1GV9A

P58/ergic-53
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
228
structure length
223
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLDGPVFGSADMWNGVGIFFDSFDNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P58/ERGIC-53
publication title Crystal Structure of the Carbohydrate Recognition Domain of P58/Ergic-53, a Protein Involved in Glycoprotein Export from the Endoplasmic Reticulum.
pubmed doi rcsb
molecule tags Carbohydrate binding
total genus 48
structure length 223
sequence length 228
ec nomenclature
pdb deposition date 2002-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gv9A00
3ILFA 5IK5A 3NV1A 4XHBA 1V6JA 4I30A 1VAMA 4ISRA 1GZWB 3AK0A 2A6YA 4Q1RA 4XOGA 3WVJA 2CY6A 1GSLA 1SLTA 2A3XA 1QOOA 2R1BA 2EIGA 4RA0A 2A6ZA 1Q8PA 3LSEA 3WDTA 4BM8A 3ZSJA 4AGVA 2E51A 1UAIA 4F83A 4AVVA 5GZEA 1GZWA 1SLIA 1WBFA 4Y1YA 3WLUA 5GZGA 2XG3A 4ISQA 3ZVXA 4P9YA 2DWRA 3WCSA 3AJYA 1D0HA 1JW6A 1EPWA 2GMEA 4NO4A 4R9CA 3APBA 4YG0A 2PELA 3VKNA 1W6OB 1DQ0A 2SLIA 2WLQA 1SBFA 2WSUA 1V6LA 1MS3A 1ZM1A 3IPVB 4FPGA 2ZZJA 3WHTA 1MR5A 4WV8A 5H9QA 3N7MA 5GZCA 1UL9A 3WOGA 1AXZA 2JJ6A 1VALA 3M1HA 3N7KA 4JCKA 5JOYA 1GV9A 1S0DA 1W6OA 3USUB 1AJOA 3D4KA 1LOFA 4AGRA 5DUXA 2A6XA 1W6MB 4YM0A 1GICA 5H9SA 1WW4A 1APNA 2W08A 2P3IA 3IPVA 3VV1A 1JXNA 4PBPA 1YO8A 2WT0A 2ZGUA 1MS9A 4Q8KA 3OBRA 3U4XA 3RRDA 1QKQA 1WLDA 5GLVA 3PJQA 4M01A 1A78A 3USUA 2GN7A 4XTPA 4XXPA 1W6MA 1SBEA 3NV3A 3OY8B 4YFWA 5BYNA 5KXBA 1S1AA 1RIRA 3MPPG 2D6LX 3W58A 2VH9A 3WG2A 2E7TA 4YM1A 2DVGA 3SISA 1SFYA 1R1ZA 3UJQA 2D3PA 1W0OA 2ZGKA 4FPFA 3RG0A 3OY8A 2DYCA 2DTWA 3T1LA 3FLPA 1Z78A 4UW5A 3WCRA 2W52A 1FNZA 2OVUA 4XTMA 1KQRA 2ZGMA 3WDYA 1MS5A 2V73A 3VKOA 4SLIA 2WQZC 4LBQB 1DLLA 1LJ7A 2HYKA 1C1FA 1I1EA 5H9RA 1VAVA 2JD4A 2EAKA 2DVFA 1BKZA 5DZEA 1JHNA 1H9WA 1LHVA 3AXEA 2PHXA 1RITA 3JU9A 1LHUA 1OQ1A 1RINA 4LBQA 4C1XA 3AFKA 1GKBA 2ZABA 2CL2A 4AVSA 4YM3A 4XYXA 1AX2A 2ENRA 4UW4A 1JYCA 1XQNA 3ZYRA 2JDZA 2EALA 1UX6A 1KITA 4YGEA 1QMJA 1SLLA 1LENA 1WLWA 5EWSA 1C4RA 1HKDA 4YGCA 1MS8A 1CESA 1SBDA 2DVBA 4TZDA 1UMZA 2PHTA 1DQ1A 1JUIA 2AREA 3INAA 1DQ2A 1ULEA 4Y1VA 1IS5A 4FP2A 1WW6A 4FQ4A 2EXJA 3HMYA 1DYPA 3B69A 4FOWA 2ZHLA 4CTEA 1LOGA 2GN3A 4XMIA 3O5SA 1J1TA 2YZ4A 3ZSLA 3M3QA 2AGSA 2P2KA 3GNEA 2DUPA 3OBTA 4IQPA 3UK9A 3QCWA 1GNHA 1H9PA 5F5QA 3ZXKA 1GNZA 1YXWA 2GNBA 4PF5A 4XXAA 4ZXKA 2A6WA 4C1WA 2PHUA 1CR7A 4PCRA 1WLCA 1LULA 2D6KA 2NMNA 2P37A 4Q8LA 3B00A 3TB0A 3TAYA 3UJOA 4XMAA 5DG1A 3R05A 2WJSA 1Q8OA 5T52A 3WG4A 3B01A 1JYIA 5DUWA 3MEPA 1FV2A 2R0FA 2UWAA 1ULGA 4GWNA 4BLIA 4M3CE 4YM2A 4U2AA 2JE9A 5GZFA 2DURA 1FX5A 1DHKB 2Q5TA 4GXLA 1LU1A 5L73A 2ZHMA 2WSVA 3M3CA 4TYSA 1KRIA 2BQPA 1LCLA 4FPHA 3AXDA 5HCFA 4Q1PA 3WG1A 1OKQA 1MVEA 2NMOA 1LEMA 4LBMA 1VIWB 3KM5A 1Q8VA 1S0GA 4BMEA 4BQ1A 1SCRA 1GZCA 3AP6A 5GLZA 3O0VA 1BJQA 4YW3A 1W6QB 5CAZA 2UURA 1G8WA 1C1LA 1N3PA 3WHUA 1UKGA 3DGTA 2JECA 5T5OA 4LBKA 5T50A 2TEPA 1O4ZA 3PVEA 5T55A 4BOWA 3V0AB 2D6NA 2ZGQA 4GKXA 4DS0A 1DFQA 2ARBA 3AP7A 1OFSA 3ILRA 3ZXLA 1SLBA 1S0FA 2OW4A 1LHWA 1WW7A 3FBYA 1MZ5A 1W6QA 1CPNA 4WZFA 4XBNA 4FPCA 1Y7BA 1UPSA 1LGBA 2EF6A 1G7YA 1LEDA 2A75A 3WDXA 4ZKTB 1G9DA 5KXCA 3FUQA 2ZMLA 3M2MA 3V0AA 1C57A 1F5FA 5EYYA 2ARXA 1LGCA 5GZDA 1W0PA 4R9AA 1ENQA 2PHRA 1IS4A 2AYHA 1BZWA 4FPOB 3UL2A 3RQ0A 3AP5A 2DU1A 2EXKA 3IKWA 5T54A 2GDFA 2ZACA 1AF9A 1SACA 3SITA 3SH5A 3R4SA 1PZ8A 3MW3A 4XILA 2A6VA 2DTYA 4FPYA 1QGLA 2GALA 3N7LA 2D3SA 1QOTA 4BMBA 3ATGA 4WVWA 2YXSA 2D43A 1G9BA 1LECA 1VLNA 2ZGPA 4FVVA 4XE9A 3B9CA 4YG3A 5EYXA 4FPJA 4BPZA 5JOXA 2ZMNA 4JRAA 2ZHNA 4R9BA 1N1YA 4Y1XA 4P14A 4GA9A 4Q27A 1ONAA 3BTAA 3ZXFA 2A7AA 1UN1A 2UWBA 5E89A 1FAYA 1N1TA 3N36A 5DZFA 5AVAA 3AP9A 3V64A 3ZSMA 1WD4A 3WUDA 4YZ2A 3AYEA 4M00A 3RS6A 3Q9OA 3QLQA 4YW4A 5T5PA 3LSDA 1HLCA 3OYWB 1V6NA 2ZAAA 3OJBA 3SH4A 4YW5A 1N3OA 4Y26A 2PHWA 1W6PB 1SLCA 2AENA 2OUJA 3R4UA 3V65A 3L2YA 3AZVA 2DV9A 3D5OA 3NWKA 2W68A 3OYWA 5JDBA 4AWDA 1LGNA 4YG6A 2ZBJA 3AZWA 1W6NB 2XB6C 1DQ4A 3M3EA 1ENRA 3M3OA 3POWA 5HCAA 1AZDA 1W6PA 3B3QE 1DIWA 4P9XA 1YI7A 2ERFA 5DUVA 3T2TA 4YZ1A 1G9AA 2FHRA 1B09A 1ZA4A 1GBGA 1BYHA 1WUVA 5JVVA 3ZPYA 1F31A 1ULCA 3N35A 3VKFC 1PZ9A 2G4IA 3RMXA 3WV6A 1DZQA 1W6NA 4YGDA 1YRZA 1PZ7A 1AVBA 1S0CA 4LBLA 1AX1A 4R9DA 3MW4A 3POSA 1N1SA 3V0BB 2ES3A 4BLJA 1V6KA 4OZXA 4RL7A 4W65A 1S0IA 1S0EA 2AUYA 2DVDA 3A0NA 1QOSA 1LODA 2AR6A 2DUQA 4UW6A 1HQLA 4Y24A 4AVTA 4Z8BA 1YYNA 3RSJA 3V0BA 1GZ9A 4DFSA 1WBLA 1QU0A 1F9KA 1DQ6A 1JN2P 1LOFC 2E53A 2VW2A 2CYFA 3HR9A 1A8DA 2CNAA 2ZGTA 2A71A 1FATA 4LBJA 3VKLA 2YMZA 2AH2A 2VUAA 3N3HA 2JE7A 4YW2A 1DYKA 4HL0A 5IT6A 1CIWA 4ATEA 3ZXJA 1AXYA 4K20A 3VKMA 4ASMB 2R16A 1N1VA 2D6OX 3KQRA 2P3JA 2CTVA 5DZGA 5CB7A 4ATFA 1SCSA 2DUOA 2ZGRA 2FMDA 4XJAA 1LOEA 3MW2A 5FREA 1KJRA 3AZXA 4GALA 5GJ6A 1V6MA 4FOYA 5IK7A 2W39A 3C2UA 4D69A 4XJ9A 5KXEA 1S0BA 1IKQA 1X50A 2JKBA 3W59A 1TEIA 3BIWE 1WW5A 1GYKA 1MACA 4P9WA 1WD3A 1IS6A 2D6MA 5DG2A 1AJKA 1G9FA 5JOWA 4FQZA 1A3KA 2VXRA 1V00A 2ZGLA 2R49A 1QDCA 2OUHA 4XJ8A 2NP0A 2PHFA 1URXA 2GMMA 5JMCA 2VU9A 3A4UA 2LTNA 1WCSA 4K21A 1V6OA 2GNDA 1ENSA 3WNXA 4XZPA 5H9PA 5E8AA 4GKYA 2WT2A 3CNAA 1DBNA 5HCBA 3SNMA 2D3RA 4ITCA 2VW1A 4PQ9A 3FFZA 5F9TA 2CWMA 3PVNA 4MYEA 1AXKA 4H55A 1LOCA 1QNWA 4FPKA 1LTEA 1MS1A 2A3YA 1UZYA 3WDUA 1O4YA 2C5DA 1I3HA 1Z0HA 3FLTA 2B7YA 1JBCA 3RMYA 3GALA 2ZGSA 1N3QA 1LOAA 4YZ5A 2ZGNA 3FLRA 2YV8A 1HQWA 2YROA 4YZ3A 2NZ9A 4JC1A 4XHXA 4K1YA 5IUQA 5JLVA 3N7JA 3PMEA 5LK5A 1MS0A 1MVQA 2V5YA 2EXHA 3ZXEA 1KJLA 3AX4A 3HN1A 4M3CF 4DQAA 1KDMA 2A5ZA 2DVAA 4Q26A 4YLZA 3AZYA 1BXHA 3WDVA 2EXIA 2WKKA 4YW1A 1LOBA 4DRVA 1CVNA 3SLIA 2VW0A 1CONA 2A3WA 4FOVA 3AJZA 1Q56A 4KBBA 2RHPA 2I2SA 1IOAA 1QNYA 4PBOA 4Y22B 3ILNA 1JOJA 2CWSA 5IK4A 5T5JA 5EXOA 5KXDA 3T1MA 2P3KA 4U36A 4Y1ZA 4XJZA 2SBAA 3I4IA 4DPNA 3DUIA 5DUUA 1LHNA 1CPMA 1AX0A 1DQ5A 1H30A 2D6PA 1HDKA 2ZKNA 4WVVA 4Y22A 3WUCA 2ZGOA 1FV3A 4CRQA 3AYAA 1G86A 1NXD1 4K1ZA 2R0HA 2NYYA 3SH3A 4L8QA 1MS4A 1S0JA 1SLAA 1NLSA 2ZA9A 1U0AA 1LU2A 2YY1A 2NM1A 2VY0A 2A70A 2GNMA 4XBLA 1Q8QA 2D7FA 5E88A 5FRAA 4DRRA 3O0XA 1GANA 2ZMKA 4XDQA 2KM2A 1QDOA 3IM0A 3D6EA 4Q2FA 3JUUA 3WZ1A 4LBQD 5SV8A 3IN9A 2H0BA 1QF3A 2E7QA 2WT1A 4XBQA 4Y1UA 4AYUA 5IK8A 1CJPA 4GWMA 1FNYA 1G9CA 4FPEA 1LHOA 4LBOA 4YZ4A 1Q8SA 3POYA 3FUOA 3A0KA 5CBLA 5GALA 3ASIA 3O12A 2E6VA 4HANA 4Y20B 5GM0A 3PVOA 4M3CB 2LALA 2UU8A 3O0WA 3OPZA 3IMNA 1CQ9A 4XIKA 5GLWA 5T5LA 3AZZA 3WDWA 3BODA 3AYDA 3LCPA 3NV2A 3H0OA 1IKPA 4XJUA 4CZSA 4XJWA 1BQPA 3ZSKA 5CNAA 4UW3A 1D2SA 1N47A 2DU0A 2NN8A 4Y20A 1ULDA 2D44A 2ZHKA 4M3CA 3ENRA 2Z42A 1CN1A 1YIFA 4FP3A 1GLHA 5GLTA 4NOTA 4AGGA 3VUOA 2P34A 4FOQA 1ULFA 2R1DA 1UZZA 3AYCA 4YGBA 4FPLA 4XIOA 5DXDA 4YFZA 1LESA 3ZYPA 3WG3A 3OGGA 1IS3A 3I8TA 1MZ6A 4LBNA 3NV4A 2WNEA 2UWCA 5GLUA 5JOZA 1DGLA 2C9AA 1FYUA 2GNTA 3BOPA 2GMPA 1V6IA 5CA6A 1KDKA 3AP4A
chains in the Genus database with same CATH superfamily
3HNMA 3ILFA 4XHBA 4LO5B 2OXBA 4AG4A 4P08A 3D82A 4I30A 4RQPB 3ZO0B 1UPIA 1VBB3 1H4GA 3JZVA 4L0PA 1DGWX 3WVJA 4EN8B 2GH2A 1JZ5A 4AEJA 1SLTA 2A3XA 5FTTC 1RUD3 4AVCA 4EN0A 3ECQA 4EV0A 4V1PA 3WDTA 2C24A 5E1RA 3VBOB 4BM8A 4AVAA 3F2ZA 2FQPA 4UYBA 1YFUA 2D97A 3E1F1 4D7TA 1XU1A 2QQOA 2N7GA 3W21A 4ARYA 4AI2A 2YPJA 1O6UA 5KHKA 4Y1YA 5GZGA 1P8JA 4NWWA 5IYYA 3OBZA 2XG3A 4ISQA 1GOFA 1LB2A 1WMEA 3AC0A 2Y60A 5J7MA 5CG8A 4R9CA 3OEBA 4YG0A 3K2OA 1J3QA 2PELA 4KG0A 3VKNA 4HK9A 3QBQA 4JZRA 3UGFA 5JI9A 2SLIA 1FXZA 1B35A 1V6LA 2O8OA 1ZM1A 2BFUL 3AVSA 4IEPA 3WHTA 4CE8A 4CUGA 5H9QA 5FY1A 2DF7A 3H1WA 4IE0A 2VZ1A 1VJ2A 3T08A 1AJOA 1VMHA 2XWJB 5J1XA 1NZCA 1UD1A 1W6MB 4YM0A 1JOBA 4XABA 3S7EA 4Q0PA 2XGXA 1JXNA 3KV6A 4PBPA 2FZ1A 2HWF1 2VUDA 1MEC1 5A3WA 4QB1A 3WP3A 1CAWA 2WNUC 1UU6A 1QJY1 3S0MA 1SQ4A 1XE0A 1PM7A 1ULOA 1WLDA 2E9QA 5C4WB 3E6DA 1QQP3 3CQOA 4IGQA 5FMOS 3USUA 5BNOB 4YNIA 1QJEA 4EWAA 3J7NA 3K3NA 4JAAA 4XXPA 4OQ8A 3IIIA 2VD7A 1OQEA 1VBB1 1S1AA 3URFA 5KXBA 2R072 4IEOA 3O14A 2VH9A 3W58A 1NA1C 2RS51 2ZTNA 1RUD1 3WQ0A 1YQ6A 3UJQA 2D3PA 3ZDSA 4IEVA 2DCYA 3ZKUA 1AL0G 1NKGA 4PI2A 2IVJA 1O4TA 2HWD3 2OVUA 5FZCA 4URTA 1BMV2 1ZA7A 1S55A 3VHRA 2QJVA 2WQZC 4LBQB 1ZRDA 5EZWA 3U11A 3QH7A 1C1FA 3NL1A 4FAGA 5H9RA 1VBA3 2F17A 2WR9A 3ZFFC 1NLRA 1JHNA 1OOPB 3ORJA 2P3YA 1OLMA 1FOD3 1HJGA 4EN9B 4P02B 4XZUG 4C1XA 1HQNA 4AVSA 3BIEA 2FCVA 1AX2A 2ENRA 4OI2A 1VMFA 2OKXA 4UW4A 1XQNA 5FZLA 3ZYRA 2JDZA 5JUVA 2EALA 2VJXA 3VDDC 1ENXA 2BVVA 1JU3A 1ST8A 1OF4A 1QJU2 1OXCA 4P5HA 3AL5A 1PGL2 1MS8A 2HWE3 2DVBA 4N9HA 1W8ZA 4TZDA 1UMZA 2RJ2A 3HQXA 5CFDC 1FPN2 4MX3A 1DQ2A 4JGZA 4KWKA 5DAQA 5J96B 1CAUB 3MFCA 5ACA2 4RR3B 2VZVA 3HMYA 1DYPA 1PM4A 3K3OA 1DYOA 1XE7A 2ZHLA 1OLME 4CTEA 3LWCA 4A3ZA 2F4PA 3WNKA 2OT7A 3A23A 2YZ4A 3ZIXA 2XJVA 3M3QA 2WFF2 1H0BA 3GBWA 4Q4X2 1EAH3 3DPRC 5J98B 3ES1A 3VHNA 1Y4WA 1NCQA 1BBT3 1UF2C 1YXWA 2A6WA 1WMFA 1XPWA 3OOXA 2PHUA 3N9QA 5EJ3A 1WLCA 3RWKX 2HWD1 2P37A 3TB0A 1X82A 3B00A 3TAYA 4E2SA 4XMAA 2CDOA 3MYXA 5LW9A 5T52A 2BGCA 3B01A 4BQ2A 1LNSA 5EP9A 1UYPA 5DUWA 5FYHA 3S7IA 2CGPA 3SKJE 2QFEA 4M3CE 4B4PA 1LAJA 4D7YA 1FX5A 4BYYA 3IWZA 2ZHMA 3M3CA 1FOD1 1LCLA 5D8AB 5HCFA 4IE5A 4Q1PA 1HN0A 4KG8A 3SKVA 3WG1A 2W2IA 4Q0QA 1CZVA 1OKQA 3B7MA 5A1AA 4LBMA 2XVGA 1GZCA 1F8VA 5L7OC 4CCEA 1IPSA 2XXZA 4HSLA 1SPPB 5CAZA 2F4LA 3IAPA 1HRI2 2JDAA 4DMIA 1WA4A 2RR13 5T50A 2TEPA 5JZGC 4BOWA 3EQEA 1AYM3 3WNMA 4DS0A 5A33A 1DFQA 3R4DB 3U07A 5FO9B 1NOVA 3ES4A 1LHWA 4UBHA 4KQ7A 3SCHA 3C7GA 4UFKA 4FPCA 4DEVA 2RJLA 1Y7BA 1G9DA 2FDGA 5FYMA 1VR3A 3WDXA 5KXCA 2VCMA 4GMP1 3GDBA 1W2UA 3LFMA 1Y3TA 1EAH1 4LJHA 4N53C 3B94A 4QKFA 4WVMB 5I0TA 1QJX3 1R082 3I7DA 3JQWA 3BCWA 1W0PA 1ENQA 2PHRA 2W1WA 2W94A 3WNPA 4DUVA 1JUHA 5KHIA 4HZFA 3RQ0A 5CFCC 2JG8C 3OD0A 4PF1A 3HQRA 1F15A 1UY4A 1D4M2 3H7JA 1U5YA 2J1EA 3O7OA 1EUTA 2VMFA 4EYUA 5A1LA 5BNPA 4UF0B 4KNCA 3AKTA 5FY7A 4XILA 2A6VA 2MNGA 5FZGA 4C91A 1UXZA 2VMIA 1TZOA 5FY5A 3F95A 5LRSA 4BMBA 1RMU3 2VQ0A 4AI0A 3HT2A 3ELNA 2VBPA 1IG0A 2ZS6B 4XE9A 2W46A 3LPFA 1U5ZA 3H1MA 2WINB 2XJSA 3RGBA 4Y1XA 4TLGA 5B4NA 4P14A 4OYUA 3SCFA 1POQA 2UWBA 5E89A 4CEWB 1N1TA 4OHYA 3ZSMA 5DN2A 3DYOA 2B9UA 3VZJA 4M00A 1RVF3 3BYWA 3Q9OA 1RHI1 2RDSA 3KCCA 4LIUA 4IL7A 3KS7A 1HLCA 2RR11 2ZAAA 5CYYA 2GP5A 5JPNB 2QQMA 1AYM1 4YW5A 1XJAA 2XKPA 1R092 1OA2A 1YQCA 2W95A 2PHWA 2D5FA 4DEQA 2ZAHA 3NNMA 3ZX7A 4META 1YWKA 3T2QA 3ZYGA 4INDA 2VTXJ 3NWKA 2WZEA 4E27A 4GH4A 2BDRA 4HN0A 3AZWA 3CJIA 4IGPA 1RUI1 3BPZA 2X53S 2XB6C 3LA7A 1PK6C 5FYZA 5FXWA 5HCAA 1AZDA 4DB5A 2VMHA 3T2TA 5EFUA 4CDXA 4E4SA 1B09A 2D93A 5FR3A 2JDKA 4DXSA 3THPA 3ZPYA 3SXWA 3N35A 5IVJA 2J1TA 3T0DA 2W47A 2VMCA 1N1SA 2ES3A 2QQIA 2WNUB 4OMCA 1V6KA 1CAXA 1C8M2 1KGYA 1AR72 3HJRA 1S0EA 2AEYA 2AUYA 2QQNA 2BZDA 1RMU1 4NPRA 2AR6A 4QXKA 5D21A 5I0SA 3POBA 1ZRRA 1QXPA 3P6BA 4UW6A 1ZBA1 2Q8CA 1XSQA 4TN7A 4Z8BA 1YYNA 1K3IA 5IWFA 5JMOA 3VBFA 1GZ9A 1YEWA 4DOUA 4A44A 1F9KA 1NA1B 2E53A 1DZRA 3RJRA 5LWBA 1C28A 5DAPA 3KV4A 1A8DA 2CNAA 5I8SA 2FCTA 2VOKA 2VUAA 3T3YA 3MFAA 4HL0A 4NHXA 1RVF1 4ATEA 2BNMA 1AXYA 4K20A 3A7QA 1RUH3 2P6HA 1KD7A 2WIIB 4DUWA 4A7KA 4ATFA 3RNSA 4EROA 3P5BA 4XFIA 4XURA 3MW2A 5FREA 5GJ6A 1IZ3A 1C3HA 5FZ4A 1AR63 4OI0A 3C2UA 4CXYA 4XJ9A 1S0BA 5FJHA 2JKBA 3TEZA 3K77A 1ZYBA 2BUKA 1GYKA 3I59B 3H50A 5DG2A 1PMIA 1GFF2 3ZFFB 1AJKA 1ZREA 3MIBA 5LEKA 2E7AA 1PVXA 5HPOA 4NIHA 1V00A 4QT6A 1VPHA 4XJ8A 4YVWA 3DECA 1YFWA 4COZA 2VBBA 2PHLA 5FOJB 4XDOA 5JMCA 1RUF2 1SMVA 1V6OA 3VDDB 3WNXA 1QEXA 4AF9A 3FMGA 2LM3A 5H9PA 5E8AA 5C3PA 1YHFA 2YGMA 2Q1MA 1E5HA 2C26A 3U14A 4OZOA 1RL3A 5CFDB 4HPKB 5FQ0A 3W20A 2D3RA 1COV3 5FZ7A 5A32A 4QDSA 1AXKA 2LUWA 4B1MA 1VRBA 4HN1A 3E6CC 2CGOA 5CZKA 1UYXA 1UZYA 5JCTA 2VCBA 2J22A 3JCIA 2XR4A 3B02A 2VVDA 5LCWL 4NE9A 1WA6X 1RUJ3 3DPRB 2H6BA 2Q0AA 2JX9A 5CU1A 4XQ4A 5FP4A 1N3QA 3LF7A 3VL9A 2ZGNA 3PDQA 4LIVA 2VE1A 4OMDA 4QX8A 4D6QA 2YV8A 5ACA3 1DLCA 2YROA 5A6ZA 2QZ3A 2NZ9A 2WBKA 2TNFA 4JC1A 1VP6A 2R071 2OZJA 2VCCA 1G6NA 4Q29A 3MLLA 1RJ7A 1MVQA 3WQ7A 1IHMA 4ZZ8A 2BBVA 4LKFA 4IEYA 3VDCA 4MOAA 1UCXA 1KDMA 1YQ5A 2A5ZA 2DVAA 5FZDA 2FDHA 3E5XA 2PA7A 3EB7A 4RYDA 2MEV2 2WDBA 1W28A 2OZ6A 2C1FA 4HLTA 4MGZE 2GSYA 5FFOC 1CONA 2KD7A 4P9GA 5E6HA 2ZEWA 1BMV1 3KQ4B 4HFSA 4K8RB 4AK3A 1QNYA 1XRUA 4CCCA 4UWDA 2PAEA 1JOJA 2CWSA 3PUIA 1TE1B 5EXOA 5T5JA 2AEZA 4GZ9A 5KXDA 4JGYA 5L7OB 2P3KA 1UU4A 2VC9A 4WVZA 4CCKA 3KT1A 5FDBA 1SDWA 5FPBA 2FMYA 3DUIA 5DUUA 3GF6A 5JZGB 1PX4A 1IQDC 1W8UA 1HDKA 4R4ZA 1COV1 4Y22A 2ZGOA 3LIGA 2DCZA 4GWJA 4LA3A 4E8CA 3RYKA 5KR7A 2XLGA 1VBC2 1TNFA 1GQGA 3RYRA 3SH3A 1SDDB 4YVSA 2ZJCA 2ZA9A 2BJSA 4YYOA 3OGVA 4BXFA 3R6SA 1PGL1 2YY1A 1RUJ1 4JKLA 4N53B 5E88A 1Q8QA 5A7QA 3I2IA 4WM7A 1HX6A 2WA3A 4AFDA 2GC2A 1FPN1 2RS33 4P00B 5ACA1 4QXHA 3D6EA 5SV5A 4I01A 5CFCB 2JG8B 2VO5A 5SV8A 2H0BA 1QF3A 2WT1A 4Y1UA 4NIDA 5IK8A 1H8TA 5ABJA 2WFF1 3BOWA 4N43A 3AL6A 4Q4X1 4LKEA 4ZS3A 2OQ6A 4YZ4A 5LEJA 3POYA 3AB0A 3TN93 3RPQA 3ZFEC 3O12A 4Y20B 2OIIA 1V70A 5DMYA 5L9BA 4M3CB 2UU8A 4XIKA 3OPZA 3IMNA 1NYWA 2VUCA 3WQBA 3MGUA 3ZYIB 4N7UA 3SHRA 1I6XA 2K46A 3HEIA 1QQP2 4QPGC 3TOJA 4FAHA 1HJFA 1N47A 2IZWA 1EUUA 1OA4A 2D44A 4QGLA 3ENRA 5JXIA 3VBHA 1O91A 2Z42A 2BU9A 2IXLA 4CDUB 1YIFA 4FP3A 3ZXDA 1GLHA 5GLTA 4OI1A 5FIXA 4AEMA 5BNNC 4CCOA 1H4HA 2WAOA 1ULFA 3WINE 1F4HA 3RDIA 4FFGA 2EIBA 2R1DA 3K4DA 5BNOC 2ADEA 1KFUL 4QPIA 1A34A 3WG3A 4PQQA 4MHUA 2IXHA 3NV4A 2WNEA 1ND2C 4MXWB 1HRI1 5CA6A 1FYUA 5I8YA 5M0TA 4YZ3A 2CSGA 1QHDA 3AP4A 1PK6B 3WP6A 5IK5A 3AMQA 3VHOA 2RS31 3WW3A 4QDRA 4JV4A 5KC6A 3WF0A 1VAMA 4OHXA 3OF1A 3C7OA 3G7DA 4MG2A 4QX0A 2A6YA 1W0NA 4P9IA 2NPIA 5C70A 1VBA2 2AACA 4TWTA 1ZZCA 3MPBA 3EHKA 2BNNA 4XEZA 1GSLA 1HB4A 2PQQA 5FZOB 4OHVA 1UZVA 2R1BA 3ZSEA 4Q0UA 5J09A 5F1RA 1UOBA 3LSEA 1JYXA 3AKSA 3O1SA 1DDLA 4AGVA 3LIHA 2E51A 5K0UA 2BOIA 2J1AA 4F83A 2G1MA 3TN91 3JD72 1GZWA 4XUQA 3WLUA 3AKQA 3IDCB 3ZFGA 3ZVXA 3EMRA 3MI8A 3AJYA 2PMWB 5EPAA 1E57A 1D4M1 1ND3A 1YCIA 2BGOA 4CXXA 1EPWA 1RXFA 1OSGA 4BB3A 2HWE2 3NNLA 2DBIA 1UU5A 4XQDA 2CV6A 1W6OB 2I74A 2YU2A 4E9KA 1DQ0A 2WLQA 2OQ7A 4FPGA 1C8M3 3IPVB 4GQ7A 4JVAA 1MR5A 5GZCA 3WF4A 3WOGA 2WWUA 4NR1A 5KHGA 3LEGA 1C5HA 4E4DX 1NCRC 1W8OA 1POV3 3N7KA 4W6YA 3NAPA 4UI9L 3VD5A 1YLLA 2QUOA 5IVVA 4CYDA 1LOFA 4AGRA 1EY2A 3OG2A 2A6XA 1EAH2 4XFGA 4NRPA 5A7OA 1APNA 4PIZA 4QMAA 5I8TA 1BBT2 3USSA 4RS5A 2ZGUA 1MZEA 1W8NA 1QJZA 1GP5A 1UMIA 3RRDA 1O8SA 5GLVA 4GJYA 5KHJA 1VB2A 3KB5A 4LO4B 2QQPA 3FL7A 3ZXGA 1UX7A 1ODNA 4P5YA 4QKDA 4IUGA 4EWDA 1UZ0A 3ZYFA 3TEWA 4XVHA 5FMBA 5BYNA 5IVFA 3I97A 2D6LX 4JKMA 3BU7A 3PHMA 4OQ9A 4IV3A 4WM8A 2RMU3 3SISA 1W0OA 4A3XA 1O3QA 3OY8A 5A6YA 3T1LA 4LXLA 3FLPA 2VVEA 1Z78A 4HVRA 4UW5A 5FK8A 3CIHA 3QH6A 2VUJA 5ERLA 4I3GA 1GU3A 1FNZA 2XBO2 3CHXA 1KQRA 3MZHA 1T6BX 2TUNA 4LEJA 3WDYA 5F37A 1C8NA 4PDWB 1DLLA 5G04L 5EIYB 4UFLA 1DG6A 5GKAC 4CP9B 1O5LA 1I1EA 3D0JA 4QB6A 2JD4A 3E5QA 4ZPIA 4BK5A 5A6QA 1AYM2 2EAKA 3BVCA 1BKZA 2JDHA 3POJA 5DZEA 3T4VA 3JB8A 1C8M1 2G9ZA 1AR71 4ET7A 1JU4A 1LHVA 3PIJA 4W50A 3BPSA 4QXCA 1RITA 5FYVA 3JU9A 1OQ1A 5TSWA 1RINA 3SEPA 3I3DA 1POV1 4QHBA 2DCKA 1JYCA 2EICA 1PIV2 2JG9C 3AFGA 3KWVA 2DDUA 3WR0A 4AOCA 1QJX2 4HVOA 1KITA 5AFEA 5LASA 4YGEA 3BTXA 2ZEYA 3FFQA 3LAGA 1LENA 5LA2A 4B7EA 2YGLA 1C4RA 4YGCA 1YFYA 1W8HA 1CESA 2PHTA 1JUIA 1WGPA 1FI2A 4R52A 1ULEA 4L92A 4M4RA 4FP2A 1WW6A 4IDZA 4LT5A 4NAOA 3CBNA 4CCLA 4XFFA 3KHCA 3PU3A 5FMOL 1CD3G 1XXNA 5FOBB 1QXJA 2Q4SA 2AGSA 4Q4W2 2P2KA 3OD4A 2B42B 4EQVA 2DFBA 2E31A 3ZXKA 5CISA 1GNZA 2GNBA 3M4FA 3OPTA 1STMA 4C1WA 5C8CA 1CR7A 1HV0A 3KCXA 4IE4A 3WY6A 3ZYJB 5FUNA 5DG1A 5K7PA 3R05A 1Y43B 1W9YA 1J58A 2WJSA 4AHYA 4MGKE 4JDNA 1RVF2 3VD9A 5AC93 5FLJA 3T30A 4K9SA 5C6CA 1DCSA 1DU3D 3MEPA 1LRHA 2XL9A 3FHQA 2R0FA 2UWAA 1QH7A 2PFWA 3ZIWA 2YBPA 2JE9A 4KWUA 2DURA 5L73A 1DHKB 2Q5TA 2W3JA 2Y6LA 4GXLA 4HBNA 4LOSA 1HXS3 3ZYBA 3ZXAC 5IVBA 2BQPA 4FPHA 4Q4V3 4CEWC 1XNKA 1ULPA 1J83A 2IVIB 1VBC3 4ES9A 4QQOA 3J7MA 2GP3A 5LATA 4JX0A 3AP6A 4HMZA 3O0VA 1BJQA 4YW3A 1W6QB 2O14A 1RUC2 2PHDA 2ADDA 2R32A 1HN1A 5HXVA 1C1LA 1N3PA 2QE3A 3NJVA 3ZN4A 1UKGA 2YDEA 3J26N 3N9LA 4FXKB 4HOOA 3QD6A 4W6WA 5FY0A 2JECA 1MQTC 4PLMA 3ZFEB 3O1TA 1O4ZA 3PVEA 1OH3A 2ZGQA 1TNRA 4GAZA 4GKXA 3THDA 4B8EA 4KGGA 2QDRA 3ILRA 3ZXLA 1S0FA 3FBYA 1WW7A 3IT8A 4WZFA 1PVC2 3OUJA 1CPNA 4BMEA 4TTGA 1F2NA 1TVGA 4MUVA 4GD4A 3PLQA 5CKQA 5I91A 2A75A 2VMEA 3GCWA 4QPGB 3FUQA 1JODA 5A3UA 1WWYA 2ZMLA 4BQWA 2VOVA 3V0AA 2WN3A 3CKHA 1C57A 2OX0A 2UYBA 2MEV1 4XAAA 1LGCA 2L9LA 5GZDA 4A7ZA 3DKQA 1HW5A 2K0GA 4RGAA 3ZOIA 1IS4A 4AQ6A 4EZHA 2W1UA 4HT1T 4AHXA 3WW4A 2FZ2A 5BNNB 2DU1A 5T54A 5EJZB 2GDFA 1AF9A 1SACA 3ACGA 1RJ8A 2O8QA 5AC91 3NKTA 4CU7A 2ETEA 2DTYA 4FPYA 3TEXA 3WW1A 1UY2A 3MIFA 1RUH2 1ND2B 2D3SA 3AMNA 4I02A 4I0WB 2V4AA 1CZSA 3GM8A 4CDWC 2D43A 2HKXA 3M3IA 5EYXA 4Q4V1 3TEYA 4FPJA 1XYPA 1AR62 5JXGA 1N1YA 4O61A 1US2A 1VBC1 4KL1A 2WNOA 2XWBB 2A7AA 3S6PA 1UN1A 2VL4A 1FAYA 4Y33A 5DZFA 5DDJ2 1WD4A 1YNAA 3K51A 3AYEA 3QLQA 4IV1A 4CEYC 5A7WB 3OJBA 3SH4A 4YW6A 5L36A 5A6XA 3KF5A 2X5IB 1HIXA 5CVRA 1X7NA 1X36A 4COUA 3DXUA 4HETA 2VR4A 3L2YA 3R0RA 3I54A 2UY9A 2E33A 4AHWA 3D5OA 1W3XA 2XOMA 2IXCA 3OYWA 4XUOA 5FK7A 3GZEA 3ZKYA 3ZPOA 1LGNA 1COV2 5T3NA 4H7MA 3JD73 3POWA 5FO7B 3B3QE 1W6PA 2IC1A 3CU7A 5DUVA 1YI7A 2C4XA 2Q1FA 2I07B 4OUMA 5FXZA 4MGQA 4QQHA 1NCRB 2O0OA 2VG9A 1VE0A 3V56A 5CIRA 2JDPA 4CCJA 1WUVA 4IETA 5JVVA 3PMSA 3PJYA 1IG3A 2ZEXA 5C5UA 1PZ9A 1RUJ2 4LO7A 1QQP1 4BIOA 5A1FA 1W6NA 4LE4A 4YGDA 3TBDA 1PZ7A 1AVBA 1S0CA 2MPFA 2VAUA 4UXAA 5AVPA 5CEHA 2Z4FA 3KV5A 1AL22 1S0IA 2QTWB 2PAKA 1QOSA 4UFJA 3HNBM 1K42A 3NRUA 4BU2A 3UESA 1HQLA 4KU7A 5BNQA 4Y24A 3CZJA 4ORFA 2DFCA 1JMUB 3V0BA 5CKNA 2VULA 4DFSA 1QU0A 3ZYHA 3HR9A 4L9BA 4BQ4A 2A71A 2W92A 3C8XA 3I2OA 2G19A 2WZ8A 2YMZA 4AI9A 2AH2A 3N3HA 4UFHA 2R062 1ZZBA 5IJRA 3WW2A 3ZXJA 2YPDA 3VKMA 1K5MB 1E5RA 4ASMB 4SBVA 3WT3A 1QH6A 5ANNA 5FBJA 1O3SA 3KQRA 1REFA 2P3JA 1VBA1 1LOEA 1CAVA 1KJRA 4FTSA 1V6MA 4D69A 2VCAA 1CX1A 5LY1A 1IKQA 1MACA 4E2QA 1NY72 3GHMA 2FBEA 3OEAA 4TXWA 3DF0A 4BK4A 3BTZA 3JD71 1G9FA 3U37A 5JOWA 3ACIA 5BV6A 1BEV3 1A3KA 2XBO3 5FPAA 4J1XA 2B4KA 2CAVA 2OUHA 3I2HA 3LE0A 1XB9A 2PHFA 2VNVA 3T2OA 2NP0A 2XJUA 2XDVA 3A4UA 2BEOA 1WCSA 2HWE1 2P5BA 2YU1A 2JG9B 3DL3A 4K21A 5FPVA 1ENSA 1W06A 1TQ5A 4QKBA 4DXRA 1MPXA 2YHJA 2RS32 4GKYA 1K5JA 3ROUA 5FZHA 1J3RA 5IVYA 5FCCA 4A6OA 1DBNA 1VBD3 3RI8A 1YQ2A 1HRV3 1ZNPA 4LHNA 2VTFA 1RB8G 1X9TA 3OGJA 4ITCA 3Q8BA 1Z7S3 1O5UA 4PQ9A 2WO1A 1U5XA 1XNTA 3Q8AA 1PIV3 2W9XA 1LTEA 1J3PA 5EV7A 1BBT1 4LNVA 1H6YA 1ZZ6A 3LB9A 3TN92 3VBRA 3OCPA 2YC4A 3IAQA 5C9AB 3LFIA 5C71A 3OPWA 2DCJA 3NNGA 3ITQA 3RMYA 4AFBA 3IZOA 4YZ5A 3FLRA 4Q4Y3 2Y6KA 1UQXA 4G3YC 4QX7A 1GQPA 4JGZC 4OVEA 4QXBA 1KS5A 3NO8A 4IEZA 1IQAA 5LK5A 3TNQA 1MS0A 2EXHA 4Q4W3 4M3CF 3UKNA 4QX1A 5JWPA 3NMBA 4BWOA 2P1BA 2B46X 4D6RA 5A7SA 4XFAA 3WXPA 4A2UA 2EXIA 3K4ZA 2YUEA 4OLLA 4A7YA 3U0ZA 1LOBA 1NCQC 4URAA 2XBO1 3O1VA 4FOVA 5FZFA 5C7GA 4NRQA 3P3PA 4M4PA 3UV9A 4CDQA 5HV4A 4KBBA 2I2SA 3RFRA 3T0BA 4CDUC 3D3AA 4NRMA 1QY4A 4LKSA 3ILNA 5ANQA 2VBDA 1UOGA 1CJDA 2JDNA 4TLFA 2VQUA 4LORA 3TWIA 2WAAA 4QX3A 4Y1ZA 5A80A 1VBD1 4XJZA 2SBAA 2RJKA 3I4IA 4DPNA 3ACFA 1MQTB 2LROA 2CU5A 5LZ6A 2OA2A 4LMFA 3WUCA 4OUSA 2VZUA 3IDAA 2QQUA 1PIV1 4K1ZA 2R0HA 2NYYA 4FBFA 4LPLA 1XBFA 3VBUB 1QJX1 1RUC3 1NLSA 1U0AA 5APAA 4KWLA 1LU2A 2NM1A 5FRAA 3VD4A 3U4SA 3B5LB 1NX9A 1GANA 1AUYA 2ZMKA 3EO6A 1H1IA 1UY0A 2KM2A 4Q4Y1 4S2GA 1O3RA 4Q2FA 3WZ1A 3CO2A 5LA1A 1PVC3 4LBQD 3MO4A 3PTRB 5FZIA 4AYUA 2RDNA 2HEYF 4BQYA 3RVHA 4A6SA 3MV01 4HKOA 4MH0E 4NHLA 4Q4W1 1D0GA 1LHOA 4PLOA 4EE2A 2V5DA 3FUOA 5CBLA 3ASIA 3ABZA 4CDWB 4O9EA 5DAXA 3PVOA 4C0HA 2C9KA 4IEQA 3AZZA 4EZ4A 1JZ8A 3VBSA 4RGKA 4XFHA 5FY8A 1BQPA 3ZN6A 4ZHNA 5CNAA 1XE8A 5FZ9A 5BNPC 4IXLA 2DU0A 2WNVA 2Q1ZB 4OHWA 2ZHKA 1OPOA 2WA4A 2BWAA 2J42A 3AM2A 4W4ZA 2VZQA 5C3RA 4CEYB 3N9NA 3WD5A 4TSVA 4AGGA 1X9PA 2RMU2 3MIDA 5F5CA 1OLQA 2P34A 4FOQA 2XQXA 4Y5Z0 4IEXA 1YJKA 1JZ6A 2HWC3 1UZZA 1JOPA 2XKOA 3NNFA 4GB33 4B4RA 2JIGA 1I9RA 4XIOA 5DXDA 1OLRA 3ZYPA 4FI9A 1IS3A 5DDJ3 5JR7B 1RUC1 2UWCA 4ARXA 1BHGA 3OSDA 5GLUA 3VD7A 5JOZA 4QPWA 3H3UA 1KDKA 2ZPXA 3PUHA 5F5AA 5DAWA 3NV1A 4CUAA 4D6SA 4V2WA 4AEDA 3D0SA 4Y5SA 4FCAA 4ISRA 4CSWA 1PVC1 1J84A 1VB4A 3N4MA 2TBVA 3I49A 4LLOA 2HYXA 5FYUA 1QIQA 4MGTA 2JDYA 4NIGA 1V9U3 2YFUA 1REDA 1H2MA 3VD3A 4RQPA 4QD2A 4PDWC 4GH4C 4UOJA 1SLIA 3LA3A 3CJIC 2BYVE 1B35B 4YARA 1PMJX 3POIA 2UYAA 3JB4C 4P9YA 1UIJA 2WO3A 2DWRA 2BBAA 5DPNA 3VBOA 1NQDA 3CLPA 4CDXC 4QPYA 3APBA 5FY9A 4A41A 2WSUA 1RUH1 4N7IA 1MS3A 1AL23 2VMGA 4N90A 4WV8A 2WO2A 1UL9A 1OC1A 1CAWB 1VALA 4JCKA 2VZOA 3IDEA 5JOYA 1S0DA 4D3WA 1AR61 2E32A 2WQ4A 3USUB 1AR83 1WCQA 2BRTA 3D4KA 4F3JA 1GICA 4NHKA 1WW4A 5H9SA 3TYJA 2P3IA 3VV1A 3WQ1A 1YO8A 1OURA 2WT0A 3GBFA 1GZTA 4G4FA 4N8MA 2QVSB 4XDPA 5DDJ1 3VBFC 3U4XA 4ZY9A 3E5UA 2Q8DA 1PNFA 4Y5TA 3PJQA 2R063 4M01A 5FYBA 4LULA 1NLQA 3MF6A 1OVPA 3L9JT 2X05A 3RJ2X 2ORXA 1W6MA 1SBEA 3VZNA 2EA7A 4YFWA 1NQJA 4CP1A 5A3OA 5AC92 3UETA 2XQRA 4DINB 1RIRA 3Q8CA 5C4WA 3WG2A 4YM1A 5BNOA 3LQCA 1SFYA 3KVAA 1R1ZA 1HXS2 1HV1A 1W9FA 4Q4V2 3RG0A 1TME3 1L7RA 3CL1A 5I0DA 2DTWA 3PNAA 1RUE3 4EWEA 2KA3A 2Y6FA 3EJKA 3KF3A 1UYZA 2V73A 2EIDA 3T4HB 3OUHA 1D7PM 3H42B 2Q8OA 4C90A 4EN7B 5A3NA 4OUEA 1E5IA 4YVWC 2E26A 4UFMA 4GMP0 1Q5OA 3UGHA 5FZKA 1UWWA 1VAVA 1PMHX 3DN7A 2DVFA 4RD7A 1AL21 3A22A 1LHUA 3B93A 4LBQA 1GKBA 1ZZ9A 2ZABA 4YM3A 3HN3A 4YW7A 1RUNA 2CDPA 1QWRA 1L7QA 4JGZB 1AR93 1W05A 4BIFA 4RFRB 5LK7B 1CWPA 3LGRA 1HB2A 4GULA 1UX6A 4ONUA 1OOPA 2W0XA 1MZFA 4CXWA 1QMJA 2BOJA 1EPZA 1HKDA 5I93A 5K8SA 3GZUC 1SBDA 2R061 2X09A 4I0BA 4BISA 1DQ1A 2AREA 4LKDA 4K6BA 1XNCA 4QM9A 2ARAA 4KI5M 1QXRA 1JI6A 4IESA 4Y1VA 4CCDA 5JSRA 1PO23 1NCQB 2EXJA 3ACLA 4I3PA 4I0AA 3THTA 3B69A 4FOWA 1XSRA 3KVBA 2IWGB 1LOGA 2WWSA 4WBBA 3T2PA 2WRAA 2VZTA 5FY4A 3O5SA 1J1TA 1WKYA 3WNLA 4XW3A 4RSUA 3GNEA 4AW7A 2DUPA 3BUCA 1CAUA 1DGRN 4JQRA 1NY71 1SFPA 1TME1 1GNHA 3QCWA 4H7LA 4RR3A 1OUXA 5F5QA 2XPJA 4BQXA 3NW4A 2O1QA 5LBFA 4ZXKA 1OPMA 1RUE1 2ZKLA 4PCRA 4MV2A 2W1QA 2D6KA 1DGWA 3UJOA 4ASLA 1R1A3 5FLIA 1Q8OA 1YI9A 4J6GA 1FMD3 4DXZA 5FWJA 1ULGA 3LDBA 4BLIA 4C8DA 2HLEA 4U2AA 5FZ0A 5HXMA 4TYSA 2WSVA 1KRIA 3E97A 4JGYC 4LO6B 3ZMOA 1EYBA 1WMDA 5FZ1A 3RZZA 4ZS2A 2D40A 3HVDA 3NJZA 4IERA 2HBUA 2NMOA 4HXCA 3O1RA 5HBAA 1LEMA 3KM5A 1AR91 2R042 4YWAA 4DRRA 5A33B 1SCRA 2HJIA 4QQPA 5F6LB 5LBBA 4AAPA 3LDKA 5GLZA 3U10A 4A45A 3FBMA 5E16A 2X5IC 4AI3A 3GJBA 1G8WA 5D8AA 3BN6A 1TG7A 1W3VA 2BTVC 1JZ7A 4YVSC 1ALYA 2H0VA 2IXIA 1PNGA 4NAMA 4LBKA 5HV0A 4UBGA 3HOBA 2IUWA 2ARBA 4WM7C 3AP7A 1PO21 1E5SA 1NUKA 2F6BA 3GYDA 1SLBA 1Q43A 4S2HA 1SPPA 4XBNA 2JD9A 1EV13 4FFIA 2AZ5A 2EF6A 5FXXA 4Z2AA 5FYIA 1LEDA 2QBXA 4CCMA 2Y6GA 2ZX0A 5A70A 2RG4A 5BNPB 5FZEA 1CGPA 1F5FA 1H8TC 2ARXA 4N43C 5ABJC 1ZRCA 2AYHA 1BZWA 4JKKA 3AP5A 4AVBA 3RZGA 3CZUA 4JTNA 4NMIA 1R1A1 4XC9A 1RUOA 1XOYA 3OBAA 4Z2WA 1OVSA 2ZACA 1BCXA 4WVMA 4CU6A 3LZZA 3HBZA 4QDQA 4XF0A 2JICA 2WLPA 5LBCA 3RI9A 2GALA 3OTFA 1U5IA 1OHFA 1D4VB 1H2NA 5FYYA 4NIIA 3NJYA 2XVLA 2B8MA 1LECA 1VLNA 4BPZA 2WFPA 2R6QA 4Y4RA 3VBHC 4UF0A 1GWKA 2QCSB 4IW3A 4R9BA 1Y9MA 1PGW1 3POGA 2VZ3A 5FKBA 4XETA 1KFXL 2EIEA 4XF9A 4A4AA 2CAUA 1ONAA 1ACCA 4BZ4A 3UT0A 1K5MC 5LA9A 3V64A 3AKRA 5AVAA 4BA6A 1BEV2 3AP9A 4QPIC 3FC0A 4QX5A 1S4CA 3LEKA 4JTOA 4UT5A 1JZ4A 3KGLA 4CA9A 2Y33A 4L97A 3LSDA 4NUBA 4YW4A 1OH4A 1V6NA 3LOIA 4GH4B 5IFTA 2VOXA 3J7HA 4PI0A 3W5MA 1WMXA 3CJIB 1ZZ7A 2JDMA 2Y64A 5F3CA 4CEWA 1LKNA 3R4UA 4KH9A 4CDXB 2UY8A 5FPZA 3WEZA 1VBD2 2V4VA 2DV9A 2P17A 3AZVA 1HRV2 2W68A 3VB9A 4AWDA 3DKWA 4COYA 2ZBJA 1Z7S2 2YFZA 2OS2A 2ZEZA 3LDRA 4CUBA 1DQ4A 1W2OA 4RFT0 2HWB2 2IFRA 1DIWA 2QKDA 5F5IA 2ERFA 5K0UC 1W8TA 1REEA 1GOGA 1CAXB 1GBGA 1H1AA 1NG0A 1ZA4A 1OMIA 1BYHA 4PIYA 2XVKA 1JH5A 4HK8A 3I2DA 2KXLA 2Y0IA 1ULCA 3OGRA 4MVTA 2J1SA 4GJZA 3VKFC 2G4IA 3ZFGC 2B39A 1UIKA 1YRZA 5K4LA 2YG0A 1ND3C 1AX1A 2HEVF 4OULA 4R9DA 4C0BA 5L9VA 4Q4Y2 2QQWA 3VBFB 5ISLA 3S5AA 1OF3A 4OZXA 4LHLA 4W65A 1BVP1 2FDJA 2DVDA 1IPJA 3UKTA 1KXGA 1NT0A 2RMU1 4AR2A 2XHNA 1H2KA 4RHV2 5C9AC 4AVTA 3T0AA 3NAPC 2WNUA 1W90A 3B9IA 1WBLA 2VW2A 1LOFC 1RUG3 2W5FA 5KC5A 2CYFA 2ZGTA 4CU9A 1FATA 2PQSA 3VKLA 3ZM8A 4RS5C 3HD8B 2JE7A 4YW2A 1DYKA 1UY3A 3J7LA 5CKMA 3OUIA 4E4HA 2J7MA 5L9RA 3MBWA 1NA1A 2D6OX 3AMPA 2QQKA 4LA2A 1AYN3 2QQVA 2CTVA 4K7JA 2LW8A 5FP9A 1SCSA 2DUOA 5CB7A 2FMDA 2ET1A 5C33A 3U75A 4FOYA 2W39A 4YVWB 2HH9A 3JQXA 1X50A 5FBZA 3W59A 5KXEA 4IV3C 4XF3A 5FPXA 2QQJA 1WW5A 4WM8C 3WP4A 4P9WA 1WD3A 1IS6A 2RM23 2HWF3 4S2FA 3IDBB 1MEC3 1NE4A 4D0QA 4FQZA 2GC3A 3VHPA 2R49A 4LUKA 5JDBA 1ZRIA 4QHZA 1Q3EA 2VU9A 5FQ0B 3I59A 4HKLA 3ZFFA 5FPUA 4CP0A 2Y26A 2P6CA 5A32B 2X8KA 5J48A 2WYSA 5L19A 2WT2A 1UKRA 3C7HA 2RS53 4R8HA 1DZTA 5HCBA 3GHNA 5FMCA 3VBUC 3K48A 4MGIE 3SNMA 1JS9A 4BXSV 5F9TA 3FFZA 2XLAA 3KSCA 2CWMA 3PVNA 4JHTA 3VDDA 5IATA 1LOCA 1QNWA 5FO8B 5AFBA 1MS1A 3VLBB 2IXKA 1SZBA 5IHRA 2W1SA 2VNGA 1RUG1 2PLV3 4BH9A 5G05L 2C5DA 5CFDA 1O7FA 1I3HA 4HPKA 3W9AA 5CADA 2C0ZA 2B7YA 2ZGSA 3GJAA 5C8WA 1SFNA 4AL9A 4MO3M 3MLKA 1F5JA 4GWIA 2WZPP 3KCYA 4COWA 4XHXA 2LS6A 1AYN1 4K1YA 4FSJA 4XPVA 5IUQA 5JLVA 3N7JA 2CHHA 3DPRA 3S5QA 4QHOA 5FZ6A 3AX4A 3S30A 3WF1A 1HXS1 4Q26A 5JIUA 4YLZA 2RV9A 3AZYA 5LB6A 1BXHA 3WDVA 1YFXA 5A7NA 1GUIA 5C5TA 2RM21 4DRVA 2VQTA 2HWC2 3SLIA 4GB32 2VW0A 4QQ2A 4JGYB 1JYTA 3S57A 2A1XA 3AJZA 3ACHA 2RHPA 5C8CC 1K12A 2BW8A 3ZR6A 1J59A 1OKOA 2OPKA 5A7PA 4PBOA 4Y22B 4NJ4A 5IW0A 4BDVB 4M0NA 3RZHA 1RTVA 3DCQA 4QGMA 4MHRA 4W6XA 4U36A 1IGOA 4PJYA 4YVSB 5F32A 3NSTA 3WX5A 4AFMA 2ZKNA 1DQ5A 1H30A 2D6PA 5BUVA 1V9U2 4WM7B 1T2XA 1FV3A 3BALA 2R043 1I5PA 3AYAA 5L7OA 1G86A 1NXD1 3ZR5A 1MS4A 3NJXA 1S0JA 3OB8A 1SLAA 4B7KA 2ZZQA 3MUY1 2PLV1 3HQUA 1W04A 5JZGA 4QWNA 3Q8FA 2G9GA 2VY0A 2A70A 4ZU7A 1H8TB 3AKPA 3O0XA 4N43B 3NNJA 5ABJB 4XDQA 1JZ3A 1QDOA 1VRH2 3RZLA 2IFWA 3JUUA 2OYZA 2Y8KA 5A3PA 1S2BA 3IN9A 2E7QA 3EYPA 3VL8A 2ARCA 4OCTA 2XJQA 1X8MA 4N53A 5FZ3A 3KGZA 2BP6A 2YB7A 1B35C 3GZTB 4HKWA 4MLOA 3RWNA 3I3MA 2VOTA 3ON7A 4FPEA 1A6CA 4LBOA 4Q0SA 3KD4A 5B2GB 1Q8SA 3O1MA 2W91A 4Z82A 1AR82 5CFCA 2JG8A 1WCDJ 3AVRA 1GMMA 3I2JA 3M8LA 4HANA 4LHSA 1W03A 2ZOEB 3H3ZA 1UOJA 2LALA 3O0WA 4H14A 3RYPA 3VBHB 1CQ9A 4AI8A 4CCNA 2BFUS 4BJ0A 3AYDA 2VOWA 3J8F2 3H0OA 3PUSA 3FE5A 4XJUA 3LA2A 2GC1A 4AE2A 3ZSKA 2WS92 4XFBA 1D2SA 1UW8A 2NLRA 4Y20A 1GNYA 3VN4A 4COVA 1ULDA 4QPIB 3KZ4C 1UO9A 4M3CA 1RYYA 4GMP3 1CN1A 1YIPA 3LPGA 3ST7A 4B1LA 5JXHA 2ORZA 4NOTA 5KWRA 2JKXA 2WN2A 2FDFA 3H8UA 4O65A 4OHZA 2RDRA 2R041 1TME2 3AYCA 4YGBA 5FUPA 2RS13 2BV4A 3HAGA 4YFZA 2X29A 1LESA 4AQTA 3C7FA 4CDUA 2WQ8A 1RUE2 5FP7A 3H8RA 5EJ1B 4RN5A 4XUTA 3VZKA 3BOPA 3PUQA 4X6QB 1GR3A 1POV0 1JHJA 2Z69A 1V6JA 3LD8A 4IV1C 5K0UB 4ZXEA 3BGAA 3FHIB 1GZWB 3AK0A 2JE8A 4Q1RA 4XOGA 5F7UA 1OT5A 2XL7A 4MXWA 3ZFGB 3NKGA 2CY6A 1QOOA 5FUIA 2EIGA 4RA0A 2A6ZA 1PK6A 1Q8PA 4Z92B 1H6XA 1ND3B 3ZSJA 2WABA 1UAIA 2HWB3 3N9OA 4O9GA 4K3UA 4AVVA 4DY3A 5GZEA 1WBFA 3IB3A 3TNPB 1AR92 4XFCA 1OD3A 3VZLA 3VZMA 2B5HA 1VBE3 5FZOA 3VZOA 1RHI3 3WCSA 1LR5A 2GH8A 4LR4A 1TMF3 1D0HA 1M06G 1JW6A 2GMEA 1L3JA 3NAPB 4NO4A 1PGSA 3KHBA 4YSFA 1OA3A 3M7AA 3J9SA 2PXJA 3AMMA 3FX3A 4FFHA 1SBFA 4MXVA 4Z07A 1PHMA 1XC6A 5FZBA 1PO22 3U78A 2ZZJA 2XLFA 4RS5B 3N7MA 1AXZA 2JJ6A 3TRSB 1ASJ2 3DXTA 3M1HA 1ODMA 1SEFA 1GV9A 4RHV3 3W5NA 1H8VA 1RUI3 1ZBE2 1W6OA 5FYCA 5JSOA 1UMHA 2XJRA 4Y3OA 5DUXA 3MV11 2VZRA 2WUHA 2QZ2A 1YC61 2W08A 3IPVA 4AFCA 2RS11 4K8FA 1MS9A 4P9JA 4Q8KA 3OBRA 4FO9A 1BEV1 5JI7A 3PL0A 1QKQA 1H2LA 4G9SB 2BNOA 3OGSA 4IV3B 3O1UA 2J1UA 4J1WA 4WM8B 1A78A 3J4UH 2GN7A 4MZUA 4XTPA 5FYTA 1R1A2 4N9IA 5I0UA 5EHDA 3WNOA 1GQHA 4UAPA 1GP4A 3NV3A 3OY8B 3SCGA 2H6CA 1FMD2 3MPPG 1W2TA 3H3LA 5FJKA 2E7TA 5EQUA 1JZ2A 1ZBA3 2DVGA 1XU2A 4IEWA 5KBFA 1HRV1 1C5IA 2BVBA 1UZWA 5F3GA 2ZGKA 1S2EA 4FPFA 5F3EA 2G9FA 1Z7S1 2DYCA 3PIGA 2HWB1 3BB6A 1PGW2 3CMGA 3M70A 3BTYA 3WCRA 5C3OA 2W52A 3UYJA 3H8XA 3JBG3 4XTMA 1X8EA 2VTXA 2ZGMA 1VBE1 3IIAA 1MS5A 3VKOA 4SLIA 4BQ5A 5FZMA 1TMF1 2VNRA 1LJ7A 1W39A 2HYKA 2PN5A 3GZAA 2FCUA 2VNOA 2HBTA 4I2OA 2R7EB 1D2QA 2B9VA 4XAEA 1H9WA 3AXEA 2PHXA 2I45A 4LTAA 3MDPA 4IE7A 4PDWA 1EV12 3MF9A 3AFKA 3ALQA 1W9SA 2CL2A 4RHV1 4XYXA 4CP9A 1KS4A 1XYOA 2B45X 4NHYA 5JXJA 4AI1A 3KT4A 4EN6B 2BERA 2GZWA 4E4ZA 4BCUA 1SLLA 3I3QA 1WLWA 2MHFA 4LUMA 5EWSA 4HVQA 5F6KA 3LOBA 2YBSA 4D94A 3VBRC 5FYSA 3HT1A 3H7YA 4HONA 4H2AA 1UYYA 1XNBA 3INAA 1WCKA 2W87A 1IS5A 5IAVA 4FQ4A 1YUDA 1M4WA 2XUEA 5LBEA 1XNAA 2V72A 3GGLA 3VGIA 2IXJA 5BXXA 2VECA 4B3NA 5IFPA 4OFGA 2GN3A 4XMIA 5C8CB 1GOHA 2JB8A 3JXSA 3ZSLA 2Y0OA 4D7SA 1PO12 3OBTA 4IQPA 3UK9A 5JSPA 4DY5A 1H9PA 3RZKA 1YJLA 2WC2A 4PF5A 4XXAA 4V2VA 4AQ2A 2DBNA 3N9MA 3JBG1 1LULA 2NMNA 4Q8LA 5FKCA 3DV8A 4AQSA 3Q8EA 2WWJA 1I5ZA 1WCUA 5F8PA 2J1VA 3WG4A 1O59A 4ZONA 4CDQC 1JYIA 2WZR2 1FV2A 2R073 4F7ZA 4GWNA 5JAXA 2KR2A 3MIHA 4QGNA 4YM2A 1J1LA 5GZFA 5FWEA 3KT7A 2VZPA 1LU1A 5A3LA 3AXDA 4QM8A 2ID4A 3DYPA 4LK7A 1NE6A 3VDBA 1MVEA 3GXUA 3ZDVA 4CVUA 1VIWB 4ES8A 1Q8VA 1S0GA 1K45A 3CJXA 1W9WA 3P3NA 3WNNA 4XCAA 4BQ1A 2UURA 3X29B 5BY5A 2XUMA 3WHUA 2Q8EA 3DGTA 3GCXA 3ME2A 1W8WA 5J36A 5T5OA 1F35A 5T55A 3V0AB 1VRH3 2VPVA 2D6NA 3BKZA 1ZRFA 3KLSA 3PU8A 1OFSA 4WZCA 4NHMA 4H3WA 2OW4A 4QX2A 1MZ5A 1W6QA 4L11A 1UXXX 1DGRA 5HI0A 3T09A 1UPSA 1LGBA 2C6SA 1G7YA 3MICA 4JHZA 4ZKTB 4F8AA 3I2GA 1BLZA 3ZFEA 5J37A 3M2MA 3IBMA 5A3MA 5EYYA 2BGPA 3N9PA 4X8NA 5IAXA 1QJU3 4R9AA 2HWC1 4GB31 4XF4A 4S2DA 5K9YA 5HCHA 4FPOB 1W8FA 3UL2A 3K4AA 1RUG2 4QPGA 4A42A 4QU1A 2EXKA 1FPN3 2K2SA 3IKWA 3J8F3 3SITA 4DZGA 3SH5A 3P1IA 3R4SA 1PZ8A 3MW3A 2WS93 2E63A 3VBSC 5F39A 1QGLA 3H8OA 3N7LA 4FT8A 4NVPA 1QOTA 1FT9A 4HSJA 5BNNA 1AYN2 5BPXA 2QQLA 2WFF3 2WNVC 3ATGA 2YXSA 4WVWA 4Q4X3 2ZGPA 3H1YA 4FVVA 5D2AA 1G9BA 3B9CA 2XJTA 4YG3A 5JOXA 3I3BA 2Y6JA 1V9U1 2LRPA 1L7LA 2ZMNA 2ZHNA 4IV1B 4JRAA 4DIQA 2FD8A 2AC1A 4GA9A 4KBZA 4AXOA 5FP8A 1ND2A 2YYOA 4JRLA 4Q27A 1O8PA 1R64A 3BTAA 2RM22 4UFIA 4LLFA 5F2WA 2HWF2 3DYMA 3ZXFA 1HB1A 1MEC2 3N36A 4YZ2A 1A8MA 1QJY2 2ZCWA 3WUDA 2D98A 3RS6A 5FZ8A 2FDIA 5T5PA 3OYWB 5C3QA 1XYNA 1VRH1 4X8PA 3POFA 4ZU4A 1N3OA 4MGSA 4Y26A 3FN9A 1W6PB 1SLCA 1VBB2 2NQYA 4FTBA 2AENA 2OUJA 2R30A 3NVCA 3PTYA 3V65A 4AEDC 2RS52 1RUD2 1JYVA 5A7WA 4MGYE 4YG6A 3BI3A 1W6NB 2X5IA 3M3EA 5DABA 1AR81 1ENRA 3M3OA 3POEA 1JTZX 1ZX5A 1ZZ8A 4P9XA 4XUNA 1QJU1 4Y4YA 4YZ1A 4DO0A 1G9AA 2FHRA 2EAAA 2Z79A 1EP0A 4RQPC 4JDMA 4CU8A 1HRI3 2ZX3A 3KMHA 3EXUA 2PLV2 1F31A 3PURA 2Z2SB 1KEXA 2ZXQA 5I0RA 5JPMB 4CPBD 2J1RA 3CDZB 3J8F1 4XQWA 1DZQA 2ZX4A 3RMXA 3WV6A 4CUCA 3VBOC 4NIAA 2ATFA 4LBLA 2WS91 3MW4A 3POSA 2DCTA 4PHZA 3V0BB 4BLJA 3LKJA 1NCRA 2QDNA 4LQRA 4RL7A 4OI4A 5FZAA 4LHKA 4AZZA 3A0NA 1ASJ3 5F2SA 1LODA 2DUQA 1GWLA 1ZBE3 4NWVA 5DAVA 3ZN5A 5FXVA 1R083 3ZLIA 3I2KA 4M0HA 4LE3A 3RSJA 4NPLA 5F3IA 1OI6A 1NXMA 1DQ6A 1JN2P 2PYTA 2VVFA 2JEMA 1HB3A 2RE9A 1OD5A 4LBJA 1JYNA 1D4M3 4DXTA 2WL1A 1CAVB 5IT6A 1CIWA 3L2HA 4XCBA 1CIYA 4FTEA 2R16A 1F4AA 3ETQA 3MLJA 1N1VA 2EVXA 2OPWA 2PAMA 2ZX1A 4Q5OA 4ZU5A 2BWCA 3FZ3A 2P4EA 1W9TA 4NROA 1OFNA 5DZGA 4XJAA 2ZGRA 3CEWA 3AZXA 4GALA 2ILMA 4PLNA 5IK7A 2PTMA 4K40A 3HPNA 4GIQA 5LRRA 5C4WC 3FHAA 1NZIA 1TEIA 1K5MA 3BIWE 4ASKA 2YC0A 4BHPA 4IGOA 4D8MA 2D6MA 2VGDA 1O3TA 2JIJA 3D8CA 4AHZA 4CP2A 5KHHA 2VXRA 2ZGLA 1QDCA 2HWD2 1V0AA 1URXA 2GMMA 3U1XA 2LTNA 1R093 2GNDA 1OBNA 1CZTA 4XZPA 4I09A 2GAUA 3LEIA 2QNKA 3CNAA 3THCA 2JENA 3VBRB 4DUXA 1UY1A 4JQTA 1ASJ1 4DNYA 1FOD2 2VW1A 1ZBE1 2JG9A 2WO7A 2WYFA 1Y9QA 2A73B 3FWEA 4MYEA 4HG6B 1R081 4PIXA 4E2GA 4H55A 1W99A 2A3YA 4FPKA 4EJRA 5C3SA 5FLHA 3UNPA 3O1OA 4JDOA 3MHZA 3QOPA 3AMHA 2XONA 4PT6A 4BE3A 3WDUA 3UGGA 1O4YA 1ZVFA 1JYWA 1Z0HA 1W2AX 5FP3A 3FLTA 3SC7X 4AFAA 1OOPC 4FFFA 1JBCA 1BVVA 3GALA 1LOAA 3VDAA 3SEEA 2Y6HA 2XH6A 4AAXA 4ZZ5A 1HQWA 1T6GC 4Q0VA 2JDUA 1GP6A 1AR73 3MUZ1 1FMD1 5LY2A 3PMEA 5C9AA 2V09A 3EBRA 2V5YA 4LO8A 3ZXEA 4Z1VA 2YC2A 1KJLA 2X10A 3HN1A 4QQLA 3I3EA 4CDQB 4DQAA 3RZMA 1PO13 2XMLA 3ETPA 2Y34A 3PUAA 2YBKA 4BQ3A 4QU2A 3O1PA 4B4QA 2WKKA 4YW1A 1GWMA 1OUSA 1UOFA 1CVNA 4L2NA 3SQOA 1OQDA 2RS12 4RR3C 3BU0A 2A3WA 2BPA2 4NPMA 5LA0A 4XUPA 1Q56A 5FPLA 1BK1A 1IOAA 2WZR3 1R091 2Q30A 1XNDA 5FV3A 5IK4A 3K46A 3T1MA 1NAEA 3E6BA 2FDKA 5JIAA 5IVCA 1U12A 3QACA 4O7XA 1EV11 1LHNA 1CPMA 1AX0A 1PX3A 3HNYM 3LEMA 4WVVA 2ET7A 2Y38A 4LK6A 4W8JA 4CRQA 1VAKA 4X6RB 1SG3A 3MIGA 4QKNA 1SHWB 4L8QA 1CX4A 1Y9GA 3I2FA 3WF2A 3HWJA 1VMJA 4P9LA 1MQTA 1W2NA 4NN0A 2D5HA 5JR2A 1RUF3 1YQ8A 1X33A 2GNMA 1VBE2 1DF0A 3C3VA 2D7FA 1RHI2 4XBLA 3G6JB 4KWJA 4YPJA 3WF3A 1US3A 1TMF2 2RVAA 3C7EA 4MSVA 2RR12 1QJFA 5D8AC 2JB4A 5B4XA 4IE6A 2GU9A 3IM0A 3VBUA 4CPBA 3UKVA 2Z5WA 4KU8A 3WP5A 1AHSA 4XBQA 4MADA 2VXJA 2GC0A 1CJPA 4GWMA 1FNYA 1G9CA 1RXGA 3VBSB 1PO11 3RZJA 1RUI2 1UNBA 4J25A 3PVBB 4LOTA 5FMDA 5IVEA 3A0KA 3ZN6B 5GALA 4B29A 2JXAA 5DQ0A 3H9AA 2E6VA 1RGSA 2WNVB 5GM0A 2RDQA 2VZSA 5T5LA 5GLWA 1S2KA 1WZXA 3WDWA 3BODA 4IEUA 4YRDA 3DEMA 3LCPA 3NV2A 1RC6A 1IKPA 4AEKA 4RGGA 4CZSA 4XJWA 3NQHA 2WZR1 5A3TA 4UW3A 1WLTA 3CF6E 2NN8A 4CDWA 4XF1A 4L99A 3MIEA 4KMQA 3GBGA 4E8DA 2XJPA 2CGNA 1IPKA 2ZX2A 1RMU2 2VMDA 3FJSA 3HBKA 4KGQA 5FAXA 4QB2A 3VUOA 1ZBA2 2VQAA 3A21A 4XACA 2JWPA 2MEV3 3KV9A 3IMMA 1H1MA 2VM9A 4FPLA 4AEDB 5J3UA 3K75B 3SMHA 1BK0A 4FXGB 4QAWA 5CG9A 1DP0A 3I8TA 3OGGA 1MZ6A 4LBNA 1QJY3 2XHKA 5D1IA 3WSOA 4CEYA 2HEWF 3HIFA 3JBG2 4R4XA 1DGLA 1RUF1 2C9AA 2GNTA 2K9ZA 2GMPA 1V6IA 4LITA 3ZMNA
chains in the Genus database with same CATH topology
3ILFA 4XHBA 4LO5B 4AG4A 3D82A 4I30A 4RQPB 3ZO0B 1UPIA 1VBB3 1H4GA 3JZVA 1DGWX 3WVJA 4EN8B 2GH2A 4AEJA 1SLTA 2A3XA 5FTTC 1RUD3 4AVCA 4EN0A 3ECQA 4EV0A 4V1PA 3WDTA 5E1RA 3VBOB 4BM8A 4AVAA 2FQPA 1YFUA 2D97A 4D7TA 1XU1A 2N7GA 4AI2A 2YPJA 5KHKA 4Y1YA 5GZGA 4NWWA 2XG3A 4ISQA 1LB2A 1WMEA 5J7MA 5CG8A 4R9CA 4YG0A 1J3QA 2PELA 4KG0A 3VKNA 4HK9A 3QBQA 5JI9A 2SLIA 1FXZA 1B35A 1V6LA 2O8OA 1ZM1A 2BFUL 4IEPA 3WHTA 5H9QA 2DF7A 3H1WA 1VJ2A 1AJOA 2XWJB 1NZCA 1UD1A 1W6MB 4YM0A 3S7EA 4Q0PA 2XGXA 1JXNA 4PBPA 3WP3A 2FZ1A 2HWF1 1MEC1 3S0MA 1CAWA 2WNUC 1UU6A 1QJY1 1SQ4A 1PM7A 1WLDA 2E9QA 5C4WB 3E6DA 1QQP3 5FMOS 3USUA 5BNOB 4YNIA 4EWAA 4JAAA 4XXPA 1OQEA 1VBB1 1S1AA 3URFA 5KXBA 2R072 4IEOA 3O14A 2VH9A 3W58A 1NA1C 2RS51 2ZTNA 1RUD1 3WQ0A 3UJQA 2D3PA 3ZDSA 4IEVA 2DCYA 1AL0G 1O4TA 2HWD3 2OVUA 4URTA 1BMV2 1S55A 3VHRA 2QJVA 2WQZC 4LBQB 1ZRDA 5EZWA 3U11A 3QH7A 1C1FA 3NL1A 4FAGA 5H9RA 1VBA3 3ZFFC 1NLRA 1JHNA 1OOPB 1FOD3 4EN9B 4C1XA 1HQNA 4AVSA 4OI2A 1AX2A 2ENRA 4UW4A 1XQNA 3ZYRA 2JDZA 2EALA 3VDDC 1ENXA 2BVVA 1QJU2 4P5HA 1PGL2 1MS8A 2HWE3 2DVBA 4N9HA 4TZDA 1UMZA 3HQXA 5CFDC 1FPN2 4MX3A 1DQ2A 4JGZA 4KWKA 5J96B 1CAUB 3MFCA 5ACA2 4RR3B 3HMYA 1DYPA 1XE7A 2ZHLA 4CTEA 3LWCA 2F4PA 2YZ4A 3ZIXA 2XJVA 3M3QA 2WFF2 1H0BA 3GBWA 4Q4X2 1EAH3 3DPRC 5J98B 3ES1A 3VHNA 1NCQA 1BBT3 1UF2C 1YXWA 2A6WA 1WMFA 2PHUA 5EJ3A 1WLCA 2HWD1 2P37A 3TB0A 1X82A 3B00A 3TAYA 4E2SA 4XMAA 3MYXA 5T52A 2BGCA 3B01A 5DUWA 3S7IA 2QFEA 4M3CE 4B4PA 4D7YA 1FX5A 4BYYA 3IWZA 2ZHMA 3M3CA 1FOD1 1LCLA 5D8AB 5HCFA 4Q1PA 4KG8A 3WG1A 4Q0QA 1OKQA 3B7MA 4LBMA 2XVGA 1GZCA 1F8VA 5L7OC 4HSLA 5CAZA 1HRI2 4DMIA 1WA4A 2RR13 5T50A 2TEPA 5JZGC 4BOWA 3EQEA 1AYM3 4DS0A 5A33A 1DFQA 3R4DB 3U07A 5FO9B 1NOVA 3ES4A 1LHWA 4UBHA 4KQ7A 3SCHA 4FPCA 2RJLA 1Y7BA 1G9DA 1VR3A 3WDXA 5KXCA 4GMP1 1W2UA 1Y3TA 1EAH1 4N53C 3B94A 5I0TA 4WVMB 1QJX3 1R082 3I7DA 3JQWA 3BCWA 1W0PA 1ENQA 2PHRA 1JUHA 5KHIA 4HZFA 3RQ0A 5CFCC 2JG8C 3OD0A 1D4M2 3H7JA 1U5YA 3O7OA 5BNPA 4KNCA 3AKTA 4XILA 2A6VA 2MNGA 4C91A 2VMIA 5LRSA 4BMBA 1RMU3 2VQ0A 4AI0A 3HT2A 3ELNA 2ZS6B 4XE9A 1U5ZA 3H1MA 2WINB 2XJSA 4Y1XA 4P14A 3SCFA 2UWBA 5E89A 4CEWB 1N1TA 4OHYA 3ZSMA 2B9UA 3VZJA 4M00A 1RVF3 3Q9OA 1RHI1 3KCCA 4IL7A 3KS7A 1HLCA 2RR11 2ZAAA 5JPNB 1AYM1 4YW5A 2XKPA 1R092 1OA2A 2PHWA 2D5FA 2ZAHA 3ZX7A 4META 1YWKA 3ZYGA 4INDA 3NWKA 4E27A 4GH4A 4HN0A 3AZWA 3CJIA 1RUI1 3BPZA 2X53S 2XB6C 3LA7A 1PK6C 5HCAA 1AZDA 4DB5A 2VMHA 3T2TA 5EFUA 4CDXA 4E4SA 1B09A 2D93A 3THPA 3ZPYA 3SXWA 3N35A 1N1SA 2ES3A 2WNUB 1V6KA 1CAXA 1C8M2 1AR72 1S0EA 2AUYA 4QXKA 5I0SA 4NPRA 1RMU1 2AR6A 1ZRRA 1QXPA 4UW6A 1ZBA1 4Z8BA 1YYNA 3VBFA 1GZ9A 4DOUA 1F9KA 1NA1B 2E53A 1DZRA 3RJRA 1C28A 1A8DA 2CNAA 5I8SA 2VOKA 2VUAA 3MFAA 4HL0A 1RVF1 4ATEA 2BNMA 1AXYA 4K20A 1RUH3 1KD7A 2WIIB 4A7KA 4ATFA 3RNSA 4EROA 4XFIA 3MW2A 5FREA 5GJ6A 1IZ3A 1C3HA 4OI0A 1AR63 3C2UA 4XJ9A 1S0BA 2JKBA 1ZYBA 2BUKA 1GYKA 3I59B 3H50A 5DG2A 1PMIA 1GFF2 3ZFFB 1AJKA 1ZREA 3MIBA 5LEKA 2E7AA 1PVXA 1V00A 4QT6A 4XJ8A 4YVWA 1YFWA 4COZA 2PHLA 5FOJB 5JMCA 1RUF2 1SMVA 1V6OA 3VDDB 3WNXA 4AF9A 3FMGA 2LM3A 5H9PA 5E8AA 1YHFA 2YGMA 2Q1MA 1RL3A 5CFDB 4HPKB 5FQ0A 2D3RA 1COV3 5A32A 1AXKA 2LUWA 4HN1A 3E6CC 2CGOA 1UZYA 5JCTA 3JCIA 3B02A 2VVDA 1RUJ3 3DPRB 2H6BA 2Q0AA 2JX9A 5CU1A 4XQ4A 1N3QA 3VL9A 2ZGNA 5ACA3 2YV8A 2YROA 2QZ3A 2NZ9A 4JC1A 2TNFA 1VP6A 2R071 2OZJA 1G6NA 4Q29A 3MLLA 1RJ7A 1MVQA 3WQ7A 1IHMA 2BBVA 4IEYA 1UCXA 1KDMA 2A5ZA 2DVAA 3E5XA 2PA7A 2MEV2 2OZ6A 2C1FA 4HLTA 4MGZE 2GSYA 5FFOC 1CONA 4P9GA 1BMV1 4HFSA 4AK3A 1QNYA 1XRUA 2PAEA 1JOJA 2CWSA 5T5JA 1TE1B 5EXOA 5L7OB 5KXDA 4JGYA 2P3KA 1UU4A 4WVZA 5FDBA 3KT1A 1SDWA 2FMYA 3DUIA 5DUUA 3GF6A 5JZGB 1HDKA 4R4ZA 1COV1 4Y22A 2ZGOA 2DCZA 4LA3A 3RYKA 2XLGA 1VBC2 1TNFA 1GQGA 3RYRA 3SH3A 4YVSA 2ZJCA 2ZA9A 4YYOA 3R6SA 1PGL1 2YY1A 1RUJ1 4N53B 5E88A 1Q8QA 4AFDA 4WM7A 1HX6A 2WA3A 2GC2A 1FPN1 2RS33 5ACA1 3D6EA 5SV5A 4I01A 5CFCB 2JG8B 5SV8A 2H0BA 1QF3A 2WT1A 4Y1UA 5IK8A 1H8TA 5ABJA 2WFF1 3BOWA 4N43A 4Q4X1 5LEJA 4YZ4A 3POYA 3AB0A 3TN93 3RPQA 3ZFEC 3O12A 4Y20B 2OIIA 1V70A 4M3CB 2UU8A 4XIKA 3OPZA 3IMNA 1NYWA 3MGUA 3ZYIB 4N7UA 3SHRA 1I6XA 1QQP2 4QPGC 3TOJA 4FAHA 1N47A 2IZWA 1OA4A 2D44A 4QGLA 3ENRA 3VBHA 1O91A 2Z42A 4CDUB 2IXLA 1YIFA 4FP3A 3ZXDA 1GLHA 5GLTA 4OI1A 4AEMA 5BNNC 1H4HA 1ULFA 3WINE 3RDIA 2R1DA 5BNOC 1KFUL 4QPIA 3WG3A 2IXHA 3NV4A 2WNEA 1ND2C 4MXWB 1HRI1 5CA6A 1FYUA 5I8YA 4YZ3A 1QHDA 3AP4A 1PK6B 3WP6A 5IK5A 3AMQA 3VHOA 2RS31 3WW3A 4JV4A 5KC6A 1VAMA 4OHXA 3OF1A 3G7DA 2A6YA 4P9IA 2NPIA 1VBA2 4TWTA 1ZZCA 3MPBA 3EHKA 2BNNA 4XEZA 1GSLA 3ZSEA 2PQQA 4OHVA 2R1BA 5J09A 4Q0UA 3LSEA 3AKSA 1DDLA 4AGVA 2E51A 5K0UA 4F83A 3TN91 3JD72 1GZWA 3WLUA 3AKQA 3IDCB 3ZFGA 3ZVXA 3MI8A 3AJYA 1E57A 1D4M1 1ND3A 1YCIA 1EPWA 1OSGA 2HWE2 4XQDA 1UU5A 2CV6A 1W6OB 2I74A 4E9KA 1DQ0A 2WLQA 4FPGA 1C8M3 3IPVB 4GQ7A 4JVAA 1MR5A 5GZCA 3WOGA 4NR1A 5KHGA 1C5HA 4E4DX 1NCRC 1POV3 3N7KA 4W6YA 3NAPA 1YLLA 2QUOA 4CYDA 1LOFA 4AGRA 1EY2A 2A6XA 1EAH2 4XFGA 1APNA 4PIZA 4QMAA 5I8TA 1BBT2 3USSA 4RS5A 2ZGUA 1MZEA 1QJZA 3RRDA 5GLVA 5KHJA 1VB2A 3KB5A 4LO4B 2QQPA 3ZXGA 4EWDA 5BYNA 2D6LX 3BU7A 3PHMA 4IV3A 4WM8A 2RMU3 3SISA 1W0OA 4A3XA 1O3QA 3OY8A 3T1LA 3FLPA 2VVEA 1Z78A 4HVRA 4UW5A 3QH6A 2VUJA 4I3GA 1FNZA 2XBO2 1KQRA 3MZHA 2TUNA 4LEJA 3WDYA 1C8NA 4PDWB 1DLLA 1DG6A 5GKAC 1O5LA 1I1EA 3D0JA 2JD4A 3E5QA 1AYM2 2EAKA 5F1RA 1BKZA 5DZEA 3JB8A 1C8M1 1AR71 1LHVA 1RITA 3JU9A 1OQ1A 5TSWA 1RINA 1POV1 4QHBA 2DCKA 1JYCA 3AFGA 1PIV2 2JG9C 3WR0A 1QJX2 4HVOA 1KITA 5AFEA 4YGEA 3FFQA 3LAGA 4B7EA 1LENA 2YGLA 1C4RA 4YGCA 1YFYA 1CESA 2PHTA 1JUIA 1WGPA 1FI2A 4R52A 1ULEA 4L92A 4FP2A 1WW6A 4LT5A 4XFFA 5FMOL 1CD3G 1XXNA 5FOBB 1QXJA 2Q4SA 2AGSA 4Q4W2 2P2KA 3OD4A 2B42B 2DFBA 3ZXKA 1GNZA 2GNBA 3M4FA 4C1WA 5C8CA 1CR7A 1HV0A 3KCXA 3WY6A 3ZYJB 5DG1A 5K7PA 3R05A 1Y43B 2WJSA 1J58A 4AHYA 4MGKE 4JDNA 1RVF2 5AC93 5FLJA 4K9SA 5C6CA 1DU3D 3MEPA 1LRHA 2XL9A 2R0FA 2UWAA 1QH7A 2PFWA 3ZIWA 2JE9A 2DURA 5L73A 1DHKB 2Q5TA 4GXLA 4HBNA 3ZXAC 2CGPA 1HXS3 2BQPA 4FPHA 4Q4V3 4CEWC 1XNKA 1VBC3 4ES9A 4QQOA 3AP6A 4HMZA 3O0VA 1BJQA 4YW3A 1W6QB 2PHDA 1RUC2 2R32A 5HXVA 1C1LA 1N3PA 2QE3A 3ZN4A 1UKGA 2YDEA 3J26N 4FXKB 4W6WA 3QD6A 2JECA 1MQTC 4PLMA 3ZFEB 1O4ZA 3PVEA 2ZGQA 4GKXA 1TNRA 4B8EA 4KGGA 2QDRA 3ILRA 3ZXLA 1S0FA 3FBYA 1WW7A 3IT8A 4WZFA 1PVC2 4BMEA 1CPNA 1F2NA 4MUVA 3PLQA 5I91A 2A75A 4QPGB 3FUQA 2ZMLA 2VOVA 3V0AA 1C57A 2UYBA 2MEV1 1LGCA 5GZDA 4A7ZA 1HW5A 2K0GA 4RGAA 4AQ6A 1IS4A 4HT1T 4AHXA 3WW4A 2FZ2A 5BNNB 2DU1A 5T54A 2GDFA 1AF9A 1SACA 1RJ8A 2O8QA 5AC91 3NKTA 2ETEA 2DTYA 4FPYA 3WW1A 3MIFA 1RUH2 1ND2B 2D3SA 3AMNA 4I02A 4I0WB 4CDWC 2D43A 2HKXA 3M3IA 5EYXA 4Q4V1 4FPJA 1XYPA 1AR62 1N1YA 1VBC1 4KL1A 2XWBB 2A7AA 3S6PA 1UN1A 1FAYA 5DZFA 5DDJ2 1WD4A 1YNAA 3K51A 3AYEA 3QLQA 4IV1A 4CEYC 3OJBA 3SH4A 5L36A 2X5IB 1HIXA 5CVRA 1X7NA 1X36A 4COUA 4HETA 3R0RA 3L2YA 3I54A 2UY9A 4AHWA 3D5OA 5JDBA 2IXCA 3OYWA 1LGNA 1COV2 5T3NA 4H7MA 3JD73 3POWA 5FO7B 3B3QE 1W6PA 2IC1A 3CU7A 5DUVA 1YI7A 4OUMA 2I07B 4QQHA 1NCRB 2O0OA 2VG9A 3V56A 5CIRA 1WUVA 4IETA 5JVVA 3PMSA 3PJYA 1PZ9A 1RUJ2 4LO7A 1QQP1 4BIOA 1W6NA 4LE4A 4YGDA 3TBDA 1PZ7A 1AVBA 1S0CA 2MPFA 4UXAA 5AVPA 1AL22 1S0IA 2PAKA 1QOSA 5BNQA 1HQLA 4KU7A 4Y24A 4ORFA 2DFCA 3V0BA 2VULA 4DFSA 1QU0A 3HR9A 4L9BA 2A71A 2YMZA 2AH2A 3N3HA 2R062 1ZZBA 3WW2A 3ZXJA 3VKMA 1K5MB 4ASMB 4SBVA 3WT3A 1QH6A 1O3SA 3KQRA 1REFA 2P3JA 1VBA1 1LOEA 1CAVA 1KJRA 4FTSA 1V6MA 4D69A 1IKQA 1MACA 4E2QA 1NY72 3GHMA 2FBEA 3DF0A 3JD71 1G9FA 5JOWA 5BV6A 1BEV3 1A3KA 2XBO3 4J1XA 2CAVA 2OUHA 2NP0A 2PHFA 2XJUA 3A4UA 2BEOA 1WCSA 2HWE1 3DL3A 4K21A 2JG9B 1ENSA 1TQ5A 2YHJA 2RS32 4GKYA 3ROUA 1J3RA 5FCCA 1DBNA 1VBD3 3RI8A 1HRV3 1ZNPA 4LHNA 1RB8G 3OGJA 4ITCA 1Z7S3 1O5UA 4PQ9A 1U5XA 1PIV3 1LTEA 1J3PA 5EV7A 1BBT1 4LNVA 3LB9A 1ZZ6A 3TN92 3VBRA 3OCPA 5