1GVDA

Crystal structure of c-myb r2 v103l mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
molecule tags Transcription
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2002-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gvdA00
1MSEC 2WAQN 3G1MA 1WGXA 2HXIA 3JRHA 1XG1A 1U8BA 3LNQA 2H1KA 4BXXJ 2HOTA 2HI3A 2KDZA 5GPAA 4A3MJ 3JRDA 2YS9A 4C3JJ 1U9NA 5F1JA 5IYCJ 3LSPA 1P7IA 4C3HJ 3CDLA 2NVQJ 3PO2J 1T56A 4DW6A 1DU0A 1WI3A 3W6VA 1IV6A 1I3QJ 4LOCA 2EZHA 3JRBA 1ZK8A 3OIOA 2DN0A 4UUSA 1APLC 2Y9ZA 2Y2ZA 2ELKA 2K9NA 3DEWA 1TWHJ 2DA5A 2NVTJ 1TWFJ 3IH3A 4XRSG 2TRTA 1MH3A 3RZOJ 2YUSA 4M6VA 2L7MP 1WPKA 3RQIA 1MNMC 3MKLA 3JRCA 2LP0A 5C3EJ 4AYBN 5K7ZA 2NVXJ 4FE4A 5F08A 4I6ZA 1NTCA 3BQYA 3QPSA 3VPRA 1AU7A 1U9OA 2AHQA 1X2NA 1OJLA 4DYCA 3I4MJ 1FIAA 1GUUA 2KT0A 1RETA 3K2AA 2Y31A 1VNDA 3GBGA 1POGA 2LKXA 4B4CA 1W0TA 1ZKGA 2VPRA 4X1EA 1WH5A 2R93J 5J1UA 4A3LJ 4MFEA 4MO7A 2XPUA 2DMPA 1ENHA 1F36A 1JT0A 1QVTA 3BG3A 3S14J 5IYDJ 3ZOBA 1W0UA 2B63J 1IGNA 2NVYJ 3JREA 2EBIA 1JUSA 4QIWN 2DA7A 4ABZA 2X48A 2LK2A 3QPLA 4Y7NJ 1G2HA 2GM4A 2OF7A 1LFUP 5FKKA 2HDDA 2NS7A 3HGGA 1O4XA 1HOMA 4Y52J 2XPWA 2CJJA 1JTXA 3TP0A 4FE7A 1IJWC 3A02A 4G12A 1Q1VA 3HM5A 1MBGA 1ZGWA 3BR1A 4A3GJ 2MGQA 3FK7A 1GV5A 1ETVA 2DMTA 3BR2A 2ME0A 3WHBA 4UUTA 1QRYA 3S1QJ 2X9DA 2CQXA 1QPIA 1R9TJ 4A3DJ 2ID6A 3G1LA 2XSDC 1JGGA 4B3AA 3S2DJ 3GTPJ 2FQ4A 2M34A 3LSRA 2HOAA 4V2GA 1CQTA 2M2EA 1LFBA 2COBA 5EZGA 2JA7J 2JWTA 2JN6A 3HDDA 4IHXA 1ZTRA 2QF7A 2RAEA 4C3IJ 2HXOA 1ETYA 5BNGA 4XICA 3TP3A 1JKQC 2XGDA 4W1UA 5FKLA 3OSGA 1X58A 4M3BA 4DZJA 5M3FJ 2DMQA 4X6AJ 2WB1N 5F0HA 5FKNA 5JLWA 1H88C 2M0CA 1IG7A 3B6CA 1H89C 1UHSA 3RZDJ 1X2MA 2R5YB 1GV2A 2DA6A 3BR6A 1GT0C 1LE8B 1JJ8C 4M3GA 2ME6A 9ANTA 2DJNA 2ID3A 2CUEA 1RESA 4JYKA 2ECBA 2L7ZA 3ZQHA 5EG0B 3LSJA 5K7FA 5FJ8J 1OCTC 2EZKA 3SDGA 2LFBA 1I50J 2WV1A 3UKGA 5K7HA 3O8HA 4MIMA 4BY1J 5DS9A 5F0CA 5C44J 4M3EA 2DMNA 1GVDA 2DA3A 2DTZA 1RKWA 3MN2A 2MW8A 1VFCA 3BTLA 3TW7A 2R5ZB 3FKIJ 4XRMA 3ZQCA 5IPAA 4FTHA 1JJ6C 1FIPA 1ETOA 2NOGA 2XRLA 1I6HJ 5GP9A 2CUFA 3PM1A 2FJ1A 1HF0A 2ECCA 1ZR2A 2R5YA 3E7LA 1QVUA 4A93J 1LE8A 3Q3SA 4M3DA 3CMYA 3MVPA 3TW6A 2O9LA 4A3IJ 1TWCJ 5EG0A 1UG2A 2DA4A 3ZQLA 1HDPA 2LR8A 3FISA 2CRGA 2NS8A 1BW5A 2Y0SN 2LY9A 2VI6A 3ZQIA 2DMUA 1FTTA 1A5JA 1FTZA 1F43A 1T33A 1OCPA 1IUFA 4RDUA 3M3YJ 2R5ZA 2EZLA 2EZIA 1E3OC 1XC5A 2K9SA 1ETKA 2AO9A 3BQZA 1JKOC 2EH3A 2VKVA 5C4XJ 3L1PA 2GLOA 3BTCA 1BW6A 2H8RA 3GTJJ 1DU6A 3ZQGA 1IC8A 2HOSA 3K7AJ 2HYJA 5IP9J 4IHWA 3CQZJ 3BT9A 4M3FA 4AC0A 1ZQ3P 2R7ZJ 4A3BJ 3C2BA 2TCTA 1BA5A 3BG5A 3IV5A 3Q0VA 1FJLA 5J3LA 2M9HA 2O8KA 5E3MA 3A01B 3H3VK 1PUFB 1TC3C 4D5FA 5GPCA 5EEAA 2HQ5A 5EZHA 5IP7J 2Y30A 4JX5A 1ETXA 1HDDC 2E2IJ 3RKQA 1RKTA 1RPWA 5J1RA 5C4JJ 2FD5A 3HB9A 1B72B 3NAUA 2R92J 1K61A 2I10A 2L0KA 2JA5J 2G0EA 4A3CJ 3A03A 3HBLA 1BJZA 5E3NA 3PO3J 2L9RA 2W48A 3JRAA 1ETWA 2JA8J 1ITYA 2M8GX 1B8IB 2ZB9A 3OSFA 5F0FA 1SFOJ 1HLVA 2K40A 4XK4A 5E3LA 4JP0A 4D7NA 4XIDA 3FK6A 4QTRA 1Y1WJ 5DTDA 1Z77A 3A01A 3DCFA 1PUFA 1BL0A 3S15J 3IH2A 3HKZN 2Y9YA 3CCYA 5FKOA 1GDTA 2O7OA 4V2FA 1K83J 1ZR4A 4NDLA 5IYBJ 3GTLJ 2LVSA 1MBFA 1WCMJ 1B72A 2DA1A 3JRFA 3JRGA 3HOUJ 5EYRA 3S17J 4DYQA 4FISA 4JX4A 3O8GA 1VI0A 1YRNB 2D5VA 1TWGJ 1S7EA 5EGOB 4BBSJ 2P81A 1AHDP 1UMQA 1B8IA 5IOYA 1HCRA 5HODA 1MBHA 1FEXA 3S2HJ 2JA6J 4A69C 3GTOJ 1TWAJ 1Z0XA 4DYRA 4CYCB 2QCOA 2CQQA 4J19A 3BR0A 4B1RA 2N8GA 2PMZN 2MSYA 5F27A 2E1OA 4IHYA 1EF4A 4BBRJ 3SJMA 4IHVA 1WH7A 5IP6A 2E19A 1MSFC 2E2HJ 2LTPA 5EDNA 3HEFA 2XPVA 3BR3A 2EQRA 3BTIA 4IEJA 3GTQJ 1IRZA 1OFCX 1U78A 4MLOA 3IH4A 1JKPC 3S1RJ 2LLKA 1YRNA 5EGOA 1NK2P 5M5XJ 5E3OA 1JKRC 4W97A 2JMWA 1JTYA 1D5YA 4C2MJ 5EF6A 3JRIA 1JUMA 3G1OA 1NK3P 3BTJA 3H0GJ 4XRSA 3JR9A 4BY7J 3FIWA 4L5EA 3B6AA 1IDYA 4CYCA 2JJ7A 4A3JJ 3Q0WA 2XGEA 4I76A 3M4OJ 3BG9A 3HOXJ 2GBYA 1AKHB 4HNVA 1JT6A 4MFDA 4DZPA 3LSGA 4EEFG 1MBJA 2DA2A 2CU7A 4RBOA 3TEDA 3BR5A 5M5YJ 2OPTA 2E2JJ 4AUXA 3S16J 1A6IA 2R0QC 5M5WJ 3Q0UA 3GTGJ 1RR7A 2IAIA 1MH4A 3OOUA 5JLXA 4FCYA 4QSHA 2L7FP 1H8AC 3S1NJ 3HOWJ 5M3MJ 3F0CA 3GTMJ 5FLVA 4A3EJ 2XGCA 4JX6A 1JUPA 4A3FJ 1ORKA 1VF9A 3SFIA 4GFBA 1MBKA 1MBEA 5J1YA 2K9QA 2XB5A 3D1NI 3GTKJ 2YU9J 3NARA 5F04A 2X6OA 1ETQA 3LOCA 2VKEA 5FKMA 4D5CA 1XS9A 2XB0X 1AKHA 3HOVJ 3ZQFA 2IBDA 3HOYJ 2LD5A 3WHCA 4UUSB 4BKXA 1IDZA 3I4NJ 3QQAA 3S1MJ 3HGYA 4S0HB 5FLMJ 4D7MA 2MG4A 1Y1VJ 5IOZA 3HOZJ 1SANA 2IEKA 2JK3A 2FX0A 1P7JA 2VUMJ 4A3KJ
chains in the Genus database with same CATH superfamily
3PL8A 1MJ9A 4XN0A 3I53A 2BY0A 4IOCF 2HI3A 4A3MJ 2PI0A 2EFQA 2VQLA 2XVCA 1GHCA 5LHHA 3REOA 2HTJA 1MGTA 4G94A 4C3JJ 1U9NA 5IYCJ 3LSPA 5JVGF 1S72I 2V1UA 3CDLA 3H1CA 3COAC 3KEQA 1T56A 3ZN0A 5DDGA 3AL0B 3KPHA 1Z6TA 3E6BA 1WI3A 3W6VA 1PUEE 2FNAA 1MDMA 1I3QJ 2IS6A 2ZJ2A 1XGOA 1TQIA 4XKCA 3ISPA 4HBLA 2E35A 2CWEA 4P1WA 2VKDA 3PIPF 3CUQC 1T6SA 2OZ6A 2DA5A 1G3TA 1TWFJ 3CJQB 1FMVA 2L7MP 2VODA 2ZXHA 2LSOA 1MNMC 2IGKA 4E7SA 3JRCA 4BYYA 3K6GA 4HQMA 4B48A 3OMYA 3MWMA 3X2QH 4FE4A 2UWMA 1U9OA 1ZREA 3I4MJ 5GAGJ 4BQAA 2QGUA 1GUUA 2KT0A 1KQ0A 4RS8A 2BY1A 3LQQA 2EV6A 2EIKH 2FQ3A 2FRHA 4Y17A 2EV0A 2ZNZA 4GYGA 4HDUA 4BNCA 1WH5A 2FXAA 3RPQA 4NQWB 3VSLA 1R5GA 4YEJA 2XAFA 4MFEA 1PP7U 1YJWI 3F21A 3F8MA 4DNCA 1ENHA 3GZNB 2DO7A 2DK8A 3BG3A 5IYDJ 3ZOBA 1SD6A 2M0MA 2UZKA 3FZVA 5LLQA 4EJTA 2NVYJ 4EJUA 3JREA 1S7OA 3F8FA 3ABMH 4LG3A 4KT6A 3ROUA 2DA7A 4AU7A 4LK1F 4Y7NJ 3WTTC 1J75A 3K70C 5LGNA 2HDDA 3CZ6A 2GIZA 3KP6A 4RM3A 5D4SA 2CV1A 2DU9A 2XPWA 4PJNA 5B1BH 4P55A 3TP0A 4FE7A 3W6JB 1IJWC 3A02A 4EM2A 1Q1VA 1KQ8A 1EH6A 1RZ4A 1MBGA 3EUKL 3QU6A 2R7XA 2MGQA 1J9IA 1VQOI 2J5PA 4TV7A 1OKRA 2LNBA 3RPUD 2ME0A 4UUTA 1Y39A 4HNUA 4NQWA 3HOSA 1FX7A 3EYYA 5AIQA 1NG6A 3ECOA 2A6TA 3C3WA 1JGGA 4B8XA 2X4HA 2TDXA 2Y69H 3S2DJ 2LRDA 1VZ0A 4EM1A 4F7ZA 3NRVA 3L2CA 1XGSA 3OYGA 3G6EI 2M7BA 3FBIB 2R7SA 3VYRB 5E79C 2XKOA 5DD4A 4F93B 2JN6A 3LAPA 3CMEI 4AIJA 3HDDA 1ZTRA 1FC3A 1P2FA 2QF7A 3ZRGA 5K5QA 3KP4A 2DPDA 2EFOA 1ETYA 5BNGA 4AD9A 1YFHA 3KP5A 2FOWA 2IS1A 2HWVA 5B5EC 3MZ8A 4G6QA 1TP4A 3W2WA 2DI3A 2WY7Q 2WB1N 3MAJA 2OAZA 3B6CA 1B9NA 5GAHJ 2H94A 4WXHA 3RZDJ 2Y75A 1GV2A 4UB8C 5ERIA 4M3GA 2CH0A 2IRFG 4PJLA 3K0LA 3AAFA 1BIBA 2RDPA 2ZMEB 2QEXI 3K4MA 2QENA 1I6XA 4UUVA 1HKTA 2CUEA 2VJJA 2Z99A 5LRSA 4I99C 5EG0B 1DP7P 3OYIA 3H9QA 1ZG5A 2I5UA 3HSEA 2M4GA 2VXDA 3S2WA 1I50J 1TBXA 4XOTA 3O8HA 3WTSC 3CUOA 2K86A 1ZG3A 3F3XA 3HOYJ 2XKPA 5JVTA 4G6TB 2Z16A 2LG4A 3MN2A 1QZYA 4CH7A 2E34A 3BTLA 4N9IA 4FETA 3IAM2 1ULYA 2W24A 5GAEJ 1HW5A 4G7HF 3F6OA 4FTHA 1JJ6C 1R36A 4RLQA 1UCRA 3VWBA 4GGGA 3DWLE 1FIPA 1OLTA 2MLKA 2NOGA 2OD5A 5GP9A 3L2WA 3RDIA 3PM1A 1IN8A 1W5CC 2C6YA 2R7OA 3VFZA 2ECCA 3F9KA 3KZZA 3LA7A 4LK0F 3SFZA 1ZR2A 2EJRA 4PJ0C 3Q3SA 3L2RA 1W5TA 4M3DA 3CMYA 5FD5A 2ZMEA 4A3IJ 5EG0A 3O2PE 2DA4A 2PMZA 1SD5A 3BZKA 3ZQLA 3ESWB 1HDPA 3FDYA 4HW0A 2IS4A 4AVPA 3SEZA 1VTNC 4BAYA 2DAOA 2VJIA 3C1DA 3ZMDA 2D2WA 2GA2A 2VI6A 4HX7A 3ZQIA 2DMUA 3I54A 3T1BA 3QP6A 1F43A 2D45A 1T33A 1OCPA 3SEQA 2EA2A 3JTGA 1K6YA 4RDUA 3M3YJ 2YSRA 1VQKI 2EZIA 2OC6A 3DPUA 1BOAA 2Z2SB 2K9SA 1ZGAA 2ZFUA 1KYZA 3P7NA 3T0YA 1SEUA 5L3DA 3KIOA 4WXDA 2EH3A 2VKVA 3C2GA 2GLOA 2EPFA 3BTCA 1X3UA 4XQFA 4HYEA 3DPLC 3ZQGA 2WC2A 3GFLA 1IC8A 2HOSA 3E6DA 4HF0A 1XX5A 4AIHA 5IP9J 3OYJA 4C2TA 5FD6A 3CQZJ 4M3FA 3H9JA 1ZQ3P 1BR4A 2M5WA 5JHFA 2F48A 2TCTA 3ZMUA 2O0YA 3IV5A 2M9HA 2O8KA 2W57A 3H3VK 3A01B 1PUFB 2DXIA 4HEA2 1IAWA 5D8LB 1HXDA 2HQ5A 5EZHA 4WWCA 3ABUA 4L0ZB 3CJTB 3TOBA 2KZGA 4WCGA 3DLLF 5LD2C 1U3EM 4GO1A 4ANJA 2NS0A 1YITI 2HFHA 2E2IJ 1RPWA 4P5OA 3HHHA 2FD5A 3HB9A 2X51A 3K1NA 2R92J 1K61A 4BU2A 3FBNB 1R5ID 1USTA 3HUGB 4A3CJ 3A03A 3HBLA 2DT6A 2W48A 1DQUA 2IP2A 1EV7A 2DOFA 2OU2A 3L2UA 3OSFA 4HAMA 2QQ9A 3ZQQA 4IRHA 5F0FA 1SFOJ 1KA8A 4M9XA 3OOPA 1HLVA 2HTSA 3HRSA 2IA0A 2P5LC 2HQNA 4BACA 2AQEA 3FK6A 2OBPA 5DTDA 2L9SA 4IX7A 1Z77A 4B44A 3A01A 1PUFA 3OYLA 3JW4A 4ESFA 4BQQA 3TL4X 2P6TA 1GDTA 2DOEA 2V4JC 4EJVA 3A2KA 1QPMA 2GIVA 4MNUA 3CCMI 3WTYC 4NDLA 4U88A 1K7AA 3GTLJ 2BXZA 5ILUA 1SFXA 1WCMJ 2DA1A 3DKWA 1FP1D 4ZDOA 3JRFA 3EUAA 3ML6A 3SXYA 3S17J 2QWWA 3HUGA 4DYQA 3O8GA 2VBZA 1VI0A 2FBKA 1FOWA 1YRNB 4HOBA 3WODF 2Q0OA 2L02A 4OOIA 3CO7C 1W5SA 1FEXA 3K10A 4PK4A 5ED4A 1BI0A 3GTOJ 2KZVA 3ZN1A 4CYCB 4I7HA 3S3MA 2FE3A 2CQQA 4B1RA 2ADUA 2F2EA 1DDNA 3LSKA 3P5JA 3DLAA 3K4CA 4EQQA 4IHYA 2G9WA 2KRFA 2Y48A 3V4GA 4BBRJ 3IRRA 2CW7A 2E1MB 4AYBA 1LPQA 5IP6A 2E19A 3WU1B 1UZCA 2XF5A 3SHFA 2M3AA 1J59A 2WA0A 1OPCA 2LTPA 5KAIC 2XPVA 1Z6RA 2E60A 2JRMA 3BR3A 3BTIA 4BXFA 2V9KA 5B66C 1MNEA 4OIOF 3SDBA 3BC8A 4IHSA 5BQTA 1JKPC 2PX9A 4IOAF 2UV1A 4MQVA 1YRNA 1T8IA 1OYWA 2A05A 3WE2A 3AL0C 3KCCA 1YQAA 2HYGD 2O5RA 1QA6A 3N05A 4ZYAA 3MCZA 1YI2I 3WTXC 1LB2A 1B6AA 1X1CA 1Z1DA 1F4KA 4YFXF 3AG4H 4EGYA 1IDYA 4CYCA 3TQNA 4A3JJ 1R4NB 2ZNYA 2IT0A 2OTJI 4I76A 2WADA 1R6RA 3PNYA 5TGTA 3M4OJ 2H09A 1XMXA 3BG9A 3DP7A 4CCOA 3B02A 3M7GA 4HNVA 3VDXA 4KN7X 2BV6A 4F52A 5AONA 3I59B 2DA2A 1MMAA 2MD5A 2QLZA 4RBOA 2P6SA 3V7SA 3GFIA 2OPTA 4C9YA 2K9MA 2E2JJ 1S3JA 1XDSA 4AUXA 4PSXA 4XM3A 2KRCA 5M5WJ 5GTIC 3KFWX 2EFPA 3BJAA 3D5RC 2ELHA 2KP6A 4RAYA 1J0RA 2IAIA 5JLXA 1VQPI 4FCYA 2HPMA 1H8AC 3S1NJ 3H9GA 1TTYA 1YX5A 3DEEA 1Z3XA 4DBRA 1VF9A 4GFBA 4HPQA 2YU3A 5L3GA 2F4MB 3MMYB 5DM6F 2V6EA 2X6OA 3LL7A 3OYEA 1ETQA 1X4PA 1WJFA 1EH7A 3J7YJ 2HNHA 2KHMA 3LWFA 2LY1A 2HDWA 2DDBA 4LMYA 3IHUA 1X1AA 1IDZA 1IUYA 2CS3A 3I59A 4KMFA 3HGYA 1QHHD 2YX4A 3FF5A 1Y1VJ 1VQNI 5IOZA 3M8JA 3HOZJ 2KLOA 1AOYA 2VUMJ 1MMSA 4L9NA 1MSEC 1CGPA 3G1MA 3G3ZA 3RKXA 3K1MA 3JRHA 1XG1A 2MC4A 1U8BA 2ETHA 4A0XA 2HOTA 4B43A 2CQ7A 1PP8F 2IA1A 3IP4B 1O3TA 2VLAA 2O61A 4CYDA 1JGSA 2L01A 4IRGA 1WVRA 2QKMB 3FM5A 4C3HJ 1E3HA 2VBXA 1U0JA 5HS8A 1LDKB 3E6CC 5J8CA 2XGXA 3HTUA 3QYFA 2MFZA 3BCAA 3GFJA 4I0BA 1IV6A 2P5KA 4CCLA 3FMRA 1ZK8A 2XSJC 2KDOA 4FHTA 1APLC 2Y2ZA 1A31A 2ELKA 3ZGKA 1H0MA 1P92A 2P0WA 4V19K 4XRSG 2A3SA 2QQBA 4KN4X 4A0ZA 3KZYA 5JFRA 1USSA 1WJ5A 2VQGA 2Q1ZB 3M9AA 4CCNA 3CC4I 1YLFA 3F22A 2ELJA 3HYIA 1LKXA 1XMAA 4I6ZA 1JXSA 3VPRA 3LA3A 3OL3A 1OJLA 3I4PA 2XUBA 1FIAA 1QQIA 2JVGA 1RETA 3K2AA 2Y31A 1LNWA 4O6JA 1VNDA 2GWRA 2XV4S 2RKHA 2LKXA 4B4CA 2LDUA 3DBHB 2ZMEC 1N77A 4X1EA 2Z9OA 5HDNA 4UVBA 2HZDA 3M1EA 3P9CA 5H6RA 1S9HA 1ZRDA 4LJZF 1XCVA 1C0WA 1QVTA 3S8PA 5LHIA 3H5NA 3SZPA 4X0GA 2JPBA 2OQGA 1T95A 2A07F 1W0UA 2B63J 1GLNA 2L54A 3NWTA 5TISC 2ZXJA 3DTEA 5E8IA 1IGNA 1F1ZA 2FSWA 3H3ZA 1S29A 1T2KA 1O3SA 1UHWA 1CF7B 1FY7A 1KYWA 2V7FA 2W00A 2P7VB 3VEPA 2X48A 3QPLA 2JVHA 1YW8A 4DBQA 1VQ4I 2IA2A 2OF7A 1LFUP 5FKKA 3ZP5A 2NS7A 3HGGA 4HX8A 4AVZA 3MZYA 1HOMA 4Y52J 1JTXA 4BE0A 2GXBA 4WF2A 4G12A 3QYEA 4KYWA 2VQHA 3FXJA 2PLYA 2CQKA 4ZJZA 1GV5A 1H9GA 3GF2A 2QUFA 3F8NA 5D5VB 3CLOA 4EVIA 4OWRB 2VONA 3S1QJ 4A3DJ 2VASA 1Y56A 3G1LA 3MEXA 4UVCA 5CVIA 1FPQA 3CCJI 3CCQI 4JBAA 4HG2A 3LSRA 4U7BA 1CQTA 4MTDA 1LFBA 1V5GA 4FX0A 2COBA 4Z2YA 1BC7C 1CF7A 1G3YA 2V26A 5J47A 1VQ8I 4UY8I 3EPZA 6PAXA 2JWTA 5E1ZB 4IHXA 2E7WA 2RAEA 3OR2C 4C3IJ 2HXOA 2L5QA 2XGDA 3L2QA 3S93A 4CHUA 3K4LA 2ZC2A 5M3FJ 4HSTA 2BVMA 4D0PA 1T39A 5FKNA 3BY6A 5B3SH 1J2XA 2OTLI 1DUXC 3IWFA 2R7FA 4DQ2A 3DTKA 4YFKF 3OYCA 4OAYA 1H89C 1UHSA 3BZ6A 3HXLA 3T8RA 1FMWA 3BR6A 1LE8B 2HQRA 2EILH 2GAUA 5EJCA 2PJRB 2ME6A 4KIFA 3BPXA 4U87A 2COMA 1RESA 2L4AA 2WAEA 4JQFA 2O6GE 3F6VA 4LITA 3VYUB 1ZRCA 3F8BA 3M8EA 2RV8A 4BDZA 4ENMA 2EZKA 3DTIA 4ESBA 2WV1A 1Z3YA 1FYKA 2ISZA 3T8TA 2DT5A 5C44J 2DDAA 1EA3A 2DMNA 1NG7A 5DV5A 4II3A 2M87A 3OIQA 3S3OA 3N4MA 3TW7A 1R00A 3FKIJ 1IN7A 5IPAA 1FSEA 1LFPA 3TBIA 3ZMZA 4OIQF 1ETOA 1L0OC 4KIBA 3KP7A 3CJNA 3K2ZA 1BJAA 1R1UA 3PFIA 3RIRA 2A61A 3NWSA 1REPC 1LE8A 2PJRA 2MABA 2LOOA 4L9TA 3TW6A 4KDPA 1F9NA 2JZYA 1TWCJ 1UG2A 1KONA 1OR7A 1WJAA 1U5TB 1Z7LA 3LFKA 4ESJA 1V54H 3FISA 3H92A 2QZ8A 1Q1HA 2HEOA 1WI9A 2IW5A 1R23A 2BHYA 2KJCA 1SVMA 4OIPF 4XLEA 2LY9A 2FMYA 2RQQA 1FTTA 1GXQA 1K4SA 1LEBA 2M7AA 2Q8KA 5DCMB 2RNGA 5LEKA 1IUFA 3NEUA 1ZARA 3MQ0A 2EFWA 2EZLA 3K4NA 4BHBA 2ZO4A 2XAHA 3BG6A 4XLFA 1E3OC 2H6CA 2EINH 2GXGA 1FBQA 5FROA 1JKOC 2ZCWA 1LJ9A 5C4XJ 3L1PA 4LIUA 4ASNA 3GTJJ 2K27A 1R58A 4PDKA 1L3LA 1DU6A 4I2OA 1ZLJA 1XCBA 3OYFA 2XROA 3JSPA 5L3EA 2HYJA 5FLXZ 3V7RA 3I71A 1U5TA 2IGOA 3R0JA 2QSHX 2P7CB 2IVMA 3IUOA 3HHGA 3C2BA 1AWCA 1S8NA 4FX4A 3SZGA 1TQPA 2X0LA 4B09A 3BJ6A 2KIMA 4M6YA 1FJLA 1ZRFA 2DW4A 2UXXA 3F23A 2ISYA 3KEOA 2E1MC 3EYIA 2DTRA 1X3ZB 2M30A 1RUOA 2HOEA 3E1SA 2K7LA 4BL0B 1JHFA 5IP7J 5DCMA 1SFUA 4XMYA 5CLSA 4EM0B 1FSHA 2GXAA 1ETXA 3A0BC 1HDDC 4ZDLA 3R4KA 1IRXA 2HZTA 5BPIA 3KZIC 2L0KA 4IQ4A 3BZCA 2NRAC 3Q9VA 4XRFA 5E3NA 2XAJA 1BJZA 2D1HA 4KISA 3PO3J 2L9RA 1E17A 5K5OA 2QM3A 2JA8J 3CTAA 4HQEA 2FU4A 2XHKA 5LRRA 2IS2A 1MMNA 1B8IB 2ZB9A 5AIPA 2KRHA 2P4WA 2X1EA 2A69F 1DGWY 2K40A 2Q2EB 4P96A 4XK4A 3E5UA 3TO9A 4XLNF 4P9UA 1IXRC 3LSTA 4UV9A 5HS9A 4QTRA 1R71A 4H0EA 2E36A 3RQ4A 3WGHA 2HS5A 1BL0A 3S15J 3IH2A 3HKZA 4PGHA 4HA8A 1BI3A 2X1DA 2Y9YA 3OYNA 1OMIA 5E1WA 1FOYA 1A36A 3K9TA 3VB2A 1YIOA 4V2FA 2LMDA 3OV8A 4JOMA 5KCMA 5E17F 4R79A 3OYMA 2LVSA 1QNTA 2IGMA 1A35A 1ZYRF 2VPLA 2VE9A 4IZZA 2VE8A 2JTVA 4N0BA 1KU7A 4M9SA 2D5VA 1N25A 1FNNA 4G6DA 4U7DA 1UMQA 1BIAA 3CDHA 4NC8A 1TL8A 1B8IA 1KU9A 2AS5F 1W7PB 5HODA 1IN6A 2CUZA 4XLCA 5HLIA 2Q2EA 3KP3A 3J80Z 5HOOA 3CJRB 1KU2A 2JRTA 2M45A 2HYFA 2R7RA 2LH9A 4J19A 3DEUA 3QOEA 1QZEA 4Y13A 2N8GA 1FP2A 3W6KB 3OS0A 2E1OA 1U8RA 4LB5A 2KPMA 1VQMI 1SMTA 4DGWB 1EF4A 2DYSH 4IVNA 4IHVA 5HDKA 2YPRA 4QWQA 4OU0A 1UAAA 4UB6C 2W25A 3FHZA 4L9VA 5JR3A 2B7EA 5IY5H 2E2HJ 5D5UB 3KLNA 2GOXB 4BGDA 3K4JA 2RVCA 1IRZA 1OFCX 1U78A 2X6XA 3GFMA 1TT0A 5E20A 2VC1A 4QPQA 3GEZA 2E1NA 1QHGA 1JKRC 1JTYA 3RJPA 1W7PA 4ON0A 2NVUB 5EF6A 2H1LA 5BS6A 3BROA 3P9KA 3MZHA 3CF2A 4ETSA 3L00A 1N78A 3HJEA 2XGEA 4ENJA 3VSKA 3HOXJ 3H5RA 1JT6A 4UVAA 5HNFA 5L3FA 3FXLA 3R0AA 4EEFG 1IO2A 2DK5A 3GYHX 3UR3C 5FLXK 2CU7A 3OS2A 5M5YJ 5CPRB 1A6QA 1E3PA 1P4XA 1JHHA 1A6IA 1O7FA 4KT5C 4CSWA 1ONVA 5ICFA 1P4AA 3GTGJ 3J7AO 3TDZC 5K1YA 3OOUA 4Q5SF 1IW7F 1Y0NA 1YJNI 4L9JA 1SC7A 2X6WA 3HOWJ 3F0CA 3U21A 2BGCA 4ZYEA 2EIMH 1KU3A 4A3FJ 4G7OF 4KJZA 1ORKA 3SFIA 2IGNA 5J1YA 1TZLA 2O3FA 2PG4A 3D5LA 3SYTA 1R5HA 4IHTA 4HX4A 2QSGX 2VJ4A 3LOCA 2VKEA 3BJOA 3HPHA 5KK1A 3HOVJ 4Y15A 5HS7A 4GYIA 1B59A 2IBDA 2V9PA 4ZC3A 2DLLA 4G8XA 2CUJA 3ZMSA 3I55I 4BKXA 4KICA 4BQNA 3A0HC 3I56I 4L5IA 3RYRA 5L3CA 3S1MJ 2PEXA 4CUGA 5FRNA 5FLMJ 3WGGA 2L3DA 4BE1A 5CQEA 1WFXA 3DU6A 2ZSHB 2K85A 2EA4A 4E4HA 1SFKA 2WAQA 1U2WA 1WGXA 2HXIA 4MEXF 2R3SA 3DXJF 4XKWA 3ASNH 1HKSA 1OCRH 2H1KA 5FRMA 4BXXJ 2KDZA 5GPAA 4LGWA 1X3WB 1VQ6I 5F1JA 3DQVC 4XKBA 3PO2J 3PNTA 4DW6A 1DU0A 3H3UA 2M4KA 2V1NA 3ERMA 3BDDA 5JI6A 3PIOF 3IKVA 5F6FA 3CCLI 4LOCA 2V1XA 3JRBA 1Z05A 3CUQA 3G4SI 4CGZA 5D5XB 3J81Z 3EUHA 2K9NA 1S5LC 3DKYA 2NVTJ 2OUMA 3J80K 3OYDA 4R8HA 3Q5FA 2TRTA 3RZOJ 1Y0UA 2IJLA 2YUSA 1WPKA 3U1DA 2QQ8A 1UELB 3MKLA 2RNJA 2A68F 3G73A 1P4WA 4YG2F 4IL6C 1HA8A 5C3EJ 2NVXJ 4RB3C 1J5YA 1NTCA 3KYCB 3QPSA 2DPUA 2AHQA 1X2NA 3L09A 4DYCA 1PDNC 1TNSA 4M71A 3WGIA 3FWEA 1W4MA 4BHCA 1GVJA 2K3PA 3C7JA 2RC4A 1POGA 3GBGA 1HQCA 2JSCA 3H5AA 4JK1X 1ZKGA 2EK5A 2R93J 4IXAA 4LIVA 3BCBA 1OR7C 2A5YB 2E5NA 4MO7A 4XLAA 1FZPB 4LB6B 4WX9A 5FFZA 3LA2A 5EEGA 3BG7A 4F92B 2F5DA 3S14J 4QPOA 2LC2A 1UG0A 3F8CA 5H2FC 2D1VA 4WXCA 1ZHFA 2V79A 2ZSIB 3RSNA 2CV0A 1LDJA 1U6GA 4M9ZA 4BJ5C 4QIWN 1JUSA 4NC7A 4ABZA 2LK2A 1G59A 3NQOA 3V8KA 4E7ZA 4QLCU 1J09A 3K69A 2AXLA 4E7IA 2F5VA 1O4XA 4XORA 2VOOA 2CJJA 2LKPA 2DQLA 1K6OA 1FT9A 4BS9A 4XN3A 4RGXA 3S32A 2F6CA 3HM5A 3GWZA 3TDUC 2ESHA 4CICA 4A3GJ 4FQGA 3FXKA 3FK7A 3ZMVA 3ASOH 1ETVA 2I8DA 3TO6A 2VT2A 4N4NB 1D3YA 1ZLKA 1QRYA 4RAFA 1T0FA 3RYPA 3KYDB 1ZAOA 2W85A 1R9TJ 3QAHA 2CW8A 1U5TC 4EJWA 3W2AA 4A2UA 5FO5A 1X1DA 4B3AA 1KQ9A 3VODA 3K4BA 2A6EF 3H35A 3GTPJ 4FASD 2FQ4A 2STTA 4AWXB 4V2GA 1HSJA 2M2EA 4HLYA 2KIFA 2X6YA 3W3CA 1TT5B 2JA7J 1ON2A 3DU5A 4OMZA 1FYLA 2G7HA 2M1BA 4E7LA 2XDVA 3OYAA 1UHMA 4XICA 4CZCA 1JKQC 3TP3A 5FKLA 2W84A 1X58A 4DZJA 3JAMZ 5K5RA 1E0EA 1G6NA 2X85A 4X6AJ 2STWA 2W7NA 5L3BA 5JLWA 2MH2A 2M0CA 3HC7A 1IG7A 4LLLA 1X19A 4OIRF 2OJED 1NHAA 4ZZDA 3IL2A 2EWNA 1X2MA 5CVRA 3E5QA 3J7AY 1XSDA 1GT0C 2QSFX 1JJ8C 4D1QA 3JCUC 1I27A 4AM3A 2MLGA 2FF4A 4PJJA 1IN4A 4IKFA 4JYKA 1J7KA 2NNNA 2DOAA 3LSJA 5CVJA 1D0ZA 5K7FA 5FJ8J 1OCTC 2QBYB 3SDGA 3DFGA 1PVEA 2LFBA 3SZTA 2FUG2 4ZYDA 3UKGA 3GX4X 1TQMA 4MIMA 3WTVC 4BY1J 3WTWC 5DS9A 5F0CA 3WG7H 4M3EA 4EATA 1QBJA 1OYIA 3TKYA 1VQ5I 2DTZA 3CP2A 1XB4A 1RKWA 2BBYA 3I58A 1OISA 2O8XA 2MW8A 3FHNA 3C2HA 1OYYA 2R5ZB 3ZQCA 3J81K 3JTHA 3MD2A 4PGGA 3LFUA 4OMYA 3IAS2 5DCFA 1I6HJ 2KL4A 1WWXA 1ACIA 2FA5A 1LEAA 3GLLA 1VQLI 3QP5A 1TNTA 5LGUA 2K4JA 3OYHA 2LR8A 2CW0F 2WBMA 2QBYA 3HIFA 1FOXA 4Q4ZF 2XAQA 2NS8A 1I3AA 1D1BA 2Y0SA 4XONA 1V5FA 3HOTA 5DUKA 2ZJPF 1DPUA 2YR2A 1P6RA 4NNJA 4E70A 3C18A 4ZTFA 5HNHA 3OIPA 1A5JA 1FTZA 3FX3A 3CC2I 2R7TA 1R1VA 1SAUA 2R5ZA 2E1CA 1IRFA 1MZBA 1OCCH 2RN7A 2FMLA 2LF8A 4LD5A 2AO9A 3BQZA 2RGVA 3KEYA 4WK8F 3RPUA 1R4MB 5ICEA 2NNYA 2VN2A 1MJBA 4HV5A 1R1TA 4UV8A 2H8RA 4RM2A 2F4IA 2VOPA 2PFBA 2Z3YA 4PUSA 2PMUA 3HSRA 2GZWA 4BUPA 4CDGA 3FKJA 4C30A 2VL8A 2Z5UA 3BWGA 1KGSA 4IHWA 1D1AA 5HLGA 3LSIA 2LY2A 5HLHA 1IN5A 3OS1A 2KJBA 1YO5C 3O3KA 3P9IA 3AG3H 4AIDA 1FYMA 3DKXA 5B1AH 4AIKA 2O03A 3PSFA 5GPCA 3KETA 4NHJA 4ZZLA 5DM7F 3VYTB 2WWYA 2EB7A 2Y30A 1DGRM 1S7AA 4JX5A 3GW2A 5D4RA 2ZBKA 2E5ZA 1BI2A 3AG1H 3U1KA 5J1RA 5C4JJ 3L7WA 2WTEA 1H9TA 1Y6IA 3CCUI 2F5EA 1B9MA 2G0EA 4PFOA 5A2QZ 3JRAA 4P9FA 1ITYA 2JA2A 2DT7B 3JAMK 3HSFA 3PNVA 3PFYA 3BLYA 2LBFB 3M1CA 2YX7A 3PJRA 4D7NA 3DPTA 4XIDA 3LSHA 2PQ8A 1Y1WJ 1FBSA 2GA1A 3DCFA 3EQLF 2NYXA 3HKZN 3CCYA 4PFPA 4B47A 1SD4A 4BXUA 4MGRA 2EFNA 5KVRA 3GO5A 2OCCH 1MBFA 4A6DA 4E7HA 1HBXG 3HOUJ 2HDCA 4FISA 1YHQI 2W4SA 2XF7A 1BR2A 1TWGJ 1S7EA 5EGOB 1BI1A 1MNDA 1WJBA 2P81A 4YIFA 4PJMA 3TMOA 4BBSJ 3CCRI 1AHDP 3ZCOA 4B3XA 5IOYA 2FBHA 1MBHA 3ECHA 5F1RA 3S2HJ 2CFOA 2LBFA 3WG9A 3HRMA 3QOPA 5CQGA 2EV5A 4DYRA 2QA4I 5GTHC 1QU3A 2QCOA 4Y3OA 3RKWA 4XNFA 3FXUA 2HR3A 3EUHC 1EKEA 2OV7A 2PMZN 2VBWA 3W2VA 2ESNA 1HKQA 1YE9A 3FXRA 5DYMA 5LGTA 2R4GA 2L4MA 2EIJH 4GRIA 2M8EA 3MKZA 1K4TA 2JQ7A 3K1PA 2EQRA 2HGCA 1G3SA 4IEJA 4Y4RA 4EJOA 1G4DA 4RGSA 1IXSB 1X1BA 1Y8RB 4XR6A 5D6EA 3S1RJ 2DYRH 5H20A 3LQRA 3BOQA 1ON1A 5EGOA 1W36D 1NK2P 1DPRA 2MC3A 5M5XJ 4NB5A 2LREA 2JMWA 3ABKH 2KMUA 4C2MJ 4E7KA 1D5YA 3JRIA 3CDIA 3I3LA 3G1OA 1MJAA 4CA0A 4PZJA 3E6MA 3GUDA 4XRSA 5DD8A 4IO9F 3VOEA 3RCOA 4L5EA 1JE8A 3DBLB 1STZA 3B73A 3Q0WA 2RQPA 2FBIA 3KYLA 2NAZA 4DZPA 3LAJA 3FXOA 2WV0A 1G3WA 4BEHB 2VJ5A 2KIQA 3V42A 3BR5A 2BOLA 3TEDA 2NOJB 2P8TA 2DFFA 3S16J 4ZYGA 4DIQA 4RB0A 4II2A 3O6BB 1RR7A 3GMEA 1MH4A 1I1SA 2R7QA 5CJ9A 4BJTA 5M3MJ 3LSMA 3ZXSA 2RREA 3GTMJ 5ILVA 5FLVA 2R7DA 4JX6A 4A3EJ 1JUPA 2VKHA 4RAGA 2JPCA 1T0FC 1MBEA 1R7JA 4NBQA 3A1YA 2K9QA 4M6XA 2KQRA 3HZJA 3HG9A 2Y0MA 2YU9J 2LF7A 5F04A 2OZUA 2W1OA 1WJCA 3WU0A 5FKMA 5IT9K 1ZG1A 2LYCA 2XAGA 2VQCA 4NUBA 5A2QK 3ZQFA 4RGUA 2FNPA 5ICGA 4UUSB 2UXNA 1WRJA 5E18F 1Z9CA 2KIUA 3CC7I 3G2BA 3GVAA 4S0HB 4BEHA 1Z67A 4RGRA 1YG2A 2MD0A 2BY3A 1Z7UA 4KITB 4ENKA 3G71I 3WTZA 2QQAA 4RLFA 2AXTC 3HRUA 2FX0A 1P7JA 1UJ8A 5DUIA 2VBYA 2P5VA 4A3KJ 2R7UA 2WAQN 5KNLA 4BH9A 1ZELA 4HSRA 3MKWB 4G9YA 1XMKA 2VB6A 3LNQA 4XLPF 4G7ZF 3I9V2 2IXSA 4FT8A 4KNYA 1D8JA 3JRDA 3OL4A 4CO8A 2YS9A 4M74A 1XSXA 3WU2C 1KZHA 1P7IA 2NVQJ 1D0YA 3IWZA 1VQ7I 2V1DA 2OCEA 1XPXA 3GZ5A 4A6EA 2EZHA 3A4CA 1SFEA 1GXPA 1MD0A 3OIOA 1ZN2A 1XGMA 2DN0A 4UUSA 3N97A 4PCQA 4KUMA 2Y9ZA 2PN6A 4R1HA 1V3FA 1ERDA 5HLTA 2ZKZA 2CQNA 1YS7A 2L7KA 3KP2A 1RR8C 3DEWA 1TWHJ 1MMDA 2MH9A 2DQRA 3ZR8X 3IH3A 4CZZA 4RA2A 1MH3A 3H36A 4M6VA 3RQIA 3BP8A 4Q48A 3U2RA 2LP0A 2PMHA 1XDUA 1I39A 4AYBN 4IJAA 5K7ZA 5J4VA 2LKSA 5F08A 1ZH5A 3D0SA 2XRNA 3BQYA 1AU7A 3UNGC 1XD7A 3CLQA 5F64A 1E2XA 1W36C 3KX2A 3J7ZI 2ACJA 2W82A 1RNLA 5FGMA 1Z21A 5HDGA 1W0TA 3GCMA 2VPRA 3IRQA 2XC7A 4XOPA 1DP3A 5J1UA 1S6LA 3QU3A 4A3LJ 3QYBA 2CSOA 2F4OB 2XPUA 2DMPA 3QODA 5FFXA 3TO7A 1K79A 2HVSA 1F36A 1JT0A 4IQJA 3PSIA 3I5UA 1OCOH 4U0YA 1V55H 2JUCA 4CCKA 2H8WA 2B9SA 3V7CA 2BHZA 2EBIA 2GQQA 1LVKA 2K02A 3E3VA 3K4KA 3LMMA 1G2HA 2GM4A 1BM9A 4ITVA 4L5JA 4ZDPA 4HLXA 4GCVA 4I09A 1YW7A 4MTEA 4HDVA 5LEJA 3ABTA 4A5NA 2MA3A 2IPQX 3BR1A 1ZGWA 4I01A 2J5OA 2DMTA 1FLIA 3BR2A 3E5XA 3WHBA 3R60A 4I98B 4A5MA 1SVOA 2B0LA 3WE3A 2F5CA 3D5SC 2CQXA 2XF6A 1WJDA 2X9DA 1QPIA 4L18B 2ID6A 4HF1A 1XN7A 4IF4A 2ZFWA 4E7JA 4NC6A 2JUGA 2XSDC 1W1WE 1IF1A 2WAFA 4MQ9F 1V4RA 2FEZA 3AKZA 2M34A 2HOAA 4C2UA 2HU9A 5EZGA 5CVVA 3CUQB 4RMNA 1IRGA 1ODDA 3OWTA 2VC0A 4XKVA 1YTYA 1BBYA 1A04A 4W1UA 3OSGA 1X1PA 4M3BA 5ILSA 4F3QA 2DMQA 1YX3A 2H27A 2WB1A 1MKMA 2H6BA 2K9LA 5F0HA 4U0VA 2K5CA 1H88C 3CD6I 4XLHA 4KA4A 2K3FA 3GLXA 4UHTA 5JHUA 1I5ZA 1MW7A 2HKOA 4F91B 2R5YB 2DA6A 1YW9A 9ANTA 1YJ9I 2FOKA 5KHDA 2DJNA 2ID3A 4KIGA 5E1XA 4OAZA 1HC8A 3S3NA 3ZPLA 2ECBA 2L7ZA 1AA7A 3ZQHA 3QRFF 2MBFA 4EMSA 5EEHA 4L0YB 1G8XA 5K7HA 2BXYA 3TGNA 1QZZA 2A6HF 3L2VA 1D0XA 4BE2A 1GVDA 2DA3A 4A12A 2CGPA 2VT3A 1RI7A 4K2EA 1FWZA 2VIXA 2DFHA 1D5VA 1R22A 1X4OA 4I02A 2JT1A 4KFCA 1O57A 4O5VA 2L9NA 1VFCA 3FXQA 1B1BA 3OYKA 4XRMA 5E8GA 2KISA 4E6KG 2OA4A 1WQ2A 1WJEA 2ICWG 2XRLA 2CUFA 2FJ1A 1HF0A 2X1CA 1YOVB 2R5YA 3E7LA 1QVUA 4H4KC 4D9JA 4A93J 2BVLA 2HPIA 3MVPA 3HPGA 2O9LA 4EV0A 2DFIA 4S05A 4LLNA 3PUBA 3ABLH 3CMAI 2BEOA 1O7LA 3EETA 2CRGA 3AG2H 2L2OA 5CYVA 1XSVA 3FMSA 3R6SA 1BW5A 2Y0SN 4A0YA 1FOKA 2XIGA 2JSPA 4YIRX 3TOAA 1UFMA 2HQAA 2K4BA 1UB9A 3H0DA 4UNOA 4XSXF 5TJJA 1XC5A 1ETKA 3L9FA 2BYVE 4Y33A 3CMMA 2CMPA 4CCMA 4CXFA 2R7VA 5CVUA 3CO6C 1IV8A 4BHPA 1BW6A 1D8KA 3HRTA 4LFUA 1EJ9A 3M07A 3QPTA 1EH8A 3K7AJ 4RB2C 4KMUX 1FBUA 4IPAA 1W7PD 4F55A 3BT9A 4AC0A 5D8KB 2R7ZJ 4A3BJ 1I1GA 4ZTJA 1BA5A 3BG5A 3M8FA 3Q0VA 1SMYF 5J3LA 2QKLB 5ICCA 5E3MA 1HSTA 1OCZH 5J6XA 1TC3C 3DF8A 3RKYA 1N75A 4D5FA 3CF5F 4OINF 2E71A 5EEAA 3IC7A 5BPDA 1BOBA 5J4YA 4BJ6C 1NH3A 4HF2A 1SD7A 3RKQA 1RKTA 2OQRA 1B72B 2GOMA 3NAUA 4Q47A 5H6QA 4XBFA 3RTRA 5KAFC 2I10A 3CESA 3BPVA 2JA5J 3PUFA 3ELKA 4MHGA 3HTSB 1BR1A 5IT3A 5BOXA 4M72A 1R49A 1O3RA 3GZ6A 1ETWA 4XL9A 1QGPA 2NXNB 2M8GX 1BN5A 2ZJRF 3GXOA 5CKTA 1YIJI 3Q9SA 2CYYA 2UUZA 3OR1C 3V8LA 4ZH4F 3OYBA 5E3LA 4JP0A 3MFKA 1OQYA 3DBRB 1RC9A 4N9HA 3F72A 2A5WA 3OY9A 5D6FA 1WZ2A 2ZJQF 5GADJ 5FKOA 3RI4A 3EDPA 4MEYF 2BW3B 1WHUA 2MYSA 1YYVA 1Y8QB 2O7OA 1K83J 2HKXA 1ZR4A 4N4OB 2CV2A 3U9GA 5IYBJ 5LHGA 1LQ1A 3PQKA 1F5TA 2HVRA 2QVOA 1B72A 3AFHA 3JRGA 5J40A 1JI8A 5EYRA 2DCEA 2DODA 4JX4A 1HW1A 2CG4A 3CCVI 4IRIA 3FM3A 1IXCA 5LBQA 3KLOA 3CP8A 2F5FA 2AQFA 3ZMTA 5D5WB 5HVQC 1T08B 1HCRA 5LFAA 1HW2A 2JA6J 4A69C 2XAUA 1TWAJ 1Z91A 2ZXWH 1Z0XA 2Z33A 4HZFA 3E97A 2BE5F 1RRJA 1BC8C 3BR0A 1MMGA 1PJRA 1PYVA 3I0TA 5J8FA 4O3MA 1MIJA 2MSYA 4HV6A 5F27A 4ZYHA 4Z6YA 4J01A 3VYSB 3SJMA 2BW3A 1LDDA 4XSZF 3ONQA 1WH7A 3KE2A 2Z1DA 1MSFC 2DJIA 3HL2A 5EDNA 3HEFA 2WY8Q 3GTQJ 2E7XA 2DFEA 1RIOH 4MLOA 2G7UA 3IH4A 2VXZA 2LLKA 3QPHA 1K78B 2BZTA 4M73A 1WKMA 3PQJA 3DV8A 5E3OA 4W97A 3ULQB 4BDYA 2QYOA 3I64A 4HRIA 1XGNA 4J00A 3E0JB 4YELA 1JUMA 1O3QA 3FMQA 1NK3P 3BTJA 3H0GJ 3JR9A 1TW3A 1LVAA 4BY7J 3FIWA 3B6AA 1P9QC 1WSUA 1SAXA 2JJ7A 1LUJB 4LG0B 4LLGF 2CO5A 2GBYA 2KKOA 4YRVA 1TW2A 1AKHB 4EGZA 3IKTA 2V9VA 4MFDA 1YS6A 3LSGA 4YFNF 3JSOA 1T38A 1MBJA 1XTAA 4GXOA 3T5XA 3MKYB 1IZ1A 2DBBA 5TRDA 4RAZA 4ENNA 1B4AA 3K70D 3ZQ7A 3CCSI 2R0QC 5DEQA 3Q0UA 1VQ9I 2L9VA 2PJPA 4QSHA 2L7FP 2XASA 3QWLA 4DOZA 3CCEI 1K78A 4I0AA 3SQNA 2XGCA 4BQOA 1TLHB 1D1CA 4U0WA 3R61A 1V5EA 1MBKA 1SVLA 5IT9Z 3D1NI 2XB5A 3GTKJ 4GDFA 3FXMA 1ZGJA 3ERED 2R7WA 2PBIA 3NARA 4CCJA 2ZXIA 4RB1A 1QO0D 2V6CA 4LG0A 3V8JA 2KFDA 2HVQA 5FB2A 4D5CA 1MDMB 1XS9A 2XB0X 4S04A 1AKHA 4DJAA 3WTUC 4PSWA 3WHCA 2LD5A 1T98A 3I4NJ 2BY2A 1RUNA 3QQAA 5BMZA 4D7MA 2MG4A 4HNTA 1SANA 2IEKA 2JK3A 4UXNA 1M1EB 4YIIA 2CFXA
chains in the Genus database with same CATH topology
1MSEC 2WAQN 3G1MA 1WGXA 2HXIA 3JRHA 1XG1A 1U8BA 3LNQA 2H1KA 4BXXJ 2HOTA 2HI3A 2KDZA 5GPAA 4A3MJ 3JRDA 2YS9A 4C3JJ 1U9NA 5F1JA 5IYCJ 3LSPA 1P7IA 4C3HJ 3CDLA 2NVQJ 3PO2J 1T56A 4DW6A 1DU0A 1WI3A 3W6VA 1IV6A 1I3QJ 4LOCA 2EZHA 3JRBA 1ZK8A 3OIOA 2DN0A 4UUSA 1APLC 2Y9ZA 2Y2ZA 2ELKA 2K9NA 3DEWA 1TWHJ 2DA5A 2NVTJ 1TWFJ 3IH3A 4XRSG 2TRTA 1MH3A 3RZOJ 2YUSA 4M6VA 2L7MP 1WPKA 3RQIA 1MNMC 3MKLA 3JRCA 2LP0A 5C3EJ 4AYBN 5K7ZA 2NVXJ 4FE4A 5F08A 4I6ZA 1NTCA 3BQYA 3QPSA 3VPRA 1AU7A 1U9OA 2AHQA 1X2NA 1OJLA 4DYCA 3I4MJ 1FIAA 1GUUA 2KT0A 1RETA 3K2AA 2Y31A 1VNDA 3GBGA 1POGA 2LKXA 4B4CA 1W0TA 1ZKGA 2VPRA 4X1EA 1WH5A 2R93J 5J1UA 4A3LJ 4MFEA 4MO7A 2XPUA 2DMPA 1ENHA 1F36A 1JT0A 1QVTA 3BG3A 3S14J 5IYDJ 3ZOBA 1W0UA 2B63J 1IGNA 2NVYJ 3JREA 2EBIA 1JUSA 4QIWN 2DA7A 4ABZA 2X48A 2LK2A 3QPLA 4Y7NJ 1G2HA 2GM4A 2OF7A 1LFUP 5FKKA 2HDDA 2NS7A 3HGGA 1O4XA 1HOMA 4Y52J 2XPWA 2CJJA 1JTXA 3TP0A 4FE7A 1IJWC 3A02A 4G12A 1Q1VA 3HM5A 1MBGA 1ZGWA 3BR1A 4A3GJ 2MGQA 3FK7A 1GV5A 1ETVA 2DMTA 3BR2A 2ME0A 3WHBA 4UUTA 1QRYA 3S1QJ 2X9DA 2CQXA 1QPIA 1R9TJ 4A3DJ 2ID6A 3G1LA 2XSDC 1JGGA 4B3AA 3S2DJ 3GTPJ 2FQ4A 2M34A 3LSRA 2HOAA 4V2GA 1CQTA 2M2EA 1LFBA 2COBA 5EZGA 2JA7J 2JWTA 2JN6A 3HDDA 4IHXA 1ZTRA 2QF7A 2RAEA 4C3IJ 2HXOA 1ETYA 5BNGA 4XICA 3TP3A 1JKQC 2XGDA 4W1UA 5FKLA 3OSGA 1X58A 4M3BA 4DZJA 5M3FJ 2DMQA 4X6AJ 2WB1N 5F0HA 5FKNA 5JLWA 1H88C 2M0CA 1IG7A 3B6CA 1H89C 1UHSA 3RZDJ 1X2MA 2R5YB 1GV2A 2DA6A 3BR6A 1GT0C 1LE8B 1JJ8C 4M3GA 2ME6A 9ANTA 2DJNA 2ID3A 2CUEA 1RESA 4JYKA 2ECBA 2L7ZA 3ZQHA 5EG0B 3LSJA 5K7FA 5FJ8J 1OCTC 2EZKA 3SDGA 2LFBA 1I50J 2WV1A 3UKGA 5K7HA 3O8HA 4MIMA 4BY1J 5DS9A 5F0CA 5C44J 4M3EA 2DMNA 1GVDA 2DA3A 2DTZA 1RKWA 3MN2A 2MW8A 1VFCA 3BTLA 3TW7A 2R5ZB 3FKIJ 4XRMA 3ZQCA 5IPAA 4FTHA 1JJ6C 1FIPA 1ETOA 2NOGA 2XRLA 1I6HJ 5GP9A 2CUFA 3PM1A 2FJ1A 1HF0A 2ECCA 1ZR2A 2R5YA 3E7LA 1QVUA 4A93J 1LE8A 3Q3SA 4M3DA 3CMYA 3MVPA 3TW6A 2O9LA 4A3IJ 1TWCJ 5EG0A 1UG2A 2DA4A 3ZQLA 1HDPA 2LR8A 3FISA 2CRGA 2NS8A 1BW5A 2Y0SN 2LY9A 2VI6A 3ZQIA 2DMUA 1FTTA 1A5JA 1FTZA 1F43A 1T33A 1OCPA 1IUFA 4RDUA 3M3YJ 2R5ZA 2EZLA 2EZIA 1E3OC 1XC5A 2K9SA 1ETKA 2AO9A 3BQZA 1JKOC 2EH3A 2VKVA 5C4XJ 3L1PA 2GLOA 3BTCA 1BW6A 2H8RA 3GTJJ 1DU6A 3ZQGA 1IC8A 2HOSA 3K7AJ 2HYJA 5IP9J 4IHWA 3CQZJ 3BT9A 4M3FA 4AC0A 1ZQ3P 2R7ZJ 4A3BJ 3C2BA 2TCTA 1BA5A 3BG5A 3IV5A 3Q0VA 1FJLA 5J3LA 2M9HA 2O8KA 5E3MA 3A01B 3H3VK 1PUFB 1TC3C 4D5FA 5GPCA 5EEAA 2HQ5A 5EZHA 5IP7J 2Y30A 4JX5A 1ETXA 1HDDC 2E2IJ 3RKQA 1RKTA 1RPWA 5J1RA 5C4JJ 2FD5A 3HB9A 1B72B 3NAUA 2R92J 1K61A 2I10A 2L0KA 2JA5J 2G0EA 4A3CJ 3A03A 3HBLA 1BJZA 5E3NA 3PO3J 2L9RA 2W48A 3JRAA 1ETWA 2JA8J 1ITYA 2M8GX 1B8IB 2ZB9A 3OSFA 5F0FA 1SFOJ 1HLVA 2K40A 4XK4A 5E3LA 4JP0A 4D7NA 4XIDA 3FK6A 4QTRA 1Y1WJ 5DTDA 1Z77A 3A01A 3DCFA 1PUFA 1BL0A 3S15J 3IH2A 3HKZN 2Y9YA 3CCYA 5FKOA 1GDTA 2O7OA 4V2FA 1K83J 1ZR4A 4NDLA 5IYBJ 3GTLJ 2LVSA 1MBFA 1WCMJ 1B72A 2DA1A 3JRFA 3JRGA 3HOUJ 5EYRA 3S17J 4DYQA 4FISA 4JX4A 3O8GA 1VI0A 1YRNB 2D5VA 1TWGJ 1S7EA 5EGOB 4BBSJ 2P81A 1AHDP 1UMQA 1B8IA 5IOYA 1HCRA 5HODA 1MBHA 1FEXA 3S2HJ 2JA6J 4A69C 3GTOJ 1TWAJ 1Z0XA 4DYRA 4CYCB 2QCOA 2CQQA 4J19A 3BR0A 4B1RA 2N8GA 2PMZN 2MSYA 5F27A 2E1OA 4IHYA 1EF4A 4BBRJ 3SJMA 4IHVA 1WH7A 5IP6A 2E19A 1MSFC 2E2HJ 2LTPA 5EDNA 3HEFA 2XPVA 3BR3A 2EQRA 3BTIA 4IEJA 3GTQJ 1IRZA 1OFCX 1U78A 4MLOA 3IH4A 1JKPC 3S1RJ 2LLKA 1YRNA 5EGOA 1NK2P 5M5XJ 5E3OA 1JKRC 4W97A 2JMWA 1JTYA 1D5YA 4C2MJ 5EF6A 3JRIA 1JUMA 3G1OA 1NK3P 3BTJA 3H0GJ 4XRSA 3JR9A 4BY7J 3FIWA 4L5EA 3B6AA 1IDYA 4CYCA 2JJ7A 4A3JJ 3Q0WA 2XGEA 4I76A 3M4OJ 3BG9A 3HOXJ 2GBYA 1AKHB 4HNVA 1JT6A 4MFDA 4DZPA 3LSGA 4EEFG 1MBJA 2DA2A 2CU7A 4RBOA 3TEDA 3BR5A 5M5YJ 2OPTA 2E2JJ 4AUXA 3S16J 1A6IA 2R0QC 5M5WJ 3Q0UA 3GTGJ 1RR7A 2IAIA 1MH4A 3OOUA 5JLXA 4FCYA 4QSHA 2L7FP 1H8AC 3S1NJ 3HOWJ 5M3MJ 3F0CA 3GTMJ 5FLVA 4A3EJ 2XGCA 4JX6A 1JUPA 4A3FJ 1ORKA 1VF9A 3SFIA 4GFBA 1MBKA 1MBEA 5J1YA 2K9QA 2XB5A 3D1NI 3GTKJ 2YU9J 3NARA 5F04A 2X6OA 1ETQA 3LOCA 2VKEA 5FKMA 4D5CA 1XS9A 2XB0X 1AKHA 3HOVJ 3ZQFA 2IBDA 3HOYJ 2LD5A 3WHCA 4UUSB 4BKXA 1IDZA 3I4NJ 3QQAA 3S1MJ 3HGYA 4S0HB 5FLMJ 4D7MA 2MG4A 1Y1VJ 5IOZA 3HOZJ 1SANA 2IEKA 2JK3A 2FX0A 1P7JA 2VUMJ 4A3KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSE C;  2WAQ N;  3G1M A;  1WGX A;  2HXI A;  3JRH A;  1XG1 A;  1U8B A;  3LNQ A;  2H1K A;  4BXX J;  2HOT A;  2HI3 A;  2KDZ A;  5GPA A;  4A3M J;  3JRD A;  2YS9 A;  4C3J J;  1U9N A;  5F1J A;  5IYC J;  3LSP A;  1P7I A;  4C3H J;  3CDL A;  2NVQ J;  3PO2 J;  1T56 A;  4DW6 A;  1DU0 A;  1WI3 A;  3W6V A;  1IV6 A;  1I3Q J;  4LOC A;  2EZH A;  3JRB A;  1ZK8 A;  3OIO A;  2DN0 A;  4UUS A;  1APL C;  2Y9Z A;  2Y2Z A;  2ELK A;  2K9N A;  3DEW A;  1TWH J;  2DA5 A;  2NVT J;  1TWF J;  3IH3 A;  4XRS G;  2TRT A;  1MH3 A;  3RZO J;  2YUS A;  4M6V A;  2L7M P;  1WPK A;  3RQI A;  1MNM C;  3MKL A;  3JRC A;  2LP0 A;  5C3E J;  4AYB N;  5K7Z A;  2NVX J;  4FE4 A;  5F08 A;  4I6Z A;  1NTC A;  3BQY A;  3QPS A;  3VPR A;  1AU7 A;  1U9O A;  2AHQ A;  1X2N A;  1OJL A;  4DYC A;  3I4M J;  1FIA A;  1GUU A;  2KT0 A;  1RET A;  3K2A A;  2Y31 A;  1VND A;  3GBG A;  1POG A;  2LKX A;  4B4C A;  1W0T A;  1ZKG A;  2VPR A;  4X1E A;  1WH5 A;  2R93 J;  5J1U A;  4A3L J;  4MFE A;  4MO7 A;  2XPU A;  2DMP A;  1ENH A;  1F36 A;  1JT0 A;  1QVT A;  3BG3 A;  3S14 J;  5IYD J;  3ZOB A;  1W0U A;  2B63 J;  1IGN A;  2NVY J;  3JRE A;  2EBI A;  1JUS A;  4QIW N;  2DA7 A;  4ABZ A;  2X48 A;  2LK2 A;  3QPL A;  4Y7N J;  1G2H A;  2GM4 A;  2OF7 A;  1LFU P;  5FKK A;  2HDD A;  2NS7 A;  3HGG A;  1O4X A;  1HOM A;  4Y52 J;  2XPW A;  2CJJ A;  1JTX A;  3TP0 A;  4FE7 A;  1IJW C;  3A02 A;  4G12 A;  1Q1V A;  3HM5 A;  1MBG A;  1ZGW A;  3BR1 A;  4A3G J;  2MGQ A;  3FK7 A;  1GV5 A;  1ETV A;  2DMT A;  3BR2 A;  2ME0 A;  3WHB A;  4UUT A;  1QRY A;  3S1Q J;  2X9D A;  2CQX A;  1QPI A;  1R9T J;  4A3D J;  2ID6 A;  3G1L A;  2XSD C;  1JGG A;  4B3A A;  3S2D J;  3GTP J;  2FQ4 A;  2M34 A;  3LSR A;  2HOA A;  4V2G A;  1CQT A;  2M2E A;  1LFB A;  2COB A;  5EZG A;  2JA7 J;  2JWT A;  2JN6 A;  3HDD A;  4IHX A;  1ZTR A;  2QF7 A;  2RAE A;  4C3I J;  2HXO A;  1ETY A;  5BNG A;  4XIC A;  3TP3 A;  1JKQ C;  2XGD A;  4W1U A;  5FKL A;  3OSG A;  1X58 A;  4M3B A;  4DZJ A;  5M3F J;  2DMQ A;  4X6A J;  2WB1 N;  5F0H A;  5FKN A;  5JLW A;  1H88 C;  2M0C A;  1IG7 A;  3B6C A;  1H89 C;  1UHS A;  3RZD J;  1X2M A;  2R5Y B;  1GV2 A;  2DA6 A;  3BR6 A;  1GT0 C;  1LE8 B;  1JJ8 C;  4M3G A;  2ME6 A;  9ANT A;  2DJN A;  2ID3 A;  2CUE A;  1RES A;  4JYK A;  2ECB A;  2L7Z A;  3ZQH A;  5EG0 B;  3LSJ A;  5K7F A;  5FJ8 J;  1OCT C;  2EZK A;  3SDG A;  2LFB A;  1I50 J;  2WV1 A;  3UKG A;  5K7H A;  3O8H A;  4MIM A;  4BY1 J;  5DS9 A;  5F0C A;  5C44 J;  4M3E A;  2DMN A;  1GVD A;  2DA3 A;  2DTZ A;  1RKW A;  3MN2 A;  2MW8 A;  1VFC A;  3BTL A;  3TW7 A;  2R5Z B;  3FKI J;  4XRM A;  3ZQC A;  5IPA A;  4FTH A;  1JJ6 C;  1FIP A;  1ETO A;  2NOG A;  2XRL A;  1I6H J;  5GP9 A;  2CUF A;  3PM1 A;  2FJ1 A;  1HF0 A;  2ECC A;  1ZR2 A;  2R5Y A;  3E7L A;  1QVU A;  4A93 J;  1LE8 A;  3Q3S A;  4M3D A;  3CMY A;  3MVP A;  3TW6 A;  2O9L A;  4A3I J;  1TWC J;  5EG0 A;  1UG2 A;  2DA4 A;  3ZQL A;  1HDP A;  2LR8 A;  3FIS A;  2CRG A;  2NS8 A;  1BW5 A;  2Y0S N;  2LY9 A;  2VI6 A;  3ZQI A;  2DMU A;  1FTT A;  1A5J A;  1FTZ A;  1F43 A;  1T33 A;  1OCP A;  1IUF A;  4RDU A;  3M3Y J;  2R5Z A;  2EZL A;  2EZI A;  1E3O C;  1XC5 A;  2K9S A;  1ETK A;  2AO9 A;  3BQZ A;  1JKO C;  2EH3 A;  2VKV A;  5C4X J;  3L1P A;  2GLO A;  3BTC A;  1BW6 A;  2H8R A;  3GTJ J;  1DU6 A;  3ZQG A;  1IC8 A;  2HOS A;  3K7A J;  2HYJ A;  5IP9 J;  4IHW A;  3CQZ J;  3BT9 A;  4M3F A;  4AC0 A;  1ZQ3 P;  2R7Z J;  4A3B J;  3C2B A;  2TCT A;  1BA5 A;  3BG5 A;  3IV5 A;  3Q0V A;  1FJL A;  5J3L A;  2M9H A;  2O8K A;  5E3M A;  3A01 B;  3H3V K;  1PUF B;  1TC3 C;  4D5F A;  5GPC A;  5EEA A;  2HQ5 A;  5EZH A;  5IP7 J;  2Y30 A;  4JX5 A;  1ETX A;  1HDD C;  2E2I J;  3RKQ A;  1RKT A;  1RPW A;  5J1R A;  5C4J J;  2FD5 A;  3HB9 A;  1B72 B;  3NAU A;  2R92 J;  1K61 A;  2I10 A;  2L0K A;  2JA5 J;  2G0E A;  4A3C J;  3A03 A;  3HBL A;  1BJZ A;  5E3N A;  3PO3 J;  2L9R A;  2W48 A;  3JRA A;  1ETW A;  2JA8 J;  1ITY A;  2M8G X;  1B8I B;  2ZB9 A;  3OSF A;  5F0F A;  1SFO J;  1HLV A;  2K40 A;  4XK4 A;  5E3L A;  4JP0 A;  4D7N A;  4XID A;  3FK6 A;  4QTR A;  1Y1W J;  5DTD A;  1Z77 A;  3A01 A;  3DCF A;  1PUF A;  1BL0 A;  3S15 J;  3IH2 A;  3HKZ N;  2Y9Y A;  3CCY A;  5FKO A;  1GDT A;  2O7O A;  4V2F A;  1K83 J;  1ZR4 A;  4NDL A;  5IYB J;  3GTL J;  2LVS A;  1MBF A;  1WCM J;  1B72 A;  2DA1 A;  3JRF A;  3JRG A;  3HOU J;  5EYR A;  3S17 J;  4DYQ A;  4FIS A;  4JX4 A;  3O8G A;  1VI0 A;  1YRN B;  2D5V A;  1TWG J;  1S7E A;  5EGO B;  4BBS J;  2P81 A;  1AHD P;  1UMQ A;  1B8I A;  5IOY A;  1HCR A;  5HOD A;  1MBH A;  1FEX A;  3S2H J;  2JA6 J;  4A69 C;  3GTO J;  1TWA J;  1Z0X A;  4DYR A;  4CYC B;  2QCO A;  2CQQ A;  4J19 A;  3BR0 A;  4B1R A;  2N8G A;  2PMZ N;  2MSY A;  5F27 A;  2E1O A;  4IHY A;  1EF4 A;  4BBR J;  3SJM A;  4IHV A;  1WH7 A;  5IP6 A;  2E19 A;  1MSF C;  2E2H J;  2LTP A;  5EDN A;  3HEF A;  2XPV A;  3BR3 A;  2EQR A;  3BTI A;  4IEJ A;  3GTQ J;  1IRZ A;  1OFC X;  1U78 A;  4MLO A;  3IH4 A;  1JKP C;  3S1R J;  2LLK A;  1YRN A;  5EGO A;  1NK2 P;  5M5X J;  5E3O A;  1JKR C;  4W97 A;  2JMW A;  1JTY A;  1D5Y A;  4C2M J;  5EF6 A;  3JRI A;  1JUM A;  3G1O A;  1NK3 P;  3BTJ A;  3H0G J;  4XRS A;  3JR9 A;  4BY7 J;  3FIW A;  4L5E A;  3B6A A;  1IDY A;  4CYC A;  2JJ7 A;  4A3J J;  3Q0W A;  2XGE A;  4I76 A;  3M4O J;  3BG9 A;  3HOX J;  2GBY A;  1AKH B;  4HNV A;  1JT6 A;  4MFD A;  4DZP A;  3LSG A;  4EEF G;  1MBJ A;  2DA2 A;  2CU7 A;  4RBO A;  3TED A;  3BR5 A;  5M5Y J;  2OPT A;  2E2J J;  4AUX A;  3S16 J;  1A6I A;  2R0Q C;  5M5W J;  3Q0U A;  3GTG J;  1RR7 A;  2IAI A;  1MH4 A;  3OOU A;  5JLX A;  4FCY A;  4QSH A;  2L7F P;  1H8A C;  3S1N J;  3HOW J;  5M3M J;  3F0C A;  3GTM J;  5FLV A;  4A3E J;  2XGC A;  4JX6 A;  1JUP A;  4A3F J;  1ORK A;  1VF9 A;  3SFI A;  4GFB A;  1MBK A;  1MBE A;  5J1Y A;  2K9Q A;  2XB5 A;  3D1N I;  3GTK J;  2YU9 J;  3NAR A;  5F04 A;  2X6O A;  1ETQ A;  3LOC A;  2VKE A;  5FKM A;  4D5C A;  1XS9 A;  2XB0 X;  1AKH A;  3HOV J;  3ZQF A;  2IBD A;  3HOY J;  2LD5 A;  3WHC A;  4UUS B;  4BKX A;  1IDZ A;  3I4N J;  3QQA A;  3S1M J;  3HGY A;  4S0H B;  5FLM J;  4D7M A;  2MG4 A;  1Y1V J;  5IOZ A;  3HOZ J;  1SAN A;  2IEK A;  2JK3 A;  2FX0 A;  1P7J A;  2VUM J;  4A3K J; 
#chains in the Genus database with same CATH topology
 3PL8 A;  1MJ9 A;  4XN0 A;  3I53 A;  2BY0 A;  4IOC F;  2HI3 A;  4A3M J;  2PI0 A;  2EFQ A;  2VQL A;  2XVC A;  1GHC A;  5LHH A;  3REO A;  2HTJ A;  1MGT A;  4G94 A;  4C3J J;  1U9N A;  5IYC J;  3LSP A;  5JVG F;  1S72 I;  2V1U A;  3CDL A;  3H1C A;  3COA C;  3KEQ A;  1T56 A;  3ZN0 A;  5DDG A;  3AL0 B;  3KPH A;  1Z6T A;  3E6B A;  1WI3 A;  3W6V A;  1PUE E;  2FNA A;  1MDM A;  1I3Q J;  2IS6 A;  2ZJ2 A;  1XGO A;  1TQI A;  4XKC A;  3ISP A;  4HBL A;  2E35 A;  2CWE A;  4P1W A;  2VKD A;  3PIP F;  3CUQ C;  1T6S A;  2OZ6 A;  2DA5 A;  1G3T A;  1TWF J;  3CJQ B;  1FMV A;  2L7M P;  2VOD A;  2ZXH A;  2LSO A;  1MNM C;  2IGK A;  4E7S A;  3JRC A;  4BYY A;  3K6G A;  4HQM A;  4B48 A;  3OMY A;  3MWM A;  3X2Q H;  4FE4 A;  2UWM A;  1U9O A;  1ZRE A;  3I4M J;  5GAG J;  4BQA A;  2QGU A;  1GUU A;  2KT0 A;  1KQ0 A;  4RS8 A;  2BY1 A;  3LQQ A;  2EV6 A;  2EIK H;  2FQ3 A;  2FRH A;  4Y17 A;  2EV0 A;  2ZNZ A;  4GYG A;  4HDU A;  4BNC A;  1WH5 A;  2FXA A;  3RPQ A;  4NQW B;  3VSL A;  1R5G A;  4YEJ A;  2XAF A;  4MFE A;  1PP7 U;  1YJW I;  3F21 A;  3F8M A;  4DNC A;  1ENH A;  3GZN B;  2DO7 A;  2DK8 A;  3BG3 A;  5IYD J;  3ZOB A;  1SD6 A;  2M0M A;  2UZK A;  3FZV A;  5LLQ A;  4EJT A;  2NVY J;  4EJU A;  3JRE A;  1S7O A;  3F8F A;  3ABM H;  4LG3 A;  4KT6 A;  3ROU A;  2DA7 A;  4AU7 A;  4LK1 F;  4Y7N J;  3WTT C;  1J75 A;  3K70 C;  5LGN A;  2HDD A;  3CZ6 A;  2GIZ A;  3KP6 A;  4RM3 A;  5D4S A;  2CV1 A;  2DU9 A;  2XPW A;  4PJN A;  5B1B H;  4P55 A;  3TP0 A;  4FE7 A;  3W6J B;  1IJW C;  3A02 A;  4EM2 A;  1Q1V A;  1KQ8 A;  1EH6 A;  1RZ4 A;  1MBG A;  3EUK L;  3QU6 A;  2R7X A;  2MGQ A;  1J9I A;  1VQO I;  2J5P A;  4TV7 A;  1OKR A;  2LNB A;  3RPU D;  2ME0 A;  4UUT A;  1Y39 A;  4HNU A;  4NQW A;  3HOS A;  1FX7 A;  3EYY A;  5AIQ A;  1NG6 A;  3ECO A;  2A6T A;  3C3W A;  1JGG A;  4B8X A;  2X4H A;  2TDX A;  2Y69 H;  3S2D J;  2LRD A;  1VZ0 A;  4EM1 A;  4F7Z A;  3NRV A;  3L2C A;  1XGS A;  3OYG A;  3G6E I;  2M7B A;  3FBI B;  2R7S A;  3VYR B;  5E79 C;  2XKO A;  5DD4 A;  4F93 B;  2JN6 A;  3LAP A;  3CME I;  4AIJ A;  3HDD A;  1ZTR A;  1FC3 A;  1P2F A;  2QF7 A;  3ZRG A;  5K5Q A;  3KP4 A;  2DPD A;  2EFO A;  1ETY A;  5BNG A;  4AD9 A;  1YFH A;  3KP5 A;  2FOW A;  2IS1 A;  2HWV A;  5B5E C;  3MZ8 A;  4G6Q A;  1TP4 A;  3W2W A;  2DI3 A;  2WY7 Q;  2WB1 N;  3MAJ A;  2OAZ A;  3B6C A;  1B9N A;  5GAH J;  2H94 A;  4WXH A;  3RZD J;  2Y75 A;  1GV2 A;  4UB8 C;  5ERI A;  4M3G A;  2CH0 A;  2IRF G;  4PJL A;  3K0L A;  3AAF A;  1BIB A;  2RDP A;  2ZME B;  2QEX I;  3K4M A;  2QEN A;  1I6X A;  4UUV A;  1HKT A;  2CUE A;  2VJJ A;  2Z99 A;  5LRS A;  4I99 C;  5EG0 B;  1DP7 P;  3OYI A;  3H9Q A;  1ZG5 A;  2I5U A;  3HSE A;  2M4G A;  2VXD A;  3S2W A;  1I50 J;  1TBX A;  4XOT A;  3O8H A;  3WTS C;  3CUO A;  2K86 A;  1ZG3 A;  3F3X A;  3HOY J;  2XKP A;  5JVT A;  4G6T B;  2Z16 A;  2LG4 A;  3MN2 A;  1QZY A;  4CH7 A;  2E34 A;  3BTL A;  4N9I A;  4FET A;  3IAM 2;  1ULY A;  2W24 A;  5GAE J;  1HW5 A;  4G7H F;  3F6O A;  4FTH A;  1JJ6 C;  1R36 A;  4RLQ A;  1UCR A;  3VWB A;  4GGG A;  3DWL E;  1FIP A;  1OLT A;  2MLK A;  2NOG A;  2OD5 A;  5GP9 A;  3L2W A;  3RDI A;  3PM1 A;  1IN8 A;  1W5C C;  2C6Y A;  2R7O A;  3VFZ A;  2ECC A;  3F9K A;  3KZZ A;  3LA7 A;  4LK0 F;  3SFZ A;  1ZR2 A;  2EJR A;  4PJ0 C;  3Q3S A;  3L2R A;  1W5T A;  4M3D A;  3CMY A;  5FD5 A;  2ZME A;  4A3I J;  5EG0 A;  3O2P E;  2DA4 A;  2PMZ A;  1SD5 A;  3BZK A;  3ZQL A;  3ESW B;  1HDP A;  3FDY A;  4HW0 A;  2IS4 A;  4AVP A;  3SEZ A;  1VTN C;  4BAY A;  2DAO A;  2VJI A;  3C1D A;  3ZMD A;  2D2W A;  2GA2 A;  2VI6 A;  4HX7 A;  3ZQI A;  2DMU A;  3I54 A;  3T1B A;  3QP6 A;  1F43 A;  2D45 A;  1T33 A;  1OCP A;  3SEQ A;  2EA2 A;  3JTG A;  1K6Y A;  4RDU A;  3M3Y J;  2YSR A;  1VQK I;  2EZI A;  2OC6 A;  3DPU A;  1BOA A;  2Z2S B;  2K9S A;  1ZGA A;  2ZFU A;  1KYZ A;  3P7N A;  3T0Y A;  1SEU A;  5L3D A;  3KIO A;  4WXD A;  2EH3 A;  2VKV A;  3C2G A;  2GLO A;  2EPF A;  3BTC A;  1X3U A;  4XQF A;  4HYE A;  3DPL C;  3ZQG A;  2WC2 A;  3GFL A;  1IC8 A;  2HOS A;  3E6D A;  4HF0 A;  1XX5 A;  4AIH A;  5IP9 J;  3OYJ A;  4C2T A;  5FD6 A;  3CQZ J;  4M3F A;  3H9J A;  1ZQ3 P;  1BR4 A;  2M5W A;  5JHF A;  2F48 A;  2TCT A;  3ZMU A;  2O0Y A;  3IV5 A;  2M9H A;  2O8K A;  2W57 A;  3H3V K;  3A01 B;  1PUF B;  2DXI A;  4HEA 2;  1IAW A;  5D8L B;  1HXD A;  2HQ5 A;  5EZH A;  4WWC A;  3ABU A;  4L0Z B;  3CJT B;  3TOB A;  2KZG A;  4WCG A;  3DLL F;  5LD2 C;  1U3E M;  4GO1 A;  4ANJ A;  2NS0 A;  1YIT I;  2HFH A;  2E2I J;  1RPW A;  4P5O A;  3HHH A;  2FD5 A;  3HB9 A;  2X51 A;  3K1N A;  2R92 J;  1K61 A;  4BU2 A;  3FBN B;  1R5I D;  1UST A;  3HUG B;  4A3C J;  3A03 A;  3HBL A;  2DT6 A;  2W48 A;  1DQU A;  2IP2 A;  1EV7 A;  2DOF A;  2OU2 A;  3L2U A;  3OSF A;  4HAM A;  2QQ9 A;  3ZQQ A;  4IRH A;  5F0F A;  1SFO J;  1KA8 A;  4M9X A;  3OOP A;  1HLV A;  2HTS A;  3HRS A;  2IA0 A;  2P5L C;  2HQN A;  4BAC A;  2AQE A;  3FK6 A;  2OBP A;  5DTD A;  2L9S A;  4IX7 A;  1Z77 A;  4B44 A;  3A01 A;  1PUF A;  3OYL A;  3JW4 A;  4ESF A;  4BQQ A;  3TL4 X;  2P6T A;  1GDT A;  2DOE A;  2V4J C;  4EJV A;  3A2K A;  1QPM A;  2GIV A;  4MNU A;  3CCM I;  3WTY C;  4NDL A;  4U88 A;  1K7A A;  3GTL J;  2BXZ A;  5ILU A;  1SFX A;  1WCM J;  2DA1 A;  3DKW A;  1FP1 D;  4ZDO A;  3JRF A;  3EUA A;  3ML6 A;  3SXY A;  3S17 J;  2QWW A;  3HUG A;  4DYQ A;  3O8G A;  2VBZ A;  1VI0 A;  2FBK A;  1FOW A;  1YRN B;  4HOB A;  3WOD F;  2Q0O A;  2L02 A;  4OOI A;  3CO7 C;  1W5S A;  1FEX A;  3K10 A;  4PK4 A;  5ED4 A;  1BI0 A;  3GTO J;  2KZV A;  3ZN1 A;  4CYC B;  4I7H A;  3S3M A;  2FE3 A;  2CQQ A;  4B1R A;  2ADU A;  2F2E A;  1DDN A;  3LSK A;  3P5J A;  3DLA A;  3K4C A;  4EQQ A;  4IHY A;  2G9W A;  2KRF A;  2Y48 A;  3V4G A;  4BBR J;  3IRR A;  2CW7 A;  2E1M B;  4AYB A;  1LPQ A;  5IP6 A;  2E19 A;  3WU1 B;  1UZC A;  2XF5 A;  3SHF A;  2M3A A;  1J59 A;  2WA0 A;  1OPC A;  2LTP A;  5KAI C;  2XPV A;  1Z6R A;  2E60 A;  2JRM A;  3BR3 A;  3BTI A;  4BXF A;  2V9K A;  5B66 C;  1MNE A;  4OIO F;  3SDB A;  3BC8 A;  4IHS A;  5BQT A;  1JKP C;  2PX9 A;  4IOA F;  2UV1 A;  4MQV A;  1YRN A;  1T8I A;  1OYW A;  2A05 A;  3WE2 A;  3AL0 C;  3KCC A;  1YQA A;  2HYG D;  2O5R A;  1QA6 A;  3N05 A;  4ZYA A;  3MCZ A;  1YI2 I;  3WTX C;  1LB2 A;  1B6A A;  1X1C A;  1Z1D A;  1F4K A;  4YFX F;  3AG4 H;  4EGY A;  1IDY A;  4CYC A;  3TQN A;  4A3J J;  1R4N B;  2ZNY A;  2IT0 A;  2OTJ I;  4I76 A;  2WAD A;  1R6R A;  3PNY A;  5TGT A;  3M4O J;  2H09 A;  1XMX A;  3BG9 A;  3DP7 A;  4CCO A;  3B02 A;  3M7G A;  4HNV A;  3VDX A;  4KN7 X;  2BV6 A;  4F52 A;  5AON A;  3I59 B;  2DA2 A;  1MMA A;  2MD5 A;  2QLZ A;  4RBO A;  2P6S A;  3V7S A;  3GFI A;  2OPT A;  4C9Y A;  2K9M A;  2E2J J;  1S3J A;  1XDS A;  4AUX A;  4PSX A;  4XM3 A;  2KRC A;  5M5W J;  5GTI C;  3KFW X;  2EFP A;  3BJA A;  3D5R C;  2ELH A;  2KP6 A;  4RAY A;  1J0R A;  2IAI A;  5JLX A;  1VQP I;  4FCY A;  2HPM A;  1H8A C;  3S1N J;  3H9G A;  1TTY A;  1YX5 A;  3DEE A;  1Z3X A;  4DBR A;  1VF9 A;  4GFB A;  4HPQ A;  2YU3 A;  5L3G A;  2F4M B;  3MMY B;  5DM6 F;  2V6E A;  2X6O A;  3LL7 A;  3OYE A;  1ETQ A;  1X4P A;  1WJF A;  1EH7 A;  3J7Y J;  2HNH A;  2KHM A;  3LWF A;  2LY1 A;  2HDW A;  2DDB A;  4LMY A;  3IHU A;  1X1A A;  1IDZ A;  1IUY A;  2CS3 A;  3I59 A;  4KMF A;  3HGY A;  1QHH D;  2YX4 A;  3FF5 A;  1Y1V J;  1VQN I;  5IOZ A;  3M8J A;  3HOZ J;  2KLO A;  1AOY A;  2VUM J;  1MMS A;  4L9N A;  1MSE C;  1CGP A;  3G1M A;  3G3Z A;  3RKX A;  3K1M A;  3JRH A;  1XG1 A;  2MC4 A;  1U8B A;  2ETH A;  4A0X A;  2HOT A;  4B43 A;  2CQ7 A;  1PP8 F;  2IA1 A;  3IP4 B;  1O3T A;  2VLA A;  2O61 A;  4CYD A;  1JGS A;  2L01 A;  4IRG A;  1WVR A;  2QKM B;  3FM5 A;  4C3H J;  1E3H A;  2VBX A;  1U0J A;  5HS8 A;  1LDK B;  3E6C C;  5J8C A;  2XGX A;  3HTU A;  3QYF A;  2MFZ A;  3BCA A;  3GFJ A;  4I0B A;  1IV6 A;  2P5K A;  4CCL A;  3FMR A;  1ZK8 A;  2XSJ C;  2KDO A;  4FHT A;  1APL C;  2Y2Z A;  1A31 A;  2ELK A;  3ZGK A;  1H0M A;  1P92 A;  2P0W A;  4V19 K;  4XRS G;  2A3S A;  2QQB A;  4KN4 X;  4A0Z A;  3KZY A;  5JFR A;  1USS A;  1WJ5 A;  2VQG A;  2Q1Z B;  3M9A A;  4CCN A;  3CC4 I;  1YLF A;  3F22 A;  2ELJ A;  3HYI A;  1LKX A;  1XMA A;  4I6Z A;  1JXS A;  3VPR A;  3LA3 A;  3OL3 A;  1OJL A;  3I4P A;  2XUB A;  1FIA A;  1QQI A;  2JVG A;  1RET A;  3K2A A;  2Y31 A;  1LNW A;  4O6J A;  1VND A;  2GWR A;  2XV4 S;  2RKH A;  2LKX A;  4B4C A;  2LDU A;  3DBH B;  2ZME C;  1N77 A;  4X1E A;  2Z9O A;  5HDN A;  4UVB A;  2HZD A;  3M1E A;  3P9C A;  5H6R A;  1S9H A;  1ZRD A;  4LJZ F;  1XCV A;  1C0W A;  1QVT A;  3S8P A;  5LHI A;  3H5N A;  3SZP A;  4X0G A;  2JPB A;  2OQG A;  1T95 A;  2A07 F;  1W0U A;  2B63 J;  1GLN A;  2L54 A;  3NWT A;  5TIS C;  2ZXJ A;  3DTE A;  5E8I A;  1IGN A;  1F1Z A;  2FSW A;  3H3Z A;  1S29 A;  1T2K A;  1O3S A;  1UHW A;  1CF7 B;  1FY7 A;  1KYW A;  2V7F A;  2W00 A;  2P7V B;  3VEP A;  2X48 A;  3QPL A;  2JVH A;  1YW8 A;  4DBQ A;  1VQ4 I;  2IA2 A;  2OF7 A;  1LFU P;  5FKK A;  3ZP5 A;  2NS7 A;  3HGG A;  4HX8 A;  4AVZ A;  3MZY A;  1HOM A;  4Y52 J;  1JTX A;  4BE0 A;  2GXB A;  4WF2 A;  4G12 A;  3QYE A;  4KYW A;  2VQH A;  3FXJ A;  2PLY A;  2CQK A;  4ZJZ A;  1GV5 A;  1H9G A;  3GF2 A;  2QUF A;  3F8N A;  5D5V B;  3CLO A;  4EVI A;  4OWR B;  2VON A;  3S1Q J;  4A3D J;  2VAS A;  1Y56 A;  3G1L A;  3MEX A;  4UVC A;  5CVI A;  1FPQ A;  3CCJ I;  3CCQ I;  4JBA A;  4HG2 A;  3LSR A;  4U7B A;  1CQT A;  4MTD A;  1LFB A;  1V5G A;  4FX0 A;  2COB A;  4Z2Y A;  1BC7 C;  1CF7 A;  1G3Y A;  2V26 A;  5J47 A;  1VQ8 I;  4UY8 I;  3EPZ A;  6PAX A;  2JWT A;  5E1Z B;  4IHX A;  2E7W A;  2RAE A;  3OR2 C;  4C3I J;  2HXO A;  2L5Q A;  2XGD A;  3L2Q A;  3S93 A;  4CHU A;  3K4L A;  2ZC2 A;  5M3F J;  4HST A;  2BVM A;  4D0P A;  1T39 A;  5FKN A;  3BY6 A;  5B3S H;  1J2X A;  2OTL I;  1DUX C;  3IWF A;  2R7F A;  4DQ2 A;  3DTK A;  4YFK F;  3OYC A;  4OAY A;  1H89 C;  1UHS A;  3BZ6 A;  3HXL A;  3T8R A;  1FMW A;  3BR6 A;  1LE8 B;  2HQR A;  2EIL H;  2GAU A;  5EJC A;  2PJR B;  2ME6 A;  4KIF A;  3BPX A;  4U87 A;  2COM A;  1RES A;  2L4A A;  2WAE A;  4JQF A;  2O6G E;  3F6V A;  4LIT A;  3VYU B;  1ZRC A;  3F8B A;  3M8E A;  2RV8 A;  4BDZ A;  4ENM A;  2EZK A;  3DTI A;  4ESB A;  2WV1 A;  1Z3Y A;  1FYK A;  2ISZ A;  3T8T A;  2DT5 A;  5C44 J;  2DDA A;  1EA3 A;  2DMN A;  1NG7 A;  5DV5 A;  4II3 A;  2M87 A;  3OIQ A;  3S3O A;  3N4M A;  3TW7 A;  1R00 A;  3FKI J;  1IN7 A;  5IPA A;  1FSE A;  1LFP A;  3TBI A;  3ZMZ A;  4OIQ F;  1ETO A;  1L0O C;  4KIB A;  3KP7 A;  3CJN A;  3K2Z A;  1BJA A;  1R1U A;  3PFI A;  3RIR A;  2A61 A;  3NWS A;  1REP C;  1LE8 A;  2PJR A;  2MAB A;  2LOO A;  4L9T A;  3TW6 A;  4KDP A;  1F9N A;  2JZY A;  1TWC J;  1UG2 A;  1KON A;  1OR7 A;  1WJA A;  1U5T B;  1Z7L A;  3LFK A;  4ESJ A;  1V54 H;  3FIS A;  3H92 A;  2QZ8 A;  1Q1H A;  2HEO A;  1WI9 A;  2IW5 A;  1R23 A;  2BHY A;  2KJC A;  1SVM A;  4OIP F;  4XLE A;  2LY9 A;  2FMY A;  2RQQ A;  1FTT A;  1GXQ A;  1K4S A;  1LEB A;  2M7A A;  2Q8K A;  5DCM B;  2RNG A;  5LEK A;  1IUF A;  3NEU A;  1ZAR A;  3MQ0 A;  2EFW A;  2EZL A;  3K4N A;  4BHB A;  2ZO4 A;  2XAH A;  3BG6 A;  4XLF A;  1E3O C;  2H6C A;  2EIN H;  2GXG A;  1FBQ A;  5FRO A;  1JKO C;  2ZCW A;  1LJ9 A;  5C4X J;  3L1P A;  4LIU A;  4ASN A;  3GTJ J;  2K27 A;  1R58 A;  4PDK A;  1L3L A;  1DU6 A;  4I2O A;  1ZLJ A;  1XCB A;  3OYF A;  2XRO A;  3JSP A;  5L3E A;  2HYJ A;  5FLX Z;  3V7R A;  3I71 A;  1U5T A;  2IGO A;  3R0J A;  2QSH X;  2P7C B;  2IVM A;  3IUO A;  3HHG A;  3C2B A;  1AWC A;  1S8N A;  4FX4 A;  3SZG A;  1TQP A;  2X0L A;  4B09 A;  3BJ6 A;  2KIM A;  4M6Y A;  1FJL A;  1ZRF A;  2DW4 A;  2UXX A;  3F23 A;  2ISY A;  3KEO A;  2E1M C;  3EYI A;  2DTR A;  1X3Z B;  2M30 A;  1RUO A;  2HOE A;  3E1S A;  2K7L A;  4BL0 B;  1JHF A;  5IP7 J;  5DCM A;  1SFU A;  4XMY A;  5CLS A;  4EM0 B;  1FSH A;  2GXA A;  1ETX A;  3A0B C;  1HDD C;  4ZDL A;  3R4K A;  1IRX A;  2HZT A;  5BPI A;  3KZI C;  2L0K A;  4IQ4 A;  3BZC A;  2NRA C;  3Q9V A;  4XRF A;  5E3N A;  2XAJ A;  1BJZ A;  2D1H A;  4KIS A;  3PO3 J;  2L9R A;  1E17 A;  5K5O A;  2QM3 A;  2JA8 J;  3CTA A;  4HQE A;  2FU4 A;  2XHK A;  5LRR A;  2IS2 A;  1MMN A;  1B8I B;  2ZB9 A;  5AIP A;  2KRH A;  2P4W A;  2X1E A;  2A69 F;  1DGW Y;  2K40 A;  2Q2E B;  4P96 A;  4XK4 A;  3E5U A;  3TO9 A;  4XLN F;  4P9U A;  1IXR C;  3LST A;  4UV9 A;  5HS9 A;  4QTR A;  1R71 A;  4H0E A;  2E36 A;  3RQ4 A;  3WGH A;  2HS5 A;  1BL0 A;  3S15 J;  3IH2 A;  3HKZ A;  4PGH A;  4HA8 A;  1BI3 A;  2X1D A;  2Y9Y A;  3OYN A;  1OMI A;  5E1W A;  1FOY A;  1A36 A;  3K9T A;  3VB2 A;  1YIO A;  4V2F A;  2LMD A;  3OV8 A;  4JOM A;  5KCM A;  5E17 F;  4R79 A;  3OYM A;  2LVS A;  1QNT A;  2IGM A;  1A35 A;  1ZYR F;  2VPL A;  2VE9 A;  4IZZ A;  2VE8 A;  2JTV A;  4N0B A;  1KU7 A;  4M9S A;  2D5V A;  1N25 A;  1FNN A;  4G6D A;  4U7D A;  1UMQ A;  1BIA A;  3CDH A;  4NC8 A;  1TL8 A;  1B8I A;  1KU9 A;  2AS5 F;  1W7P B;  5HOD A;  1IN6 A;  2CUZ A;  4XLC A;  5HLI A;  2Q2E A;  3KP3 A;  3J80 Z;  5HOO A;  3CJR B;  1KU2 A;  2JRT A;  2M45 A;  2HYF A;  2R7R A;  2LH9 A;  4J19 A;  3DEU A;  3QOE A;  1QZE A;  4Y13 A;  2N8G A;  1FP2 A;  3W6K B;  3OS0 A;  2E1O A;  1U8R A;  4LB5 A;  2KPM A;  1VQM I;  1SMT A;  4DGW B;  1EF4 A;  2DYS H;  4IVN A;  4IHV A;  5HDK A;  2YPR A;  4QWQ A;  4OU0 A;  1UAA A;  4UB6 C;  2W25 A;  3FHZ A;  4L9V A;  5JR3 A;  2B7E A;  5IY5 H;  2E2H J;  5D5U B;  3KLN A;  2GOX B;  4BGD A;  3K4J A;  2RVC A;  1IRZ A;  1OFC X;  1U78 A;  2X6X A;  3GFM A;  1TT0 A;  5E20 A;  2VC1 A;  4QPQ A;  3GEZ A;  2E1N A;  1QHG A;  1JKR C;  1JTY A;  3RJP A;  1W7P A;  4ON0 A;  2NVU B;  5EF6 A;  2H1L A;  5BS6 A;  3BRO A;  3P9K A;  3MZH A;  3CF2 A;  4ETS A;  3L00 A;  1N78 A;  3HJE A;  2XGE A;  4ENJ A;  3VSK A;  3HOX J;  3H5R A;  1JT6 A;  4UVA A;  5HNF A;  5L3F A;  3FXL A;  3R0A A;  4EEF G;  1IO2 A;  2DK5 A;  3GYH X;  3UR3 C;  5FLX K;  2CU7 A;  3OS2 A;  5M5Y J;  5CPR B;  1A6Q A;  1E3P A;  1P4X A;  1JHH A;  1A6I A;  1O7F A;  4KT5 C;  4CSW A;  1ONV A;  5ICF A;  1P4A A;  3GTG J;  3J7A O;  3TDZ C;  5K1Y A;  3OOU A;  4Q5S F;  1IW7 F;  1Y0N A;  1YJN I;  4L9J A;  1SC7 A;  2X6W A;  3HOW J;  3F0C A;  3U21 A;  2BGC A;  4ZYE A;  2EIM H;  1KU3 A;  4A3F J;  4G7O F;  4KJZ A;  1ORK A;  3SFI A;  2IGN A;  5J1Y A;  1TZL A;  2O3F A;  2PG4 A;  3D5L A;  3SYT A;  1R5H A;  4IHT A;  4HX4 A;  2QSG X;  2VJ4 A;  3LOC A;  2VKE A;  3BJO A;  3HPH A;  5KK1 A;  3HOV J;  4Y15 A;  5HS7 A;  4GYI A;  1B59 A;  2IBD A;  2V9P A;  4ZC3 A;  2DLL A;  4G8X A;  2CUJ A;  3ZMS A;  3I55 I;  4BKX A;  4KIC A;  4BQN A;  3A0H C;  3I56 I;  4L5I A;  3RYR A;  5L3C A;  3S1M J;  2PEX A;  4CUG A;  5FRN A;  5FLM J;  3WGG A;  2L3D A;  4BE1 A;  5CQE A;  1WFX A;  3DU6 A;  2ZSH B;  2K85 A;  2EA4 A;  4E4H A;  1SFK A;  2WAQ A;  1U2W A;  1WGX A;  2HXI A;  4MEX F;  2R3S A;  3DXJ F;  4XKW A;  3ASN H;  1HKS A;  1OCR H;  2H1K A;  5FRM A;  4BXX J;  2KDZ A;  5GPA A;  4LGW A;  1X3W B;  1VQ6 I;  5F1J A;  3DQV C;  4XKB A;  3PO2 J;  3PNT A;  4DW6 A;  1DU0 A;  3H3U A;  2M4K A;  2V1N A;  3ERM A;  3BDD A;  5JI6 A;  3PIO F;  3IKV A;  5F6F A;  3CCL I;  4LOC A;  2V1X A;  3JRB A;  1Z05 A;  3CUQ A;  3G4S I;  4CGZ A;  5D5X B;  3J81 Z;  3EUH A;  2K9N A;  1S5L C;  3DKY A;  2NVT J;  2OUM A;  3J80 K;  3OYD A;  4R8H A;  3Q5F A;  2TRT A;  3RZO J;  1Y0U A;  2IJL A;  2YUS A;  1WPK A;  3U1D A;  2QQ8 A;  1UEL B;  3MKL A;  2RNJ A;  2A68 F;  3G73 A;  1P4W A;  4YG2 F;  4IL6 C;  1HA8 A;  5C3E J;  2NVX J;  4RB3 C;  1J5Y A;  1NTC A;  3KYC B;  3QPS A;  2DPU A;  2AHQ A;  1X2N A;  3L09 A;  4DYC A;  1PDN C;  1TNS A;  4M71 A;  3WGI A;  3FWE A;  1W4M A;  4BHC A;  1GVJ A;  2K3P A;  3C7J A;  2RC4 A;  1POG A;  3GBG A;  1HQC A;  2JSC A;  3H5A A;  4JK1 X;  1ZKG A;  2EK5 A;  2R93 J;  4IXA A;  4LIV A;  3BCB A;  1OR7 C;  2A5Y B;  2E5N A;  4MO7 A;  4XLA A;  1FZP B;  4LB6 B;  4WX9 A;  5FFZ A;  3LA2 A;  5EEG A;  3BG7 A;  4F92 B;  2F5D A;  3S14 J;  4QPO A;  2LC2 A;  1UG0 A;  3F8C A;  5H2F C;  2D1V A;  4WXC A;  1ZHF A;  2V79 A;  2ZSI B;  3RSN A;  2CV0 A;  1LDJ A;  1U6G A;  4M9Z A;  4BJ5 C;  4QIW N;  1JUS A;  4NC7 A;  4ABZ A;  2LK2 A;  1G59 A;  3NQO A;  3V8K A;  4E7Z A;  4QLC U;  1J09 A;  3K69 A;  2AXL A;  4E7I A;  2F5V A;  1O4X A;  4XOR A;  2VOO A;  2CJJ A;  2LKP A;  2DQL A;  1K6O A;  1FT9 A;  4BS9 A;  4XN3 A;  4RGX A;  3S32 A;  2F6C A;  3HM5 A;  3GWZ A;  3TDU C;  2ESH A;  4CIC A;  4A3G J;  4FQG A;  3FXK A;  3FK7 A;  3ZMV A;  3ASO H;  1ETV A;  2I8D A;  3TO6 A;  2VT2 A;  4N4N B;  1D3Y A;  1ZLK A;  1QRY A;  4RAF A;  1T0F A;  3RYP A;  3KYD B;  1ZAO A;  2W85 A;  1R9T J;  3QAH A;  2CW8 A;  1U5T C;  4EJW A;  3W2A A;  4A2U A;  5FO5 A;  1X1D A;  4B3A A;  1KQ9 A;  3VOD A;  3K4B A;  2A6E F;  3H35 A;  3GTP J;  4FAS D;  2FQ4 A;  2STT A;  4AWX B;  4V2G A;  1HSJ A;  2M2E A;  4HLY A;  2KIF A;  2X6Y A;  3W3C A;  1TT5 B;  2JA7 J;  1ON2 A;  3DU5 A;  4OMZ A;  1FYL A;  2G7H A;  2M1B A;  4E7L A;  2XDV A;  3OYA A;  1UHM A;  4XIC A;  4CZC A;  1JKQ C;  3TP3 A;  5FKL A;  2W84 A;  1X58 A;  4DZJ A;  3JAM Z;  5K5R A;  1E0E A;  1G6N A;  2X85 A;  4X6A J;  2STW A;  2W7N A;  5L3B A;  5JLW A;  2MH2 A;  2M0C A;  3HC7 A;  1IG7 A;  4LLL A;  1X19 A;  4OIR F;  2OJE D;  1NHA A;  4ZZD A;  3IL2 A;  2EWN A;  1X2M A;  5CVR A;  3E5Q A;  3J7A Y;  1XSD A;  1GT0 C;  2QSF X;  1JJ8 C;  4D1Q A;  3JCU C;  1I27 A;  4AM3 A;  2MLG A;  2FF4 A;  4PJJ A;  1IN4 A;  4IKF A;  4JYK A;  1J7K A;  2NNN A;  2DOA A;  3LSJ A;  5CVJ A;  1D0Z A;  5K7F A;  5FJ8 J;  1OCT C;  2QBY B;  3SDG A;  3DFG A;  1PVE A;  2LFB A;  3SZT A;  2FUG 2;  4ZYD A;  3UKG A;  3GX4 X;  1TQM A;  4MIM A;  3WTV C;  4BY1 J;  3WTW C;  5DS9 A;  5F0C A;  3WG7 H;  4M3E A;  4EAT A;  1QBJ A;  1OYI A;  3TKY A;  1VQ5 I;  2DTZ A;  3CP2 A;  1XB4 A;  1RKW A;  2BBY A;  3I58 A;  1OIS A;  2O8X A;  2MW8 A;  3FHN A;  3C2H A;  1OYY A;  2R5Z B;  3ZQC A;  3J81 K;  3JTH A;  3MD2 A;  4PGG A;  3LFU A;  4OMY A;  3IAS 2;  5DCF A;  1I6H J;  2KL4 A;  1WWX A;  1ACI A;  2FA5 A;  1LEA A;  3GLL A;  1VQL I;  3QP5 A;  1TNT A;  5LGU A;  2K4J A;  3OYH A;  2LR8 A;  2CW0 F;  2WBM A;  2QBY A;  3HIF A;  1FOX A;  4Q4Z F;  2XAQ A;  2NS8 A;  1I3A A;  1D1B A;  2Y0S A;  4XON A;  1V5F A;  3HOT A;  5DUK A;  2ZJP F;  1DPU A;  2YR2 A;  1P6R A;  4NNJ A;  4E70 A;  3C18 A;  4ZTF A;  5HNH A;  3OIP A;  1A5J A;  1FTZ A;  3FX3 A;  3CC2 I;  2R7T A;  1R1V A;  1SAU A;  2R5Z A;  2E1C A;  1IRF A;  1MZB A;  1OCC H;  2RN7 A;  2FML A;  2LF8 A;  4LD5 A;  2AO9 A;  3BQZ A;  2RGV A;  3KEY A;  4WK8 F;  3RPU A;  1R4M B;  5ICE A;  2NNY A;  2VN2 A;  1MJB A;  4HV5 A;  1R1T A;  4UV8 A;  2H8R A;  4RM2 A;  2F4I A;  2VOP A;  2PFB A;  2Z3Y A;  4PUS A;  2PMU A;  3HSR A;  2GZW A;  4BUP A;  4CDG A;  3FKJ A;  4C30 A;  2VL8 A;  2Z5U A;  3BWG A;  1KGS A;  4IHW A;  1D1A A;  5HLG A;  3LSI A;  2LY2 A;  5HLH A;  1IN5 A;  3OS1 A;  2KJB A;  1YO5 C;  3O3K A;  3P9I A;  3AG3 H;  4AID A;  1FYM A;  3DKX A;  5B1A H;  4AIK A;  2O03 A;  3PSF A;  5GPC A;  3KET A;  4NHJ A;  4ZZL A;  5DM7 F;  3VYT B;  2WWY A;  2EB7 A;  2Y30 A;  1DGR M;  1S7A A;  4JX5 A;  3GW2 A;  5D4R A;  2ZBK A;  2E5Z A;  1BI2 A;  3AG1 H;  3U1K A;  5J1R A;  5C4J J;  3L7W A;  2WTE A;  1H9T A;  1Y6I A;  3CCU I;  2F5E A;  1B9M A;  2G0E A;  4PFO A;  5A2Q Z;  3JRA A;  4P9F A;  1ITY A;  2JA2 A;  2DT7 B;  3JAM K;  3HSF A;  3PNV A;  3PFY A;  3BLY A;  2LBF B;  3M1C A;  2YX7 A;  3PJR A;  4D7N A;  3DPT A;  4XID A;  3LSH A;  2PQ8 A;  1Y1W J;  1FBS A;  2GA1 A;  3DCF A;  3EQL F;  2NYX A;  3HKZ N;  3CCY A;  4PFP A;  4B47 A;  1SD4 A;  4BXU A;  4MGR A;  2EFN A;  5KVR A;  3GO5 A;  2OCC H;  1MBF A;  4A6D A;  4E7H A;  1HBX G;  3HOU J;  2HDC A;  4FIS A;  1YHQ I;  2W4S A;  2XF7 A;  1BR2 A;  1TWG J;  1S7E A;  5EGO B;  1BI1 A;  1MND A;  1WJB A;  2P81 A;  4YIF A;  4PJM A;  3TMO A;  4BBS J;  3CCR I;  1AHD P;  3ZCO A;  4B3X A;  5IOY A;  2FBH A;  1MBH A;  3ECH A;  5F1R A;  3S2H J;  2CFO A;  2LBF A;  3WG9 A;  3HRM A;  3QOP A;  5CQG A;  2EV5 A;  4DYR A;  2QA4 I;  5GTH C;  1QU3 A;  2QCO A;  4Y3O A;  3RKW A;  4XNF A;  3FXU A;  2HR3 A;  3EUH C;  1EKE A;  2OV7 A;  2PMZ N;  2VBW A;  3W2V A;  2ESN A;  1HKQ A;  1YE9 A;  3FXR A;  5DYM A;  5LGT A;  2R4G A;  2L4M A;  2EIJ H;  4GRI A;  2M8E A;  3MKZ A;  1K4T A;  2JQ7 A;  3K1P A;  2EQR A;  2HGC A;  1G3S A;  4IEJ A;  4Y4R A;  4EJO A;  1G4D A;  4RGS A;  1IXS B;  1X1B A;  1Y8R B;  4XR6 A;  5D6E A;  3S1R J;  2DYR H;  5H20 A;  3LQR A;  3BOQ A;  1ON1 A;  5EGO A;  1W36 D;  1NK2 P;  1DPR A;  2MC3 A;  5M5X J;  4NB5 A;  2LRE A;  2JMW A;  3ABK H;  2KMU A;  4C2M J;  4E7K A;  1D5Y A;  3JRI A;  3CDI A;  3I3L A;  3G1O A;  1MJA A;  4CA0 A;  4PZJ A;  3E6M A;  3GUD A;  4XRS A;  5DD8 A;  4IO9 F;  3VOE A;  3RCO A;  4L5E A;  1JE8 A;  3DBL B;  1STZ A;  3B73 A;  3Q0W A;  2RQP A;  2FBI A;  3KYL A;  2NAZ A;  4DZP A;  3LAJ A;  3FXO A;  2WV0 A;  1G3W A;  4BEH B;  2VJ5 A;  2KIQ A;  3V42 A;  3BR5 A;  2BOL A;  3TED A;  2NOJ B;  2P8T A;  2DFF A;  3S16 J;  4ZYG A;  4DIQ A;  4RB0 A;  4II2 A;  3O6B B;  1RR7 A;  3GME A;  1MH4 A;  1I1S A;  2R7Q A;  5CJ9 A;  4BJT A;  5M3M J;  3LSM A;  3ZXS A;  2RRE A;  3GTM J;  5ILV A;  5FLV A;  2R7D A;  4JX6 A;  4A3E J;  1JUP A;  2VKH A;  4RAG A;  2JPC A;  1T0F C;  1MBE A;  1R7J A;  4NBQ A;  3A1Y A;  2K9Q A;  4M6X A;  2KQR A;  3HZJ A;  3HG9 A;  2Y0M A;  2YU9 J;  2LF7 A;  5F04 A;  2OZU A;  2W1O A;  1WJC A;  3WU0 A;  5FKM A;  5IT9 K;  1ZG1 A;  2LYC A;  2XAG A;  2VQC A;  4NUB A;  5A2Q K;  3ZQF A;  4RGU A;  2FNP A;  5ICG A;  4UUS B;  2UXN A;  1WRJ A;  5E18 F;  1Z9C A;  2KIU A;  3CC7 I;  3G2B A;  3GVA A;  4S0H B;  4BEH A;  1Z67 A;  4RGR A;  1YG2 A;  2MD0 A;  2BY3 A;  1Z7U A;  4KIT B;  4ENK A;  3G71 I;  3WTZ A;  2QQA A;  4RLF A;  2AXT C;  3HRU A;  2FX0 A;  1P7J A;  1UJ8 A;  5DUI A;  2VBY A;  2P5V A;  4A3K J;  2R7U A;  2WAQ N;  5KNL A;  4BH9 A;  1ZEL A;  4HSR A;  3MKW B;  4G9Y A;  1XMK A;  2VB6 A;  3LNQ A;  4XLP F;  4G7Z F;  3I9V 2;  2IXS A;  4FT8 A;  4KNY A;  1D8J A;  3JRD A;  3OL4 A;  4CO8 A;  2YS9 A;  4M74 A;  1XSX A;  3WU2 C;  1KZH A;  1P7I A;  2NVQ J;  1D0Y A;  3IWZ A;  1VQ7 I;  2V1D A;  2OCE A;  1XPX A;  3GZ5 A;  4A6E A;  2EZH A;  3A4C A;  1SFE A;  1GXP A;  1MD0 A;  3OIO A;  1ZN2 A;  1XGM A;  2DN0 A;  4UUS A;  3N97 A;  4PCQ A;  4KUM A;  2Y9Z A;  2PN6 A;  4R1H A;  1V3F A;  1ERD A;  5HLT A;  2ZKZ A;  2CQN A;  1YS7 A;  2L7K A;  3KP2 A;  1RR8 C;  3DEW A;  1TWH J;  1MMD A;  2MH9 A;  2DQR A;  3ZR8 X;  3IH3 A;  4CZZ A;  4RA2 A;  1MH3 A;  3H36 A;  4M6V A;  3RQI A;  3BP8 A;  4Q48 A;  3U2R A;  2LP0 A;  2PMH A;  1XDU A;  1I39 A;  4AYB N;  4IJA A;  5K7Z A;  5J4V A;  2LKS A;  5F08 A;  1ZH5 A;  3D0S A;  2XRN A;  3BQY A;  1AU7 A;  3UNG C;  1XD7 A;  3CLQ A;  5F64 A;  1E2X A;  1W36 C;  3KX2 A;  3J7Z I;  2ACJ A;  2W82 A;  1RNL A;  5FGM A;  1Z21 A;  5HDG A;  1W0T A;  3GCM A;  2VPR A;  3IRQ A;  2XC7 A;  4XOP A;  1DP3 A;  5J1U A;  1S6L A;  3QU3 A;  4A3L J;  3QYB A;  2CSO A;  2F4O B;  2XPU A;  2DMP A;  3QOD A;  5FFX A;  3TO7 A;  1K79 A;  2HVS A;  1F36 A;  1JT0 A;  4IQJ A;  3PSI A;  3I5U A;  1OCO H;  4U0Y A;  1V55 H;  2JUC A;  4CCK A;  2H8W A;  2B9S A;  3V7C A;  2BHZ A;  2EBI A;  2GQQ A;  1LVK A;  2K02 A;  3E3V A;  3K4K A;  3LMM A;  1G2H A;  2GM4 A;  1BM9 A;  4ITV A;  4L5J A;  4ZDP A;  4HLX A;  4GCV A;  4I09 A;  1YW7 A;  4MTE A;  4HDV A;  5LEJ A;  3ABT A;  4A5N A;  2MA3 A;  2IPQ X;  3BR1 A;  1ZGW A;  4I01 A;  2J5O A;  2DMT A;  1FLI A;  3BR2 A;  3E5X A;  3WHB A;  3R60 A;  4I98 B;  4A5M A;  1SVO A;  2B0L A;  3WE3 A;  2F5C A;  3D5S C;  2CQX A;  2XF6 A;  1WJD A;  2X9D A;  1QPI A;  4L18 B;  2ID6 A;  4HF1 A;  1XN7 A;  4IF4 A;  2ZFW A;  4E7J A;  4NC6 A;  2JUG A;  2XSD C;  1W1W E;  1IF1 A;  2WAF A;  4MQ9 F;  1V4R A;  2FEZ A;  3AKZ A;  2M34 A;  2HOA A;  4C2U A;  2HU9 A;  5EZG A;  5CVV A;  3CUQ B;  4RMN A;  1IRG A;  1ODD A;  3OWT A;  2VC0 A;  4XKV A;  1YTY A;  1BBY A;  1A04 A;  4W1U A;  3OSG A;  1X1P A;  4M3B A;  5ILS A;  4F3Q A;  2DMQ A;  1YX3 A;  2H27 A;  2WB1 A;  1MKM A;  2H6B A;  2K9L A;  5F0H A;  4U0V A;  2K5C A;  1H88 C;  3CD6 I;  4XLH A;  4KA4 A;  2K3F A;  3GLX A;  4UHT A;  5JHU A;  1I5Z A;  1MW7 A;  2HKO A;  4F91 B;  2R5Y B;  2DA6 A;  1YW9 A;  9ANT A;  1YJ9 I;  2FOK A;  5KHD A;  2DJN A;  2ID3 A;  4KIG A;  5E1X A;  4OAZ A;  1HC8 A;  3S3N A;  3ZPL A;  2ECB A;  2L7Z A;  1AA7 A;  3ZQH A;  3QRF F;  2MBF A;  4EMS A;  5EEH A;  4L0Y B;  1G8X A;  5K7H A;  2BXY A;  3TGN A;  1QZZ A;  2A6H F;  3L2V A;  1D0X A;  4BE2 A;  1GVD A;  2DA3 A;  4A12 A;  2CGP A;  2VT3 A;  1RI7 A;  4K2E A;  1FWZ A;  2VIX A;  2DFH A;  1D5V A;  1R22 A;  1X4O A;  4I02 A;  2JT1 A;  4KFC A;  1O57 A;  4O5V A;  2L9N A;  1VFC A;  3FXQ A;  1B1B A;  3OYK A;  4XRM A;  5E8G A;  2KIS A;  4E6K G;  2OA4 A;  1WQ2 A;  1WJE A;  2ICW G;  2XRL A;  2CUF A;  2FJ1 A;  1HF0 A;  2X1C A;  1YOV B;  2R5Y A;  3E7L A;  1QVU A;  4H4K C;  4D9J A;  4A93 J;  2BVL A;  2HPI A;  3MVP A;  3HPG A;  2O9L A;  4EV0 A;  2DFI A;  4S05 A;  4LLN A;  3PUB A;  3ABL H;  3CMA I;  2BEO A;  1O7L A;  3EET A;  2CRG A;  3AG2 H;  2L2O A;  5CYV A;  1XSV A;  3FMS A;  3R6S A;  1BW5 A;  2Y0S N;  4A0Y A;  1FOK A;  2XIG A;  2JSP A;  4YIR X;  3TOA A;  1UFM A;  2HQA A;  2K4B A;  1UB9 A;  3H0D A;  4UNO A;  4XSX F;  5TJJ A;  1XC5 A;  1ETK A;  3L9F A;  2BYV E;  4Y33 A;  3CMM A;  2CMP A;  4CCM A;  4CXF A;  2R7V A;  5CVU A;  3CO6 C;  1IV8 A;  4BHP A;  1BW6 A;  1D8K A;  3HRT A;  4LFU A;  1EJ9 A;  3M07 A;  3QPT A;  1EH8 A;  3K7A J;  4RB2 C;  4KMU X;  1FBU A;  4IPA A;  1W7P D;  4F55 A;  3BT9 A;  4AC0 A;  5D8K B;  2R7Z J;  4A3B J;  1I1G A;  4ZTJ A;  1BA5 A;  3BG5 A;  3M8F A;  3Q0V A;  1SMY F;  5J3L A;  2QKL B;  5ICC A;  5E3M A;  1HST A;  1OCZ H;  5J6X A;  1TC3 C;  3DF8 A;  3RKY A;  1N75 A;  4D5F A;  3CF5 F;  4OIN F;  2E71 A;  5EEA A;  3IC7 A;  5BPD A;  1BOB A;  5J4Y A;  4BJ6 C;  1NH3 A;  4HF2 A;  1SD7 A;  3RKQ A;  1RKT A;  2OQR A;  1B72 B;  2GOM A;  3NAU A;  4Q47 A;  5H6Q A;  4XBF A;  3RTR A;  5KAF C;  2I10 A;  3CES A;  3BPV A;  2JA5 J;  3PUF A;  3ELK A;  4MHG A;  3HTS B;  1BR1 A;  5IT3 A;  5BOX A;  4M72 A;  1R49 A;  1O3R A;  3GZ6 A;  1ETW A;  4XL9 A;  1QGP A;  2NXN B;  2M8G X;  1BN5 A;  2ZJR F;  3GXO A;  5CKT A;  1YIJ I;  3Q9S A;  2CYY A;  2UUZ A;  3OR1 C;  3V8L A;  4ZH4 F;  3OYB A;  5E3L A;  4JP0 A;  3MFK A;  1OQY A;  3DBR B;  1RC9 A;  4N9H A;  3F72 A;  2A5W A;  3OY9 A;  5D6F A;  1WZ2 A;  2ZJQ F;  5GAD J;  5FKO A;  3RI4 A;  3EDP A;  4MEY F;  2BW3 B;  1WHU A;  2MYS A;  1YYV A;  1Y8Q B;  2O7O A;  1K83 J;  2HKX A;  1ZR4 A;  4N4O B;  2CV2 A;  3U9G A;  5IYB J;  5LHG A;  1LQ1 A;  3PQK A;  1F5T A;  2HVR A;  2QVO A;  1B72 A;  3AFH A;  3JRG A;  5J40 A;  1JI8 A;  5EYR A;  2DCE A;  2DOD A;  4JX4 A;  1HW1 A;  2CG4 A;  3CCV I;  4IRI A;  3FM3 A;  1IXC A;  5LBQ A;  3KLO A;  3CP8 A;  2F5F A;  2AQF A;  3ZMT A;  5D5W B;  5HVQ C;  1T08 B;  1HCR A;  5LFA A;  1HW2 A;  2JA6 J;  4A69 C;  2XAU A;  1TWA J;  1Z91 A;  2ZXW H;  1Z0X A;  2Z33 A;  4HZF A;  3E97 A;  2BE5 F;  1RRJ A;  1BC8 C;  3BR0 A;  1MMG A;  1PJR A;  1PYV A;  3I0T A;  5J8F A;  4O3M A;  1MIJ A;  2MSY A;  4HV6 A;  5F27 A;  4ZYH A;  4Z6Y A;  4J01 A;  3VYS B;  3SJM A;  2BW3 A;  1LDD A;  4XSZ F;  3ONQ A;  1WH7 A;  3KE2 A;  2Z1D A;  1MSF C;  2DJI A;  3HL2 A;  5EDN A;  3HEF A;  2WY8 Q;  3GTQ J;  2E7X A;  2DFE A;  1RIO H;  4MLO A;  2G7U A;  3IH4 A;  2VXZ A;  2LLK A;  3QPH A;  1K78 B;  2BZT A;  4M73 A;  1WKM A;  3PQJ A;  3DV8 A;  5E3O A;  4W97 A;  3ULQ B;  4BDY A;  2QYO A;  3I64 A;  4HRI A;  1XGN A;  4J00 A;  3E0J B;  4YEL A;  1JUM A;  1O3Q A;  3FMQ A;  1NK3 P;  3BTJ A;  3H0G J;  3JR9 A;  1TW3 A;  1LVA A;  4BY7 J;  3FIW A;  3B6A A;  1P9Q C;  1WSU A;  1SAX A;  2JJ7 A;  1LUJ B;  4LG0 B;  4LLG F;  2CO5 A;  2GBY A;  2KKO A;  4YRV A;  1TW2 A;  1AKH B;  4EGZ A;  3IKT A;  2V9V A;  4MFD A;  1YS6 A;  3LSG A;  4YFN F;  3JSO A;  1T38 A;  1MBJ A;  1XTA A;  4GXO A;  3T5X A;  3MKY B;  1IZ1 A;  2DBB A;  5TRD A;  4RAZ A;  4ENN A;  1B4A A;  3K70 D;  3ZQ7 A;  3CCS I;  2R0Q C;  5DEQ A;  3Q0U A;  1VQ9 I;  2L9V A;  2PJP A;  4QSH A;  2L7F P;  2XAS A;  3QWL A;  4DOZ A;  3CCE I;  1K78 A;  4I0A A;  3SQN A;  2XGC A;  4BQO A;  1TLH B;  1D1C A;  4U0W A;  3R61 A;  1V5E A;  1MBK A;  1SVL A;  5IT9 Z;  3D1N I;  2XB5 A;  3GTK J;  4GDF A;  3FXM A;  1ZGJ A;  3ERE D;  2R7W A;  2PBI A;  3NAR A;  4CCJ A;  2ZXI A;  4RB1 A;  1QO0 D;  2V6C A;  4LG0 A;  3V8J A;  2KFD A;  2HVQ A;  5FB2 A;  4D5C A;  1MDM B;  1XS9 A;  2XB0 X;  4S04 A;  1AKH A;  4DJA A;  3WTU C;  4PSW A;  3WHC A;  2LD5 A;  1T98 A;  3I4N J;  2BY2 A;  1RUN A;  3QQA A;  5BMZ A;  4D7M A;  2MG4 A;  4HNT A;  1SAN A;  2IEK A;  2JK3 A;  4UXN A;  1M1E B;  4YII A;  2CFX A; 
#chains in the Genus database with same CATH homology
 1MSE C;  2WAQ N;  3G1M A;  1WGX A;  2HXI A;  3JRH A;  1XG1 A;  1U8B A;  3LNQ A;  2H1K A;  4BXX J;  2HOT A;  2HI3 A;  2KDZ A;  5GPA A;  4A3M J;  3JRD A;  2YS9 A;  4C3J J;  1U9N A;  5F1J A;  5IYC J;  3LSP A;  1P7I A;  4C3H J;  3CDL A;  2NVQ J;  3PO2 J;  1T56 A;  4DW6 A;  1DU0 A;  1WI3 A;  3W6V A;  1IV6 A;  1I3Q J;  4LOC A;  2EZH A;  3JRB A;  1ZK8 A;  3OIO A;  2DN0 A;  4UUS A;  1APL C;  2Y9Z A;  2Y2Z A;  2ELK A;  2K9N A;  3DEW A;  1TWH J;  2DA5 A;  2NVT J;  1TWF J;  3IH3 A;  4XRS G;  2TRT A;  1MH3 A;  3RZO J;  2YUS A;  4M6V A;  2L7M P;  1WPK A;  3RQI A;  1MNM C;  3MKL A;  3JRC A;  2LP0 A;  5C3E J;  4AYB N;  5K7Z A;  2NVX J;  4FE4 A;  5F08 A;  4I6Z A;  1NTC A;  3BQY A;  3QPS A;  3VPR A;  1AU7 A;  1U9O A;  2AHQ A;  1X2N A;  1OJL A;  4DYC A;  3I4M J;  1FIA A;  1GUU A;  2KT0 A;  1RET A;  3K2A A;  2Y31 A;  1VND A;  3GBG A;  1POG A;  2LKX A;  4B4C A;  1W0T A;  1ZKG A;  2VPR A;  4X1E A;  1WH5 A;  2R93 J;  5J1U A;  4A3L J;  4MFE A;  4MO7 A;  2XPU A;  2DMP A;  1ENH A;  1F36 A;  1JT0 A;  1QVT A;  3BG3 A;  3S14 J;  5IYD J;  3ZOB A;  1W0U A;  2B63 J;  1IGN A;  2NVY J;  3JRE A;  2EBI A;  1JUS A;  4QIW N;  2DA7 A;  4ABZ A;  2X48 A;  2LK2 A;  3QPL A;  4Y7N J;  1G2H A;  2GM4 A;  2OF7 A;  1LFU P;  5FKK A;  2HDD A;  2NS7 A;  3HGG A;  1O4X A;  1HOM A;  4Y52 J;  2XPW A;  2CJJ A;  1JTX A;  3TP0 A;  4FE7 A;  1IJW C;  3A02 A;  4G12 A;  1Q1V A;  3HM5 A;  1MBG A;  1ZGW A;  3BR1 A;  4A3G J;  2MGQ A;  3FK7 A;  1GV5 A;  1ETV A;  2DMT A;  3BR2 A;  2ME0 A;  3WHB A;  4UUT A;  1QRY A;  3S1Q J;  2X9D A;  2CQX A;  1QPI A;  1R9T J;  4A3D J;  2ID6 A;  3G1L A;  2XSD C;  1JGG A;  4B3A A;  3S2D J;  3GTP J;  2FQ4 A;  2M34 A;  3LSR A;  2HOA A;  4V2G A;  1CQT A;  2M2E A;  1LFB A;  2COB A;  5EZG A;  2JA7 J;  2JWT A;  2JN6 A;  3HDD A;  4IHX A;  1ZTR A;  2QF7 A;  2RAE A;  4C3I J;  2HXO A;  1ETY A;  5BNG A;  4XIC A;  3TP3 A;  1JKQ C;  2XGD A;  4W1U A;  5FKL A;  3OSG A;  1X58 A;  4M3B A;  4DZJ A;  5M3F J;  2DMQ A;  4X6A J;  2WB1 N;  5F0H A;  5FKN A;  5JLW A;  1H88 C;  2M0C A;  1IG7 A;  3B6C A;  1H89 C;  1UHS A;  3RZD J;  1X2M A;  2R5Y B;  1GV2 A;  2DA6 A;  3BR6 A;  1GT0 C;  1LE8 B;  1JJ8 C;  4M3G A;  2ME6 A;  9ANT A;  2DJN A;  2ID3 A;  2CUE A;  1RES A;  4JYK A;  2ECB A;  2L7Z A;  3ZQH A;  5EG0 B;  3LSJ A;  5K7F A;  5FJ8 J;  1OCT C;  2EZK A;  3SDG A;  2LFB A;  1I50 J;  2WV1 A;  3UKG A;  5K7H A;  3O8H A;  4MIM A;  4BY1 J;  5DS9 A;  5F0C A;  5C44 J;  4M3E A;  2DMN A;  1GVD A;  2DA3 A;  2DTZ A;  1RKW A;  3MN2 A;  2MW8 A;  1VFC A;  3BTL A;  3TW7 A;  2R5Z B;  3FKI J;  4XRM A;  3ZQC A;  5IPA A;  4FTH A;  1JJ6 C;  1FIP A;  1ETO A;  2NOG A;  2XRL A;  1I6H J;  5GP9 A;  2CUF A;  3PM1 A;  2FJ1 A;  1HF0 A;  2ECC A;  1ZR2 A;  2R5Y A;  3E7L A;  1QVU A;  4A93 J;  1LE8 A;  3Q3S A;  4M3D A;  3CMY A;  3MVP A;  3TW6 A;  2O9L A;  4A3I J;  1TWC J;  5EG0 A;  1UG2 A;  2DA4 A;  3ZQL A;  1HDP A;  2LR8 A;  3FIS A;  2CRG A;  2NS8 A;  1BW5 A;  2Y0S N;  2LY9 A;  2VI6 A;  3ZQI A;  2DMU A;  1FTT A;  1A5J A;  1FTZ A;  1F43 A;  1T33 A;  1OCP A;  1IUF A;  4RDU A;  3M3Y J;  2R5Z A;  2EZL A;  2EZI A;  1E3O C;  1XC5 A;  2K9S A;  1ETK A;  2AO9 A;  3BQZ A;  1JKO C;  2EH3 A;  2VKV A;  5C4X J;  3L1P A;  2GLO A;  3BTC A;  1BW6 A;  2H8R A;  3GTJ J;  1DU6 A;  3ZQG A;  1IC8 A;  2HOS A;  3K7A J;  2HYJ A;  5IP9 J;  4IHW A;  3CQZ J;  3BT9 A;  4M3F A;  4AC0 A;  1ZQ3 P;  2R7Z J;  4A3B J;  3C2B A;  2TCT A;  1BA5 A;  3BG5 A;  3IV5 A;  3Q0V A;  1FJL A;  5J3L A;  2M9H A;  2O8K A;  5E3M A;  3A01 B;  3H3V K;  1PUF B;  1TC3 C;  4D5F A;  5GPC A;  5EEA A;  2HQ5 A;  5EZH A;  5IP7 J;  2Y30 A;  4JX5 A;  1ETX A;  1HDD C;  2E2I J;  3RKQ A;  1RKT A;  1RPW A;  5J1R A;  5C4J J;  2FD5 A;  3HB9 A;  1B72 B;  3NAU A;  2R92 J;  1K61 A;  2I10 A;  2L0K A;  2JA5 J;  2G0E A;  4A3C J;  3A03 A;  3HBL A;  1BJZ A;  5E3N A;  3PO3 J;  2L9R A;  2W48 A;  3JRA A;  1ETW A;  2JA8 J;  1ITY A;  2M8G X;  1B8I B;  2ZB9 A;  3OSF A;  5F0F A;  1SFO J;  1HLV A;  2K40 A;  4XK4 A;  5E3L A;  4JP0 A;  4D7N A;  4XID A;  3FK6 A;  4QTR A;  1Y1W J;  5DTD A;  1Z77 A;  3A01 A;  3DCF A;  1PUF A;  1BL0 A;  3S15 J;  3IH2 A;  3HKZ N;  2Y9Y A;  3CCY A;  5FKO A;  1GDT A;  2O7O A;  4V2F A;  1K83 J;  1ZR4 A;  4NDL A;  5IYB J;  3GTL J;  2LVS A;  1MBF A;  1WCM J;  1B72 A;  2DA1 A;  3JRF A;  3JRG A;  3HOU J;  5EYR A;  3S17 J;  4DYQ A;  4FIS A;  4JX4 A;  3O8G A;  1VI0 A;  1YRN B;  2D5V A;  1TWG J;  1S7E A;  5EGO B;  4BBS J;  2P81 A;  1AHD P;  1UMQ A;  1B8I A;  5IOY A;  1HCR A;  5HOD A;  1MBH A;  1FEX A;  3S2H J;  2JA6 J;  4A69 C;  3GTO J;  1TWA J;  1Z0X A;  4DYR A;  4CYC B;  2QCO A;  2CQQ A;  4J19 A;  3BR0 A;  4B1R A;  2N8G A;  2PMZ N;  2MSY A;  5F27 A;  2E1O A;  4IHY A;  1EF4 A;  4BBR J;  3SJM A;  4IHV A;  1WH7 A;  5IP6 A;  2E19 A;  1MSF C;  2E2H J;  2LTP A;  5EDN A;  3HEF A;  2XPV A;  3BR3 A;  2EQR A;  3BTI A;  4IEJ A;  3GTQ J;  1IRZ A;  1OFC X;  1U78 A;  4MLO A;  3IH4 A;  1JKP C;  3S1R J;  2LLK A;  1YRN A;  5EGO A;  1NK2 P;  5M5X J;  5E3O A;  1JKR C;  4W97 A;  2JMW A;  1JTY A;  1D5Y A;  4C2M J;  5EF6 A;  3JRI A;  1JUM A;  3G1O A;  1NK3 P;  3BTJ A;  3H0G J;  4XRS A;  3JR9 A;  4BY7 J;  3FIW A;  4L5E A;  3B6A A;  1IDY A;  4CYC A;  2JJ7 A;  4A3J J;  3Q0W A;  2XGE A;  4I76 A;  3M4O J;  3BG9 A;  3HOX J;  2GBY A;  1AKH B;  4HNV A;  1JT6 A;  4MFD A;  4DZP A;  3LSG A;  4EEF G;  1MBJ A;  2DA2 A;  2CU7 A;  4RBO A;  3TED A;  3BR5 A;  5M5Y J;  2OPT A;  2E2J J;  4AUX A;  3S16 J;  1A6I A;  2R0Q C;  5M5W J;  3Q0U A;  3GTG J;  1RR7 A;  2IAI A;  1MH4 A;  3OOU A;  5JLX A;  4FCY A;  4QSH A;  2L7F P;  1H8A C;  3S1N J;  3HOW J;  5M3M J;  3F0C A;  3GTM J;  5FLV A;  4A3E J;  2XGC A;  4JX6 A;  1JUP A;  4A3F J;  1ORK A;  1VF9 A;  3SFI A;  4GFB A;  1MBK A;  1MBE A;  5J1Y A;  2K9Q A;  2XB5 A;  3D1N I;  3GTK J;  2YU9 J;  3NAR A;  5F04 A;  2X6O A;  1ETQ A;  3LOC A;  2VKE A;  5FKM A;  4D5C A;  1XS9 A;  2XB0 X;  1AKH A;  3HOV J;  3ZQF A;  2IBD A;  3HOY J;  2LD5 A;  3WHC A;  4UUS B;  4BKX A;  1IDZ A;  3I4N J;  3QQA A;  3S1M J;  3HGY A;  4S0H B;  5FLM J;  4D7M A;  2MG4 A;  1Y1V J;  5IOZ A;  3HOZ J;  1SAN A;  2IEK A;  2JK3 A;  2FX0 A;  1P7J A;  2VUM J;  4A3K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...