3MJSA 3QSGA 1NWHA 3H6KA 4J2OA 4F3YA 4Q3BA 3H65A 1GUFA 3WJ7A 4IJKA 1YQXA 2E6UX 4ZQHA 4I8XA 4CMIB 4M55A 1ML3A 5AYVA 4WCFA 1PGOA 4FN4A 3UF0A 4KMSA 2B36A 3GDFA 1YOVB 2BMAA 2VHXA 4L8VA 2HK9A 2AEMA 2PD4A 3WYEA 5CG1A 3DMTA 3ROKA 2O23A 4JIGA 4NNJA 3VZSA 2OFPA 1LBEA 1XA0A 2JFHA 4FFLA 3QW2A 3C7DB 5AXBA 3GZ4A 4D79A 3VH4A 3EDMA 2YV3A 3QVSA 4LN1A 4CMKA 5JY1A 4RQUA 4BMNA 2JAPA 3VPGA 1BSVA 4E21A 4R1SA 3C7AA 4CMEC 1R66A 1GFSA 1I30A 1N9GB 2H5LA 3H5RA 4YPOA 3H2SA 2QZ9A 1DJQA 1EUCA 2Q1UA 3PIDA 1F12A 1B3RA 4RO0A 3TQHA 1HDXA 1YS4A 1GR0A 2IDZA 4P22A 5T57A 3EAGA 4U0KA 1DHTA 4PVCA 4GKBA 4CLXA 1NR7A 1YJQA 5BR7A 4B3JA 2DT5A 3RU7A 4YJHA 4YJDA 3A06A 3GAFA 1V0JA 2Y93A 1TB4A 4Y9DA 1GPDG 4XR4A 1F17A 2OMEA 3U4DA 5I7FA 2AQIA 3K8ZA 4AJPA 4BL5A 3VZQA 2NNLD 3OQBA 1E1MA 1P1KA 1NPTO 4BHTA 5CG2A 1NWCA 5GY7A 3OP4A 1KS9A 3IOYA 4EYEA 2A94A 2PTGA 4Z3DA 2I76A 4GVLA 3PLNA 5JDIC 1VJTA 3AJRA 2GO1A 3H9GA 3O26A 4DRYA 3O9ZA 4JP2A 2V6FA 1CQJA 3PP8A 3TL2A 3JQ6A 4LSWA 3TZHA 1HLPA 3AI3A 1B8VA 1TT5B 2FRDA 3AY6A 3OICA 3WSVA 4BO8A 1ULSA 5THQA 1WVGA 4CQMB 5I7SA 4CUJA 2C54A 3VPSA 3D5TA 3OF2A 2AHRA 1DC3A 1G6KA 1H5QA 2YFQA 1PJ2A 3QWFA 3UOGA 3VPHA 4B3HA 4BNUA 3SVTA 3AOEA 5DOVA 3VPFA 3IS3A 4ND1A 1SZJG 1EBFA 1ZK2A 2O2YA 2BKAA 1HETA 4CM6A 1DXYA 2Y67A 3MOGA 3F46A 1GY8A 4BO3A 4B8WA 3RUEA 1QSGA 2DTEA 4HFMA 3ZHZA 2CZCA 1U8XX 4HBGA 3DBRB 3TPCA 4MVJH 3DBHB 3RD5A 2O3QA 1J49A 4CQLB 3L9XA 3ORFA 4WOJA 4BNWA 2Q1TA 4QX6A 1LQUA 5ENDA 3CEAA 1LDEA 4J16A 1I0ZA 2E49A 3ANMA 5DCYA 4DWVA 1Q2XA 3CUKA 4CMHA 4KQWA 2IE0A 3I52A 3WFJA 3VC7A 2GN6A 3QA9A 4BNHA 4GBJA 4GLOA 5I9NA 4LVUA 1QLHA 2PGLA 3S8MA 4BUCA 4MDHA 4BO7A 4CLRA 2C7GA 5B4TA 1PGPA 2J6IA 3ANNA 3PZRA 4PIVA 2IXAA 3ZWYA 1I33A 3KTDA 3PHLA 3QJ5A 5CEJA 4ZRMA 4IDCA 4CM4B 4O6VA 2DKNA 3H9QA 5DN9A 1NVTA 4ALKA 3VDRA 1T24A 4ZQFA 3C1TA 3A4VA 2OUIA 1GEEA 1DB3A 4JK3A 4KDEA 5F1PA 5MGBA 4FPXA 3H2ZA 1GPJA 5B1YA 4JGBA 1NQ5A 1EFKA 3RIHA 4DBZA 2EW8A 4JXKA 2SCUA 1A72A 1MFPA 3LSYA 3DBVO 3NTQA 1U4OA 1XDWA 1ZKMA 4GGPA 3L9WA 4A26A 4BNVA 1PS0A 4G65A 2X5KO 1ZEMA 4CMGA 4DXHA 3HE3A 1XU7A 3NDJA 3HADA 3RQSA 4E32A 5JCJD 3DZKA 3PQEA 1DC6A 2VNAA 2OBYA 3IKTA 1Y8QA 1WDLA 5BSHA 3BTOA 1K2WA 4L4RA 3DHEA 4DMLA 1NFFA 1I3LA 1V6AA 5TJ9A 3OJ0A 1ISGA 1Y8RA 4RF4A 4R1NA 2HRZA 1UZLA 3C24A 3I9NA 1AHHA 2ZCVA 5TC4A 5TF4A 3D5QA 3GUCA 5L4SA 3HUDA 4DTIA 3LQFA 4XIYA 1WWKA 3AY3A 1R12A 2NU8A 3ZWMA 4Z0TA 1GAEO 4E5NA 1CYDA 1U3VA 4IZIA 3WICA 4DUPA 4AJKA 4INAA 4RVGA 4XB1A 1O5IA 3WGQA 3TZCA 1KVQA 4YRBA 3RKRA 1U2DA 1EMDA 5JO0A 4J4HA 4FIZA 2X0IA 5LDGA 4O1MA 1DO8A 2EW2A 4FS3A 4H3VA 1R0LA 3WS7A 1PJCA 1HE2A 3EZLA 1NHGA 2DFDA 3Q2IA 4YT5A 4W82A 2J3HA 2DPHA 4BKQA 3JQAD 5CDYA 5A5FA 2DTXA 4RVHA 1YXMA 2HO5A 3ZWXA 4B4OA 3B1JA 1RPNA 3O8QB 4ZD6A 5A5EA 1YDWA 2WE7A 2FMUA 3P5SA 2NUAA 5CPBA 1UJMA 5K9ZA 1AE1A 2UV8A 4FDAA 3F9IA 3BHIA 2P5YA 2Y1FA 4XQEA 1MX3A 3KRTA 2YZ7A 3OJFA 1VL6A 4D0RA 3Q3CA 1DJNA 4E3ZA 3M6IA 3FRJA 2PWZA 1O8CA 3K5PA 4XCVA 3N74A 3ON5A 4N18A 4JJIA 1H6AA 2O3JA 4R68A 3QIVA 4FFRA 2HSDA 4R51A 5H82A 1NXQA 2IZ1A 4EDFA 4J1QA 4BNKA 4C7KA 4PVDA 1H9AA 5F5LA 3SJUA 2YY7A 3GNTA 4YT2A 3SBOA 3I9OA 3DZIA 3AM5A 3EMKA 5KTKA 2ZQZA 3ZHXA 4TZKA 3ASVA 5TLSA 1IZ9A 4NR0A 4DPLA 2W4QA 3K31A 3DZGA 2JJYA 4H7PA 4FR5A 4JJGA 4IMPA 1DC4A 2VHWA 2NACA 1HDZA 1EK5A 3GG2A 3ASUA 3OETA 3BMCB 2PGJA 4L4SA 3PFFA 4B7CA 1PGQA 1V3TA 1Y5MA 2Q46A 2O7QA 2ZTLA 4GKVA 3GFGA 5JPIA 4G5HA 1ADBA 1FDSA 4L4XA 1NP3A 1DIAA 3U4IA 3QP9A 4II3A 1BGVA 4NPCA 3NEPX 4BNYA 4BNMA 1G0NA 3LC1O 4Q3NA 1YQGA 4FFOA 1LSUA 3B20A 5A9SB 1E3WA 2G1UA 4HX5A 2B35A 3ZWPA 3FNEA 1GTMA 3RC7A 3GMDA 3DBLA 2W2LA 3B1KA 1GV1A 2RHRA 1OAAA 3TOXA 4LRTB 3CZRA 3ZI0A 3KBOA 4RVSA 4IMRA 1E1KA 4OXNA 4ALNA 3F1LA 3VZPA 2ZCUA 1LDYA 3W8DA 5G0TA 4AJ4A 3U5TA 3NGXA 4I08A 4OKIA 2B4QA 4OXYA 2O4CA 2X4GA 3NDRA 1I2CA 3KSDO 4FGWA 2LDBA 4UREA 1E3JA 4XRRA 1PZEA 4J90A 1QYWA 3S2GA 4MVJA 2FZEA 4IDEA 3RUAA 1KVTA 3MWDB 5IXYA 1GCOA 3PJDA 4ALIA 1U2GA 4RQTA 4PLTA 5THKA 4GX2A 2GR9A 1JVBA 1MB4A 2EWMA 3HN7A 3JTMA 1M66A 3W8EA 4BO2A 1ULUA 5KVVA 3JD1A 1W6UA 3OM9A 4M54A 4ND5A 2PH5A 4IS2A 1JWBB 2P68A 4RORA 4M87A 4WLVA 3VAZA 3V2HA 2GYYA 3PDUA 2AQHA 3UCXA 3DOOA 1ZJZA 4R01A 4M86A 2HDHA 1ADGA 4ESOA 4D45A 5TT0A 5HM8A 4LSMA 4RPHA 1F8FA 1DRVA 3LLVA 1HDCA 4OO3A 2IZ0A 4R4JA 1C1DB 2VHZA 3OIFA 1BG6A 1JWAB 2YUTA 4PG7A 3FWZA 5KJEA 4A2CA 1PJTA 3AK4A 4L74A 3E5MA 3EK2A 3E5RA 1MXHA 3JD2A 3IMFA 2E4AA 1LUAA 2IEBA 3E9NA 3LVFO 4YT4A 1Z7BA 3WQQA 4CV1A 3DHNA 5CAEA 2P9GA 4ZICA 3PHHA 1JU9A 5KJ1A 4A7PA 4CM3A 5FI5A 4I5EA 1LQTA 3IQDB 5IZCC 3LU1A 2VHYA 4TRMA 4NU5A 4F6CA 4AJNA 4Y6PA 1HYHA 4BKRA 5L4LA 2ET6A 2QYTA 1XGKA 3UVEA 1MP0A 5BSFA 3QWHA 3NUGA 4Z3KA 4CODB 1PWXA 3C8MA 5JLAA 1FXSA 4CLEA 3JQFC 2F1KA 1EK6A 1PGJA 2YJZA 4TKMA 4JN6B 1UZNA 2B69A 2EKPA 4AFNA 1LC0A 4CV0A 1R16A 3HNPA 4CUZA 2B83A 1KOLA 1MUUA 3IJPA 4TRJA 3K30A 2HLPA 3PVZA 5EQFA 2AQ8A 2QG4A 3QVTA 4D46A 1F14A 2X6TA 5K6AA 4UUOA 4XYMA 3OECA 2DBQA 3EZYA 3MTJA 4NBRA 4QSMA 1CDOA 3CZMA 3ITDA 4QO8A 2HMTA 3R3SA 3UFXA 1MG5A 4YDRA 3MJEA 2V6GA 2WJPA 3T4EA 4UVGA 1WPQA 1I36A 4BV8A 4U0JA 3ZHYA 1LRJA 2EJVA 2I3AA 3U4CA 2C7VA 3JYLA 1YB5A 3H9EO 3WQRA 2YHIB 4BGEA 2O3TA 3FTNA 4RL6A 3ZDFA 3I6QA 4IPTA 1O6ZA 3DC2A 4ND3A 4DLBA 3CXRA 4E5PA 3AW9A 1PTJA 1PWZA 2HJSA 4Y6RA 4EJMA 2CDBA 1LRLA 1SEPA 3DMYA 3IUSA 3PHJA 3JD3A 1PGNA 5BT9A 3ZCXA 4DC0A 1P77A 1X7GA 4CQMD 3HG7A 1C3VA 4BGVA 4BQRA 1WXDA 4DVJA 4PZEA 8LDHA 4OM8A 1TLTA 4U5QA 5ITWA 2GZ3A 3IKVA 3ULKA 4Q3DA 4BGIA 4CMCA 1T25A 5A9TA 1W73A 3T7CA 1BWSA 4XZ3A 2HMSA 5AVOA 4XRGA 3OEYA 3HSKA 2GPTA 4RPGA 5G4LA 1GYRA 3CE6A 4CV3A 4CMEA 2X7HA 3HWRA 3LYLA 5KIAA 5JDCC 1UP4A 3VH1A 1PS9A 2C20A 4TQGA 3W1VA 4DLLA 5L53A 4I9NA 1FDTA 1LC3A 2D0IA 2GN9A 4OMUA 1HEUA 2D3TA 1P31A 4E2YA 2AMFA 2BLLA 3B1FA 4R3NA 1HDRA 4YJFB 2FR1A 4Y67A 3A9WA 1P45A 3BMQA 3F4LA 1C14A 1R4MA 3RVDA 1GEGA 5H83A 4ZGWA 2J3JA 2QQ5A 3CIFA 1VI2A 2CF6A 1GCUA 1ISIA 4RVUA 5DCUA 1E6WA 1YBMA 1T4DA 5KWEA 3V1YA 2GZ2A 5JDIA 4YACA 2CSUA 2UUOA 4Z9YA 1JKJA 4ZQGA 1I3MA 4IJUA 2OOSA 2DVMA 4U7WA 3RSHA 5B12A 1HXHA 1O89A 5A03A 1R6DA 3GN2A 3OA2A 3SXPA 1W8DA 2WMDA 3IIEA 3E8XA 2B0JA 5JO9A 2AQKA 1X1EA 1DOHA 1Q7CA 2D5CA 3UICA 2EF1A 1B8PA 1QP8A 3BTSA 4E6PA 1LA2A 1AHIA 2JKVA 4WK6A 2BELA 1DC5A 3Q9UA 3Q6IA 2I5PO 1N8KA 2CF5A 4WCFB 1NBOA 4DC1A 5ILGA 3BMOA 4OQYA 3BZUA 3OMLA 4TRRA 3HB4X 3L4SO 5CEFA 4IDAA 2DPGA 4YAGA 2JCVA 4DREA 1ZXLA 3TRIA 3LF1A 4K6FA 3INGA 3I9KA 1J6UA 1VL8A 5FYDA 5DF1A 4AVYA 1QYDA 4ALLA 4TROA 5A04A 1GYPA 3TN7A 3VDQA 4QQRA 4UULA 3OBBA 1TVEA 5GZ1A 5JS6A 1IY8A 4YT8A 2FWMX 1X13A 3GK3A 1L1FA 1U5CA 1DPGA 3EYWA 4MIOA 3H4VA 5CDTA 1Z74A 2YW9A 3H3JA 3ZGYA 3P19A 1U5AA 5COAA 3VPXA 2CFCA 4M8SA 3WGTA 2VCYA 3WIEA 5ITVA 1QR6A 5JAMA 1Z73A 1H6BA 3GGGA 4YJHB 4R5HA 1NM5A 4JNKA 4XYGA 4OL9A 4EJ6A 4L75A 1BXZA 3U4HA 2GF2A 3IL2A 4XD2A 1E3EA 1UDCA 3WMWA 3SC4A 1DIBA 4UEOA 3AU8A 3KETA 1I3NA 4CR8A 2V7PA 1P9LA 2VWPA 2ZYGA 4EEXA 1U9JA 1JTVA 4RDHA 2PY6A 3ROQA 3WGGA 3GEMA 1BTOA 5FF9A 4HFJA 5AXAA 1M75A 4XQGA 1K89A 2JL1A 1UDBA 4Q39A 4FFPA 1Z7EA 5A3VA 3M1LA 4S1VA 3DONA 2PZMA 1GYQA 4MVJI 4RV9A 5KJ6A 3JYQA 3C1AA 1L7EA 4PZDA 3FI9A 4KWIA 2QYSA 1PIWA 3WR5A 3HDJA 3STHA 1UP6A 2A92A 2EGHA 5TQVA 5J23A 1JVSA 1WLYA 2D5AA 2G5CA 3UH1A 2XPCA 3LT2A 2JHGA 1UXIA 3L4BC 4L76A 2EKQA 5JYDA 3PYLA 3WWYA 3ZHBA 1OBFO 1VC2A 4YEDA 4ALMA 4QFDA 4FW8A 4NJMA 4ONEA 3FWNA 1MGOA 1Q0LA 2X58A 5CP8A 1MC5A 3FBGA 4CL8A 4J91A 3RFXA 4BB5A 4D43A 5EMHA 4A5OA 1LXCA 2O3RA 4MINA 2X9GA 2OO5A 2Q2WA 4BMVA 2B37A 4E4YA 5JC8A 2JD0A 1JLLA 3K2EA 1CRWG 1M2WA 3LF2A 4EUHA 4MVJP 3SLKA 4N54A 1YH3A 1D3AA 3GGPA 1R0KA 3U3XA 3TZ6A 3LK7A 3EVNA 4CLRB 1PSDA 3FNFA 2VUSA 1XEAA 2Q2VA 1HSZA 1U28A 2QX7A 2BFPA 1YKFA 3I83A 4HWKA 1NAHA 4QTZA 5DT9A 2QRLA 3WIDA 4NG5A 2W98A 2XOXA 4FD3A 3GHYA 4GQAA 2QRKA 4UVIA 1GQ2A 3TFQA 3WBBA 1B0AA 4YWJA 4YAJA 3ZZNA 1BXKA 2DBZA 4AJLA 2UYYA 1ISHA 1LLCA 4ZVVA 4KP7A 2EP5A 5I9MA 4W6ZA 1JN0A 1YONA 1ZBQA 3U49A 3DO5A 2POQX 5L51A 4CR6A 4MVJG 1M6WA 1ZJYA 1E6UA 1B16A 3RUDA 3S1LA 4DGSA 1NQTA 4W4TA 4BNXA 5IAAA 1N1EA 2FP4A 3VVCA 4ND4A 5HWSA 1Y8QB 3ETEA 3LC2O 4GL4A 4IJVA 2W2KA 4P4GA 1XIVA 1E7QA 1Y9AA 2DU8A 3DZHA 5T67A 3VKVA 4E5YA 1Y81A 2FHSA 1KETA 1R15A 1Y8RB 4BKOA 2BHLA 1LU9A 4XJSA 2GGSA 3E18A 2VUUA 4NIMA 3NT5A 3H9UA 1XG5A 4RF3A 4U6QA 3JQ7A 1NAIA 1Y7TA 4WLOA 1UXKA 3ADPA 3GOHA 2IXBA 4NK4A 2B5VA 4PGFA 4BKPA 4LCJA 2H63A 4AICA 4DYVA 1XU9A 3PQFA 4MVJE 3OH8A 1JDJA 3R0IA 4HKTA 5A05A 5KOIA 4J7CA 3ENNA 1B3BA 2JHFA 5ADHA 4LISA 4GMFA 2JFFA 2GNAA 1A4IA 2NLOA 2WEKA 4QO7A 3NT2A 1E7RA 3R6DA 4BNTA 1KC1A 1DEHA 3K96A 2GDZA 2CMDA 3I9MA 2NQ8A 3ZW8A 2JD2A 3ETDA 1WAMA 1GUYA 2XAAA 1UUFA 1I2BA 1RM3A 4ROSA 1K5HA 1HDGO 4K9DA 2A9FA 4ZA2A 3H7AA 1ZCJA 4K1LA 4NBTA 4YB8A 2UAGA 5CDGA 1OFGA 1B26A 1AXGA 1IULA 1CEQA 1Q0HA 2X9NA 4I5DA 3KXDA 3S2EA 1ADCA 3GFBA 1J5PA 4IIUA 4EUFA 4II2A 4NFHA 1GZ3A 2E37A 5JC1A 2FR8A 3KVOA 2EHDA 4YRDA 1E1LA 2CUKA 3DFZA 1YL5A 4WLEA 2R00C 3QY9A 1DDOA 1CQIA 2I67A 2OP1A 3GVXA 2VN8A 5DP2A 1G1AA 5COBA 2A35A 3DBRA 3QQPA 4ND2A 4DBVO 1GZ6A 1IHXA 2ZJ1A 2NVWA 3PYMA 3UW3A 5GZ3A 3AY7A 5TJHA 1DAPA 1NFQA 4WLNA 1HWYA 1P1JA 2VUTA 2O3UA 1FDUA 4K28A 4R54A 4AJJA 6LDHA 2BF7A 3KYDB 1Y1PA 1HE5A 4I1IA 1E1NA 5JAZA 3DTYA 4BKUA 4PLFA 3FNGA 2GN8A 1NVGA 1HYGA 2O3SA 2A4KA 1EVYA 3FPCA 4W99A 1H2BA 4BQPA 2E48A 5JSFA 3RROA 1DIHA 4OSPA 4R1TA 1TXGA 1UR5A 2XXBA 2HKIA 4B7UA 3FTPA 1KYQA 3CTMA 3WSWA 3GT0A 5EERA 4K6CA 2O48X 2DQ4A 1NFRA 5EN4A 3A14A 5DBFA 4KZPA 2YV2A 4QECA 3GEDA 2BGMA 4RGBA 5TGDA 2GASA 3Q0EA 4Q3CA 4CMJA 2E82A 2EJWA 4YAIA 4JROA 3W8FA 1BDMA 1LDMA 2X9VA 2AXQA 2BI7A 2ZTMA 1WMAA 3DFUA 4FGSA 4GPD1 4J1NA 5IZCA 4OXKA 1FDVA 3T4XA 2P9CA 3LC7O 2J3IA 1JAYA 2DUUA 3DZBA 1DAOA 3DOJA 2FPPA 1LI4A 3FN4A 4Y6SA 2I99A 3RASA 1F8GA 4BO9A 1QV7A 1E3WB 1NNUA 1P3DA 4D41A 3OJEA 1P44A 5FEUA 4YCAA 3DBLB 4RZHA 4G2NA 4KTVE 2Q99A 5TNXA 3IP3A 3E9MA 4WJZA 3IC5A 3JQFA 4IY1A 1CJCA 4IJWA 5U4QA 1Y6JA 5EINA 2VT3A 4R16A 2FN7A 2NVUA 1E7MA 1PJBA 2IODA 3NT4A 4IDDA 4PG4A 4YAKA 3KB6A 4BMSA 4DPMA 1R4NA 3WGIA 1RKXA 1ONNA 5AXDA 1PJ4A 2FY8A 4CM9D 4N5MA 4LMRA 2VYNA 3RUCA 1SCUA 3M1AA 4XWYA 3GEGA 1DRUA 3HN2A 2BGLA 3ONEA 4XKJA 4EJ0A 4BNGA 2ZB3A 3TNLA 3UCEA 3BMNA 4L73A 3QWIA 1HZZA 1RWBA 5I9LA 1E7SA 1EVZA 3FBTA 4KOAA 3DEYX 5JAIA 3ITKA 1E6EA 4CJXA 3DAPA 4JCOA 5IDXA 4B8ZA 1YGYA 2HRBA 3L0DA 2YQ5A 3UAGA 1UXJA 2IYOA 4GWKA 4MVJM 5K0ZA 4HNGA 2AG5A 1T2DA 2VYVD 1SNYA 4XDYA 5L7TA 3JQBC 2BFAA 4DIFA 2JCYA 4E5KA 1PJSA 5HA5A 5KJFA 4PRKA 1H2HA 3Q9NA 4U8GA 4URFA 1C0IA 2WYWA 3JQGA 3JQ9C 5T8KA 3UN1A 4DYDA 3WB9A 4FOOA 4DIOA 1LJ8A 2VTDA 2JAHA 4CR7A 3M2TA 1R37A 3AM3A 2Z5LA 5L4NA 1C1XA 1A7KA 4LW8A 5TS3A 3HZZA 3WGOA 4D3DA 2HCTA 1BXGA 4RPLA 4MKZA 1MV8A 2C0CA 5IG2A 2UDPA 1LEHA 4OAQA 1M76A 4FQ8A 4L0QA 2ZKLA 1I10A 3EUWA 3VZRA 1QV6A 1V3UA 4B3IA 5JDCA 4DMMA 3GR6A 4RVFA 1YJ8A 3JD4A 4HNHA 7ADHA 3B70A 3ST7A 1PJQA 3GVHA 5BNFA 3GUYA 2J5KA 3PPIA 1P1HA 3GZNA 3KYCA 1UZMA 3WG9A 3PJEA 4LRSB 2WDZA 3BHMA 5ICSA 1IPEA 1RM5A 5H81A 5TRTA 1JW9B 3WYCA 3KSUA 4LMPA 1JA9A 5B4UA 4WKGA 4J4TA 1Y9EA 4W9NC 4YR9A 3K73O 2RCYA 5F3RA 4NBVA 3WTCA 1NX6A 2FPIA 1BDBA 3PRJA 5CFZA 3K9QO 1DRWA 1E7YA 1SB8A 1ZVMA 2ZB7A 4UUPA 2VRCD 1FK8A 4DQVA 2PKQP 1T2AA 4WNIA 1DBVO 3HB5X 1BW9B 3MJTA 2R2GA 2HQ1A 4NFYA 4B4UA 3U0BA 2X0JA 4GSLA 3O4RA 4BVAA 4CMBA 4CL3A 5KCZA 3PWKA 3V8BA 1K6JA 1AXEA 4XA8A 2EG9A 2WTBA 2PKQO 1ENZA 1PL6A 2ZQYA 1WDKA 3OEWA 7MDHA 2OHXA 3HDYA 1ENPA 2IZZA 3WTBA 3R1IA 1PQPA 4BO1A 2BRUA 5HS4A 4DL9A 1EDZA 2PZLA 1H93A 1HYEA 1LDNA 1ZFNA 4YVFA 3TWOA 5IJZA 3GGOA 3KLPX 3QHAA 4JX8A 4WEQA 1QLJA 2Y0DA 3IUPA 5TX7A 3N58A 4TVBA 4WEOA 3GDGA 1NPYA 1ZMTA 1H0KA 4IS3A 5JYEA 3EW7A 3E6AA 1S7CA 2C82A 2JD1A 2V6MA 1XQ6A 5IF3A 4YBZA 5DZSA 2PZJA 1NHWA 3ONFA 1KEVA 4YRAA 3ICPA 4G81A 1RYEA 4KTTE 1EE9A 4YJGA 2DUWA 3W4JA 3SEFA 5L45A 5L9AA 3F6YA 1GU7A 4BV9A 2CVOA 1GQYA 3G3EA 4E31A 4PG8A 1Z6ZA 2IYPA 1HE4A 3GAZA 2O4UX 3GVCA 3SX2A 2RIRA 1B7GO 1HF3A 1KBZA 4AJIA 1Q1NA 3PI7A 2V65A 3GVPA 4LCEA 4NFSA 1ZUD1 4J43A 5IDYA 1MG0A 3MJCA 2ZB8A 3PJFA 4GX0A 3W6ZA 3PGJA 3KUXA 3A28A 1Z45A 3MJ4A 1IYZA 5LDHA 5CPFA 2OGUA 3BMQB 1IHYA 1QG6A 1R4MB 4D3SA 5AQ1A 3EGOA 4X54A 1T26A 3BAZA 3WMXA 2ILTA 4HUJA 5T6BA 2DTDA 1X14A 4TWRA 3HFSA 1B15A 3IJRA 1KY5A 1BVRA 2YQ4A 3TZQA 3JQDA 3Q2KA 3V1TC 3VKUA 2PD3A 3PK0A 1SBYA 4TKLA 2B4TO 1NASA 3JV7A 3NX4A 1YBVA 3RC9A 3I4FA 1BHSA 1EQ2A 4P8RA 4M49A 3ZV3A 2DLDA 5AXCA 3A1NA 2NM0A 4J7UA 4E0BA 4DLAA 1HLDA 3I5MA 3N7UA 2F00A 1I01A 4RLSA 1LSSA 5JCJA 4MOWA 4IQ8A 2Z95A 1MC4A 1P1RA 4HADA 1VSUA 4WPGA 2AE2A 2X23A 2ZIZA 4J7XA 5FWNA 2WD7A 4GWGA 6ADHA 4R9RA 1MLDA 1YDEA 2NU6A 1WMBA 4GGOA 4J2HA 3BMOB 3EY4A 3U62A 4Y98A 4H15A 3KEQA 2FSSA 2I65A 1CF2O 4ITUA 4R69A 1FF9A 2Q45A 5L3ZA 3TL3A 3EC7A 4Q3AA 5JMWA 1T1RA 2J8ZA 1PJ3A 2HAEA 4PCVA 4W7HA 3F1KA 5FFFA 4EEZA 3TF5A 1YL6A 2G82A 2PD6A 2GERA 3ZU5A 2I6TA 1HKUA 4FFMA 4TSKA 3AUUA 1U8FO 1CETA 4WGGA 4EGFA 4EI2A 4AL4A 3PWZA 1O0SA 2B4RO 4BO6A 5EPOA 1CERA 1B8UA 3LT0A 3X2EA 3ETGA 4PRLA 3JQ8A 1VM6A 5BNTA 3H5AA 2CNBA 2CDCA 1VE9A 5ENVA 4JLWA 5KVCA 3JQAA 2UUPA 3WNQA 2TMDA 2HU2A 2I9PA 1P1FA 3CMCO 1ZSNA 4WLFA 4OIMA 4I5FA 2Q2QA
chains in the Genus database with same CATH superfamily
3IALA 1KBOA 1PZGA 2PS0A 2ZKIA 1V4BA 3HMKA 3KCQA 3NRCA 3SJZA 5EKUA 1QE3A 4CTMA 3RC2A 1GPWB 3S2ZA 4AWAA 5MDHA 4L02A 4UW9A 4HXGA 5KWSA 3G7NA 1TTQB 2VQ3A 4MITA 1GN8A 3SM9A 2DFVA 5GADl 2ZSEA 5D1HA 3WKBA 3FHTA 1Z6XA 7GPBA 3H16A 5EMKA 3V1MA 2RK4A 3GGJA 4XAQA 2O8DB 4D4GA 2IPXA 1A82A 3WJ1A 3FHLA 4BNJA 5BWCA 4UPVA 3K1YA 4WFIA 1ZUWA 3DZJA 4X9XA 4LXGA 3NGLA 5T4FA 3OHSX 2GCOA 2R79A 4A8HA 4JWTA 4AY4A 4P34A 3A4TA 1J1ZA 1EGVB 2ZVQX 2B2NA 2GJ9A 3MLAA 3NIDB 3GA0A 3SMQA 1JL3A 1QCDA 4M1MA 5EJIA 3SS8A 2HSJA 1SELA 1SU8A 1K7EB 1Y3AA 3HBMA 2WYUA 5AM0A 1ZAKA 2OPBA 1QO9A 3VU9A 1G19A 1Q0ZA 4EPVA 5IKPA 4G0UA 1NR1A 2FSVA 1I3KA 4G85A 5BQFA 1E0DA 2VLIA 3A0UA 4HXYA 1ND6A 1X7YA 3INYA 5ALIA 1S2LA 2Q1SA 3NALA 4C0JA 1JU3A 2CGEA 3ABSB 5BQ5A 5MF6A 1JAXA 4Z4HA 3A11A 1G4HA 5LZ8A 2CE2X 4MVWA 3B9BA 3FSJX 3G8BA 1JGTA 1ZK0A 4PU0A 4K6HA 3NVMB 2R9VA 1C9MA 3D8SA 4OXIA 1HL3A 1TEHA 5DI9A 3GDOA 2H9IA 1DCKA 4MAFA 3RJ9A 3BJEA 3BA6A 4DSAA 1QH8B 2TMGA 4MPDA 4M0MA 4CDNA 4E11A 1MX9A 4FW9A 2MSWA 2WWIA 2JGAA 3AEUA 2ZUFA 2FWNA 3ESAA 4GNKA 3R3YA 4JB3A 2Q6IA 4L28A 1RJ9B 4K9PA 5JYBA 3ADOA 3JASB 4HTFB 1GZVA 1JLLB 4KVAA 3V55A 2HRQA 4J0FA 1Q7TA 3H1GA 5JTUA 2E7ZA 1AQUA 1P60A 1Y1TA 5A0TA 3GRUA 2E5WA 1LNQA 3G5MA 4WXHA 3W2GA 4IMJB 4I3HA 5IJ0B 3AJAA 3LOQA 3WO1A 1Q1EA 2ATXA 1FB5A 1FTSA 1RAAA 2WMNB 2AJBA 2VSNA 3I04M 2PLWA 3MZ0A 1V8OA 1L5MA 2FPRA 2IK8A 2PGDA 2XUAA 3AUXA 2EZUA 3GFFA 3SFTA 5CDSA 4I4TF 2C7OA 4KV7A 3WLJA 5JE8A 1R88A 3I23A 1E99A 1Y80A 2V7TA 2YFYA 1P4SA 3MOIA 3SIXA 2HA2A 5G4KA 1YB4A 1C81A 2VTBA 1PTJC 1USVA 2JFBA 2ISSD 3ANXA 3FZNA 2DB3A 3PTAA 1K0UA 1QS0B 1WDWB 2VPXA 3D4OA 3KAKA 4MW2A 4Y2QA 3RYIA 1DTSA 2JKYA 3V8VA 1IVNA 2QP4A 1DUSA 1EWVA 1PR1A 2HK7A 4DV3B 3ZE9A 2DHRA 2BGKA 1DOAA 2PV7A 5E7JA 3GXBA 4BN4A 3K9NA 2CZGA 2YWXA 3K70D 5BNIA 1QJ4A 3F9RA 3WRYC 1IXRC 3K9GA 4U2CA 5KDLA 1RLJA 1CUUA 2AKAB 3UUWA 2XUHA 5IVHA 2IDKA 1J7JA 4UUMA 1UJ6A 2FFAA 5ICGA 1ZD5A 4NK5A 2G9NA 4IGFA 2TECE 5JAUA 4Y1RA 4KFSA 4MVJD 2ZATA 4N6GA 1FC0A 2HNBA 3ZZ0A 3L1HA 4QLOA 3R7WB 4KFTA 3MHTA 1EGMB 2QMOA 1QVAA 2BM9A 2MOKA 2XOKA 1N1GA 3C7TA 4RHFA 2VRBA 5IDYA 3WFIA 4F5DA 1FDOA 3HY4A 4XM2A 3MFYA 3OHMA 5HKBA 1UFKA 4LRWA 2ZK7A 1UMKA 2QTWB 5DNEA 1XD9A 4HWGA 3WGKA 3G0CA 3SF0A 1Y6FA 4CG2A 4JC4A 1W85A 4N48A 2WA1A 5C5IA 2HLNA 1CUGA 3MTAA 5E3HA 4ISBA 2YV4A 3WNVA 2YXBA 3C6YA 4F6LA 2ZJ2A 5FWDA 1BRMA 1M2GA 3JVEA 3D3EA 1AU9A 1KFJB 1VLHA 3ASZA 4V39A 4RK5A 4RD1A 4OH1A 2YY5A 4GRIA 4X44A 1DXHA 1NI4A 2QM0A 3NBAA 1WVMA 1RRVA 4AJEA 1B73A 1QC5B 5KAMA 4COKA 3FTFA 3NAMA 5I4CA 4IKEA 2QG9A 5LOVA 1VGRA 1MABB 4EOGA 2H7VA 2VSYA 1FA9A 2WUGA 1NLYA 4ID9A 4KBGA 4R0VA 3SYLA 5CHEA 5KNLA 2BKVA 1GHTA 1ZQ9A 5EEHA 5FUVA 4K05A 5HZMA 2IP4A 1UXHA 3PFWO 3V4RA 2B4KA 2DEUA 3VX3A 2PUDA 3ACBA 4DIKA 4JUAA 1MH9A 4EG3A 1UMBB 2JZOA 3KKEA 2E4YA 4PTLA 1QIKA 3ENKA 4PPQA 2DX7A 4QTYA 1YE3A 3RK0A 1M2HA 3IODA 4X95A 4QFCA 2EX4A 2JGEA 4BCCA 1O8BA 4LK3A 1VPDA 2I6XA 2BFOA 4N7JA 3UOWA 2X14A 2JFGA 4QFBA 5C9ZA 5F2NA 1XZGA 1KYIA 1GJRA 2HPZA 2RH4A 2VDWB 4P3OA 4AJ2A 4AP6A 3UKJA 5J4HA 5FOWA 2JJMA 1XKQA 3DMDA 3PHCA 2B8NA 4FSXA 5E1DA 5L3QB 4TV9B 3WL4A 4D4LA 2MMGA 3C14C 1OVMA 2F1OA 2AE1A 2PNFA 3QVXA 1W93A 1WCIB 5CH8A 1XZIA 4V0LA 1T5HX 4YPFA 3VR5D 4AJHA 2XB6A 4X41A 3CX8A 3IUJA 4GI2A 4U39A 2GCPA 4FZJA 1NUUA 1ZD8A 1MB2A 2H7CA 1OPXA 2PL5A 4I8DA 1H1LB 2BM8A 16PKA 4WZZA 1ENOA 2BE7A 4IXTA 3WMFA 3MXOA 3OTGA 3T8YA 3B1VA 3U3MA 3TR6A 3RSLA 3GJZA 4X24A 4DR6B 5AVXA 4AKIA 2ERXA 2Y76A 1A9YA 1TIBA 3KTFA 4F3KA 1R8SA 5IVPA 3QOFA 5IH3A 3QNMA 1I24A 1FYXA 3QVGA 4GM4A 2NPFA 1DZIA 2H4WA 1LPBB 2EIXA 2P2ZA 4PYRA 5DBGA 5DM1A 1W5EA 4PBRA 4AJ1A 4QWMA 2CDNA 1JWLA 5NLLA 3G0IA 3LZ6A 4MB0A 4Q66C 4TZTA 2QRUA 5EHNA 3SVZA 2C00A 4FCTA 2B25A 4K3UA 2QMQA 4BBAA 1IHOA 5BR1A 3RF7A 3ZGOA 3ADBA 4TV8F 5DYNA 4F4IA 4RVDA 1D0SA 1LLQA 3QV2A 3IIJA 4E46A 1FX1A 1T13A 1YQDA 3AB7A 4QAQA 3MINA 1E66A 1PWEA 1FDRA 4BZZA 2GD1O 4IXMA 1XLTC 4N39A 1K3UB 2AG8A 2FPXA 1OXBB 4DANA 3LQYA 2VOJA 5I5GA 4BJ1A 4RTMA 4J3NA 1P33A 3KD2A 4V1CA 4JUIA 4PLWA 5DM4A 3M3DA 1VIYA 4HVCA 1AQYA 2C99A 3OJWA 4W5JA 5A6SB 5EHGA 1X39A 4WCFC 2XVZA 2CY0A 1D07A 1L8LA 1Y1QA 2OZKA 2RH8A 4IWYA 3W8RA 1QFZA 3ZNNA 4DXDA 5BWOA 3WLTA 2QUHA 4ZO4A 1Q0SA 3TR0A 3W7BA 2LCQA 3D3QA 1TA0A 2TRSB 4HMOA 4LQLA 3DBHA 1RFGE 2XMRA 3M6MD 3JRWA 4CQLA 2CV0A 5I48A 4Z4IA 1Q3TA 2CBGA 3KQQA 1PNRA 5IAJA 1WUTA 1Q22A 2JEZA 4NRDA 1HDOA 3GLQA 1KDZA 1QFSA 4MVCA 3CONA 4UVEA 4KQHA 4MW9A 5LWQA 2W5UA 4PLHA 4NCAA 5FQNA 4AY3A 4E33A 2IRWA 3VR5H 1CJTC 3EX7C 1KJJA 1SUSA 1I7NA 1W1WA 4OAOA 4KO2S 3D6MA 2CMHA 3IX7A 5FOQA 2XIJA 5EE1A 4WTOA 2OV8A 3QYPA 2ENUA 2PTHA 2Z30A 5JD6A 5HFNA 2J3LA 5EIAA 1VKOA 3DP9A 1RKBA 4YONB 1DFIA 4FWIB 3WLFA 1E0SA 1YVEI 2G1JA 4MUGA 3BT7A 2BUCA 1DINA 5JCXA 2ATEA 4MRPA 5SZHB 4MDEA 4NEQA 2YNMC 3PXCX 4UXJA 5COQA 4C7JA 2YOHA 4Y2VA 4K9OA 1R8QA 4IIJA 4GVPA 1HBJA 4RK0A 4LVOA 4YMSA 1XAJA 5I5EA 3OQMA 3GG9A 1DC7A 4V0RA 1L4MA 3SF8A 1DLIA 2D1SA 2QD5A 3ZDAA 1BU5A 4QOIA 4H27A 5BMOA 4Z8YA 3U1VA 1T1EA 4LDAA 3ZI7A 1V4VA 3BPSA 4ZHQB 1LKZA 4X65B 4IICA 4MQFB 5HGXA 3KQOA 4EECA 2CLHB 1VECA 1W36B 3QVMA 3KHKA 3SQXA 1DFHA 1SIBE 2ZAYA 3VJRA 5A06A 3PRHA 4F5ZA 3ZYZA 1W5FA 3TSOA 5JMOA 3ZH2A 2GZ1A 2G7ZA 1ZM2A 5TGZA 4JENA 1SG9A 4IH1A 3FWKA 3NTOA 1P61B 1SEVA 2XWSA 3JQGB 3QLVC 2ZUWA 1S3FA 3HWWA 4GE3A 1OOEA 3VJKA 2QRJA 3HDHA 1DPFA 1JFFB 1GLVA 4KKXB 3KOUA 3L8DA 4DOMA 1E7WA 5AW0A 3BXXA 5DXFA 1CE8A 3DVRX 4HX9A 4HQNA 3K71B 3RVOA 3AEQB 3RBZA 3OJXA 3IQGX 2OTCA 2ZIGA 2BGTA 3F6SA 1EB9A 4N0PA 3VTFA 3RHTA 3DT9A 5DXJA 2R25B 1W29A 3L0BA 1B6GA 3MCVA 4FX2A 3TL6A 1P2TA 1AK2A 3JZDA 3MVEA 4K46A 3ZDRA 3AFMA 3HDTA 3STUA 5AJXA 1ITZA 5K2MA 4NXMB 2BBSA 2IE8A 3ZZTA 2C7QA 4KFUA 4RJIA 1F2VA 4U5XA 3R0ZA 5ETJA 1ZXBA 4MLZA 4MJLA 4DMRA 2H1RA 2Z83A 4BQQA 5F9HA 2O19A 5DM0A 4W5NA 3C15C 2A1IA 2H4XA 1IU9A 2VJBA 4HH0A 4B46A 3KYDA 4QT0A 2ZSUA 3DFIA 3TQTA 3K2QA 1TCVA 3ADDA 3OCWA 4KH1A 3B6IA 1MR3F 3FH0A 1TZMA 3BYZA 2XB9A 4JC0A 4Q3EA 2D00A 3W78A 4F46A 1EIWA 1CWUA 3TSCA 3EDYA 2NT3A 5BYKA 1OFUX 1ZW6A 4TX1A 5CT8A 1FTNA 2BMEA 3PIRA 3QOWA 4MWGA 5JSYA 4HV4A 1XWFA 2GN1A 4Z4GA 1NQOA 1D2GA 4RTQA 3ONVA 3AVWA 4GOXA 4MPJA 2XMQA 2G5GX 3PGVA 1J0EA 1BKYA 1T9KA 3AI7A 4NU6A 5EAIA 2M98A 1DEAA 4CPDA 5I47A 5DLYA 5BWNA 5EA2A 3I6BA 3DTVB 3T1NA 4LF6B 2XUDA 2O8FB 1XJCA 1N7HA 1NUPA 3REGA 3WYBA 1SU6A 2GEBA 3BIXA 1K6EA 1P0QA 5DBOA 1Q15A 5ARBA 2B78A 1SO8A 3PT9A 4LGVA 5CCBA 1RRMA 1FJXA 3G88A 4MKXA 4N8EA 5TB5A 1GQQA 3RJZA 1CZNA 2Z1NA 4K9NA 4C5AA 5IVKA 3E03A 1KJWA 1NW4A 2XCIA 4OU5A 2WD8A 2VK8A 4W1SA 3AXTA 3F7TA 1UJ5A 1U0NA 3ZVRA 3EXHC 4EVSA 3OUZA 5AWFC 1Q7GA 2RGRA 1X80A 2DRIA 2VSXA 3I1JA 3KO8A 1Y9JA 3H0CA 3BXPA 2OZVA 5A2GA 5HTOA 3S68A 3L8CA 4YGXB 3LCJA 2IV7A 5BUQA 3A37A 3QPUA 3CVVA 2F64A 5CB6A 1JNXX 1LQ2A 4HEA6 1EEHA 1DOZA 2JATA 3PX2A 2HWUA 5F1OA 5HILA 2VT2A 1RWKA 3KZMA 2OV6A 1Z26A 4IQ0A 2XF8A 3VTZA 2DY0A 2GRAA 4BTEA 3L4KA 4A15A 1XTQA 1BEUB 1U8EA 3L6UA 4HTAA 2WLTA 4Q47A 3KT8A 4XM0A 2HQRA 1YFLA 4MR9A 1ZRSA 5CGZA 3D59A 3ONDA 2DPXA 2GA8A 2CLOB 2GETA 4I99A 4NH0A 1OHHA 3MTGA 4ZT4A 4PLPA 4R3UC 2J33A 3R3JA 1OC2A 4MICA 1GAQA 2PGNA 4EMUA 5EXEA 4UTZA 5F7ZA 4J9VA 3ABZA 2R6R1 3IPLA 2NPIA 5J1TB 3ZU4A 3X3HA 1JHPA 3CY6A 3IJEB 1X1TA 4DLWA 1DEXA 5DCWA 4ZCTA 1U8YA 1I8TA 3LQQA 3UAYA 3ER9A 3H8JA 3IPRA 1TIKA 5H3HA 4ZFNA 5E6RA 3VTAA 1JEAA 4AROA 3MRXA 1TYAE 3LHKA 2YASA 1P8AA 3LE8A 2WHPA 5GJBA 1Z06A 3UW1A 3WWZA 4P4SB 2I3BA 4PLGA 5DM2A 2AH5A 1QG0A 3E2IA 3O2JA 2W22A 3BWEA 3H1TA 4JDPA 1HSOA 1TGVA 2PZAA 2FWAA 1V71A 2PJZA 3PENA 4FK8A 3ZVMA 2I2XB 2HA4A 5C4MA 3O21A 2P7HA 4MO2A 4UNPA 3SLGA 4AF6A 5JJBA 3O8NA 1UM9B 4R8MA 1TLFA 1FY2A 3RADC 1I1OA 3B7WA 2A59A 3MBKA 1XOIA 2C5EA 4KU4A 4BLUA 2EQBA 4BBJA 1G5FA 1UH5A 3PKZA 3RYHA 2X7JA 2F9FA 3PNOA 4Y2XA 4Q7EA 1I0LA 221PA 4TRNA 5HBRA 1L7AA 4AMBA 3QXCA 5KYXA 2BFBA 5CFNA 3I4CA 1DIRA 2H6EA 1DIGA 3A05A 3DH0A 3TB4A 4N65A 3V1UA 2OB2A 3QELB 3EBLA 2HWXA 1KPGA 2XGMA 3JTEA 1DMRA 2WICA 3NJ4A 3QXXA 4Q3OA 5LQRA 1Y5IA 1ONOA 7YASA 3CC8A 5CBPA 3WJ2A 4PG6A 2JJQA 4DB4A 4ZQEA 1URPA 4OFWA 2X1HA 5LXTF 4DDWA 2X0FA 1E1RD 3ICCA 3KE8A 4KQFA 1DAMA 3KHSA 3L0PA 4X1IA 3OTOB 3KT6A 1A7UA 4IQFA 4WNYA 1QGOA 2JHCA 2HEGA 1C1YA 4FDMA 4G1MB 4HAXA 4OMCA 3FR8A 3LTEA 4PSUA 2C3UA 2H92A 6Q21A 1KEWA 1T34A 2W0SA 4LG1A 1S9DA 4YA6A 1ZEJA 3F73A 1QGUA 3TLBA 4K5QA 1YO6A 1EFRD 3LIIA 3ZWBA 1YZQA 4Q3LA 1NNEA 1JR2A 1IN4A 5EYPB 1TVKA 2EV9A 5K8CA 1V5IA 2MSKA 2Q4RA 2IHKA 3I4LA 4R2MA 4NI5A 2F55A 1KARA 1YQ9A 2O8VA 4M7RA 5C3MA 4TUYA 1D9ZA 4BE9A 3GFSA 2H1LA 5EMLA 1R10A 1MEEA 2EBWA 2G72A 4YJ3A 1FP7A 2V8BA 4PWYA 4MRSA 5EWLA 3SOPA 1H2FA 2QHXA 1C1DA 1CJUC 4NDNE 3RFFA 5J4LA 4CEJB 1UK6A 2PL9A 1UT6A 2DBVO 2RGUA 4X61A 1ZW1A 2WF5A 1QHHB 2JIZA 3X1ZA 2AW5A 4HX2A 1VBMA 3K1AB 2P2SA 2WZQA 3DAOA 3LO5A 4S24A 1R0SA 2Q9UA 3U4QB 4ZRNA 3P4UA 1CVRA 1MPTA 1NVUQ 1BYIA 3O4HA 1XI2A 3MMXA 4D26A 1R6VA 4EO9A 3ADCA 3B1ZA 3RV4A 4GXNA 3JQAB 4OYRA 3EGWA 1NN1A 3T1TA 3S4YA 4DMUB 3TFOA 5EIWA 1BN6A 5DGHA 2ACKA 4PHGA 5ALLA 2PX5A 5A62A 4J1SA 2IY8A 1QTIA 2ARKA 1NBME 3QEAZ 3ZHCA 5KNDD 4JBHA 5AJHA 1DO2A 2FEKA 4WCDA 3B7PA 2J0QA 1L1QA 2NPOA 1ONPA 2C9DA 2OBLA 4M8IA 4UVDA 1PL7A 2ZREA 2RB4A 4Q05A 1LVGA 1WF3A 4MP6A 4BFYA 1E8NA 2DETA 2UXDB 2PLRA 3JWHA 1PJRA 4D99A 5FUXA 3DLBA 4G0XA 5HJ5A 4AS2A 4OHUA 2Q1WA 4EZIA 3UJ8A 2PJDA 3DW1X 3WRYA 4IHJB 2I2FA 2XUKA 1BVHA 1OPRA 3T99A 1CUIA 3TO5A 2BHTA 3DGFC 3ROTA 2V3VA 4EX7A 3TD9A 4FMDF 3V8QA 1J9ZA 4J75A 2F67A 3AESA 4BP3A 3PHBE 5IJAA 2QJWA 2CLCX 2ZZMA 2YZKA 4IM7A 4XYBA 4B2LA 3L4BA 3GNQA 1Y0BA 2QORA 2FX3A 3OKFA 4UM7A 4ENRA 5LR6A 2PUBA 4IINA 3U7IA 4L3OA 3NORA 1JQDA 1NKTA 2ZUUA 4MGYR 3NGMA 5DI3B 3THWB 3CA8A 4RMIA 1K88A 4AIRA 3BILA 2V9ZA 4HDAA 2Y27A 4QT4A 5TT1A 4Z4QA 4IIBA 3EMBA 4ABYA 5IZ4A 3U31A 4O0LA 2IHZA 1T2FA 1BXRA 1ZC4A 2C4VA 5HCNA 3S3TA 4HB4A 2ANCA 3L06A 3TFWA 4EHAA 2JBHA 4JUFA 3HB0A 4BIIA 2CVQA 2H2WA 2ZANA 3GF4A 6REQA 3F7NA 1SOWA 3AUFA 1YRBA 3G2PA 1R5NA 1YR2A 2HBYA 4IVNA 4ARZB 5HQ3A 2WWRA 2YWDA 1YRQA 3FB1A 3REFA 2QX4A 2QB5A 3UAXA 1Q0UA 1U9IC 3IP1A 4FEGA 1SHLA 1E4OA 4UFPA 1OBVA 3H42B 3PDIA 1JQBA 4GBGA 2IY7A 1FMTA 4LYDA 1VP3A 2NXJA 1BMDA 2PAAA 3JATA 4W9RA 4Q0MA 1EK1A 4MR7B 1Y5RA 2C2YA 3PUXA 4XDGA 1CEXA 1CKEA 5CB4B 1GL3A 2PRZA 5IYZB 2HHHB 4YK7A 2BHRA 2Y1EA 1MA0A 3DDOA 4JLSA 1DHRA 3JPYA 4G86A 3AU9A 1I80A 2OCAA 1YK1A 1ZIPA 1VIVA 2VTEA 2P91A 4GXTA 1JIKA 1OKKD 1TKAA 1N2CA 1OMOA 2DM6A 2HRCA 4IBOA 4UD2A 4XFDA 3R5XA 1QKIA 1ZUNB 2G5TA 1D03A 5FTKA 1XR3A 2XRYA 3HPRA 1L4UA 1Q7EA 1TYCA 3HP7A 3UMRA 2VRWA 3I2GA 3Q7SA 4YI3A 4UNRA 1ZOLA 1KKUA 1MHPA 1NW7A 3M3HA 1QMGA 5EJ8A 4EY8A 3QHPA 1AKWA 1OA0A 2YDYA 5FIUA 1MRSA 1CLEA 1E5QA 2ZROA 3FB4A 2DR2A 2CMGA 4TZ6A 1X0VA 4M6WA 1ACJA 3OZ7A 1EXWA 5REQB 3RSQA 3BGSA 1J4AA 1HT0A 1WB6A 1X7DA 1QXSA 1L7QA 3FNHA 4WWHA 1L4GA 2GNOA 3WLAA 1SD2A 3A26A 1ZY2A 5CM2Z 4QUAA 3Q12A 3KOZA 5B1HA 1DQYA 2GCGA 2A14A 2VQDA 2CCJA 1DADA 2YC4C 4A0RA 3AF6A 2B99A 2JLVA 3I09A 2GLXA 4F84A 4PX3A 1PG0A 4JC8A 2HMVA 1QRDA 3T7DA 3C97A 2G76A 3PQ3A 3RVQA 5E0OA 1L8OA 1JDVA 3B52X 4FSDA 5K05A 3ZIDA 4NS4A 2H85A 1G5HA 5EGSA 2E89A 2UYGA 1GQSA 3DQZA 4J9UE 5FX2A 3PB3A 5GINE 1WSWA 1RP7A 1M2KA 4ARIA 4AZVA 1D6SA 2RBGA 2VHUA 4RAOA 4GLJA 4G67A 1BGWA 2XCTB 1L5YA 2KE5A 2RG1A 5KVQA 3VISA 1GCGA 1ULTA 1G3IA 3QVOA 4TUYF 2R8EA 2LCIA 1ODLA 4RA9A 1RLOA 4RKWA 5WRFA 1O97C 3AJ9A 3OY2A 4JLKA 4L27A 3QU7A 4JBNA 4FONA 5CLLA 2J46A 4PTYA 3R8XA 4OI0A 1R0WA 4EY4A 1YCFA 4UXIA 1WMEA 5CK5A 2R60A 3M2PA 5I4KA 1KC3A 4C7OB 4BMYA 2OVFA 5A02A 4QQNA 3UHAA 2ZYTX 4EUEA 1RIFA 4CBVA 4EB6B 1OLXB 1UKEA 1XLTA 2VF5X 3TSZA 1M2OB 3C5CA 4JLDA 4UATA 3T0IA 4OK3A 4UD6A 4P98A 1TMKA 1EFUA 2IU4A 3FFWA 3WHKA 1K9SA 4F3YA 4FLEA 4F71A 4KI0A 5AD1A 1R6TA 3F5DA 4RIIA 2E6UX 4ZOLA 4JLPA 4ZQIA 4DAEA 3UPTA 4M55A 4FXPA 3SHFA 4YMUA 5AYVA 4WCFA 1PGOA 4FN4A 3P32A 3UF0A 1P91A 5BN5B 1H22A 4ARVA 4AF8A 1KI2A 3LHSA 1D0IA 5GGYA 1GT91 2B36A 3SGLA 4C3UA 1YOVB 1MC1A 1NYLA 2LBPA 5GTDA 3FZEA 4S1WA 3WYEA 1DEOA 4HH3C 4GMDA 5CG1A 2FJPA 1O03A 3D1VA 5AVJA 4IIGA 4NNJA 4D57A 1O9GA 2OFPA 1XA0A 2JFHA 3Q9SA 2VBGA 5AXBA 3C7DB 4AUEA 4PSDA 5EKTA 3R3XA 3MW8A 4TMXA 4V24A 5EZ6B 5B7PA 4RUKA 4JLUA 4IJ5A 3VH4A 1N77A 1BX0A 4NONA 4CMKA 2C4TA 1ATZA 2JAPA 3EGXA 1XHEA 5LN1A 1BA3A 3NXSA 4LQCA 5IT0A 2YIDA 1QWOA 2A1UA 2FI1A 3G13A 1GFSA 3D0KA 4OQLA 4WZBE 3H5RA 2ZRQA 4L5BA 2GEFA 1FRZA 5ALFA 1W34A 1KI3A 3OHPA 4KIUA 1WZUA 3PNKA 2JGDB 3G2MA 1ZU4A 5K3CA 1QO7A 1GR0A 1S8AA 1ZGGA 2IDZA 2NT4A 3LM8A 4U0KA 3UAVA 1G7RA 4OL0A 3KR2A 4OA5A 1W581 3KEFA 5ICFA 4B4KA 2W6ID 4X64B 1IZ7A 2FSIA 3ZWKA 4KHZA 2YNMA 4NX2A 4YJDA 3GLTA 4N5IX 3TPZA 3GAFA 4WW0A 1IN8A 4FCVA 1OB5A 4Y9DA 3EVCA 4XR4A 4DFDA 1GAWA 4NYMR 4AJPA 1X1SA 4OHVA 3VZQA 4H1TA 2H57A 4BHTA 2I6FA 2OHHA 1TZ2A 2V6JA 3PC7A 5GY7A 4EYEA 1A8HA 1BHO1 5DO9A 2WG1A 3EZGA 4Z3DA 2QRVA 1H23A 2R84A 2Z2IA 3TYXA 5LLSA 4EA6A 3ZTWA 3VNRA 4ZGBA 4ZXPA 1G20E 3PLNA 4M2LA 5H9WA 2VP2A 2VP5A 4XWTA 5JJCA 2GO1A 1EXDA 3FDJA 2WJYA 1IBSA 1D5WA 1J90A 3O26A 3O9ZA 4JP2A 3BFPA 5FFMA 3PP8A 1O77A 3QLVA 1HLPA 4XTRA 5FR1A 4CQMB 4BO8A 5JO0A 4LHYA 3W06A 1WVGA 4CUJA 2YS7A 1SQ5A 1U2RA 2DR3A 2C54A 4RY8A 3FCSB 3KKOA 1V1MB 3OF2A 2XKAA 4UBKA 1XF9A 2CV1A 2YFQA 3PDHA 5C5DA 3TCKA 3VPHA 2AI2A 1V96A 4GMHA 4UXHA 1TADA 1ODCA 3OZXA 2W71A 2NQ2C 2HIGA 2V59A 1L3BA 2BKAA 4B5KA 2PWPA 2F90A 4M22A 4B33A 4KI7A 4B8WA 4YP1A 1N6IA 1OY1A 3AFIA 4HFMA 2Z5VA 2WWXA 5BSWA 1UOOA 1W25A 3DBRB 2PFKA 4CF4A 3TTSA 4G0MA 3UMMA 3DCYA 2ZVDA 4QVKA 5KSZA 2O3QA 2G04A 4O3MA 2QZSA 3PI6A 4BNWA 4DWOA 1UWLA 1N34B 3N2GA 1LQUA 1YNOA 3C3CA 2XA9A 3O0TA 1AGYA 5ENDA 2QQ0A 1Y5NA 4YDQA 3CEAA 2W2QA 4DWVA 1WV1A 1UDRA 4PYMA 3EG9A 3PC6A 4EYOA 2R8OA 2A3RA 5JS7A 1Q2XA 2IPMA 2O7NA 3CUKA 3WYAA 4KQWA 1Y37A 1ZHOA 2HUPA 3DDWA 3UGTA 1A95A 3NIBA 1BE6A 1LPAB 3CZCA 3OY7A 3VC7A 5KTYA 1VBFA 1C8BA 5FORA 3SQWA 4EUKA 3RVPA 2WSYB 3FX2A 5I9NA 3QEMB 2ODTX 3SYRA 1EFVB 1PUJA 2DPMA 2YYZA 3A25A 4UHJA 1COWA 2HQBA 4HAZA 1ZRNA 4HG2A 4MDHA 3T7JA 4BO7A 4BRWA 5F2OA 4BUCA 1RXVA 3PKJA 4IVQA 4FB4A 5B4TA 4O3FA 4C0WA 1U80A 2XB4A 2J6IA 3ANNA 3PZRA 5K3DA 3B9PA 3FPKA 5K1ZA 4RTLA 2XNDD 2P0YA 3G2LA 3PHLA 2X9QA 5T6MA 3STVA 3DD5A 2H1HA 2VP6A 4TL7A 3TUZC 3T1YB 4AUKA 1DKQA 1CS0A 3PTLA 4IDCA 3E8SA 2WV9A 1QTQA 3NU1A 1JPJA 1J42A 3UB2A 4Q37A 5AM2A 5DEIA 1N0WA 3H4MA 1GNRA 2PX4A 2OAEA 5P21A 4JK3A 3EXHA 3O1HB 4FPXA 3H2ZA 5LU9A 5MGBA 3DE4X 1HEIA 2FW0A 3MJHA 3ELUA 2A0KA 1XJ0A 3BBPA 3PBKA 3RNLA 2WQZA 4PR3A 2H2IA 2O9JA 5JV5A 5GONB 1SUDA 3UUEA 1GPH1 1PT7A 4ND7A 3QHQA 4OBBA 3MWYW 4ZOLF 3ZOZA 3HO6A 1MFPA 3NTQA 3DBVO 1U4OA 1CPYA 4R7ZA 1AQLA 1S02A 1WMSA 2BT4A 3V7FA 1LWNA 5BMVB 1TW2A 5D7NA 4CKCB 2E18A 1EUQA 3ZDEA 1XU7A 4JASB 4LF7B 2W6JA 3DOIA 3EZFA 3RSOA 2J0UB 4ACAA 1QJCA 3TBKA 1FMFA 3QXGA 1XNJA 3IKTA 3A70A 5BN4A 3LCMA 1WDLA 2W11A 4A8PA 4IJQA 1OU4A 1K2WA 1DTEA 1E62A 2H9YA 3LH5A 2P69A 3NHMA 4DCTA 2YYSA 4GZLA 4DMLA 3JAMA 1I3LA 1FX0B 2QX8A 3OJ0A 1ISGA 3Q9LA 5TJ9A 4WBSA 5AMXA 1K8ZB 4TXHA 5E38A 1JTEA 4ZVTA 1EYZA 1SRRA 2GVDC 1SCUB 2HA3A 3I9NA 1AHHA 2JJ1D 4LTDA 4MEJA 4S35A 5SYAA 3ZH9B 1PVDA 3NWJA 2HRRA 5TF4A 1Q0TA 4E7PA 1X7ZA 3VSBA 4XIYA 3HBNA 4YAFA 2YIJA 1R12A 4V2IA 3GO4A 3ELYA 2NU8A 2Q2OA 4MUIA 5K3AA 1G20B 1U3VA 1XTSA 2HZBA 2VBFA 1B1CA 2QMYA 3CNEA 3K0KA 3D2CA 3WICA 4GM1A 4AJKA 3UATA 3WGQA 3M1YA 1W2GA 4LZZA 4A8JA 3NHZA 4TKUB 1EMDA 1DBWA 4FIZA 4UHCA 1QUFA 3CJTA 3ZQ4A 2EW2A 4FS3A 3QEJA 1RCTE 1TM5E 2VA9A 1MRZA 2SICE 3W3AD 3EN0A 1A9RA 1E6CA 1HE2A 3VYUB 2JF0A 2I6SA 2DFDA 2FPUA 3W0LB 5DTEA 3SI7A 3V80A 3EXIA 2PA0A 2J3HA 4W82A 5FNVA 2IYZA 2J0SA 1RSZA 1RS0A 5JQGB 1QRAA 4LYHA 3LSTA 1WV0A 3T54A 3QX9A 3EFBA 5KKNB 3FDZB 3MCUA 4RVHA 2GN0A 1YXMA 3DXXA 3OMWA 4G09A 1EB8A 1GPKA 1RPNA 5DJ5A 4OUKX 4B4OA 3H2HA 3SOZA 2R6GA 4HH4A 2YXLA 3HCDA 4JI8B 2WVHA 1C3OB 5E3IA 2W42A 4ADSG 4UQPA 3N2EA 2C9YA 3FZYA 2WFZA 2WJIA 3DMGA 2CBZA 1Y63A 2Y1FA 2C95A 3KRTA 1SC9A 2JIMA 3MBOA 2VHCA 3N8IA 2BONA 2IEIA 3IAXA 5FLYA 3ZJTA 3D8BA 3FMGA 2XI4A 3O6VA 2DERA 2JKZA 4XCVA 2ZRJA 1YS1X 3BWYA 4OHOA 1OXSC 1BE1A 3EVBA 4M9RA 3V32A 3ON5A 4G1VA 1Q3HA 4N18A 2O3JA 4PC2A 4Q7LA 3SC3A 4DEVA 3T35A 4ZV9A 1WSAA 4CQNA 3LW8A 3H99A 4X84A 2P9JA 1FNNA 3A6HA 1QZXA 5H82A 5KPDA 4GECA 2YN0A 3EAQA 4J1QA 4QNNA 2ADMA 1VIMA 2K6GA 3SJUA 5HKKD 3D8HA 3A7EA 1T9GR 5CH3A 4YT2A 4I1PA 1CY1A 3SBOA 4JA2A 1BA2A 2Z04A 5TQ0B 1LW6E 3ND8A 4C43A 1DEKA 5KTKA 2ZQZA 1PK9A 3DL0A 3HCOA 2HV9A 5TLSA 2FOXA 3PCTA 2W4QA 4DPLA 3DLHA 2WIBA 3E9CA 2OD7A 3EZ2A 3K31A 5DM70 4BLWA 4H7PA 4G97A 5BUZA 4JP8A 5FTLA 1I5EA 2FPGB 2GXUA 2P2GA 3HVRA 2JLYA 1O96A 5ITSA 2A7XA 3AIMA 2PMDA 3HZOA 4M76B 4PAQA 4CFYA 3KQLA 2RE8A 5DTQA 5EZSA 4ZT6A 4B7CA 5FA5A 3PD0A 3TKAA 3H04A 1PGQA 5FAKA 2OYSA 4GKVA 3GFGA 3SZUA 4ZDWA 1Z4PX 3BRWD 5JPIA 4L8GA 5HW0A 2HTFA 4LRUA 5JATA 1GGMA 1TAQA 3QP9A 1O6FA 3PE4A 3U7QB 3JAKA 4OHRA 1H3FA 2H2HA 3HWX1 1U0GA 5JNTA 2XX3A 3B20A 3ONNA 2DFLA 2PUCA 1MJNA 2G1UA 3BX1A 3GXOA 3ZWPA 3L7KA 1SKBA 4RS3A 4BFWA 1MAUA 3ASYA 2PHZA 4ZT2A 3KD3A 4DSTA 3NVKI 3DBLA 4HYQA 1GV1A 4OMDA 2FW6A 2J67A 3F71A 4MAAA 1PT5A 3ZI0A 3A9VA 2ZPUA 2G80A 3KQPA 4IMRA 4RFSB 5EGNA 2NAFA 2RKOA 4ALNA 2JFQA 4WZAE 3U5TA 2ZCUA 1X7XA 1TZJA 2OCYC 3NGXA 4EELA 1TF2A 4Q4AB 1OD6A 4C2TA 1X42A 2E0IA 3EG5A 4RZXA 2O4CA 3KSDO 1T3SA 1TF5A 4F96A 5KDDA 2VH1A 5E8RA 1E3JA 2GJKA 5BQ3A 3GEPA 2P77A 2RHWA 4MVJA 1L7OA 2OESA 2W2TA 2FZEA 2XJ9A 1FFBA 4IDEA 3RSSA 4KPYA 3MWDB 3DLPX 4ALIA 4RXTA 4PLTA 1JVBA 2IUYA 3IA7A 3NKFA 4B9EA 1XRMA 4EHNA 1PD0A 1EIZA 2PKEA 3REQA 3K4QA 5B58T 2ZIEA 4MCJA 2RAUA 3RRFA 3CRMA 1V5EA 5TDHA 1CNFA 3T52A 4EY5A 4CIWA 5KEIA 2QQFA 4C04A 2MIIA 2PMKA 1ZG3A 4H35A 2ZIWB 3KUDA 5AM5A 3SSAA 5LQMA 9MHTA 1HRKA 1U9IA 2GYYA 1QH9A 1R18A 1NMQA 3B36A 3E9YA 3PDUA 1Z12A 3N05A 1F51E 5FLXA 1ZJZA 2R8XA 4M1WA 1OH5A 3UMSA 3W6NA 1R74A 1AG9A 3AVQA 3G8DA 3DGEC 4ESOA 3H9CA 4D45A 3K32A 5TT0A 5HM8A 1AZLA 4QEKA 1H05A 3FOBA 4RPHA 1F8FA 1UMDB 1DRVA 3EZNA 3ZLVA 4GLFA 4HNRA 3RG8A 4R4JA 1TEZA 3JYHA 4IIEA 4CEHA 3AIKA 1BG6A 1RNLA 1JWAB 1YFKA 3P0JA 4PG7A 5IMBA 3Q3EA 1PJTA 1A8PA 1QIHA 2CYCA 1OZFA 2IPLA 3JWGA 2V9CA 3EK2A 4BAGA 1KQ3A 1WXHA 2ZDQA 3R7DA 1ORWA 1IIBA 3FNRA 2J6CA 4X20B 4KDCA 3GLUA 2W83A 5DCLA 1M6NA 4R8KA 1TU3A 3T3DA 4CV1A 2WNHA 4I4TB 2P9GA 4QUGA 2JLUA 2EKZA 3C8DA 2BZGA 3NHFA 2XLBA 5KJ1A 2YZNA 5DX0A 1DELA 2OE2A 4CM3A 2IYYA 4F4FA 4LBZA 3ZEIA 4C07A 3OPVA 3WMGA 4CETA 5IRCD 4DJ5X 3LU1A 4FNAA 1T5LA 1VG0B 1U8CB 3RYCB 1JHRA 5BV2P 1HYHA 2W2MA 5L4LA 3SXUB 4KHPB 2ET6A 5H3LA 1BIFA 4Q4DA 2I2WA 5CXSA 2QD3A 4AG6A 3T15A 5B2FA 1XDBA 3VSCA 2JLBA 3KQMA 4FYKA 3CW8X 4D02A 2NXWA 1C9DB 1H2EA 2JARA 1J0CA 1RVV1 3VC2A 4JUDX 4BLVA 4YIHA 2VAVA 1PGJA 2WFLA 4R8VA 4UJ5A 1QE0A 3VR5A 4D6PA 1GL7A 2GVNA 2IC5A 3IEXA 3IP7A 4RD0A 2VYQA 1IQUA 3IIIA 1REQA 4MS4A 4UBJA 5ESDA 1R16A 2JJ8A 3HNPA 1BE8A 1F2DA 3PNLA 4KWCA 4MUJA 4WMLA 2FE1A 3E22B 3UT0A 5BW6B 1PZMA 5JXGA 1NATA 1O95D 2Q62A 1XZKA 4GXQA 1RYMA 4HBZA 2IS2A 3EWNA 1SUFA 2WMOB 5EQFA 3I76A 4YRMA 2QG4A 1RRPA 3OD5A 3DKRA 3L1JA 2XKKA 3QVTA 1Y6ZA 1NI3A 5A4MS 1BD4A 2DBYA 2GTPA 3CPEA 2B1RA 4DA7A 3TRKA 1IXYA 3LWZA 2H06A 1CZUA 2QL6A 3C0KA 3EZYA 2WUVA 3IB6A 3M4XA 4KNVA 4OP2A 4QSMA 4JOQA 5K09A 3OCXA 3QNWA 3HXTA 5K8VA 4QBGB 3GW8A 2FXVA 2WJPA 2C0QA 5DYIA 2WRZA 4WN3A 1L7BA 4QEZA 4QDUA 4BV8A 1OFIA 3DKVA 2EDAA 2I3AA 2XE4A 5KOJA 2DFNA 3H9EO 4UMDA 1RCUA 1YJ5A 2FCAA 4WKCA 1JF8A 5ECWA 4P9NA 5LIRA 3CX7A 3N2IA 4IPTA 2QT9A 3DC2A 1ONSA 3DVLA 3LZDA 1Y4DE 1HG0A 2ZT8A 2CWDA 5MFPA 2R11A 3C87A 3LPDA 4FTWA 3RODA 3I1YA 3W7VA 2C8KA 3QG1A 2IYFA<