1GV9A

P58/ergic-53
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
228
structure length
223
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLDGPVFGSADMWNGVGIFFDSFDNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Carbohydrate Recognition Domain of P58/Ergic-53, a Protein Involved in Glycoprotein Export from the Endoplasmic Reticulum.
pubmed doi rcsb
molecule tags Carbohydrate binding
molecule keywords P58/ERGIC-53
total genus 48
structure length 223
sequence length 228
ec nomenclature
pdb deposition date 2002-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gv9A00
1C1FA 1S0EA 2EXJA 2VUAA 1IKQA 3AK0A 5IK8A 1F5FA 4FP2A 3WDYA 2E51A 1W6QB 3OBRA 3R4SA 1IS6A 3A0KA 1C4RA 3WV6A 2GMEA 4F83A 3LSEA 4K21A 4Q2FA 3VKLA 1AF9A 1Q8QA 5IK4A 2GN3A 3CNAA 4PF5A 1O4YA 3AXDA 1GLHA 4FPLA 2DVGA 1MS5A 5DUWA 2CNAA 4YLZA 1LECA 4ITCA 4YGCA 4YM3A 3OY8A 4XJUA 1DQ1A 1MS1A 5T5LA 2DUPA 4BMBA 5IT6A 1HQLA 4XILA 3ATGA 3A4UA 2ZMLA 3V0BB 5KXDA 4M00A 3UL2A 3OPZA 1YI7A 3PJQA 5GZGA 3AZZA 3AZYA 1N1YA 1W6PB 3AP4A 5KXBA 1HQWA 3N7JA 5T5JA 1RITA 3WDVA 4YM0A 1LHUA 1LOBA 1MR5A 2DTYA 2ES3A 2OVUA 4Y1XA 4M3CA 4OZXA 3R05A 1AZDA 1QKQA 2VH9A 5FREA 3INAA 2GNTA 1RIRA 3VV1A 2WLQA 5F5QA 1MZ5A 1WLWA 2NM1A 4ASMB 5DUUA 1ZA4A 5JLVA 4R9DA 2ARBA 1LEMA 2AREA 4WZFA 1LESA 1ULEA 3AP6A 4LBQA 4AYUA 1KJLA 3JUUA 3M3CA 4XYXA 4XJ9A 3VKFC 1DQ4A 2A6YA 1Q56A 2CYFA 3AX4A 5GJ6A 3RMXA 4JC1A 3NV2A 2DYCA 5JOZA 3C2UA 1ULFA 1GKBA 1G9FA 2NMNA 4Y1YA 1AXYA 3FBYA 1H9WA 4SLIA 4XBLA 1GZ9A 4XIKA 2P3JA 3NV1A 1MS0A 3ZYRA 4XMAA 4FOVA 1VIWB 1LOAA 5HCBA 2YROA 3JU9A 2A6ZA 1GICA 3MW3A 3V65A 5FRAA 4YM1A 4XHXA 2R16A 4XBQA 4YZ3A 3SISA 1LJ7A 4H55A 1BXHA 2D44A 1N47A 1W0OA 1TEIA 2CWMA 1Q8OA 4LBNA 2D6PA 2GNMA 1S0BA 1DYKA 4IQPA 4FOWA 3VKOA 1H30A 1FNYA 4HANA 1SLLA 1MS8A 3FFZA 1QOOA 2JKBA 4YGEA 4CRQA 4LBQB 3Q9OA 1Y7BA 3R4UA 4Q1RA 1V00A 1V6IA 2R0FA 2C9AA 4YG6A 5GZCA 4ISRA 5H9RA 1H9PA 4M3CF 2A70A 1ONAA 1LOCA 2LTNA 4YG0A 4ZXKA 4DPNA 1CQ9A 1CVNA 3WDWA 1I1EA 1W0PA 2A3YA 4XXAA 2ZKNA 4P9XA 2ZHMA 5HCAA 1BKZA 1DQ0A 2D6KA 2GNBA 2UU8A 1OKQA 3GNEA 3ASIA 1LOGA 1WBLA 2D3SA 4AVVA 3B01A 4Y22B 4GALA 1G7YA 4FPGA 4P14A 3IPVB 4WV8A 1QDCA 3FLTA 4YGBA 5GLTA 1JN2P 4AGRA 3RQ0A 1D2SA 4BQ1A 2DVDA 2D3PA 2DUQA 4GWNA 3FLPA 4R9AA 1QOSA 3M2MA 2E7TA 1DGLA 1MACA 3WG4A 2E53A 1J1TA 1N3QA 3BODA 2W52A 2ZABA 3OY8B 1Q8VA 3MW4A 5CNAA 4Q27A 1S0DA 2ZZJA 3OJBA 3N3HA 3D6EA 1UZZA 5CAZA 1SLTA 4FP3A 3ZXEA 1CPNA 3ZXLA 1LGBA 3AYEA 4YG3A 2KM2A 1UKGA 1W6QA 3SH3A 3WCSA 3UK9A 1GBGA 3TAYA 3DGTA 4GKYA 1G9AA 1N1SA 5EYYA 4ATFA 2XG3A 1HKDA 1KDKA 4FPOB 4K20A 5GZEA 1G9BA 2DU1A 2WKKA 4NO4A 2WNEA 4PCRA 2GN7A 1UL9A 2P2KA 1ULCA 2JECA 2WT0A 4BLJA 4LBLA 3A0NA 5BYNA 2VW2A 3IN9A 4XJAA 1CJPA 1WUVA 1ENQA 1X50A 4UW5A 2YY1A 3SNMA 3M3EA 3O0WA 1W6MA 1WD4A 2ZGLA 1LCLA 1LU2A 2DTWA 2A75A 2PELA 5DUVA 4FOQA 2D6MA 1AX1A 2WSUA 4DFSA 1JYIA 3BOPA 1AVBA 3H0OA 3QCWA 1YXWA 1S1AA 4XXPA 1LEDA 1NXD1 2PHWA 2UWAA 3T1MA 3AZVA 4FPHA 2JD4A 2ZHNA 2WT1A 3HN1A 3AFKA 3MW2A 4FQ4A 3ILNA 3ZSJA 2P37A 4XDQA 2B7YA 4FVVA 2ZHLA 3PVOA 1UAIA 4FPYA 4K1YA 2GMMA 2EF6A 4NOTA 4UW6A 1IS3A 4HL0A 3NV3A 2GMPA 1QNYA 2DU0A 1MVQA 2Z42A 1BQPA 2CTVA 1YRZA 1AJOA 1PZ8A 1WW5A 4ZKTB 1V6NA 1JUIA 2A6VA 5H9QA 5GM0A 4BOWA 3POWA 1UZYA 4XTMA 2AGSA 4CZSA 1Z0HA 2PHRA 2D6LX 1SCSA 2CY6A 2ZGKA 4JCKA 4UW3A 3ZSLA 1VLNA 1NLSA 2SLIA 1D0HA 1LTEA 1APNA 2CL2A 5GLZA 4AGVA 1OFSA 1LULA 1IOAA 1W6OB 2DV9A 3V0AB 1VALA 4Y26A 4YGDA 2EXHA 5DZEA 4DQAA 2W39A 1IS4A 5GLUA 2DWRA 1ULGA 3ZVXA 1DQ2A 4W65A 2ZMKA 5JMCA 1A3KA 1G9DA 4GA9A 2GNDA 1V6KA 5EYXA 3WDUA 4FPJA 5JOWA 3POSA 3AZXA 4XHBA 1DZQA 5T50A 2ZMNA 4I30A 1W6OA 2UWBA 4YW5A 3WUCA 5E89A 5EWSA 3AYCA 4FOYA 2AENA 1CR7A 4R9BA 1R1ZA 2R0HA 1QOTA 1OQ1A 5T5OA 1SLBA 1GYKA 1SLCA 4LBJA 4GWMA 2YXSA 1JOJA 3W59A 3D5OA 1LU1A 3B3QE 3IPVA 1B09A 5GZDA 4KBBA 5IUQA 1CIWA 3WCRA 2ZGOA 1KITA 2VW1A 1FYUA 2W68A 2D7FA 3AP7A 3AXEA 4Y22A 1S0GA 3NV4A 3WDXA 4AWDA 2UURA 2A6XA 2YV8A 4WVVA 1VAVA 4YFWA 3BTAA 2ZACA 1GV9A 4Y20A 1HLCA 5E88A 2YMZA 3WG3A 4XOGA 3UJQA 2DUOA 5GALA 4YM2A 1UX6A 4C1XA 2A7AA 1LODA 2YZ4A 1F31A 1V6JA 4U2AA 3WG1A 2OUJA 3O0VA 4LBMA 3N36A 1WLCA 1MVEA 2EXIA 3B69A 2NP0A 1G8WA 4AVSA 1BYHA 1GZWB 1LHVA 2XB6C 3GALA 4P9YA 3B00A 3SH4A 4XZPA 3WUDA 1MS9A 3VKNA 2VU9A 2WT2A 2ZBJA 3LSDA 1JHNA 3QLQA 4RL7A 4U36A 3KQRA 3ZPYA 3WHUA 2PHTA 1LOFA 2AYHA 3ILRA 4LBKA 1DFQA 3WG2A 3M1HA 1LENA 1DQ6A 2JJ6A 3M3OA 4BMEA 2R49A 1EPWA 1VAMA 2ENRA 4Q26A 4Y20B 3IM0A 2ZGUA 3IMNA 5CBLA 2NMOA 3ZSKA 1XQNA 2AUYA 5AVAA 3N7LA 1GNHA 1UPSA 5GZFA 3OGGA 5EXOA 4YW3A 1ZM1A 3T2TA 5JVVA 2ZAAA 1CPMA 4RA0A 1V6OA 3USUA 2A71A 1SBFA 1CN1A 1S0IA 2VXRA 4GXLA 3OYWA 4ISQA 1AX0A 5DG2A 3BIWE 3PVEA 3FUOA 4YW1A 4YW4A 1N1VA 2R1DA 4Z8BA 3FLRA 1ULDA 1SLIA 4YW2A 1SACA 1A78A 4YZ4A 5DUXA 4GKXA 2V5YA 1LGCA 4AGGA 3POYA 1Q8SA 4MYEA 5KXEA 2ZGPA 1N3OA 4FPEA 2C5DA 2CWSA 3WNXA 2LALA 4Q1PA 5T54A 3RSJA 1DIWA 3N7MA 2ZHKA 4XMIA 5T55A 4XJZA 3V0BA 3FUQA 5JOXA 5CA6A 4LBQD 3WLUA 5JOYA 1LGNA 3V64A 1N3PA 3IKWA 1KJRA 2ZGRA 5HCFA 1URXA 2HYKA 3U4XA 5KXCA 1AX2A 2ZA9A 2VY0A 4Y24A 1GZWA 2TEPA 1WW4A 1GNZA 2A3WA 3WZ1A 1HDKA 2RHPA 2PHXA 2NN8A 2W08A 5F9TA 3VUOA 2P3IA 5T52A 4DS0A 1YO8A 2GDFA 3PMEA 1QF3A 4PBOA 3ENRA 5CB7A 4D69A 1IKPA 1IS5A 1MS3A 1SFYA 2JE9A 1DBNA 1CONA 1QNWA 4XJWA 5E8AA 4Y1VA 2UWCA 1FV3A 2FHRA 3I4IA 2A3XA 3ZYPA 1FV2A 1LHNA 1FNZA 4FPCA 2A5ZA 1JW6A 1W6NA 3N35A 1AXZA 1N1TA 4K1ZA 1WW6A 1QMJA 1ENSA 1LOFC 1MS4A 3RRDA 1W6PA 1DQ5A 2AH2A 2EALA 1FAYA 4BLIA 1JXNA 1SBEA 3OYWB 3RS6A 1DLLA 1G9CA 1S0JA 3L2YA 2FMDA 1YYNA 4BPZA 1KDMA 3WHTA 5GLWA 2E6VA 4YFZA 3AJZA 3O0XA 1AXKA 1V6LA 1WLDA 1I3HA 3ZXJA 1QGLA 1BZWA 2ZGNA 3N7KA 1W6NB 3AYDA 1CESA 3LCPA 2D6OX 5SV8A 4DRRA 4YZ2A 2A6WA 1SLAA 1RINA 1YIFA 3APBA 2DVBA 2ZGQA 3M3QA 4P9WA 5IK5A 4XIOA 2H0BA 3O12A 1S0CA 3RG0A 1F9KA 1FATA 3I8TA 3TB0A 3PVNA 1KRIA 4PBPA 1WCSA 1ENRA 3V0AA 3AYAA 3HR9A 1WD3A 3O5SA 3SH5A 1LHWA 3WOGA 3NWKA 4L8QA 2WJSA 2EAKA 1AJKA 2ZGTA 1UMZA 1O4ZA 1W6MB 4WVWA 4Y1ZA 3ZSMA 1JYCA 5LK5A 2G4IA 3RMYA 3WDTA 5DZGA 5DXDA 3ZXKA 4XBNA 4YZ5A 1SCRA 4TYSA 4Y1UA 4AVTA 4CTEA 1GANA 2PHFA 4C1WA 1PZ9A 1U0AA 4DRVA 2WSVA 2GALA 3SITA 3WVJA 1KQRA 2DVAA 1LHOA 4XTPA 3ZXFA 3USUB 4YZ1A 1JBCA 5GLVA 2EXKA 4FPFA 1QU0A 2NZ9A 5T5PA 1BJQA 5L73A 2PHUA 3VKMA 4ATEA 4Q8KA 2OUHA 2DURA 4M3CE 5JDBA 4JRAA 3SLIA 1Z78A 2D43A 2D6NA 4M3CB 2OW4A 1LOEA 1DHKB 2VW0A 4LBOA 1C1LA 3DUIA 2EIGA 2R1BA 3AJYA 4M01A 4Q8LA 1A8DA 2BQPA 3AP9A 2P34A 2JE7A 1GZCA 1FX5A 1WW7A 5H9SA 3KM5A 2P3KA 1Q8PA 2WQZC 1GSLA 2JDZA 3MPPG 4XJ8A 1DYPA 2SBAA 4FPKA 1S0FA 4UW4A 3W58A 5IK7A 2AR6A 1WBFA 1PZ7A 3B9CA 5H9PA 3MEPA 4TZDA 4BM8A 1G86A 2ARXA 3AZWA 2NYYA 4FQZA 2ERFA 4XE9A 2I2SA 5DZFA 1UN1A 3D4KA 1MZ6A 3HMYA 2Q5TA 1V6MA 3OBTA 4PQ9A 3UJOA 1SBDA 5DG1A 1C57A 1QDOA 4R9CA 2ZGMA 2E7QA 3T1LA 2V73A 3AP5A 2DVFA 2D3RA 3ILFA 2ZGSA
chains in the Genus database with same CATH superfamily
2EXJA 1JZ2A 5IK8A 1F5FA 1NE4A 4FP2A 5L36A 3OBRA 2BBAA 4UFIA 1PO11 4XUNA 5A3MA 2C24A 2GSYA 4BISA 3VDCA 5EQUA 1Q8QA 3L9JT 4FFFA 4BWOA 4JV4A 2CDPA 1WGPA 2QNKA 3VL9A 4K8FA 4QXCA 4JZRA 1RGSA 1MS5A 2CNAA 4YLZA 4ITCA 4AK3A 1FOD1 4AI0A 1DQ1A 1K3IA 5T5LA 1R081 4YNIA 1HQLA 1L7QA 2WIIB 3A4UA 2BYVE 3M4FA 3VL8A 4EN6B 4CCKA 1O91A 3I54A 1IGOA 3PJQA 2WDBA 3AB0A 3GZEA 2BGCA 3AZZA 3S30A 3ZFFA 2RS11 4TSVA 1W6PB 2IUWA 2PN5A 5KXBA 1O8PA 4CE8A 3GCWA 1XXNA 3WQ7A 1HQNA 1EUTA 4YM0A 1JZ5A 1MR5A 1UYZA 2ES3A 2Z79A 1ZBA1 4AHXA 5IAVA 5FREA 3INAA 1RIRA 3MF9A 4GH4C 3F2ZA 4LKSA 3DECA 4AFDA 2FD8A 3VDBA 5FO7B 1WLWA 3QH7A 3ZXDA 2RMU3 4MGQA 2JDKA 5JLVA 4JQRA 5I0RA 4XEZA 4WZFA 5LY2A 3O1VA 1LESA 2MEV3 3ACGA 3N9NA 3AP6A 5FZ8A 4DZGA 3BKZA 3MZHA 4XF3A 5LA9A 4XJ9A 3VKFC 5K9YA 2OZJA 4NHMA 2A6YA 4LA2A 1QJY1 4IV1B 1O3TA 4JC1A 3I2GA 2VGDA 1NAEA 3NV2A 5FO8B 3RDIA 5JOZA 1AR71 1ULFA 1SEFA 2NMNA 3LA3A 4NAMA 2Q8CA 4CCLA 5JUVA 5CKMA 1CJDA 4Y1YA 5C8WA 1W2NA 4MGTA 1H9WA 2R061 3WW4A 2P3JA 3ZYRA 1JYWA 4XMAA 4FOVA 1COV1 1YIPA 3UT0A 4HK8A 1XU1A 3AKSA 4K8RB 4MZUA 4XFGA 4XHXA 3VBOA 3CL1A 2BW8A 1RUI1 4H55A 1N47A 2RVAA 1TEIA 5FMOS 1Q8OA 3MUY1 3OG2A 4QXKA 1S0BA 4META 1KGYA 4IV3C 4LUKA 4CDWA 5EP9A 2JEMA 1MS8A 1H0BA 4URAA 3CKHA 3POJA 3VBUA 2IWGB 1UF2C 1WWYA 4IW3A 5I8YA 4C0HA 1HB2A 1OLMA 1F8VA 1V00A 1V6IA 4LO6B 3ZSEA 5GZCA 2VZOA 2K0GA 4IV3A 4PDWB 1ZRRA 4FFIA 4DINB 1H9PA 2A70A 5FZ7A 4YG0A 4DPNA 1CQ9A 2X10A 4O9EA 3URFA 4LNVA 2VVDA 3MF6A 1SPPA 4BIOA 1I1EA 4LT5A 2VTFA 5FZDA 4LKFA 4IEOA 4QPIC 3SCHA 3LIHA 1VRH3 3H3ZA 2GNBA 2UU8A 4TLGA 1LOGA 1AR61 1WBLA 1O3QA 2D97A 3WW1A 2D3SA 3WQBA 1JOBA 4P14A 3CEWA 4FPGA 4Y22B 3IPVB 5A70A 5GLTA 4BQ1A 3Q8AA 5F5IA 5C3SA 1HRI2 1XYPA 4Q4X1 3BI3A 1FPN1 1QOSA 3CZUA 5FQ0B 4OHZA 3S57A 1DGLA 4K9SA 3T0BA 1RUD2 1N3QA 3BODA 3OY8B 1MEC2 2XHNA 1RMU3 3ZM8A 1RUJ3 4H2AA 2ZZJA 5C7GA 3MLLA 5KHJA 4QDRA 3LE0A 1CPNA 3ZXLA 1LGBA 1US2A 2ZCWA 2KM2A 4Q4V2 1UKGA 3WP5A 3ZIWA 3SH3A 3EMRA 3TAYA 1YLLA 4RHV2 4ATFA 1BMV2 3U37A 5L7OB 1PGL2 1HKDA 1ND3B 3ON7A 4IV1C 4XFBA 4BH9A 1G9BA 5FUNA 1JOPA 4TTGA 2WKKA 3WSOA 1W9YA 1XSQA 3OGSA 4F3JA 4CDUA 4LOTA 1ULCA 3A0NA 4R4XA 2VW2A 2EA7A 4XJAA 3VBUC 1DGWX 1COV3 2BTVC 1WUVA 4E4HA 3QACA 5FZGA 2E7AA 4MGZE 5JIAA 1NX9A 2E33A 3I3BA 2ZGLA 3VBSB 1HRV1 1GWMA 1RMU2 2DTWA 2J1RA 2VZVA 4KGGA 1K45A 3FHAA 1VBD3 5DUVA 5KHHA 1F5JA 1AX1A 2WSUA 4JVAA 3BOPA 1AVBA 2O8OA 3C7GA 1YXWA 2UY9A 1S1AA 2VBPA 1UD1A 1LEDA 2JD9A 3POFA 2XGXA 3T1MA 1DCSA 3DN7A 3HJRA 5ABJB 2DCZA 3KT4A 1O8SA 2DDUA 4FQ4A 4V1PA 2WNOA 3ILNA 4XDQA 2B7YA 4FVVA 4QPWA 1OPOA 2RDNA 3GZTB 1JYXA 5BNPA 3BTXA 3KF3A 4Q4W2 2CAVA 2HWF1 3HEIA 3VBHA 1RUF3 1UOGA 3MIEA 4DXRA 4HL0A 1QNYA 2DU0A 2G19A 1R082 4IE7A 5ABJA 4XW3A 4Y4RA 4QU1A 5JXGA 1AJOA 1PZ8A 1C5HA 1A8MA 2OPWA 1V6NA 4MGSA 3T2OA 1JUIA 2A6VA 5F2SA 3POWA 4BK5A 1FT9A 1UZYA 2ID4A 5FK7A 2QDNA 5FYYA 3Q8CA 1RHI3 1Z0HA 4P9LA 2CY6A 5FUPA 4JCKA 4LOSA 5C33A 2R30A 5DDJ3 5B4NA 5JI9A 1S55A 5IJRA 1D0HA 4FSJA 1PVC1 4AEDA 1ND3C 4H7LA 4QQLA 2WN3A 2ZAHA 4HPKA 4Y26A 4XF9A 3OOXA 2JDNA 1GU3A 4JGYB 5DZEA 5AC91 2W39A 1HW5A 1IS4A 2Y8KA 5FKCA 3ZVXA 1W3XA 5KC6A 5JMCA 4H3WA 2VZUA 2VZTA 5EYXA 3KHCA 2BPA2 5DAPA 2J1SA 5JOWA 3I2JA 2ZMNA 4GULA 4YW5A 1YCIA 2DCTA 4B1LA 3BPZA 3KMHA 2OQ6A 1FXZA 4FOYA 4P5YA 3LPGA 2PLV2 2YB7A 2JWPA 2AACA 2B4KA 2C1FA 1D4M1 2RMU1 4RQPB 4UF0B 3ST7A 1YFYA 5A33B 5C8CB 3VHPA 2IXCA 1J59A 4GWMA 5EHDA 4Z1VA 3ZN6B 1WA4A 3D5OA 3O1TA 5KHGA 4AFCA 5G04L 2NLRA 3AMQA 5IUQA 1CIWA 2XQXA 2ZGOA 5I0SA 4Y22A 2DCYA 2XDVA 3AP7A 1W28A 3J8F2 1JTZX 3NNMA 1S0GA 3J8F3 1GWLA 3KF5A 4PLNA 2UURA 4CEWA 4CXYA 2ZACA 1J1LA 1XU2A 4AFMA 4QWNA 5E88A 5CZKA 3BTZA 3OUJA 2FDHA 3VBOC 3UJQA 1ZZ9A 2DUOA 2RS52 2BFUL 2YFUA 3AKPA 1VP6A 3K4DA 1H8VA 1LODA 1NCQA 1W9FA 1U5XA 1JU3A 2WQ8A 1YQ6A 3AVSA 4LBMA 2IFWA 3I2KA 4XQWA 5E6HA 4URTA 4Q4Y1 3P3PA 4LR4A 2KXLA 4N43A 2JG9A 1GZWB 3TN93 3SH4A 3B00A 3QD6A 4XZPA 3TEXA 3WUDA 3PURA 3SMHA 2VU9A 1OA3A 2VXJA 4XC9A 2ZBJA 4LHSA 4WM7B 1JZ7A 4CCCA 2W92A 2WZR1 4U36A 1H4GA 2JG9C 1JZ8A 2VCAA 4BHPA 1OF3A 4M4RA 4RR3A 1LOFA 2AYHA 2HWC1 2Q0AA 4O9GA 4HETA 5FXXA 4M4PA 3WG2A 5CISA 3Q8EA 4IGPA 4XCAA 1Y43B 3M3OA 5FXVA 5KC5A 2R49A 4Q26A 1VAMA 2HWE1 4ZS3A 3IM0A 1RUC2 2AUYA 5FZKA 5AVAA 4AHZA 4E4DX 5FR3A 5B2GB 1UPSA 2WAOA 1ZM1A 3JD73 3VD7A 1IPSA 2BZDA 3P6BA 2VQTA 2VQUA 1V6OA 4FI9A 4RA0A 4CU6A 5FKBA 4GAZA 3ZFFB 2ZOEB 1SBFA 1JHJA 2JXAA 3RWKX 2MPFA 3LKJA 4AQTA 3VN4A 5C5UA 3MYXA 2BOJA 2R1DA 4PIZA 2BNOA 3DL3A 3FLRA 4Z8BA 2ZEWA 4P9JA 3I97A 3K46A 1SACA 1A78A 1XYOA 4UWDA 2VZ1A 4CCNA 5K7PA 1WLTA 5D1IA 2YBSA 3R4DB 1BHGA 3I59A 2VBDA 3O7OA 1Q8SA 3TEZA 2JG8C 3HOBA 4KMQA 1N3OA 2ARCA 3WNXA 1RMU1 4Q1PA 1X7NA 3M3IA 5C3QA 4XZUG 5F6LB 3N7MA 2ZHKA 2D40A 1XNTA 4NVPA 5LCWL 3KGZA 4NR1A 4WM8B 5FCCA 4XFFA 1OQEA 1CAUA 5JWPA 1ZRDA 4FCAA 5B4XA 3VZKA 1N3PA 2WA3A 3A21A 4FBFA 2ZA9A 1VBB2 2TEPA 4JKMA 4LK6A 3WZ1A 3R6SA 4FTEA 4X8PA 2PHXA 2CU5A 4HK9A 5FP3A 3VBRC 3CBNA 2XUMA 4YW6A 2ILMA 1RUF1 4XABA 4HOOA 1QF3A 3WF0A 2OQ7A 4AVCA 3U78A 4RR3C 1VBC1 2Q1MA 2QBXA 2PAEA 2G9FA 3BU7A 1UOJA 5E8AA 2UWCA 2VG9A 1W06A 1FV3A 2FHRA 1NQJA 4NIAA 1LHNA 3GJBA 4ES8A 5AFEA 1AR73 1OUSA 2IXKA 1PVC2 2XKPA 4CDXC 1YFUA 3E5UA 4ZU7A 3LDRA 5FZEA 2CAUA 2R063 1E5IA 2VMGA 1NZCA 1F4HA 4E2SA 1V9U1 3CU7A 3IT8A 3Q8FA 2RDRA 3ZMOA 3C7OA 4QPGC 5A3LA 1SBEA 3HD8B 5ACA3 1SZBA 3L2YA 5F7UA 5J37A 5A3PA 1XNKA 4XPVA 3GYDA 4QD2A 1XE0A 3NO8A 4LITA 5EPAA 1RUE3 3ZXJA 2KD7A 2ZGNA 4JHTA 4DY5A 4DUVA 5J96B 4FAHA 3LCPA 4AI8A 1YIFA 3K48A 4QX7A 1PX3A 1UWWA 4XIOA 2H0BA 3RG0A 1K5JA 2W47A 5E1RA 1FATA 3I8TA 3GXUA 1ND3A 3OPTA 1AR92 4XUTA 4CVUA 1WCSA 4Y4YA 4QHZA 5FZ3A 1KRIA 1IPJA 5FLJA 2RR12 1ASJ2 2E9QA 4S2GA 3IDAA 3AYAA 3GM8A 2W1WA 1LHWA 5FY4A 3WOGA 1RUG2 2RM22 3ZIXA 4AI1A 4BZ4A 2JDAA 1AJKA 3VHNA 3MFAA 4D7YA 5CFDB 4WVWA 3LQCA 1X36A 2IXJA 1GOGA 3FL7A 2G4IA 5F6KA 5DZGA 5DXDA 3VBFC 4YZ5A 1EY2A 2RE9A 1GMMA 3N9OA 4HKWA 4Y1UA 3CMGA 1PZ9A 3SITA 3WVJA 1KQRA 3MI8A 1LHOA 4HVOA 2Y0OA 5T5PA 5FWEA 3J9SA 2QVSB 2NZ9A 3PTRB 2ZEYA 2HEVF 2ETEA 5DQ0A 1UYYA 2GH2A 3KWVA 2OUHA 2DURA 3SLIA 1Z78A 2D6NA 1BEV3 2XWJB 2Y38A 1LOEA 3I7DA 3DUIA 2WZEA 4OUEA 2EIGA 4KG0A 3WF1A 2XJUA 4A6SA 3N9QA 1W99A 1A8DA 2W2IA 2BQPA 1NXMA 4UBHA 5JSOA 2WRAA 1FX5A 3KM5A 1Q8PA 4V2WA 3HNBM 3IAPA 4FPKA 2GP3A 4MGIE 1PZ7A 5C6CA 4C91A 1HXS3 4KU8A 4BM8A 1HXS2 1RUC1 2OXBA 5FBJA 3AZWA 4HG6B 4E27A 4XE9A 2ERFA 5CFCB 4Q4V3 1BVP1 1XPWA 5IATA 1FPN2 1K5MC 1V6MA 2Y33A 3OBTA 4AAPA 4B8EA 1QDOA 2WQ4A 4R9CA 3SKVA 3T1LA 1C5IA 1CX1A 2IXLA 2PA7A 3WQ0A 4BQWA 3OPWA 3P5BA 5D2AA 1H8TB 2D3RA 4AQ2A 3WX5A 5FY0A 1XRUA 3ILFA 3RZMA 4K6BA 1S0EA 2VTXJ 2R073 3AK0A 4TWTA 1PMHX 2Q8OA 4O65A 2QQOA 3RWNA 2E51A 2OA2A 1W6QB 1ZBE3 4H7MA 2W87A 4BXFA 2GMEA 4K21A 3MHZA 4Q2FA 4YPJA 3U0ZA 2XWBB 3A7QA 3CNAA 1O4YA 3AXDA 4I0BA 1GLHA 4IEWA 1W2AX 4CDXB 5ISLA 1BBT2 3C8XA 3TOJA 2VULA 5DUWA 4YM3A 1LECA 3OF1A 5LEJA 1MS1A 3WINE 5LBBA 2R6QA 3I2FA 5IT6A 3LAGA 4XILA 1PO22 2BGPA 2DFCA 2VZSA 3PUQA 5KXDA 4M00A 2AEZA 1OFNA 5FY7A 4ARYA 2HWB1 2X53S 2VMDA 4Q29A 4CUAA 1HRV2 2VNOA 2VOXA 4JDNA 3EXUA 1N1YA 3IAQA 2GC2A 5T5JA 1HRI3 1H6YA 3U11A 1AR63 1RITA 3KVAA 4Y1XA 2Z2SB 2OVUA 3JXSA 3TEWA 4M3CA 3BN6A 1AR81 4EJRA 3GF6A 4A4AA 1QKQA 3O1OA 1AYN2 1GR3A 2GNTA 3LA7A 3VD9A 5F5QA 4D7TA 3KCXA 2W1QA 1C3HA 3RYKA 4PDWA 4JGYC 5A7WB 2YBPA 4ZXEA 2ARBA 4LK7A 2AREA 3QOPA 4LXLA 5IVEA 4TXWA 4LHNA 1ULEA 3WNLA 3I49A 3VBRA 3RZZA 1KJLA 3IBMA 3M3CA 4I09A 4XYXA 2F17A 2V4AA 4GH4A 4KU7A 4COWA 5A6YA 1Q56A 5GJ6A 4XFIA 1M4WA 5L7OC 3MFCA 4AVBA 3I3DA 4LKDA 1Y3TA 2JG8B 2DYCA 1G9FA 1R1A1 4N43B 4CDQB 1JZ4A 2G9GA 4UT5A 1AYM2 4W6WA 2YHJA 3FBYA 4SLIA 2BVBA 2P1BA 4W50A 4XIKA 3NV1A 5LA2A 2ADDA 1B35B 2WNVC 3ZPOA 4MXWB 1K12A 2VUJA 5HCBA 2WA4A 1PNFA 2YROA 2LM3A 2A6ZA 1GICA 1BVVA 3H1YA 1VMFA 5IVYA 4B1MA 1O6UA 4XBQA 1QXRA 4GMP0 1LJ7A 2JG8A 1O7FA 3NJYA 3B93A 4N7UA 1DZTA 4INDA 2OZ6A 2MHFA 1H30A 2R7EB 3LEMA 4HANA 2W1SA 2Y6GA 3FFZA 2C0ZA 2JKBA 3M70A 4CRQA 4LBQB 3LDBA 3ETQA 1KS5A 1O3RA 2R072 3H3LA 3K2OA 4DEQA 3AMNA 1E57A 4XDPA 1YHFA 4OMCA 1YFWA 2C9AA 1W05A 1AR91 4QM9A 3W21A 1NA1A 3GCXA 1ONAA 4HT1T 2PLV1 2GH8A 3DXUA 1BBT3 3EYPA 1T6GC 3LIGA 2RMU2 3TYJA 3WDWA 2VOKA 3LGRA 4D94A 2VTXA 2ZKNA 4P9XA 3I59B 4QM8A 2WZPP 4MV2A 5EIYB 1BKZA 1DQ0A 2D6KA 1OKQA 2GC1A 2WAAA 4PI2A 3B01A 5IAXA 4GALA 1G7YA 4L92A 4AGRA 4QB6A 3FLTA 3LEIA 4YGBA 1HV1A 1JN2P 3KHBA 3FJSA 1D2SA 4MSVA 1UZWA 4LA3A 4LO5B 4AEJA 1CGPA 4WM8A 1RUNA 1YJLA 2E53A 2VQ0A 3ZFEC 1UPIA 3LB9A 3NJXA 5CG9A 1RUJ2 5CNAA 3LOIA 2W3JA 4Q27A 3ZYGA 1W2OA 5DPNA 4UFMA 4NIHA 3ZN4A 1IG0A 4MOAA 4YG3A 1D0GA 1W6QA 2IZWA 3IZOA 3IDBB 3UK9A 2WS91 2WLPA 3DGTA 1G9AA 1N1SA 2WFPA 2Z5WA 3B94A 5EFUA 2BWCA 2XG3A 3FBMA 4H14A 1S2EA 2DU1A 1QJX1 2VC9A 2WNEA 3IIAA 2GN7A 3JBG2 4NO4A 4CU7A 2LW8A 1UL9A 2P2KA 2WT0A 4BLJA 4A45A 3D8CA 4LBLA 2HH9A 4JRLA 3JZVA 3IN9A 2VQAA 1HXS1 1CJPA 1CIYA 2I07B 1ENQA 4QPGB 4C90A 1W8WA 3HT1A 1EAH1 1DYOA 2YY1A 3H7JA 3VZNA 4B4QA 1OOPB 4AOCA 5FDBA 1WD4A 4E2QA 4OZOA 4LPLA 4IXLA 2W1UA 4DFSA 4DUWA 4I02A 3BB6A 4CXXA 1NYWA 3K4ZA 5C70A 1CAVA 2UWAA 2HWD3 3U07A 1W03A 1TQ5A 3AZVA 5KHIA 5FJKA 1RUC3 1IQAA 2JD4A 2QUOA 2ZHNA 2Y6JA 3MW2A 1XNBA 2LROA 4ZY9A 4XF1A 4MVTA 3PVOA 3AL5A 1UAIA 3LF7A 3PLQA 4GWJA 1UY3A 4C8DA 3NNGA 3TN92 4E2GA 4RN5A 4Y5TA 4UW6A 4Z07A 1MEC3 1CAVB 2CDOA 2VMFA 1MVQA 2Z42A 1BQPA 2CTVA 1AHSA 1FMD1 1WCDJ 5DMYA 5H9QA 4BYYA 2HWB2 4WBBA 5J48A 4KG8A 2AGSA 4WVMA 5FY9A 1VMHA 3NQHA 4CZSA 4RQPA 4UF0A 3RVHA 2D6LX 2ZGKA 5FBZA 3ZSLA 5FK8A 3PIJA 5FP8A 4QX2A 4YVWC 2SLIA 5ACA2 4G4FA 2HEYF 1AR82 1NQDA 3A22A 4AGVA 5BNOB 3BCWA 1W6OB 3CJIC 3GZAA 1IHMA 1POV0 2AEYA 3EHKA 5FZMA 2VL4A 2WFF1 5SV5A 4COVA 2WWSA 1NA1C 4DQAA 4YRDA 1AYM3 2DWRA 1ULGA 2ZPXA 3ACFA 3U75A 4W65A 2ZMKA 3RZKA 4QQHA 1NLRA 2GNDA 1R083 1V6KA 2K2SA 4FPJA 4GA9A 1RUE1 4XAAA 3S7IA 5FAXA 3AZXA 4CP2A 1DZQA 1S2BA 1W39A 5FP9A 5FYZA 4I30A 1W6OA 3WUCA 4CEWB 1QJY3 1B35C 5E89A 1H1MA 5EWSA 1W2TA 4JKKA 5IVBA 3UGFA 1R092 1R1ZA 3JQWA 1OQ1A 1DGWA 5T5OA 1VBA1 1PGW2 1SLBA 5JR7B 1EV12 1UO9A 1SLCA 1PMIA 2X5IC 2VCMA 2QDRA 1J84A 4NUBA 2H6BA 3B3QE 2W91A 5BPXA 1BEV1 3IPVA 4BXSV 5GZDA 4KBBA 2QQVA 1NZIA 5CYYA 4CEYA 4F7ZA 5J09A 1WMDA 4COYA 5KBFA 1FYUA 2W68A 1YQ5A 4QU2A 2W5FA 1H2NA 1IG3A 3WDXA 2YUEA 1UZ0A 5BY5A 5FPVA 2A6XA 5CFCA 3ES1A 1GV9A 3PUHA 3THTA 1C8M2 1HLCA 4Q0SA 1RHI2 2YMZA 2ZEZA 1CAXA 2ZX4A 5K4LA 4ZU5A 2VPVA 4KQ7A 2VMHA 1UX6A 5FYHA 4RFRB 4U2AA 3I2HA 4CEYB 3ZOIA 3O0VA 3T2PA 3TNPB 2EXIA 3B69A 1IQDC 1W9WA 4AVSA 1BYHA 4IETA 2Y64A 1Z7S3 2O8QA 4JTOA 5I0TA 4P9YA 1NCRC 4S2HA 1OXCA 2Y6LA 5CKQA 1TME1 2ADEA 1ZBE2 1PIV3 1X9TA 2KR2A 2R041 4M0NA 4E9KA 4E8CA 4A44A 2BBVA 2B5HA 3PL0A 1Y4WA 1O4TA 3BYWA 3BOWA 1ASJ1 1JHNA 3HIFA 2XMLA 4D3WA 3WHUA 3T4VA 4N53C 2XOMA 4IEVA 1XNDA 5FZ9A 1TNFA 4NRQA 5FZOA 3ILRA 1C8M3 1JZ3A 1DFQA 2H6CA 1LENA 1UU6A 4OVEA 2JJ6A 1PM4A 5CG8A 4A7ZA 1KEXA 4PDWC 1PM7A 4Y20B 2E32A 4LLOA 5KR7A 4KGQA 2ZGUA 4G9SB 5JI7A 2JDYA 3D3AA 4EN9B 1HX6A 2H0VA 1VB2A 1CWPA 2J1TA 2BEOA 1GNHA 3T2TA 1RTVA 3AFGA 2O1QA 5EJZB 5JMOA 1HV0A 1QJU2 3AL6A 3ACHA 4FT8A 1LNSA 2RS12 4L2NA 3NRUA 3ME2A 4Q4X3 2DFBA 2B46X 3AC0A 5DG2A 5A7WA 3RYRA 1D2QA 3BIWE 2XBO2 3FUOA 1NOVA 2V4VA 1VBE1 3QH6A 5JSRA 4YW2A 5IW0A 1WA6X 5J3UA 3VZLA 3OGRA 4GKXA 1LGCA 5D8AB 4I3GA 2GP5A 4AGGA 3POYA 4MYEA 3SCFA 4CXWA 2VMCA 4FPEA 1FOD3 1LKNA 4EQVA 2B9VA 5LB6A 5EJ1B 3L2HA 5T54A 1JS9A 3ZLIA 2XJVA 4UI9L 4EYUA 5FPBA 1UY0A 1VBD1 1ZYBA 2JKXA 4GB31 2W46A 5T55A 4IE5A 4QQOA 5A3NA 1HB1A 2WABA 2L9LA 4J25A 3WLUA 5I0DA 1AR72 4LE3A 1SDWA 2PFWA 4CDQA 3O1SA 3ABZA 3KV9A 2V5DA 4BIFA 1URXA 3U4XA 2CGNA 1GZWA 3A23A 4Z82A 1WW4A 3OUIA 3UKTA 2RR13 2RHPA 3TN91 3WNNA 2XPJA 1VR3A 3CJXA 2BWAA 1W8ZA 4DS0A 2IVJA 1Q43A 4UBGA 2FBEA 5CADA 1JYVA 4KWJA 2VNRA 4PBOA 1JI6A 5E16A 2WWUA 4LHKA 1VAKA 5C9AC 1MS3A 1SFYA 3DKWA 5BNNB 1J3RA 1DBNA 2F4PA 4NJ4A 3RZGA 1F35A 5HV0A 3I4IA 2A3XA 3RPQA 5BNOA 1RUI3 4IEPA 4LIUA 4XVHA 3ZYPA 1FNZA 1OVPA 2A5ZA 1SDDB 2RG4A 5C71A 4P02B 5FZFA 1AXZA 2HWF3 5CU1A 5G05L 1YWKA 5FMDA 4DXTA 5I0UA 3WP4A 5BXXA 1DQ5A 4W4ZA 2AH2A 3TEYA 3VD4A 3MUZ1 5FWJA 1FAYA 2FMYA 4AE2A 1GOFA 2YC4A 1JXNA 1RVF1 3OYWB 1TE1B 3RS6A 2I74A 1G9CA 1ACCA 1S0JA 2ZX2A 1OD5A 2VUCA 2FMDA 1VRH1 4BPZA 3NJVA 1OC1A 3VGIA 3WHTA 4YFZA 5FFOC 3AJZA 1AXKA 1AR62 4YVSA 4NHYA 1W6NB 5CEHA 1PIV2 4YWAA 1SPPB 4IESA 2D6OX 4Q4X2 3C7FA 3FHIB 5FYBA 2R32A 2ZGQA 3M3QA 4X6QB 1QH7A 4OYUA 4B29A 1CAWB 3O12A 1VBA2 1S0CA 5F3CA 3TB0A 2VVEA 2XL9A 2GC0A 2WN2A 2XLGA 3PVNA 2Y0IA 2PAMA 3WP6A 2C9KA 5JZGB 3RFRA 2JICA 1W8FA 5FTTC 4NIGA 2WYSA 1WD3A 5FY8A 4L8QA 2X09A 1AYM1 5D8AC 2EAKA 1GNYA 2ZGTA 3WD5A 1O4ZA 2F6BA 3WF2A 2DCKA 1JYCA 1J3QA 1VB4A 5K8SA 3WDTA 4AAXA 4CDUC 4XBNA 5JZGA 2QQPA 3MIHA 1SG3A 2PHFA 3MV01 4FXGB 5AVPA 1U0AA 3WNKA 4C1WA 2FDJA 3FHQA 4RS5A 3ZXFA 2FCTA 1JBCA 2Y6KA 2EXKA 1VRBA 2PMWB 4FPFA 1YFXA 4NWWA 4AI3A 3K3NA 4G3YC 5BNPB 3ZXAC 3HQRA 4L11A 4FO9A 1JMUB 3E5QA 1NE6A 3W5NA 2OW4A 4YSFA 2CHHA 2VW0A 4NIDA 4KWUA 4XF0A 4D6QA 3AJYA 3NNJA 4M01A 4Q8LA 5DAXA 3AP9A 4TLFA 1XYNA 5HI0A 3F95A 4ZONA 2P3KA 2O0OA 1GSLA 2VNGA 4QDQA 4GJZA 3UGGA 4DEVA 4EZ4A 1UYXA 5IFPA 5JXJA 2SBAA 3M7AA 4UW4A 3W58A 2AR6A 2VZRA 1WBFA 3S7EA 3ROUA 4Q4W1 4BQYA 2HWF2 2VD7A 1YQ2A 4Z2WA 2ARXA 2Z4FA 3MLKA 3MIDA 5FZLA 5DZFA 2P5BA 2I2SA 3C7EA 4AI9A 1UN1A 1C28A 1OHFA 1MZ6A 3E6DA 1ASJ3 3VHRA 4PQ9A 4OI0A 3BVCA 1SBDA 3TNQA 1C57A 5F3IA 2ZGMA 2E7QA 3ZDSA 1Y9GA 3SC7X 1LRHA 2WBKA 3P1IA 1ZNPA 4RGKA 1OURA 4N90A 4ASLA 4AXOA 4CEYC 4BA6A 3VZMA 2ZGSA 2V72A 2VUAA 1UQXA 4UFJA 5FYIA 5DN2A 5FZCA 2X5IA 3T30A 2WL1A 2ZX1A 1ZRFA 1WKYA 1IS6A 3A0KA 5FP7A 2QFEA 1GQGA 3WV6A 1AF9A 3J7HA 4WM8C 5IK4A 2QQKA 1UCXA 4NHLA 4PF5A 5FZHA 2QQUA 4K7JA 3ZN5A 4UOJA 4Y3OA 3OY8A 4XJUA 1CZSA 1HJGA 2DUPA 3S0MA 2WFF3 4O7XA 4J1WA 4Y5Z0 2X5IB 2HWD2 5DDJ2 4GB32 2WNVA 5T3NA 2EVXA 3OPZA 2VCBA 3AZYA 4N8MA 1TMF3 1LB2A 3WDVA 1LHUA 4AR2A 4SBVA 3UYJA 3R05A 1AZDA 3RZLA 4LO4B 5M0TA 2PYTA 4TN7A 4UXAA 3U10A 4OHWA 3VV1A 2WLQA 3HT2A 2CGOA 2WNVB 5ERLA 1KXGA 2NQYA 3ZFFC 2EAAA 2R062 1NA1B 5DUUA 5FOJB 1ZA4A 1CX4A 3UESA 4R9DA 4CDWC 5IVCA 3OGVA 5A33A 3FN9A 3GJAA 4LBQA 5A7OA 4AYUA 2WR9A 4B3NA 3JUUA 5AFBA 5CFDA 4WM7A 2CYFA 1ZBA2 3AX4A 4I01A 2C4XA 2WS93 3N9MA 1UYPA 4HSLA 1XC6A 1K5MB 4Q4Y2 1WMEA 2BERA 4AFAA 3BIEA 1QQP1 2X29A 2K46A 4N53B 1AXYA 3ZXKA 4XBLA 2OT7A 1MS0A 4UFLA 3T0DA 1LOAA 3K51A 1PK6C 4P9GA 4XF4A 3UKNA 4JGZA 3MW3A 3V65A 5FRAA 2QQJA 4YM1A 2YFZA 4QHBA 1V70A 4YZ3A 4HVRA 3SISA 2WZR2 4NHXA 4NWVA 2D44A 3FC0A 3THCA 1W0OA 2CWMA 1VBC3 4LBNA 2XJPA 1A34A 3ECQA 1RJ8A 4XETA 1MZFA 2BUKA 4DXSA 1FNYA 3DEMA 3T0AA 5LBEA 1DF0A 3SHRA 3PUIA 4YGEA 4UAPA 2HWE2 2JIJA 3Q9OA 1ZA7A 5C4WB 3MIFA 5A32B 3WNOA 1COV2 1X33A 2QZ2A 5BV6A 2R0FA 4YARA 3E6CC 4KNCA 1O3SA 5FLHA 2Q8EA 5H9RA 3D82A 4COZA 3LFIA 1PX4A 1LOCA 2JDMA 1R091 4ZXKA 4AHYA 4HPKB 4QKNA 1OOPA 1PGW1 2X8KA 2ET7A 1MEC1 2A3YA 5FUIA 4XXAA 3OTFA 3H9AA 3ZX7A 5LA0A 4EROA 2FCVA 3GHNA 2VO5A 1BEV2 3K75B 2HKXA 4EWDA 4AVVA 4BQ2A 1OF4A 2RJLA 4M0HA 1QDCA 3POEA 3O1UA 1YC61 3PVBB 3DPRC 3AVRA 1UIJA 4GWNA 4R9AA 1MQTA 1BLZA 4ARXA 1MACA 2P6HA 1YEWA 3W5MA 2YC0A 3MW4A 3NMBA 3RGBA 2C26A 1S0DA 4IV1A 4YYOA 3W20A 2TNFA 3CO2A 3GBWA 3ES4A 3N3HA 5IWFA 1UZZA 2KA3A 3BUCA 3NKTA 4FP3A 4XUQA 4QPIA 4LJHA 3AYEA 2Z69A 2XUEA 3HQUA 3POBA 4W6YA 3WCSA 1ND2C 5L19A 1GBGA 5JR2A 2BNNA 3OD0A 5EYYA 1JODA 1OH4A 3BALA 1KDKA 2Y26A 5GZEA 2VJXA 1GFF2 1LAJA 4GB33 2OPKA 2RS32 2UYBA 4PCRA 3HNYM 2JECA 5BYNA 1NY71 3J7NA 4QPIB 5BNPC 1VE0A 2QE3A 4E8DA 2D5FA 2WINB 3SNMA 1BK0A 1QH6A 1OLRA 3K3OA 4GMP1 5J98B 5F2WA 4UFHA 1LCLA 1LU2A 2BP6A 4I0AA 5FPAA 2ZX3A 3WR0A 3WY6A 2JG9B 2PELA 2XJTA 3G6JB 4OULA 3HVDA 2D6MA 4RHV1 3NL1A 1BMV1 1NLQA 4PIYA 1P8JA 3MIGA 5L9BA 5FPZA 1NXD1 4BJ0A 3KV4A 1VBB3 5CFDC 1PO23 2Q1ZB 5FMCA 4NPRA 1UZVA 2MEV2 2PTMA 2XKOA 4FPHA 3RZHA 3HN1A 5FPLA 1DU3D 4MLOA 4MO3M 3ZSJA 3FE5A 5LWBA 5A3OA 2ORZA 4OI2A 4XUPA 2VR4A 2GMMA 3E97A 3O14A 1RUH1 2BRTA 2EF6A 1E5RA 4Q4W3 1OMIA 1QJU3 1U12A 2XBO1 4NOTA 2WNUA 5TSWA 3ITQA 5A7SA 3ZXGA 3NV3A 5J1XA 2GMPA 1V9U3 4K40A 1YRZA 3RYPA 4ZKTB 5AC92 3RJ2X 4LMFA 1CZTA 2XL7A 3T08A 4CCDA 4XTMA 2HWB3 4BQXA 1XJAA 3VBUB 1NT0A 1SCSA 4UW3A 2JB8A 1VLNA 1FPN3 1NLSA 4CUCA 5F3GA 1PNGA 4MHRA 5K0UB 5FJHA 2Q4SA 4ZZ8A 1IOAA 5LRRA 4QHOA 3VZJA 2HJIA 1JH5A 2TUNA 1W8NA 1WCKA 2HWE3 4HONA 1RVF3 2W94A 2EXHA 4OHXA 3BPSA 5GLUA 1UKRA 5APAA 4YW7A 2J1UA 2JDUA 4WVZA 1C8NA 4MUVA 5L7OA 1DQ2A 1A3KA 4IEQA 1G9DA 3H8OA 4YVSC 3JD71 1CAXB 5JSPA 3S5AA 4P5HA 5FMOL 4ZHNA 1W90A 3IWZA 3WEZA 5FQ0A 4R52A 4CP0A 5LK7B 5C9AB 1OOPC 4R9BA 5EJ3A 4XQ4A 2XVGA 4NMIA 5FZBA 3OGJA 2RS51 1GYKA 4XACA 3GHMA 2IVIB 3EB7A 2D5HA 4LHLA 1L7LA 1W8OA 2YDEA 3W59A 5K0UC 1LU1A 2FCUA 4A3XA 3KT1A 4QKDA 2WO2A 4W6XA 3ZO0B 5FZIA 4AHWA 1H4HA 4IE4A 5A1LA 1TZOA 2B8MA 1KITA 1ZRCA 3AXEA 1ZZCA 2D7FA 4XAEA 3UNPA 1ND2B 2W95A 2YBKA 3O1PA 1QJZA 5DAVA 4BQ4A 4AWDA 3LEGA 4WVVA 5L9RA 3GBFA 1R1A3 2VOTA 4Y20A 3HAGA 2FDFA 1GOHA 1RXGA 1VRH2 5FYCA 5FZ4A 2OYZA 5GALA 2P3YA 1QJY2 1XBFA 4N9HA 4C1XA 1GP6A 2A7AA 1RL3A 1XE8A 2YZ4A 1F31A 4PLMA 4YVWA 3RI8A 2HWC2 1NG0A 1OUXA 1WLCA 4O61A 1MVEA 2IC1A 3GBGA 1G8WA 5FY5A 1A6CA 1TVGA 4IEYA 1NKGA 2W0XA 3KT7A 3PMSA 2XB6C 3GALA 3JB8A 4CDXA 1OD3A 2CGPA 5CIRA 2DF7A 4JDMA 1DGRA 1UY1A 3I3QA 1JU4A 1AL22 4QPGA 3FFQA 5LATA 4PLOA 3QLQA 1RUI2 4Y5SA 4RL7A 3ZPYA 4ONUA 2PHTA 4FTSA 4N43C 3B5LB 3EQEA 1PVC3 2W9XA 1H1IA 2RJKA 1AR93 3KCYA 4J1XA 3U4SA 4GWIA 5IFTA 3Q8BA 5JAXA 1R093 4RGGA 4BMEA 4XFCA 4KWLA 2ENRA 5CBLA 1QIQA 1BBT1 2J1VA 2NMOA 2YC2A 4I2OA 1XQNA 3KCCA 2XLAA 4AEKA 5FPUA 2HLEA 2WNUC 4K3UA 1OA2A 5F5AA 5GZFA 4DY3A 3OGGA 2VUDA 5ANNA 1OT5A 5FP4A 1CPMA 3T09A 4LTAA 4QMAA 2E31A 1OH3A 2JE8A 3LPFA 3USUA 3RZJA 2A71A 3H42B 1CN1A 1S0IA 3POGA 4GXLA 3ZYFA 3N9LA 5C8CA 3AMPA 4OMDA 1X8MA 3T4HB 3ZN6A 4A6OA 3FX3A 4YW1A 1PK6B 4IERA 3WP3A 1OLME 1WCQA 1UU4A 1ULDA 2RS53 4EV0A 5JXHA 3BU0A 1SLIA 3O1RA 1UXXX 2QKDA 5DUXA 4RS5C 2V5YA 1DLCA 4AI2A 2RDSA 1UIKA 1AR83 3THPA 1VMJA 2ZGPA 1K42A 3UV9A 2C5DA 2CWSA 4OI1A 3D0SA 3RSJA 4BQ5A 1DIWA 1PHMA 1RUF2 1POV1 2PQSA 4A2UA 5IVFA 2EIBA 3FUQA 4OHYA 3SCGA 3AKTA 4QB2A 3IMMA 4NIIA 4NE9A 1R1A2 1DDLA 1UY2A 2BFUS 4JHZA 3V64A 4LIVA 1KJRA 2ZGRA 5HCFA 1PGL1 2HYKA 5KXCA 4Y24A 2VY0A 4GH4B 2VZPA 2MNGA 3DYMA 2A3WA 2ZEXA 1HDKA 2NN8A 4JDOA 5T52A 3VHOA 1YO8A 5F1RA 2E26A 2ZKLA 1QQP3 2GDFA 4R8HA 2BJSA 1QXJA 3ENRA 4JAAA 1IKPA 1ZRIA 2J7MA 4KI5M 3VDDA 1IS5A 2LUWA 2IXHA 5FZ6A 5FZOB 5LBFA 1CONA 4RFT0 4XJWA 3IIIA 1CAWA 3D0JA 2D93A 1FV2A 1W8UA 3OEBA 1VBB1 2VCCA 5FY1A 1T2XA 1JW6A 2XBO3 4D7SA 2EIDA 1W6NA 2BU9A 4K1ZA 4NAOA 1LOFC 3RRDA 3VD3A 1UU5A 5A6ZA 1QEXA 3USSA 3B02A 5A3TA 1I6XA 2EALA 2O14A 3NJZA 3G7DA 4FFGA 1SFNA 3N4MA 4MADA 4ZZ5A 1ULPA 1RB8G 2FDKA 1RUH3 2QQNA 5F3EA 4BLIA 1VBC2 2XH6A 2XVKA 4CP9B 1DLLA 1O59A 2HEWF 1ENXA 1UY4A 5BNOC 4DUXA 1CD3G 3KB5A 4AFBA 4L99A 1QHDA 3VBFA 5FZ1A 5GLWA 4KWKA 2ZS6B 3O0XA 1WMXA 4LLFA 3B7MA 1V6LA 3LDKA 1WLDA 1QWRA 4HMZA 1I3HA 4V2VA 5A3WA 5C9AA 3MO4A 2RM21 1BZWA 3I2DA 3N7KA 5FYMA 3FMGA 4D6SA 3VDAA 3I3MA 4YZ2A 4DRRA 4QXHA 1RC6A 1U5YA 2A6WA 3APBA 3CIHA 2DVBA 5CVRA 5A6QA 5HXMA 3DF0A 5LEKA 5AC93 3NAPC 4QX0A 1OKOA 2VBBA 5A7NA 3EBRA 5C5TA 1GP4A 3GDBA 3OSDA 3MGUA 4GD4A 4PBPA 5C3PA 4HZFA 1J58A 1ENRA 3V0AA 3O5SA 2VMEA 3NWKA 1QQP2 1GWKA 1W04A 4XFAA 3U14A 2WJSA 2WS92 3H1MA 2OKXA 2JX9A 3J7MA 1PVXA 2B9UA 3OUHA 4RGAA 4Y1ZA 1ZZ8A 5C3OA 4LEJA 3RMYA 1XOYA 3VBRB 2J1EA 1QJX3 4OQ9A 1L7RA 1SCRA 1UX7A 4TYSA 3SKJE 1RUD3 1W9TA 1GANA 1TG7A 3J4UH 4ORFA 4CTEA 4EN7B 4IEUA 4EN0A 2GALA 3E5XA 4RSUA 1E5SA 2RR11 3VBSC 1UMIA 2P6CA 4CPBD 2EIEA 5GLVA 4YZ1A 1VBA3 1QU0A 4JGYA 3VD5A 3VKMA 3HN3A 2E63A 2PHUA 1I9RA 3UETA 4BDVB 3HWJA 3MDPA 4M3CE 4NPMA 1YI9A 2D43A 4M3CB 4Z2AA 3K77A 4IUGA 3ELNA 4LBOA 1C1LA 3H8UA 3KLSA 2PHLA 4DNYA 4RQPC 3DXTA 1YJKA 4XDOA 1GP5A 1O5LA 1SFPA 4L9BA 2JE7A 3J8F1 5H9SA 4CEWC 2JDZA 2RV9A 4XJ8A 5JCTA 1AL23 5JZGC 5LZ6A 1S0FA 3LFMA 4QQPA 1AYN3 3SEEA 5IK7A 1WCUA 4AVAA 3MEPA 4CCOA 4TZDA 3ALQA 2Q30A 3S5QA 1G86A 4OI4A 4FQZA 4B7KA 3D4KA 2ZX0A 3QBQA 1WZXA 4LE4A 4DO0A 3UJOA 5DG1A 3WW3A 4AQ6A 1E5HA 5J36A 3CJIB 4HBNA 3AMMA 5BNNA 2IXIA 3VBHC 1B35A 2FQPA 4QKBA 1PO21 1REFA 3ACIA 1C1FA 5FXZA 1IKQA 3WDYA 1GQHA 3R4SA 4DB5A 1C4RA 5IVVA 4F83A 3LSEA 1J3PA 3VKLA 1QXPA 2GN3A 4DXZA 1NCQC 1ST8A 3TRSB 5DAQA 1ALYA 1UXZA 2BNMA 2CV6A 4FPLA 2G9ZA 2P17A 2DVGA 4IEZA 4P08A 4FFHA 4YGCA 2JENA 2YGLA 1GZTA 4BMBA 4JGZB 3ATGA 1Q3EA 3KZ4C 2ZMLA 4MX3A 3V0BB 1IZ3A 4AG4A 3UL2A 1YI7A 1QY4A 4RR3B 3KV6A 5GZGA 3AP4A 1HQWA 3N7JA 4S2FA 4ES9A 5I91A 1LOBA 2DTYA 4LUMA 1D4M3 1AL0G 1EV11 2HBUA 3DYOA 4OZXA 3WNMA 2VH9A 3LWCA 4Q0VA 1MZEA 4YVSB 1EUUA 4OFGA 1W2UA 1MZ5A 1POV3 4JQTA 3ZR6A 2NM1A 2VECA 4ASMB 4B7EA 1CAUB 2ZJCA 3PUSA 2AC1A 1HJFA 2A1XA 1LEMA 5FYVA 1RUH2 2DCJA 3BTYA 5HCHA 4EWAA 1H2LA 2I45A 4QT6A 5F37A 4XFHA 1OSGA 1DQ4A 1S2KA 1H8TC 1KFXL 2YPJA 1RUG3 5F8PA 3VBHB 1XNAA 2N7GA 3RMXA 3T2QA 1AYN1 2D98A 2HYXA 3U1XA 1OQDA 1ULOA 5IYYA 4LULA 3C2UA 4Q0UA 1GKBA 1ODNA 1Y9MA 2V09A 3CZJA 4QX3A 5BUVA 3NSTA 2VE1A 1GZ9A 2XONA 4UYBA 1YUDA 3WXPA 4AEDC 2J1AA 3KD4A 4HVQA 4PIXA 1VIWB 3WF4A 1WMFA 3JU9A 3SXWA 1PGSA 4CUBA 2R16A 5FLIA 3H3UA 5DABA 3MV11 4QKFA 1BXHA 2VVFA 3M8LA 3VBSA 2D6PA 2GNMA 4XCBA 4EN8B 3DPRB 1DYKA 3KV5A 4IQPA 4CU9A 5FO9B 1H2MA 4FOWA 3VKOA 1QJFA 1SLLA 4S2DA 1HN1A 1QOOA 2GU9A 4WVMB 3T3YA 3JD72 3ACLA 4JGZC 1Y7BA 4WZCA 3R4UA 3VZOA 4Q1RA 2G1MA 4YVWB 5L9VA 4Q4Y3 4GQ7A 4Q0PA 4YG6A 3DCQA 4ISRA 3OBZA 4M3CF 2QJVA 4IGQA 2LTNA 1V9U2 2XLFA 1QJU1 1CVNA 5A80A 1W0PA 1ZVFA 3KSCA 2ZHMA 5HCAA 4IDZA 3GNEA 4IEXA 1FMD3 3ASIA 4OCTA 4N9IA 3ETPA 3V56A 2RM23 1F15A 1ZBA3 2ATFA 3HPNA 3IDCB 4WV8A 3RI9A 5A3UA 3MBWA 2VM9A 3PIGA 3RQ0A 2ZZQA 2DVDA 2D3PA 2DUQA 3NNFA 3FLPA 4CYDA 3M2MA 2E7TA 1XSRA 3NVCA 4D0QA 2WO3A 3WG4A 1QJX2 2Q1FA 1J1TA 2W52A 2ZABA 1ZREA 1Q8VA 4X8NA 3OJBA 4ZU4A 3D6EA 1JYTA 1ZZ6A 5JPNB 5CAZA 1SLTA 2VNVA 3ZXEA 5C3RA 4ZS2A 3AKRA 5HXVA 4NROA 2XVLA 5D8AA 1PO12 3AKQA 4E4SA 2WO1A 1RUG1 1PMJX 1XB9A 4GKYA 4FXKB 2QQIA 1I5ZA 2PAKA 3ZYJB 3FWEA 4P9IA 1W0NA 4FPOB 2RS33 4K20A 4EWEA 1AL21 1O5UA 1FOD2 4C0BA 3ZYHA 1EYBA 1MQTC 1KD7A 3PTYA 1GQPA 1X50A 3OBAA 4UW5A 1D4VB 5FYUA 3ZYIB 1KS4A 3J26N 3M3EA 3O0WA 1W6MA 2RJ2A 1T6BX 5LASA 3R0RA 5DAWA 2A75A 4BE3A 1LR5A 4FOQA 4E4ZA 2PHDA 1JYIA 3H0OA 3QCWA 3MPBA 4KL1A 3E6BA 1ZX5A 1DG6A 4XXPA 3PNAA 2JIGA 5KHKA 3JBG1 5C4WA 2PHWA 3NAPA 1FMD2 3OEAA 4PHZA 4IL7A 5ANQA 2P4EA 5FIXA 5FV3A 2VZQA 3ZFEB 3J7LA 2A73B 4HKOA 4CCMA 2WT1A 3AFKA 4LKEA 2P37A 2QCSB 1EAH2 2QTWB 2ZHLA 4CCEA 1RYYA 4FPYA 4K1YA 4ET7A 1J83A 5K0UA 5ACA1 2Y60A 3PUAA 5F39A 3OCPA 4DIQA 1IS3A 3MIBA 3H50A 3NAPB 2PXJA 2PQQA 2Q8DA 1Z7S1 4B4PA 4PJYA 1YQCA 1UOFA 1WW5A 4QB1A 4QX8A 5GM0A 4AW7A 1PIV1 4BOWA 3AM2A 5LRSA 5IVJA 2PHRA 2WZR3 3H1WA 1UW8A 4HKLA 4PQQA 3SQOA 3H8XA 2VAUA 4QAWA 4CCJA 5GLZA 1LTEA 1APNA 2CL2A 2GC3A 1EV13 2Y34A 4LQRA 5F5CA 2YU1A 3KQ4B 1OFSA 1LULA 2DV9A 4OQ8A 2XR4A 3V0AB 1VALA 4UFKA 2TBVA 1SQ4A 1VJ2A 1U5IA 2FDIA 4YGDA 1W3VA 4L0PA 4KH9A 5CFCC 4CA9A 2WO7A 2BGOA 3PU8A 3JQXA 4IGOA 4QXBA 1TMF1 1YNAA 2WZ8A 4BU2A 3WDUA 2YYOA 1RJ7A 3POSA 1S4CA 4XHBA 4FAGA 1OPMA 3HNMA 5T50A 4RYDA 2UWBA 5I8SA 1BK1A 5BNQA 3CLPA 4AEDB 3HQXA 5BNNC 4PI0A 3AYCA 1CR7A 2AENA 3NNLA 2VOWA 2R0HA 4Y33A 3THDA 1QOTA 1EP0A 1US3A 1F2NA 1VBE3 3NKGA 3POIA 1MQTB 1EAH3 1DZRA 4LBJA 2IFRA 2YXSA 1JOJA 1IPKA 5F32A 1MPXA 4MGYE 2XQRA 1B09A 3DKQA 1H6XA 4XUOA 1M06G 2F4LA 2RDQA 4W8JA 3WCRA 2VW1A 2ZXQA 1V0AA 2WC2A 5FZAA 4CSWA 4GZ9A 3NV4A 2BV4A 4QX1A 3DV8A 3EJKA 2YV8A 4LORA 1TME2 1VAVA 2R042 3BTAA 4YFWA 4NRPA 1HN0A 1HB3A 1I5PA 4WM7C 1RUD1 4XOGA 3WG3A 2LS6A 3LA2A 4A7YA 4YM2A 1UOBA 1PK6A 1VPHA 4BQ3A 1V6JA 3WG1A 2OUJA 5A1FA 3N36A 2DBNA 4IV3B 4QDSA 4ASKA 2NP0A 4Q4V1 4OHVA 2ARAA 4RD7A 4X6RB 1G6NA 1JZ6A 3UGHA 2JDPA 4I0WB 1LHVA 3P3NA 1L3JA 1MS9A 2QQWA 3GGLA 3VKNA 4Z92B 3HBKA 3NW4A 5LA1A 4MG2A 4A7KA 2WT2A 1H2KA 2J22A 4NN0A 1RHI1 3LSDA 5IHRA 3KQRA 5I93A 4PF1A 2Y6HA 1NCQB 1PO13 2YU2A 4LBKA 3M1HA 1OA4A 1DQ6A 1UNBA 3FZ3A 2PLV3 3JCIA 5EV7A 3VLBB 1EPWA 2X05A 3X29B 4MXWA 4QGNA 2R071 3IMNA 1VBE2 2VMIA 3ZSKA 4HXCA 3ZR5A 2ORXA 1JYNA 4XQDA 5C4WC 2WUHA 1GUIA 1BCXA 1ZBE1 3ZKUA 3WNPA 4OUSA 1R64A 4NHKA 1ZZBA 3N7LA 3WT3A 5J7MA 5EXOA 4YW3A 1NCRA 1YQ8A 2ZAAA 5JVVA 4CDWB 4BB3A 5JPMB 3KS7A 2YPDA 2ET1A 2VXRA 5FMBA 3OYWA 1VBD2 4ISQA 1AX0A 2XXZA 4HN0A 3I3EA 3PVEA 4YW4A 1DGRN 1N1VA 4Q5OA 3ZYBA 2OX0A 3PDQA 2DBIA 1NCRB 2LRPA 2WYFA 4GIQA 4YZ4A 3ZKYA 4I3PA 5FPXA 2J42A 2FZ1A 1K5MA 1RUOA 2FDGA 3ZFGC 1Q5OA 1X9PA 3H7YA 2GAUA 4DMIA 5KXEA 3C7HA 1ND2A 4N7IA 5A7QA 2LALA 3PU3A 1RUJ1 1HRV3 4MXVA 2VOVA 2Y6FA 2JB4A 4LO8A 4J6GA 5EZWA 4XMIA 3V0BA 3E1F1 4JKLA 4XJZA 3TBDA 4DOUA 5JOXA 4QX5A 5CA6A 3I2OA 4LBQD 1OI6A 1REDA 1NUKA 5JOYA 1LGNA 2ZTNA 1SHWB 3I2IA 2B42B 3IKWA 5KWRA 4B4RA 1AX2A 3HBZA 4OLLA 4A41A 4Q0QA 1GNZA 4NRMA 1STMA 2EICA 3VBFB 4EE2A 4CDUB 2W08A 5FOBB 5F9TA 3VUOA 2P3IA 1W9SA 4RHV3 4R4ZA 1OVSA 4CP1A 3H8RA 3K4AA 4P00B 3PMEA 5FXWA 3WQ1A 3KGLA 5D21A 1Z7S2 5CB7A 4RS5B 4D69A 1RVF2 2OIIA 1HIXA 1UMHA 3ORJA 2B45X 3JB4C 2QQMA 4QPYA 2JE9A 3RJRA 3TWIA 4EZHA 5ABJC 2YGMA 1H8TA 3DYPA 1QNWA 1D4M2 1JUHA 3OD4A 4Y1VA 1OBNA 1ODMA 3CHXA 4CUGA 5I8TA 2AZ5A 3AMHA 1Y9QA 3BGAA 4FPCA 4CU8A 3N35A 2XJRA 1N1TA 3O1MA 1EPZA 1WW6A 1QMJA 2XHKA 1ENSA 1MS4A 4AEMA 1W6PA 2WWJA 3PHMA 4CDQC 1HB4A 3ZDVA 2UYAA 5A32A 1FI2A 4BK4A 1YYNA 3MLJA 1KDMA 2C6SA 1TMF2 4AF9A 2E6VA 4XURA 5LW9A 2UY8A 3S6PA 3CQOA 3VDDC 4OUMA 1QGLA 3DPRA 4HLTA 5A7PA 1X8EA 3ZMNA 4COUA 3AYDA 2OS2A 1CESA 4MGKE 3ZFGA 5SV8A 5LBCA 5HBAA 1SLAA 1RINA 1W8TA 2BDRA 5CKNA 4P9WA 4HFSA 5IK5A 1RXFA 4LO7A 1F9KA 4FTBA 4D6RA 5HPOA 5HV4A 5FZ0A 5JIUA 4ZPIA 4NPLA 2WFF2 3HR9A 3SH5A 3B9IA 3ZFGB 2B39A 5GKAC 4KBZA 1X82A 3LD8A 3UKVA 1F4AA 1TNRA 1UMZA 1W6MB 3CDZB 3ZSMA 5LK5A 1RUE2 1SMVA 2RS31 3OB8A 3VBOB 1DP0A 2XJQA 4QGLA 4CPBA 2VZ3A 1XNCA 4IE0A 4AVTA 5JXIA 1W8HA 3LEKA 2RS13 1NY72 4MH0E 4BCUA 4DRVA 1HRI1 2WSVA 3SEPA 2GZWA 1ZZ7A 2DVAA 2CSGA 4XTPA 3USUB 3IB3A 4QQ2A 3WW2A 3EO6A 4Q8KA 1BJQA 2YG0A 3KVBA 5L73A 4ATEA 4HN1A 3CJIA 3C3VA 4N53A 1D7PM 5JDBA 4JRAA 5FYTA 2WNUB 3PJYA 2XJSA 4HSJA 2BVVA 5C8CC 1DHKB 2K9ZA 4L97A 1H1AA 2R1BA 4QGMA 3N9PA 3JBG3 1OLQA 3ZFEA 5A6XA 1CZVA 3W9AA 2P34A 2MEV1 1GZCA 1WW7A 2BOIA 4A3ZA 4GJYA 1XE7A 2WQZC 1POQA 3CF6E 3RNSA 3MPPG 1C8M1 1DYPA 5LY1A 4CP9A 3B9CA 1REEA 5H9PA 2QZ3A 1AUYA 2FZ2A 4MHUA 2QQLA 4IE6A 1TME3 2R043 1U5ZA 2NYYA 4JX0A 4GMP3 2NPIA 4JTNA 5FYSA 3WF3A 3HMYA 4AZZA 2Q5TA 4AQSA 1QJEA 4D8MA 2HBTA 1KFUL 3GZUC 3IDEA 3LOBA 4AL9A 3LZZA 2V73A 2JDHA 2HWC3 3MICA 3VDDB 3AP5A 5A1AA 2DVFA 3VB9A 4F8AA 4A42A 2HWD1 4PT6A 5DDJ1
chains in the Genus database with same CATH topology
2EXJA 5IK8A 1F5FA 1NE4A 4FP2A 5L36A 3OBRA 1PO11 5A3MA 2GSYA 4BWOA 1Q8QA 3L9JT 4JV4A 1WGPA 2QNKA 3VL9A 4K8FA 1RGSA 1MS5A 2CNAA 4YLZA 4ITCA 4AK3A 1FOD1 4AI0A 1DQ1A 5T5LA 1R081 4YNIA 1HQLA 2WIIB 3A4UA 2BYVE 3M4FA 3VL8A 4EN6B 1O91A 3I54A 1IGOA 3PJQA 3AB0A 2BGCA 3AZZA 3S30A 3ZFFA 2RS11 4TSVA 1W6PB 2PN5A 5KXBA 3WQ7A 1XXNA 1HQNA 4YM0A 1MR5A 2ES3A 2Z79A 1ZBA1 4AHXA 5FREA 3INAA 1RIRA 3MF9A 4GH4C 4AFDA 5FO7B 1WLWA 3QH7A 3ZXDA 2RMU3 5JLVA 4JQRA 5I0RA 4XEZA 4WZFA 1LESA 2MEV3 3MZHA 3AP6A 4DZGA 4XF3A 4XJ9A 3VKFC 5K9YA 2OZJA 4NHMA 2A6YA 4LA2A 1QJY1 4IV1B 1O3TA 4JC1A 3NV2A 2VGDA 5FO8B 3RDIA 5JOZA 1AR71 1ULFA 1SEFA 2NMNA 3LA3A 1CJDA 4Y1YA 5C8WA 1H9WA 2R061 3WW4A 2P3JA 3ZYRA 4XMAA 4FOVA 1COV1 1YIPA 4HK8A 1XU1A 3AKSA 4MZUA 4XFGA 4XHXA 3VBOA 3CL1A 2BW8A 1RUI1 4H55A 1N47A 1TEIA 5FMOS 1Q8OA 4QXKA 1S0BA 4META 4IV3C 4LUKA 4CDWA 2JEMA 1MS8A 1H0BA 3VBUA 2IWGB 1UF2C 5I8YA 4C0HA 1F8VA 1V00A 1V6IA 4LO6B 3ZSEA 5GZCA 2K0GA 4IV3A 4PDWB 1ZRRA 4DINB 1H9PA 2A70A 4YG0A 4DPNA 1CQ9A 4O9EA 3URFA 4LNVA 2VVDA 3MF6A 4BIOA 1I1EA 4LT5A 4IEOA 4QPIC 3SCHA 1VRH3 3H3ZA 2GNBA 2UU8A 1LOGA 1AR61 1WBLA 1O3QA 2D97A 3WW1A 2D3SA 4Y22B 4P14A 3CEWA 4FPGA 3IPVB 5GLTA 4BQ1A 1HRI2 1XYPA 4Q4X1 1FPN1 1QOSA 5FQ0B 4OHZA 1DGLA 4K9SA 1RUD2 1N3QA 3BODA 3OY8B 1MEC2 1RMU3 1RUJ3 2ZZJA 3MLLA 5KHJA 1CPNA 3ZXLA 1LGBA 2ZCWA 2KM2A 4Q4V2 1UKGA 3WP5A 3ZIWA 3SH3A 3TAYA 1YLLA 4RHV2 4ATFA 1BMV2 1PGL2 5L7OB 1HKDA 1ND3B 4IV1C 4XFBA 4BH9A 1G9BA 2WKKA 4F3JA 4CDUA 1ULCA 3A0NA 4R4XA 2VW2A 2EA7A 4XJAA 3VBUC 1DGWX 1COV3 2BTVC 1WUVA 3QACA 2E7AA 4MGZE 5JIAA 2ZGLA 3VBSB 1HRV1 1RMU2 2DTWA 4KGGA 1VBD3 5DUVA 5KHHA 1F5JA 1AX1A 2WSUA 4JVAA 3BOPA 1AVBA 2O8OA 1YXWA 2UY9A 1S1AA 1UD1A 1LEDA 2XGXA 3T1MA 3DN7A 5ABJB 2DCZA 3KT4A 4FQ4A 4V1PA 3ILNA 4XDQA 2B7YA 4FVVA 1OPOA 3GZTB 5BNPA 4Q4W2 2CAVA 2HWF1 3VBHA 1RUF3 3MIEA 4HL0A 1QNYA 2DU0A 1R082 5ABJA 4XW3A 1AJOA 1PZ8A 1C5HA 1A8MA 1V6NA 1JUIA 2A6VA 3POWA 1FT9A 1UZYA 2QDNA 1RHI3 1Z0HA 4P9LA 2CY6A 4JCKA 5C33A 2R30A 5DDJ3 5JI9A 1S55A 1D0HA 4FSJA 1PVC1 4AEDA 1ND3C 4H7LA 4QQLA 2ZAHA 4HPKA 4Y26A 4XF9A 4JGYB 5DZEA 5AC91 2W39A 1HW5A 1IS4A 3ZVXA 5KC6A 5JMCA 4H3WA 5EYXA 2BPA2 5JOWA 2ZMNA 4GULA 4YW5A 1YCIA 2DCTA 3BPZA 3KMHA 1FXZA 4FOYA 2PLV2 3ST7A 4RQPB 1D4M1 2C1FA 2RMU1 1YFYA 5A33B 5C8CB 3VHPA 2IXCA 1J59A 4GWMA 4Z1VA 3ZN6B 1WA4A 3D5OA 5KHGA 4AFCA 2NLRA 3AMQA 5IUQA 1CIWA 2ZGOA 5I0SA 4Y22A 2DCYA 3AP7A 3J8F2 1JTZX 1S0GA 3J8F3 4PLNA 4CEWA 2UURA 2ZACA 1J1LA 1XU2A 4AFMA 5E88A 3VBOC 3UJQA 1ZZ9A 2DUOA 2RS52 2BFUL 3AKPA 1VP6A 1H8VA 1LODA 1NCQA 4XQWA 1U5XA 4LBMA 2IFWA 4URTA 4Q4Y1 3P3PA 4LR4A 2KXLA 4N43A 2JG9A 1GZWB 3TN93 3SH4A 3B00A 3QD6A 4XZPA 3WUDA 3SMHA 2VU9A 1OA3A 2ZBJA 4WM7B 2WZR1 4U36A 1H4GA 2JG9C 4BHPA 5FQ0A 4RR3A 1LOFA 2AYHA 2HWC1 2Q0AA 4O9GA 4HETA 3WG2A 1Y43B 3M3OA 5KC5A 2R49A 4Q26A 1VAMA 2HWE1 3IM0A 1RUC2 2AUYA 5AVAA 4AHZA 4E4DX 5B2GB 1UPSA 1ZM1A 3JD73 4RA0A 1V6OA 3ZFFB 2ZOEB 1SBFA 2JXAA 2MPFA 3LKJA 4AQTA 3VN4A 3MYXA 2R1DA 4PIZA 2BNOA 3DL3A 3FLRA 4Z8BA 4P9JA 5K7PA 1SACA 1A78A 1XYOA 1WLTA 5D1IA 3R4DB 3I59A 3O7OA 1Q8SA 2JG8C 1N3OA 3WNXA 1RMU1 4Q1PA 1X7NA 3M3IA 5F6LB 3N7MA 2ZHKA 2D40A 4NVPA 3KGZA 4NR1A 4WM8B 5FCCA 4XFFA 1OQEA 1CAUA 5JWPA 1ZRDA 4FCAA 3VZKA 1N3PA 2WA3A 4FBFA 2ZA9A 1VBB2 2TEPA 3WZ1A 3R6SA 4FTEA 4X8PA 2PHXA 3VBRC 4HK9A 2XUMA 2ILMA 1RUF1 1QF3A 4AVCA 4RR3C 1VBC1 2Q1MA 2PAEA 2G9FA 3BU7A 5E8AA 2UWCA 2VG9A 1FV3A 2FHRA 1NQJA 1LHNA 4ES8A 5AFEA 1AR73 2IXKA 1PVC2 2XKPA 4CDXC 1YFUA 3E5UA 4ZU7A 2CAUA 2R063 2VMGA 1NZCA 4E2SA 1V9U1 3CU7A 3IT8A 5A3LA 3ZMOA 4QPGC 5ACA3 1SBEA 3HD8B 3L2YA 5J37A 1XNKA 4XPVA 3GYDA 4QD2A 3NO8A 1RUE3 3ZXJA 4DY5A 2ZGNA 5J96B 4FAHA 3LCPA 4AI8A 1YIFA 3K48A 4XIOA 2H0BA 3RG0A 5E1RA 1FATA 3I8TA 1ND3A 1AR92 1KRIA 1WCSA 4Y4YA 1IPJA 5FLJA 2RR12 1ASJ2 2E9QA 4S2GA 3AYAA 1LHWA 3WOGA 1RUG2 2RM22 3ZIXA 4AI1A 4BZ4A 1AJKA 3VHNA 3MFAA 4D7YA 5CFDB 4WVWA 5F6KA 1X36A 2IXJA 2G4IA 5DZGA 5DXDA 3VBFC 4YZ5A 1EY2A 2RE9A 4HKWA 4Y1UA 1PZ9A 3SITA 3WVJA 1KQRA 3MI8A 1LHOA 4HVOA 2Y0OA 5T5PA 3J9SA 2QVSB 2NZ9A 2HEVF 2ETEA 2GH2A 2OUHA 2DURA 3SLIA 1Z78A 2D6NA 1BEV3 2XWJB 2Y38A 1LOEA 3I7DA 3DUIA 2EIGA 4KG0A 2XJUA 5JSOA 1A8DA 4UBHA 2BQPA 1NXMA 1FX5A 3KM5A 1Q8PA 4FPKA 4MGIE 1PZ7A 5C6CA 4C91A 1HXS3 4KU8A 4BM8A 1HXS2 1RUC1 3AZWA 4E27A 4XE9A 2ERFA 5CFCB 4Q4V3 1BVP1 1FPN2 1K5MC 1V6MA 3OBTA 4B8EA 1QDOA 2WQ4A 4R9CA 3T1LA 1C5IA 2IXLA 2PA7A 3WQ0A 1H8TB 2D3RA 4AQ2A 3WX5A 1XRUA 3ILFA 4K6BA 1S0EA 3AK0A 2R073 4TWTA 2Q8OA 3RWNA 2E51A 2OA2A 1W6QB 1ZBE3 4H7MA 2GMEA 4K21A 4Q2FA 3U0ZA 2XWBB 3CNAA 1O4YA 3AXDA 4I0BA 1GLHA 4IEWA 4CDXB 1BBT2 3TOJA 2VULA 5DUWA 4YM3A 1LECA 3OF1A 5LEJA 1MS1A 3WINE 2R6QA 5IT6A 3LAGA 4XILA 1PO22 2DFCA 5KXDA 4M00A 1OFNA 2HWB1 2X53S 4Q29A 1HRV2 2VNOA 2VOXA 4JDNA 3EXUA 1N1YA 2GC2A 5T5JA 1HRI3 3U11A 1AR63 1RITA 4Y1XA 2Z2SB 2OVUA 4M3CA 4EJRA 1AR81 3GF6A 1QKQA 1AYN2 1GR3A 2GNTA 3LA7A 5F5QA 4D7TA 3KCXA 1C3HA 3RYKA 4PDWA 4JGYC 2ARBA 2AREA 3QOPA 4LHNA 1ULEA 3VBRA 3RZZA 1KJLA 3IBMA 3M3CA 4I09A 4XYXA 4GH4A 4COWA 4KU7A 1Q56A 5GJ6A 4XFIA 1M4WA 5L7OC 3MFCA 4AVBA 1Y3TA 2JG8B 2DYCA 1G9FA 1R1A1 4N43B 4CDQB 2G9GA 4W6WA 1AYM2 2YHJA 3FBYA 4SLIA 2BVBA 4XIKA 3NV1A 1B35B 2WNVC 4MXWB 2VUJA 5HCBA 2WA4A 1PNFA 2YROA 2LM3A 2A6ZA 1GICA 1BVVA 3H1YA 4XBQA 1QXRA 4GMP0 1LJ7A 2JG8A 1O7FA 3B93A 4N7UA 1DZTA 4INDA 2OZ6A 2MHFA 1H30A 4HANA 3M70A 3FFZA 2C0ZA 2JKBA 4CRQA 4LBQB 3ETQA 1KS5A 1O3RA 2R072 3AMNA 1E57A 1YHFA 1YFWA 2C9AA 1AR91 4QM9A 1NA1A 1ONAA 4HT1T 2PLV1 2GH8A 1BBT3 1T6GC 3WDWA 2RMU2 3TYJA 2VOKA 3LGRA 4D94A 2ZKNA 4P9XA 3I59B 4QM8A 2WZPP 4MV2A 1BKZA 1DQ0A 2D6KA 1OKQA 2GC1A 3B01A 4GALA 1G7YA 4L92A 4AGRA 4YGBA 3FLTA 1HV1A 1JN2P 3FJSA 1D2SA 4MSVA 4LA3A 4LO5B 4AEJA 1CGPA 4WM8A 1RUNA 1YJLA 2E53A 2VQ0A 3ZFEC 1UPIA 3LB9A 5CG9A 1RUJ2 5CNAA 3LOIA 4Q27A 3ZYGA 3ZN4A 4YG3A 1D0GA 1W6QA 2IZWA 3IDBB 3UK9A 2WS91 2WLPA 3DGTA 1G9AA 1N1SA 2WFPA 2Z5WA 3B94A 5EFUA 2BWCA 2XG3A 3FBMA 4H14A 2DU1A 1QJX1 4NO4A 2WNEA 3IIAA 2GN7A 3JBG2 1UL9A 2P2KA 2WT0A 4BLJA 3D8CA 4LBLA 4JRLA 3JZVA 3IN9A 2VQAA 1HXS1 1CJPA 2I07B 4QPGB 1ENQA 4C90A 3HT1A 1EAH1 3H7JA 2YY1A 3VZNA 4B4QA 1OOPB 5FDBA 1WD4A 4E2QA 4IXLA 4DFSA 4I02A 3BB6A 1NYWA 1CAVA 2UWAA 2HWD3 3U07A 1TQ5A 3AZVA 5KHIA 1RUC3 1IQAA 2JD4A 2QUOA 2ZHNA 3MW2A 1XNBA 4XF1A 4MVTA 3PVOA 1UAIA 3PLQA 3TN92 4E2GA 4UW6A 4Z07A 1MEC3 1CAVB 1MVQA 2Z42A 1BQPA 2CTVA 1AHSA 1FMD1 1WCDJ 5H9QA 4BYYA 2HWB2 4WBBA 5J48A 4KG8A 2AGSA 4WVMA 4CZSA 4RQPA 2D6LX 2ZGKA 5FBZA 3ZSLA 4YVWC 2SLIA 5ACA2 4G4FA 2HEYF 1AR82 1NQDA 4AGVA 5BNOB 3BCWA 1W6OB 3CJIC 3GZAA 1IHMA 1POV0 3EHKA 2WFF1 5SV5A 4COVA 2WWSA 1NA1C 4DQAA 4YRDA 1AYM3 2DWRA 1ULGA 2ZPXA 4W65A 2ZMKA 4QQHA 1NLRA 2GNDA 1R083 1V6KA 2K2SA 4FPJA 4GA9A 1RUE1 3S7IA 5FAXA 3AZXA 4CP2A 1DZQA 1S2BA 1W39A 4I30A 1W6OA 3WUCA 4CEWB 1QJY3 1B35C 5E89A 1H1MA 5EWSA 1R092 1R1ZA 3JQWA 1OQ1A 1DGWA 5T5OA 1VBA1 1PGW2 1SLBA 5JR7B 1EV12 1SLCA 1PMIA 2X5IC 2QDRA 2H6BA 3B3QE 5BPXA 1BEV1 3IPVA 5GZDA 4KBBA 4CEYA 4F7ZA 5J09A 1WMDA 4COYA 5KBFA 1FYUA 2W68A 4QU2A 1H2NA 5BY5A 3WDXA 2YUEA 5CFCA 2A6XA 3ES1A 1GV9A 3THTA 1C8M2 1HLCA 4Q0SA 1RHI2 2YMZA 2ZX4A 1CAXA 4ZU5A 2VPVA 4KQ7A 2VMHA 1UX6A 4U2AA 4CEYB 3O0VA 3TNPB 2EXIA 3B69A 4AVSA 1BYHA 4IETA 1Z7S3 2O8QA 4JTOA 5I0TA 4P9YA 1NCRC 4S2HA 1TME1 2R041 1ZBE2 1PIV3 4M0NA 4E9KA 2BBVA 2B5HA 1O4TA 3BOWA 3HIFA 1ASJ1 1JHNA 4D3WA 3WHUA 4N53C 4IEVA 1XNDA 1TNFA 3ILRA 1C8M3 1DFQA 2H6CA 1LENA 1UU6A 4OVEA 2JJ6A 5CG8A 4A7ZA 4PDWC 1PM7A 4Y20B 4LLOA 4KGQA 2ZGUA 4G9SB 5JI7A 4EN9B 1HX6A 2H0VA 1VB2A 2BEOA 1GNHA 3T2TA 1RTVA 3AFGA 2O1QA 1HV0A 1QJU2 4FT8A 2RS12 4L2NA 3ME2A 4Q4X3 2DFBA 2B46X 5DG2A 3RYRA 1D2QA 3BIWE 2XBO2 3FUOA 1NOVA 1VBE1 3QH6A 5JSRA 4YW2A 5J3UA 3VZLA 4GKXA 1LGCA 5D8AB 4I3GA 4AGGA 3POYA 4MYEA 3SCFA 4FPEA 1FOD3 1LKNA 3L2HA 5T54A 2XJVA 1VBD1 1ZYBA 4GB31 5T55A 4QQOA 3WLUA