1GV9A

P58/ergic-53
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
228
structure length
223
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLDGPVFGSADMWNGVGIFFDSFDNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P58/ERGIC-53
publication title Crystal Structure of the Carbohydrate Recognition Domain of P58/Ergic-53, a Protein Involved in Glycoprotein Export from the Endoplasmic Reticulum.
pubmed doi rcsb
molecule tags Carbohydrate binding
total genus 48
structure length 223
sequence length 228
ec nomenclature
pdb deposition date 2002-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1gv9A00
1WBFA 4GWNA 1N3OA 2B7YA 3LSDA 2VW0A 4YLZA 2E7QA 1LODA 5T5OA 2E53A 4M01A 3ATGA 4Y1YA 1AXKA 1R1ZA 4KBBA 1WLWA 5GLVA 1DFQA 3M3QA 1QDOA 4FPJA 2P3KA 3WLUA 2NYYA 2ZACA 5H9PA 2CTVA 3ILRA 4Q8KA 3B00A 5GZEA 5FRAA 1PZ9A 1Y7BA 4XJAA 5GLUA 2VH9A 1WLCA 2HYKA 4P9WA 3WCSA 1DZQA 2G4IA 3AK0A 2D3SA 3ILFA 1W0OA 1QKQA 2KM2A 3KM5A 4NOTA 1JOJA 2D43A 5EWSA 1N3PA 1KDKA 5EXOA 4YGDA 1AX2A 4K1YA 2A75A 3W59A 2ZGQA 3O0VA 3AXEA 5JOWA 3VKNA 1DQ5A 3ZPYA 4Q2FA 4XJZA 3ZXFA 1GYKA 4U36A 3B01A 4YM2A 1LESA 5KXBA 2DUQA 2EXJA 1ONAA 1V6LA 2NMNA 2SLIA 5DZFA 1LHVA 2P34A 2TEPA 3SH4A 5IT6A 2R0FA 4Y1ZA 1HLCA 4HL0A 1PZ7A 1CN1A 1CPMA 4YW4A 4XTPA 4LBMA 3BOPA 2WT2A 2GMPA 1AX1A 4H55A 4FVVA 4W65A 3AZWA 2BQPA 3RMXA 1QNWA 4U2AA 1BYHA 1A8DA 4LBQD 1H9WA 1DQ2A 4Y1XA 1SLIA 3FUOA 1ENQA 3HN1A 2R1BA 4K20A 4GWMA 2GN3A 2PHUA 1KJRA 1Q56A 1JUIA 1Z78A 3PVOA 1I3HA 3N7JA 2YMZA 5JOYA 1UN1A 2A6YA 2JE9A 1CONA 2AUYA 3ZSLA 5JOZA 2NN8A 3NV2A 1HKDA 1FNZA 1MS3A 1Q8QA 2ZGKA 2ZGLA 3PVEA 3LSEA 3R4SA 1LJ7A 4ISQA 3WUDA 2EXIA 2VW2A 2ZHMA 1IS6A 1S0JA 1SBDA 3ZXJA 1S1AA 2V5YA 4WVVA 5FREA 2DUOA 3OY8A 3MPPG 2D6PA 3JU9A 1W6PB 1LU2A 2CWSA 4GKYA 3SISA 5GJ6A 2ZHLA 3N35A 3WV6A 1UZYA 1WW6A 3UL2A 4Y20B 5IK5A 4FQ4A 3A4UA 5CB7A 2A3WA 4XDQA 1LCLA 2WSUA 4SLIA 1G86A 4FPKA 5T50A 4BQ1A 1G9DA 1WLDA 1AJKA 2EXKA 4UW5A 1DYKA 2V73A 2D6MA 5H9SA 1GKBA 5HCAA 1W6QB 3N3HA 4Q1PA 1S0CA 2WLQA 3WDXA 2EIGA 1GZWA 3IPVA 1YI7A 4LBQA 1IS4A 1G9AA 4Y22B 4XZPA 4YM1A 4YZ2A 3AZXA 4AWDA 4FOYA 1GLHA 4BM8A 5T5LA 5HCFA 4YFZA 4R9DA 1G9FA 4FPFA 2YXSA 4JCKA 4YG3A 4AGGA 2P3IA 2UWAA 3POYA 1MVEA 4Q26A 2AGSA 1DQ1A 3V0BB 3AP7A 4XJ9A 3T1MA 4C1XA 3WG2A 2GNBA 5E88A 3AP4A 1IS3A 2D7FA 2VXRA 3TAYA 3GALA 4Y1VA 1DYPA 2YZ4A 4AVSA 3N7MA 1C57A 2VY0A 4YGCA 1QNYA 2CY6A 2DVDA 4FP3A 5JVVA 1CJPA 1OFSA 1V6IA 3VKMA 2ZZJA 2JDZA 3IN9A 1ULCA 3I8TA 4M3CB 3AJYA 3ZYRA 4HANA 1MS4A 2DU0A 2I2SA 1B09A 3GNEA 3OGGA 5DG1A 3ZSMA 1BXHA 4FOWA 4XMAA 2A6VA 2AENA 1QF3A 4C1WA 2OVUA 3NV1A 1DIWA 2A70A 3BIWE 2D6OX 1FATA 3N7KA 4YW5A 1GNZA 5DUWA 1S0DA 2DVBA 2ZMKA 3LCPA 4JC1A 5JOXA 1PZ8A 2YV8A 1BJQA 2JD4A 4XYXA 3SH5A 3WVJA 1MVQA 2PELA 1AVBA 1G7YA 2ES3A 1DBNA 1ZM1A 5SV8A 1N1YA 1MS9A 3D6EA 3OJBA 1DGLA 2PHRA 4XHXA 3VUOA 1BKZA 3WG4A 2A7AA 4FPGA 1YYNA 2EXHA 1XQNA 4M3CF 3FFZA 2WT1A 2DVFA 3PMEA 1CIWA 4FOVA 5KXDA 2CNAA 4DQAA 4ZXKA 5DZEA 4YW2A 5IK8A 1AZDA 2C5DA 1JN2P 2GMMA 1SCSA 3WNXA 3RS6A 2ARBA 3AYEA 2GN7A 1G9BA 2OUJA 4BPZA 2NZ9A 2PHWA 1D2SA 3WUCA 4M00A 5DZGA 4BMBA 3SH3A 5H9QA 4Z8BA 2UU8A 1GZCA 1UMZA 1KJLA 1RITA 3AZYA 3ENRA 3M3CA 4ISRA 3NWKA 4ASMB 5DUUA 1HQWA 1VALA 4UW4A 4F83A 4YZ4A 4AVVA 1WUVA 1SCRA 1KRIA 4P9XA 4GKXA 2UWBA 3I4IA 1A3KA 1W6NB 4PF5A 3FUQA 1I1EA 3VKFC 2ZKNA 1SFYA 4FPYA 2ZGPA 1O4YA 2OW4A 2ZGTA 3BODA 5GALA 3USUB 1VIWB 1LOAA 1ULGA 3M2MA 2PHTA 3UJQA 1A78A 1W6MB 3H0OA 1MS8A 3AYCA 4ZKTB 1O4ZA 1SLAA 3FLRA 3ZSKA 4XIOA 1MACA 2A6WA 4YZ1A 2GMEA 1CQ9A 3AZVA 4YM0A 5T55A 2D3PA 1SLBA 3A0NA 3T1LA 4YFWA 2WSVA 2A6ZA 1H30A 3WOGA 1GNHA 1QOSA 2D6KA 3AYDA 1KITA 4GA9A 4R9AA 4PBPA 1F31A 1MS0A 3V65A 1W6OB 2ZGNA 4FP2A 4XXPA 2GDFA 3O0XA 5GLZA 4GALA 1WD4A 5BYNA 4M3CE 1W6PA 2FHRA 2JECA 3ILNA 5T5JA 5CBLA 5JDBA 2UURA 4Y26A 4Y20A 4PQ9A 1S0IA 1AXZA 5E8AA 5EYXA 1LHWA 4YGBA 4MYEA 1DHKB 2DYCA 4FPLA 3B69A 4CRQA 3RQ0A 3MW4A 1MR5A 3V0AB 1U0AA 2R49A 2JKBA 1W6QA 1UAIA 1AX0A 1WBLA 2ZGRA 1WW4A 4LBOA 4AVTA 4Y22A 4LBKA 3RG0A 3HR9A 2A5ZA 1LENA 4RA0A 1H9PA 2D6NA 3KQRA 4AGRA 3NV3A 1QU0A 1LOEA 3M3EA 1APNA 4Q1RA 3WDTA 3ZSJA 4D69A 3WHTA 3POSA 1ULFA 4NO4A 2JJ6A 3FLPA 1IOAA 3RSJA 4FPCA 1V6KA 4ATEA 3V0BA 4ATFA 4AYUA 1FV3A 4WZFA 4P14A 2R0HA 4DRRA 1LGCA 1AXYA 1LGBA 3OYWB 2R1DA 2WQZC 1TEIA 3AFKA 1WD3A 3UK9A 1CESA 4XJ8A 4XOGA 3WDVA 5DUVA 4M3CA 2GNDA 3QLQA 4TZDA 2EF6A 1UX6A 1DQ6A 2VW1A 1SACA 1ULDA 3B3QE 2DVAA 3IKWA 5GLTA 3MW2A 1GANA 2ZGMA 2ERFA 2CL2A 1SLTA 2VUAA 4CZSA 3AX4A 4YG0A 1DLLA 1G8WA 3DGTA 4PBOA 5T5PA 3AP9A 4K21A 4OZXA 2AREA 3AYAA 4IQPA 4CTEA 2PHFA 5JMCA 1V6OA 1GICA 4XIKA 1SBEA 3NV4A 3O5SA 1F9KA 4RL7A 1LU1A 3AP5A 3SLIA 4WVWA 5GZCA 4PCRA 2GALA 2ZGSA 4BLJA 4UW6A 3CNAA 4YM3A 1LECA 1N1SA 3JUUA 4LBNA 2DTYA 2DTWA 2DV9A 1FNYA 2A71A 5JLVA 3WZ1A 4Y1UA 1Q8VA 1NXD1 2NP0A 1CVNA 1CPNA 1N3QA 3D4KA 4LBLA 1UL9A 2AH2A 3IMNA 4YW1A 5L73A 3WG3A 2CWMA 1UKGA 2ZHNA 1WCSA 1IS5A 1MS1A 1OKQA 2WKKA 5EYYA 5E89A 2SBAA 1YO8A 2EALA 2GNTA 4XJUA 2ZMNA 3MEPA 4XTMA 1GBGA 5GM0A 3ZYPA 5F5QA 1Q8SA 3RRDA 1HQLA 1KQRA 1JYIA 3B9CA 3D5OA 1LEDA 1LOFA 2NMOA 5LK5A 2W68A 1W6NA 4BOWA 2ZGOA 1IKQA 1QOTA 3USUA 2W08A 1Q8OA 4FOQA 1JHNA 1LGNA 1YRZA 3ZXEA 1LTEA 3O12A 1W6MA 3ZXLA 3AXDA 2OUHA 5GZGA 1DQ4A 3POWA 1ZA4A 1LEMA 5DXDA 4XBNA 1QGLA 3VKLA 1WW5A 3MW3A 2CYFA 1G9CA 2ZMLA 3R05A 1WW7A 5CAZA 2LALA 2ZHKA 1FYUA 1CR7A 3C2UA 1LULA 3VKOA 2AR6A 2H0BA 2E7TA 2C9AA 3OPZA 4XILA 1SBFA 2DWRA 1FV2A 4L8QA 1LHOA 1W6OA 4AGVA 3QCWA 1EPWA 3APBA 1LOBA 2P2KA 4XXAA 1F5FA 4GXLA 2ZGUA 2E6VA 1JXNA 2VU9A 4BMEA 3W58A 5AVAA 2P37A 1C4RA 3V64A 3SNMA 4BLIA 1SLCA 5F9TA 2D3RA 3Q9OA 2DUPA 4ITCA 4XBLA 5GLWA 2W52A 1ULEA 4XE9A 1D0HA 2P3JA 5H9RA 4DFSA 1AJOA 1QDCA 4UW3A 1LOCA 3WHUA 3AP6A 3WCRA 1IKPA 1Z0HA 2PHXA 1VAVA 2A6XA 3TB0A 1YXWA 1GSLA 3PVNA 4K1ZA 5KXEA 1ENSA 2DVGA 3WG1A 3V0AA 1LOGA 1BQPA 4YZ3A 1GZ9A 3ZXKA 2JE7A 3ASIA 3BTAA 1JYCA 2D44A 2W39A 4R9BA 3OBTA 5DG2A 4Y24A 2WT0A 2XG3A 3OY8B 3L2YA 2DURA 1FAYA 3ZVXA 2R16A 1N1VA 1RIRA 2YROA 4DS0A 1S0BA 5IK4A 4YG6A 2AYHA 2A3YA 1OQ1A 3VV1A 2WJSA 4Q27A 1V6MA 1J1TA 2E51A 3T2TA 4FPHA 4XHBA 5T52A 1SLLA 3N7LA 4LBJA 1AF9A 3FLTA 2UWCA 3PJQA 4YZ5A 3SITA 1N47A 2XB6C 1W0PA 2ZA9A 1UPSA 5GZDA 3OYWA 1JW6A 3AZZA 4FQZA 3INAA 1Q8PA 3A0KA 1RINA 1N1TA 3M1HA 1VLNA 1GZWB 1UZZA 1MZ6A 3IPVB 4LBQB 1V6NA 1HDKA 3FBYA 4YGEA 3U4XA 1VAMA 4WV8A 3M3OA 3RMYA 1FX5A 4XMIA 3O0WA 1C1LA 4FPOB 5HCBA 2ZABA 1LOFC 5KXCA 3DUIA 1QOOA 1S0FA 2WNEA 4XBQA 4P9YA 1X50A 2D6LX 2FMDA 2ARXA 4DRVA 1DQ0A 1JBCA 1V00A 3N36A 5T54A 3UJOA 4TYSA 2YY1A 4Q8LA 1QMJA 2NM1A 5GZFA 3WDUA 4R9CA 2DU1A 2ZAAA 1BZWA 2Z42A 5CNAA 4XJWA 1C1FA 2ENRA 4YW3A 5CA6A 1KDMA 1V6JA 3HMYA 1GV9A 1LHUA 2RHPA 1NLSA 5DUXA 1MS5A 2Q5TA 3IM0A 2ZBJA 5IUQA 4FPEA 1ENRA 1YIFA 2EAKA 4DPNA 1URXA 1LHNA 1S0GA 3WDWA 3OBRA 2GNMA 4JRAA 1MZ5A 3WDYA 2LTNA 5IK7A 1S0EA 3AJZA 2A3XA 4I30A 3R4UA
chains in the Genus database with same CATH superfamily
1WBFA 5A7PA 2HWE1 2OPKA 2E7QA 5T5OA 3S7IA 5FY0A 1OI6A 1T2XA 4GH4B 4EWDA 1R1ZA 2QTWB 4S2HA 2VZOA 5GLVA 4QB2A 3WLUA 1XXNA 3JBG1 1AR71 1AR62 5H9PA 4OYUA 4AXOA 5GLUA 4XJAA 4LIUA 5FBZA 1QJU1 1CZTA 1FOD2 4MLOA 5ANQA 4XUPA 1VBD3 2G4IA 2GH8A 2D97A 4LUKA 4UFIA 1QKQA 4NPMA 4A6OA 3K77A 3FE5A 2X5IB 5FYUA 4CU8A 3LDRA 5F32A 2ZGQA 5JOWA 4LEJA 4HN0A 3VKNA 1COV2 1DQ5A 1SQ4A 1WMDA 2XLGA 1OA2A 3NJZA 4NHKA 4QT6A 1YJKA 3VDDA 3ZPYA 5A1AA 5J48A 3VBHC 3OPWA 5KXBA 1OC1A 2DCJA 1FPN3 5HXMA 2SLIA 1LHVA 4XABA 2EA7A 1UOGA 4MXWA 1R082 2P34A 4GJYA 4QKBA 4PHZA 2TEPA 3SH4A 4EZHA 4Y1ZA 1CPMA 2YU1A 3P3PA 4FCAA 4XTPA 4LBMA 3BOPA 4L11A 2WT2A 3AMNA 1H2KA 1PMIA 2O8OA 1NCQA 4WM8C 5CFDA 3ZXDA 1RVF3 4XFFA 1RUJ1 5DAWA 1JMUB 1QEXA 1BYHA 4JHZA 4ARYA 2VOVA 5GKAC 4CEWB 3OUJA 5A6QA 5JXHA 2G1MA 1OF4A 4KL1A 2BGCA 1AR63 3C7GA 1SLIA 3FUOA 2OZ6A 4I0BA 1PMHX 3AMQA 3WNNA 1R1A1 2HWC2 4K7JA 2PHUA 3E97A 4X6QB 1CWPA 1FOD3 1JUIA 4IERA 3SKVA 3M8LA 3KLSA 4MGZE 4UI9L 1SDWA 5FMOS 2VZRA 2BNMA 5AC92 1UN1A 2JE9A 3ZSLA 2R071 3VZLA 1MS3A 1JYWA 3PVEA 1PM4A 3LSEA 1YNAA 4JQRA 4F7ZA 4HKLA 4AVBA 1JU3A 1COV3 2LRPA 2UYBA 3H42B 2BTVC 3JD72 4O65A 4QPIC 3ZXJA 2BPA2 2V5YA 3OY8A 1W9TA 2W92A 4EWEA 3H8OA 4INDA 2D6PA 2H6BA 1SFNA 2CWSA 2QDRA 3M4FA 2FDGA 3VN4A 3NKTA 3N35A 1I9RA 1R083 2ZTNA 3AKPA 1KS4A 3BN6A 1SHWB 3J26N 3KT7A 4FFGA 3K3OA 5IK5A 3TN93 1IQDC 2ADDA 2B9VA 5BNPC 5E16A 1V0AA 3Q8EA 2HWB2 4FPKA 2EIBA 3I49A 1F8VA 3K46A 1XNAA 1DYKA 1NUKA 2V73A 5EJ1B 3RWNA 1GWKA 5H9SA 1GKBA 2VMHA 1RUC1 3QH7A 4IGQA 1FXZA 4QPWA 1W6QB 4W6YA 4BK4A 4CA9A 4Q1PA 2WLQA 5LA0A 1XE8A 1GZWA 1HV1A 1EPZA 4LBQA 4QX0A 5F3GA 4Y22B 4YVSC 1ZZ9A 1B35B 2HWF3 4XZPA 4YM1A 3W5NA 3M3IA 4CXWA 1UYXA 1RHI2 5K4LA 2H6CA 4GZ9A 3UT0A 3HD8B 3UKNA 5HCFA 2PHLA 4R9DA 4FPFA 1D4VB 1H2MA 3EHKA 3E1F1 4IEXA 4K40A 5CKMA 5CEHA 1JZ5A 2GC2A 2HBUA 3POYA 4J1WA 4CDUC 3H7JA 3V0BB 4NWWA 1IS3A 1WLTA 2R041 3MIBA 2ZZQA 3GALA 1OUXA 3N7MA 1C57A 3WP6A 2XUEA 3FMGA 4XF0A 2X10A 4LKSA 5FV3A 2Z2SB 2OPWA 5JVVA 1EV11 4ZY9A 2ZZJA 2JDZA 1TMF3 5AVPA 4AEKA 4W50A 1F4HA 3ZYRA 3AJYA 2B5HA 1QJY2 3OGGA 1HB3A 4XMAA 1A8MA 2A6VA 4OHYA 2J1TA 4C1WA 5CVRA 4DEQA 2HWB3 3N7KA 1GNZA 2RDRA 1OA4A 2VZUA 3ZFGA 1S0DA 2DVBA 3DCQA 5JZGC 1PK6A 1QY4A 3PNAA 4V2VA 4XAEA 4JHTA 2EVXA 2IZWA 1MVQA 3LF7A 3ZFEA 1G7YA 4CP0A 1YEWA 1N1YA 1OHFA 2WZEA 3OJBA 3RJ2X 3O1TA 3VUOA 2A7AA 4FPGA 3RZHA 1RHI3 2MPFA 4LJHA 4W6WA 3OSDA 3NRUA 2JDHA 2WT1A 3K4ZA 2PAMA 3UV9A 3PMEA 4BQ5A 3JCIA 5KXDA 3A23A 2WL1A 1H6XA 2IWGB 1O5LA 5IK8A 1H1IA 2C5DA 2GMMA 3HNYM 5A3UA 5FY7A 3AYEA 5LWBA 2P3YA 3DECA 1G9BA 2OUJA 3GHNA 2J1AA 1D2SA 4BMBA 2GP3A 3SH3A 5H9QA 1KFXL 1KS5A 2VBDA 3NKGA 4RN5A 2PA7A 1RITA 1QJY3 1X8MA 5JR2A 1NYWA 2JDAA 3P1IA 4H3WA 5LA2A 2JD9A 3VL9A 5DUUA 4KGQA 4OUSA 2X29A 1CIYA 3OD4A 2VVFA 3NNJA 5A1FA 4Y4RA 3HEIA 3MUY1 4P9XA 3LOIA 4HONA 4XETA 3H9AA 1YFXA 1I1EA 4QM9A 2OW4A 5GALA 3BODA 2C0ZA 4UFMA 1VIWB 1EAH3 2Q1MA 1ULGA 3M2MA 4N7UA 5JWPA 5FOBB 1A78A 1UWWA 3U4SA 3SCFA 1VBC3 4ZKTB 1NA1C 1X9TA 1SLAA 3ZSKA 1O8PA 2QQJA 1GOHA 1UYPA 5CKNA 1AL22 3Q8AA 1CQ9A 4LPLA 1PNGA 4YM0A 5T55A 4N53A 4CP9A 2D3PA 4R4XA 4DXSA 1SG3A 1GFF2 1ZBA1 3VZMA 2Y0IA 2VTXA 3DXUA 4IEUA 3VBOB 4NRPA 2ZS6B 1RUI1 1XSQA 2VOTA 4EE2A 1REDA 1W6OB 1DU3D 4FP2A 4C91A 2GDFA 5LY1A 1WD4A 3A21A 4OHZA 4JGYA 1W6PA 4XQ4A 4JGZB 2QQMA 4HSJA 2WWJA 1UXXX 4OMDA 1UW8A 4PQ9A 1L3JA 2IXJA 5CISA 4CUAA 4E4HA 2JDYA 4RFT0 3P6BA 4FPLA 4DXRA 2VZ1A 3USSA 1PVC3 4XFGA 4QU2A 4NIAA 1VMJA 4GH4C 5AC93 4ARXA 2ZX0A 4LXLA 4NAOA 3WR0A 2HWE2 4ZZ8A 5FPZA 4CSWA 2XPJA 2Q30A 1AYM1 1GMMA 2VMEA 4GQ7A 4LULA 4WM7C 1C3HA 4AVTA 5EFUA 3U75A 5A32B 1XPWA 2VUDA 3NW4A 5L7OB 1LENA 5CU1A 1H9PA 2PLV1 4AGRA 1DDLA 1AL23 5ACA1 3H7YA 3NV3A 2WWUA 1LOEA 3JBG2 1AR72 3M3EA 4N43A 3WDTA 5LEKA 3WHTA 4A3XA 4NO4A 1NE6A 2WNUA 3FLPA 5BUVA 3B02A 1QJU2 4MHUA 2D98A 4QQPA 4RGAA 4FI9A 2WNVC 1V9U1 2X5IC 3MGUA 2P6HA 4ATFA 4OHWA 3OGVA 3VZOA 2DCZA 3VZNA 3OOXA 2R0HA 4JV4A 1AXYA 2YPJA 1XRUA 1J84A 3ITQA 1K5MA 1NG0A 3WY6A 4Q4X3 5A33B 1XSRA 2LM3A 4FT8A 4AOCA 4CDQC 2Y33A 3LFMA 4XOGA 4XF3A 2FCUA 5LBCA 1W2UA 2GNDA 3QLQA 1I6XA 3D82A 4LO6B 3ZXAC 4BISA 4C8DA 1UX6A 2WS91 3ZDSA 4NIDA 2YG0A 1DQ6A 5KC6A 1UOBA 1ULDA 2DVAA 2ATFA 3TRSB 2BOIA 4EV0A 3MW2A 1GANA 3RZZA 2R6QA 4KWLA 4OZOA 2WR9A 5IHRA 4CEWC 1AUYA 3MPBA 2QQPA 1OSGA 4YW6A 3MFCA 1NQJA 4V1PA 2AREA 1W8UA 1RUJ2 4LA2A 1GICA 2JIJA 4WM7A 3NV4A 4RL7A 3J7LA 1WCKA 3DKQA 1Q5OA 2Y6FA 3AP5A 3HN3A 3JBG3 4WVWA 1QH6A 4PCRA 5FY1A 1HXS1 2GALA 4BLJA 4I09A 4XCAA 4DEVA 1K12A 1NCRC 2XVKA 3MI8A 3JUUA 4AR2A 3MHZA 4RS5A 2Q0AA 4LBNA 2DTYA 1FNYA 1US2A 4RGGA 4LO7A 3PHMA 1Q8VA 4LO4B 4Y1UA 5G04L 2VQAA 1CVNA 2WNVA 2R30A 2R072 3H1YA 3BVCA 2AH2A 5LW9A 1R093 3WF2A 3LGRA 3ABZA 4YW1A 5L73A 3THCA 4NIGA 2VVDA 3WG3A 1Z7S3 2HEWF 1OKQA 2WKKA 3BPZA 3FHQA 2ZPXA 5E89A 1GP6A 2GNTA 3ZYPA 2ZMNA 4NE9A 1PO21 4HLTA 4N7IA 1LEDA 1LOFA 1VBD1 2IVJA 5LK5A 4L97A 3O1MA 5I8TA 2P6CA 1PNFA 4TN7A 2YPDA 2ZGOA 3USUA 1NLRA 5LRRA 1YRZA 3KVBA 1RXGA 1ZZCA 1RUJ3 3O12A 1QXPA 1RUC2 2OX0A 1B35C 4QHBA 5JSPA 1DQ4A 1HW5A 4Y4YA 5ISLA 3RYKA 3VDDB 4D6QA 4MUVA 3WNLA 5FZGA 5FMDA 1AR93 5JUVA 3MW3A 5BV6A 3VBUA 4E9KA 1R1A3 4IV1A 3GZAA 3OUHA 4MXWB 1FYUA 1O5UA 1LULA 1YUDA 3C2UA 1R64A 3WQBA 5IJRA 5IVYA 4E27A 3TNPB 1NCRA 4CU9A 1RL3A 5SV5A 4LLOA 2VO5A 5DAPA 2Y0OA 1JUHA 4PI0A 4XILA 5CFDB 1NCQB 2R042 1FV2A 3UKTA 1OD3A 4GB33 3I97A 3APBA 4I02A 1F5FA 2E6VA 1J3QA 3DN7A 4IEYA 1EV12 2ET7A 3K75B 3W58A 3J7MA 3R6SA 3V64A 3SNMA 3W9AA 2Y6KA 2XVLA 2YB7A 1ULEA 4DFSA 2P3JA 1K42A 3BU0A 1UOJA 1RUH3 1OLRA 3WCRA 1Z0HA 1Q3EA 1ZNPA 4I2OA 3EB7A 1JYVA 3N9OA 3TB0A 2XBO1 1DP0A 1W8ZA 3V0AA 4NROA 2TBVA 1Y43B 1RUC3 2JE7A 2QE3A 3KGLA 1NOVA 3ETQA 3BTAA 2HKXA 2D44A 3GZTB 4MSVA 4P9LA 5FJHA 5KHHA 5C5TA 5JSOA 4A7KA 3OY8B 3I2IA 2RS52 4FXKB 4Y33A 3ZVXA 2XKPA 3OGJA 2YROA 5IK4A 4KWJA 4OI1A 5L9VA 4HETA 1OXCA 1S4CA 3GCXA 4A7ZA 3VBSA 4Q27A 3TN91 2A73B 4EN9B 2E33A 4XHBA 3ZXGA 1FT9A 3N7LA 4LBJA 4AEDA 3J8F1 1W0PA 2R043 2P17A 2OT7A 1JW6A 3AZZA 3U07A 3A0KA 1RINA 5JXJA 2QQVA 3M1HA 1ZRCA 2YFUA 4E2SA 4KWKA 2HLEA 1DGRN 1GZWB 1UZZA 4MGSA 5IAVA 1VMHA 4LBQB 1DYOA 4QQOA 3FBYA 2HWF1 3HQXA 4WV8A 3B94A 3ZDVA 1VMFA 5FJKA 1SZBA 3OEAA 1QJFA 3EQEA 2LUWA 2Q1ZB 5FK8A 5FMBA 4XBQA 4SBVA 4K9SA 4TTGA 4P9YA 2RS31 2WQ4A 1EY2A 5JR7B 3VBFA 2OIIA 1J59A 1ZYBA 2IVIB 2YY1A 5GZFA 1QMJA 4CUBA 5A6ZA 3AMMA 2DU1A 4YVWA 1BZWA 2Z42A 3CJXA 2DCKA 1JZ4A 4B4RA 2ENRA 3ACIA 1TMF1 4QX7A 5IAXA 1GV9A 2AEYA 3UETA 1M06G 3EO6A 4CYDA 2Q5TA 4ASKA 2VMFA 2EAKA 3ZR6A 1YIPA 1URXA 4QKDA 3ZFFA 4WZCA 3ZN5A 1RB8G 2ZAHA 1JU4A 3VBOC 5C3PA 1MZ5A 4PT6A 5IK7A 1S0EA 3AJZA 3ZFGB 3O1SA 1PK6B 1ND3C 3ACFA 1DCSA 3R4UA 4LUMA 3H8RA 1H4GA 2B7YA 4NVPA 1H1MA 5EP9A 1RUI2 1VP6A 2VW0A 3BCWA 3ZFEB 4J6GA 1LODA 4AHYA 2E53A 4M01A 4MOAA 5FLJA 3WQ7A 1AXKA 4KWUA 2JKXA 1LRHA 1CX1A 4L0PA 1WLWA 3IDCB 3NNLA 3M3QA 1QDOA 1OH3A 3KCXA 3ZPOA 3BTYA 1POQA 3SQOA 5C33A 5JAXA 1RUE3 2CTVA 5JSRA 3B00A 3FC0A 5GZEA 1ZREA 1PZ9A 2FBEA 3CDZB 2EICA 3WCSA 4QWNA 1DZQA 5FZ6A 3ILFA 1JI6A 1STMA 3KM5A 2WINB 4LHKA 1MQTC 4OULA 3T30A 2Y26A 5IVJA 5EWSA 1E5IA 4YGDA 2A75A 1C8M1 3KD4A 4QKFA 3O0VA 3AXEA 4IGOA 2HBTA 5L7OC 2FCTA 5BNNA 1V70A 2OQ6A 1AYM2 3C7HA 4Q2FA 3ZYBA 4IW3A 4JDMA 3ZXFA 5IATA 2DUQA 2UY8A 2NMNA 2PLV2 4PIYA 5ACA2 2YHJA 5FIXA 2JDKA 3S5QA 1VRH1 4A2UA 3HJRA 3KGZA 1HLCA 4EN8B 1CN1A 1UY2A 1ZBA3 4YW4A 5FZCA 1JYTA 3T09A 1V9U2 1LKNA 2GMPA 3WQ0A 4H55A 1RUI3 5FP7A 1EAH1 2HYXA 1W28A 1QNWA 4O61A 3RZJA 3F95A 2CAVA 3E6DA 1VBC1 2H0VA 1DQ2A 4Y1XA 1IZ3A 1SPPA 4UFHA 2R1BA 5FXZA 2QQNA 2IXCA 2QCSB 5FZLA 1RYYA 3AMHA 2QFEA 1O8SA 3ACGA 3HIFA 2WS92 3PVOA 4XFBA 4O9EA 4N53B 4AQ2A 4CP9B 3N7JA 2YMZA 4EZ4A 5JOYA 1CZSA 3B7MA 2AUYA 4IV3A 2NN8A 4LLFA 3NV2A 4FXGB 1HKDA 2P5BA 3K2OA 4TXWA 2ZGKA 3E6CC 2VVEA 1TVGA 3IMMA 3R4SA 2VNVA 5I91A 4IESA 1CAVA 2EXIA 2VW2A 2ZHMA 1S0JA 3WXPA 1UF2C 4D94A 3MPPG 5C8WA 1D4M2 5JIUA 1W6PB 1LU2A 3LDKA 3SISA 5ACA3 4LIVA 1WW6A 3VDCA 1HXS2 3GJAA 1OLQA 1X36A 1D2QA 2O0OA 3A4UA 4HKOA 2A3WA 1ND2C 3OD0A 4AW7A 1G9DA 1WLDA 1CAUA 4HBNA 1JH5A 4M0NA 2EXKA 5F37A 3J7NA 4UW5A 4XFCA 2VNRA 4Y3OA 1Y3TA 4BWOA 1TZOA 3AB0A 2ORZA 3N3HA 4DMIA 1YQCA 2EIGA 1UD1A 3IPVA 4FFFA 2W1WA 4H7MA 4UYBA 1GNYA 1UNBA 2C6SA 1GLHA 2Y6LA 1NA1B 2PQSA 2YC4A 2ZX1A 3AZXA 3ES4A 4FOYA 4AFMA 4YFZA 2WS93 3LIHA 4N43B 1PGW1 1ZA7A 3ES1A 2ZCWA 1QWRA 2B8MA 2UWAA 2WNUB 1BEV1 1MVEA 2CSGA 3AKTA 4Q26A 1VBD2 3AP7A 3T1MA 3WG2A 2VG9A 3AP4A 3HQRA 2VXRA 4MADA 4AI8A 4AVSA 1DYPA 5FQ0A 5D2AA 3W5MA 3VDDC 4HVRA 2IXLA 1K5MB 1XE0A 4EROA 2KA3A 4HK9A 1RC6A 3MIGA 3VHOA 1ULCA 4EQVA 1U5IA 1CX4A 3A7QA 4OCTA 4A44A 2DU0A 1B09A 1MEC1 3NQHA 4B1MA 4CCNA 3PU8A 1BXHA 4LTAA 2WDBA 3IDBB 4YW5A 4QU1A 5CFDC 1NCQC 2YC2A 1BCXA 2ZMKA 4Q4Y3 3LCPA 3O1VA 3BTZA 2YV8A 5CG9A 2QZ3A 1VE0A 2XMLA 3I2KA 4FAHA 4K3UA 3WVJA 4MX3A 3ZO0B 4HPKA 1RVF2 5ABJA 5BPXA 4OFGA 3D6EA 3ZYFA 1DGLA 5FBJA 3WG4A 1QJX1 4WM7B 2K9ZA 1YYNA 2EXHA 1XQNA 2DVFA 3WNOA 1YHFA 1E5HA 1PO23 5I93A 2F4LA 4JDNA 4ZXKA 4EN7B 4RS5B 4YW2A 5FYTA 5G05L 3O7OA 4X6RB 2XBO2 2WNVB 4HMZA 4BPZA 5FYHA 2PHWA 4LKDA 1RUOA 1R091 3ZLIA 4AK3A 4E4ZA 1W9SA 1J1LA 5DZGA 5A7WA 5JMOA 2VQ0A 4MGKE 2YGMA 3H3ZA 1Z7S1 1HN1A 2UU8A 1HV0A 2PN5A 3WP4A 1UMZA 1KJLA 4BYYA 3AZYA 4CDQB 5FTTC 2XQXA 4ASMB 4H7LA 5A70A 1HQWA 2MHFA 3MFAA 2XR4A 3DL3A 4COVA 4FO9A 1O4TA 2W5FA 4XAAA 3TN92 1WUVA 4HZFA 2OYZA 1KRIA 2XQRA 1Y9QA 1CJDA 1A3KA 4XQWA 3VKFC 1SFYA 2ZGTA 4KI5M 3USUB 1LOAA 1NY71 2PHTA 3LQCA 5ERLA 3UJQA 4RFRB 3H0OA 1MS8A 5K8SA 4E2QA 2VQUA 3VD5A 1AR91 2DCTA 2HWF2 4L92A 3VBUB 2PTMA 4IV1B 3AZVA 2PAKA 4NIIA 5IVEA 4S2DA 1RUD3 2Y38A 4YYOA 3T1LA 4HSLA 4YFWA 1NCRB 2A6ZA 1H30A 4L2NA 1DZRA 1PIV1 2O1QA 1O91A 2D6KA 2Q8CA 3WOGA 2XBO3 2D5FA 1CD3G 3HAGA 1KEXA 1MS0A 3M7AA 1D0GA 4GB31 3KT1A 3V65A 2Y8KA 1VJ2A 3O0XA 5EPAA 2J1VA 1XNCA 4GALA 4M3CE 3ILNA 1TMF2 5FY5A 5JDBA 2GH2A 4GMP3 2LW8A 2BGPA 4Y26A 5JI9A 1S0IA 2Y64A 5F6LB 2VBBA 1FI2A 4XFHA 1JTZX 5FZIA 3ZFGC 1RUH1 2DYCA 1PK6C 3MIFA 2YBKA 2ZKLA 3B69A 2B39A 5LA9A 5FZ7A 2QUOA 3MW4A 3J8F3 4A4AA 1PGL1 5FKBA 3ZFEC 3V0AB 1YFUA 2XJSA 2R49A 4EN0A 1AX0A 2JX9A 2F4PA 2ZGRA 5EHDA 2AC1A 1VBA3 2R7EB 1GP5A 3HR9A 2A5ZA 2D6NA 5IW0A 5M0TA 3G6JB 5FO7B 5IVCA 3POSA 2QQOA 3VBSB 5FUNA 1IG3A 3ACHA 2BNNA 4IEWA 1OMIA 5FPLA 3WP3A 5HXVA 1IOAA 3HBKA 5HPOA 2BOJA 4ATEA 4Q4W1 3H8XA 2C26A 2RS33 4M0HA 3HT2A 1FV3A 4AEDB 2ZJCA 1AYN3 2QQWA 4A41A 1LGBA 1UU5A 4YRDA 4NHYA 5FZMA 2VXJA 3B5LB 3RZLA 1C8M2 1EP0A 1WD3A 2J22A 2W1QA 1OKOA 2BBVA 5CADA 2VNGA 4XJ8A 3S7EA 4MZUA 2EF6A 1JZ2A 1W3VA 2VW1A 3JXSA 4ASLA 1VRH2 5GLTA 1ZBE1 1VBE3 2VTXJ 2ERFA 5K0UA 2CL2A 3KV4A 1SLTA 2JE8A 2RJ2A 1UZWA 2VUAA 3IB3A 3FWEA 3VBFB 1DLLA 3ZX7A 3MIHA 1G8WA 5A3MA 5FP3A 5C71A 1H4HA 3UNPA 4K21A 4NPRA 3FJSA 1IPSA 1EAH2 4IQPA 2PHFA 5JMCA 3MV01 4LE3A 4IGPA 3BOWA 3TEWA 1NT0A 1SBEA 1VBC2 5FOJB 4LHLA 1LU1A 2KD7A 3GM8A 5F5CA 4N53C 2ZGSA 4UW6A 3CNAA 3GHMA 3POEA 5E1RA 2QVSB 5FXWA 2QQLA 3ZFFB 4MG2A 1S55A 2DTWA 4QXCA 2WZR1 3WZ1A 4ORFA 2OXBA 2WZPP 3U10A 4CCKA 3MO4A 3GDBA 4FFHA 4LT5A 4LITA 3D4KA 2O8QA 5TSWA 3CBNA 3M70A 1C8M3 4XUNA 1J3RA 1ODMA 3FN9A 1H2LA 4JGYC 4LKEA 2RR13 4URTA 3C3VA 4HXCA 1O3RA 3KCCA 5FPXA 4AI2A 1UKGA 1WCSA 2PQQA 3ZMNA 2Y60A 1RUE1 1YO8A 4XTMA 4RHV1 3D0JA 4LE4A 4Q29A 1Q8SA 4LKFA 1VRH3 3L2HA 2FQPA 3RRDA 1IGOA 1WCUA 3SKJE 4NAMA 2NMOA 4HT1T 3RYRA 4NMIA 1IKQA 1QOTA 2D40A 1PVC2 5FPBA 2AACA 3H1WA 1Q8OA 4FOQA 1JHNA 4IEQA 4NR1A 4XC9A 4CE8A 3ZKUA 1JOBA 2JG8A 1W6MA 2YBPA 3AXDA 4G9SB 4XPVA 2XJPA 3ZXLA 2RG4A 4JTOA 4YPJA 1YLLA 5BNNB 1BVP1 4AEJA 4GJZA 3TEYA 3I7DA 2Q4SA 1QGLA 4N43C 1WW5A 3WW4A 2WNUC 2CYFA 3B9IA 2J1SA 2MNGA 1OF3A 2WFF1 2ZMLA 3ZYJB 3SEEA 3VKOA 4I01A 1PGW2 2AR6A 5DDJ1 2CAUA 1BEV2 2BYVE 4G4FA 1W8TA 1HQNA 4PI2A 4O9GA 2NPIA 1HRV1 1K5MC 4L8QA 1LHOA 4PIXA 1ND3B 1UQXA 1OVSA 2FZ1A 1A6CA 5L9RA 4ET7A 4GXLA 4GIQA 2ZGUA 3S30A 4Q4X2 5LCWL 4BMEA 2JB4A 3DYMA 1H0BA 1C4RA 2P37A 5FMCA 1SLCA 5F9TA 1SPPB 3KV9A 5GLWA 3VDAA 4D7YA 3RWKX 1MEC2 5H9RA 3KB5A 2Q1FA 3AL6A 4UW3A 1XNDA 3PVBB 4DUVA 3WHUA 3AP6A 3EXUA 2CU5A 4S2GA 1TME1 1YXWA 1ZRFA 4IV3B 2VQTA 2O14A 2W3JA 1MQTB 4Q4V1 4BQ2A 1CAVB 4BZ4A 1WMXA 5KHJA 3TOJA 4XCBA 2W39A 1MZEA 3OBTA 3NJXA 4A42A 2XG3A 4AFDA 4BE3A 4DIQA 4EJRA 2I74A 3VD7A 3LA3A 5J37A 2R16A 2PYTA 3O1UA 3IWZA 1BK0A 4PJYA 5HV4A 4YG6A 5FYZA 2AYHA 4AFAA 2A3YA 1OQ1A 3K4AA 4RS5C 3VZJA 2XJRA 1HB2A 1C5IA 2XJQA 1VBB3 4YARA 1BEV3 2WZ8A 2V4VA 4QX3A 3WX5A 1ZZ7A 3UESA 3FLTA 1ENXA 2UWCA 2ZA9A 5GZDA 3TEZA 3NNMA 3D0SA 1L7QA 2VZQA 1Q8PA 1GUIA 1R092 1XNKA 4Z07A 1VLNA 1W90A 3IPVB 4LO5B 4I3GA 2B46X 1F5JA 1V6NA 4RR3C 4XF1A 4XUTA 1Z7S2 2K2SA 3UGHA 1UZ0A 1HJFA 3PLQA 2GAUA 1MEC3 1W99A 3MF6A 5LK7B 3U1XA 1LOFC 4UFJA 1E57A 4CUGA 1HJGA 1RJ8A 3DUIA 4UF0A 2E7AA 1X50A 3CIHA 2LROA 5F5IA 2RM21 2FMDA 2YC0A 3LIGA 3ON7A 4K8RB 4L99A 1JBCA 1V00A 2CGOA 2B4KA 5T54A 3AKRA 1WMFA 2DBIA 4Q8LA 4PLOA 4QQLA 1BLZA 1WA6X 2YGLA 2ZAAA 4B29A 1NY72 4FAGA 2QDNA 3KCYA 1C1FA 3N9NA 4XJWA 5CA6A 4NIHA 1V6JA 3JQWA 3VBUC 4COYA 1QJX3 1LHUA 4IV1C 1NZIA 5E6HA 1AR92 3IM0A 2WUHA 2ZBJA 1R1A2 5J7MA 5FZAA 4DPNA 2VJXA 2E32A 1S0GA 3GCWA 1ZX5A 4RQPC 4MH0E 3WDYA 2LTNA 4Q4Y1 4J25A 2A3XA 1PIV2 1ND2B 2MEV1 1GQPA 1K45A 2XL7A 4I30A 1AR83 3TBDA 3CJIA 3ELNA 4GWNA 5EJ3A 3NJVA 2WN3A 1OOPA 4YLZA 4GB32 4HPKB 4Y1YA 5A80A 4B1LA 4KBBA 1YFWA 3MLLA 2BU9A 3CL1A 3NAPA 4RYDA 4FPJA 2P3KA 5F7UA 2NLRA 2ZACA 3OPTA 4OHVA 4RR3A 1X9PA 4Q8KA 2CDOA 4TWTA 5FCCA 1OUSA 1Y7BA 1WLCA 3RFRA 4P9WA 3ECQA 3LKJA 4ZU4A 3W20A 4Z1VA 1ASJ1 1U5ZA 1RUH2 2D3SA 3HBZA 5L9BA 5B4NA 4NOTA 3W21A 5IFTA 3NSTA 3SHRA 2BNOA 4CCLA 1PGL2 1PGSA 1AX2A 3BYWA 4K1YA 1W9WA 2BRTA 2XWBB 1UY0A 2RDSA 5A7WB 2ZEWA 4XURA 1GYKA 4U36A 2J1RA 3B01A 3LEIA 3SCGA 1H8VA 1OPMA 4TSVA 3WP5A 3VBSC 5FYBA 2XJVA 3S57A 3OBAA 2R0FA 4M4RA 2VAUA 3OB8A 4AEDC 3RI8A 4C90A 1JZ7A 1XNBA 5F8PA 1PIV3 4RQPA 5D8AC 4AZZA 5T3NA 1AX1A 4FVVA 4I3PA 4JRLA 1U5XA 3AZWA 4W65A 4CPBA 5FLHA 2GC1A 4QM8A 4U2AA 3ZOIA 2QJVA 5C70A 3K51A 3AVRA 4XW3A 5IVVA 4Q0PA 3OBZA 2VZVA 5FKCA 1TNFA 3IIIA 2VOXA 2VMCA 3GXUA 1H9WA 3LA7A 4LBQD 4XQDA 2ID4A 5DAVA 4BDVB 1ENQA 1WZXA 5FPUA 3V56A 3HN1A 4ES9A 1OFNA 4K20A 4ZHNA 4LOTA 3O1RA 4GWMA 2VOKA 2WQ8A 1KJRA 4UAPA 1Z78A 3GZUC 1NX9A 3LDBA 1RUD1 4LNVA 1O3SA 3VBFC 2QQKA 2FDHA 2A6YA 1ZBE2 3VZKA 1EYBA 1W8WA 4P00B 5C9AC 4CP2A 1FNZA 1Q8QA 5B4XA 4D8MA 3WUDA 4YVWC 3RJRA 1IS6A 2QBXA 1ZZBA 5ANNA 1S1AA 5FREA 3QH6A 5FZ8A 3Q8CA 3KV6A 3POJA 2ZEYA 3MUZ1 3CLPA 3IDAA 3MDPA 2FDFA 2JICA 3GZEA 4GKYA 5GJ6A 4GMP1 5EQUA 3ZFFC 3K3NA 5FZ0A 2W46A 2RV9A 3UL2A 4D0QA 5FYIA 4FQ4A 4MGQA 1UX7A 5CB7A 1RJ7A 3PTYA 2NQYA 4Q4W3 1LCLA 2WSUA 3R4DB 4IL7A 5T50A 2VECA 2WZR2 1F15A 2VGDA 1AJKA 3FHIB 4CDXA 3KWVA 2JWPA 5D8AA 2D6MA 3AKQA 2BZDA 5HCAA 1DZTA 3KS7A 5FXXA 3RZMA 3KVAA 3WDXA 4QD2A 1L7LA 1YI7A 2XUMA 1IS4A 1TQ5A 5LATA 1VBA1 5A3LA 4AWDA 3KSCA 4Q0VA 1ZRIA 3ZIXA 1RUE2 2YXSA 4E8DA 4AGGA 4QGNA 3U37A 1ZBE3 2L9LA 2V5DA 1DQ1A 4C1XA 4XJ9A 2GNBA 5E88A 2D7FA 2BVVA 1AYN1 4FTEA 1J58A 2BUKA 5BNNC 5C9AA 5FO8B 4CDWA 1QNYA 2CY6A 2DVDA 2ARAA 1RTVA 4FP3A 1OFSA 1V6IA 4I0WB 5F2WA 3ORJA 5FAXA 3VKMA 1CGPA 2FD8A 2ORXA 3ZN6A 3IN9A 3I8TA 1P8JA 4Q0QA 2HWC1 1YJLA 1MS4A 4CVUA 4XFIA 5DG1A 3ZSMA 4FOWA 3WNKA 4KG0A 4OVEA 3NV1A 2VMIA 2A70A 4NHLA 4R4ZA 2XGXA 2D6OX 1FATA 2VZ3A 5FYMA 1VBE1 2WZR3 5DUWA 4R8HA 1ZBA2 5DDJ2 2GP5A 4JC1A 4EN6B 5K0UB 1PZ8A 1BJQA 4JZRA 2JD4A 2YFZA 3SH5A 1AHSA 1WMEA 4FTBA 3PL0A 1NQDA 1HRV2 2PELA 3A22A 1AVBA 1IHMA 4IE5A 2JENA 4DXTA 5DABA 5C3RA 4YWAA 4R52A 1W2TA 1U12A 4XHXA 5A3OA 4O7XA 3VHRA 1BKZA 5L36A 1JZ6A 1VB2A 2Q8EA 2VMGA 4M3CF 5FZDA 1UU6A 2D5HA 3FFZA 5FZHA 4RHV3 1CIWA 2WABA 4DQAA 1VAKA 2ARCA 4IV3C 4HG6B 5DZEA 4Q5OA 1WGPA 1JN2P 3RS6A 4AFCA 4MGTA 1RGSA 1ZZ8A 2JDUA 2GN7A 3LOBA 4DINB 5CFCA 3CHXA 5FZOA 1EUTA 2NZ9A 3THPA 4QQHA 3NJYA 1QXJA 4N9IA 4Q4V2 4IDZA 2RR11 1O3TA 1QQP1 3ZYHA 4URAA 3PUQA 4Z8BA 5BNQA 4FFIA 4B8EA 4P5HA 3M3CA 2VNOA 4DXZA 4MO3M 4W6XA 2J42A 2WFF3 1VALA 2W91A 2VZTA 3HT1A 4UT5A 4UW4A 3SMHA 4OUEA 1GP4A 4COZA 1SCRA 5DDJ3 4IE6A 4GKXA 4OQ9A 3EMRA 3I4IA 4UOJA 4PF5A 3FUQA 2ZXQA 4YW7A 4FPYA 2ZGPA 3PIJA 1HRV3 1JYXA 2C9KA 3AM2A 3N9QA 3QOPA 4X8NA 2JG8B 5CIRA 1W6MB 1OLME 4HVQA 5C4WA 4ZXEA 3FLRA 5A3NA 4XIOA 4P9GA 2FDIA 2WNOA 3WNPA 4AG4A 3O1OA 2A6WA 1VRBA 2GMEA 4YZ1A 1F4AA 1SMVA 2BV4A 2V72A 4KG8A 3A0NA 2WSVA 1QOSA 1TME3 4GA9A 1KITA 5D21A 4W4ZA 1ULPA 4R9AA 2V4AA 2RM22 3E5QA 4PBPA 1F31A 4RSUA 2W0XA 5LZ6A 3H3LA 1D7PM 3KMHA 4IUGA 4Q4V3 4D3WA 1W8OA 4CEYA 4PIZA 3VD3A 3GJBA 4XXPA 1JS9A 1XC6A 5GLZA 1RUG3 5BYNA 2ZEXA 4JGZA 2FHRA 1JODA 3CO2A 4HVOA 4IEPA 4JGYB 5FZ1A 5JXGA 2UURA 2J1EA 4KNCA 3SXWA 4OMCA 4Y20A 5KHGA 3T2PA 5E8AA 1WKYA 3KV5A 5EYXA 1T6BX 4CUCA 4MYEA 2IFWA 4CRQA 3RQ0A 4YNIA 2Z5WA 5BNOA 4Q4Y2 3SCHA 1MR5A 3NL1A 2MEV2 1UYYA 2FZ2A 4WVMA 5ABJC 1U0AA 2IFRA 5I8YA 1MPXA 2JKBA 2EIDA 1UAIA 1WBLA 1REFA 1W2AX 4P08A 4CXXA 4LBOA 2XWJB 5C3SA 2Y6HA 1GQGA 2VZSA 3KQRA 4RA0A 5LBEA 3SC7X 5EIYB 4KMQA 1S2EA 1APNA 3ZSJA 2BWAA 3BPSA 1ULFA 1VBB1 3DYPA 2XVGA 4NRQA 4ONUA 4QMAA 5LB6A 1BBT1 1UIKA 1PO22 3RSJA 1XE7A 1UO9A 4MXVA 5K9YA 1ASJ2 2RM23 3S6PA 4AYUA 2WRAA 4OLLA 4PLMA 2JEMA 2KXLA 4DRRA 1LGCA 3QACA 4H14A 1LR5A 4P9JA 4JQTA 2WQZC 5APAA 1TEIA 2F6BA 4QPGA 1UMHA 2AZ5A 2WC2A 2WWSA 3T0DA 1WWYA 4F3JA 3SEPA 5I0RA 3MYXA 3WDVA 5DUVA 4M3CA 4WVZA 2JIGA 3CKHA 4LHNA 1QHDA 3HWJA 5FY4A 4BQ3A 4Y5TA 2RJLA 4TZDA 1W39A 4OI0A 3BKZA 4A7YA 1YQ8A 2Z79A 1S2KA 3IAQA 5A7QA 1E5SA 3IKWA 4OHXA 1BMV1 2MEV3 2WBKA 4B7KA 2WIIB 4YG0A 2Q8DA 1PVXA 4PBOA 5T5PA 3H8UA 1XU1A 3CEWA 4GWIA 3AP9A 1FMD3 4CTEA 2HWD3 2OQ7A 3KZ4C 2E26A 3I2JA 3I3QA 5D1IA 1ALYA 3O5SA 4QGMA 2BWCA 2VCBA 3SLIA 4BB3A 4YM3A 3CU7A 1LECA 2BERA 4A6SA 1GWMA 4QQ2A 1RUD2 2DV9A 3DPRA 1ASJ3 1YC61 2A71A 1W04A 4H2AA 4AI1A 5F1RA 1NXD1 1GOGA 3WEZA 1N3QA 1AR81 5C8CA 1PHMA 3CJIB 4LBLA 3IMNA 4CPBD 3S0MA 1WCDJ 3RPQA 1OOPB 3FZ3A 2CGPA 3RI9A 1X7NA 3I3MA 3IZOA 4LA3A 2CWMA 3NAPB 5LBBA 1XBFA 3AKSA 3L9JT 2SBAA 2EALA 2W94A 4RR3B 1W05A 2JG9C 3H3UA 2ZOEB 4Z2AA 1HQLA 1KQRA 1ULOA 1W0NA 3GYDA 1YFYA 1JYIA 2XONA 2RMU3 2A1XA 2XLFA 4META 5FP4A 2J7MA 3IBMA 2V09A 1W6NA 5EZWA 3IIAA 4BOWA 1YWKA 2BP6A 3D8CA 3J8F2 3TEXA 2FMYA 1RUF3 3ZXEA 1LTEA 3POGA 1RMU3 4IEVA 5JPMB 1K5JA 4COUA 1OQDA 4IEOA 3ZM8A 1HIXA 5A3TA 5DXDA 2CV6A 1C8NA 3IT8A 1VBA2 5FYSA 3C7EA 4IETA 3R05A 1KFUL 1WW7A 2W87A 4UFKA 5CAZA 1RXFA 5FWEA 3ME2A 3RGBA 2E7TA 4D6SA 3S5AA 2VBPA 4PF1A 5FO9B 4MGIE 4RQPB 2RS32 1SBFA 3J7HA 1AYN2 4BJ0A 4GWJA 4OQ8A 3DEMA 2ILMA 2DFBA 3BALA 4AAXA 3H50A 3QCWA 1EPWA 5FZEA 2P2KA 4HN1A 4XXAA 2JB8A 4RD7A 1ZVFA 1X8EA 2CHHA 3VBRC 5LEJA 2VU9A 4AAPA 1JYNA 5AVAA 2Q8OA 2D3RA 4CCMA 3Q9OA 2DUPA 4ITCA 4XBLA 5FY8A 3BI3A 1NAEA 2BEOA 1D0HA 2BW8A 2VOWA 3MF9A 1AJOA 2GC0A 3TYJA 2JG9A 5K0UC 3CMGA 4JKLA 2PHXA 4L9BA 1VBE2 2A6XA 1GSLA 4K1ZA 4NN0A 5KXEA 1ENSA 2DVGA 3WG1A 4QB6A 1LOGA 1GZ9A 1ZRDA 3ZXKA 1JZ8A 5KWRA 1O7FA 3DKWA 3VHPA 2RDQA 5DG2A 5LA1A 4XACA 4IE0A 5A6YA 1W2NA 2EAAA 2JXAA 5FZKA 3L2YA 1UYZA 2DURA 1O3QA 3OTFA 1Y9GA 2VCAA 1EUUA 3GF6A 1RIRA 1KXGA 2HJIA 3VBHA 3U11A 4DB5A 2WYSA 2CGNA 1NE4A 2VPVA 2WJSA 5BXXA 3VL8A 3VV1A 2BGOA 1V6MA 2OZJA 4PDWC 2E51A 4XUQA 2XJUA 5F3CA 1XOYA 4HK8A 4FPHA 5T52A 3T2TA 2WAOA 4AF9A 5JCTA 3WINE 1AF9A 3PJQA 4YZ5A 1N47A 4JTNA 1UPSA 4DUWA 4CDXB 3OYWA 4E4DX 1NZCA 2HEVF 5D8AB 4FQZA 5FFOC 1POV1 3INAA 3THDA 4WM8A 1H1AA 3T2OA 5FUPA 4DOUA 3NMBA 1Q43A 2W95A 1W2OA 1MZ6A 1QQP2 2RR12 2K46A 3VBRA 4YGEA 5A7OA 1VAMA 3T2QA 3M3OA 4AFBA 3U4XA 4TLGA 1OT5A 2HWC3 1NLQA 3O0WA 3PJYA 4C0HA 3TWIA 2DF7A 2EIEA 5FZFA 4UXAA 2ZABA 5KXCA 1W9YA 4ZU5A 5FZ9A 1QOOA 2CDPA 2E31A 2WNEA 3NNFA 4CU6A 2VD7A 5A7SA 4DRVA 1H8TC 2QQIA 5FYVA 1QJEA 4AEMA 2JG8C 5LASA 1S2BA 3JD73 1SFPA 3PURA 2PFWA 4TYSA 4ZONA 3WDUA 5C9AB 1GR3A 4NRMA 4CDWB 4YVWB 4COWA 5CNAA 4YW3A 4QPIA 4ES8A 3ZN6B 4AE2A 4MVTA 2X05A 2XHKA 3X29B 1IPJA 3LEKA 1NLSA 1YQ6A 3P5BA 5FPAA 5IUQA 5IVFA 1YIFA 1UIJA 2GNMA 4JRAA 4PDWA 3MIDA 3AL5A 3FX3A 5BNPA 1IG0A 5C3QA 1GWLA 2RJKA 1UY1A 1N3OA 3LSDA 2RVAA 2VL4A 4V2WA 1XB9A 4LR4A 2GC3A 1TG7A 4K6BA 4HFSA 3ATGA 1QQP3 2RS51 3NNGA 5C5UA 1DFQA 5CYYA 3J4UH 3MIEA 4XUOA 5IFPA 3MLJA 2NYYA 5J1XA 4YVSA 2XH6A 3ILRA 1PX3A 5FRAA 1UPIA 4D6RA 5C3OA 2VH9A 5FR3A 4Q0UA 2HYKA 3AVSA 2YBSA 2WO3A 2XKOA 3AK0A 4B4QA 3T0AA 1W0OA 2KM2A 4CDUA 3I2DA 1DF0A 2B9UA 3I59A 1JOJA 3LAGA 4Q0SA 2D43A 4TLFA 1N3PA 3DF0A 1KDKA 4XF9A 5EXOA 4AHZA 4CCCA 4CCDA 3MICA 1PO11 1H8TA 3W59A 5FZOB 2KR2A 5CFCB 2OA2A 3VDBA 3PDQA 2AEZA 4LQRA 3P3NA 4XJZA 3O1PA 1IQAA 3FBMA 4NHXA 1LESA 3LA2A 4YM2A 2EXJA 1ONAA 1V6LA 5FPVA 1A34A 3LEGA 1WA4A 5DZFA 1CZVA 4AVCA 4Y5SA 4LOSA 3T3YA 4PQQA 1OH4A 3U14A 1YI9A 2W1SA 4LMFA 5IT6A 1TNRA 4HL0A 1VBB2 1PZ7A 4NJ4A 1BBT2 3UGFA 1GOFA 4KU8A 3RYPA 1UY4A 3LPFA 5JIAA 5I0UA 2YYOA 5JZGA 1F35A 2BQPA 3N9MA 3OF1A 3FFQA 3RMXA 3ZYGA 5J36A 4JX0A 4J1XA 1UXZA 3PTRB 2XDVA 2ZX2A 5J98B 5DN2A 3ZIWA 4CU7A 1A8DA 1KGYA 2WO2A 2ZX3A 2E9QA 4QXBA 5C4WB 2PXJA 2R061 1CAWA 4QX2A 1W8FA 2DBNA 3R0RA 5FK7A 4A3ZA 3I2OA 4QX5A 3LFIA 2GN3A 2G9FA 3WT3A 2Z69A 5CG8A 1Q56A 1J83A 1Y4WA 1I3HA 4UWDA 5J3UA 1CONA 5JOZA 1BMV2 1XYPA 4ISQA 3CZUA 2ZGLA 3WF4A 1LJ7A 5FUIA 1SBDA 4M4PA 3LEMA 4CEYB 4WVVA 4GMP0 2DUOA 1YQ5A 1RUG1 3JU9A 1L7RA 1W8HA 3U0ZA 1QJX2 2IUWA 1W06A 2E63A 2ZHLA 3WV6A 3HVDA 1UZYA 4Y20B 4D7TA 3G7DA 2RS11 4XDPA 4AI9A 5F2SA 1BBT3 4P9IA 4XDQA 1UKRA 2WYFA 4SLIA 1G86A 3CJIC 4N9HA 3PU3A 2IXKA 3EJKA 4KGGA 3MLKA 4BQ1A 1OOPC 4JAAA 1CAUB 1CAXA 3RVHA 5BNOB 4WVMB 1AR82 1BHGA 3URFA 4QGLA 5KC5A 1S0CA 3GBFA 4GAZA 1BVVA 2WAAA 3NAPC 2DFCA 2TUNA 3H1MA 2YUEA 1G9AA 1HB1A 3POIA 4YZ2A 1NA1A 2RE9A 4BM8A 1SDDB 2B45X 5J96B 5FYCA 2PMWB 1DGRA 2XOMA 5T5LA 3PMSA 1Y9MA 5I0TA 3FHAA 5I8SA 3ROUA 1G9FA 2VCMA 4JCKA 4S2FA 4YG3A 1ST8A 3BTXA 2P3IA 1TE1B 3BU7A 5CZKA 2AGSA 2I07B 1REEA 3ZMOA 3TAYA 4Y1VA 2YZ4A 1US3A 5FQ0B 3JQXA 3VGIA 2HEYF 2VY0A 1BK1A 4YGCA 4BIFA 4QPGB 1CJPA 3PUAA 5FZ3A 3VHNA 1H2NA 3KHBA 1HRI1 4EWAA 4M3CB 4HANA 1OD5A 3GNEA 2I2SA 4BQ4A 3ZKYA 5F39A 3RZKA 1NKGA 2AENA 2ADEA 1QF3A 2OVUA 1DIWA 3BIWE 5AFBA 3DV8A 4B3NA 5JOXA 3GBGA 4XYXA 1DGWA 2HWE3 4AQ6A 4ZS3A 1UZVA 2ES3A 1FMD1 4B4PA 3MBWA 1DBNA 2HWD1 1ZM1A 4GH4A 5SV8A 4AQSA 5DQ0A 1MS9A 5ABJB 1D4M1 2PHRA 2YU2A 1OA3A 2X8KA 4MV2A 5HI0A 2TNFA 4IE4A 5IWFA 5HBAA 1AR73 1I5ZA 2J1UA 3TNQA 2P1BA 4AI3A 4FOVA 3WF1A 3MV11 2CNAA 1ODNA 1QJU3 4X8PA 4DUXA 4P5YA 3WNMA 2XJTA 1M4WA 1XYNA 5F5AA 1AZDA 3I3DA 3DPRB 3WNXA 1SCSA 1W3XA 1X82A 5C6CA 5JPNB 1GU3A 2ARBA 2X5IA 3C7OA 4OUMA 5FWJA 5C8CB 5I0DA 1PM7A 3WUCA 2X09A 4M00A 3D3AA 1XYOA 4ZZ5A 4NWVA 4MGYE 4Y5Z0 2YDEA 3JB4C 1HB4A 5AFEA 5IYYA 1GZCA 3ENRA 2X53S 2DDUA 3HNBM 4JDOA 4CDQA 3RZGA 3FL7A 4ISRA 5FLIA 4CP1A 2VMDA 3EBRA 2W2IA 3NWKA 3Q8FA 1JOPA 4BA6A 1HN0A 4F83A 4YZ4A 4IE7A 4AVVA 4BQWA 4QXHA 2RMU1 4N90A 4CDXC 3VD9A 2W9XA 3WSOA 2IXHA 2UWBA 4Q4W2 1W6NB 3C7FA 3QD6A 2ZKNA 2RDNA 1O4YA 5A1LA 2IC1A 2VUJA 1RUF1 4PLNA 4F8AA 1RMU1 1JHJA 2WO7A 4CEWA 4EYUA 2FCVA 3AYCA 1O4ZA 4XDOA 3E5XA 2VC9A 4QHOA 3C8XA 3RNSA 1FPN1 4AHXA 1MACA 4BHPA 5DPNA 5LRSA 4GULA 1SLBA 3J9SA 2JDNA 3DXTA 1GNHA 3AYDA 2QKDA 2R073 4NPLA 2OKXA 3WF0A 2VULA 3NO8A 4CDWC 2WLPA 3OUIA 3QBQA 4JVAA 4Z2WA 1RVF1 3UGGA 2ZGNA 3IAPA 2QQUA 5DAQA 4N8MA 5A3WA 2JDMA 4LHSA 5JI7A 5T5JA 2JECA 1AR61 4ZS2A 5CBLA 4AHWA 4QDQA 5EV7A 5FYYA 1AXZA 1FOD1 1XJAA 5JXIA 4QKNA 1LHWA 4YGBA 2HH9A 2JG9B 3ST7A 1DHKB 3WQ1A 1LAJA 2OS2A 3I2HA 1QXRA 3AFGA 3N9LA 3BIEA 3POFA 1POV3 1W6QA 1ZRRA 1COV1 4CCEA 3K48A 4E8CA 3BUCA 1WW4A 3ZR5A 1OLMA 4BQXA 1LB2A 1DGWX 4Y22A 4LBKA 1B35A 3RG0A 4NUBA 2XL9A 3T4VA 3WW2A 1QU0A 3NVCA 1R081 3OGSA 2C4XA 4Q1RA 3VBHB 4BIOA 3ZYIB 3DYOA 4D69A 2LS6A 3LB9A 4RHV2 4QAWA 1OURA 2JJ6A 5FZBA 4W8JA 4FPCA 1V6KA 3V0BA 4LK7A 3HOBA 1U5YA 1F2NA 5CFCC 4QB1A 4P14A 2C1FA 4WZFA 5FZ4A 4OI2A 3OYWB 3PUIA 4QX8A 2R1DA 1OPOA 3VB9A 3AFKA 1PO12 2BFUL 1DG6A 4K8FA 4WM8B 3N9PA 4XVHA 3THTA 3N4MA 3UK9A 3CQOA 4BCUA 1EV13 2VUCA 1CESA 4KBZA 3T4HB 3VBRB 3ZN4A 3OGRA 1W8NA 1C28A 5KBFA 5A3PA 2UYAA 2WFF2 1UY3A 1SACA 3B3QE 4E2GA 5FDBA 3OEBA 1PMJX 5EJZB 3KHCA 2ZGMA 4XEZA 5DAXA 5KHKA 4CZSA 3AX4A 2R32A 2WFPA 3E5UA 3DGTA 2XLAA 3KQ4B 5KHIA 3JD71 3PUHA 5HCHA 4OZXA 2P4EA 3AYAA 5C4WC 1V6OA 2QZ2A 2RS53 5LBFA 4LO8A 4XIKA 5BY5A 4YSFA 4QPIB 1F9KA 1H6YA 4ZU7A 2GU9A 1G6NA 1YCIA 2R062 5GZCA 2WO1A 2BJSA 2N7GA 4QDSA 4DY3A 5B2GB 2QNKA 3OCPA 4D7SA 1N1SA 4DO0A 2HWB1 4BXFA 3VD4A 4QPYA 1ACCA 5JLVA 5C7GA 2VM9A 4PDWB 1SEFA 1O59A 3Q8BA 4BH9A 5BNPB 2NP0A 4G3YC 1CPNA 1TME2 1O6UA 3CZJA 4IEZA 1QJZA 2VCCA 1UL9A 4CEYC 1PO13 1RUNA 3I3BA 3GGLA 3LZZA 1OQEA 4JGZC 2WA4A 4A45A 5FXVA 3ETPA 2I45A 2PAEA 3I2FA 1RUG2 3I3EA 1RHI1 2ZHNA 1IS5A 1MS1A 1T6GC 5EYYA 3UYJA 4XJUA 4YVSB 4QXKA 2FDJA 2VZPA 3MEPA 1GBGA 3POBA 5GM0A 5F5QA 1AL0G 3HPNA 2RS12 1X33A 3B9CA 3D5OA 1HX6A 5BNOC 1UMIA 2GSYA 4IXLA 4CCJA 2W68A 1WCQA 1VB4A 4CDUB 4BQYA 3I59B 4AL9A 3F2ZA 3KT4A 5CKQA 4WBBA 3OG2A 4B7EA 1VPHA 2W08A 1LGNA 5L19A 1H8TB 2G19A 3B93A 3KF3A 2OUHA 2Y34A 5GZGA 3ALQA 3LPGA 3POWA 3WW3A 1ZA4A 4Z92B 1LEMA 4QHZA 2R063 1QJY1 4XBNA 1MZFA 2ETEA 3VKLA 5J09A 2UY9A 1G9CA 2VTFA 2LALA 2ZHKA 1CR7A 2BVBA 2H0BA 4FSJA 2C9AA 1PX4A 4XF4A 1K3IA 1ZZ6A 1VR3A 1GZTA 3VBOA 2G9GA 3OPZA 5A6XA 5F3EA 4C0BA 4QPGC 3UKVA 4ZPIA 1IPKA 2DWRA 3T08A 3PUSA 2VR4A 5JZGB 1ND3A 5A7NA 1W6OA 2VE1A 4LK6A 4AGVA 2C24A 1LOBA 1W03A 5KR7A 2WN2A 1DLCA 3PIGA 1JXNA 3K4DA 4AVAA 1HRI2 2W1UA 2Y6JA 1XNTA 4BLIA 1CAWB 3KF5A 4DZGA 2K0GA 2W52A 5F6KA 2PHDA 2ET1A 3I54A 4XE9A 3T0BA 2RS13 1QDCA 1LOCA 2IXIA 4QX1A 2BBAA 2BFUS 1IKPA 4CCOA 4P02B 5FP8A 3I2GA 1VAVA 4XZUG 3RDIA 3PVNA 4HKWA 4RGKA 5FP9A 3WD5A 1BQPA 1QIQA 4YZ3A 2D93A 1MQTA 5DMYA 5LY2A 3ASIA 1YQ2A 1AYM3 1JYCA 4R9BA 4MHRA 1FMD2 3ZSEA 4Y24A 2HWD2 2WT0A 4DNYA 3LE0A 2ZX4A 5A32A 3HQUA 5L7OA 1FAYA 1N1VA 3WF3A 2PLV3 4DS0A 1S0BA 1I5PA 4BK5A 2XXZA 5I0SA 3U78A 3DPRC 1OBNA 1J1TA 1QH7A 2BDRA 2W47A 1SLLA 1V9U3 1POV0 3EYPA 5C8CC 4JKMA 3E6BA 3SITA 2XB6C 1PVC1 3WW1A 4DY5A 1CAXB 5AC91 4CXYA 3BGAA 5FMOL 4NHMA 3JZVA 1N1TA 2JDPA 5A33A 2DCYA 4XFAA 4JKKA 4UBHA 4KU7A 1OVPA 1J3PA 1HDKA 1HRI3 1XU2A 2ZEZA 3BB6A 3VLBB 4AI0A 4GD4A 3RMYA 1FX5A 3LD8A 1AL21 4XMIA 4E4SA 1NXMA 5K7PA 1C1LA 4LORA 5FY9A 4FPOB 5HCBA 5IVBA 1KD7A 4QDRA 2G9ZA 4UBGA 4FTSA 1UOFA 1S0FA 1E5RA 4UF0B 3HNMA 2RMU2 2D6LX 2Z4FA 2ARXA 4UFLA 1DQ0A 3N36A 3ACLA 3CF6E 4HOOA 4KH9A 4BXSV 3UJOA 3LWCA 2NM1A 4KQ7A 1RUF2 1UCXA 2WA3A 3O14A 3IDEA 4Q4X1 1LNSA 1C5HA 1RMU2 4R9CA 5F3IA 1D4M3 1JZ3A 1UU4A 1KDMA 1W9FA 2GZWA 2Y6GA 3HMYA 4I0AA 4FBFA 2FDKA 2RHPA 2XHNA 3AMPA 1FPN2 2F17A 5DUXA 1HXS3 1MS5A 4FPEA 1ENRA 1LHNA 3WDWA 4BU2A 3JB8A 3OBRA 2B42B 3GBWA 4OI4A 5HV0A 3MZHA 1ND2A 4Z82A 4AQTA 1GQHA 3AC0A
chains in the Genus database with same CATH topology
1WBFA 2HWE1 2OPKA 2E7QA 5T5OA 3S7IA 1OI6A 4GH4B 4EWDA 1R1ZA 4S2HA 5GLVA 3WLUA 1XXNA 3JBG1 1AR71 1AR62 5H9PA 4AXOA 5GLUA 4XJAA 5FBZA 1QJU1 1FOD2 4MLOA 1VBD3 2G4IA 2GH8A 2D97A 4LUKA 1QKQA 3FE5A 2X5IB 2ZGQA 5JOWA 4LEJA 4HN0A 3VKNA 1COV2 1DQ5A 1SQ4A 1WMDA 2XLGA 1OA2A 3NJZA 4NHKA 4QT6A 1YJKA 3VDDA 3ZPYA 5J48A 3VBHC 5KXBA 2DCJA 1FPN3 2SLIA 1LHVA 2EA7A 4MXWA 1R082 2P34A 2TEPA 3SH4A 4Y1ZA 1CPMA 3P3PA 4FCAA 4XTPA 4LBMA 3BOPA 4L11A 2WT2A 3AMNA 1H2KA 1PMIA 2O8OA 1NCQA 4WM8C 5CFDA 3ZXDA 1RVF3 4XFFA 1RUJ1 1BYHA 4CEWB 2VOVA 5GKAC 4KL1A 2BGCA 1AR63 1SLIA 3FUOA 2OZ6A 4I0BA 3AMQA 1R1A1 2HWC2 4K7JA 2PHUA 3E97A 4X6QB 1FOD3 1JUIA 4IERA 3M8LA 3KLSA 4MGZE 5FMOS 1SDWA 2BNMA 1UN1A 2JE9A 3ZSLA 2R071 3VZLA 1MS3A 3PVEA 3LSEA 1YNAA 4JQRA 4F7ZA 4HKLA 4AVBA 1COV3 2UYBA 3JD72 2BTVC 3ZXJA 4QPIC 2BPA2 2V5YA 3OY8A 4EWEA 4INDA 2D6PA 2H6BA 1SFNA 2CWSA 2QDRA 3M4FA 3VN4A 3NKTA 3N35A 1I9RA 1R083 2ZTNA 3AKPA 1KS4A 3J26N 3KT7A 5IK5A 3TN93 5BNPC 5E16A 2HWB2 4FPKA 1F8VA 1DYKA 2V73A 3RWNA 5H9SA 1GKBA 2VMHA 1RUC1 3QH7A 1FXZA 1W6QB 4W6YA 4Q1PA 2WLQA 1XE8A 1GZWA 1HV1A 1EPZA 4LBQA 4Y22B 4YVSC 1ZZ9A 1B35B 2HWF3 4XZPA 4YM1A 3M3IA 1RHI2 2H6CA 3HD8B 3UKNA 5HCFA 2PHLA 4R9DA 4FPFA 1D4VB 1H2MA 3EHKA 4IEXA 4K40A 2GC2A 3POYA 4J1WA 4CDUC 3H7JA 3V0BB 4NWWA 1IS3A 1WLTA 2R041 3MIBA 2ZZQA 3GALA 3N7MA 1C57A 3WP6A 3FMGA 4XF0A 5JVVA 2Z2SB 4AEKA 1EV11 2ZZJA 2JDZA 1TMF3 5AVPA 3ZYRA 3AJYA 2B5HA 1QJY2 3OGGA 4XMAA 1A8MA 2A6VA 4OHYA 4C1WA 5CVRA 2HWB3 3N7KA 1GNZA 1OA4A 3ZFGA 1S0DA 2DVBA 5JZGC 1PK6A 1QY4A 3PNAA 2EVXA 2IZWA 1MVQA 3ZFEA 1G7YA 4CP0A 1N1YA 1OHFA 3RJ2X 3OJBA 3VUOA 2A7AA 4FPGA 1RHI3 2MPFA 4W6WA 2WT1A 3UV9A 2PAMA 3PMEA 3JCIA 5KXDA 2WL1A 2IWGB 1O5LA 5IK8A 1H1IA 2C5DA 2GMMA 3AYEA 1G9BA 2OUJA 3GHNA 1D2SA 4BMBA 3SH3A 5H9QA 1KFXL 1KS5A 3NKGA 2PA7A 1RITA 1QJY3 1X8MA 1NYWA 4H3WA 3VL9A 5DUUA 4KGQA 4OUSA 2X29A 3OD4A 2VVFA 4P9XA 3LOIA 4XETA 3H9AA 1YFXA 1I1EA 4QM9A 2OW4A 5GALA 3BODA 2C0ZA 1VIWB 1EAH3 2Q1MA 1ULGA 3M2MA 4N7UA 5JWPA 5FOBB 1A78A 3SCFA 1VBC3 4ZKTB 1NA1C 1SLAA 3ZSKA 1AL22 1CQ9A 1PNGA 4YM0A 5T55A 4N53A 2D3PA 4R4XA 1GFF2 1ZBA1 3VZMA 2Y0IA 4IEUA 3VBOB 2ZS6B 1RUI1 1REDA 1W6OB 1DU3D 4FP2A 4C91A 2GDFA 1WD4A 4OHZA 4JGYA 1W6PA 4XQ4A 4JGZB 4HSJA 1UW8A 4PQ9A 1L3JA 2IXJA 4RFT0 4FPLA 3USSA 1PVC3 4XFGA 4QU2A 4GH4C 5AC93 2ZX0A 3WR0A 2HWE2 5FPZA 2XPJA 2Q30A 1AYM1 4LULA 4WM7C 4GQ7A 1C3HA 4AVTA 5EFUA 5A32B 3NW4A 5L7OB 1LENA 5CU1A 1H9PA 2PLV1 4AGRA 1DDLA 1AL23 5ACA1 3H7YA 3NV3A 1LOEA 3JBG2 1AR72 3M3EA 4N43A 3WDTA 5LEKA 3WHTA 4A3XA 4NO4A 1NE6A 2WNUA 3FLPA 5BUVA 3B02A 1QJU2 4QQPA 2D98A 4RGAA 2WNVC 1V9U1 2X5IC 3MGUA 4ATFA 4OHWA 3VZOA 2DCZA 3VZNA 2R0HA 4JV4A 1AXYA 2YPJA 1XRUA 1K5MA 1NG0A 3WY6A 4Q4X3 5A33B 2LM3A 4FT8A 4CDQC 4XOGA 4XF3A 1W2UA 2GNDA 3QLQA 1I6XA 3D82A 4LO6B 3ZXAC 1UX6A 2WS91 3ZDSA 1DQ6A 5KC6A 1ULDA 2DVAA 2ATFA 3TRSB 4EV0A 3MW2A 1GANA 3RZZA 2R6QA 4KWLA 4CEWC 1AUYA 3MPBA 2QQPA 1OSGA 3MFCA 1NQJA 4V1PA 2AREA 1RUJ2 4LA2A 1GICA 4WM7A 3NV4A 4RL7A 1WCKA 1Q5OA 3AP5A 3JBG3 4WVWA 1QH6A 4PCRA 1HXS1 2GALA 4BLJA 4I09A 1NCRC 2XVKA 3MI8A 3JUUA 4RS5A 2Q0AA 4LBNA 2DTYA 1FNYA 4RGGA 4LO7A 3PHMA 1Q8VA 4LO4B 4Y1UA 2VQAA 1CVNA 2WNVA 2R30A 2R072 3H1YA 2AH2A 1R093 3LGRA 4YW1A 5L73A 2VVDA 3WG3A 1Z7S3 2HEWF 1OKQA 2WKKA 3BPZA 2ZPXA 5E89A 2GNTA 3ZYPA 2ZMNA 1PO21 4HLTA 4N7IA 1LEDA 1LOFA 1VBD1 5LK5A 4L97A 5I8TA 1PNFA 2ZGOA 3USUA 1NLRA 5LRRA 1YRZA 1ZZCA 1RUJ3 3O12A 1QXPA 1RUC2 1B35C 4QHBA 5JSPA 1DQ4A 1HW5A 4Y4YA 3RYKA 3VDDB 4MUVA 1AR93 3MW3A 5BV6A 3VBUA 4E9KA 1R1A3 4IV1A 3GZAA 4MXWB 1FYUA 1O5UA 1LULA 1YUDA 3C2UA 4E27A 3TNPB 1NCRA 1RL3A 5SV5A 4LLOA 2Y0OA 1JUHA 4XILA 5CFDB 1NCQB 2R042 1FV2A 3UKTA 4GB33 3APBA 4I02A 1F5FA 2E6VA 1J3QA 3DN7A 4IEYA 1EV12 2ET7A 3W58A 3W9AA 3R6SA 3V64A 3SNMA 2XVLA 1ULEA 4DFSA 2P3JA 1RUH3 1OLRA 3WCRA 1Z0HA 1Q3EA 1ZNPA 4I2OA 3TB0A 2XBO1 3V0AA 2TBVA 1Y43B 1RUC3 2JE7A 2QE3A 3KGLA 1NOVA 3ETQA 3BTAA 2HKXA 2D44A 3GZTB 4MSVA 4P9LA 5KHHA 5JSOA 4A7KA 3OY8B 2RS52 4FXKB 3ZVXA 2XKPA 3OGJA 2YROA 5IK4A 4KWJA 4OI1A 4HETA 4A7ZA 3VBSA 4Q27A 3TN91 2A73B 4EN9B 4XHBA 3ZXGA 1FT9A 3N7LA 4LBJA 4AEDA 3J8F1 1W0PA 2R043 2P17A 1JW6A 3AZZA 3U07A 3A0KA 1RINA 1ZRCA 3M1HA 4E2SA 4KWKA 1DGRN 1GZWB 1UZZA 4LBQB 4QQOA 3FBYA 2HWF1 3HQXA 4WV8A 3B94A 3EQEA 2LUWA 2Q1ZB 4XBQA 4SBVA 4K9SA 4P9YA 2RS31 2WQ4A 1EY2A 5JR7B 3VBFA 2OIIA 1J59A 1ZYBA 2YY1A 5GZFA 1QMJA 3AMMA 2DU1A 4YVWA 1BZWA 2Z42A 3CJXA 2DCKA 4B4RA 2ENRA 1TMF1 1GV9A 1M06G 3EO6A 4CYDA 2Q5TA 2EAKA 1YIPA 1URXA 3ZFFA 3ZN5A 4WZCA 1RB8G 2ZAHA 3VBOC 1MZ5A 5IK7A 1S0EA 3AJZA 3ZFGB 1PK6B 1ND3C 3R4UA 4LUMA 1H4GA 2B7YA 4NVPA 1H1MA 1RUI2 1VP6A 2VW0A 3BCWA 3ZFEB 4J6GA 1LODA 4AHYA 2E53A 4M01A 5FLJA 3WQ7A 1AXKA 1LRHA 1WLWA 3IDCB 3M3QA 1QDOA 3KCXA 5C33A 5JAXA 1RUE3 2CTVA 5JSRA 3B00A 3FC0A 5GZEA 1ZREA 1PZ9A 2FBEA 3WCSA 1DZQA 3ILFA 3KM5A 2WINB 4LHKA 1MQTC 4OULA 2Y26A 5EWSA 4YGDA 2A75A 1C8M1 3KD4A 3O0VA 3AXEA 5L7OC 5BNNA 1V70A 1AYM2 4Q2FA 3ZXFA 4JDMA 2DUQA 2UY8A 2NMNA 2PLV2 4PIYA 5ACA2 2YHJA 1VRH1 4A2UA 3KGZA 1HLCA 4EN8B 1CN1A 1ZBA3 4YW4A 1V9U2 1LKNA 2GMPA 3WQ0A 4H55A 1RUI3 1EAH1 1QNWA 2CAVA 3E6DA 1VBC1 2H0VA 1DQ2A 4Y1XA 1IZ3A 2R1BA 2IXCA 2QCSB 3AMHA 2QFEA 3HIFA 4XFBA 2WS92 3PVOA 4O9EA 4N53B 4AQ2A 3N7JA 2YMZA 5JOYA 3B7MA 2AUYA 4IV3A 2NN8A 4LLFA 3NV2A 4FXGB 1HKDA 2ZGKA 3E6CC 2VVEA 5I91A 3R4SA 4IESA 1CAVA 2EXIA 2VW2A 2ZHMA 1S0JA 3WXPA 1UF2C 4D94A 3MPPG 5C8WA 1D4M2 5JIUA 1W6PB 1LU2A 3SISA 5ACA3 1WW6A 1HXS2 1OLQA 1X36A 1D2QA 2O0OA 3A4UA 4HKOA 2A3WA 1ND2C 3OD0A 4AW7A 1G9DA 1WLDA 1CAUA 4HBNA 1JH5A 4M0NA 2EXKA 4UW5A 4XFCA 2VNRA 1Y3TA 4BWOA 3AB0A 3N3HA 4DMIA 2EIGA 1UD1A 3IPVA 4H7MA 2ZX1A 3AZXA 4FOYA 1GLHA 1NA1B 4AFMA 3ES4A 4YFZA 2WS93 4N43B 1PGW1 3ES1A 2ZCWA 1QWRA 2B8MA 2UWAA 2WNUB 1BEV1 1MVEA 4Q26A 3AKTA 1VBD2 3AP7A 3T1MA 3WG2A 2VG9A 3AP4A 2VXRA 4AI8A 4AVSA 1DYPA 5FQ0A 3VDDC 4HVRA 2IXLA 1K5MB 4EROA 2KA3A 4HK9A 1RC6A 3MIGA 3VHOA 1ULCA 1U5IA 1CX4A 2DU0A 1B09A 1MEC1 1BXHA 4LTAA 3IDBB 4YW5A 5CFDC 1NCQC 2ZMKA 1BCXA 4Q4Y3 3LCPA 2YV8A 5CG9A 2QZ3A 4FAHA 4K3UA 3WVJA 4MX3A 3ZO0B 4HPKA 1RVF2 5ABJA 5BPXA 4OFGA 3D6EA 1DGLA 3WG4A 1QJX1 4WM7B 2K9ZA 1YYNA 2EXHA 1XQNA 2DVFA 1YHFA 1PO23 5I93A 4ZXKA 4JDNA 4EN7B 4RS5B 4YW2A 3O7OA 4X6RB 2XBO2 2WNVB 4HMZA 4BPZA 2PHWA 1RUOA 1R091 4AK3A 4E4ZA 5DZGA 1J1LA 2VQ0A 4MGKE 2YGMA 3H3ZA 1Z7S1 2UU8A 3WP4A 1HV0A 2PN5A 1UMZA 1KJLA 4BYYA 3AZYA 4CDQB 5FTTC 4ASMB 4H7LA 1HQWA 2MHFA 3MFAA 3DL3A 4COVA 4FO9A 1O4TA 3TN92 1WUVA 4HZFA 2OYZA 1KRIA 1Y9QA 1CJDA 1A3KA 4XQWA 3VKFC 1SFYA 2ZGTA 3USUB 1LOAA 1NY71 2PHTA 3UJQA 5K8SA 3H0OA 1MS8A 4E2QA 1AR91 2DCTA 2HWF2 4L92A 3VBUB 2PTMA 4IV1B 3AZVA 2PAKA 4S2DA 1RUD3 2Y38A 4YYOA 3T1LA 4HSLA 4YFWA 1NCRB 2A6ZA 1H30A 4L2NA 1DZRA 1PIV1 2O1QA 1O91A 2D6KA 3WOGA 2XBO3 2D5FA 1CD3G 3HAGA 1MS0A 3M7AA 1D0GA 4GB31 3KT1A 3V65A 1VJ2A 3O0XA 4GALA 1XNCA 4M3CE 3ILNA 1TMF2 5JDBA 2GH2A 4GMP3 5JI9A 4Y26A 1S0IA 5F6LB 1FI2A 4XFHA 1JTZX 3ZFGC 1RUH1 2DYCA 1PK6C 3MIFA 2ZKLA 3B69A 2B39A 2QUOA 3MW4A 3J8F3 1PGL1 3ZFEC 3V0AB 1YFUA 2XJSA 2R49A 4EN0A 1AX0A 2JX9A 2F4PA 2ZGRA 1VBA3 3HR9A 2A5ZA 2D6NA 3G6JB 5FO7B 3POSA 3VBSB 2BNNA 4IEWA 1OMIA 3WP3A 5HXVA 1IOAA 4ATEA 4Q4W1 2RS33 4M0HA 3HT2A 1FV3A 4AEDB 2ZJCA 1AYN3 1LGBA 1UU5A 4YRDA 3B5LB 1C8M2 1EP0A 1WD3A 2BBVA 5CADA 2VNGA 4XJ8A 3S7EA 4MZUA 2EF6A 2VW1A 4ASLA 1VRH2 5GLTA 1ZBE1 1VBE3 2ERFA 5K0UA 2CL2A 1SLTA 2VUAA 3VBFB 3FWEA 1DLLA 3ZX7A 3MIHA 1G8WA 5A3MA 1H4HA 4K21A 4NPRA 3FJSA 1EAH2 4IQPA 2PHFA 5JMCA 4LE3A 3BOWA 1SBEA 1VBC2 5FOJB 4LHLA 1LU1A 4N53C 2ZGSA 4UW6A 3CNAA 3GHMA 5E1RA 2QVSB 3ZFFB 1S55A 2DTWA 2WZR1 3WZ1A 4ORFA 2WZPP 3U10A 4LT5A 3D4KA 2O8QA 5TSWA 3M70A 1C8M3 1J3RA 1H2LA 4JGYC 2RR13 4URTA 3C3VA 1O3RA 3KCCA 5FPXA 4AI2A 1UKGA 1WCSA 2PQQA 3ZMNA 1RUE1 1YO8A 4XTMA 4RHV1 3D0JA 4LE4A 4Q29A 1Q8SA 3RRDA 1VRH3 3L2HA 2FQPA 1IGOA 2