1GV9A

P58/ergic-53
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
228
structure length
223
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLDGPVFGSADMWNGVGIFFDSFDNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Carbohydrate Recognition Domain of P58/Ergic-53, a Protein Involved in Glycoprotein Export from the Endoplasmic Reticulum.
pubmed doi rcsb
molecule tags Carbohydrate binding
molecule keywords P58/ERGIC-53
total genus 48
structure length 223
sequence length 228
ec nomenclature
pdb deposition date 2002-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gv9A00
2R0FA 2DURA 1GNZA 5CBLA 1LOAA 1G9BA 4Y1UA 5CA6A 4YGDA 4GKYA 3N7MA 3VKFC 3RG0A 5IK8A 2E53A 1LOEA 2EIGA 3WCRA 5IK4A 4Y1XA 3OBRA 1Z78A 4RL7A 5IUQA 2A70A 5SV8A 1KDMA 2A6WA 4DFSA 3I4IA 3HMYA 3NV2A 2UWAA 3FLTA 1SLBA 2AYHA 3OYWB 1DLLA 5DXDA 2A71A 3WVJA 2WKKA 4CRQA 4YW2A 2BQPA 3SH4A 5IT6A 2ARBA 3WNXA 1OKQA 1C1FA 1I3HA 1GBGA 1AX1A 4LBLA 1WLWA 2CNAA 2JJ6A 4M01A 3FFZA 4MYEA 2P3KA 2UWBA 1MVEA 3POWA 1AXKA 4XJ8A 1QMJA 2EXIA 4UW6A 3VKLA 1AJKA 4Y22B 3OY8A 5FREA 1WW4A 3ENRA 4Q1PA 2PHUA 4XE9A 2FMDA 1IKQA 3RSJA 3ZVXA 1W6PA 4Y20A 5H9SA 3IMNA 2VW2A 4XMIA 4YM1A 4LBKA 1UZZA 1LECA 3TAYA 3WG3A 4C1WA 1CQ9A 2AGSA 1QKQA 2XG3A 4JRAA 4UW4A 4YW1A 1Q8OA 1LEMA 4YM2A 3AFKA 3N35A 5EXOA 5GM0A 3ZSJA 4CZSA 3FUQA 2DVBA 2ZMLA 2GNDA 3ZXLA 3ZSKA 2D6LX 4DRVA 3SITA 4ISRA 1BZWA 1N3QA 4D69A 1Q8PA 1SLTA 2LTNA 1UL9A 1CN1A 2NP0A 2WSVA 4UW5A 1CJPA 1ULGA 2G4IA 2ZBJA 4FOYA 3V64A 1MZ6A 3M3QA 1JN2P 3ZSMA 2YZ4A 4R9CA 1IS5A 2CWMA 2FHRA 4YZ3A 3TB0A 4XBNA 3VV1A 5F9TA 2ZA9A 4FPFA 1MS5A 2A6XA 3AP5A 4SLIA 4YG3A 1SLAA 1V00A 4LBQB 3ZXKA 4R9DA 1GZWA 4K1ZA 5IK7A 3WHUA 2P3IA 2WSUA 3H0OA 2JE9A 2EAKA 3M1HA 1Q56A 4M3CA 2R1BA 5T54A 1W6MA 2W08A 2GNMA 2GMEA 2YXSA 1VIWB 4R9BA 4XBQA 1AF9A 2DUPA 4W65A 3L2YA 1O4YA 5F5QA 3HR9A 2PHTA 1IS3A 3AP4A 1MS4A 2D6OX 1ULDA 1FNYA 2OVUA 4BMBA 3ZYPA 3D4KA 3UJOA 3V0BA 1N1TA 3FUOA 2EXJA 1WCSA 2ZGOA 3BOPA 2WT0A 2A75A 2ES3A 2ENRA 1G9AA 3JU9A 3USUB 2R0HA 2ZGPA 3ASIA 3SH5A 1KQRA 1MACA 3CNAA 1URXA 4IQPA 4Y24A 1H30A 2A3WA 4M00A 2E7QA 2DV9A 2CWSA 2DUOA 3U4XA 2W39A 3WDUA 4XMAA 1AZDA 2WLQA 4ATFA 3M3CA 4M3CF 2JDZA 3OBTA 1N1YA 3AP6A 4XOGA 5E8AA 1V6NA 5GLUA 1LHVA 3MEPA 1ULCA 1LGCA 3OY8B 5T5JA 3OJBA 2AENA 3JUUA 2R1DA 3R05A 1I1EA 5GJ6A 2H0BA 1AX2A 1CONA 1DHKB 3RQ0A 1SLIA 3POYA 1ZA4A 2WJSA 4HL0A 1IOAA 3AK0A 2R49A 4Y26A 1UMZA 4XBLA 1W0OA 2AREA 2Q5TA 4FPYA 1F31A 1FAYA 3PJQA 3OPZA 2EF6A 1GNHA 4GWMA 4Y1YA 1ZM1A 4DS0A 1UKGA 2VW1A 1AXYA 4AVTA 1LU1A 1TEIA 3BIWE 4YZ2A 1JHNA 4Q8KA 4JC1A 4Y20B 1CIWA 1JOJA 3PVEA 3QLQA 5LK5A 1LHWA 4ISQA 3FBYA 5T5OA 2ZGTA 3O12A 4K21A 4XJAA 2AH2A 4YW3A 5DG1A 3ZXEA 1GV9A 3PVOA 5DZGA 5CB7A 3ZYRA 3OGGA 1QDOA 3UJQA 4FVVA 4ATEA 1UN1A 2EXHA 2ZGMA 5KXEA 3ILNA 2ZMKA 1UX6A 4DRRA 3AJYA 3PMEA 2JD4A 4BM8A 1DZQA 1N1VA 3BTAA 3M2MA 1MVQA 1MS3A 3MW4A 3WHTA 2JKBA 3WUCA 4XJZA 2B7YA 4FOQA 4FOVA 4YGBA 5GLWA 1G7YA 1WLDA 5HCFA 5JOWA 1NLSA 3GALA 3WUDA 2ZHMA 3WDXA 2DU0A 3VKOA 1BKZA 5DZEA 3ZXFA 2WNEA 1GYKA 4FQ4A 3WV6A 1S0EA 3AZXA 2GN3A 1RINA 3IPVA 2DU1A 4XJ9A 2NM1A 1SACA 2A6YA 2ZGSA 2E6VA 1O4ZA 1CPMA 1LENA 5HCBA 1VLNA 3O0WA 3T1LA 2D3RA 1WW7A 1C1LA 5T50A 4YG6A 4WV8A 1X50A 1V6MA 3AYAA 1YXWA 4FPEA 5T55A 5DG2A 2GMPA 2D6NA 2ZKNA 1MZ5A 3Q9OA 1DBNA 1UPSA 1APNA 1LOFA 5JOYA 1FV2A 1LOBA 2NYYA 2V73A 3IKWA 5JOZA 1WD4A 1FX5A 3R4UA 1AX0A 1LOFC 2EXKA 2NMOA 2ZZJA 4KBBA 3N7JA 3WLUA 1CR7A 4Q1RA 5DUVA 1CESA 1G8WA 1LESA 2ZAAA 3C2UA 3MW2A 4FPKA 4PF5A 2C9AA 2WT2A 5GALA 2GALA 5JVVA 2ZABA 1J1TA 3WCSA 3AYEA 4WVWA 3LCPA 1WLCA 1G9CA 3AYCA 1DFQA 3NV1A 2GN7A 3VUOA 1DQ1A 4FPGA 3B3QE 1OFSA 4XIOA 1KJRA 1WW6A 2TEPA 4FPOB 4P9YA 2D6KA 2ZGLA 3LSDA 4K1YA 5GZDA 1ULFA 4ITCA 4M3CE 4NOTA 5L73A 3RS6A 4XTMA 2DVGA 5H9RA 3WG2A 1V6LA 1YIFA 3NWKA 3NV4A 4GALA 4PBPA 3M3OA 2ZGNA 2NZ9A 3WG1A 5GLZA 3KM5A 3V0AA 1V6IA 1WUVA 1FV3A 1SBFA 4P14A 1SCRA 4U2AA 1Q8QA 4GXLA 1S0FA 3APBA 4F83A 1FATA 2KM2A 3FLRA 4BPZA 3AXEA 4FOWA 1C4RA 1W6NB 1YI7A 5T5LA 4GWNA 2ZGQA 3WDWA 1S0JA 4XHXA 4CTEA 1QOOA 2DVDA 4YM0A 1SCSA 2ARXA 4LBNA 1QU0A 1WBFA 3AZWA 3SISA 1XQNA 2VY0A 2ZMNA 5GLTA 3AJZA 1IS6A 1ENSA 1W6OA 1SBEA 2VUAA 3B01A 2P37A 4FP2A 4Z8BA 4P9WA 2SBAA 1MS8A 3WDTA 5CAZA 4K20A 1MR5A 3UK9A 3QCWA 1SLLA 4ASMB 4FPLA 4FPCA 4XYXA 1KJLA 1DQ0A 4FPHA 5KXDA 3ILFA 4FPJA 4HANA 1IS4A 1Z0HA 1G86A 2CL2A 4LBQD 3W58A 4DPNA 1Q8SA 4GKXA 5KXCA 1QF3A 3WZ1A 1KDKA 1V6OA 3VKMA 3AYDA 1GZWB 1YYNA 3HN1A 3N7KA 3O5SA 4XHBA 5BYNA 1LEDA 5HCAA 1V6JA 5GZGA 2OUHA 1LCLA 2ZHKA 1IKPA 2EALA 1QNYA 4YGEA 1Y7BA 2PHWA 4AYUA 5JOXA 2D3PA 3O0XA 4XXAA 5DUUA 3SNMA 1AXZA 2SLIA 3INAA 3PVNA 1MS1A 3ILRA 4UW3A 1JBCA 2P3JA 1LOCA 1WW5A 1YRZA 1HDKA 1JYIA 4JCKA 1W6QB 1MS0A 3V0BB 1GKBA 5EYYA 4YFZA 1LHOA 3D6EA 1S0GA 2Z42A 1PZ8A 1BYHA 3I8TA 1QGLA 4LBOA 5T5PA 4AWDA 3AX4A 3B69A 1D0HA 1LGNA 4Y1VA 2W52A 2E7TA 4NO4A 3UL2A 5DUWA 3KQRA 4BMEA 4TYSA 1FNZA 1N3OA 1DQ5A 4XJWA 4YZ4A 5GZEA 2A3XA 1RIRA 1CPNA 1V6KA 4OZXA 1LHUA 1A78A 5DUXA 3SH3A 1R1ZA 5JMCA 4YGCA 4M3CB 4WZFA 2VU9A 1BQPA 1JYCA 2NN8A 1Q8VA 1S0BA 3W59A 4U36A 4C1XA 1W6QA 2WQZC 3N36A 2P2KA 1AJOA 3IM0A 1YO8A 2LALA 1ENRA 2OUJA 3DGTA 3R4SA 4I30A 4XILA 5JLVA 1D2SA 1CVNA 2C5DA 1UAIA 1BXHA 2A3YA 1DQ6A 2XB6C 1W6MB 2VW0A 2DWRA 1QNWA 3POSA 2YMZA 4AGVA 4AGRA 5GZCA 3M3EA 3ATGA 5T52A 1QDCA 4YZ5A 1DQ2A 2I2SA 2W68A 5GZFA 4PCRA 3DUIA 4ZKTB 4TZDA 3AXDA 1GZ9A 1B09A 1VAVA 4Q26A 4XDQA 1PZ7A 2NMNA 2AUYA 1LHNA 1W0PA 3RMYA 1S0IA 3V65A 1UZYA 4BOWA 2A6ZA 3O0VA 1BJQA 2ZHLA 5KXBA 5JDBA 2DVFA 2PHFA 2PELA 3AP9A 5CNAA 5GLVA 1JUIA 4YG0A 3T2TA 2DYCA 1KRIA 1DYKA 3A0NA 1HQWA 3AP7A 4P9XA 4DQAA 4YLZA 1H9PA 2ZGUA 1LTEA 2OW4A 1A8DA 4ZXKA 2GMMA 3SLIA 4XJUA 4BQ1A 1F9KA 4LBJA 3RMXA 1JXNA 2A5ZA 3USUA 1A3KA 1LOGA 1SFYA 4YM3A 4Y22A 3A0KA 2YROA 2CTVA 3B00A 2UWCA 4XXPA 3FLPA 3N3HA 4AVVA 1SLCA 2UURA 1LODA 4Q27A 4PBOA 1C57A 1GZCA 1W6PB 1S0CA 4FQZA 1ENQA 1GSLA 1U0AA 5IK5A 3A4UA 4XZPA 1HKDA 1W6OB 1W6NA 4L8QA 4Y1ZA 2ZGRA 1ULEA 2ZGKA 3NV3A 1S0DA 2DTWA 2ZHNA 2ZACA 1JW6A 3T1MA 3AZZA 1G9FA 3GNEA 2YV8A 1F5FA 2VH9A 1N3PA 1DQ4A 2YY1A 5EYXA 1HQLA 3AZVA 2P34A 2WT1A 1OQ1A 1GANA 2D6MA 4LBQA 2V5YA 1HLCA 2AR6A 1DYPA 2D44A 2JE7A 3LSEA 3N7LA 1GICA 3OYWA 3RRDA 1WD3A 4RA0A 1FYUA 2PHXA 4WVVA 5FRAA 2GNTA 3IPVB 4XTPA 3B9CA 2D6PA 4H55A 5H9PA 1DGLA 3AZYA 2CY6A 1PZ9A 3V0AB 5E88A 1WBLA 1AVBA 2DTYA 5H9QA 1LULA 3IN9A 5DZFA 2GNBA 1LGBA 1RITA 1DIWA 1H9WA 4R9AA 2D43A 2R16A 1S1AA 2A7AA 4XIKA 1MS9A 4AGGA 4BLJA 4Q2FA 1N1SA 2E51A 5E89A 1VAMA 4GA9A 2PHRA 3BODA 2GDFA 3D5OA 2A6VA 4LBMA 3WDVA 3WOGA 2JECA 4FP3A 2D7FA 4YW4A 1LU2A 4BLIA 1LJ7A 1ONAA 3ZXJA 3MPPG 5EWSA 3ZPYA 2DUQA 3WG4A 4YW5A 4AVSA 1EPWA 2D3SA 1GLHA 4YZ1A 1QOTA 2UU8A 2VXRA 3MW3A 1VALA 4PQ9A 5AVAA 1NXD1 2ERFA 1KITA 1SBDA 2CYFA 3WDYA 1QOSA 2DVAA 2HYKA 1G9DA 3VKNA 4YFWA 3ZSLA 2RHPA 4Q8LA 1N47A
chains in the Genus database with same CATH superfamily
2DDUA 1QJY3 3NNLA 4K9SA 3NJYA 4IV1A 2PHLA 2WO3A 1RUJ3 3MPBA 2QQKA 4A2UA 5CBLA 4GKYA 3N7MA 2J1UA 1CD3G 3LAGA 3POBA 2VM9A 4QPWA 2RJLA 1HRI2 1GOFA 2EIGA 4IV1C 2GC2A 3NRUA 2JICA 4Y1XA 2Y60A 3JZVA 4J6GA 5BY5A 1KDMA 3IMMA 4WM8B 3NV2A 2UWAA 1VRBA 2WO2A 2W1UA 3ZFFA 2H6CA 4NJ4A 4AFDA 3VL9A 1ZNPA 4BIOA 2A71A 3JBG2 3RVHA 4OI0A 2BQPA 1AYM3 2JD9A 3SH4A 2VZQA 2CGPA 2UY9A 1O3RA 3WNXA 1OKQA 4W6YA 5C3PA 1C1FA 5IJRA 5F2SA 2UY8A 3RWKX 1NE4A 3LPFA 2P3KA 5JI9A 4QXHA 1ZBA3 4JDOA 2ZTNA 3AVRA 4IGQA 5AFBA 2X09A 1WW4A 3M8LA 3C3VA 2P6HA 1IKQA 3MF6A 4Y20A 1UOJA 2VNOA 2BWAA 2VW2A 2JB8A 3WF2A 1CQ9A 2JG9A 2XUEA 1QKQA 1RUI3 4JRAA 3JBG1 4RD7A 1COV1 3DPRA 1LEMA 3K46A 3OGSA 4MGQA 1AR71 4NIDA 5JSPA 2IXHA 3FFQA 1L7QA 3FUQA 2GNDA 4QPIC 2E26A 1I5ZA 5FUNA 1W2AX 1PVC2 1RYYA 1E5SA 2D6LX 4DRVA 4AI0A 4QQOA 4QPIB 5BPXA 4B29A 4D69A 5AC93 1MQTA 5ACA3 4YVSC 3H7JA 5J96B 1CJPA 1ULGA 4FOYA 5T3NA 1RL3A 1MZ6A 2WAOA 4LKSA 4QX1A 1OD5A 4NE9A 4E8DA 1IS5A 2CWMA 1STMA 3BPSA 4CCEA 4EN9B 5FMOL 1NE6A 1EAH1 3LKJA 4Z82A 2FDFA 3NW4A 4QXKA 5J09A 1AUYA 1W04A 4YG3A 1TME1 1V9U3 2V72A 1SLAA 4NHLA 1RUC2 4ES8A 4R9DA 1GZWA 4QDSA 4AVAA 1T6GC 1X9TA 2Y6FA 4QQ2A 3VB9A 3BUCA 4CDXC 1AYM1 1BK0A 3AMHA 3SEPA 3VD5A 1ULPA 1W6MA 2ZPXA 2GNMA 2XWJB 3J9SA 3NAPC 5ABJC 5ANQA 4CDWC 2RDNA 1J59A 1MEC1 4FXGB 1AR63 5FDBA 3AP4A 3DL3A 1J84A 4M0NA 2OVUA 2IXCA 3LE0A 5C9AC 3WP4A 1GWKA 1HX6A 2EXJA 2R072 4QPGA 2R6QA 3USUB 5EJ3A 4BH9A 4WVMB 5K0UB 3I59B 3CU7A 3H3UA 1AYM2 4AW7A 5BNOC 2RE9A 5GKAC 4JTOA 2IVIB 3WNNA 1OLRA 5KR7A 5L7OA 1AR93 5FCCA 1JZ8A 2D97A 3I97A 4QQPA 2JG8A 5FZKA 2HJIA 1WKYA 2OS2A 2WLQA 4IW3A 3ACFA 4LEJA 4E9KA 3URFA 2HWC2 4L97A 3AB0A 2X10A 5E1RA 1W8UA 3VBHB 3OY8B 3R05A 1AX2A 1DHKB 3RQ0A 2N7GA 4HL0A 1O3TA 5A1FA 5LCWL 1UMZA 3AMMA 2WC2A 3LB9A 1WGPA 2Q5TA 2WO1A 4FPYA 4IXLA 1KFUL 4JTNA 4P9JA 3ZOIA 3LQCA 2EF6A 4GWMA 4QHOA 2HWB2 1PX4A 3TWIA 1UKGA 1PIV1 4DOUA 4ASLA 4DEQA 3HIFA 5FXXA 2EAAA 3BIWE 1JHNA 4Q8KA 4CDXB 1Z7S2 1RUF2 4Y20B 1YQ6A 4ZU7A 1ENXA 3PVEA 1LHWA 1MEC3 2PQQA 2Q1ZB 3LA7A 5A3MA 2VQUA 1W28A 1W03A 3PVOA 3HQRA 4JKLA 2WZR3 4KWKA 3N9OA 1ST8A 1UD1A 1OHFA 2Q30A 5EPAA 4ATEA 5A33B 3H8XA 1VBC1 2EXHA 4GB32 2B5HA 1ZBA2 1FXZA 4QX2A 5FAXA 5A6ZA 3HD8B 2R063 2I74A 5FXZA 4DUXA 2Y33A 2XQXA 1YHFA 2MEV2 2HWD1 2VNVA 5F39A 1VBA3 2HYXA 1ZRDA 4CXXA 1AR83 2JKBA 4JGYC 5EHDA 5CKNA 3T09A 4HPKB 4XJZA 4FOQA 2PAMA 4QQHA 4YGBA 4EV0A 2FDKA 1G7YA 2XVLA 4WM8A 1GR3A 1NLSA 3WUDA 2ZHMA 4JGYA 3VKOA 1VAKA 3POFA 3POGA 2PLV1 1A8MA 5FOJB 2RS13 3VBUB 2GN3A 3POJA 2DU1A 4AEJA 2NM1A 2A6YA 1RTVA 5HCBA 1GQPA 4MXWA 1GUIA 3WSOA 1C1LA 1FOD3 1MPXA 3LGRA 2VBBA 3OG2A 2BNMA 3RZLA 4LHSA 4BIFA 5A7QA 1YXWA 4AQSA 3SC7X 2XJRA 4O61A 4QGNA 2GMPA 2YHJA 1FPN2 5CADA 5K9YA 1MQTC 2D6NA 2W47A 1NCRB 4NROA 4M0HA 1DBNA 1UPSA 4JZRA 4L11A 5C70A 4RSUA 1LOBA 1RUE1 5JOZA 4MHUA 2XJSA 3THCA 4G3YC 1E5IA 2BPA2 4QB2A 4KBBA 2Q0AA 5C8WA 2LM3A 4X6RB 2YBSA 1CESA 1LESA 3B5LB 5FMBA 4DIQA 5JZGA 4QKNA 2R061 1SG3A 3LEIA 4PF5A 4AVCA 2H6BA 2WT2A 2TNFA 1SDWA 3WCSA 4A7YA 3THDA 4EJRA 1UYZA 3H9AA 2HKXA 1GWMA 4C8DA 2P5BA 2O14A 5KWRA 4FPOB 2XBO1 3P1IA 4BQ2A 1IQDC 1COV2 2ZEZA 3LSDA 3V65A 1F4HA 1NX9A 1ULFA 4NOTA 4XURA 4DUWA 4B4RA 1V6LA 1KS4A 1J83A 1YIFA 2YPJA 3NV4A 4N9IA 3W9AA 5KHKA 2XUMA 1OQEA 3KVAA 3M3OA 3PU8A 4P08A 3S7IA 3WXPA 5DAXA 3BTZA 3WG1A 3FJSA 5GLZA 3KM5A 1V6IA 1WUVA 4WVZA 4P14A 4CYDA 1WA6X 3N9LA 4GZ9A 5JZGB 1S2EA 1PHMA 2WZR1 1Q8QA 3K4ZA 3NO8A 1I9RA 2OX0A 5LBCA 1FOD1 3IIAA 5K8SA 3N9QA 3ZYFA 4FTSA 2G9ZA 1RJ8A 5IAVA 3C7OA 1IQAA 1W6NB 3AMNA 3LA3A 1CIYA 5FZ1A 5T5LA 4ZHNA 3ZSEA 4GWNA 4B3NA 4LO5B 2C1FA 2ZGQA 1AR82 4UFMA 4W8JA 4CTEA 4LPLA 1XE8A 1US2A 2DVDA 3ETPA 4XEZA 3U37A 1QU0A 1CAUA 3FZ3A 3KGZA 4YYOA 3SISA 2ZMNA 3AJZA 2VL4A 1ENSA 1W6OA 5F32A 1A6CA 2BYVE 5DAQA 1H4HA 1C5IA 1T2XA 3I2IA 2L9LA 4FP2A 4UXAA 1QH6A 1R091 1UWWA 3WDTA 5CISA 4FFHA 2CAVA 4K20A 3VBRC 5E16A 1RMU3 2K0GA 1RB8G 2HLEA 1O59A 2WNVC 4ASMB 2YBKA 3MUY1 1V9U1 3ILFA 3KD4A 4AHYA 3MYXA 4YPJA 1V70A 2ZKLA 5IVBA 2CL2A 4LBQD 3RZKA 3USSA 2Q8OA 4AI1A 3H8OA 4JGYB 1W2UA 3CF6E 1Y9MA 3AYDA 5I0RA 2ZEYA 3N7KA 3ITQA 4UFKA 5BYNA 2OUHA 4LULA 3WX5A 1BEV3 2F4PA 3DCQA 1CAVB 4JKKA 2EALA 2JIJA 4D0QA 2VG9A 3S30A 3U0ZA 5FZ7A 1KD7A 2PHWA 3J7NA 2X8KA 5DUUA 3O0XA 3SNMA 3PVNA 4B1MA 5FYSA 4MSVA 1LOCA 1RUNA 5L7OB 1K42A 4XUNA 4YW6A 4GWIA 1JYIA 3OUJA 1MS0A 1NYWA 3RZZA 3V0BB 4HLTA 3D3AA 1HB4A 2Z42A 4WM8C 4OYUA 4CP2A 5C7GA 3E6CC 3WP3A 2B4KA 3S7EA 1QGLA 1JZ3A 3TEYA 2E7TA 5DMYA 5DUWA 1QXPA 1XU2A 1N3OA 4NVPA 4A6OA 2MEV3 4GMP1 4N43C 4RS5A 4AEDC 4OI1A 5J37A 4OZXA 1POQA 1A78A 3A23A 3J4UH 4ASKA 4AI3A 5JMCA 4H7MA 4M3CB 4WZFA 4NIIA 1JYCA 1OSGA 3W59A 1RUD3 2BGOA 2BOIA 4NRPA 4CU9A 3NL1A 1RJ7A 3H1WA 4DXTA 4HK9A 1AJOA 2CGNA 3R4SA 3MZHA 1QQP3 1ZZBA 2XLGA 2C5DA 2Y0IA 3CIHA 2VW0A 3POSA 2VZVA 3KVBA 5FK7A 3M3EA 3AKQA 3ATGA 1VBA1 3PURA 1AR61 4EN0A 4CP9A 5GZFA 2HWE3 3R4DB 2WA4A 4Q4Y1 3WF4A 1NLQA 5CFDC 3O1PA 3AXDA 1LNSA 3BN6A 4XDQA 5FPLA 5LK7B 3A21A 3UKVA 3RMYA 2LW8A 4LR4A 5EJZB 2HEYF 3PIGA 5J7MA 4JHTA 1S55A 3UT0A 2DCTA 2ET7A 2JDAA 3LA2A 2PTMA 4QGMA 5HXMA 5GLVA 5FUIA 4YG0A 5ACA1 2DYCA 1WWYA 2PXJA 5CFCA 4CU6A 2CAUA 4ZS3A 1BBT3 2WN2A 5A80A 1HQWA 5JPNB 4QXBA 5C6CA 1PO21 1UY4A 2BDRA 2G19A 4ZZ8A 3BKZA 1ZZCA 5CEHA 3WW4A 2QQWA 3SLIA 5FOBB 1XB9A 4BQWA 2XLFA 5DAVA 3USUA 1X7NA 1A3KA 3ZMOA 1VRH2 3RZHA 1BLZA 4YM3A 3K48A 4EROA 2XJTA 2YROA 1RHI2 4XQDA 3FLPA 3N3HA 3T2OA 4AVVA 2WNOA 1LODA 4IEXA 4P9LA 1S0CA 3GJAA 2X5IB 2X53S 4SBVA 1SFPA 4FBFA 5J48A 2ADEA 4EWEA 2WNUA 4Y1ZA 1H6XA 1S0DA 5FO8B 3E1F1 4DXZA 3EJKA 1VBB1 5FP9A 3S0MA 1G9FA 2HWB3 3OGVA 4GAZA 4OHZA 1HQLA 1ODMA 2P34A 1OQ1A 1GANA 1PGSA 2D6MA 3RZJA 2YU2A 4CDQB 4CVUA 2AR6A 1W90A 2ZS6B 1Y9QA 3LSEA 5DDJ2 1MZEA 1RUE2 3DV8A 5FZCA 3RRDA 4AHWA 3IZOA 1G6NA 1FYUA 3FN9A 5A3WA 2GNTA 4HKLA 4LLOA 1H1IA 3O1UA 3PNAA 4YVWB 1LAJA 1HRI3 1PZ9A 3V0AB 2V5DA 3MIBA 4B8EA 4DO0A 1UY1A 3KSCA 3CJIA 1LGBA 2B39A 1DIWA 1WCUA 1X8MA 5EP9A 4E4ZA 2YFZA 5BNQA 2RM21 2R16A 5F3EA 1IZ3A 4BLJA 2AZ5A 2Y6HA 1AHSA 1EYBA 1N1SA 1VMFA 2VO5A 1BHGA 1JU4A 3ZYGA 5JZGC 1VAMA 2P6CA 3RJ2X 2FQPA 3HNBM 2K9ZA 4ZPIA 1RVF3 3SXWA 4CU7A 3D5OA 1RHI3 1ZZ6A 3LPGA 3WDVA 1ZZ8A 3WOGA 4I01A 3KF3A 5HPOA 1ACCA 4NPMA 4UI9L 4YW4A 1LU2A 4I3PA 3MHZA 2QQNA 4IE5A 3ZLIA 2HWE2 3WF0A 3MLKA 3HNYM 3ZPYA 2HWE1 5EWSA 1W8WA 4HVQA 5AVPA 4ES9A 4IEZA 4AVSA 5FY4A 1CGPA 2CDOA 1GLHA 3CMGA 2UU8A 4W50A 4EQVA 4I0BA 1VALA 1VE0A 2EIEA 1ZX5A 2VQAA 2XDVA 3HT2A 1EAH3 1O4TA 1O8SA 1NXD1 1UMIA 1SBDA 2YU1A 3E6DA 2CYFA 3MBWA 3T2PA 3ST7A 3WDYA 1W8ZA 1UU4A 3RPQA 1E5RA 1K12A 1XC6A 3VD4A 1N47A 1LHNA 2VZOA 2IXLA 2VE1A 2DURA 1AR72 1BBT2 1UMHA 5CA6A 4YGDA 4C91A 3VKFC 3RG0A 4ZY9A 4DZGA 1HJFA 3AKRA 3WCRA 2VMEA 4I2OA 5IK4A 3OBRA 2Q8CA 1O5UA 1Z78A 4RL7A 5IUQA 3W5NA 1H8TB 3OTFA 3TRSB 4Q4X3 5FPZA 3JB4C 5FPAA 3ZKYA 2AYHA 3IAQA 1SEFA 5FJKA 3WVJA 1ZRIA 5C5UA 4YW2A 5A32B 1K3IA 1NOVA 3BTXA 1M4WA 1I3HA 3TEXA 1GBGA 2Z69A 4LTAA 1WLWA 2JJ6A 3POWA 4GWJA 1QMJA 3VBFC 4CDUA 3OY8A 1RMU2 1LKNA 2PN5A 1RUD2 4GMP0 5HI0A 1SZBA 2GH8A 4Q1PA 1ND3C 1HB2A 2FMDA 1CAWA 4PI2A 3IMNA 3SCGA 2J1AA 4RFRB 2RM23 5FY5A 4UW4A 4R52A 5EQUA 4QMAA 5I91A 2E9QA 3AFKA 3AM2A 3N35A 5GM0A 3RFRA 3FHQA 3ZSKA 1W05A 1N3QA 1POV1 2LTNA 1UL9A 4UW5A 2ZBJA 2ET1A 4A41A 3M3QA 4XQ4A 3ZYBA 1GP6A 3ZSMA 1IPKA 3VV1A 5BNOB 1JZ4A 4XBNA 4LJHA 4FO9A 4FPFA 4AQ6A 2C6SA 1WA4A 2A6XA 2RS31 1C8M3 4NRQA 1VRH3 3HQUA 4SLIA 5FY7A 2OZJA 4BQXA 4LBQB 4OLLA 2ID4A 3PVBB 3WQBA 4FAGA 1NCQB 4K1ZA 3S5QA 4LO6B 3WHUA 3JXSA 2BZDA 4HVRA 2LRPA 4A6SA 2WSUA 4QM8A 4CP0A 2IVJA 4V2VA 5C3RA 1KS5A 3M1HA 2EAKA 2OZ6A 2ZX3A 1Q56A 1OLME 4M3CA 1FMD3 4Y33A 2W08A 5C3SA 4BK5A 2YXSA 1H2KA 4R9BA 2NLRA 1H1AA 1QWRA 1O4YA 3TEWA 1BVVA 3OB8A 1UPIA 2PHTA 5LBFA 1JI6A 4AL9A 1IS3A 2PAEA 4UWDA 4XUQA 5CFDA 2ATFA 1QHDA 3V0BA 1DZTA 2VTXA 4LE4A 2I45A 3OGRA 1XSQA 2ES3A 2ENRA 2ZAHA 1OUSA 3JU9A 1JS9A 2ZGPA 4NAOA 1VRH1 1OH4A 2GP3A 4NPLA 2D98A 3CNAA 4LT5A 1H6YA 4Q0PA 4Y24A 3GCXA 5BNNC 1UF2C 4M00A 3UKTA 3GJBA 3U4XA 1CJDA 2WZPP 5CG8A 4GJZA 3RZMA 3BOWA 3HPNA 5ACA2 2NQYA 4KNCA 1ZVFA 3M3CA 2QJVA 3OBTA 1N1YA 2J42A 5JR2A 1KFXL 4XOGA 5E8AA 1YQCA 5GLUA 1GOGA 4W4ZA 4E4DX 3MEPA 1AYN3 1LGCA 1ULCA 4XFBA 4BB3A 1C8M2 2RS52 3OJBA 4CUAA 3ZFEC 4PDWB 5GJ6A 4AAXA 3E6BA 5HBAA 2W1WA 1ZA4A 4K40A 2R49A 2VCBA 4WM7A 1Y9GA 4Y26A 5FJHA 2AREA 4CPBD 5CYYA 5DDJ1 1O3SA 5LBEA 3OPZA 1DF0A 2ARCA 4FFFA 2XMLA 3LOBA 3ZFGA 1RUOA 2VW1A 4CXWA 3VBOA 1TEIA 5EFUA 5FYMA 4YZ2A 4JC1A 4NIGA 1JOJA 3I59A 3POIA 3QLQA 5L7OC 1GWLA 3T08A 4ISQA 3WR0A 2ZGTA 3O12A 4EZ4A 2OA2A 2PA7A 1GV9A 2BVVA 4JQTA 1QDOA 3TEZA 3R0RA 3T30A 2LROA 3FMGA 1RHI1 3SMHA 3HT1A 4RGGA 2JE8A 2WQ8A 3SCHA 3D0SA 3AJYA 3VBRA 2JD4A 3ES4A 4PIXA 5BNPC 3RI9A 3M2MA 1JOBA 2LS6A 2RV9A 1RUF3 1MVQA 4Q4V1 3I54A 3MW4A 1CAUB 2DF7A 5BNPB 4MH0E 3WUCA 5JMOA 1VBE3 2R062 5HCFA 1WLDA 5FO7B 2ZZQA 1C3HA 2DU0A 1QJY1 1RUG1 2IFWA 3KZ4C 2WQ4A 1GYKA 1RINA 2BNOA 1SACA 4Z2WA 1REFA 3PTRB 2ZGSA 2VVFA 3CO2A 2GP5A 1LENA 2VQTA 3PL0A 1UO9A 2JDUA 2XJQA 1PGL2 3EYPA 2AC1A 2D3RA 2RS11 3KV5A 4TN7A 3FX3A 4ZXEA 4NIAA 3VHRA 1R64A 4V1PA 3EXUA 4QX5A 3HAGA 1DGWA 2A73B 5I0TA 1U5XA 1H8TC 4CDWA 3GHMA 2F6BA 5FK8A 1FOD2 1W8NA 4XFGA 5JOYA 4CCDA 5FZ3A 4CCOA 1JH5A 2NYYA 5FYCA 1J58A 4LO4B 4E4SA 1H2MA 3BIEA 4H2AA 1LOFC 4LHNA 5L36A 4IEOA 1HB3A 4RQPB 2NMOA 1UIKA 2ZZJA 2VR4A 1YUDA 4IE0A 4Q1RA 1G8WA 4MGTA 2ZAAA 2RS53 2JX9A 4FPKA 2GALA 2QZ3A 4GH4A 5JVVA 1ALYA 2WDBA 3AYEA 1G9CA 2XJVA 2IXIA 1TQ5A 2RR11 1EPZA 1KJRA 1PO12 2TEPA 3ZMNA 4QKBA 5FO9B 5A7WA 4P9YA 2D6KA 2IFRA 2XL9A 3ZO0B 4I0AA 2G9GA 1PO11 4ITCA 4K1YA 1OLMA 2BRTA 4M3CE 4XF3A 3RS6A 1DG6A 4XTMA 3ZXAC 2VBPA 1S2BA 1VR3A 4GALA 4PBPA 5FP7A 2RVAA 3GDBA 1SBFA 1PK6A 4N53B 1OF4A 4B7EA 5FYHA 4C90A 1D7PM 2XJUA 4GXLA 5J36A 4TTGA 1GP4A 4KWUA 3WQ1A 5ISLA 5I8SA 2MPFA 3C8XA 4CEYC 3I2OA 3APBA 3ZX7A 1FATA 1L7RA 2KM2A 3ZFGB 3AXEA 4AVBA 4EYUA 2VMGA 2OPWA 2V4VA 4CUCA 3ELNA 4BA6A 3BI3A 1AYN1 1L3JA 5IYYA 4XHXA 4E8CA 3BU0A 1DYOA 3K51A 3NNMA 3BVCA 5A70A 1NCQC 4TSVA 4XC9A 3QBQA 2VY0A 2Y38A 4OUSA 1IS6A 2XWBB 2VUAA 2W0XA 4Q0QA 3J8F1 2JDPA 4P9WA 4XF0A 5CZKA 1R083 2F4LA 1HJGA 2G1MA 4NHYA 1WZXA 3UK9A 3QCWA 1X36A 3IDAA 4XFCA 1VMJA 2HWD3 1RXFA 5KXDA 1JZ6A 1O5LA 4HANA 1G86A 2E33A 3KT1A 3NKTA 5A33A 1Q8SA 4DPNA 4GKXA 2RR13 4Z1VA 1QF3A 3WZ1A 1KDKA 1V6OA 2VZPA 3JBG3 3OEBA 5FZOB 1R1A1 3P6BA 3HN1A 2XOMA 2X29A 1LCLA 1W9YA 4CCMA 3FL7A 1IKPA 2AACA 4AI2A 3S5AA 3ON7A 2XXZA 2VC9A 5LY1A 3Q8FA 3I2KA 3EB7A 4XCBA 2GC3A 1UNBA 1EV13 2FMYA 3NJZA 1YLLA 2VMFA 4HN0A 4XXAA 1AXZA 1S4CA 3BB6A 1MS1A 4UW3A 1JBCA 3A22A 3I2HA 1Z7S1 1JZ7A 1WW5A 4CE8A 2QBXA 2QQJA 1HDKA 4AK3A 5C8CB 4JCKA 1W6QB 3I2JA 4N90A 4ET7A 4YFZA 3D6EA 4ZS2A 1S0GA 1PZ8A 5CKMA 3I8TA 2VGDA 5T5PA 2IXJA 1UYPA 2HWF1 3NSTA 4OMDA 1D0HA 1LGNA 1R1A3 1ZBA1 5SV5A 3UL2A 2XBO3 1YEWA 4XJWA 1OKOA 1VMHA 2W95A 2R071 3ZFFC 3ZFEA 2JG8B 1S2KA 2XHKA 1OURA 5LA1A 3I3DA 1V6KA 5DUXA 1QXRA 1BMV2 5I8TA 4QHBA 4RHV3 4XUTA 4CCKA 1H0BA 1YCIA 5LRSA 4LOSA 4DB5A 3H7YA 2HBUA 1HV0A 2QCSB 1W6QA 1UZVA 3N9MA 4UFIA 5FP4A 5C8CA 3IM0A 4AXOA 1YO8A 5FR3A 1ENRA 3K75B 3BGAA 1FMD1 4MVTA 4XILA 3VBSC 5JLVA 3VZNA 1CVNA 1UAIA 3POYA 1BXHA 2XB6C 1DQ6A 2PMWB 1W6MB 3VBSB 1UQXA 2J1SA 4DMIA 2YMZA 5GZCA 3R6SA 1J3PA 4Q4V3 2BBAA 1QDCA 4YZ5A 1DQ2A 3FWEA 3IDEA 1TME2 1VBB2 2VCAA 2WL1A 2IC1A 1B09A 1MZFA 1VBD1 4HETA 4Q26A 2NMNA 2VOKA 2BGCA 2WNUC 2AUYA 5FYTA 3VDDB 4CXYA 1S0IA 2QKDA 1YC61 3HQXA 4MLOA 4BOWA 2A6ZA 4KU8A 4QPIA 3DPRB 4ZONA 1FPN1 1W9FA 3CZJA 3GYDA 4NHKA 3RYRA 2Y6LA 4MGKE 2X05A 4BQ3A 1D4M1 4NWWA 2PELA 1CX1A 1SDDB 1UYXA 2VVEA 1O6UA 5C4WA 5FZAA 2W2IA 4Q4V2 4XPVA 5A6YA 3AP7A 4IEUA 4JKMA 4YLZA 1H9PA 2WNVA 3NNFA 4ZXKA 4OI4A 5AFEA 4MGYE 2PLV3 5FTTC 3H3LA 4XJUA 4DXSA 3K3OA 1F9KA 4LBJA 2RM22 1EV11 1JXNA 1LRHA 3CHXA 1EV12 3A0KA 1NZCA 3CJIC 3Q8BA 4Q4X2 4XXPA 4GB31 5IVCA 1PK6C 1CAXB 1SLCA 4Q27A 1RUE3 2UYBA 4PQQA 5DDJ3 5F1RA 2OIIA 1GSLA 4O65A 1U0AA 5IK5A 3A4UA 3WW3A 3ZR5A 2JG9B 4F7ZA 2KXLA 1HKDA 3I2FA 4MXVA 4L8QA 3VBFA 1B35B 4CDUC 3NV3A 1YNAA 2DTWA 1VBC3 2ZACA 4HOOA 3T1MA 1ODNA 1F5FA 3MIDA 4A7ZA 4DY3A 1N3PA 2O0OA 2VUJA 5EYXA 1HN1A 2J1TA 2WT1A 3AZVA 3WEZA 4YSFA 1W99A 1HB1A 2V5YA 1T6BX 2B8MA 2K2SA 1HLCA 2D44A 5G04L 4JV4A 4RHV1 2YGMA 4IESA 1VBD3 2HWB1 1RC6A 4K6BA 5JXIA 4XFIA 3UESA 4RHV2 4XTPA 5H9PA 1DGLA 2D40A 1BBT1 2CY6A 3AZYA 3GGLA 4QPGC 1AVBA 3IN9A 2RS51 3BPZA 4BISA 3ZDVA 5F2WA 1H9WA 5FY8A 4CEYB 1DGRA 3WY6A 4AGGA 1OOPB 4D6QA 1MS9A 3JCIA 4KL1A 1TZOA 2ZX2A 3U11A 4QAWA 5A7WB 2KA3A 1J1LA 1BEV1 2E51A 5E89A 4DUVA 2R32A 3BODA 2ZXQA 1R082 3FE5A 3LFIA 4CCNA 2FDIA 2A6VA 4JQRA 2QQVA 4IV1B 5FP8A 3I3QA 2K46A 3THTA 3VZOA 2VXJA 4BLIA 2HWD2 2Y8KA 4HKWA 1LJ7A 3DXUA 1GQHA 1W3VA 2OPKA 1ONAA 1V9U2 4IEYA 4Y5TA 4E2GA 3MPPG 3H50A 2DUQA 4N53A 4V2WA 1EPWA 5A1AA 5FYZA 4AQ2A 2D93A 2HEWF 3MW3A 1RUD1 4QKFA 3KWVA 4BK4A 4NN0A 1R093 5FY0A 1QOSA 2DVAA 1AR91 3CEWA 5F5AA 1ZBE1 4N7IA 1OA4A 1QQP2 4Q8LA 1PVC3 1GNZA 1LOAA 2RS32 5CIRA 5L9BA 1F2NA 4HSJA 3M4FA 4IUGA 1XJAA 2RJ2A 4LKEA 3T3YA 3VDAA 5BV6A 5K0UC 4I3GA 4O9GA 4D6RA 1GNYA 4TLFA 2JDHA 1KEXA 1TMF2 2A70A 5C9AB 3LEMA 3ALQA 4DFSA 4HKOA 1Q3EA 2Q4SA 3HMYA 4GULA 3PIJA 4OHWA 1FI2A 1SLBA 3OYWB 4CRQA 3P3NA 2WKKA 2PYTA 5IT6A 1NY72 4IE4A 2VOVA 2EA7A 1NY71 3VZJA 3NQHA 1AX1A 1ULOA 2BERA 4LBLA 5FBZA 1NQJA 2CNAA 4M01A 3CJXA 4OQ8A 2UWBA 5JPMB 2RDQA 4UF0B 4QU2A 3VKLA 1U5ZA 4Y22B 4B7KA 5FREA 2A1XA 3ENRA 1TMF1 3HEIA 5JI7A 3RSJA 4NUBA 3ZVXA 4L2NA 3J8F2 2W9XA 1LECA 5TSWA 3WG3A 4D8MA 2AGSA 3WP5A 4IERA 4YW1A 1D0GA 4YM2A 2Q8DA 3PMSA 5FBJA 3NKGA 2DFBA 5C4WC 3ZSJA 2JG9C 1DGRN 4NPRA 1AR81 1H2LA 2DVBA 2ZMLA 4CP1A 5B4XA 4YVSA 4KGGA 5F3CA 1C28A 4HONA 4ISRA 4KQ7A 1Q8PA 4QWNA 5FWEA 1CN1A 4Q0VA 5I93A 2NP0A 3WP6A 4LKFA 2G4IA 3V64A 3IAPA 1NZIA 2E32A 4HK8A 2ZX0A 2BTVC 4TLGA 5A6QA 1W9TA 4R9CA 3TB0A 5F9TA 5A3UA 2ZA9A 4I09A 1MS5A 3AP5A 5IW0A 1K5MC 1OT5A 3LEGA 5I0UA 4Q4Y3 5DAPA 4CCJA 3VZLA 4AFBA 3P3PA 5IAXA 2W92A 3T0BA 4Z2AA 3J7MA 1QJFA 3H0OA 2YBPA 2EVXA 5LA9A 5LEKA 1BVP1 2JE9A 2DBNA 5T54A 2R1BA 4XUOA 2VCCA 2OQ7A 1R092 1UX7A 4CDXA 3DXTA 5L9VA 1AF9A 2WZEA 1TE1B 4NMIA 4W65A 4UT5A 4YVWC 3HR9A 3MV01 5F5QA 5FXVA 1XSRA 4Q4W1 4HZFA 4WZCA 2ARAA 1MS4A 2D6OX 4A45A 1FNYA 1TMF3 3D4KA 1N1TA 1YFXA 1W8OA 4CCCA 1OI6A 4C0BA 3GBFA 3BOPA 4Z92B 4FFGA 4RGAA 1G9AA 3KS7A 3LZZA 4QX0A 5DPNA 3ASIA 5L19A 1KQRA 4IQPA 2D5HA 1H30A 2A3WA 4G9SB 4QB1A 2E7QA 2DV9A 2CWSA 3MDPA 1PMJX 4JDMA 5BNOA 1B35C 5FZ8A 3LIHA 1VBE1 4PHZA 3WDUA 1AZDA 4ATFA 5C5TA 1VBA2 4M3CF 5F3IA 1VBE2 3B02A 3L9JT 1HRV1 5BNNB 1V6NA 5J1XA 5JIUA 4MZUA 4BQ5A 1PGL1 5T5JA 2AENA 1PVXA 3JUUA 5KC6A 1U5YA 1I1EA 2H0BA 1CONA 4PIYA 1R1A2 3LF7A 3LD8A 5DQ0A 1IOAA 3AK0A 3W20A 3HBZA 4ARYA 4XBLA 1PX3A 1W0OA 3Q8EA 3PJQA 5F7UA 4ARXA 4QX3A 1GNHA 4GJYA 3U4SA 4HVOA 1U5IA 5CU1A 3MICA 2FCTA 2BP6A 1HXS2 2WABA 1LU1A 4QXCA 1J3QA 4D7SA 1VB2A 3ZN5A 3K4AA 5FY1A 4UF0A 2E63A 3J7LA 5LK5A 3ACHA 3FBYA 1ND3A 1YFYA 4O7XA 4K21A 4MADA 2AH2A 4XJAA 4YW3A 5DG1A 5DZGA 5LA0A 1XYOA 5FXWA 2VTFA 1NCQA 3OGGA 2JDNA 2J1RA 4S2DA 2CGOA 3UJQA 3MIEA 5ERLA 3RNSA 4BZ4A 4HBNA 1PNFA 1WCQA 5KXEA 2ZGMA 4JVAA 4PT6A 4QU1A 3KV9A 1GOHA 4BM8A 1DZQA 1N1VA 2BWCA 4IL7A 2YC2A 3ZIXA 4AR2A 3TN92 3WHTA 1OOPA 4PF1A 1CAWB 3L2HA 3DEMA 3OD0A 2OXBA 2WS92 3LDBA 1RUH1 4YNIA 4FOVA 4Q4W3 5FKBA 2OKXA 5J3UA 1CZVA 3GALA 1LB2A 4AEDA 3WDXA 1OFNA 2DCKA 3AMQA 5A7SA 4CDUB 4M4RA 3GBGA 1OBNA 4NRMA 4P5YA 5DZEA 3ZXFA 1YFWA 3E97A 2WNEA 3OPWA 3WV6A 1REDA 1S0EA 2ILMA 3AZXA 4GB33 4IGPA 3IPVA 4QX8A 1JU3A 2VTXJ 2QQIA 3DYMA 3HN3A 3J26N 1SPPB 4L0PA 4LLFA 4XJ9A 4BXFA 2VOTA 2E6VA 2RDSA 1O4ZA 3IT8A 1VLNA 3O0WA 1XYPA 1TME3 3T1LA 1PMIA 2BNNA 1UCXA 3C7HA 4XETA 2R041 3PTYA 5T50A 4WV8A 3U78A 2JIGA 1X50A 1V6MA 2B46X 3AYAA 4MO3M 1JUHA 2R042 4HMZA 4HPKA 5FFOC 5T55A 1GP5A 5ANNA 2JEMA 3VD3A 2VOXA 2WUHA 1JYNA 4AZZA 4CUBA 5IVFA 1MZ5A 1KGYA 3MLLA 3OUIA 3Q9OA 4XFAA 3RZGA 1FV2A 3VBUA 5A32A 3R4UA 4LK6A 4AEKA 1UU6A 2J7MA 5FLIA 4CEWB 4LITA 2Z5WA 4LUKA 1BK1A 2ZEXA 3VBUC 4RR3B 3WLUA 1CR7A 3VD9A 3ZPOA 3IIIA 2AEYA 4CU8A 4OHYA 5IFTA 3MW2A 2Z79A 5LZ6A 2G9FA 2YC4A 3GZEA 2W87A 4HFSA 2BFUL 5GALA 4FI9A 1W8HA 4PIZA 3VBHC 5DABA 4LQRA 3MF9A 1RUG3 3UYJA 5JXJA 5HCHA 3LCPA 3CBNA 1WLCA 3IDCB 3OBAA 3VUOA 3VBOB 4PLNA 1DQ1A 4FPGA 3B3QE 1GFF2 1AR92 1WW6A 4URTA 3ZKUA 5K4LA 3DKWA 5L73A 2V4AA 2XLAA 3JQWA 4J1XA 3WQ7A 2DVGA 3IWZA 3WINE 4A4AA 5K7PA 5F5CA 4Q0SA 5FMDA 1XRUA 2WWJA 2NZ9A 2WNVB 1FV3A 4AEDB 1RUI1 1SCRA 1I6XA 3DN7A 1W06A 3ROUA 1O7FA 1S0FA 4S2HA 4EN8B 5I0SA 4CCLA 1DDLA 3EBRA 4F83A 4BPZA 1C4RA 1QIQA 1ND2B 1UOBA 1YI7A 2WLPA 1O8PA 5LASA 1YI9A 2RMU3 1SHWB 2C9KA 2TBVA 1S0JA 2VUCA 1QOOA 5FPXA 2GC0A 1YWKA 3ACIA 3LDKA 3CL1A 4CDQA 2ARXA 4LBNA 5A7NA 1WBFA 2C0ZA 2QNKA 3AZWA 5HV0A 2QVSB 1XQNA 1B35A 1ZZ9A 5GLTA 4DXRA 3UNPA 2XQRA 2RMU1 3NNGA 1SBEA 2WA3A 4KH9A 3S6PA 4QQLA 4B1LA 3O1MA 2JENA 2P37A 2TUNA 4META 4RR3A 5CFDB 1UY0A 2SBAA 2WZR2 1MS8A 1RVF2 3S57A 1MR5A 1SLLA 4FPLA 5DAWA 4NHXA 3IDBB 4XYXA 5LEJA 2HH9A 2Y6JA 4GIQA 1IG0A 3KT4A 4IV3B 5FZMA 4S2GA 4FPJA 5C4WB 1IS4A 1RUC1 1A34A 3GM8A 1Y4WA 2OYZA 4UFLA 3W58A 5KXCA 3X29B 1K5MA 1WMDA 2VMCA 4HXCA 5EV7A 1DLCA 5LA2A 1GZWB 1YYNA 3O5SA 1CZSA 4KWJA 1LEDA 5HCAA 1V6JA 5GZGA 3WW1A 1JZ5A 3GZUC 3GCWA 3HBKA 4KG8A 3VD7A 4FXKB 3OUHA 2P17A 4JRLA 1SPPA 1W2NA 5A1LA 3B94A 1OUXA 4UBHA 1W2TA 3B7MA 2D3PA 4Q0UA 3G6JB 3NAPB 3VBSA 2SLIA 5ABJB 5IHRA 3RYKA 2ZX1A 2P3JA 3D8CA 1YRZA 3E5QA 3H42B 2DCYA 3DYPA 5F3GA 3ORJA 4W6XA 1GKBA 3HVDA 4OZOA 1LHOA 3I2DA 1XNCA 4P9GA 3MIHA 2VUDA 4DEVA 2Q1MA 1ZRCA 1ND2C 4LBOA 4OQ9A 4AWDA 4XZUG 3B69A 5FZ4A 5JXHA 4CP9B 1XE0A 1OOPC 2W52A 4NO4A 4Y1VA 3JD71 4S2FA 4BMEA 4TYSA 1FNZA 1UYYA 4LMFA 5E6HA 3PDQA 3MO4A 3VHOA 4M4PA 5GZEA 4A44A 3D0JA 1RIRA 1SFNA 3OCPA 3SH3A 5A3LA 5LY2A 3GHNA 3RYPA 2CSGA 2VPVA 4D6SA 1REEA 1UOFA 2NN8A 3THPA 1Q8VA 1HXS3 2YYOA 4AHZA 4C1XA 3M70A 1QJY2 1UOGA 1WMEA 2WQZC 5FPBA 3N36A 3KCCA 2P2KA 3WG2A 4ZKTB 2XH6A 2FDHA 1D2SA 1OLQA 5L9RA 4LXLA 4XW3A 4FCAA 1OA2A 2XONA 1HXS1 2YC0A 3OBZA 3PUQA 4LO7A 5JIAA 3WD5A 4AGVA 4AGRA 1U12A 4MGZE 4MV2A 2QQPA 3UGFA 4PCRA 3DUIA 5JWPA 4TZDA 1GZ9A 3I2GA 1XNBA 1PZ7A 2Y0OA 1W0PA 1GQGA 3F2ZA 2X5IC 2B42B 3KB5A 4LIVA 5A7PA 3WQ0A 4COYA 2LUWA 4E2SA 3O0VA 1BJQA 2VVDA 2FD8A 1K45A 2ZHLA 5KXBA 5BNNA 2DVFA 1ZYBA 2PHFA 4P00B 5CNAA 3SKJE 1ZA7A 1R081 4I02A 3FBMA 3T2TA 3AKPA 3NNJA 3PUAA 5EZWA 4D7TA 2NPIA 2MHFA 2BBVA 4XF1A 1PO22 3OD4A 2IUWA 4DQAA 4JDNA 4OI2A 1O3QA 1TNFA 3VLBB 3SHRA 2ZGUA 1LTEA 3NMBA 2HEVF 5C8CC 2GMMA 4CSWA 3MFAA 4K8FA 2BW8A 4BQ1A 2VJXA 2A5ZA 5FZDA 1W39A 1HQNA 2JKXA 2GC1A 1SFYA 1W3XA 2E7AA 4Y5SA 5EJ1B 4XCAA 5FP3A 1HN0A 3B00A 3J8F3 3ZFGC 5AC91 2UWCA 3RI8A 2VZUA 4RQPA 4YVSB 4AI9A 2UURA 3LOIA 1W8FA 4KBZA 1W6PB 4J1WA 1AL21 4FQZA 1QJU2 1JYTA 5CKQA 2DFCA 2VMHA 1COV3 2GU9A 2W1QA 2WFF3 2DBIA 1X9PA 2BEOA 1ULEA 4GH4B 4XQWA 3VZKA 2ZHNA 1VP6A 4P5HA 2VBDA 3AZZA 4XUPA 3GNEA 3JD73 1XNTA 3OPTA 1QJU3 1EY2A 4COUA 4AOCA 3NVCA 2FZ2A 3WNOA 2VZRA 2DCZA 4IE6A 5FYVA 4J25A 4D3WA 3DYOA 4TWTA 5FZ9A 1O91A 3O1VA 2QE3A 1DYPA 2JE7A 3N7LA 5FMOS 4LORA 1GICA 1QEXA 4FFIA 3DKQA 4RA0A 2PHXA 3U1XA 4XF4A 2XPJA 2JDYA 2W46A 3IPVB 3B9CA 4H55A 5FQ0A 5FZGA 4CDWB 1UXZA 2VAUA 3CDZB 1WBLA 1JYXA 5H9QA 1AYN2 1LULA 1X82A 4QPYA 3K2OA 1PO23 5D8AB 2GNBA 1RITA 3CZUA 3WNKA 3FC0A 4N43B 4R9AA 2OQ6A 1S1AA 1YQ8A 4XIKA 2VULA 4LUMA 1RGSA 1NQDA 1UZWA 4BYYA 2VMIA 5LB6A 2P4EA 4GA9A 2HWF3 2GDFA 3Q8AA 4IEPA 2CHHA 4HSLA 4K8RB 4PDWC 2QUOA 1EP0A 4G4FA 2JECA 4K3UA 3WW2A 4FP3A 2DCJA 3B9IA 1I5PA 1QJX1 1XPWA 2CV6A 5FLJA 3BCWA 3MV11 3ZXJA 1C5HA 1NUKA 2EIBA 3KLSA 1JZ2A 2RS12 4XACA 2JXAA 3WG4A 1H8TA 3ZXGA 5C71A 2D3SA 4O9EA 4RGKA 1QOTA 4UFJA 3WF3A 2VXRA 2FBEA 5AVAA 1NA1C 3N9PA 4Q4X1 2Z4FA 3LIGA 2CU5A 1KITA 2JB4A 3WF1A 1G9DA 1NA1A 4N9HA 3VDCA 4FTEA 4JAAA 4YFWA 2ORZA 2XHNA 2RHPA 4YARA 4OMCA 4FVVA 3VL8A 3W5MA 2R0FA 3QOPA 1G9BA 3UGHA 4Y1UA 2O1QA 4E4HA 1IHMA 3MLJA 2BFUS 1OXCA 5FUPA 5DN2A 1Y3TA 1LOEA 2E53A 5IWFA 4BDVB 4CPBA 1ND3B 5KC5A 5IK8A 1M06G 1US3A 4DINB 4K7JA 3RWNA 2PFWA 5LATA 1VB4A 5SV8A 2A6WA 3I4IA 3VBRB 4ZZ5A 3C7FA 3UETA 3FLTA 3D82A 1Z7S3 2HWF2 1DLLA 4MHRA 5DXDA 4KGQA 3VHPA 5BNPA 5FYIA 3O1RA 3EHKA 5FPVA 4BU2A 2RS33 2ARBA 1WCDJ 3I3MA 1RUC3 3KT7A 1CX4A 2RJKA 1H1MA 3FFZA 4MYEA 4XJ8A 1MVEA 1RMU1 1AXKA 4UW6A 2EXIA 1AJKA 5HV4A 4ONUA 1F35A 4AEMA 3MIGA 2ZX4A 1Q5OA 2PHUA 3LEKA 4XE9A 2E31A 5JUVA 1W6PA 5FYBA 5H9SA 3WNMA 4YM1A 4H7LA 4XMIA 5KHHA 4LBKA 1UZZA 3T4VA 1J3RA 3TAYA 4C1WA 3AKSA 5D2AA 2XG3A 2OT7A 1Q8OA 1DCSA 4ORFA 2GAUA 4CZSA 1HRV2 5EXOA 5CFCC 4N7UA 1UZ0A 3LFMA 3ZYIB 3ZXLA 1SQ4A 4QX7A 3I7DA 5LRRA 1LR5A 5FYUA 3SITA 1BZWA 2Y64A 1SLTA 3VGIA 2WFF2 5C33A 3VDDA 2WSVA 5B4NA 3OOXA 1JN2P 2Y6GA 2YZ4A 3VBFB 3GBWA 2FHRA 3KHCA 4LHLA 4YZ3A 1UY2A 3QD6A 2XVKA 3ZXDA 3QH6A 1UU5A 4B4QA 1NT0A 3ETQA 2IXKA 4R4XA 5A6XA 1AR62 4MG2A 4DY5A 1OVSA 2YB7A 2O8QA 4A3XA 2GSYA 3ZXKA 1V00A 4PJYA 1QJZA 4QHZA 5IK7A 2P3IA 2BV4A 4LA3A 4AFMA 5A3PA 2UYAA 4IEQA 1GZTA 3O14A 3IBMA 4OVEA 1JODA 1VPHA 2GMEA 1VIWB 1W8TA 4XBQA 2DUPA 3AFGA 1EUUA 3L2YA 1VBC2 2C26A 1GMMA 4NAMA 3LWCA 1E57A 4A7KA 1RUH3 2WAAA 5IVVA 2WR9A 2VZSA 3JB8A 5B2GB 3N9NA 2H0VA 1ULDA 4LO8A 4AE2A 4N53C 4BMBA 3ZYPA 3UJOA 4Q4Y2 3FUOA 1UIJA 1WCSA 2ZGOA 1Q43A 2WT0A 4QPGB 2A75A 3RJRA 4UYBA 1RUH2 2R0HA 1AL0G 2RMU2 1F15A 4WVMA 4QB6A 3IB3A 1MACA 3J7HA 5K0UA 3SH5A 5AC92 4CEWC 1URXA 4BWOA 1FMD2 3POEA 3TBDA 1EUTA 3ZM8A 2DUOA 2WINB 3OGJA 3VBHA 2J1EA 2PLV2 2Z2SB 4XAAA 2W39A 2XKOA 4XMAA 3F95A 1P8JA 2R043 2RDRA 3MI8A 5D1IA 5KHJA 1QJX3 2JDZA 5IVEA 1EAH2 5JR7B 1X8EA 3AP6A 4OHXA 3SQOA 1H4GA 1C8M1 1LHVA 1YIPA 3PUIA 2I07B 2R1DA 5KHIA 2WO7A 4F8AA 2D5FA 3CLPA 4MGSA 1AR73 1SLIA 2WJSA 3NAPA 5ABJA 5F5IA 1C8NA 3EQEA 3EO6A 3N4MA 2P3YA 3UV9A 1RXGA 1F31A 5HXVA 2PAKA 1FAYA 1QXJA 4Y1YA 5A7OA 4KG0A 1X33A 1ZM1A 3MFCA 2BUKA 1MEC2 3KGLA 5D8AC 5F6LB 4DS0A 1AXYA 2FDGA 4AVTA 2HWC3 2VCMA 3TYJA 1Y43B 3H8UA 4AFCA 1HRV3 3W21A 4COWA 1CIWA 4JGZB 5T5OA 3BYWA 1HV1A 1ASJ1 4IV3A 3ZXEA 4A3ZA 4CDQC 1XYNA 1ZZ7A 5CB7A 3ZYRA 3JQXA 3I49A 4UBGA 2J1VA 2ZEWA 2QQLA 3AL6A 1UN1A 1VBB3 3DPRC 3ILNA 4XFHA 4DNYA 1ZBE2 2ZMKA 3GZAA 4LOTA 1UX6A 1XU1A 4Q4W2 4DRRA 3PMEA 2AEZA 2XBO2 1QJX2 1UW8A 3BTAA 4OCTA 3WT3A 4JX0A 1MS3A 5FZIA 5FPUA 1CAVA 4R4ZA 3ZR6A 1VJ2A 4UAPA 1ZREA 2B7YA 5JOWA 5GLWA 1RUG2 5FZOA 1PK6B 1W2OA 3KCYA 1BKZA 2ADDA 4XDOA 2VOWA 3GZTB 3GF6A 3PJYA 4MXWB 4FQ4A 1ZBE3 1OH3A 5APAA 1QH7A 3ZFFB 4W6WA 5BXXA 4P9IA 2FDJA 2VMDA 4NHMA 1JMUB 3ME2A 1CPMA 1IPJA 4OUMA 5FZBA 1XE7A 4N8MA 1UY3A 1BCXA 2WS93 5J98B 1WW7A 2R7EB 3ES1A 3FHIB 1YJLA 1DGWX 1DZRA 4BQ4A 4E27A 4YG6A 5FZ0A 3V56A 4AF9A 1L7LA 1D4VB 2WYSA 4FPEA 5FLHA 4YWAA 3OSDA 5DG2A 1RUI2 4X8NA 4HT1T 4YVWA 2VZ1A 2ZKNA 4GQ7A 2Q8EA 4IGOA 2P1BA 2QDRA 2WN3A 2RR12 1OVPA 1APNA 1LOFA 3IKWA 2V73A 1PIV2 3AL5A 1WD4A 4IE7A 4TXWA 1FX5A 4FT8A 1AX0A 4CEWA 3NJXA 2EXKA 4PLMA 1TVGA 1E5HA 1F5JA 3N7JA 1RUF1 1H2NA 3VDDC 4BCUA 5DUVA 3BALA 1SMVA 2B9VA 4P02B 3GXUA 3C2UA 5C3OA 5F6KA 1PIV3 2ZJCA 1XOYA 2C9AA 5D21A 3SEEA 5FKCA 4CA9A 1F4AA 2YFUA 3LDRA 4NIHA 2XR4A 1J1TA 2FCUA 2ZABA 4WVWA 3U10A 3O1SA 3WNPA 3AYCA 1DFQA 2QTWB 1QQP1 2GN7A 3NV1A 3KF5A 4GH4C 5FZFA 5FWJA 3OF1A 5CFCB 4B4PA 1OFSA 4XIOA 4NR1A 1CAXA 3OEAA 2MEV1 4GMP3 5M0TA 1OPOA 2ZGLA 1YQ5A 4QDQA 4RR3C 5GZDA 4F3JA 2VZ3A 1HRI1 4COVA 2BGPA 3VDBA 5KBFA 5H9RA 4D7YA 3NWKA 3CJIB 3RGBA 1IG3A 1D2QA 2ZGNA 1PM7A 1FT9A 3KQ4B 4LE3A 4Y5Z0 2B9UA 1XNAA 4MGIE 2WFF1 3V0AA 3ZYHA 3C7GA 4U2AA 1BEV2 2GH2A 4UOJA 1QJEA 1FPN3 4ZU5A 2X5IA 4KWLA 5IVYA 3FLRA 2JWPA 3QACA 4FOWA 2KR2A 2Y6KA 5FQ0B 3BU7A 4ZU4A 4C0HA 4EWDA 1PMHX 2YUEA 5FZEA 3T2QA 4JGZC 4IETA 5A3OA 3VN4A 1JOPA 3KV4A 3WDWA 1RUJ1 4CUGA 3KHBA 1NLRA 4YRDA 2ORXA 1GU3A 1SCSA 1YQ2A 4JGZA 4QDRA 4YM0A 5CVRA 4URAA 5CG9A 1PGW2 3G7DA 5FIXA 3BTYA 1NKGA 2WNUB 1PGW1 3B01A 2ZCWA 4RFT0 3B93A 5I0DA 1NXMA 3ZFEB 3VHNA 4Z8BA 2F17A 2BVBA 5CAZA 2C24A 2BU9A 3ZN6B 3TOJA 3JD72 4FPCA 1YFUA 3AVSA 1KJLA 1DQ0A 1IGOA 2V09A 4FPHA 1PO13 4KI5M 3ZN4A 4XDPA 1WMFA 3CKHA 4Y4RA 1Z0HA 4WM7C 4Q5OA 1XBFA 3MGUA 4RYDA 3T4HB 1XNKA 3TN93 5JSOA 1XXNA 4JHZA 4WM7B 3VKMA 4AFAA 5KHGA 4XHBA 2W1SA 2WFPA 5D8AA 3VBOC 3U14A 2ZHKA 4HN1A 3A7QA 2VD7A 2Y26A 3PLQA 1QNYA 1OC1A 2EIDA 4RN5A 2WWUA 4YGEA 4BQYA 4COZA 4KU7A 2YGLA 1Y7BA 2W94A 1CZTA 4AYUA 5JOXA 4X6QB 4FSJA 3INAA 1POV0 1W9WA 3ILRA 2CDPA 4LNVA 4XVHA 1DP0A 3MUZ1 1OA3A 4LIUA 1MQTB 3TNQA 3I3EA 3UGGA 4L9BA 1PVC1 2KD7A 5LBBA 3T0AA 1AL23 1PM4A 5EYYA 4UFHA 1F8VA 4QD2A 3KCXA 4RS5B 1BYHA 2ZOEB 3K3NA 3ZDSA 5JSRA 1D4M3 5JAXA 2QQUA 1RVF1 3AX4A 1JYVA 2BJSA 4MOAA 1NG0A 2XKPA 4XAEA 1POV3 2MNGA 4EN6B 2XGXA 4IEWA 3HJRA 1QJU1 3KQRA 4WBBA 4EWAA 3H8RA 1DQ5A 4YZ4A 4BJ0A 2QQMA 2XJPA 3ABZA 4QGLA 2A3XA 4Y3OA 5FZ6A 3NJVA 3SCFA 3TNPB 1CPNA 1LHUA 1R1ZA 3KV6A 4INDA 5FY9A 3ZYJB 1OQDA 3SKVA 2QDNA 2VNRA 4YGCA 2VU9A 1BQPA 4AAPA 1BMV1 1S0BA 4AQTA 3E5XA 4U36A 4PDWA 3U07A 1OF3A 1CWPA 3EMRA 4NWVA 3PUSA 4I30A 4I0WB 2LALA 2OUJA 3DGTA 2B45X 2A3YA 2HWC1 2DWRA 1QNWA 1UKRA 1W0NA 5A3NA 5T52A 2O8OA 1DU3D 2YG0A 2FZ1A 2I2SA 2W68A 4EE2A 3DF0A 1WLTA 1PNGA 2WYFA 4OFGA 1UXXX 2WRAA 4IV3C 2BOJA 1VAVA 3O1TA 4BXSV 2QFEA 2C4XA 2W91A 1VBD2 2VECA 2JG8C 5A3TA 1UZYA 4LHKA 3UKNA 3PU3A 4X8PA 1YJKA 2WWSA 3O7OA 3M3IA 4XABA 3RDIA 5JDBA 3AP9A 3HNMA 1OMIA 4IEVA 1H8VA 1JUIA 4AI8A 1D4M2 1WCKA 3ECQA 3H1MA 1DYKA 3A0NA 5LWBA 1KRIA 4KMQA 5FV3A 2JDMA 2VNGA 3DECA 4P9XA 2WBKA 3ZIWA 4EN7B 3C7EA 5JCTA 2XVGA 3VZMA 2OW4A 1A8DA 2FCVA 3P5BA 4Q29A 3WNLA 4L99A 3T0DA 3K4DA 4OULA 3RMXA 1LOGA 2W3JA 3QH7A 4H14A 1OD3A 4Y22A 1K5MB 3E5UA 2CTVA 4A42A 4XF9A 4PBOA 1C57A 1GZCA 3AMPA 1ENQA 2WZ8A 4EZHA 1HIXA 5F37A 1NAEA 3FHAA 4XZPA 5IVJA 5FYYA 1W6OB 1W6NA 1W9SA 3O1OA 2ZGRA 2IWGB 2Q1FA 2ZGKA 3CQOA 1TNRA 4H3WA 1JW6A 5F8PA 3PHMA 2YV8A 4OHVA 2VH9A 4GD4A 1HW5A 1DQ4A 2YY1A 5C9AA 4BE3A 3ACLA 4E2QA 2JDKA 4LBQA 3MIFA 1JHJA 3OYWA 4QT6A 4QKDA 5BUVA 1NA1B 1WD3A 4WVVA 5FRAA 5IFPA 5FZLA 2D6PA 1ND2A 1NCRA 1XNDA 2HBTA 3ZN6A 5E88A 1KXGA 2DTYA 1JTZX 4HG6B 5DZFA 4D94A 1NCRC 3ACGA 4Y4YA 4AG4A 3TN91 4FTBA 3HOBA 4RQPC 4N43A 4RS5C 5FZHA 3H1YA 2D43A 5FMCA 3KMHA 2A7AA 4PI0A 1QY4A 4Z07A 4Q2FA 4MUVA 2ETEA 3HWJA 3M7AA 2IZWA 3AKTA 2W5FA 2PHRA 4MX3A 5JXGA 2VZTA 4FAHA 2WIIB 4L92A 4QM9A 5G05L 1AL22 4LBMA 1WMXA 2QZ2A 1ZRRA 3U75A 2YDEA 3AC0A 2QQOA 4BHPA 4PLOA 2GZWA 2D7FA 5EIYB 2PHDA 2R073 4LA2A 2EICA 3PUHA 3K77A 1RUJ2 4OUEA 5LW9A 1V0AA 4IDZA 1ZRFA 4YW5A 2WS91 5IATA 1ASJ2 2VQ0A 4YZ1A 1TG7A 3I3BA 4AHXA 1K5JA 4R8HA 3H3ZA 4PQ9A 4CEYA 4YW7A 2ERFA 2YPDA 3Q8CA 2Y34A 1OPMA 1JYWA 2HYKA 2J22A 2R30A 2RG4A 3VKNA 5I8YA 4XFFA 5C3QA 4LK7A 3ZSLA 1ASJ3 2PQSA 1IPSA 4LKDA 2XL7A
chains in the Genus database with same CATH topology
1QJY3 4K9SA 5CBLA 4IV1A 2PHLA 4A2UA 1RUJ3 3MPBA 4GKYA 3N7MA 1CD3G 3LAGA 2RJLA 1HRI2 2EIGA 4IV1C 2GC2A 2JICA 4Y1XA 3JZVA 4J6GA 5BY5A 1KDMA 4WM8B 3NV2A 2UWAA 3ZFFA 2H6CA 3VL9A 1ZNPA 4BIOA 2A71A 3JBG2 4OI0A 2BQPA 1AYM3 3SH4A 2CGPA 2UY9A 1O3RA 3WNXA 1OKQA 4W6YA 1C1FA 2UY8A 5JI9A 1NE4A 2P3KA 1ZBA3 4JDOA 2ZTNA 5AFBA 1WW4A 3M8LA 3C3VA 1IKQA 3MF6A 4Y20A 2VNOA 2BWAA 2VW2A 1CQ9A 2JG9A 1QKQA 1RUI3 4JRAA 3JBG1 4RD7A 1COV1 3DPRA 1LEMA 1AR71 5JSPA 2IXHA 3FFQA 3FUQA 2GNDA 4QPIC 1I5ZA 1PVC2 2D6LX 4DRVA 4AI0A 4QQOA 4QPIB 5BPXA 4B29A 4D69A 5AC93 1MQTA 5ACA3 4YVSC 3H7JA 5J96B 1CJPA 1ULGA 4FOYA 5T3NA 1RL3A 1MZ6A 1OD5A 1IS5A 2CWMA 4EN9B 5FMOL 1NE6A 1EAH1 3LKJA 4Z82A 3NW4A 4QXKA 1AUYA 4YG3A 1TME1 1V9U3 4NHLA 1SLAA 1RUC2 4ES8A 4R9DA 1GZWA 4AVAA 1T6GC 4QQ2A 4CDXC 1AYM1 3AMHA 1W6MA 2ZPXA 2GNMA 2XWJB 3J9SA 3NAPC 5ABJC 4CDWC 1J59A 1MEC1 4FXGB 1AR63 5FDBA 3AP4A 3DL3A 4M0NA 2OVUA 2IXCA 5C9AC 3WP4A 1HX6A 2EXJA 2R072 4QPGA 2R6QA 3USUB 5EJ3A 4BH9A 4WVMB 5K0UB 3I59B 3CU7A 3H3UA 1AYM2 4AW7A 5BNOC 2RE9A 5GKAC 4JTOA 1OLRA 5L7OA 1AR93 5FCCA 2D97A 4QQPA 2JG8A 2HJIA 2WLQA 4LEJA 4E9KA 3URFA 2HWC2 4L97A 3AB0A 5E1RA 3VBHB 3OY8B 3R05A 1AX2A 1DHKB 3RQ0A 2N7GA 4HL0A 1O3TA 1UMZA 3AMMA 2WC2A 3LB9A 1WGPA 2Q5TA 4FPYA 4IXLA 4JTNA 1KFUL 4P9JA 2EF6A 4GWMA 2HWB2 3TWIA 1UKGA 1PIV1 4DOUA 4ASLA 3HIFA 2EAAA 3BIWE 1JHNA 4Q8KA 4CDXB 1Z7S2 1RUF2 4Y20B 4ZU7A 1ENXA 3PVEA 1LHWA 1MEC3 2PQQA 2Q1ZB 3LA7A 5A3MA 3PVOA 2WZR3 4KWKA 5A33B 1UD1A 1OHFA 2Q30A 4ATEA 1VBC1 2EXHA 4GB32 2B5HA 1ZBA2 1FXZA 5FAXA 3HD8B 2R063 2I74A 1YHFA 2MEV2 2HWD1 1VBA3 1ZRDA 1AR83 2JKBA 4JGYC 4HPKB 4XJZA 4FOQA 2PAMA 4QQHA 4YGBA 4EV0A 1G7YA 2XVLA 4WM8A 1GR3A 1NLSA 3WUDA 2ZHMA 4JGYA 3VKOA 1VAKA 2PLV1 1A8MA 5FOJB 2RS13 3VBUB 2GN3A 2DU1A 4AEJA 2NM1A 2A6YA 1RTVA 5HCBA 4MXWA 1C1LA 1FOD3 3LGRA 2BNMA 4BIFA 1YXWA 4AQSA 2XJRA 4QGNA 2GMPA 2YHJA 1FPN2 5CADA 5K9YA 1MQTC 2D6NA 1NCRB 4M0HA 1DBNA 1UPSA 4L11A 4RSUA 1LOBA 1RUE1 5JOZA 2XJSA 4G3YC 2BPA2 4KBBA 2Q0AA 5C8WA 2LM3A 4X6RB 1CESA 1LESA 3B5LB 5JZGA 2R061 4PF5A 4AVCA 2H6BA 2WT2A 2TNFA 1SDWA 3WCSA 4A7YA 4EJRA 3H9AA 2HKXA 5KWRA 4FPOB 2XBO1 1COV2 3LSDA 3V65A 1ULFA 4NOTA 4B4RA 1V6LA 1KS4A 1YIFA 4N9IA 2YPJA 3NV4A 3W9AA 5KHKA 2XUMA 1OQEA 3M3OA 3S7IA 3WXPA 3WG1A 3FJSA 5GLZA 3KM5A 1V6IA 1WUVA 4WVZA 4P14A 4CYDA 5JZGB 1PHMA 2WZR1 1Q8QA 3NO8A 1I9RA 1FOD1 3IIAA 5K8SA 4FTSA 1RJ8A 1IQAA 1W6NB 3AMNA 3LA3A 5T5LA 3ZSEA 4GWNA 4B3NA 4LO5B 2C1FA 2ZGQA 1AR82 4CTEA 1XE8A 2DVDA 4XEZA 1QU0A 1CAUA 3FZ3A 3KGZA 4YYOA 3SISA 2ZMNA 3AJZA 1ENSA 1W6OA 1A6CA 2BYVE 1H4HA 1C5IA 4FP2A 4UXAA 1QH6A 1R091 3WDTA 2CAVA 4K20A 3VBRC 5E16A 1RMU3 2K0GA 1RB8G 2WNVC 4ASMB 1V9U1 3ILFA 3KD4A 4AHYA 3MYXA 1V70A 2ZKLA 2CL2A 4LBQD 3USSA 2Q8OA 4AI1A 4JGYB 1W2UA 3CF6E 3AYDA 5I0RA 3N7KA 5BYNA 2OUHA 4LULA 3WX5A 1BEV3 2F4PA 1CAVB 2EALA 2VG9A 3S30A 3U0ZA 1KD7A 2PHWA 2X8KA 5DUUA 3O0XA 3SNMA 3PVNA 4MSVA 1LOCA 1RUNA 5L7OB 1JYIA 1MS0A 1NYWA 3RZZA 3V0BB 4HLTA 2Z42A 4WM8C 4CP2A 3E6CC 3WP3A 3S7EA 1QGLA 2E7TA 5DUWA 1QXPA 1XU2A 1N3OA 4NVPA 2MEV3 4GMP1 4N43C 4RS5A 4AEDC 4OI1A 5J37A 4OZXA 1A78A 3J4UH 4AI3A 5JMCA 4H7MA 4M3CB 4WZFA 3W59A 1JYCA 1OSGA 1RUD3 3NL1A 1RJ7A 3H1WA 4HK9A 1AJOA 2CGNA 3R4SA 3MZHA 1QQP3 1ZZBA 2XLGA 2C5DA 2Y0IA 2VW0A 3POSA 3M3EA 3AKQA 3ATGA 1VBA1 1AR61 4EN0A 5GZFA 2HWE3 3R4DB 2WA4A 4Q4Y1 5CFDC 3AXDA 4XDQA 5LK7B 3UKVA 3RMYA 4LR4A 2HEYF 5J7MA 1S55A 2DCTA 2ET7A 3LA2A 4QGMA 2PTMA 5GLVA 4YG0A 5ACA1 2DYCA 5CFCA 2CAUA 1BBT3 1HQWA 5JPNB 5C6CA 1PO21 1ZZCA 3WW4A 3SLIA 5FOBB 2XLFA 3USUA 1X7NA 1A3KA 3ZMOA 1VRH2 4YM3A 3K48A 4EROA 2XJTA 2YROA 1RHI2 4XQDA 3FLPA 3N3HA 4AVVA 1LODA 4IEXA 4P9LA 1S0CA 2X5IB 2X53S 4SBVA 4FBFA 5J48A 4EWEA 2WNUA 4Y1ZA 1S0DA 5FO8B 4DXZA 3EJKA 1VBB1 3S0MA 1G9FA 2HWB3 4OHZA 1HQLA 2P34A 1OQ1A 1GANA 1PGSA 2D6MA 4CDQB 2ZS6B 2AR6A 3LSEA 1Y9QA 5DDJ2 3RJRA 1MZEA 1RUE2 3DV8A 3RRDA 4AHWA 1G6NA 1FYUA 2GNTA 4HKLA 4LLOA 1H1IA 3PNAA 4YVWB 1HRI3 1PZ9A 3V0AB 3MIBA 4B8EA 3KSCA 3CJIA 1LGBA 2B39A 1DIWA 1X8MA 4E4ZA 5BNQA 2RM21 2R16A 1IZ3A 4BLJA 2AZ5A 1AHSA 1EYBA 1N1SA 5JZGC 3ZYGA 1VAMA 3RJ2X 2FQPA 2K9ZA 1RVF3 3SXWA 3D5OA 1RHI3 1ZZ6A 3WDVA 1ZZ8A 3WOGA 4I01A 4YW4A 1LU2A 4I3PA 2HWE2 3MLKA 3ZPYA 2HWE1 5EWSA 4HVQA 5AVPA 4ES9A 4IEZA 4AVSA 1CGPA 1GLHA 2UU8A 4I0BA 1VALA 3HT2A 2VQAA 1ZX5A 4AFDA 1EAH3 1O4TA 1NXD1 3E6DA 1SBDA 2CYFA 3ST7A 3WDYA 1UU4A 3RPQA 1N47A 1LHNA 2IXLA 2DURA 1AR72 1BBT2 5CA6A 4YGDA 4C91A 3VKFC 3RG0A 4DZGA 3AKRA 3WCRA 4I2OA 5IK4A 3OBRA 1O5UA 1Z78A 4RL7A 5IUQA 1H8TB 3OTFA 3TRSB 4Q4X3 5FPZA 3JB4C 2AYHA 1SEFA 3WVJA 4YW2A 5A32B 1NOVA 1M4WA 1I3HA 1GBGA 2Z69A 4LTAA 1WLWA 2JJ6A 3POWA 1QMJA 3VBFC 4CDUA 3OY8A 1RMU2 1LKNA 2PN5A 1RUD2 4GMP0 5HI0A 4Q1PA 2GH8A 1ND3C 2FMDA 1CAWA 3IMNA 3SCGA 2RM23 4UW4A 4R52A 4QMAA 5I91A 2E9QA 3AFKA 3AM2A 3N35A 5GM0A 3ZSKA 1N3QA 1POV1 2LTNA 1UL9A 4UW5A 2ZBJA 2ET1A 3M3QA 4XQ4A 3ZSMA 1IPKA 3VV1A 5BNOB 4XBNA 4FO9A 4FPFA 4AQ6A 1WA4A 2A6XA 2RS31 1C8M3 4SLIA 1VRH3 2OZJA 4LBQB 4OLLA 3PVBB 4FAGA 1NCQB 4K1ZA 3WHUA 4LO6B 4CP0A 4HVRA 2WSUA 4QM8A 1KS5A 3M1HA 2EAKA 2OZ6A 2ZX3A 1Q56A 4M3CA 1FMD3 2W08A 2YXSA 1H2KA 4R9BA 2NLRA 1H1AA 1QWRA 1O4YA 1BVVA 1UPIA 2PHTA 1IS3A 2PAEA 5CFDA 2ATFA 1QHDA 3V0BA 1DZTA 4LE4A 2I45A 2ZAHA 2ES3A 2ENRA 3JU9A 2ZGPA 1VRH1 4LT5A 2D98A 3CNAA 5BNNC 4Q0PA 4Y24A 1UF2C 4M00A 3UKTA 3U4XA 1CJDA 2WZPP 5CG8A 3BOWA 5ACA2 2NQYA 4KNCA 1ZVFA 3M3CA 2QJVA 3OBTA 1N1YA 1KFXL 4XOGA 5E8AA 5GLUA 4E4DX 3MEPA 1AYN3 1LGCA 1ULCA 4XFBA 1C8M2 2RS52 3OJBA 3ZFEC 4PDWB 5GJ6A 3E6BA 5HBAA 1ZA4A 4K40A 2R49A 4Y26A 4WM7A 2AREA 5DDJ1 1O3SA 3OPZA 1DF0A 3LOBA 3ZFGA 1RUOA 2VW1A 3VBOA 1TEIA 5EFUA 4YZ2A 4JC1A 1JOJA 3I59A 5L7OC 3QLQA 4ISQA 3WR0A 2ZGTA 3O12A 2OA2A 2PA7A 1GV9A 2BVVA 1QDOA 3R0RA 3FMGA 1RHI1 3SMHA 3HT1A 4RGGA 3SCHA 3D0SA 3AJYA 3VBRA 2JD4A 3ES4A 4PIXA 5BNPC 3RI9A 3M2MA 4Q4V1 1RUF3 1MVQA 3I54A 3MW4A 1CAUB 2DF7A 5BNPB 4MH0E 3WUCA 1VBE3 2R062 5HCFA 1WLDA 5FO7B 2ZZQA 1C3HA 2DU0A 1QJY1 1RUG1 2IFWA 3KZ4C 2WQ4A 1GYKA 1RINA 2BNOA 1SACA 4Z2WA 1REFA 2ZGSA 2VVFA 3CO2A 1LENA 1PGL2 2XJQA 2D3RA 2RS11 3FX3A 3VHRA 4V1PA 3EXUA 4QX5A 3HAGA 1DGWA 2A73B 5I0TA 1U5XA 1H8TC 4CDWA 3GHMA 2F6BA 1FOD2 4XFGA 5JOYA 1JH5A 2NYYA 1J58A 4LO4B 4E4SA 1H2MA 1LOFC 4LHNA 5L36A 4IEOA 4RQPB 2NMOA 1UIKA 2ZZJA 1YUDA 4Q1RA 1G8WA 2ZAAA 2RS53 2JX9A 4FPKA 2GALA 2QZ3A 4GH4A 5JVVA 1ALYA 3AYEA 1G9CA 2XJVA 2IXIA 1TQ5A 2RR11 1EPZA 1KJRA 1PO12 2TEPA 3ZMNA 5FO9B 4P9YA 2D6KA 2IFRA 2XL9A 3ZO0B 4I0AA 2G9GA 1PO11 4ITCA 4K1YA 4M3CE 4XF3A 3RS6A 3ZXAC 1DG6A 4XTMA 1S2BA 1VR3A 4GALA 4PBPA 1SBFA 1PK6A 4N53B 4B7EA 4C90A 5J36A 2XJUA 4GXLA 3WQ1A 5I8SA 2MPFA 4CEYC 3APBA 3ZX7A 1FATA 3ZFGB 2KM2A 3AXEA 4AVBA 2VMGA 3ELNA 4BA6A 1AYN1 1L3JA 4XHXA 3K51A 1NCQC 4TSVA 3QBQA 2VY0A 2Y38A 4OUSA 1IS6A 2XWBB 2VUAA 2W0XA 4Q0QA 3J8F1 4P9WA 4XF0A 1R083 3UK9A 3QCWA 1X36A 4XFCA 2HWD3 5KXDA 1O5LA 4HANA 1G86A 3KT1A 3NKTA 5A33A 1Q8SA 4DPNA 4GKXA 2RR13 4Z1VA 1QF3A 3WZ1A 1KDKA 1V6OA 3JBG3 1R1A1 3HN1A 2X29A 1LCLA 1IKPA 4AI2A 2GC3A 1EV13 2FMYA 3NJZA 1YLLA 4HN0A 4XXAA 1AXZA 3BB6A 1MS1A 4UW3A 1JBCA 1Z7S1 1WW5A 1HDKA 4AK3A 5C8CB 4JCKA 1W6QB 4N90A 4YFZA 3D6EA 1S0GA 1PZ8A 3I8TA 2VGDA 5T5PA 2IXJA 2HWF1 3NSTA 1D0HA 1LGNA 1R1A3 1ZBA1 5SV5A 3UL2A 2XBO3 4XJWA 2R071 3ZFFC 3ZFEA 2JG8B 1S2KA 2XHKA 1V6KA 5DUXA 1QXRA 1BMV2 5I8TA 4QHBA 4RHV3 1H0BA 1YCIA 5LRSA 4DB5A 3H7YA 1HV0A 2QCSB 1W6QA 5C8CA 3IM0A 4AXOA 1YO8A 1ENRA 4MVTA 3VBSC 1FMD1 4XILA 5JLVA 3VZNA 1CVNA 1UAIA 3POYA 1BXHA 2XB6C 1DQ6A 5J09A 1W6MB 3VBSB 4DMIA 5GZCA 2YMZA 3R6SA 1J3PA 4Q4V3 1QDCA 4YZ5A 1DQ2A 3FWEA 3IDEA 1TME2 1VBB2 2WL1A 2IC1A 1B09A 1MZFA 1VBD1 4HETA 4Q26A 2NMNA 2VOKA 2BGCA 2WNUC 2AUYA 3VDDB 1S0IA 2QKDA 3HQXA 4MLOA 4BOWA 2A6ZA 4KU8A 4QPIA 3DPRB 4CEWC 1FPN1 3GYDA 4NHKA 3RYRA 4MGKE 1D4M1 4NWWA 2PELA 2VVEA 5C4WA 4Q4V2 4XPVA 3AP7A 4IEUA 4YLZA 1H9PA