1GVDA

Crystal structure of c-myb r2 v103l mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
molecule tags Transcription
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gvdA00
2NVTJ 3A01A 5IP9J 3BTIA 2LTPA 4A69C 5J1YA 2EH3A 2X6OA 1HOMA 5F27A 2H8RA 1ETYA 1TWFJ 2VPRA 4DYRA 4C3JJ 2R5ZB 3GTJJ 1AHDP 2KT0A 1RPWA 1Y1WJ 1HLVA 1ETQA 2L7FP 3PM1A 5E3OA 3OSGA 2DA3A 1MBEA 2LP0A 3A03A 2OF7A 2W48A 5E3MA 1GV5A 4M3BA 3FISA 1WCMJ 2HOTA 4EEFG 2HXOA 2K9QA 4A3IJ 1G2HA 5EGOB 2DMQA 1RR7A 2YU9J 3BR0A 1GUUA 2WV1A 2LVSA 3C2BA 1P7JA 1MH3A 2O7OA 3HOYJ 2VI6A 1H8AC 3RKQA 1VF9A 2H1KA 5C3EJ 2D5VA 1X2MA 4FCYA 1W0TA 2XB5A 1TWHJ 1X58A 5IP6A 3BG5A 1APLC 3NAUA 1MSEC 4IHYA 1MH4A 1JT6A 1AKHB 3FIWA 3IH4A 2DA5A 3HOUJ 1JKRC 4GFBA 2EZIA 2JA8J 4XICA 5GP9A 4X6AJ 2HDDA 4D5FA 1YRNB 2DMUA 1GV2A 5M3FJ 1MSFC 4MIMA 4FE7A 4FISA 1UMQA 4ABZA 1Z77A 1NK2P 4L5EA 3TW6A 3GTKJ 2ECCA 1MBKA 1TWAJ 1LE8B 3ZQCA 2E2HJ 2L9RA 1HDPA 3HOWJ 5BNGA 4QSHA 1JJ6C 3B6AA 1WH7A 1PUFA 3BTLA 4IEJA 2MG4A 5IOYA 1VFCA 4BXXJ 4A3LJ 3CDLA 3WHCA 5C4JJ 3W6VA 2HOSA 4A3FJ 1GDTA 1IUFA 4M3EA 5E3NA 1LE8A 2NVQJ 3LSGA 1MBFA 1T56A 2L0KA 2VKEA 2CJJA 2R7ZJ 2ME0A 3IH3A 3HOVJ 3JRFA 1TWCJ 2M8GX 3OIOA 3S1RJ 2LFBA 3HBLA 2XB0X 3M4OJ 2HYJA 4M3GA 4DZPA 1U78A 1ZR4A 1U8BA 2DN0A 1MBJA 4I6ZA 1JUPA 2QF7A 5E3LA 3H0GJ 2Y0SN 2WAQN 2NS8A 1A5JA 4JYKA 4XRSG 2WB1N 2XPUA 1UG2A 2IAIA 1JKOC 1XS9A 1RKTA 5GPAA 1IDYA 5K7FA 5EF6A 1I3QJ 1A6IA 1VNDA 2EBIA 3S2DJ 1RESA 1POGA 2Y9YA 4RDUA 4BKXA 2P81A 2X9DA 1DU0A 5F04A 1IC8A 1OJLA 4J19A 4A3EJ 2ID3A 5J3LA 2HI3A 4D7MA 1I50J 1OFCX 3BR1A 3TEDA 2GLOA 4Y7NJ 3QQAA 1SANA 5EDNA 4IHWA 1XG1A 3BR5A 2B63J 3HGYA 4MO7A 3TW7A 3I4MJ 3FKIJ 2DMPA 1H88C 4G12A 1U9OA 2XGDA 4DYCA 1HF0A 3GTPJ 2L7ZA 1H89C 2M9HA 3CMYA 1XC5A 3HOXJ 2JK3A 2EQRA 2CQQA 3ZQGA 2O9LA 2FD5A 1D5YA 1EF4A 2R5ZA 4BBRJ 3OOUA 5FJ8J 2FX0A 4QIWN 2DMNA 2EZKA 4FE4A 3ZQIA 5F0HA 5IYBJ 3S14J 1QRYA 3I4NJ 3G1OA 2MSYA 5FLMJ 3MN2A 4RBOA 2FQ4A 1ETXA 2LR8A 1NK3P 4XRSA 1QVTA 5EGOA 1IJWC 3O8HA 5EZGA 2KDZA 4B1RA 5IPAA 4A3MJ 2HOAA 2JA7J 5GPCA 1Y1VJ 4DZJA 3QPSA 3PO3J 2L7MP 5FKLA 1S7EA 3DEWA 4UUTA 5FKMA 2R93J 4Y52J 5EYRA 3S1NJ 3RZDJ 1WGXA 5K7ZA 4BY7J 3RQIA 2MGQA 5J1UA 5EG0B 1AKHA 3S1QJ 1IG7A 4A3GJ 4B4CA 5IOZA 1LFUP 1FIAA 2R92J 4X1EA 3JRHA 4AUXA 1UHSA 1GT0C 2M0CA 2XPVA 3SJMA 4NDLA 1YRNA 4MFEA 1ZKGA 5F0FA 4XRMA 1MBGA 3BG3A 3BTJA 3UKGA 2CQXA 3LSJA 5FKOA 3NARA 5EG0A 3JRDA 2DTZA 3WHBA 2JJ7A 1I6HJ 1K83J 3BR6A 3Q3SA 5FLVA 2DA4A 3CCYA 3GTLJ 3DCFA 4MLOA 4D7NA 3FK6A 1OCPA 2NVYJ 1ETVA 1FTZA 2ZB9A 4JP0A 4A3KJ 3HKZN 1ZR2A 2XSDC 1ITYA 1U9NA 1IDZA 4IHXA 1FEXA 3F0CA 1WH5A 3LSRA 3MVPA 4XIDA 4M6VA 2XRLA 4FTHA 1ENHA 1TWGJ 5JLWA 1SFOJ 1JKQC 4C3HJ 2MW8A 3SDGA 1OCTC 3RZOJ 4M3FA 2R0QC 3K2AA 2R5YB 3BG9A 3ZQFA 2ECBA 1JGGA 3BTCA 3D1NI 3HDDA 4JX6A 2HXIA 3HOZJ 2JN6A 4AC0A 2LK2A 2Y9ZA 4JX5A 2JA6J 1ZGWA 3IV5A 2R5YA 2CUEA 4A3BJ 2E19A 2M2EA 5F0CA 1IRZA 2JA5J 1FIPA 1ZQ3P 1K61A 4MFDA 2K9NA 3JRCA 3TP0A 4C3IJ 5M5XJ 4CYCB 2VKVA 4AYBN 3S2HJ 4DW6A 3JRIA 1ETWA 1ORKA 3GTQJ 3JR9A 4A3JJ 2EZLA 3JREA 3HB9A 4A3CJ 2M34A 2DA1A 4W97A 4BBSJ 1IGNA 1MNMC 3CQZJ 2Y30A 4V2FA 2JMWA 4CYCA 1Q1VA 1F36A 4QTRA 4V2GA 3JRGA 3SFIA 5M5WJ 3FK7A 5F1JA 5IYCJ 4B3AA 2XPWA 2GM4A 2XGEA 2G0EA 3JRBA 2XGCA 2DA7A 5DS9A 2NS7A 1B72B 4LOCA 4I76A 5F08A 5M5YJ 4C2MJ 1JTXA 2O8KA 1RETA 3GTOJ 1IV6A 2Y31A 2DMTA 2DA6A 2JWTA 2LKXA 1F43A 3GTGJ 1DU6A 5C4XJ 3A02A 3S16J 2CUFA 9ANTA 3K7AJ 3OSFA 1WPKA 1AU7A 1B72A 3Q0VA 1ZK8A 3BR2A 1ZTRA 2LY9A 2E1OA 2HQ5A 2E2IJ 5K7HA 4HNVA 2VUMJ 1BW5A 3LOCA 4JX4A 3O8GA 1JKPC 4A93J 1WI3A 2GBYA 1HDDC 2E2JJ 1JT0A 3VPRA 1PUFB 1NTCA 4M3DA 2OPTA 2LD5A 1HCRA 3S15J 3IH2A 3JRAA 3GTMJ 1BA5A 2IBDA 3S17J 1JJ8C 3GBGA 4DYQA 3E7LA 1FJLA 3QPLA 4A3DJ 3B6CA 3BQYA 2EZHA 4UUSB 2ME6A 1T33A 1X2NA 1O4XA 1P7IA 3BT9A 2RAEA 1BL0A 5J1RA 2ID6A 2NOGA 3Q0UA 3ZQHA 3LNQA 1B8IB 3HGGA 1W0UA 1FTTA 1JTYA 1E3OC 2K9SA 1GVDA 1BJZA 2X48A 4UUSA 1JUMA 1MBHA 4S0HB 1QPIA 2Y2ZA 2NVXJ 2FJ1A 3ZQLA 3S1MJ 2ELKA 2QCOA 2TCTA 3MKLA 3HEFA 4BY1J 2IEKA 1B8IA 3TP3A 2AO9A 1VI0A 2AHQA 2COBA 5HODA 1LFBA 2YUSA 1CQTA 3G1MA 2YS9A 3ZOBA 5EEAA 4XK4A 3LSPA 1ETOA 1R9TJ 5JLXA 1Z0XA 3BQZA 4D5CA 5IYDJ 5M3MJ 2TRTA 3M3YJ 3A01B 1BW6A 2DJNA 5FKKA 1TC3C 3H3VK 3BR3A 2N8GA 1RKWA 3G1LA 3L1PA 5C44J 2PMZN 2CRGA 4W1UA 1QVUA 5DTDA 2CU7A 5FKNA 2K40A 3HM5A 1JUSA 5EZHA 3PO2J 3Q0WA 2I10A 5IP7J 2DA2A 2LLKA 1ETKA 4IHVA
chains in the Genus database with same CATH superfamily
5H20A 2Z16A 5J47A 3GLLA 5IP9J 2MLKA 4E7JA 2VJJA 4A69C 5J1YA 1W5TA 4BYYA 3OYEA 3H3ZA 3FMQA 1HOMA 5F27A 4GO1A 2H8RA 4Z6YA 4DYRA 4C3JJ 2R5ZB 5FFXA 3S8PA 3B73A 3KP4A 4P55A 1YS6A 2XUBA 1FY7A 3A03A 4HX4A 2QBYB 3EYYA 2W48A 5LLQA 4L0ZB 4DQ2A 5IT9Z 1W5CC 1X1AA 4PDKA 4M72A 3RKXA 2HXOA 3SEQA 4A3IJ 4G94A 4G7HF 2K4BA 1QNTA 1P4AA 3BR0A 5TJJA 3CDHA 1MW7A 1JHHA 2RVCA 1H8AC 4U0WA 2LKPA 5ICEA 2WA0A 2HS5A 1X2MA 4FCYA 4HF0A 3L2QA 1QBJA 2BGCA 1P9QC 3IHUA 4PCQA 1S6LA 1IRFA 3DTEA 2LG4A 3NAUA 5FD5A 4M9SA 4CXFA 2XC7A 1MSEC 4ENJA 2V4JC 1JT6A 4IRHA 1AKHB 1WJFA 3FIWA 4WXDA 5KVRA 4I01A 3IH4A 2W57A 1TQIA 2XIGA 2KQRA 3HZJA 3F22A 4J00A 2WWYA 3DP7A 2JA8J 3E6CC 2WB1A 4HA8A 1YRNB 2DMUA 5HLHA 4XL9A 1A31A 3REOA 1J9IA 2QQ9A 1MSFC 3M1CA 3L2VA 2DDAA 3LFKA 4ABZA 4EJWA 5AIQA 2LYCA 3EDPA 3GTKJ 3W2VA 3ABMH 4CCMA 2M30A 4ZYGA 1LE8B 1K79A 3M07A 1HDPA 2A07F 3CUOA 5FD6A 3F8MA 5LGUA 2F5DA 2EILH 2E36A 2L9NA 3PNVA 1WJEA 2HKOA 2F5VA 5L3GA 1XGOA 4E7SA 2R7OA 1W7PB 2R7SA 4A3LJ 2ISYA 1ZG1A 3K9TA 4A6DA 2BY2A 1MD0A 5HVQC 4HLXA 4GCVA 3LSGA 2KISA 1MBFA 1N75A 1T56A 5HDGA 3TOBA 1YW8A 2CJJA 3HOSA 3LSMA 4ZZDA 2ME0A 5DDGA 5J4YA 1YJNI 2W24A 1DUXC 4PSXA 3HUGB 1JGSA 3FX3A 4MTDA 2L4AA 2KIMA 3OIOA 2FNPA 3S1RJ 3CF5F 4ANJA 3M4OJ 4M3GA 1UFMA 1XB4A 1ZHFA 5ICGA 1YIJI 1LPQA 3WE3A 3DLLF 3WG7H 4Z2YA 2DFIA 3F21A 3SXYA 3RQ4A 5E3LA 2P0WA 3OR1C 3E6MA 4UUVA 5F1RA 3MAJA 3GZNB 4G8XA 4HG2A 4LLGF 1XS9A 4IJAA 2BHZA 3WGGA 5EF6A 5LHIA 1I3QJ 2UXXA 2LREA 3I54A 4DNCA 2VT3A 3OV8A 3LA2A 5A2QZ 1FSEA 3IWZA 1IC8A 2ID3A 3NEUA 1HW2A 3AG1H 3EQLF 4P1WA 1MMSA 2VE8A 1YJWI 2GLOA 3SZPA 3QQAA 1Z05A 2E71A 4NUBA 1XG1A 1BJAA 2K3FA 3CJQB 2ZXIA 4MO7A 5GADJ 2MFZA 4HX8A 3I4MJ 1EA3A 1D1AA 4UHTA 3KP5A 2VONA 1HSJA 2DMPA 2HQAA 3FZVA 3P7NA 6PAXA 4P96A 1FYKA 1UJ8A 2E1MC 4DYCA 1HF0A 1IRXA 1IXRC 1YOVB 4UV8A 2VBZA 2DPDA 5DUKA 2NRAC 2IA0A 1W1WE 2KIQA 1H89C 3C7JA 3CMYA 1R5HA 2DOAA 2AQEA 3F9KA 5FLXK 4UVAA 2X85A 2G7HA 4BBRJ 3OOUA 4QIWN 2DMNA 1MMGA 3MD2A 3G1OA 1LVKA 5HDNA 5LRSA 4BQNA 1EKEA 2XGXA 2LR8A 4XRSA 1QVTA 1U0JA 1XGSA 4KIFA 5BOXA 5EGOA 4K2EA 2PI0A 3TL4X 4FHTA 4ESJA 5TRDA 4PJMA 1JE8A 2LY2A 1ZRDA 4E7KA 2L7MP 2VBWA 1S7EA 4UUTA 2WAQA 1UHMA 2ZNZA 3RZDJ 3PUFA 2P5LC 4CCKA 4IVNA 4BY7J 5B1AH 4GDFA 2M45A 1I1SA 1SD6A 3JW4A 5EG0B 1G59A 2VQLA 4A3GJ 1IG7A 2UXNA 3KP6A 4X1EA 1O7LA 3U1DA 4ESBA 1PVEA 3HPHA 1GT0C 2Q1ZB 1KU9A 3F6OA 5CPRB 1RUOA 2MD0A 3A2KA 1RC9A 2FE3A 4D9JA 4MFEA 4LGWA 5L3DA 2GIVA 2OD5A 3WU0A 1FC3A 3BG3A 3SQNA 4CUGA 4HDVA 1UG0A 2X0LA 4JOMA 1B9NA 2PJRB 3EYIA 4MQ9F 1K83J 1GVJA 3KP3A 2X1EA 2XASA 3G4SI 5FLVA 4PFOA 4XLAA 3FXQA 2EV0A 2L54A 4WXHA 4LLNA 2JQ7A 3VSKA 4NQWA 2WY8Q 2V79A 2ZB9A 3BJAA 4JP0A 2FEZA 1MNEA 3HKZN 1X3ZB 1ZR2A 4BDZA 1U9NA 3T8TA 3GZ5A 4IHXA 3TO7A 3DKYA 2EPFA 1FEXA 2DYSH 1T98A 3BROA 4LK1F 4M73A 2LY1A 4LIUA 2O8XA 4U88A 3CESA 1TWGJ 3JTHA 4HRIA 3TDZC 1SFOJ 1Z7LA 3ISPA 1K7AA 2FMLA 4OMYA 1AA7A 2CWEA 2HZDA 3ZQFA 3COAC 4YG2F 3H5NA 3KCCA 4C2UA 2DT6A 2ECBA 3L2WA 1JGGA 3BTCA 4UB6C 3VYSB 2OCEA 2V1XA 4XKWA 2HU9A 2HOEA 3HOZJ 3ECOA 2NNNA 4YFXF 3OYAA 2L7KA 1VQ6I 1P4WA 3AFHA 3KP7A 4BJTA 4U87A 3QPTA 3HYIA 3L2CA 1LUJB 2M2EA 2V1UA 2R7WA 1KA8A 3J80Z 4BHPA 1ZQ3P 2W25A 4LG0A 4L9JA 3CC2I 3CCQI 1YE9A 2W85A 4JQFA 1ZAOA 1X1DA 4L9TA 4XRFA 1XCBA 4OIOF 2CS3A 1IO2A 3JR9A 2BY1A 2K9LA 3ZXSA 3S3OA 2CFXA 1SC7A 2STTA 1ZREA 3IWFA 5B5EC 2KJCA 3EUAA 4ENMA 2R7VA 4LK0F 2M34A 2VL8A 2V1DA 2XSJC 1I39A 3DKXA 1IGNA 1SD4A 1D3YA 3TMOA 1PDNC 4DBRA 2JMWA 1YQAA 1RZ4A 3K6GA 5K5OA 1G3TA 3A4CA 2ZMEB 4ZH4F 5ILUA 3E97A 3S32A 4AVPA 5D4RA 3ZP5A 4HF1A 2WBMA 3KZIC 3JRBA 2Q0OA 2QSGX 2A6TA 1LDJA 1SAXA 2DA7A 1LQ1A 4B48A 4KFCA 4RB0A 4NC6A 4KN4X 2CUZA 4R79A 1X4OA 3HXLA 4RLFA 2L01A 3H1CA 2R7FA 1OCZH 3H9QA 2O8KA 2LKXA 4RLQA 2UUZA 3CUQA 3R4KA 1VZ0A 5DUIA 2E5NA 2HPIA 2RV8A 3GTGJ 1DU6A 3TKYA 5C4XJ 2CUFA 2BE5F 2Y0MA 3GFJA 1WPKA 1BIAA 4ZDPA 2TDXA 4CCOA 1MZBA 2V1NA 4E70A 1VQ5I 3H36A 3DTKA 3QOEA 1BBYA 5K7HA 4HNVA 3CMAI 1IAWA 2G9WA 2HZTA 3LMMA 4BEHB 4CHUA 2K02A 4Q5SF 3TO6A 1Z91A 1L3LA 4BXUA 1PUFB 1ZGAA 1HCRA 2LD5A 5CJ9A 2DOFA 1OMIA 4B09A 1OQYA 3VODA 1LJ9A 3U9GA 2CW0F 1JJ8C 3WTXC 1TW3A 3C3WA 3AAFA 5EEGA 2VASA 3QPLA 1S7AA 3BQYA 3H9GA 4LG3A 1SVMA 3O2PE 4XLNF 2Y69H 1D0YA 1T08B 3J81K 1V5GA 1O4XA 1Y56A 5JVGF 2VOPA 2RAEA 1BL0A 3F8BA 1P4XA 2ID6A 4KJZA 3OYNA 1IN6A 4II2A 5JVTA 1O7FA 2EIMH 2VT2A 2X51A 4DBQA 5B3SH 2K9SA 3RPUA 1TTYA 2CMPA 3DF8A 2ZXJA 2X48A 2BW3A 4F52A 2CQNA 1YTYA 1ZYRF 1QPIA 2NVXJ 2L9VA 3OWTA 3S1MJ 3CLQA 3MKLA 3JCUC 2M0MA 2W00A 3KLNA 2COBA 3GFIA 3E0JB 5CLSA 5HODA 3OS1A 2VBYA 4BAYA 1CQTA 3DEEA 5ICFA 2ETHA 3CJRB 1Y0UA 4XK4A 3E6BA 1R9TJ 4E6KG 4BE1A 4RAZA 3GX4X 1E3HA 4D5CA 5M3MJ 1YFHA 3W3CA 3CCRI 1DGWY 2W4SA 3BR3A 5C44J 1YYVA 3RTRA 2OC6A 1CGPA 2ESNA 1SVOA 1K78B 4BE2A 4N9IA 3P5JA 5DD8A 5EZHA 2ZJQF 3MEXA 2LLKA 2BEOA 1ETKA 2VXZA 4IHVA 2NVTJ 4DGWB 4EATA 3BTIA 5D6EA 4XBFA 4N4OB 3ONQA 4EGYA 3QYFA 1HKSA 1QGPA 3FHZA 1M1EB 2ZCWA 2VOOA 3PQKA 1TWFJ 3OL3A 3HTSB 2FOWA 2KT0A 1WSUA 2KKOA 3MZYA 2L7FP 5E3OA 3PM1A 3OYMA 2JPBA 1UCRA 4HF2A 1KQ8A 3HPGA 1FPQA 4II3A 2ADUA 1TT5B 4CDGA 2Q2EA 1R22A 5D5VB 3FISA 1WJ5A 2ZBKA 3RCOA 4BHCA 5J8FA 1U6GA 3RSNA 3BPVA 2CV0A 2A3SA 3FMSA 3A0BC 3DBRB 1ON1A 4IXAA 4BUPA 1R6RA 4FX0A 1VQLI 3I55I 1D0XA 1B4AA 4CYDA 2BY0A 5LRRA 2M7AA 2IJLA 2Q8KA 4AVZA 4YRVA 1X3UA 1IZ1A 2QBYA 3J7AY 2H1KA 1VQPI 1OCOH 4XLHA 4ZZLA 1TWHJ 1DPUA 3V8LA 2EFPA 5IP6A 2HYGD 3QRFF 2ZXWH 2QM3A 1APLC 1FSHA 3SHFA 4ZYDA 2H27A 1OR7A 4XSXF 4ENNA 2DA5A 2BBYA 1JKRC 2CFOA 4A0YA 3CCLI 4GFBA 3UR3C 2EJRA 3FXJA 4X6AJ 1W36D 1ODDA 1WHUA 4F3QA 1XSXA 2PMZA 5M3FJ 4FE7A 1EV7A 3UNGC 4FISA 3TQNA 1Z77A 2VXDA 2VC1A 5HS7A 2MA3A 4B3XA 4KMUX 4BL0B 1ZGJA 1TWAJ 4RM3A 2E2HJ 2L9RA 3CJNA 3WTYC 3SYTA 2PFBA 2IA1A 3HOWJ 1T39A 5BNGA 5E18F 2Y75A 5CVRA 1JJ6C 1B59A 2VKDA 2MG4A 5DM6F 1VFCA 3CDLA 3WHCA 5C4JJ 4NB5A 4A3FJ 4PJNA 3IRQA 1GDTA 3PFYA 4M3EA 2VODA 2HQRA 2MH2A 3DU6A 4ASNA 3CO6C 3KIOA 3MKYB 1LE8A 1ZN2A 1U8RA 2E60A 2D1VA 3I4PA 5HS9A 2VJ4A 4IKFA 4PGGA 3ZQ7A 5CVIA 3H92A 4G6TB 2V6EA 1U78A 2FNAA 3W2AA 2O5RA 4XKBA 2DN0A 4BDYA 4MTEA 1KU2A 1MBJA 3TDUC 1MDMB 1QU3A 2R7DA 2BY3A 1X19A 3H0GJ 3K10A 2Z3YA 5HNFA 2NS8A 3OS0A 3HUGA 1A5JA 4H4KC 1BM9A 4B8XA 1UG2A 5BQTA 2IAIA 5GPAA 1IDYA 1QO0D 5K7FA 1XX5A 3ABTA 4XKCA 1A6IA 3PFIA 2EBIA 1POGA 1U5TA 2Y9YA 2KHMA 4V19K 4BKXA 3KP2A 1DU0A 5F04A 3DU5A 1UELB 4HX7A 4J19A 5BS6A 1WZ2A 1BI1A 4ITVA 2HI3A 1R4MB 3QODA 3TOAA 3WTWC 2J5PA 2DFHA 1PP7U 2P6SA 3KYDB 3V42A 1PP8F 1FLIA 3F3XA 2F5FA 2OV7A 5TGTA 1FOYA 1USTA 4A5MA 1ZLKA 1H88C 3BG6A 1RR8C 2L2OA 2L7ZA 3JSOA 2K9MA 2FBHA 1R1UA 2M9HA 2EA4A 4M6XA 4Q48A 3PUBA 1IN5A 1ZRFA 2CQQA 1S5LC 2XF7A 2FD5A 3C1DA 2FX0A 2KRHA 4XMYA 4FE4A 3ZQIA 2KZGA 5IYBJ 1QRYA 2EFWA 3CF2A 2JTVA 2OZ6A 4EJVA 2MSYA 2V26A 1TW2A 3LSHA 4FT8A 2KP6A 2QKMB 3BOQA 5CVVA 1G8XA 1SD5A 5D8KB 2PLYA 3QPHA 2CYYA 3K4JA 3FM3A 3O8HA 3T1BA 2KZVA 5K5RA 5IPAA 2JA7J 3K4NA 1BOAA 5GPCA 2VJ5A 3VB2A 1PYVA 5DD4A 2HYFA 4CA0A 4HV5A 5BPIA 3DTIA 5FKLA 3PO3J 1D1BA 2Y0SA 3DEWA 4Y52J 2O03A 4OWRB 2VC0A 4RAGA 3GXOA 4I0AA 5EYRA 3S1NJ 2JPCA 1ZRCA 2W7NA 1G3YA 2F48A 1WGXA 1WRJA 4QLCU 4YFNF 1H9GA 3S1QJ 4M6YA 2OUMA 4MGRA 1FIAA 1LFUP 4KISA 2R92J 4XLPF 3N97A 4DOZA 1BI2A 3D5LA 4AUXA 4RGXA 1TL8A 4XONA 2M0CA 2EB7A 4IF4A 3SJMA 2RNJA 3FXLA 4DJAA 1ZKGA 2GAUA 5F0FA 4CH7A 4UVCA 3CDIA 3K1NA 2DDBA 2CW8A 2CQXA 4YIIA 5EG0A 2IS1A 4AU7A 2HFHA 2BXZA 2EA2A 3JRDA 2DTZA 2EINH 5GAHJ 3WHBA 3BC8A 5HNHA 1FYLA 1OYIA 2PN6A 3VOEA 2DFEA 3DWLE 3KLOA 4HOBA 5EEHA 5DYMA 4HEA2 3HRMA 2XROA 5E79C 3FK6A 1OCPA 1QPMA 2XAJA 3FF5A 2LBFB 3JAMK 1YIOA 4OIRF 2XSDC 2PJRA 4IZZA 3BY6A 1IDZA 2ELHA 1I6XA 2K5CA 4C2TA 1FWZA 3AL0C 1A6QA 4PK4A 1U3EM 1QHGA 4I99C 3LL7A 3LWFA 3M1EA 3QP5A 1MNDA 4IO9F 1HKQA 3IKTA 5D8LB 4FTHA 1ENHA 2MYSA 1JKQC 2PG4A 3I56I 3RZOJ 1LFPA 2Z5UA 4BHBA 1KU3A 1HXDA 2R5YB 1BOBA 2XHKA 2QSFX 3BG9A 4CZZA 5LEJA 5IT9K 4RM2A 2Z33A 3EETA 2YU3A 3I64A 3OIPA 3OOPA 1E3PA 2XF5A 3SFZA 2QQBA 2NYXA 4CCLA 4WK8F 1CF7B 2JSCA 1WFXA 4ESFA 1Z6TA 3MZ8A 2JA6J 2Y9ZA 2DBBA 3CCSI 5LGTA 4B44A 2ELJA 3OYKA 3H9JA 3GFLA 2CUEA 5J40A 3ZPLA 1IRZA 2BYVE 3U1KA 4CICA 1GXPA 5M5XJ 3G73A 4CYCB 2VKVA 4UVBA 4DW6A 1TBXA 5FB2A 3GTQJ 1V55H 5AIPA 2V9VA 2EZLA 2F5CA 2F6CA 2NNYA 2RC4A 4G6DA 3FM5A 3AL0B 3CCMI 1LDKB 2DA1A 5BPDA 1MNMC 1V3FA 1ZH5A 1Q1VA 3LA7A 3HHGA 4V2GA 3JRGA 4XLEA 3FK7A 3FMRA 4B3AA 2G0EA 5CVJA 2VN2A 1VQ8I 1LVAA 5D6FA 4BGDA 1W36C 1O57A 3K4KA 2BVLA 2FA5A 1B72B 1IXCA 2PMUA 1VQ9I 2ZMEA 4XLFA 5F08A 5M5YJ 4C2MJ 2Y31A 2JWTA 3HOTA 3A02A 2VQHA 9ANTA 2IGMA 3K7AJ 4I98B 2E1MB 1OPCA 3RPUD 4PJJA 3KX2A 2E1OA 1FNNA 2E2IJ 2EIKH 2HGCA 3NWSA 4M74A 4F7ZA 1JI8A 2VUMJ 3KZYA 4QPQA 3W2WA 1JKPC 3WGHA 1WWXA 2E2JJ 1JT0A 1NTCA 2QQ8A 4IX7A 1IUYA 1P6RA 4HPQA 4XM3A 3IH2A 2LF7A 3JRAA 3BJ6A 4A0XA 4RS8A 2LC2A 1TQPA 1R36A 3LSIA 2OA4A 3GBGA 4DYQA 4A3DJ 4L9NA 3MCZA 5H6QA 3B6CA 2M4GA 5KCMA 4AYBA 2EZHA 1YW9A 4MEXF 4UUSB 1T33A 3ASOH 2LRDA 3QWLA 3ML6A 4YIRX 3MZHA 2WADA 5A2QK 4RA2A 5LD2C 3HL2A 1K6YA 3ZQHA 3MFKA 1B8IB 1R5GA 3HGGA 4G6QA 3RI4A 1W0UA 3K4BA 3K70D 1E3OC 5JFRA 2KLOA 2R7TA 4GYIA 1GVDA 2ZFUA 2X6XA 1B9MA 4F92B 2DU9A 4RB2C 2DLLA 1JUMA 2NVUB 1MMNA 4S0HB 3M7GA 2FJ1A 4EMSA 3CCJI 1WQ2A 2LF8A 2TCTA 4AIKA 2LMDA 5E8IA 3TP3A 3R6SA 5GAGJ 1DP3A 3DBLB 1DDNA 2H8WA 2ZO4A 1VQ4I 4ON0A 1J2XA 2YS9A 2BV6A 1ZLJA 3OYJA 5L3BA 1ULYA 3RKYA 1BR4A 1Z0XA 3JSPA 5JHFA 3PIOF 1J7KA 3I59B 3A01B 1BW6A 5FKKA 3H3VK 1OCRH 3DBHB 5ERIA 4FQGA 4ZTJA 5AONA 1F4KA 4KT6A 1XSDA 4N9HA 4AIHA 1A36A 1QVUA 2DCEA 3ABUA 5DTDA 1X4PA 5ICCA 2JUCA 5FKNA 1X1BA 3ZRGA 3FBIB 3HM5A 4NBQA 5IP7J 2DA2A 2R7QA 2JSPA 3KETA 4Y17A 3V8KA 3GO5A 4S05A 1YG2A 3CCEI 5LEKA 3F8CA 2ZXHA 1FBUA 2X6OA 4AWXB 5FO5A 1ONVA 1R5ID 1K78A 1BC8C 1ON2A 1YX3A 2ESHA 2XAUA 2STWA 1AHDP 2FQ3A 2E35A 4BQQA 3F8FA 2R7XA 3OSGA 2DA3A 5TISC 1IN4A 4U0YA 2GZWA 1EJ9A 2OF7A 2D1HA 2WTEA 3CLOA 2E7WA 3R61A 5E3MA 1GV5A 1A35A 1WCMJ 3GWZA 4EM1A 1DQUA 2FSWA 3V7RA 4EEFG 2AS5F 3L2RA 1FYMA 2IS2A 3IP4B 3ROUA 3CTAA 1G2HA 5EGOB 2DMQA 1RR7A 2Z2SB 2F4MB 2YU9J 3KEOA 1GUUA 3GYHX 2LVSA 5EJCA 1P7JA 2HDWA 2O7OA 3HOYJ 2VI6A 3DV8A 2KRCA 2DYRH 1VF9A 4KA4A 3RKQA 3PNTA 1GLNA 3ASNH 4IRIA 3S2WA 2XB5A 3IUOA 2NS0A 4LJZF 4MHGA 1Z9CA 4LFUA 2GQQA 4IHYA 3VEPA 1HW5A 2QGUA 4E7HA 3ZMSA 2FF4A 1XDUA 3RPQA 2QWWA 1RNLA 4WF2A 4P9FA 2EZIA 3H0DA 4XICA 4Y4RA 2HDDA 3L00A 4RAFA 4MIMA 3HC7A 5BMZA 3OYHA 1UB9A 1UMQA 2KDOA 2R7RA 1SEUA 3NWTA 4L5EA 3TW6A 3V8JA 3ZQCA 1MGTA 3O6BB 5E1XA 4HSRA 1TT0A 2KIUA 4EV0A 1SD7A 3BPXA 2CV2A 3WTVC 1YI2I 4AM3A 1MKMA 4JK1X 3B6AA 4BJ5C 1WH7A 1KQ0A 1QZZA 2I8DA 3BTLA 4TV7A 1J75A 4BXXJ 5IOYA 2HOSA 4RMNA 2MBFA 3R0AA 3I5UA 5E3NA 4Y13A 3RIRA 1SFXA 4RGRA 2NVQJ 3HHHA 2QYOA 4CCJA 2L0KA 4ZYHA 3JTGA 4ETSA 1STZA 3WGIA 2R7ZJ 3IH3A 3EUHA 4B47A 3JRFA 3J80K 2QQAA 3BZCA 4L0YB 1V5FA 3AG2H 3HBLA 2K7LA 2XB0X 2F5EA 4WX9A 1AWCA 4DZPA 2BVMA 1D1CA 1ZR4A 4XLCA 4G9YA 1NH3A 2EFNA 1VQKI 4CCNA 3ZN1A 2QKLB 2FU4A 1KGSA 2QF7A 5ED4A 2R4GA 4L5IA 1IRGA 2WAQN 4A0ZA 4JYKA 1TLHB 1XPXA 4Y15A 1W5SA 2B7EA 4ENKA 4IOAF 3J7YJ 2ZC2A 3D5RC 1U2WA 3OIQA 1Z3XA 2A05A 2R7UA 2VKHA 1RESA 4G7ZF 3PJRA 1MDMA 3VFZA 2DOEA 2X9DA 1WJDA 4ZTFA 1OISA 3VDXA 1Z21A 4NC7A 1OJLA 3E1SA 4LLLA 4A3EJ 5J3LA 3S3MA 1FBQA 5H6RA 5FFZA 3SEZA 2IGKA 1I50J 3BR1A 3R60A 4Y7NJ 1QZYA 3HSRA 1N78A 1SMYF 1FX7A 1OLTA 1SANA 4E7ZA 5KHDA 2B63J 4FETA 3HGYA 4KYWA 4YIFA 4BNCA 5CQEA 2UV1A 2O3FA 3SZGA 4RB3C 1U9OA 3KYLA 1T0FC 3GTPJ 3I3LA 2EQRA 2HDCA 1XGMA 2D2WA 3ZQGA 2R5ZA 3WTTC 3ECHA 1IF1A 2EZKA 2DT5A 3ZCOA 3I4NJ 3VWBA 3F8NA 5CYVA 5FLMJ 2MD5A 4EQQA 2HVRA 2GA1A 3RJPA 4RBOA 3FXRA 4IQJA 2FQ4A 1ETXA 3BWGA 1NK3P 4R1HA 1HQCA 2ZJ2A 2DXIA 5EZGA 2KDZA 4B1RA 3FDYA 2HOAA 2H6CA 3HRTA 1Y1VJ 1LNWA 3QPSA 1O3RA 2YR2A 1D5VA 2JRTA 2R93J 4U7BA 1T8IA 3H3UA 2COMA 4E4HA 4QWQA 3BZKA 5LHGA 3NQOA 2MGQA 5DCFA 1AKHA 1X1PA 2BOLA 1G3WA 2CSOA 1BN5A 3CO7C 4J01A 1I5ZA 1XMAA 3K70C 4NDLA 2E5ZA 1YRNA 2P7CB 2M4KA 4FX4A 3ZN0A 4XRMA 3ZMTA 3CMMA 2K3PA 3NARA 1WVRA 2RQPA 3CC7I 4KDPA 2E1NA 1GHCA 2JJ7A 3OYFA 3Q3SA 5FGMA 2QA4I 4BACA 1F1ZA 3HSEA 4IL6C 3L2UA 3DPLC 3I9V2 2DA4A 3CCYA 5L3EA 3OYIA 3DCFA 2HVSA 4OAYA 1S72I 3SZTA 3F23A 1FBSA 1W7PA 1WJCA 4MLOA 4D7NA 1SMTA 1HSTA 2DTRA 1FTZA 1ETVA 1WJBA 2PMHA 2EWNA 3N05A 4A3KJ 1ITYA 3GF2A 3L7WA 4L18B 2I5UA 2XV4S 3E5QA 2BHYA 4I09A 1KZHA 2FRHA 1VQ7I 2VQCA 3PSFA 3LSRA 1JHFA 3MVPA 5GTHC 4XIDA 4M6VA 2XRLA 3K4LA 3GMEA 1R49A 3HIFA 2DQLA 3SDGA 1QZEA 2X1DA 3BG7A 1KQ9A 3DPUA 1ZELA 4C30A 1C0WA 3TGNA 5DCMB 1P2FA 5DEQA 3I58A 1R4NB 4N0BA 1BR2A 4IOCF 2JUGA 3GCMA 4CGZA 4XORA 5FRMA 1OR7C 5JI6A 4CSWA 4L9VA 1LEAA 4JX5A 1S3JA 5F64A 2VPLA 1OYWA 3D0SA 3RKWA 4ZDOA 3IV5A 2R5YA 1KYZA 3LQQA 3M8EA 1K4SA 5F0CA 4XQFA 2JA5J 1P92A 2GXBA 3K2ZA 5L3CA 3CCVI 2QZ8A 4HQMA 4MFDA 2K9NA 3JRCA 1TZLA 4C3IJ 4FASD 2WV0A 5HLGA 1REPC 2X4HA 3S2HJ 1CF7A 4KIGA 4LIVA 1ETWA 2IS6A 4XSZF 2Q2EB 4A3JJ 3GEZA 1VQOI 1FP1D 2CW7A 1R58A 3CMEI 3HB9A 4A3CJ 4WXCA 1Y0NA 4A6EA 4CO8A 3OMYA 2O0YA 1XCVA 4LB5A 3U2RA 4Q4ZF 4CYCA 4HSTA 1F36A 3VYTB 4XNFA 2HTSA 3C18A 3HJEA 3CC4I 3E3VA 5M5WJ 4YFKF 1EH8A 2ZKZA 5IYCJ 2XPWA 2GM4A 2XGEA 3HKZA 2W82A 5J4VA 2GOMA 2X1CA 2OU2A 1KONA 5D4SA 1SVLA 2GXAA 2A6HF 3NRVA 4ZJZA 1WKMA 3A1YA 4O3MA 4LOCA 4IHTA 2ZJPF 2OAZA 3H35A 1LKXA 3QAHA 1RETA 2DMTA 2RN7A 3E6DA 5E1WA 3FHNA 2P8TA 3S16J 3ELKA 4I7HA 3DKWA 1D8KA 3U21A 1R00A 2V6CA 3OSFA 1J09A 1AU7A 1B72A 3Q0VA 1ZK8A 1Z3YA 1ZTRA 2LY9A 3IAS2 5FLXZ 1JXSA 3I71A 3LOCA 4PUSA 3L9FA 4M9ZA 1U5TC 2L5QA 5K1YA 1IXSB 4A93J 1WI3A 2GBYA 1HDDC 3D5SC 4IPAA 3FXMA 1D8JA 3GTMJ 1BA5A 2IBDA 5KK1A 2FBIA 3CD6I 1RI7A 3S17J 1V4RA 4YELA 2BXYA 2K85A 1FJLA 2FOKA 1UZCA 2JRMA 2OBPA 4IRGA 2DQRA 4HAMA 4UB8C 4XOPA 4F93B 1BC7C 1X2NA 1P7IA 2A69F 4CZCA 2WY7Q 3Q0UA 1DP7P 3LNQA 3HG9A 4GGGA 2OTLI 1IN8A 3MWMA 1JTYA 4LB6B 5IY5H 4Q47A 2P4WA 4F91B 2FXAA 2HWVA 3G71I 3K0LA 1BJZA 3BCAA 4KT5C 1I3AA 3HRSA 4UUSA 3F72A 3FBNB 1T95A 3ZQLA 2FBKA 2ELKA 2H6BA 2KJBA 1YLFA 4BY1J 3WTZA 1B8IA 3BDDA 2AO9A 1VI0A 3EPZA 2AHQA 3HRUA 3WTSC 2QVOA 3ESWB 1LFBA 3N4MA 2YUSA 2KRFA 2CUJA 4C9YA 2QUFA 4U7DA 2OZUA 2M5WA 3WE2A 3G1MA 3ZOBA 5L3FA 1U5TB 1G3SA 5B1BH 5EEAA 1O3SA 1Z67A 1G4DA 2P5VA 4OU0A 3LFUA 3M8FA 2DJNA 3KEYA 3T0YA 2N8GA 3G1LA 3ZMZA 2A68F 2R3SA 1OCCH 2PMZN 2X6WA 3ERMA 2VB6A 2CRGA 1FMWA 1Z6RA 2CU7A 3C2GA 3C2HA 2K40A 1F5TA 1MJAA 1JUSA 1Q1HA 3Q0WA 2I10A 4OOIA 2JVGA 1G6NA 3I59A 4EJOA 2OQGA 2PBIA 1Z7UA 3A01A 3GW2A 2O6GE 3AKZA 1SFEA 1W4MA 3ZMUA 3RYRA 2LTPA 3LQRA 2EH3A 3OYLA 3PSIA 2L4MA 1ACIA 2CO5A 3WODF 1J5YA 2CV1A 1ETYA 2VPRA 1K6OA 4HV6A 3GTJJ 5DM7F 1FP2A 1RPWA 4PJLA 1Y1WJ 1HLVA 1IN7A 1GXQA 1ETQA 3J7AO 4P9UA 1N77A 3K69A 2DAOA 2Z9OA 1MBEA 2CQKA 2LP0A 2P7VB 1V54H 5CVUA 2DK5A 2X6YA 4M3BA 2HOTA 2LOOA 1O3TA 1R1TA 4PGHA 1Y8RB 3GZ6A 2K9QA 4R8HA 4KUMA 1HC8A 5K5QA 1WI9A 2VLAA 2D45A 2VQGA 2IGOA 2WV1A 4UV9A 3KYCB 1XMKA 5LGNA 2LH9A 3C2BA 1MH3A 2CH0A 2XRNA 4A5NA 1KYWA 2GIZA 2PX9A 1Y8QB 3K1MA 5C3EJ 3LSTA 2D5VA 3CCUI 3GVAA 3WG9A 1FOKA 3TO9A 1W0TA 4PJ0C 1X58A 3BG5A 3BLYA 1MMAA 3DPTA 4BU2A 1MH4A 3KZZA 1K4TA 3FWEA 2E1CA 3VYRB 1FOXA 3HOUJ 3H5RA 1FOWA 5GP9A 2MH9A 3QOPA 2FUG2 1YITI 4D5FA 1NHAA 4NHJA 1GV2A 2WAFA 2ZFWA 1R23A 2Z1DA 4PZJA 2QSHX 3A0HC 5J8CA 1NK2P 3DEUA 2CG4A 4WWCA 5IT3A 2ECCA 1MBKA 2P5KA 4QPOA 2YSRA 1TP4A 1RRJA 4BEHA 2V9KA 1J0RA 4QSHA 5E20A 3KEQA 2OJED 1PUFA 2IVMA 1A04A 4IEJA 1BIBA 1OKRA 2DT7B 3W6VA 1YJ9I 1QA6A 4OIPF 1HKTA 1IUFA 2QENA 4HDUA 5CQGA 1PUEE 2RKHA 4M71A 3BZ6A 1IV8A 4EM2A 1FZPB 3G3ZA 3FXUA 4I2OA 2VKEA 2WAEA 4ZYEA 3Q9VA 1D0ZA 3S3NA 2IW5A 3HOVJ 2DK8A 1X1CA 3QU3A 1SFKA 1TWCJ 1BR1A 2M8GX 3FKJA 1YW7A 2LFBA 1FMVA 4EJUA 4LD5A 4BH9A 2HYJA 1UAAA 3P9CA 1E2XA 1E0EA 2XAQA 4RGUA 4Y33A 1U8BA 3O3KA 2G7UA 1MJBA 5D5WB 4RGSA 4I6ZA 1JUPA 3DFGA 2JA2A 2Y0SN 5JR3A 3F6VA 4XRSG 2WB1N 3X2QH 2AQFA 2E34A 2XPUA 3J7ZI 3E5XA 3M9AA 3CZ6A 4O6JA 1JKOC 1RKTA 2XF6A 2UWMA 2ZMEC 3QP6A 3GUDA 4EVIA 1VNDA 1O3QA 4U0VA 2Y48A 4BXFA 3J81Z 3S2DJ 4RDUA 2C6YA 2P81A 2KFDA 1MMDA 2YX7A 2KL4A 3PQJA 3K1PA 3SDBA 1F9NA 2A5WA 5FROA 4HNUA 2HNHA 3WU1B 4X0GA 2B0LA 4XN3A 4KICA 4D7MA 3ZGKA 1OFCX 3TEDA 2IA2A 3G2BA 1XMXA 3OYDA 4EGZA 2YX4A 2M8EA 1SFUA 3ZR8X 2IRFG 5EDNA 4IHWA 2YPRA 3S93A 2GXGA 3BR5A 2DJIA 2E7XA 4HQEA 2M7BA 3TW7A 2KMUA 1R71A 3FKIJ 3CJTB 1TQMA 2K4JA 3BCBA 3ZQQA 4PSWA 2NAZA 1T38A 4G12A 2XGDA 2MABA 5LHHA 2WC2A 2IT0A 3L09A 3HTUA 1XC5A 2BZTA 3OR2C 3HOXJ 2JK3A 2IP2A 3HSFA 1T2KA 2O9LA 1H9TA 2H1LA 1EF4A 1D5YA 1E17A 1J59A 4D0PA 5FJ8J 5HS8A 2IPQX 5F0HA 1S8NA 4MNUA 3S14J 2DFFA 3LAPA 2W1OA 2W84A 2MC4A 4OINF 3R0JA 4HW0A 2AXLA 2P6TA 3KPHA 1RIOH 4EJTA 1ZG3A 2M1BA 2L3DA 3GLXA 3MN2A 2JT1A 4BJ6C 1T6SA 1XDSA 5E17F 1IJWC 1NG7A 5F6FA 3OYGA 2XAHA 1B6AA 3T8RA 2DO7A 4IHSA 4A3MJ 3ZMDA 2PEXA 4KIBA 3IKVA 3T5XA 5GTIC 4NC8A 4XOTA 2A5YB 2EV6A 2JVHA 4M9XA 2VJIA 3I53A 4DZJA 3BP8A 1XD7A 3ABLH 5FKMA 3DLAA 4BQOA 5K7ZA 4P5OA 1I27A 1YX5A 1W7PD 2XAGA 2IS4A 2DPUA 3RQIA 5HLTA 1LDDA 5J1UA 4B4CA 5IOZA 1TNTA 3LSKA 3JRHA 3MKZA 1UHSA 2XVCA 4I02A 1OYYA 2XPVA 5J6XA 2ZSIB 2EV5A 3IC7A 1WJAA 3AG3H 2LNBA 4JBAA 5KAFC 2QLZA 1MBGA 4BS9A 4NQWB 3FXKA 3BTJA 3UKGA 5LBQA 2CGPA 3LSJA 5FKOA 1HBXG 3IL2A 1XTAA 3QU6A 1QHHD 1YO5C 3P9KA 1HA8A 1BI0A 1T0FA 3I0TA 3MKWB 3W6JB 2EFOA 1I6HJ 4DIQA 3BR6A 4LITA 2B9SA 1R1VA 4ZC3A 2CQ7A 1RUNA 5DV5A 2EK5A 2HVQA 1Z1DA 4HZFA 3GTLJ 3ERED 3B02A 1YS7A 3LAJA 3MQ0A 1H0MA 2NVYJ 4MEYF 3Q5FA 2LDUA 3W6KB 2ZJRF 1BI3A 3RDIA 2K86A 2RDPA 4A12A 1Y39A 2NXNB 1NG6A 1V5EA 3F0CA 1WH5A 4UXNA 5KAIC 5HOOA 3G6EI 4A2UA 2JZYA 3CP8A 5JLWA 1LEBA 4C3HJ 2MW8A 1OCTC 2M87A 2ZNYA 4M3FA 2VIXA 3K2AA 3VSLA 4AD9A 1SAUA 2R0QC 4S04A 2Z99A 5KNLA 4LMYA 2VE9A 3CUQC 3IRRA 2KIFA 3FXOA 4LG0B 4O5VA 3E5UA 2ACJA 3D1NI 2XKOA 3HDDA 4JX6A 1KU7A 2FMYA 3WTUC 2HXIA 2F2EA 2EFQA 4Y3OA 5JHUA 2JN6A 2RQQA 4G7OF 4AC0A 2LK2A 4BQAA 4KN7X 2IXSA 1ZGWA 2L9SA 5HDKA 1DGRM 4A3BJ 2E19A 5ILVA 4OIQF 2VBXA 1FIPA 1VTNC 2XDVA 1K61A 2GA2A 4PFPA 5DCMA 3TP0A 1HW1A 4HBLA 2DI3A 4AYBN 3JRIA 4HLYA 4KNYA 1ORKA 3P9IA 3JREA 3ULQB 4W97A 4BBSJ 3CQZJ 2Y30A 1PJRA 4V2FA 1ZG5A 3IAM2 2RGVA 5E8GA 2F4IA 4D1QA 4QTRA 2M3AA 4XR6A 3SFIA 5F1JA 3BJOA 1X3WB 4AIJA 2J5OA 2DODA 3CUQB 2HR3A 2H94A 2XGCA 3ABKH 4RAYA 1I1GA 2K27A 4AIDA 2A6EF 3EUHC 3K4CA 1XN7A 1EH7A 5DS9A 2NS7A 3ZMVA 1S7OA 2RREA 4I76A 4WCGA 1QQIA 1Y6IA 2HTJA 3PIPF 1JTXA 3PL8A 3GTOJ 1IV6A 2DA6A 1MJ9A 4MQVA 2OCCH 1IW7F 1F43A 3H5AA 4UNOA 4EM0B 3LA3A 2HKXA 1YHQI 2LSOA 3CP2A 5H2FC 3V4GA 2XKPA 3BR2A 2HQ5A 2PQ8A 2EIJH 5D5UB 2LKSA 2V9PA 4ZDLA 2ISZA 1B1BA 1BW5A 4RB1A 4JX4A 3WU2C 3O8GA 3VPRA 5D5XB 1UHWA 2OQRA 4M3DA 4F55A 4E7IA 2OPTA 1AOYA 2XAFA 4NNJA 3S15J 2HPMA 3Q9SA 2GOXB 4GRIA 4I0BA 4HYEA 1ERDA 4IQ4A 3KFWX 3E7LA 1XSVA 2BW3B 2OTJI 2PJPA 3V7CA 2ME6A 1EH6A 3QYBA 3DQVC 1FT9A 1R7JA 3BT9A 3OYBA 2O61A 5J1RA 2NOGA 2KPMA 3KE2A 3GFMA 3OL4A 4XKVA 4H0EA 1FTTA 2ICWG 2A61A 3DXJF 2MLGA 4XN0A 4ZYAA 5FRNA 1VQNI 4E7LA 4OMZA 3OS2A 2F4OB 2HEOA 4OAZA 2GWRA 1S9HA 3OY9A 1MBHA 4HNTA 4GYGA 2DW4A 5LFAA 2Y2ZA 2UZKA 2QCOA 3HEFA 2LBFA 5E1ZB 5B66C 2IEKA 1ZARA 3EUKL 4BE0A 3TBIA 1L0OC 1LB2A 3M8JA 4B43A 4KITB 2L02A 2V7FA 1N25A 5HLIA 5ILSA 4N4NB 1XGNA 2IGNA 1TNSA 1DPRA 1ETOA 5GAEJ 3LSPA 3QYEA 5JLXA 4L5JA 3VYUB 3PNYA 3BQZA 2NOJB 5IYDJ 2TRTA 3M3YJ 2MC3A 1TC3C 5CKTA 4KMFA 4GXOA 3L1PA 1RKWA 4UY8I 2AXTC 3V7SA 2HQNA 2H09A 3OYCA 3RYPA 4YEJA 2ZSHB 4W1UA 3AG4H 3MMYB 1VQMI 1S29A 1USSA 2QEXI 1MIJA 3K4MA 3PO2J 3JAMZ 2RNGA
chains in the Genus database with same CATH topology
2NVTJ 3A01A 5IP9J 3BTIA 2LTPA 4A69C 5J1YA 2EH3A 2X6OA 1HOMA 5F27A 2H8RA 1ETYA 1TWFJ 2VPRA 4DYRA 4C3JJ 2R5ZB 3GTJJ 1AHDP 2KT0A 1RPWA 1Y1WJ 1HLVA 1ETQA 2L7FP 3PM1A 5E3OA 3OSGA 2DA3A 1MBEA 2LP0A 3A03A 2OF7A 2W48A 5E3MA 1GV5A 4M3BA 3FISA 1WCMJ 2HOTA 4EEFG 2HXOA 2K9QA 4A3IJ 1G2HA 5EGOB 2DMQA 1RR7A 2YU9J 3BR0A 1GUUA 2WV1A 2LVSA 3C2BA 1P7JA 1MH3A 2O7OA 3HOYJ 2VI6A 1H8AC 3RKQA 1VF9A 2H1KA 5C3EJ 2D5VA 1X2MA 4FCYA 1W0TA 2XB5A 1TWHJ 1X58A 5IP6A 3BG5A 1APLC 3NAUA 1MSEC 4IHYA 1MH4A 1JT6A 1AKHB 3FIWA 3IH4A 2DA5A 3HOUJ 1JKRC 4GFBA 2EZIA 2JA8J 4XICA 5GP9A 4X6AJ 2HDDA 4D5FA 1YRNB 2DMUA 1GV2A 5M3FJ 1MSFC 4MIMA 4FE7A 4FISA 1UMQA 4ABZA 1Z77A 1NK2P 4L5EA 3TW6A 3GTKJ 2ECCA 1MBKA 1TWAJ 1LE8B 3ZQCA 2E2HJ 2L9RA 1HDPA 3HOWJ 5BNGA 4QSHA 1JJ6C 3B6AA 1WH7A 1PUFA 3BTLA 4IEJA 2MG4A 5IOYA 1VFCA 4BXXJ 4A3LJ 3CDLA 3WHCA 5C4JJ 3W6VA 2HOSA 4A3FJ 1GDTA 1IUFA 4M3EA 5E3NA 1LE8A 2NVQJ 3LSGA 1MBFA 1T56A 2L0KA 2VKEA 2CJJA 2R7ZJ 2ME0A 3IH3A 3HOVJ 3JRFA 1TWCJ 2M8GX 3OIOA 3S1RJ 2LFBA 3HBLA 2XB0X 3M4OJ 2HYJA 4M3GA 4DZPA 1U78A 1ZR4A 1U8BA 2DN0A 1MBJA 4I6ZA 1JUPA 2QF7A 5E3LA 3H0GJ 2Y0SN 2WAQN 2NS8A 1A5JA 4JYKA 4XRSG 2WB1N 2XPUA 1UG2A 2IAIA 1JKOC 1XS9A 1RKTA 5GPAA 1IDYA 5K7FA 5EF6A 1I3QJ 1A6IA 1VNDA 2EBIA 3S2DJ 1RESA 1POGA 2Y9YA 4RDUA 4BKXA 2P81A 2X9DA 1DU0A 5F04A 1IC8A 1OJLA 4J19A 4A3EJ 2ID3A 5J3LA 2HI3A 4D7MA 1I50J 1OFCX 3BR1A 3TEDA 2GLOA 4Y7NJ 3QQAA 1SANA 5EDNA 4IHWA 1XG1A 3BR5A 2B63J 3HGYA 4MO7A 3TW7A 3I4MJ 3FKIJ 2DMPA 1H88C 4G12A 1U9OA 2XGDA 4DYCA 1HF0A 3GTPJ 2L7ZA 1H89C 2M9HA 3CMYA 1XC5A 3HOXJ 2JK3A 2EQRA 2CQQA 3ZQGA 2O9LA 2FD5A 1D5YA 1EF4A 2R5ZA 4BBRJ 3OOUA 5FJ8J 2FX0A 4QIWN 2DMNA 2EZKA 4FE4A 3ZQIA 5F0HA 5IYBJ 3S14J 1QRYA 3I4NJ 3G1OA 2MSYA 5FLMJ 3MN2A 4RBOA 2FQ4A 1ETXA 2LR8A 1NK3P 4XRSA 1QVTA 5EGOA 1IJWC 3O8HA 5EZGA 2KDZA 4B1RA 5IPAA 4A3MJ 2HOAA 2JA7J 5GPCA 1Y1VJ 4DZJA 3QPSA 3PO3J 2L7MP 5FKLA 1S7EA 3DEWA 4UUTA 5FKMA 2R93J 4Y52J 5EYRA 3S1NJ 3RZDJ 1WGXA 5K7ZA 4BY7J 3RQIA 2MGQA 5J1UA 5EG0B 1AKHA 3S1QJ 1IG7A 4A3GJ 4B4CA 5IOZA 1LFUP 1FIAA 2R92J 4X1EA 3JRHA 4AUXA 1UHSA 1GT0C 2M0CA 2XPVA 3SJMA 4NDLA 1YRNA 4MFEA 1ZKGA 5F0FA 4XRMA 1MBGA 3BG3A 3BTJA 3UKGA 2CQXA 3LSJA 5FKOA 3NARA 5EG0A 3JRDA 2DTZA 3WHBA 2JJ7A 1I6HJ 1K83J 3BR6A 3Q3SA 5FLVA 2DA4A 3CCYA 3GTLJ 3DCFA 4MLOA 4D7NA 3FK6A 1OCPA 2NVYJ 1ETVA 1FTZA 2ZB9A 4JP0A 4A3KJ 3HKZN 1ZR2A 2XSDC 1ITYA 1U9NA 1IDZA 4IHXA 1FEXA 3F0CA 1WH5A 3LSRA 3MVPA 4XIDA 4M6VA 2XRLA 4FTHA 1ENHA 1TWGJ 5JLWA 1SFOJ 1JKQC 4C3HJ 2MW8A 3SDGA 1OCTC 3RZOJ 4M3FA 2R0QC 3K2AA 2R5YB 3BG9A 3ZQFA 2ECBA 1JGGA 3BTCA 3D1NI 3HDDA 4JX6A 2HXIA 3HOZJ 2JN6A 4AC0A 2LK2A 2Y9ZA 4JX5A 2JA6J 1ZGWA 3IV5A 2R5YA 2CUEA 4A3BJ 2E19A 2M2EA 5F0CA 1IRZA 2JA5J 1FIPA 1ZQ3P 1K61A 4MFDA 2K9NA 3JRCA 3TP0A 4C3IJ 5M5XJ 4CYCB 2VKVA 4AYBN 3S2HJ 4DW6A 3JRIA 1ETWA 1ORKA 3GTQJ 3JR9A 4A3JJ 2EZLA 3JREA 3HB9A 4A3CJ 2M34A 2DA1A 4W97A 4BBSJ 1IGNA 1MNMC 3CQZJ 2Y30A 4V2FA 2JMWA 4CYCA 1Q1VA 1F36A 4QTRA 4V2GA 3JRGA 3SFIA 5M5WJ 3FK7A 5F1JA 5IYCJ 4B3AA 2XPWA 2GM4A 2XGEA 2G0EA 3JRBA 2XGCA 2DA7A 5DS9A 2NS7A 1B72B 4LOCA 4I76A 5F08A 5M5YJ 4C2MJ 1JTXA 2O8KA 1RETA 3GTOJ 1IV6A 2Y31A 2DMTA 2DA6A 2JWTA 2LKXA 1F43A 3GTGJ 1DU6A 5C4XJ 3A02A 3S16J 2CUFA 9ANTA 3K7AJ 3OSFA 1WPKA 1AU7A 1B72A 3Q0VA 1ZK8A 3BR2A 1ZTRA 2LY9A 2E1OA 2HQ5A 2E2IJ 5K7HA 4HNVA 2VUMJ 1BW5A 3LOCA 4JX4A 3O8GA 1JKPC 4A93J 1WI3A 2GBYA 1HDDC 2E2JJ 1JT0A 3VPRA 1PUFB 1NTCA 4M3DA 2OPTA 2LD5A 1HCRA 3S15J 3IH2A 3JRAA 3GTMJ 1BA5A 2IBDA 3S17J 1JJ8C 3GBGA 4DYQA 3E7LA 1FJLA 3QPLA 4A3DJ 3B6CA 3BQYA 2EZHA 4UUSB 2ME6A 1T33A 1X2NA 1O4XA 1P7IA 3BT9A 2RAEA 1BL0A 5J1RA 2ID6A 2NOGA 3Q0UA 3ZQHA 3LNQA 1B8IB 3HGGA 1W0UA 1FTTA 1JTYA 1E3OC 2K9SA 1GVDA 1BJZA 2X48A 4UUSA 1JUMA 1MBHA 4S0HB 1QPIA 2Y2ZA 2NVXJ 2FJ1A 3ZQLA 3S1MJ 2ELKA 2QCOA 2TCTA 3MKLA 3HEFA 4BY1J 2IEKA 1B8IA 3TP3A 2AO9A 1VI0A 2AHQA 2COBA 5HODA 1LFBA 2YUSA 1CQTA 3G1MA 2YS9A 3ZOBA 5EEAA 4XK4A 3LSPA 1ETOA 1R9TJ 5JLXA 1Z0XA 3BQZA 4D5CA 5IYDJ 5M3MJ 2TRTA 3M3YJ 3A01B 1BW6A 2DJNA 5FKKA 1TC3C 3H3VK 3BR3A 2N8GA 1RKWA 3G1LA 3L1PA 5C44J 2PMZN 2CRGA 4W1UA 1QVUA 5DTDA 2CU7A 5FKNA 2K40A 3HM5A 1JUSA 5EZHA 3PO2J 3Q0WA 2I10A 5IP7J 2DA2A 2LLKA 1ETKA 4IHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT J;  3A01 A;  5IP9 J;  3BTI A;  2LTP A;  4A69 C;  5J1Y A;  2EH3 A;  2X6O A;  1HOM A;  5F27 A;  2H8R A;  1ETY A;  1TWF J;  2VPR A;  4DYR A;  4C3J J;  2R5Z B;  3GTJ J;  1AHD P;  2KT0 A;  1RPW A;  1Y1W J;  1HLV A;  1ETQ A;  2L7F P;  3PM1 A;  5E3O A;  3OSG A;  2DA3 A;  1MBE A;  2LP0 A;  3A03 A;  2OF7 A;  2W48 A;  5E3M A;  1GV5 A;  4M3B A;  3FIS A;  1WCM J;  2HOT A;  4EEF G;  2HXO A;  2K9Q A;  4A3I J;  1G2H A;  5EGO B;  2DMQ A;  1RR7 A;  2YU9 J;  3BR0 A;  1GUU A;  2WV1 A;  2LVS A;  3C2B A;  1P7J A;  1MH3 A;  2O7O A;  3HOY J;  2VI6 A;  1H8A C;  3RKQ A;  1VF9 A;  2H1K A;  5C3E J;  2D5V A;  1X2M A;  4FCY A;  1W0T A;  2XB5 A;  1TWH J;  1X58 A;  5IP6 A;  3BG5 A;  1APL C;  3NAU A;  1MSE C;  4IHY A;  1MH4 A;  1JT6 A;  1AKH B;  3FIW A;  3IH4 A;  2DA5 A;  3HOU J;  1JKR C;  4GFB A;  2EZI A;  2JA8 J;  4XIC A;  5GP9 A;  4X6A J;  2HDD A;  4D5F A;  1YRN B;  2DMU A;  1GV2 A;  5M3F J;  1MSF C;  4MIM A;  4FE7 A;  4FIS A;  1UMQ A;  4ABZ A;  1Z77 A;  1NK2 P;  4L5E A;  3TW6 A;  3GTK J;  2ECC A;  1MBK A;  1TWA J;  1LE8 B;  3ZQC A;  2E2H J;  2L9R A;  1HDP A;  3HOW J;  5BNG A;  4QSH A;  1JJ6 C;  3B6A A;  1WH7 A;  1PUF A;  3BTL A;  4IEJ A;  2MG4 A;  5IOY A;  1VFC A;  4BXX J;  4A3L J;  3CDL A;  3WHC A;  5C4J J;  3W6V A;  2HOS A;  4A3F J;  1GDT A;  1IUF A;  4M3E A;  5E3N A;  1LE8 A;  2NVQ J;  3LSG A;  1MBF A;  1T56 A;  2L0K A;  2VKE A;  2CJJ A;  2R7Z J;  2ME0 A;  3IH3 A;  3HOV J;  3JRF A;  1TWC J;  2M8G X;  3OIO A;  3S1R J;  2LFB A;  3HBL A;  2XB0 X;  3M4O J;  2HYJ A;  4M3G A;  4DZP A;  1U78 A;  1ZR4 A;  1U8B A;  2DN0 A;  1MBJ A;  4I6Z A;  1JUP A;  2QF7 A;  5E3L A;  3H0G J;  2Y0S N;  2WAQ N;  2NS8 A;  1A5J A;  4JYK A;  4XRS G;  2WB1 N;  2XPU A;  1UG2 A;  2IAI A;  1JKO C;  1XS9 A;  1RKT A;  5GPA A;  1IDY A;  5K7F A;  5EF6 A;  1I3Q J;  1A6I A;  1VND A;  2EBI A;  3S2D J;  1RES A;  1POG A;  2Y9Y A;  4RDU A;  4BKX A;  2P81 A;  2X9D A;  1DU0 A;  5F04 A;  1IC8 A;  1OJL A;  4J19 A;  4A3E J;  2ID3 A;  5J3L A;  2HI3 A;  4D7M A;  1I50 J;  1OFC X;  3BR1 A;  3TED A;  2GLO A;  4Y7N J;  3QQA A;  1SAN A;  5EDN A;  4IHW A;  1XG1 A;  3BR5 A;  2B63 J;  3HGY A;  4MO7 A;  3TW7 A;  3I4M J;  3FKI J;  2DMP A;  1H88 C;  4G12 A;  1U9O A;  2XGD A;  4DYC A;  1HF0 A;  3GTP J;  2L7Z A;  1H89 C;  2M9H A;  3CMY A;  1XC5 A;  3HOX J;  2JK3 A;  2EQR A;  2CQQ A;  3ZQG A;  2O9L A;  2FD5 A;  1D5Y A;  1EF4 A;  2R5Z A;  4BBR J;  3OOU A;  5FJ8 J;  2FX0 A;  4QIW N;  2DMN A;  2EZK A;  4FE4 A;  3ZQI A;  5F0H A;  5IYB J;  3S14 J;  1QRY A;  3I4N J;  3G1O A;  2MSY A;  5FLM J;  3MN2 A;  4RBO A;  2FQ4 A;  1ETX A;  2LR8 A;  1NK3 P;  4XRS A;  1QVT A;  5EGO A;  1IJW C;  3O8H A;  5EZG A;  2KDZ A;  4B1R A;  5IPA A;  4A3M J;  2HOA A;  2JA7 J;  5GPC A;  1Y1V J;  4DZJ A;  3QPS A;  3PO3 J;  2L7M P;  5FKL A;  1S7E A;  3DEW A;  4UUT A;  5FKM A;  2R93 J;  4Y52 J;  5EYR A;  3S1N J;  3RZD J;  1WGX A;  5K7Z A;  4BY7 J;  3RQI A;  2MGQ A;  5J1U A;  5EG0 B;  1AKH A;  3S1Q J;  1IG7 A;  4A3G J;  4B4C A;  5IOZ A;  1LFU P;  1FIA A;  2R92 J;  4X1E A;  3JRH A;  4AUX A;  1UHS A;  1GT0 C;  2M0C A;  2XPV A;  3SJM A;  4NDL A;  1YRN A;  4MFE A;  1ZKG A;  5F0F A;  4XRM A;  1MBG A;  3BG3 A;  3BTJ A;  3UKG A;  2CQX A;  3LSJ A;  5FKO A;  3NAR A;  5EG0 A;  3JRD A;  2DTZ A;  3WHB A;  2JJ7 A;  1I6H J;  1K83 J;  3BR6 A;  3Q3S A;  5FLV A;  2DA4 A;  3CCY A;  3GTL J;  3DCF A;  4MLO A;  4D7N A;  3FK6 A;  1OCP A;  2NVY J;  1ETV A;  1FTZ A;  2ZB9 A;  4JP0 A;  4A3K J;  3HKZ N;  1ZR2 A;  2XSD C;  1ITY A;  1U9N A;  1IDZ A;  4IHX A;  1FEX A;  3F0C A;  1WH5 A;  3LSR A;  3MVP A;  4XID A;  4M6V A;  2XRL A;  4FTH A;  1ENH A;  1TWG J;  5JLW A;  1SFO J;  1JKQ C;  4C3H J;  2MW8 A;  3SDG A;  1OCT C;  3RZO J;  4M3F A;  2R0Q C;  3K2A A;  2R5Y B;  3BG9 A;  3ZQF A;  2ECB A;  1JGG A;  3BTC A;  3D1N I;  3HDD A;  4JX6 A;  2HXI A;  3HOZ J;  2JN6 A;  4AC0 A;  2LK2 A;  2Y9Z A;  4JX5 A;  2JA6 J;  1ZGW A;  3IV5 A;  2R5Y A;  2CUE A;  4A3B J;  2E19 A;  2M2E A;  5F0C A;  1IRZ A;  2JA5 J;  1FIP A;  1ZQ3 P;  1K61 A;  4MFD A;  2K9N A;  3JRC A;  3TP0 A;  4C3I J;  5M5X J;  4CYC B;  2VKV A;  4AYB N;  3S2H J;  4DW6 A;  3JRI A;  1ETW A;  1ORK A;  3GTQ J;  3JR9 A;  4A3J J;  2EZL A;  3JRE A;  3HB9 A;  4A3C J;  2M34 A;  2DA1 A;  4W97 A;  4BBS J;  1IGN A;  1MNM C;  3CQZ J;  2Y30 A;  4V2F A;  2JMW A;  4CYC A;  1Q1V A;  1F36 A;  4QTR A;  4V2G A;  3JRG A;  3SFI A;  5M5W J;  3FK7 A;  5F1J A;  5IYC J;  4B3A A;  2XPW A;  2GM4 A;  2XGE A;  2G0E A;  3JRB A;  2XGC A;  2DA7 A;  5DS9 A;  2NS7 A;  1B72 B;  4LOC A;  4I76 A;  5F08 A;  5M5Y J;  4C2M J;  1JTX A;  2O8K A;  1RET A;  3GTO J;  1IV6 A;  2Y31 A;  2DMT A;  2DA6 A;  2JWT A;  2LKX A;  1F43 A;  3GTG J;  1DU6 A;  5C4X J;  3A02 A;  3S16 J;  2CUF A;  9ANT A;  3K7A J;  3OSF A;  1WPK A;  1AU7 A;  1B72 A;  3Q0V A;  1ZK8 A;  3BR2 A;  1ZTR A;  2LY9 A;  2E1O A;  2HQ5 A;  2E2I J;  5K7H A;  4HNV A;  2VUM J;  1BW5 A;  3LOC A;  4JX4 A;  3O8G A;  1JKP C;  4A93 J;  1WI3 A;  2GBY A;  1HDD C;  2E2J J;  1JT0 A;  3VPR A;  1PUF B;  1NTC A;  4M3D A;  2OPT A;  2LD5 A;  1HCR A;  3S15 J;  3IH2 A;  3JRA A;  3GTM J;  1BA5 A;  2IBD A;  3S17 J;  1JJ8 C;  3GBG A;  4DYQ A;  3E7L A;  1FJL A;  3QPL A;  4A3D J;  3B6C A;  3BQY A;  2EZH A;  4UUS B;  2ME6 A;  1T33 A;  1X2N A;  1O4X A;  1P7I A;  3BT9 A;  2RAE A;  1BL0 A;  5J1R A;  2ID6 A;  2NOG A;  3Q0U A;  3ZQH A;  3LNQ A;  1B8I B;  3HGG A;  1W0U A;  1FTT A;  1JTY A;  1E3O C;  2K9S A;  1GVD A;  1BJZ A;  2X48 A;  4UUS A;  1JUM A;  1MBH A;  4S0H B;  1QPI A;  2Y2Z A;  2NVX J;  2FJ1 A;  3ZQL A;  3S1M J;  2ELK A;  2QCO A;  2TCT A;  3MKL A;  3HEF A;  4BY1 J;  2IEK A;  1B8I A;  3TP3 A;  2AO9 A;  1VI0 A;  2AHQ A;  2COB A;  5HOD A;  1LFB A;  2YUS A;  1CQT A;  3G1M A;  2YS9 A;  3ZOB A;  5EEA A;  4XK4 A;  3LSP A;  1ETO A;  1R9T J;  5JLX A;  1Z0X A;  3BQZ A;  4D5C A;  5IYD J;  5M3M J;  2TRT A;  3M3Y J;  3A01 B;  1BW6 A;  2DJN A;  5FKK A;  1TC3 C;  3H3V K;  3BR3 A;  2N8G A;  1RKW A;  3G1L A;  3L1P A;  5C44 J;  2PMZ N;  2CRG A;  4W1U A;  1QVU A;  5DTD A;  2CU7 A;  5FKN A;  2K40 A;  3HM5 A;  1JUS A;  5EZH A;  3PO2 J;  3Q0W A;  2I10 A;  5IP7 J;  2DA2 A;  2LLK A;  1ETK A;  4IHV A; 
#chains in the Genus database with same CATH topology
 5H20 A;  2Z16 A;  5J47 A;  3GLL A;  5IP9 J;  2MLK A;  4E7J A;  2VJJ A;  4A69 C;  5J1Y A;  1W5T A;  4BYY A;  3OYE A;  3H3Z A;  3FMQ A;  1HOM A;  5F27 A;  4GO1 A;  2H8R A;  4Z6Y A;  4DYR A;  4C3J J;  2R5Z B;  5FFX A;  3S8P A;  3B73 A;  3KP4 A;  4P55 A;  1YS6 A;  2XUB A;  1FY7 A;  3A03 A;  4HX4 A;  2QBY B;  3EYY A;  2W48 A;  5LLQ A;  4L0Z B;  4DQ2 A;  5IT9 Z;  1W5C C;  1X1A A;  4PDK A;  4M72 A;  3RKX A;  2HXO A;  3SEQ A;  4A3I J;  4G94 A;  4G7H F;  2K4B A;  1QNT A;  1P4A A;  3BR0 A;  5TJJ A;  3CDH A;  1MW7 A;  1JHH A;  2RVC A;  1H8A C;  4U0W A;  2LKP A;  5ICE A;  2WA0 A;  2HS5 A;  1X2M A;  4FCY A;  4HF0 A;  3L2Q A;  1QBJ A;  2BGC A;  1P9Q C;  3IHU A;  4PCQ A;  1S6L A;  1IRF A;  3DTE A;  2LG4 A;  3NAU A;  5FD5 A;  4M9S A;  4CXF A;  2XC7 A;  1MSE C;  4ENJ A;  2V4J C;  1JT6 A;  4IRH A;  1AKH B;  1WJF A;  3FIW A;  4WXD A;  5KVR A;  4I01 A;  3IH4 A;  2W57 A;  1TQI A;  2XIG A;  2KQR A;  3HZJ A;  3F22 A;  4J00 A;  2WWY A;  3DP7 A;  2JA8 J;  3E6C C;  2WB1 A;  4HA8 A;  1YRN B;  2DMU A;  5HLH A;  4XL9 A;  1A31 A;  3REO A;  1J9I A;  2QQ9 A;  1MSF C;  3M1C A;  3L2V A;  2DDA A;  3LFK A;  4ABZ A;  4EJW A;  5AIQ A;  2LYC A;  3EDP A;  3GTK J;  3W2V A;  3ABM H;  4CCM A;  2M30 A;  4ZYG A;  1LE8 B;  1K79 A;  3M07 A;  1HDP A;  2A07 F;  3CUO A;  5FD6 A;  3F8M A;  5LGU A;  2F5D A;  2EIL H;  2E36 A;  2L9N A;  3PNV A;  1WJE A;  2HKO A;  2F5V A;  5L3G A;  1XGO A;  4E7S A;  2R7O A;  1W7P B;  2R7S A;  4A3L J;  2ISY A;  1ZG1 A;  3K9T A;  4A6D A;  2BY2 A;  1MD0 A;  5HVQ C;  4HLX A;  4GCV A;  3LSG A;  2KIS A;  1MBF A;  1N75 A;  1T56 A;  5HDG A;  3TOB A;  1YW8 A;  2CJJ A;  3HOS A;  3LSM A;  4ZZD A;  2ME0 A;  5DDG A;  5J4Y A;  1YJN I;  2W24 A;  1DUX C;  4PSX A;  3HUG B;  1JGS A;  3FX3 A;  4MTD A;  2L4A A;  2KIM A;  3OIO A;  2FNP A;  3S1R J;  3CF5 F;  4ANJ A;  3M4O J;  4M3G A;  1UFM A;  1XB4 A;  1ZHF A;  5ICG A;  1YIJ I;  1LPQ A;  3WE3 A;  3DLL F;  3WG7 H;  4Z2Y A;  2DFI A;  3F21 A;  3SXY A;  3RQ4 A;  5E3L A;  2P0W A;  3OR1 C;  3E6M A;  4UUV A;  5F1R A;  3MAJ A;  3GZN B;  4G8X A;  4HG2 A;  4LLG F;  1XS9 A;  4IJA A;  2BHZ A;  3WGG A;  5EF6 A;  5LHI A;  1I3Q J;  2UXX A;  2LRE A;  3I54 A;  4DNC A;  2VT3 A;  3OV8 A;  3LA2 A;  5A2Q Z;  1FSE A;  3IWZ A;  1IC8 A;  2ID3 A;  3NEU A;  1HW2 A;  3AG1 H;  3EQL F;  4P1W A;  1MMS A;  2VE8 A;  1YJW I;  2GLO A;  3SZP A;  3QQA A;  1Z05 A;  2E71 A;  4NUB A;  1XG1 A;  1BJA A;  2K3F A;  3CJQ B;  2ZXI A;  4MO7 A;  5GAD J;  2MFZ A;  4HX8 A;  3I4M J;  1EA3 A;  1D1A A;  4UHT A;  3KP5 A;  2VON A;  1HSJ A;  2DMP A;  2HQA A;  3FZV A;  3P7N A;  6PAX A;  4P96 A;  1FYK A;  1UJ8 A;  2E1M C;  4DYC A;  1HF0 A;  1IRX A;  1IXR C;  1YOV B;  4UV8 A;  2VBZ A;  2DPD A;  5DUK A;  2NRA C;  2IA0 A;  1W1W E;  2KIQ A;  1H89 C;  3C7J A;  3CMY A;  1R5H A;  2DOA A;  2AQE A;  3F9K A;  5FLX K;  4UVA A;  2X85 A;  2G7H A;  4BBR J;  3OOU A;  4QIW N;  2DMN A;  1MMG A;  3MD2 A;  3G1O A;  1LVK A;  5HDN A;  5LRS A;  4BQN A;  1EKE A;  2XGX A;  2LR8 A;  4XRS A;  1QVT A;  1U0J A;  1XGS A;  4KIF A;  5BOX A;  5EGO A;  4K2E A;  2PI0 A;  3TL4 X;  4FHT A;  4ESJ A;  5TRD A;  4PJM A;  1JE8 A;  2LY2 A;  1ZRD A;  4E7K A;  2L7M P;  2VBW A;  1S7E A;  4UUT A;  2WAQ A;  1UHM A;  2ZNZ A;  3RZD J;  3PUF A;  2P5L C;  4CCK A;  4IVN A;  4BY7 J;  5B1A H;  4GDF A;  2M45 A;  1I1S A;  1SD6 A;  3JW4 A;  5EG0 B;  1G59 A;  2VQL A;  4A3G J;  1IG7 A;  2UXN A;  3KP6 A;  4X1E A;  1O7L A;  3U1D A;  4ESB A;  1PVE A;  3HPH A;  1GT0 C;  2Q1Z B;  1KU9 A;  3F6O A;  5CPR B;  1RUO A;  2MD0 A;  3A2K A;  1RC9 A;  2FE3 A;  4D9J A;  4MFE A;  4LGW A;  5L3D A;  2GIV A;  2OD5 A;  3WU0 A;  1FC3 A;  3BG3 A;  3SQN A;  4CUG A;  4HDV A;  1UG0 A;  2X0L A;  4JOM A;  1B9N A;  2PJR B;  3EYI A;  4MQ9 F;  1K83 J;  1GVJ A;  3KP3 A;  2X1E A;  2XAS A;  3G4S I;  5FLV A;  4PFO A;  4XLA A;  3FXQ A;  2EV0 A;  2L54 A;  4WXH A;  4LLN A;  2JQ7 A;  3VSK A;  4NQW A;  2WY8 Q;  2V79 A;  2ZB9 A;  3BJA A;  4JP0 A;  2FEZ A;  1MNE A;  3HKZ N;  1X3Z B;  1ZR2 A;  4BDZ A;  1U9N A;  3T8T A;  3GZ5 A;  4IHX A;  3TO7 A;  3DKY A;  2EPF A;  1FEX A;  2DYS H;  1T98 A;  3BRO A;  4LK1 F;  4M73 A;  2LY1 A;  4LIU A;  2O8X A;  4U88 A;  3CES A;  1TWG J;  3JTH A;  4HRI A;  3TDZ C;  1SFO J;  1Z7L A;  3ISP A;  1K7A A;  2FML A;  4OMY A;  1AA7 A;  2CWE A;  2HZD A;  3ZQF A;  3COA C;  4YG2 F;  3H5N A;  3KCC A;  4C2U A;  2DT6 A;  2ECB A;  3L2W A;  1JGG A;  3BTC A;  4UB6 C;  3VYS B;  2OCE A;  2V1X A;  4XKW A;  2HU9 A;  2HOE A;  3HOZ J;  3ECO A;  2NNN A;  4YFX F;  3OYA A;  2L7K A;  1VQ6 I;  1P4W A;  3AFH A;  3KP7 A;  4BJT A;  4U87 A;  3QPT A;  3HYI A;  3L2C A;  1LUJ B;  2M2E A;  2V1U A;  2R7W A;  1KA8 A;  3J80 Z;  4BHP A;  1ZQ3 P;  2W25 A;  4LG0 A;  4L9J A;  3CC2 I;  3CCQ I;  1YE9 A;  2W85 A;  4JQF A;  1ZAO A;  1X1D A;  4L9T A;  4XRF A;  1XCB A;  4OIO F;  2CS3 A;  1IO2 A;  3JR9 A;  2BY1 A;  2K9L A;  3ZXS A;  3S3O A;  2CFX A;  1SC7 A;  2STT A;  1ZRE A;  3IWF A;  5B5E C;  2KJC A;  3EUA A;  4ENM A;  2R7V A;  4LK0 F;  2M34 A;  2VL8 A;  2V1D A;  2XSJ C;  1I39 A;  3DKX A;  1IGN A;  1SD4 A;  1D3Y A;  3TMO A;  1PDN C;  4DBR A;  2JMW A;  1YQA A;  1RZ4 A;  3K6G A;  5K5O A;  1G3T A;  3A4C A;  2ZME B;  4ZH4 F;  5ILU A;  3E97 A;  3S32 A;  4AVP A;  5D4R A;  3ZP5 A;  4HF1 A;  2WBM A;  3KZI C;  3JRB A;  2Q0O A;  2QSG X;  2A6T A;  1LDJ A;  1SAX A;  2DA7 A;  1LQ1 A;  4B48 A;  4KFC A;  4RB0 A;  4NC6 A;  4KN4 X;  2CUZ A;  4R79 A;  1X4O A;  3HXL A;  4RLF A;  2L01 A;  3H1C A;  2R7F A;  1OCZ H;  3H9Q A;  2O8K A;  2LKX A;  4RLQ A;  2UUZ A;  3CUQ A;  3R4K A;  1VZ0 A;  5DUI A;  2E5N A;  2HPI A;  2RV8 A;  3GTG J;  1DU6 A;  3TKY A;  5C4X J;  2CUF A;  2BE5 F;  2Y0M A;  3GFJ A;  1WPK A;  1BIA A;  4ZDP A;  2TDX A;  4CCO A;  1MZB A;  2V1N A;  4E70 A;  1VQ5 I;  3H36 A;  3DTK A;  3QOE A;  1BBY A;  5K7H A;  4HNV A;  3CMA I;  1IAW A;  2G9W A;  2HZT A;  3LMM A;  4BEH B;  4CHU A;  2K02 A;  4Q5S F;  3TO6 A;  1Z91 A;  1L3L A;  4BXU A;  1PUF B;  1ZGA A;  1HCR A;  2LD5 A;  5CJ9 A;  2DOF A;  1OMI A;  4B09 A;  1OQY A;  3VOD A;  1LJ9 A;  3U9G A;  2CW0 F;  1JJ8 C;  3WTX C;  1TW3 A;  3C3W A;  3AAF A;  5EEG A;  2VAS A;  3QPL A;  1S7A A;  3BQY A;  3H9G A;  4LG3 A;  1SVM A;  3O2P E;  4XLN F;  2Y69 H;  1D0Y A;  1T08 B;  3J81 K;  1V5G A;  1O4X A;  1Y56 A;  5JVG F;  2VOP A;  2RAE A;  1BL0 A;  3F8B A;  1P4X A;  2ID6 A;  4KJZ A;  3OYN A;  1IN6 A;  4II2 A;  5JVT A;  1O7F A;  2EIM H;  2VT2 A;  2X51 A;  4DBQ A;  5B3S H;  2K9S A;  3RPU A;  1TTY A;  2CMP A;  3DF8 A;  2ZXJ A;  2X48 A;  2BW3 A;  4F52 A;  2CQN A;  1YTY A;  1ZYR F;  1QPI A;  2NVX J;  2L9V A;  3OWT A;  3S1M J;  3CLQ A;  3MKL A;  3JCU C;  2M0M A;  2W00 A;  3KLN A;  2COB A;  3GFI A;  3E0J B;  5CLS A;  5HOD A;  3OS1 A;  2VBY A;  4BAY A;  1CQT A;  3DEE A;  5ICF A;  2ETH A;  3CJR B;  1Y0U A;  4XK4 A;  3E6B A;  1R9T J;  4E6K G;  4BE1 A;  4RAZ A;  3GX4 X;  1E3H A;  4D5C A;  5M3M J;  1YFH A;  3W3C A;  3CCR I;  1DGW Y;  2W4S A;  3BR3 A;  5C44 J;  1YYV A;  3RTR A;  2OC6 A;  1CGP A;  2ESN A;  1SVO A;  1K78 B;  4BE2 A;  4N9I A;  3P5J A;  5DD8 A;  5EZH A;  2ZJQ F;  3MEX A;  2LLK A;  2BEO A;  1ETK A;  2VXZ A;  4IHV A;  2NVT J;  4DGW B;  4EAT A;  3BTI A;  5D6E A;  4XBF A;  4N4O B;  3ONQ A;  4EGY A;  3QYF A;  1HKS A;  1QGP A;  3FHZ A;  1M1E B;  2ZCW A;  2VOO A;  3PQK A;  1TWF J;  3OL3 A;  3HTS B;  2FOW A;  2KT0 A;  1WSU A;  2KKO A;  3MZY A;  2L7F P;  5E3O A;  3PM1 A;  3OYM A;  2JPB A;  1UCR A;  4HF2 A;  1KQ8 A;  3HPG A;  1FPQ A;  4II3 A;  2ADU A;  1TT5 B;  4CDG A;  2Q2E A;  1R22 A;  5D5V B;  3FIS A;  1WJ5 A;  2ZBK A;  3RCO A;  4BHC A;  5J8F A;  1U6G A;  3RSN A;  3BPV A;  2CV0 A;  2A3S A;  3FMS A;  3A0B C;  3DBR B;  1ON1 A;  4IXA A;  4BUP A;  1R6R A;  4FX0 A;  1VQL I;  3I55 I;  1D0X A;  1B4A A;  4CYD A;  2BY0 A;  5LRR A;  2M7A A;  2IJL A;  2Q8K A;  4AVZ A;  4YRV A;  1X3U A;  1IZ1 A;  2QBY A;  3J7A Y;  2H1K A;  1VQP I;  1OCO H;  4XLH A;  4ZZL A;  1TWH J;  1DPU A;  3V8L A;  2EFP A;  5IP6 A;  2HYG D;  3QRF F;  2ZXW H;  2QM3 A;  1APL C;  1FSH A;  3SHF A;  4ZYD A;  2H27 A;  1OR7 A;  4XSX F;  4ENN A;  2DA5 A;  2BBY A;  1JKR C;  2CFO A;  4A0Y A;  3CCL I;  4GFB A;  3UR3 C;  2EJR A;  3FXJ A;  4X6A J;  1W36 D;  1ODD A;  1WHU A;  4F3Q A;  1XSX A;  2PMZ A;  5M3F J;  4FE7 A;  1EV7 A;  3UNG C;  4FIS A;  3TQN A;  1Z77 A;  2VXD A;  2VC1 A;  5HS7 A;  2MA3 A;  4B3X A;  4KMU X;  4BL0 B;  1ZGJ A;  1TWA J;  4RM3 A;  2E2H J;  2L9R A;  3CJN A;  3WTY C;  3SYT A;  2PFB A;  2IA1 A;  3HOW J;  1T39 A;  5BNG A;  5E18 F;  2Y75 A;  5CVR A;  1JJ6 C;  1B59 A;  2VKD A;  2MG4 A;  5DM6 F;  1VFC A;  3CDL A;  3WHC A;  5C4J J;  4NB5 A;  4A3F J;  4PJN A;  3IRQ A;  1GDT A;  3PFY A;  4M3E A;  2VOD A;  2HQR A;  2MH2 A;  3DU6 A;  4ASN A;  3CO6 C;  3KIO A;  3MKY B;  1LE8 A;  1ZN2 A;  1U8R A;  2E60 A;  2D1V A;  3I4P A;  5HS9 A;  2VJ4 A;  4IKF A;  4PGG A;  3ZQ7 A;  5CVI A;  3H92 A;  4G6T B;  2V6E A;  1U78 A;  2FNA A;  3W2A A;  2O5R A;  4XKB A;  2DN0 A;  4BDY A;  4MTE A;  1KU2 A;  1MBJ A;  3TDU C;  1MDM B;  1QU3 A;  2R7D A;  2BY3 A;  1X19 A;  3H0G J;  3K10 A;  2Z3Y A;  5HNF A;  2NS8 A;  3OS0 A;  3HUG A;  1A5J A;  4H4K C;  1BM9 A;  4B8X A;  1UG2 A;  5BQT A;  2IAI A;  5GPA A;  1IDY A;  1QO0 D;  5K7F A;  1XX5 A;  3ABT A;  4XKC A;  1A6I A;  3PFI A;  2EBI A;  1POG A;  1U5T A;  2Y9Y A;  2KHM A;  4V19 K;  4BKX A;  3KP2 A;  1DU0 A;  5F04 A;  3DU5 A;  1UEL B;  4HX7 A;  4J19 A;  5BS6 A;  1WZ2 A;  1BI1 A;  4ITV A;  2HI3 A;  1R4M B;  3QOD A;  3TOA A;  3WTW C;  2J5P A;  2DFH A;  1PP7 U;  2P6S A;  3KYD B;  3V42 A;  1PP8 F;  1FLI A;  3F3X A;  2F5F A;  2OV7 A;  5TGT A;  1FOY A;  1UST A;  4A5M A;  1ZLK A;  1H88 C;  3BG6 A;  1RR8 C;  2L2O A;  2L7Z A;  3JSO A;  2K9M A;  2FBH A;  1R1U A;  2M9H A;  2EA4 A;  4M6X A;  4Q48 A;  3PUB A;  1IN5 A;  1ZRF A;  2CQQ A;  1S5L C;  2XF7 A;  2FD5 A;  3C1D A;  2FX0 A;  2KRH A;  4XMY A;  4FE4 A;  3ZQI A;  2KZG A;  5IYB J;  1QRY A;  2EFW A;  3CF2 A;  2JTV A;  2OZ6 A;  4EJV A;  2MSY A;  2V26 A;  1TW2 A;  3LSH A;  4FT8 A;  2KP6 A;  2QKM B;  3BOQ A;  5CVV A;  1G8X A;  1SD5 A;  5D8K B;  2PLY A;  3QPH A;  2CYY A;  3K4J A;  3FM3 A;  3O8H A;  3T1B A;  2KZV A;  5K5R A;  5IPA A;  2JA7 J;  3K4N A;  1BOA A;  5GPC A;  2VJ5 A;  3VB2 A;  1PYV A;  5DD4 A;  2HYF A;  4CA0 A;  4HV5 A;  5BPI A;  3DTI A;  5FKL A;  3PO3 J;  1D1B A;  2Y0S A;  3DEW A;  4Y52 J;  2O03 A;  4OWR B;  2VC0 A;  4RAG A;  3GXO A;  4I0A A;  5EYR A;  3S1N J;  2JPC A;  1ZRC A;  2W7N A;  1G3Y A;  2F48 A;  1WGX A;  1WRJ A;  4QLC U;  4YFN F;  1H9G A;  3S1Q J;  4M6Y A;  2OUM A;  4MGR A;  1FIA A;  1LFU P;  4KIS A;  2R92 J;  4XLP F;  3N97 A;  4DOZ A;  1BI2 A;  3D5L A;  4AUX A;  4RGX A;  1TL8 A;  4XON A;  2M0C A;  2EB7 A;  4IF4 A;  3SJM A;  2RNJ A;  3FXL A;  4DJA A;  1ZKG A;  2GAU A;  5F0F A;  4CH7 A;  4UVC A;  3CDI A;  3K1N A;  2DDB A;  2CW8 A;  2CQX A;  4YII A;  5EG0 A;  2IS1 A;  4AU7 A;  2HFH A;  2BXZ A;  2EA2 A;  3JRD A;  2DTZ A;  2EIN H;  5GAH J;  3WHB A;  3BC8 A;  5HNH A;  1FYL A;  1OYI A;  2PN6 A;  3VOE A;  2DFE A;  3DWL E;  3KLO A;  4HOB A;  5EEH A;  5DYM A;  4HEA 2;  3HRM A;  2XRO A;  5E79 C;  3FK6 A;  1OCP A;  1QPM A;  2XAJ A;  3FF5 A;  2LBF B;  3JAM K;  1YIO A;  4OIR F;  2XSD C;  2PJR A;  4IZZ A;  3BY6 A;  1IDZ A;  2ELH A;  1I6X A;  2K5C A;  4C2T A;  1FWZ A;  3AL0 C;  1A6Q A;  4PK4 A;  1U3E M;  1QHG A;  4I99 C;  3LL7 A;  3LWF A;  3M1E A;  3QP5 A;  1MND A;  4IO9 F;  1HKQ A;  3IKT A;  5D8L B;  4FTH A;  1ENH A;  2MYS A;  1JKQ C;  2PG4 A;  3I56 I;  3RZO J;  1LFP A;  2Z5U A;  4BHB A;  1KU3 A;  1HXD A;  2R5Y B;  1BOB A;  2XHK A;  2QSF X;  3BG9 A;  4CZZ A;  5LEJ A;  5IT9 K;  4RM2 A;  2Z33 A;  3EET A;  2YU3 A;  3I64 A;  3OIP A;  3OOP A;  1E3P A;  2XF5 A;  3SFZ A;  2QQB A;  2NYX A;  4CCL A;  4WK8 F;  1CF7 B;  2JSC A;  1WFX A;  4ESF A;  1Z6T A;  3MZ8 A;  2JA6 J;  2Y9Z A;  2DBB A;  3CCS I;  5LGT A;  4B44 A;  2ELJ A;  3OYK A;  3H9J A;  3GFL A;  2CUE A;  5J40 A;  3ZPL A;  1IRZ A;  2BYV E;  3U1K A;  4CIC A;  1GXP A;  5M5X J;  3G73 A;  4CYC B;  2VKV A;  4UVB A;  4DW6 A;  1TBX A;  5FB2 A;  3GTQ J;  1V55 H;  5AIP A;  2V9V A;  2EZL A;  2F5C A;  2F6C A;  2NNY A;  2RC4 A;  4G6D A;  3FM5 A;  3AL0 B;  3CCM I;  1LDK B;  2DA1 A;  5BPD A;  1MNM C;  1V3F A;  1ZH5 A;  1Q1V A;  3LA7 A;  3HHG A;  4V2G A;  3JRG A;  4XLE A;  3FK7 A;  3FMR A;  4B3A A;  2G0E A;  5CVJ A;  2VN2 A;  1VQ8 I;  1LVA A;  5D6F A;  4BGD A;  1W36 C;  1O57 A;  3K4K A;  2BVL A;  2FA5 A;  1B72 B;  1IXC A;  2PMU A;  1VQ9 I;  2ZME A;  4XLF A;  5F08 A;  5M5Y J;  4C2M J;  2Y31 A;  2JWT A;  3HOT A;  3A02 A;  2VQH A;  9ANT A;  2IGM A;  3K7A J;  4I98 B;  2E1M B;  1OPC A;  3RPU D;  4PJJ A;  3KX2 A;  2E1O A;  1FNN A;  2E2I J;  2EIK H;  2HGC A;  3NWS A;  4M74 A;  4F7Z A;  1JI8 A;  2VUM J;  3KZY A;  4QPQ A;  3W2W A;  1JKP C;  3WGH A;  1WWX A;  2E2J J;  1JT0 A;  1NTC A;  2QQ8 A;  4IX7 A;  1IUY A;  1P6R A;  4HPQ A;  4XM3 A;  3IH2 A;  2LF7 A;  3JRA A;  3BJ6 A;  4A0X A;  4RS8 A;  2LC2 A;  1TQP A;  1R36 A;  3LSI A;  2OA4 A;  3GBG A;  4DYQ A;  4A3D J;  4L9N A;  3MCZ A;  5H6Q A;  3B6C A;  2M4G A;  5KCM A;  4AYB A;  2EZH A;  1YW9 A;  4MEX F;  4UUS B;  1T33 A;  3ASO H;  2LRD A;  3QWL A;  3ML6 A;  4YIR X;  3MZH A;  2WAD A;  5A2Q K;  4RA2 A;  5LD2 C;  3HL2 A;  1K6Y A;  3ZQH A;  3MFK A;  1B8I B;  1R5G A;  3HGG A;  4G6Q A;  3RI4 A;  1W0U A;  3K4B A;  3K70 D;  1E3O C;  5JFR A;  2KLO A;  2R7T A;  4GYI A;  1GVD A;  2ZFU A;  2X6X A;  1B9M A;  4F92 B;  2DU9 A;  4RB2 C;  2DLL A;  1JUM A;  2NVU B;  1MMN A;  4S0H B;  3M7G A;  2FJ1 A;  4EMS A;  3CCJ I;  1WQ2 A;  2LF8 A;  2TCT A;  4AIK A;  2LMD A;  5E8I A;  3TP3 A;  3R6S A;  5GAG J;  1DP3 A;  3DBL B;  1DDN A;  2H8W A;  2ZO4 A;  1VQ4 I;  4ON0 A;  1J2X A;  2YS9 A;  2BV6 A;  1ZLJ A;  3OYJ A;  5L3B A;  1ULY A;  3RKY A;  1BR4 A;  1Z0X A;  3JSP A;  5JHF A;  3PIO F;  1J7K A;  3I59 B;  3A01 B;  1BW6 A;  5FKK A;  3H3V K;  1OCR H;  3DBH B;  5ERI A;  4FQG A;  4ZTJ A;  5AON A;  1F4K A;  4KT6 A;  1XSD A;  4N9H A;  4AIH A;  1A36 A;  1QVU A;  2DCE A;  3ABU A;  5DTD A;  1X4P A;  5ICC A;  2JUC A;  5FKN A;  1X1B A;  3ZRG A;  3FBI B;  3HM5 A;  4NBQ A;  5IP7 J;  2DA2 A;  2R7Q A;  2JSP A;  3KET A;  4Y17 A;  3V8K A;  3GO5 A;  4S05 A;  1YG2 A;  3CCE I;  5LEK A;  3F8C A;  2ZXH A;  1FBU A;  2X6O A;  4AWX B;  5FO5 A;  1ONV A;  1R5I D;  1K78 A;  1BC8 C;  1ON2 A;  1YX3 A;  2ESH A;  2XAU A;  2STW A;  1AHD P;  2FQ3 A;  2E35 A;  4BQQ A;  3F8F A;  2R7X A;  3OSG A;  2DA3 A;  5TIS C;  1IN4 A;  4U0Y A;  2GZW A;  1EJ9 A;  2OF7 A;  2D1H A;  2WTE A;  3CLO A;  2E7W A;  3R61 A;  5E3M A;  1GV5 A;  1A35 A;  1WCM J;  3GWZ A;  4EM1 A;  1DQU A;  2FSW A;  3V7R A;  4EEF G;  2AS5 F;  3L2R A;  1FYM A;  2IS2 A;  3IP4 B;  3ROU A;  3CTA A;  1G2H A;  5EGO B;  2DMQ A;  1RR7 A;  2Z2S B;  2F4M B;  2YU9 J;  3KEO A;  1GUU A;  3GYH X;  2LVS A;  5EJC A;  1P7J A;  2HDW A;  2O7O A;  3HOY J;  2VI6 A;  3DV8 A;  2KRC A;  2DYR H;  1VF9 A;  4KA4 A;  3RKQ A;  3PNT A;  1GLN A;  3ASN H;  4IRI A;  3S2W A;  2XB5 A;  3IUO A;  2NS0 A;  4LJZ F;  4MHG A;  1Z9C A;  4LFU A;  2GQQ A;  4IHY A;  3VEP A;  1HW5 A;  2QGU A;  4E7H A;  3ZMS A;  2FF4 A;  1XDU A;  3RPQ A;  2QWW A;  1RNL A;  4WF2 A;  4P9F A;  2EZI A;  3H0D A;  4XIC A;  4Y4R A;  2HDD A;  3L00 A;  4RAF A;  4MIM A;  3HC7 A;  5BMZ A;  3OYH A;  1UB9 A;  1UMQ A;  2KDO A;  2R7R A;  1SEU A;  3NWT A;  4L5E A;  3TW6 A;  3V8J A;  3ZQC A;  1MGT A;  3O6B B;  5E1X A;  4HSR A;  1TT0 A;  2KIU A;  4EV0 A;  1SD7 A;  3BPX A;  2CV2 A;  3WTV C;  1YI2 I;  4AM3 A;  1MKM A;  4JK1 X;  3B6A A;  4BJ5 C;  1WH7 A;  1KQ0 A;  1QZZ A;  2I8D A;  3BTL A;  4TV7 A;  1J75 A;  4BXX J;  5IOY A;  2HOS A;  4RMN A;  2MBF A;  3R0A A;  3I5U A;  5E3N A;  4Y13 A;  3RIR A;  1SFX A;  4RGR A;  2NVQ J;  3HHH A;  2QYO A;  4CCJ A;  2L0K A;  4ZYH A;  3JTG A;  4ETS A;  1STZ A;  3WGI A;  2R7Z J;  3IH3 A;  3EUH A;  4B47 A;  3JRF A;  3J80 K;  2QQA A;  3BZC A;  4L0Y B;  1V5F A;  3AG2 H;  3HBL A;  2K7L A;  2XB0 X;  2F5E A;  4WX9 A;  1AWC A;  4DZP A;  2BVM A;  1D1C A;  1ZR4 A;  4XLC A;  4G9Y A;  1NH3 A;  2EFN A;  1VQK I;  4CCN A;  3ZN1 A;  2QKL B;  2FU4 A;  1KGS A;  2QF7 A;  5ED4 A;  2R4G A;  4L5I A;  1IRG A;  2WAQ N;  4A0Z A;  4JYK A;  1TLH B;  1XPX A;  4Y15 A;  1W5S A;  2B7E A;  4ENK A;  4IOA F;  3J7Y J;  2ZC2 A;  3D5R C;  1U2W A;  3OIQ A;  1Z3X A;  2A05 A;  2R7U A;  2VKH A;  1RES A;  4G7Z F;  3PJR A;  1MDM A;  3VFZ A;  2DOE A;  2X9D A;  1WJD A;  4ZTF A;  1OIS A;  3VDX A;  1Z21 A;  4NC7 A;  1OJL A;  3E1S A;  4LLL A;  4A3E J;  5J3L A;  3S3M A;  1FBQ A;  5H6R A;  5FFZ A;  3SEZ A;  2IGK A;  1I50 J;  3BR1 A;  3R60 A;  4Y7N J;  1QZY A;  3HSR A;  1N78 A;  1SMY F;  1FX7 A;  1OLT A;  1SAN A;  4E7Z A;  5KHD A;  2B63 J;  4FET A;  3HGY A;  4KYW A;  4YIF A;  4BNC A;  5CQE A;  2UV1 A;  2O3F A;  3SZG A;  4RB3 C;  1U9O A;  3KYL A;  1T0F C;  3GTP J;  3I3L A;  2EQR A;  2HDC A;  1XGM A;  2D2W A;  3ZQG A;  2R5Z A;  3WTT C;  3ECH A;  1IF1 A;  2EZK A;  2DT5 A;  3ZCO A;  3I4N J;  3VWB A;  3F8N A;  5CYV A;  5FLM J;  2MD5 A;  4EQQ A;  2HVR A;  2GA1 A;  3RJP A;  4RBO A;  3FXR A;  4IQJ A;  2FQ4 A;  1ETX A;  3BWG A;  1NK3 P;  4R1H A;  1HQC A;  2ZJ2 A;  2DXI A;  5EZG A;  2KDZ A;  4B1R A;  3FDY A;  2HOA A;  2H6C A;  3HRT A;  1Y1V J;  1LNW A;  3QPS A;  1O3R A;  2YR2 A;  1D5V A;  2JRT A;  2R93 J;  4U7B A;  1T8I A;  3H3U A;  2COM A;  4E4H A;  4QWQ A;  3BZK A;  5LHG A;  3NQO A;  2MGQ A;  5DCF A;  1AKH A;  1X1P A;  2BOL A;  1G3W A;  2CSO A;  1BN5 A;  3CO7 C;  4J01 A;  1I5Z A;  1XMA A;  3K70 C;  4NDL A;  2E5Z A;  1YRN A;  2P7C B;  2M4K A;  4FX4 A;  3ZN0 A;  4XRM A;  3ZMT A;  3CMM A;  2K3P A;  3NAR A;  1WVR A;  2RQP A;  3CC7 I;  4KDP A;  2E1N A;  1GHC A;  2JJ7 A;  3OYF A;  3Q3S A;  5FGM A;  2QA4 I;  4BAC A;  1F1Z A;  3HSE A;  4IL6 C;  3L2U A;  3DPL C;  3I9V 2;  2DA4 A;  3CCY A;  5L3E A;  3OYI A;  3DCF A;  2HVS A;  4OAY A;  1S72 I;  3SZT A;  3F23 A;  1FBS A;  1W7P A;  1WJC A;  4MLO A;  4D7N A;  1SMT A;  1HST A;  2DTR A;  1FTZ A;  1ETV A;  1WJB A;  2PMH A;  2EWN A;  3N05 A;  4A3K J;  1ITY A;  3GF2 A;  3L7W A;  4L18 B;  2I5U A;  2XV4 S;  3E5Q A;  2BHY A;  4I09 A;  1KZH A;  2FRH A;  1VQ7 I;  2VQC A;  3PSF A;  3LSR A;  1JHF A;  3MVP A;  5GTH C;  4XID A;  4M6V A;  2XRL A;  3K4L A;  3GME A;  1R49 A;  3HIF A;  2DQL A;  3SDG A;  1QZE A;  2X1D A;  3BG7 A;  1KQ9 A;  3DPU A;  1ZEL A;  4C30 A;  1C0W A;  3TGN A;  5DCM B;  1P2F A;  5DEQ A;  3I58 A;  1R4N B;  4N0B A;  1BR2 A;  4IOC F;  2JUG A;  3GCM A;  4CGZ A;  4XOR A;  5FRM A;  1OR7 C;  5JI6 A;  4CSW A;  4L9V A;  1LEA A;  4JX5 A;  1S3J A;  5F64 A;  2VPL A;  1OYW A;  3D0S A;  3RKW A;  4ZDO A;  3IV5 A;  2R5Y A;  1KYZ A;  3LQQ A;  3M8E A;  1K4S A;  5F0C A;  4XQF A;  2JA5 J;  1P92 A;  2GXB A;  3K2Z A;  5L3C A;  3CCV I;  2QZ8 A;  4HQM A;  4MFD A;  2K9N A;  3JRC A;  1TZL A;  4C3I J;  4FAS D;  2WV0 A;  5HLG A;  1REP C;  2X4H A;  3S2H J;  1CF7 A;  4KIG A;  4LIV A;  1ETW A;  2IS6 A;  4XSZ F;  2Q2E B;  4A3J J;  3GEZ A;  1VQO I;  1FP1 D;  2CW7 A;  1R58 A;  3CME I;  3HB9 A;  4A3C J;  4WXC A;  1Y0N A;  4A6E A;  4CO8 A;  3OMY A;  2O0Y A;  1XCV A;  4LB5 A;  3U2R A;  4Q4Z F;  4CYC A;  4HST A;  1F36 A;  3VYT B;  4XNF A;  2HTS A;  3C18 A;  3HJE A;  3CC4 I;  3E3V A;  5M5W J;  4YFK F;  1EH8 A;  2ZKZ A;  5IYC J;  2XPW A;  2GM4 A;  2XGE A;  3HKZ A;  2W82 A;  5J4V A;  2GOM A;  2X1C A;  2OU2 A;  1KON A;  5D4S A;  1SVL A;  2GXA A;  2A6H F;  3NRV A;  4ZJZ A;  1WKM A;  3A1Y A;  4O3M A;  4LOC A;  4IHT A;  2ZJP F;  2OAZ A;  3H35 A;  1LKX A;  3QAH A;  1RET A;  2DMT A;  2RN7 A;  3E6D A;  5E1W A;  3FHN A;  2P8T A;  3S16 J;  3ELK A;  4I7H A;  3DKW A;  1D8K A;  3U21 A;  1R00 A;  2V6C A;  3OSF A;  1J09 A;  1AU7 A;  1B72 A;  3Q0V A;  1ZK8 A;  1Z3Y A;  1ZTR A;  2LY9 A;  3IAS 2;  5FLX Z;  1JXS A;  3I71 A;  3LOC A;  4PUS A;  3L9F A;  4M9Z A;  1U5T C;  2L5Q A;  5K1Y A;  1IXS B;  4A93 J;  1WI3 A;  2GBY A;  1HDD C;  3D5S C;  4IPA A;  3FXM A;  1D8J A;  3GTM J;  1BA5 A;  2IBD A;  5KK1 A;  2FBI A;  3CD6 I;  1RI7 A;  3S17 J;  1V4R A;  4YEL A;  2BXY A;  2K85 A;  1FJL A;  2FOK A;  1UZC A;  2JRM A;  2OBP A;  4IRG A;  2DQR A;  4HAM A;  4UB8 C;  4XOP A;  4F93 B;  1BC7 C;  1X2N A;  1P7I A;  2A69 F;  4CZC A;  2WY7 Q;  3Q0U A;  1DP7 P;  3LNQ A;  3HG9 A;  4GGG A;  2OTL I;  1IN8 A;  3MWM A;  1JTY A;  4LB6 B;  5IY5 H;  4Q47 A;  2P4W A;  4F91 B;  2FXA A;  2HWV A;  3G71 I;  3K0L A;  1BJZ A;  3BCA A;  4KT5 C;  1I3A A;  3HRS A;  4UUS A;  3F72 A;  3FBN B;  1T95 A;  3ZQL A;  2FBK A;  2ELK A;  2H6B A;  2KJB A;  1YLF A;  4BY1 J;  3WTZ A;  1B8I A;  3BDD A;  2AO9 A;  1VI0 A;  3EPZ A;  2AHQ A;  3HRU A;  3WTS C;  2QVO A;  3ESW B;  1LFB A;  3N4M A;  2YUS A;  2KRF A;  2CUJ A;  4C9Y A;  2QUF A;  4U7D A;  2OZU A;  2M5W A;  3WE2 A;  3G1M A;  3ZOB A;  5L3F A;  1U5T B;  1G3S A;  5B1B H;  5EEA A;  1O3S A;  1Z67 A;  1G4D A;  2P5V A;  4OU0 A;  3LFU A;  3M8F A;  2DJN A;  3KEY A;  3T0Y A;  2N8G A;  3G1L A;  3ZMZ A;  2A68 F;  2R3S A;  1OCC H;  2PMZ N;  2X6W A;  3ERM A;  2VB6 A;  2CRG A;  1FMW A;  1Z6R A;  2CU7 A;  3C2G A;  3C2H A;  2K40 A;  1F5T A;  1MJA A;  1JUS A;  1Q1H A;  3Q0W A;  2I10 A;  4OOI A;  2JVG A;  1G6N A;  3I59 A;  4EJO A;  2OQG A;  2PBI A;  1Z7U A;  3A01 A;  3GW2 A;  2O6G E;  3AKZ A;  1SFE A;  1W4M A;  3ZMU A;  3RYR A;  2LTP A;  3LQR A;  2EH3 A;  3OYL A;  3PSI A;  2L4M A;  1ACI A;  2CO5 A;  3WOD F;  1J5Y A;  2CV1 A;  1ETY A;  2VPR A;  1K6O A;  4HV6 A;  3GTJ J;  5DM7 F;  1FP2 A;  1RPW A;  4PJL A;  1Y1W J;  1HLV A;  1IN7 A;  1GXQ A;  1ETQ A;  3J7A O;  4P9U A;  1N77 A;  3K69 A;  2DAO A;  2Z9O A;  1MBE A;  2CQK A;  2LP0 A;  2P7V B;  1V54 H;  5CVU A;  2DK5 A;  2X6Y A;  4M3B A;  2HOT A;  2LOO A;  1O3T A;  1R1T A;  4PGH A;  1Y8R B;  3GZ6 A;  2K9Q A;  4R8H A;  4KUM A;  1HC8 A;  5K5Q A;  1WI9 A;  2VLA A;  2D45 A;  2VQG A;  2IGO A;  2WV1 A;  4UV9 A;  3KYC B;  1XMK A;  5LGN A;  2LH9 A;  3C2B A;  1MH3 A;  2CH0 A;  2XRN A;  4A5N A;  1KYW A;  2GIZ A;  2PX9 A;  1Y8Q B;  3K1M A;  5C3E J;  3LST A;  2D5V A;  3CCU I;  3GVA A;  3WG9 A;  1FOK A;  3TO9 A;  1W0T A;  4PJ0 C;  1X58 A;  3BG5 A;  3BLY A;  1MMA A;  3DPT A;  4BU2 A;  1MH4 A;  3KZZ A;  1K4T A;  3FWE A;  2E1C A;  3VYR B;  1FOX A;  3HOU J;  3H5R A;  1FOW A;  5GP9 A;  2MH9 A;  3QOP A;  2FUG 2;  1YIT I;  4D5F A;  1NHA A;  4NHJ A;  1GV2 A;  2WAF A;  2ZFW A;  1R23 A;  2Z1D A;  4PZJ A;  2QSH X;  3A0H C;  5J8C A;  1NK2 P;  3DEU A;  2CG4 A;  4WWC A;  5IT3 A;  2ECC A;  1MBK A;  2P5K A;  4QPO A;  2YSR A;  1TP4 A;  1RRJ A;  4BEH A;  2V9K A;  1J0R A;  4QSH A;  5E20 A;  3KEQ A;  2OJE D;  1PUF A;  2IVM A;  1A04 A;  4IEJ A;  1BIB A;  1OKR A;  2DT7 B;  3W6V A;  1YJ9 I;  1QA6 A;  4OIP F;  1HKT A;  1IUF A;  2QEN A;  4HDU A;  5CQG A;  1PUE E;  2RKH A;  4M71 A;  3BZ6 A;  1IV8 A;  4EM2 A;  1FZP B;  3G3Z A;  3FXU A;  4I2O A;  2VKE A;  2WAE A;  4ZYE A;  3Q9V A;  1D0Z A;  3S3N A;  2IW5 A;  3HOV J;  2DK8 A;  1X1C A;  3QU3 A;  1SFK A;  1TWC J;  1BR1 A;  2M8G X;  3FKJ A;  1YW7 A;  2LFB A;  1FMV A;  4EJU A;  4LD5 A;  4BH9 A;  2HYJ A;  1UAA A;  3P9C A;  1E2X A;  1E0E A;  2XAQ A;  4RGU A;  4Y33 A;  1U8B A;  3O3K A;  2G7U A;  1MJB A;  5D5W B;  4RGS A;  4I6Z A;  1JUP A;  3DFG A;  2JA2 A;  2Y0S N;  5JR3 A;  3F6V A;  4XRS G;  2WB1 N;  3X2Q H;  2AQF A;  2E34 A;  2XPU A;  3J7Z I;  3E5X A;  3M9A A;  3CZ6 A;  4O6J A;  1JKO C;  1RKT A;  2XF6 A;  2UWM A;  2ZME C;  3QP6 A;  3GUD A;  4EVI A;  1VND A;  1O3Q A;  4U0V A;  2Y48 A;  4BXF A;  3J81 Z;  3S2D J;  4RDU A;  2C6Y A;  2P81 A;  2KFD A;  1MMD A;  2YX7 A;  2KL4 A;  3PQJ A;  3K1P A;  3SDB A;  1F9N A;  2A5W A;  5FRO A;  4HNU A;  2HNH A;  3WU1 B;  4X0G A;  2B0L A;  4XN3 A;  4KIC A;  4D7M A;  3ZGK A;  1OFC X;  3TED A;  2IA2 A;  3G2B A;  1XMX A;  3OYD A;  4EGZ A;  2YX4 A;  2M8E A;  1SFU A;  3ZR8 X;  2IRF G;  5EDN A;  4IHW A;  2YPR A;  3S93 A;  2GXG A;  3BR5 A;  2DJI A;  2E7X A;  4HQE A;  2M7B A;  3TW7 A;  2KMU A;  1R71 A;  3FKI J;  3CJT B;  1TQM A;  2K4J A;  3BCB A;  3ZQQ A;  4PSW A;  2NAZ A;  1T38 A;  4G12 A;  2XGD A;  2MAB A;  5LHH A;  2WC2 A;  2IT0 A;  3L09 A;  3HTU A;  1XC5 A;  2BZT A;  3OR2 C;  3HOX J;  2JK3 A;  2IP2 A;  3HSF A;  1T2K A;  2O9L A;  1H9T A;  2H1L A;  1EF4 A;  1D5Y A;  1E17 A;  1J59 A;  4D0P A;  5FJ8 J;  5HS8 A;  2IPQ X;  5F0H A;  1S8N A;  4MNU A;  3S14 J;  2DFF A;  3LAP A;  2W1O A;  2W84 A;  2MC4 A;  4OIN F;  3R0J A;  4HW0 A;  2AXL A;  2P6T A;  3KPH A;  1RIO H;  4EJT A;  1ZG3 A;  2M1B A;  2L3D A;  3GLX A;  3MN2 A;  2JT1 A;  4BJ6 C;  1T6S A;  1XDS A;  5E17 F;  1IJW C;  1NG7 A;  5F6F A;  3OYG A;  2XAH A;  1B6A A;  3T8R A;  2DO7 A;  4IHS A;  4A3M J;  3ZMD A;  2PEX A;  4KIB A;  3IKV A;  3T5X A;  5GTI C;  4NC8 A;  4XOT A;  2A5Y B;  2EV6 A;  2JVH A;  4M9X A;  2VJI A;  3I53 A;  4DZJ A;  3BP8 A;  1XD7 A;  3ABL H;  5FKM A;  3DLA A;  4BQO A;  5K7Z A;  4P5O A;  1I27 A;  1YX5 A;  1W7P D;  2XAG A;  2IS4 A;  2DPU A;  3RQI A;  5HLT A;  1LDD A;  5J1U A;  4B4C A;  5IOZ A;  1TNT A;  3LSK A;  3JRH A;  3MKZ A;  1UHS A;  2XVC A;  4I02 A;  1OYY A;  2XPV A;  5J6X A;  2ZSI B;  2EV5 A;  3IC7 A;  1WJA A;  3AG3 H;  2LNB A;  4JBA A;  5KAF C;  2QLZ A;  1MBG A;  4BS9 A;  4NQW B;  3FXK A;  3BTJ A;  3UKG A;  5LBQ A;  2CGP A;  3LSJ A;  5FKO A;  1HBX G;  3IL2 A;  1XTA A;  3QU6 A;  1QHH D;  1YO5 C;  3P9K A;  1HA8 A;  1BI0 A;  1T0F A;  3I0T A;  3MKW B;  3W6J B;  2EFO A;  1I6H J;  4DIQ A;  3BR6 A;  4LIT A;  2B9S A;  1R1V A;  4ZC3 A;  2CQ7 A;  1RUN A;  5DV5 A;  2EK5 A;  2HVQ A;  1Z1D A;  4HZF A;  3GTL J;  3ERE D;  3B02 A;  1YS7 A;  3LAJ A;  3MQ0 A;  1H0M A;  2NVY J;  4MEY F;  3Q5F A;  2LDU A;  3W6K B;  2ZJR F;  1BI3 A;  3RDI A;  2K86 A;  2RDP A;  4A12 A;  1Y39 A;  2NXN B;  1NG6 A;  1V5E A;  3F0C A;  1WH5 A;  4UXN A;  5KAI C;  5HOO A;  3G6E I;  4A2U A;  2JZY A;  3CP8 A;  5JLW A;  1LEB A;  4C3H J;  2MW8 A;  1OCT C;  2M87 A;  2ZNY A;  4M3F A;  2VIX A;  3K2A A;  3VSL A;  4AD9 A;  1SAU A;  2R0Q C;  4S04 A;  2Z99 A;  5KNL A;  4LMY A;  2VE9 A;  3CUQ C;  3IRR A;  2KIF A;  3FXO A;  4LG0 B;  4O5V A;  3E5U A;  2ACJ A;  3D1N I;  2XKO A;  3HDD A;  4JX6 A;  1KU7 A;  2FMY A;  3WTU C;  2HXI A;  2F2E A;  2EFQ A;  4Y3O A;  5JHU A;  2JN6 A;  2RQQ A;  4G7O F;  4AC0 A;  2LK2 A;  4BQA A;  4KN7 X;  2IXS A;  1ZGW A;  2L9S A;  5HDK A;  1DGR M;  4A3B J;  2E19 A;  5ILV A;  4OIQ F;  2VBX A;  1FIP A;  1VTN C;  2XDV A;  1K61 A;  2GA2 A;  4PFP A;  5DCM A;  3TP0 A;  1HW1 A;  4HBL A;  2DI3 A;  4AYB N;  3JRI A;  4HLY A;  4KNY A;  1ORK A;  3P9I A;  3JRE A;  3ULQ B;  4W97 A;  4BBS J;  3CQZ J;  2Y30 A;  1PJR A;  4V2F A;  1ZG5 A;  3IAM 2;  2RGV A;  5E8G A;  2F4I A;  4D1Q A;  4QTR A;  2M3A A;  4XR6 A;  3SFI A;  5F1J A;  3BJO A;  1X3W B;  4AIJ A;  2J5O A;  2DOD A;  3CUQ B;  2HR3 A;  2H94 A;  2XGC A;  3ABK H;  4RAY A;  1I1G A;  2K27 A;  4AID A;  2A6E F;  3EUH C;  3K4C A;  1XN7 A;  1EH7 A;  5DS9 A;  2NS7 A;  3ZMV A;  1S7O A;  2RRE A;  4I76 A;  4WCG A;  1QQI A;  1Y6I A;  2HTJ A;  3PIP F;  1JTX A;  3PL8 A;  3GTO J;  1IV6 A;  2DA6 A;  1MJ9 A;  4MQV A;  2OCC H;  1IW7 F;  1F43 A;  3H5A A;  4UNO A;  4EM0 B;  3LA3 A;  2HKX A;  1YHQ I;  2LSO A;  3CP2 A;  5H2F C;  3V4G A;  2XKP A;  3BR2 A;  2HQ5 A;  2PQ8 A;  2EIJ H;  5D5U B;  2LKS A;  2V9P A;  4ZDL A;  2ISZ A;  1B1B A;  1BW5 A;  4RB1 A;  4JX4 A;  3WU2 C;  3O8G A;  3VPR A;  5D5X B;  1UHW A;  2OQR A;  4M3D A;  4F55 A;  4E7I A;  2OPT A;  1AOY A;  2XAF A;  4NNJ A;  3S15 J;  2HPM A;  3Q9S A;  2GOX B;  4GRI A;  4I0B A;  4HYE A;  1ERD A;  4IQ4 A;  3KFW X;  3E7L A;  1XSV A;  2BW3 B;  2OTJ I;  2PJP A;  3V7C A;  2ME6 A;  1EH6 A;  3QYB A;  3DQV C;  1FT9 A;  1R7J A;  3BT9 A;  3OYB A;  2O61 A;  5J1R A;  2NOG A;  2KPM A;  3KE2 A;  3GFM A;  3OL4 A;  4XKV A;  4H0E A;  1FTT A;  2ICW G;  2A61 A;  3DXJ F;  2MLG A;  4XN0 A;  4ZYA A;  5FRN A;  1VQN I;  4E7L A;  4OMZ A;  3OS2 A;  2F4O B;  2HEO A;  4OAZ A;  2GWR A;  1S9H A;  3OY9 A;  1MBH A;  4HNT A;  4GYG A;  2DW4 A;  5LFA A;  2Y2Z A;  2UZK A;  2QCO A;  3HEF A;  2LBF A;  5E1Z B;  5B66 C;  2IEK A;  1ZAR A;  3EUK L;  4BE0 A;  3TBI A;  1L0O C;  1LB2 A;  3M8J A;  4B43 A;  4KIT B;  2L02 A;  2V7F A;  1N25 A;  5HLI A;  5ILS A;  4N4N B;  1XGN A;  2IGN A;  1TNS A;  1DPR A;  1ETO A;  5GAE J;  3LSP A;  3QYE A;  5JLX A;  4L5J A;  3VYU B;  3PNY A;  3BQZ A;  2NOJ B;  5IYD J;  2TRT A;  3M3Y J;  2MC3 A;  1TC3 C;  5CKT A;  4KMF A;  4GXO A;  3L1P A;  1RKW A;  4UY8 I;  2AXT C;  3V7S A;  2HQN A;  2H09 A;  3OYC A;  3RYP A;  4YEJ A;  2ZSH B;  4W1U A;  3AG4 H;  3MMY B;  1VQM I;  1S29 A;  1USS A;  2QEX I;  1MIJ A;  3K4M A;  3PO2 J;  3JAM Z;  2RNG A; 
#chains in the Genus database with same CATH homology
 2NVT J;  3A01 A;  5IP9 J;  3BTI A;  2LTP A;  4A69 C;  5J1Y A;  2EH3 A;  2X6O A;  1HOM A;  5F27 A;  2H8R A;  1ETY A;  1TWF J;  2VPR A;  4DYR A;  4C3J J;  2R5Z B;  3GTJ J;  1AHD P;  2KT0 A;  1RPW A;  1Y1W J;  1HLV A;  1ETQ A;  2L7F P;  3PM1 A;  5E3O A;  3OSG A;  2DA3 A;  1MBE A;  2LP0 A;  3A03 A;  2OF7 A;  2W48 A;  5E3M A;  1GV5 A;  4M3B A;  3FIS A;  1WCM J;  2HOT A;  4EEF G;  2HXO A;  2K9Q A;  4A3I J;  1G2H A;  5EGO B;  2DMQ A;  1RR7 A;  2YU9 J;  3BR0 A;  1GUU A;  2WV1 A;  2LVS A;  3C2B A;  1P7J A;  1MH3 A;  2O7O A;  3HOY J;  2VI6 A;  1H8A C;  3RKQ A;  1VF9 A;  2H1K A;  5C3E J;  2D5V A;  1X2M A;  4FCY A;  1W0T A;  2XB5 A;  1TWH J;  1X58 A;  5IP6 A;  3BG5 A;  1APL C;  3NAU A;  1MSE C;  4IHY A;  1MH4 A;  1JT6 A;  1AKH B;  3FIW A;  3IH4 A;  2DA5 A;  3HOU J;  1JKR C;  4GFB A;  2EZI A;  2JA8 J;  4XIC A;  5GP9 A;  4X6A J;  2HDD A;  4D5F A;  1YRN B;  2DMU A;  1GV2 A;  5M3F J;  1MSF C;  4MIM A;  4FE7 A;  4FIS A;  1UMQ A;  4ABZ A;  1Z77 A;  1NK2 P;  4L5E A;  3TW6 A;  3GTK J;  2ECC A;  1MBK A;  1TWA J;  1LE8 B;  3ZQC A;  2E2H J;  2L9R A;  1HDP A;  3HOW J;  5BNG A;  4QSH A;  1JJ6 C;  3B6A A;  1WH7 A;  1PUF A;  3BTL A;  4IEJ A;  2MG4 A;  5IOY A;  1VFC A;  4BXX J;  4A3L J;  3CDL A;  3WHC A;  5C4J J;  3W6V A;  2HOS A;  4A3F J;  1GDT A;  1IUF A;  4M3E A;  5E3N A;  1LE8 A;  2NVQ J;  3LSG A;  1MBF A;  1T56 A;  2L0K A;  2VKE A;  2CJJ A;  2R7Z J;  2ME0 A;  3IH3 A;  3HOV J;  3JRF A;  1TWC J;  2M8G X;  3OIO A;  3S1R J;  2LFB A;  3HBL A;  2XB0 X;  3M4O J;  2HYJ A;  4M3G A;  4DZP A;  1U78 A;  1ZR4 A;  1U8B A;  2DN0 A;  1MBJ A;  4I6Z A;  1JUP A;  2QF7 A;  5E3L A;  3H0G J;  2Y0S N;  2WAQ N;  2NS8 A;  1A5J A;  4JYK A;  4XRS G;  2WB1 N;  2XPU A;  1UG2 A;  2IAI A;  1JKO C;  1XS9 A;  1RKT A;  5GPA A;  1IDY A;  5K7F A;  5EF6 A;  1I3Q J;  1A6I A;  1VND A;  2EBI A;  3S2D J;  1RES A;  1POG A;  2Y9Y A;  4RDU A;  4BKX A;  2P81 A;  2X9D A;  1DU0 A;  5F04 A;  1IC8 A;  1OJL A;  4J19 A;  4A3E J;  2ID3 A;  5J3L A;  2HI3 A;  4D7M A;  1I50 J;  1OFC X;  3BR1 A;  3TED A;  2GLO A;  4Y7N J;  3QQA A;  1SAN A;  5EDN A;  4IHW A;  1XG1 A;  3BR5 A;  2B63 J;  3HGY A;  4MO7 A;  3TW7 A;  3I4M J;  3FKI J;  2DMP A;  1H88 C;  4G12 A;  1U9O A;  2XGD A;  4DYC A;  1HF0 A;  3GTP J;  2L7Z A;  1H89 C;  2M9H A;  3CMY A;  1XC5 A;  3HOX J;  2JK3 A;  2EQR A;  2CQQ A;  3ZQG A;  2O9L A;  2FD5 A;  1D5Y A;  1EF4 A;  2R5Z A;  4BBR J;  3OOU A;  5FJ8 J;  2FX0 A;  4QIW N;  2DMN A;  2EZK A;  4FE4 A;  3ZQI A;  5F0H A;  5IYB J;  3S14 J;  1QRY A;  3I4N J;  3G1O A;  2MSY A;  5FLM J;  3MN2 A;  4RBO A;  2FQ4 A;  1ETX A;  2LR8 A;  1NK3 P;  4XRS A;  1QVT A;  5EGO A;  1IJW C;  3O8H A;  5EZG A;  2KDZ A;  4B1R A;  5IPA A;  4A3M J;  2HOA A;  2JA7 J;  5GPC A;  1Y1V J;  4DZJ A;  3QPS A;  3PO3 J;  2L7M P;  5FKL A;  1S7E A;  3DEW A;  4UUT A;  5FKM A;  2R93 J;  4Y52 J;  5EYR A;  3S1N J;  3RZD J;  1WGX A;  5K7Z A;  4BY7 J;  3RQI A;  2MGQ A;  5J1U A;  5EG0 B;  1AKH A;  3S1Q J;  1IG7 A;  4A3G J;  4B4C A;  5IOZ A;  1LFU P;  1FIA A;  2R92 J;  4X1E A;  3JRH A;  4AUX A;  1UHS A;  1GT0 C;  2M0C A;  2XPV A;  3SJM A;  4NDL A;  1YRN A;  4MFE A;  1ZKG A;  5F0F A;  4XRM A;  1MBG A;  3BG3 A;  3BTJ A;  3UKG A;  2CQX A;  3LSJ A;  5FKO A;  3NAR A;  5EG0 A;  3JRD A;  2DTZ A;  3WHB A;  2JJ7 A;  1I6H J;  1K83 J;  3BR6 A;  3Q3S A;  5FLV A;  2DA4 A;  3CCY A;  3GTL J;  3DCF A;  4MLO A;  4D7N A;  3FK6 A;  1OCP A;  2NVY J;  1ETV A;  1FTZ A;  2ZB9 A;  4JP0 A;  4A3K J;  3HKZ N;  1ZR2 A;  2XSD C;  1ITY A;  1U9N A;  1IDZ A;  4IHX A;  1FEX A;  3F0C A;  1WH5 A;  3LSR A;  3MVP A;  4XID A;  4M6V A;  2XRL A;  4FTH A;  1ENH A;  1TWG J;  5JLW A;  1SFO J;  1JKQ C;  4C3H J;  2MW8 A;  3SDG A;  1OCT C;  3RZO J;  4M3F A;  2R0Q C;  3K2A A;  2R5Y B;  3BG9 A;  3ZQF A;  2ECB A;  1JGG A;  3BTC A;  3D1N I;  3HDD A;  4JX6 A;  2HXI A;  3HOZ J;  2JN6 A;  4AC0 A;  2LK2 A;  2Y9Z A;  4JX5 A;  2JA6 J;  1ZGW A;  3IV5 A;  2R5Y A;  2CUE A;  4A3B J;  2E19 A;  2M2E A;  5F0C A;  1IRZ A;  2JA5 J;  1FIP A;  1ZQ3 P;  1K61 A;  4MFD A;  2K9N A;  3JRC A;  3TP0 A;  4C3I J;  5M5X J;  4CYC B;  2VKV A;  4AYB N;  3S2H J;  4DW6 A;  3JRI A;  1ETW A;  1ORK A;  3GTQ J;  3JR9 A;  4A3J J;  2EZL A;  3JRE A;  3HB9 A;  4A3C J;  2M34 A;  2DA1 A;  4W97 A;  4BBS J;  1IGN A;  1MNM C;  3CQZ J;  2Y30 A;  4V2F A;  2JMW A;  4CYC A;  1Q1V A;  1F36 A;  4QTR A;  4V2G A;  3JRG A;  3SFI A;  5M5W J;  3FK7 A;  5F1J A;  5IYC J;  4B3A A;  2XPW A;  2GM4 A;  2XGE A;  2G0E A;  3JRB A;  2XGC A;  2DA7 A;  5DS9 A;  2NS7 A;  1B72 B;  4LOC A;  4I76 A;  5F08 A;  5M5Y J;  4C2M J;  1JTX A;  2O8K A;  1RET A;  3GTO J;  1IV6 A;  2Y31 A;  2DMT A;  2DA6 A;  2JWT A;  2LKX A;  1F43 A;  3GTG J;  1DU6 A;  5C4X J;  3A02 A;  3S16 J;  2CUF A;  9ANT A;  3K7A J;  3OSF A;  1WPK A;  1AU7 A;  1B72 A;  3Q0V A;  1ZK8 A;  3BR2 A;  1ZTR A;  2LY9 A;  2E1O A;  2HQ5 A;  2E2I J;  5K7H A;  4HNV A;  2VUM J;  1BW5 A;  3LOC A;  4JX4 A;  3O8G A;  1JKP C;  4A93 J;  1WI3 A;  2GBY A;  1HDD C;  2E2J J;  1JT0 A;  3VPR A;  1PUF B;  1NTC A;  4M3D A;  2OPT A;  2LD5 A;  1HCR A;  3S15 J;  3IH2 A;  3JRA A;  3GTM J;  1BA5 A;  2IBD A;  3S17 J;  1JJ8 C;  3GBG A;  4DYQ A;  3E7L A;  1FJL A;  3QPL A;  4A3D J;  3B6C A;  3BQY A;  2EZH A;  4UUS B;  2ME6 A;  1T33 A;  1X2N A;  1O4X A;  1P7I A;  3BT9 A;  2RAE A;  1BL0 A;  5J1R A;  2ID6 A;  2NOG A;  3Q0U A;  3ZQH A;  3LNQ A;  1B8I B;  3HGG A;  1W0U A;  1FTT A;  1JTY A;  1E3O C;  2K9S A;  1GVD A;  1BJZ A;  2X48 A;  4UUS A;  1JUM A;  1MBH A;  4S0H B;  1QPI A;  2Y2Z A;  2NVX J;  2FJ1 A;  3ZQL A;  3S1M J;  2ELK A;  2QCO A;  2TCT A;  3MKL A;  3HEF A;  4BY1 J;  2IEK A;  1B8I A;  3TP3 A;  2AO9 A;  1VI0 A;  2AHQ A;  2COB A;  5HOD A;  1LFB A;  2YUS A;  1CQT A;  3G1M A;  2YS9 A;  3ZOB A;  5EEA A;  4XK4 A;  3LSP A;  1ETO A;  1R9T J;  5JLX A;  1Z0X A;  3BQZ A;  4D5C A;  5IYD J;  5M3M J;  2TRT A;  3M3Y J;  3A01 B;  1BW6 A;  2DJN A;  5FKK A;  1TC3 C;  3H3V K;  3BR3 A;  2N8G A;  1RKW A;  3G1L A;  3L1P A;  5C44 J;  2PMZ N;  2CRG A;  4W1U A;  1QVU A;  5DTD A;  2CU7 A;  5FKN A;  2K40 A;  3HM5 A;  1JUS A;  5EZH A;  3PO2 J;  3Q0W A;  2I10 A;  5IP7 J;  2DA2 A;  2LLK A;  1ETK A;  4IHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...