1GVJA

Ets-1 dna binding and autoinhibitory domains
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
MNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of C-Ets-1 DNA-Binding and Autoinhibitory Domains
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords C-ETS-1 PROTEIN
total genus 43
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gvjA00
2FBHA 2A6HF 4CYDA 3L2CA 1WSUA 2ACJA 1B6AA 3BJOA 5FGMA 5ED4A 4JBAA 3BJAA 4HLYA 1UHWA 2CSOA 3KCCA 4U88A 2EFWA 4BH9A 5BPDA 3TO7A 2XGXA 4Q48A 4RB0A 1BIAA 5BS6A 3I54A 1XSVA 3E3VA 4B8XA 3WTSC 2BE5F 1U3EM 2GA2A 1USTA 3RTRA 3LWFA 3HSRA 3K2ZA 3ROUA 3KP7A 3TKYA 1B9NA 5FD5A 5F6FA 4ZZDA 3CJNA 2BGCA 2EV5A 3K1NA 2DPUA 5BQTA 2FU4A 1TQMA 3ECOA 3FWEA 5D8LB 4HW0A 5DCMA 2ZNZA 3AAFA 3C18A 2QLZA 3CUOA 1BC8C 1KU9A 4HX4A 2X0LA 5K1YA 1T38A 4KYWA 2OU2A 3CUQB 4HBLA 3KP5A 2ESHA 3I5UA 4IVNA 3KETA 1JGSA 3KZZA 4KN4X 1BJAA 1I1GA 2WV0A 2RGVA 1E17A 5D5VB 4XSZF 2STWA 1XDUA 2LDUA 1T0FA 4ON0A 4BYYA 1BI3A 3I4PA 1WKMA 2L54A 2MD5A 3V7CA 3HUGA 4Y15A 3K1PA 3T8RA 1EH8A 2WWYA 1B4AA 3IKTA 1TBXA 3LA7A 4UVBA 5E18F 1ZLJA 3RKWA 2XAHA 1CF7B 2P8TA 1ZHFA 1G3YA 4WCGA 1U5TC 4WXHA 3RYPA 3N97A 2MLGA 4A2UA 3CO7C 4GGGA 2B0LA 2IPQX 5BMZA 1R5GA 1F9NA 3FMSA 4RAYA 1HW1A 1IZ1A 1FYLA 1J75A 1W7PB 1IN5A 1O3TA 2PEXA 1XDSA 3HHGA 2DQRA 4KUMA 2K86A 1OR7A 3TQNA 5LEJA 5DD8A 4PCQA 2O0YA 4WX9A 2G9WA 4YFNF 2CG4A 5EEGA 4YFKF 1YFHA 1YS7A 2G7HA 1S7AA 2EJRA 2F5DA 2LNBA 1ODDA 4MTEA 3GFLA 2GWRA 3GX4X 3IRRA 3J80K 1TQPA 4LG0A 4FHTA 1BI2A 3P9IA 1R1TA 4LG0B 4ENKA 3V8JA 1E2XA 2DAOA 2D1VA 3M9AA 4I7HA 5AONA 1ZG5A 3JAMK 2DU9A 2DQLA 2HGCA 3GZ6A 1OYYA 3GZ5A 4UHTA 3GW2A 1V3FA 1QQIA 4H0EA 3ERED 4M72A 3SHFA 1YS6A 3GEZA 3M8EA 2EFNA 4S04A 5HS8A 4ETSA 2V1UA 2FE3A 2YX4A 1DPUA 1IN4A 1LDKB 4KA4A 4CHUA 1R36A 5J8CA 3DPTA 4WF2A 1KYZA 4G94A 3V7RA 1B9MA 1MKMA 2XAQA 4KNYA 4O3MA 1G3SA 5H6QA 5AIQA 1I5ZA 3R6SA 3Q9SA 2H09A 2XRNA 4MTDA 1B1BA 2YU3A 5JHUA 1JE8A 4CICA 3RKXA 2IT0A 1ZN2A 2VC1A 3J7AO 1IN6A 2KIMA 3I59A 1W5TA 2DK8A 3FMRA 3D0SA 4EJWA 3I53A 2GQQA 3DKWA 3L7WA 1K79A 5LLQA 2JZYA 4HV5A 3V8LA 3MWMA 3QPTA 3HSEA 3I58A 4RS8A 5DUKA 3S2WA 4R8HA 2H94A 3BP8A 3T5XA 3SQNA 3GO5A 3U1DA 1Q1HA 2IW5A 5FLXK 2KIFA 4Q5SF 3BWGA 4KICA 1U78A 4M6XA 4PGHA 1FBQA 3MEXA 2X4HA 4A6EA 4ESJA 4MEXF 3T0YA 2XV4S 5K5RA 2W24A 4R1HA 2VT2A 3T1BA 1NHAA 3DF8A 3FXUA 3Q5FA 1XCBA 5KVRA 2WTEA 2ZO4A 4XRFA 1W5SA 3J81K 2FSWA 4P55A 2UXNA 1ULYA 2W85A 4KFCA 4D0PA 4I2OA 1W7PA 3F8FA 4FX4A 5E8GA 2HR3A 3MCZA 1BIBA 4HX7A 1O7FA 4RB2C 1J2XA 2VBWA 1W7PD 2EA2A 2CO5A 3ISPA 5LEKA 2QBYB 2W84A 2CFXA 3WE2A 1OYIA 5TRDA 1MGTA 3WG9A 1XGOA 2XAFA 4RGUA 4OIOF 1DUXC 4HDUA 4AIJA 4A5MA 1HSJA 4F7ZA 1GHCA 2HQRA 2P5LC 2PG4A 3RDIA 3PQJA 3ZMZA 4N9HA 5HLIA 3VFZA 1D8JA 1Z91A 3B73A 2EA4A 2F5CA 4RGSA 5D6EA 3U2RA 4IRGA 4FT8A 2P7CB 5KK1A 3HHHA 3E6MA 2XKOA 1R00A 1FYKA 4GO1A 1KU2A 3O2PE 2XAGA 1O57A 2DTRA 1H0MA 1FT9A 1L0OC 4EJVA 1R22A 4HF1A 1IUYA 4UXNA 3K9TA 3QU3A 3U9GA 2VOOA 5K5OA 1UHMA 1JXSA 3LSTA 2FOKA 1FPQA 1JHHA 3F3XA 1XD7A 4LMYA 1MJ9A 3ABTA 3HRUA 4O6JA 3GFJA 1U8RA 1HKQA 2EFOA 2ZKZA 5HS9A 2H6BA 3RPUA 3JSOA 3C3WA 1S7OA 2FNPA 4Z2YA 2FEZA 5LRRA 2UZKA 4IRIA 5DCFA 2ZBKA 1BBYA 3PFIA 2Y75A 1QNTA 1XCVA 3BZ6A 2D2WA 3VODA 4XBFA 2MH2A 4CDGA 4WXDA 2ISYA 2CWEA 2GXBA 2KIUA 2W25A 1JHFA 3MAJA 1USSA 1YW8A 4NQWA 5CVJA 2R7DA 4A0YA 2NAZA 1TNTA 2M1BA 4FX0A 4HZFA 2DPDA 3ZMVA 1LEBA 2O6GE 4U7DA 3ML6A 2LF8A 5FFZA 3P9KA 3B02A 2RVCA 5D4RA 3TO6A 2M5WA 5HDKA 1FBUA 2QVOA 3CLOA 2VN2A 3GLXA 4WXCA 4OU0A 4XLNF 1YIOA 1LQ1A 1FWZA 2CGPA 1R1VA 2OD5A 2RQPA 4KN7X 3GFMA 1TW2A 4BHPA 1IAWA 5LHIA 3G3ZA 2KRFA 4XLPF 4ENMA 1T6SA 5E1ZB 2UXXA 1SAXA 2LKPA 5D4SA 4JQFA 4K2EA 2EFQA 2K27A 1IRFA 1SFEA 3LA2A 4HOBA 1GXPA 4A12A 1P92A 1LDJA 4P9FA 4HQEA 3TDUC 3M7GA 1FYMA 1T98A 2KJCA 5L3BA 5CLSA 2A68F 2QYOA 4EJUA 6PAXA 5LGTA 1PDNC 1SD4A 2GAUA 3DPLC 1HKTA 2QQBA 4Y17A 4MHGA 1I1SA 2VBYA 1OPCA 4HF0A 3CTAA 2Z9OA 1P2FA 3E5UA 2TDXA 5D6FA 2QUFA 2M8EA 1SD6A 2VOPA 3I59B 2L3DA 4GCVA 1CGPA 2VXZA 2QENA 4LLLA 1Z6RA 5BPIA 1BM9A 2CW0F 1CF7A 2BV6A 1KU3A 4PZJA 2HYFA 2Q0OA 5DDGA 2V1XA 3KP2A 3WTUC 5CVRA 1GXQA 4G7OF 3GVAA 1RNLA 4OIQF 3WGGA 2EB7A 3R60A 3R0AA 1O3QA 2PBIA 2HFHA 1K78B 4EJOA 4WK8F 1WQ2A 3K69A 2HZTA 2FNAA 2KKOA 1ZAOA 1IXSB 2L01A 3RYRA 2IRFG 1DPRA 5E1XA 1VTNC 1IRGA 2J5PA 1R23A 3BY6A 4EGZA 1MJBA 1P6RA 5D5WB 3V8KA 3EDPA 1W4MA 5FO5A 4UV8A 5DYMA 2FRHA 2K4JA 2DO7A 1WI9A 4IHTA 5F1RA 3Q9VA 4EJTA 2FBKA 5DCMB 1U5TB 1ZYRF 3QU6A 3T8TA 2OAZA 4MNUA 1H9GA 1RZ4A 2P5VA 3E5XA 3IC7A 2DLLA 2K4BA 4ESBA 4RGRA 2KJBA 1U2WA 4JK1X 1FC3A 2A07F 3SZPA 4L9TA 4RAZA 4LB5A 4ASNA 1ON1A 4GXOA 1S29A 3ZMTA 4EM1A 1I6XA 3SFZA 5D8KB 2QQ9A 4M73A 5L3FA 3P7NA 3V7SA 3HTUA 3EYIA 2XAJA 2HKOA 1XSXA 5E8IA 4KIGA 2ZNYA 3LQRA 2J5OA 5HLHA 4HQMA 3GFIA 2XASA 2CQKA 4R79A 1ZGJA 2XHKA 1G3WA 3EUHA 2OA4A 2VE8A 2RC4A 4ZH4F 4LLNA 2FBIA 2L4MA 1LDDA 5LBQA 3HOSA 3NEUA 2P4WA 1RIOH 3GXOA 1YG2A 2YPRA 4L9VA 5DEQA 1U5TA 4M9SA 4U7BA 5H20A 1IF1A 1MD0A 5K5QA 2E1CA 3BPXA 4LLGF 5AIPA 2FA5A 2AXLA 3DV8A 2F5EA 2PMHA 3C7JA 4ZYGA 4HX8A 4YG2F 4GYIA 3W6KB 3E6DA 5LGNA 5E20A 2AS5F 3WU0A 5EEHA 3BOQA 2GZWA 1I27A 2GIVA 3FXQA 1S6LA 5IT3A 3SXYA 3QOPA 4BNCA 2PJPA 1UFMA 4UUVA 1ZREA 1QGPA 5CVUA 1FBSA 2L02A 2NRAC 3ZN1A 4L9JA 1KYWA 1P4WA 1XSDA 1IN7A 3P9CA 2FXAA 5ICGA 2OQGA 3RKYA 2EK5A 2QWWA 1ZRCA 1BI1A 3WTYC 4KMFA 1XGMA 4P96A 2IA1A 1LJ9A 1RI7A 3QP6A 4ZYDA 3H92A 3MZYA 2VC0A 3V4GA 3QP5A 2ZFWA 2O61A 1KGSA 2DBBA 5H6RA 4BAYA 2EV0A 4NHJA 2JT1A 4KIBA 2R7FA 2F5FA 1F4KA 2QBYA 4L9NA 5J8FA 2ZMEA 4P5OA 2HKXA 3MFKA 1QZYA 1Z1DA 3W6JB 5DUIA 2H6CA 1FY7A 3RIRA 4O5VA 1IW7F 2DW4A 4LB6B 2Z3YA 5L3CA 1FP1D 2VT3A 1F5TA 1STZA 5JVTA 4BQAA 5L3GA 1TNSA 1FX7A 2XVCA 4WWCA 2OZUA 3FHZA 2O3FA 5L3EA 4ZZLA 4DQ2A 5FFXA 1OKRA 2Y48A 2RKHA 4G7HF 2UWMA 1UCRA 3WGHA 4HDVA 2ZJ2A 2Z99A 3ZMDA 5JI6A 2BEOA 4E70A 4RB1A 2FQ3A 2NNYA 5IT9K 2MLKA 3WTVC 1QBJA 1O7LA 3I71A 5HLGA 1L3LA 2OBPA 4RGXA 3WE3A 2VE9A 1AOYA 3HRSA 4OINF 1OMIA 2E1NA 2M45A 3E6BA 1SD7A 3MQ0A 1RUOA 3OOPA 5E1WA 3O6BB 1R5HA 4IJAA 5CVVA 2OZ6A 4AIKA 2V79A 4HA8A 1XN7A 1Z6TA 1R58A 1REPC 3R0JA 4KDPA 3ELKA 3PQKA 1PP7U 2HOEA 2M30A 3IL2A 5CVIA 1SFUA 3O3KA 3ABUA 5LRSA 4HV6A 1K6OA 1EH7A 1HW5A 3LA3A 2A61A 1EH6A 3M8FA 1HKSA 4IHSA 3HIFA 1B59A 3COAC 3QAHA 2IP2A 3F8NA 4PDKA 1ON2A 3LQQA 2ADUA 4Q4ZF 4EVIA 4MEYF 1IXRC 1TLHB 2V6CA 1LEAA 1FSHA 1FOKA 1R1UA 3FF5A 1LNWA 2C6YA 3JTHA 1BN5A 5HVQC 2PI0A 3VEPA 1LVAA 4MGRA 2PMUA 3GF2A 4ESFA 3KLOA 4YIFA 4EGYA 2YX7A 5ERIA 4NB5A 1XGSA 2EV6A 2XKPA 1O3SA 2XROA 4IPAA 1H9TA 2NYXA 3I64A 4YIIA 1D5VA 5ICFA 1HQCA 5A2QK 3FMQA 2ELHA 1HXDA 4G9YA 4G7ZF 2FF4A 1XB4A 2PLYA 2HTSA 2GXGA 2LSOA 1GVJA 1RUNA 3RJPA 4IXAA 2CYYA 1EV7A 1ZRFA 3K1MA 1TTYA 5HDGA 2RNJA 1BOAA 4P9UA 2OQRA 3MZHA 1T39A 2YSRA 2VONA 2ZCWA 3IWFA 4OOIA 1D3YA 4I01A 3WTZA 2Q8KA 5FLXZ 1SMYF 3N4MA 2STTA 4CO8A 4AIHA 1YO5C 3GYHX 4BHCA 1ZRDA 4OMYA 4OIRF 4GYGA 4KT5C 3DQVC 2JTVA 1R7JA 1YTYA 3VOEA 2PQ8A 2XIGA 3RI4A 1QZZA 5FB2A 3F21A 3FXRA 3ZMUA 4L0YB 5TJJA 1MDMB 1ZGAA 4EM0B 1YW7A 4I0AA 1G6NA 2D1HA 2Q2EA 2DFIA 5JFRA 2JSCA 2JRTA 3IRQA 5IT9Z 3CDHA 1Z05A 5DD4A 3LAJA 1SD5A 1BC7C 3GWZA 4LK0F 1ONVA 3ZPLA 4AD9A 1YLFA 2F2EA 2RN7A 4TV7A 2G7UA 3VB2A 4IRHA 3SZTA 4G6QA 3NRVA 4M6YA 1J9IA 3CUQA 2IJLA 4ENNA 2NS0A 3BJ6A 1AWCA 4UVCA 2V9VA 2QZ8A 5HDNA 3M1EA 4A6DA 3BPVA 1DDNA 2E7XA 3RPQA 2COMA 2O8XA 4L5JA 4IF4A 4I02A 4N0BA 4Q47A 5J6XA 4OMZA 3KP4A 2QM3A 2ETHA 3KP3A 1HBXG 3HYIA 5ILVA 3HRTA 1YYVA 3TGNA 3H3ZA 4CGZA 2VODA 3F23A 2HS5A 2DK5A 3IHUA 4HLXA 2DI3A 4QLCU 4M74A 2HWVA 5F64A 1P4XA 4UNOA 3GUDA 3E97A 4OIPF 4BHBA 5ICEA 1ZG1A 3D5LA 2JPCA 1OYWA 4EQQA 3WU1B 1S3JA 2V1DA 4N9IA 2LF7A 1ZLKA 3R61A 5A2QZ 2O03A 1FNNA 3L00A 3ZN0A 3F6OA 4AWXB 4CZZA 1Y0UA 2R3SA 1TW3A 3I0TA 3WTWC 4UV9A 2BYVE 3OV8A 2E7WA 1F1ZA 1T2KA 2EFPA 2ZXJA 4L0ZB 1FP2A 1WRJA 4M9ZA 4KIFA 4G8XA 1G3TA 4U0VA 3TDZC 1S8NA 4I0BA 4EV0A 2VBZA 3CUQC 1PUEE 1J7KA 1KQ9A 2EWNA 5ICCA 4UVAA 1ZG3A 3HSFA 3WGIA 3LAPA 1TQIA 3H3UA 4CXFA 3L9FA 4M9XA 3WODF 2HDCA 2PN6A 3HOTA 3JW4A 1UB9A 1WWXA 2MH9A 3KP6A 2MBFA 3WTTC 4MQVA 4HF2A 1FZPB 5DV5A 4HAMA 4YFXF 3IWZA 2JPBA 2QQAA 2ISZA 2Y0MA 3NQOA 5BOXA 1K78A 3DFGA 3FM3A 3HTSB 2P5KA 3TOBA 2IA2A 2IVMA 3EETA 3REOA 4B09A 2L4AA 2YR2A 1ZH5A 1ZARA 3F72A 2VBXA 2P6TA 4LFUA 3KEOA 4KMUX 3E6CC 4BXUA 3WTXC 1J5YA 5LHHA 4M71A 2A69F 4A0XA 3KLNA 2HEOA 1IXCA 2K02A 3FZVA 5D5UB 2IA0A 4MQ9F 3JAMZ 3F22A 2MA3A 1KA8A 1SFXA 2P7VB 2MC3A 1IN8A 3DEUA 3F8CA 2K7LA 4G6DA 1YQAA 3TOAA 3HRMA 3F6VA 4LD5A 5D5XB 4RB3C 2P6SA 1K7AA 1FSEA 1QO0D 2A3SA 4ZYHA 3KE2A 3J80Z 3ULQB 3ZQ7A 4XSXF 4PGGA 2D45A 3ZP5A 2A6EF 1U6GA 1V4RA 3CO6C 3FM5A 3L09A 1DP7P 4S05A 1XGNA 2PFBA 1Z7UA 2A5YB 4EM2A 3E5QA 3J81Z 4U0YA 3BROA 1KQ8A 1BI0A 1YW9A 2WC2A 3G73A 2ZMEB 1G4DA 4DNCA 3KEQA 3IKVA 5JR3A 4L18B 2FMYA 5HOOA 4HYEA 3F8MA 2W57A 4ZYEA 4ENJA 2NNNA 5LHGA 3DP7A 5LGUA 1O3RA 1D8KA 1SMTA 3TO9A 5L3DA 2Z5UA 3QRFF 1J0RA 1Z9CA 3LFKA 4I98B 3C1DA 4AVPA 2FMLA 2Z33A 1QPMA 4QWQA 1HSTA 1HW2A 4Y13A 3ZMSA 1X3UA 5CJ9A 5CYVA 2GA1A 4LK1F 1P4AA 1J59A 3JSPA 2ESNA 2RV8A 1FLIA 4L5IA 3FX3A 5HS7A 1MJAA 3EYYA 4LJZF 4A0ZA 3F8BA 2HYGD 3JTGA 3EQLF 4I09A 3KZYA 5ILSA 4EMSA 4A5NA 1LB2A 1XMKA 1C0WA 1MDMA 1A04A 1KU7A 1XMAA 1PP8F 1KQ0A 2M87A 3R4KA 3KFWX 2XUBA 2DT5A 3DXJF 3QPHA 2HTJA 3BDDA 5ILUA 5FD6A 3K0LA 3ECHA 2RDPA 4LGWA 5E17F 4U0WA 2H27A 2HQNA 1MZBA 2BBYA
chains in the Genus database with same CATH superfamily
4S0HB 1TL8A 2FBHA 2A6HF 4CYDA 3L2CA 3ZRGA 5DTDA 1WJAA 1YHQI 1WSUA 1UJ8A 1B6AA 2ACJA 3BJOA 2DA5A 2HNHA 5J40A 4ZYAA 5FGMA 5ED4A 2LC2A 4JBAA 4UY8I 4HEA2 3BJAA 4HLYA 1UHWA 2CSOA 3KCCA 2F4IA 4A3JJ 3QPSA 4U88A 2EFWA 4BH9A 4QIWN 3W3CA 1AHDP 5BPDA 3TO7A 2M34A 2XGXA 2DMPA 3JRHA 4Q48A 4RB0A 1BIAA 2ECBA 5BS6A 3I54A 5EZHA 2DFFA 1XSVA 5IYBJ 2OTLI 3E3VA 4B8XA 3WTSC 2BE5F 3N05A 3TMOA 1U3EM 2GA2A 3E7LA 1USTA 3TP0A 3RTRA 2OCCH 3LWFA 2GBYA 3HSRA 2K9QA 3K7AJ 1A6QA 2Y30A 3K2ZA 1D5YA 4HNVA 3OIQA 5K7ZA 2DYSH 3C2BA 1T0FC 2DJNA 3ROUA 3KP7A 1TWHJ 4C9YA 3RPUD 2MD0A 1MMDA 2AQEA 3TKYA 1B9NA 1VI0A 5IOZA 5FD5A 4EEFG 3B6AA 5F6FA 4QPQA 4YELA 2ZXWH 4ZZDA 3CJNA 5IP7J 4XLHA 2BGCA 2EV5A 4Y33A 3K1NA 5BQTA 2FU4A 2DPUA 1TQMA 4PJJA 3CJTB 3ECOA 3S1RJ 3FWEA 4CCKA 5D8LB 4HW0A 2M0MA 4Y4RA 2QSGX 1VQ5I 2E19A 2VJ4A 2FOWA 5DCMA 3CF5F 1S9HA 2ZNZA 3LSJA 3AAFA 3C18A 4F93B 3OS2A 5KCMA 2W1OA 3IH4A 4II3A 2QLZA 1JUMA 3CUOA 1BC8C 4BACA 2R7VA 2MABA 2JQ7A 1KU9A 4HX4A 3Q0VA 1OCOH 3K70C 2X0LA 2DA3A 3CJQB 5K1YA 1SFKA 1T38A 4FISA 2DDAA 4KYWA 2OU2A 4XRSA 2MSYA 3CUQB 4HBLA 4XL9A 3K6GA 3KP5A 2ESHA 2MGQA 3I5UA 2JJ7A 3FK6A 4IVNA 1JGSA 3KETA 2O8KA 3A2KA 3K2AA 3CMYA 3KZZA 4KN4X 1BJAA 2L7KA 1I1GA 2WV0A 4A3FJ 2RGVA 2P81A 1E17A 5D5VB 2FUG2 4XSZF 2E5NA 2STWA 5H2FC 1XDUA 2LDUA 1T0FA 4IEJA 2HXIA 2YU9J 4ON0A 4BYYA 1TC3C 1WJEA 1BI3A 3NWTA 4PJMA 2KIQA 3I4PA 1WKMA 1OISA 2L54A 2MD5A 3V7CA 4A3BJ 3G71I 3CCEI 4G12A 3HUGA 4Y15A 3K1PA 4E7SA 2OCEA 3T8RA 4IZZA 1OCZH 3EUKL 3BTCA 1EH8A 2HDDA 2WWYA 4BQQA 1VQ9I 1B4AA 3CQZJ 4DYQA 3IKTA 1SVMA 3K4MA 1TBXA 3LA7A 4AVZA 4UVBA 5E18F 1ZLJA 3BLYA 3RKWA 2XAHA 3IH2A 1CF7B 2P8TA 1ZHFA 1G3YA 1P9QC 1LPQA 4WCGA 1U5TC 4WXHA 2Y0SN 3RYPA 3N97A 2MLGA 5JLWA 1S7EA 2XPUA 4A2UA 4PFOA 3LMMA 3DU5A 3S16J 3CO7C 4GGGA 2B0LA 2IPQX 4Y52J 3VYTB 4A3DJ 2ZSIB 2Z16A 1R5GA 5BMZA 1F9NA 3FMSA 4RAYA 2B63J 1HW1A 1IZ1A 2DT7B 2V26A 2BXYA 1FYLA 1J75A 2H1LA 1W7PB 1IN5A 2HXOA 3RKQA 1O3TA 2EIKH 3CCQI 2PEXA 1XDSA 3BC8A 3HHGA 2DQRA 4KUMA 2K86A 1X2NA 4J19A 4RAGA 3HOZJ 4BEHB 1OR7A 5CQGA 3TQNA 2CFOA 5LEJA 5DD8A 2RAEA 3HOYJ 2KRCA 2O0YA 4PCQA 4WX9A 2F5VA 2G9WA 4YFNF 2CG4A 4E7LA 3DTEA 1SANA 2DMUA 4BY1J 3DTKA 3LOCA 1V5FA 5EEGA 1KZHA 4YFKF 3G6EI 1YFHA 1YS7A 1RETA 2G7HA 1IG7A 1S7AA 2EJRA 2F5DA 2LNBA 1ODDA 4MTEA 3GFLA 4DZJA 3S32A 2GWRA 3TW7A 3IRRA 2CH0A 3GX4X 1SAUA 4DJAA 2XB0X 3F9KA 3J80K 1TQPA 4LG0A 2EH3A 4FHTA 5F1JA 4ZDPA 2K9MA 3BG5A 2X6OA 4P1WA 1BI2A 3DLLF 5J1RA 3P9IA 1R1TA 4RLQA 4LG0B 4ENKA 3V8JA 9ANTA 1ZTRA 2D5VA 1E2XA 3LSRA 3ZQFA 2DAOA 2D1VA 3KPHA 3JRDA 3M9AA 4I7HA 5AONA 4QPOA 3JAMK 3LNQA 1ZG5A 2DU9A 2DQLA 2HGCA 2XGDA 4DGWB 4HPQA 3GZ6A 1OYYA 2IBDA 3CP2A 3GZ5A 1DU6A 3BTIA 4B43A 4BDZA 4NC8A 4XMYA 4UHTA 4C3HJ 3GW2A 1V3FA 4LIVA 5GPAA 3BG3A 1QQIA 1LVKA 1JT6A 4XLCA 4H0EA 3ERED 4M72A 3SHFA 2IAIA 1YS6A 3GEZA 3M8EA 4A3CJ 2DMNA 2A05A 1DGRM 2XRLA 4AU7A 3MN2A 2EFNA 4BQNA 3LFUA 1UAAA 3FXKA 4S04A 5HS8A 4IOCF 4ETSA 2PMZA 2V1UA 3FIWA 1FOWA 4BXXJ 2FE3A 1QVTA 2YX4A 4IHWA 2JVGA 5HODA 1MMAA 1WI3A 3H3VK 4IL6C 3QOEA 1DPUA 5J4YA 1IN4A 1LDKB 4KA4A 5J4VA 4CHUA 1R36A 5KAFC 5J8CA 2ECCA 3DPTA 2JUGA 4WF2A 1KYZA 4YIRX 5TGTA 4XN3A 4G94A 4PSWA 2LH9A 2QGUA 1V55H 3HOUJ 3V7RA 2TCTA 2HDWA 2QKLB 4DYRA 1B9MA 4XRSG 4J01A 1MKMA 4XICA 1F36A 2EIJH 2XAQA 3ONQA 3JRCA 4KNYA 4O3MA 3ZQHA 2HVQA 4MFDA 1G3SA 5H6QA 5AIQA 1I5ZA 4CCOA 3R6SA 3H9GA 3Q9SA 2H09A 3KX2A 4XLFA 1R4NB 3CF2A 2JA5J 2XRNA 4MTDA 3S1NJ 2LBFB 3HL2A 3VYSB 3OR2C 1B1BA 2YU3A 5JHUA 4IHXA 1JE8A 4CICA 4BS9A 2KL4A 3RKXA 2IT0A 1ZN2A 2VC1A 2VQHA 4L5EA 2ZXIA 5GAHJ 3J7AO 1IN6A 3DU6A 2KIMA 3I59A 2DA1A 1W5TA 1JUPA 2DK8A 3FMRA 3D0SA 4EJWA 2KHMA 3I53A 2P0WA 2GQQA 1WVRA 2HVRA 3DKWA 2R7WA 3OYEA 3L2VA 3EUAA 3L7WA 3W2WA 1W36D 1JKQC 1T08B 1K79A 4XLAA 3PUFA 5LLQA 5GAEJ 2JZYA 3DPUA 2IGOA 1ORKA 4HV5A 1GV5A 3V8LA 3MWMA 3QPTA 1OLTA 3HSEA 3I58A 3GCMA 4RS8A 4B44A 2F48A 3I4MJ 5DUKA 3OIOA 2CQXA 3S2WA 1YITI 4ZDOA 1IRZA 3OYAA 2E60A 3F0CA 4R8HA 3A0BC 5CPRB 2H94A 3BP8A 3T5XA 3S1QJ 4DIQA 3SQNA 3GO5A 2NOJB 5B3SH 1YJ9I 4XKCA 1MIJA 4CA0A 1LUJB 2JA2A 3U1DA 1Q1HA 2IW5A 5FLXK 3BCAA 2KIFA 5EDNA 4Q5SF 1B72A 3BWGA 4KICA 4N4NB 1WCMJ 1U78A 4M6XA 3ZOBA 2M8GX 4PGHA 1FBQA 4N4OB 3GLLA 3MEXA 2X4HA 4A6EA 5GPCA 4ESJA 4MEXF 1BA5A 3BT9A 3T0YA 2XV4S 5K5RA 3CC2I 1JKRC 1UHSA 2W24A 4R1HA 2VT2A 3H5AA 3T1BA 1JI8A 3WHBA 2KPMA 1NHAA 5K7HA 3DF8A 4CCMA 3FXUA 4BUPA 3Q5FA 1XCBA 5GTIC 2BY2A 5KVRA 2WTEA 2ZO4A 3IH3A 4XRFA 3AL0B 1W5SA 3SZGA 2JRMA 3J81K 1X58A 4F52A 2FSWA 1GLNA 4ZC3A 4P55A 2UXNA 1ULYA 2W85A 4KFCA 4D0PA 4I2OA 1OR7C 1W7PA 3F8FA 4FX4A 5M5WJ 5E8GA 4B48A 2HR3A 2V4JC 1H88C 2WB1N 1IDYA 1T33A 3MCZA 1BIBA 4CH7A 4HX7A 1O7FA 4RB2C 1NH3A 4EATA 1BR4A 3K4CA 1J2XA 2VBWA 5E3OA 3FDYA 1W7PD 2EA2A 3HKZN 2CO5A 3ISPA 2TRTA 5LEKA 2QBYB 2DMTA 2W84A 3O8GA 1X2MA 3PUBA 2CFXA 3WE2A 1BL0A 1RKTA 1IV6A 1OYIA 3BQYA 5TRDA 2VJ5A 4X0GA 2X1CA 3PNTA 4II2A 1MGTA 3WG9A 1XGOA 4BBRJ 2XAFA 4RGUA 2LKSA 4OIOF 1DUXC 3L1PA 2AO9A 4HDUA 4AIJA 2LG4A 2XB5A 2R7OA 4A5MA 1HSJA 1XTAA 5FRMA 2VPLA 4F7ZA 1GHCA 2HQRA 2P5LC 3OL4A 2K5CA 3VDXA 2PG4A 3RDIA 3PQJA 3ZMZA 4N9HA 5HLIA 3MMYB 2L7FP 4IHVA 3FISA 2XF7A 3OS0A 1MSEC 2CV0A 2DA2A 3RCOA 3VFZA 1D8JA 1Z91A 3B73A 2EA4A 2F5CA 1OCCH 2NS8A 4RGSA 5D6EA 3U2RA 1W36C 2WAQA 4IRGA 1WGXA 2ZJPF 2R93J 4FT8A 2P7CB 3OYDA 5KK1A 3HHHA 3E6MA 2XKOA 1MBGA 1FTTA 1R00A 2QSHX 1FYKA 4GO1A 1KU2A 1WJ5A 3O2PE 2XAGA 2L9RA 3PNVA 1O57A 2DTRA 2Y31A 3VSKA 1FT9A 4JP0A 5C4JJ 3NAUA 1H0MA 1APLC 1A35A 2CUZA 1L0OC 4EJVA 4RMNA 2W00A 1R22A 2M4KA 1EF4A 4HF1A 1SC7A 3JRAA 5B1AH 1IUYA 4UXNA 3K9TA 2OV7A 3QU3A 3CMAI 3U9GA 2VOOA 2XF5A 5K5OA 1UHMA 3VSLA 3LSKA 1RESA 4QTRA 1JXSA 3PIPF 3LSTA 2Y9YA 4U87A 3CCYA 2E2JJ 2FOKA 1FPQA 2LK2A 4M3EA 5FROA 1JHHA 1A6IA 1U8BA 2QEXI 4I76A 4D7NA 3F3XA 2HPMA 1XD7A 4LMYA 1A36A 1MJ9A 3ABTA 3HRUA 4O6JA 4DW6A 3GFJA 1JUSA 2B7EA 2F4OB 5E79C 4RLFA 1FJLA 5FRNA 1U8RA 1HKQA 3GTLJ 2EFOA 2ZKZA 1HCRA 5HS9A 2L2OA 2E35A 2H6BA 3BG9A 3HEFA 3RPUA 3JSOA 3C3WA 3LSGA 2HQ5A 2KISA 1S7OA 1T56A 1VQLI 2FNPA 4Z2YA 2R5YB 3HOVJ 1MNEA 2FEZA 2BVLA 2KLOA 5LRRA 2CMPA 2MW8A 1Y8QB 2UZKA 4IRIA 5DCFA 4Y7NJ 2ZBKA 1BBYA 1JJ6C 3WU2C 2R5YA 1U9NA 3PFIA 3CCVI 1GT0C 2Y75A 1OQYA 1QNTA 2UV1A 5FJ8J 1XCVA 3BZ6A 4ITVA 1Y1VJ 2D2WA 1EJ9A 1AU7A 3JRIA 3VODA 1IJWC 2COBA 1BR1A 4XBFA 3GTJJ 2DA7A 1TWFJ 2MH2A 4V2FA 4NQWB 4CDGA 2L7ZA 2CUEA 4MIMA 4WXDA 2ISYA 1R49A 2CWEA 4E7ZA 2GXBA 1IO2A 4CYCB 2KIUA 2W25A 3OYNA 1DP3A 1JHFA 3MAJA 3PNYA 5IP9J 1USSA 3H0DA 4UUTA 1YW8A 4NQWA 1UG2A 3CC7I 5CKTA 5CVJA 3QYEA 2R7DA 2Z2SB 4A0YA 2NAZA 5HNHA 1TNTA 1ETXA 2M1BA 4FX0A 4HZFA 2DPDA 4D5CA 5J1YA 4D9JA 4PFPA 1OCTC 3ZMVA 2DODA 3J7ZI 3CCMI 1LEBA 1ETKA 2MYSA 2O6GE 3OYJA 1I6HJ 3RQIA 4U7DA 3BR3A 3ML6A 2RQQA 2LF8A 2NOGA 5FFZA 5DM7F 1D0ZA 3QODA 2QF7A 3P9KA 4M3DA 3X2QH 3B02A 2GLOA 4GFBA 1VQNI 2RVCA 5D4RA 2L9NA 3TO6A 2M5WA 5HDKA 1FBUA 2QVOA 4XQFA 3M3YJ 1LFPA 4XKBA 3CLOA 2VN2A 1TT0A 1YRNB 3GLXA 2VB6A 3OYMA 1ETWA 1LKXA 2JSPA 1M1EB 4WXCA 4OU0A 4XLNF 1YIOA 1LQ1A 1FWZA 2CGPA 3JREA 2PJRB 3WHCA 1R1VA 2OD5A 2RQPA 4KN7X 3GFMA 1TW2A 4IQJA 3DCFA 3CESA 1EA3A 2XF6A 4BHPA 2WAFA 1IAWA 5LHIA 3G3ZA 2KRFA 3AG3H 4W97A 5IY5H 4XLPF 4ENMA 2PJRA 1T6SA 5E1ZB 2UXXA 2A6TA 1SAXA 3LL7A 4PJ0C 2LKPA 5D4SA 3G1MA 4JQFA 3HGYA 4BJTA 4K2EA 2EFQA 2K27A 2IGNA 2M3AA 3OYFA 3ASOH 4D1QA 4A3GJ 3CCLI 1TWCJ 3OY9A 2X9DA 3S15J 4BEHA 1IRFA 1SFEA 3LA2A 4HOBA 3CLQA 3L2WA 3DBRB 1GXPA 2CV1A 4A12A 1N75A 1TWAJ 3AG2H 1P92A 1LDJA 4P9FA 4HQEA 3BCBA 2XGEA 3TDUC 3M7GA 5FKMA 1FYMA 1MBJA 1RR7A 2E1MB 3S17J 1T98A 2IGKA 1D1CA 2JMWA 4BL0B 4BGDA 2KJCA 4F55A 3HM5A 5L3BA 1X3ZB 2R0QC 2DA6A 5CLSA 1JGGA 2A68F 2QYOA 4EJUA 2IEKA 6PAXA 5LGTA 2E1OA 2Y69H 1PDNC 3E0JB 5FLMJ 2W7NA 1SD4A 2GAUA 1MMNA 3DPLC 1HKTA 2QQBA 3KYDB 4M3FA 1PJRA 2V9PA 1X1CA 4Y17A 2VIXA 4MHGA 1I1SA 4CCLA 2LVSA 2VBYA 1OPCA 4HF0A 1RRJA 2PMZN 3CTAA 3K70D 3SDBA 2HVSA 2Z9OA 1P2FA 3E5UA 2TDXA 4OAYA 5D6FA 3HKZA 2QUFA 3BR1A 3MD2A 1ZGWA 2M8EA 1TT5B 1SD6A 4RM3A 2VOPA 4E7KA 3I59B 4AM3A 2L3DA 4GCVA 4UUSB 2XSDC 1CGPA 4V2GA 4E4HA 2VXZA 3BTJA 2QENA 4AUXA 2XPVA 2CU7A 3PO3J 2E34A 2Z1DA 2RREA 4LLLA 1MNMC 1Z6RA 5BPIA 1BM9A 5F04A 2CW0F 1CF7A 2VKVA 2BV6A 4NDLA 1KU3A 4PZJA 5EYRA 1YX5A 2HYFA 2VUMJ 1R5ID 2AHQA 4CCJA 2CS3A 1ZKGA 2Q0OA 3GZNB 3BR0A 3LSPA 5DDGA 2V1XA 2BY1A 2BXZA 3GBGA 4H4KC 3BR5A 1WJBA 3ABLH 3KP2A 3WTUC 5CVRA 1X4PA 3QQAA 1DU0A 2DJIA 1NK2P 1A31A 3OYIA 1GXQA 1X4OA 1YOVB 2KMUA 4G7OF 3S1MJ 1QRYA 3GVAA 1RNLA 4OIQF 3TBIA 3WGGA 4IHYA 2EB7A 1Z3YA 2VKEA 4W1UA 4J00A 3HPGA 3R60A 1X1PA 1VQOI 3R0AA 1O3QA 2PBIA 2HI3A 2HFHA 1K78B 3KIOA 4EJOA 4WK8F 1WQ2A 2BOLA 3CCSI 3K69A 1MW7A 2KKOA 2HZTA 1TZLA 1ZAOA 2FNAA 1IXSB 2L01A 1PVEA 2R4GA 3RYRA 1DPRA 2M0CA 5E1XA 2IRFG 1VTNC 1IRGA 2J5PA 3BTLA 3CP8A 5F0CA 2H1KA 4KT6A 1WJCA 1R23A 5E3NA 4D5FA 2GIZA 3BY6A 1MH3A 4EGZA 1MJBA 1P6RA 1Z21A 3JR9A 3U1KA 5D5WB 3V8KA 3SFIA 3EDPA 1W4MA 5JHFA 4C30A 4FASD 3EUHC 3HPHA 5FO5A 1K83J 1CQTA 4UV8A 5DYMA 2FRHA 2LLKA 3PSFA 2K4JA 4PJNA 2DO7A 2OUMA 5K7FA 1WI9A 3BG6A 4IHTA 1LFUP 1R9TJ 5F1RA 3Q9VA 1Z3XA 4EJTA 2FBKA 5DCMB 1U5TB 2VQGA 1ZYRF 1ZR2A 3GTOJ 2KP6A 3QU6A 1PUFB 3T8TA 3BQZA 2OAZA 2I5UA 1H9GA 4MNUA 2FX0A 3J7AY 2CRGA 1RZ4A 2EIMH 2P5VA 1ETOA 3DLAA 1I39A 5GAGJ 1IUFA 3E5XA 4OWRB 3IC7A 1ITYA 2GXAA 2DLLA 1JT0A 2K4BA 2IXSA 4B47A 3L2UA 4ESBA 1E0EA 1W1WE 4RGRA 2KJBA 1U2WA 4JK1X 1FC3A 3GTQJ 2A07F 3SZPA 4BQOA 5E3MA 4L9TA 4FCYA 4DBRA 4RAZA 4LB5A 1WZ2A 4ASNA 1ON1A 2CUJA 3FK7A 1S29A 4GXOA 2JN6A 3ZMTA 4EM1A 1I6XA 3CCJI 1WH5A 1XS9A 3SFZA 1X3WB 3HB9A 1VQ8I 5D8KB 4I6ZA 2QQ9A 4M73A 4A3IJ 2KDOA 5L3FA 3S3OA 2IS1A 3M4OJ 4BJ5C 3P7NA 1FEXA 2EZIA 3V7SA 4JX6A 1VZ0A 1BW6A 3HTUA 2LMDA 3EYIA 3DBHB 2WY8Q 4XONA 2XAJA 2HKOA 1XSXA 2EILH 3BZKA 3FKIJ 5E8IA 1VQ6I 4KIGA 2ZNYA 3LQRA 2J5OA 2KZVA 5HLHA 4Y3OA 4HQMA 2LBFA 2XASA 3GFIA 1FOYA 4ANJA 2CQKA 4R79A 1ZGJA 2WB1A 4CUGA 2XHKA 1G3WA 3RZDJ 2VASA 5BNGA 3RZOJ 2M2EA 2XPWA 3EUHA 4LG3A 3IV5A 2OA4A 2VE8A 2RC4A 1V5GA 3H35A 4ZH4F 4LLNA 1NG6A 2FBIA 2H8RA 5LFAA 3SYTA 2L4MA 1LDDA 5LBQA 3HOSA 2X48A 3FBIB 2P4WA 3NEUA 3VPRA 2HQAA 1RIOH 3PM1A 2VXDA 3GXOA 5M5YJ 1YG2A 2CQ7A 2YPRA 4L9VA 5DEQA 1U5TA 4C3JJ 4M9SA 3OR1C 2R7TA 4XNFA 4UB6C 3H5NA 4U7BA 5H20A 1IF1A 2NVTJ 1GV2A 3DTIA 1WFXA 2EZKA 1MD0A 5K5QA 2E1CA 3BPXA 4LLGF 3OSFA 5AIPA 3HG9A 2ME0A 3OMYA 2FA5A 4B1RA 1VFCA 4ZJZA 2AXLA 3DV8A 2F5EA 1PYVA 2K40A 2PMHA 1RPWA 3C7JA 3FXJA 2LY9A 1FIPA 4HX8A 4ZYGA 4RBOA 4AYBA 2HZDA 4YG2F 2VKDA 4GYIA 2M7BA 3W6KB 3ZQIA 3E6DA 5LGNA 3S2DJ 5E20A 3H36A 2AS5F 3WU0A 2JA8J 1JKPC 5EEHA 4XOPA 1SVOA 1SVLA 2GZWA 3BOQA 3L2RA 1I27A 3MKWB 2GIVA 3FXQA 4A3LJ 5JLXA 1S6LA 5IT3A 3SXYA 1W5CC 2ID6A 3W2VA 3QOPA 2X1DA 4BNCA 1FOXA 2PJPA 1UFMA 4UUVA 1ZREA 1YJWI 1ZK8A 1HA8A 2V7FA 2EQRA 1QGPA 3ABMH 5CVUA 3PFYA 4Z6YA 1HOMA 1FBSA 2CUFA 3ERMA 2L02A 3NWSA 1E3PA 2KT0A 3ZN1A 2NRAC 4L9JA 1KYWA 3D1NI 1VNDA 1P4WA 1XSDA 1IN7A 3P9CA 2FXAA 5ICGA 3M07A 3HDDA 4C2MJ 4XIDA 4XOTA 2OQGA 3RKYA 3OYHA 2EK5A 2QWWA 1ZRCA 1F43A 1BI1A 3WTYC 4KMFA 1XGMA 2ZXHA 4F92B 2LY1A 4P96A 2IA1A 1LJ9A 1Y0NA 2XC7A 5EJCA 4PSXA 4DYCA 1G8XA 1VQ4I 3LSMA 4NNJA 1RI7A 3QP6A 4ZYDA 3H92A 3A01A 3MZYA 2VC0A 1NG7A 1DGWY 2GOMA 3V4GA 3QP5A 2ZFWA 2O61A 1KGSA 2DBBA 1VQPI 1GVDA 5H6RA 4BAYA 2I10A 4BU2A 3K4NA 2EV0A 2DDBA 4NHJA 2JT1A 4KIBA 2R7FA 2F5FA 2LKXA 3AFHA 1F4KA 2QBYA 3QYBA 1VQKI 4L9NA 3OIPA 4QSHA 2JWTA 1A5JA 5J8FA 2AXTC 2ZMEA 4HNUA 2DYRH 4P5OA 2HKXA 3MFKA 1H89C 4CSWA 1QZYA 1Z1DA 3W6JB 5DUIA 2H6CA 4LITA 2JA6J 1FY7A 3RIRA 3OL3A 4O5VA 3IAS2 1IW7F 2DW4A 4LB6B 2Z3YA 2DOFA 5L3CA 1FP1D 2DFHA 2VT3A 4B3XA 2NS7A 1F5TA 2N8GA 4E7IA 3D5RC 3A4CA 1STZA 5JVTA 2R7XA 2KRHA 2VKHA 4BQAA 5L3GA 1TNSA 3EPZA 1FX7A 1MNDA 5KNLA 1XG1A 2DFEA 2XVCA 2NVXJ 5IOYA 4WWCA 2OZUA 3FHZA 2O3FA 5F08A 5L3EA 4ZZLA 4DQ2A 2DCEA 5FFXA 1OKRA 2Y48A 3H9QA 2CQQA 3K4JA 2RKHA 4ZDLA 1T95A 4G7HF 2G0EA 2UWMA 1UCRA 1K4TA 1QHGA 3UKGA 3WGHA 4HDVA 2ZJ2A 5EG0A 2Z99A 3ZMDA 3ASNH 2HU9A 5FKLA 5IPAA 2ELKA 2QQ8A 2E1MC 5JI6A 1X19A 1ZELA 2BEOA 4E70A 4A69C 3K4BA 4RB1A 2K3PA 2OPTA 2FQ3A 2LOOA 2HYJA 2NNYA 2R92J 5IT9K 5EG0B 2MLKA 3WTVC 1ETVA 1QBJA 1HF0A 1K6YA 2CV2A 3GMEA 1O7LA 3I71A 5HLGA 1L3LA 1XX5A 2OBPA 4RGXA 3WE3A 5HNFA 5C3EJ 2VE9A 2BW3B 2IS2A 1AOYA 4MFEA 4ABZA 3HRSA 4OINF 1OMIA 2E1NA 2M45A 3A03A 2X1EA 3E6BA 1SD7A 2BW3A 3E1SA 3MQ0A 1RUOA 3OOPA 5E1WA 3O6BB 1AKHA 2DOAA 1R5HA 5M5XJ 2AQFA 3CMMA 2LREA 2W48A 2RNGA 4IJAA 5CVVA 2OZ6A 5E3LA 4AIKA 1MBFA 2WAEA 1AKHB 2V79A 1FMWA 1UELB 4HA8A 1XN7A 1Z6TA 1YIJI 1R58A 1V54H 1REPC 1TWGJ 2HOTA 3R0JA 4BY7J 4NUBA 1QVUA 4IKFA 4KDPA 1RC9A 3ELKA 3PQKA 4BDYA 1PP7U 2HOEA 2M30A 3IL2A 5CVIA 1SFUA 3O3KA 3ABUA 3KYLA 5LRSA 3G4SI 4CCNA 4HV6A 1K6OA 1EH7A 5F0FA 3SEZA 1HW5A 3LA3A 3ZCOA 2VLAA 1P7IA 2A61A 1EH6A 3M8FA 5DS9A 2V6EA 1HKSA 2KDZA 2WADA 4IHSA 2VJIA 4NBQA 3HIFA 2JA7J 1J09A 1NTCA 2JK3A 1MBEA 1B59A 3COAC 4OAZA 1D0XA 3QAHA 2IP2A 4C2TA 3F8NA 4PDKA 1ON2A 3LQQA 2ADUA 4Q4ZF 2NVQJ 4EVIA 1N77A 3W6VA 4MEYF 4YRVA 1IXRC 1TLHB 2BY3A 2V6CA 1LEAA 2W4SA 1FSHA 1FOKA 1R1UA 3FF5A 3FXOA 1LNWA 2BHYA 2C6YA 3JTHA 5EZGA 3I4NJ 2IGMA 4XM3A 1E3OC 2A5WA 3G1LA 3HC7A 4JX5A 1BN5A 5HVQC 2PI0A 2R7ZJ 2MC4A 3VEPA 1LVAA 2IS6A 3HZJA 3UNGC 4BXFA 3Q0WA 4MGRA 4RAFA 4HNTA 2PMUA 3GF2A 4ESFA 1ETYA 3KLOA 4YIFA 2QSFX 4EGYA 2YX7A 3I55I 1ENHA 3VWBA 5ERIA 4NB5A 1XGSA 1LE8B 2EV6A 2XKPA 1O3SA 2L9SA 2Q2EB 4IPAA 2XROA 2NYXA 3I64A 4YIIA 3QWLA 5LD2C 1H9TA 2VJJA 1D5VA 3FKJA 5ICFA 1HQCA 3FMQA 5A2QK 1JTXA 2ELHA 1HXDA 4G9YA 1Z77A 4G7ZF 3GTMJ 2FF4A 1XB4A 1VQ7I 2Y2ZA 1HC8A 1X1DA 4M6VA 2HTSA 2PLYA 2GXGA 2LSOA 4BJ6C 1GVJA 1RUNA 3RJPA 4IXAA 2CYYA 1EV7A 3OOUA 2NVYJ 4HG2A 1D1AA 1ZRFA 1Q1VA 2PX9A 1HDPA 3K1MA 1R71A 4A93J 2BZTA 1TTYA 4D7MA 5HDGA 2RNJA 1BOAA 1BR2A 1MMSA 2CW7A 3G1OA 1P7JA 3DKYA 2R5ZA 5FKKA 4P9UA 2OQRA 1Z0XA 3MKYB 4IOAF 3MZHA 3MVPA 1T39A 4C3IJ 2ICWG 5TISC 2YSRA 3DEEA 2VONA 2E36A 5EF6A 1U9OA 2OC6A 2ZCWA 3IWFA 4OOIA 2GM4A 5B1BH 1D3YA 1X1BA 4I01A 1YRNA 3MZ8A 1RKWA 2E5ZA 3WTZA 3HUGB 4G6TB 2Q8KA 5FLXZ 3H1CA 2O7OA 5M3FJ 2ZMEC 1SMYF 4ZTFA 3OWTA 3BR2A 1X1AA 3N4MA 2STTA 4CO8A 3ZGKA 4AIHA 1YO5C 3GYHX 4LOCA 1ZR4A 4BHCA 3ZXSA 1ZRDA 3A02A 2JVHA 3J7YJ 1U0JA 4OMYA 4GYGA 4OIRF 2LRDA 4KT5C 4RDUA 3DQVC 2JTVA 3ESWB 1R7JA 1YTYA 3VOEA 2DOEA 1Y56A 2PQ8A 2X6WA 2XIGA 3DWLE 3RI4A 3BG7A 3HGGA 5FKOA 1QZZA 5FB2A 5B5EC 4JX4A 3F21A 1W0TA 3FXRA 3ZMUA 4L0YB 5TJJA 1MDMB 2XSJC 2CJJA 1ZGAA 4EM0B 4BE2A 1YW7A 1IDZA 2YS9A 3IP4B 4I0AA 1WH7A 1G6NA 2D1HA 2Q2EA 2DFIA 4XK4A 4XRMA 2R7QA 5JFRA 2JSCA 2JRTA 1PUFA 3IRQA 5IT9Z 3C2HA 3CDHA 4NC7A 3BZCA 4DBQA 1Z05A 5DD4A 3LAJA 2GOXB 1SD5A 3K10A 1BC7C 3GWZA 4LK0F 1ONVA 3HJEA 2M9HA 4V19K 3ZPLA 4AD9A 1YLFA 2F2EA 2RN7A 2EZLA 4TV7A 4C2UA 2G7UA 3VB2A 4IRHA 1OCRH 3SZTA 2DMQA 4G6QA 2K9NA 1D1BA 2F6CA 2JUCA 3PIOF 1OJLA 3NRVA 4M6YA 1J9IA 4XLEA 4BE0A 1AA7A 3CUQA 1GUUA 1VF9A 4PJLA 4CZCA 2IJLA 2CW8A 4ENNA 3LSHA 2NS0A 3BJ6A 2I8DA 3JCUC 1AWCA 4FE7A 2EINH 2E71A 4UVCA 3JRGA 3OSGA 2V9VA 2ID3A 2QZ8A 1E3HA 5HDNA 4FTHA 2H8WA 3M1EA 4A6DA 3BPVA 1DDNA 2KZGA 4FQGA 2E7XA 1QHHD 3ABKH 3RPQA 2M4GA 1ETQA 2COMA 2O8XA 4L5JA 4IF4A 5GADJ 4I02A 4N0BA 4Q47A 3K4LA 2ZSHB 4XKWA 5J6XA 4OMZA 4BE1A 3KP4A 1N25A 2DTZA 2QM3A 1Y39A 2ETHA 3FHNA 4E7JA 3PJRA 3KP3A 3DEWA 1HBXG 3HXLA 4A3KJ 3HYIA 5FKNA 4B4CA 5F0HA 3OYLA 2VQLA 2B9SA 5ILVA 2E2IJ 3HRTA 1YYVA 4X1EA 4XN0A 3TGNA 1MSFC 1I3AA 3H3ZA 4CGZA 2VODA 3F23A 2HS5A 2DK5A 3IHUA 4HLXA 2DI3A 2BVMA 4QLCU 4M74A 4X6AJ 1POGA 1EKEA 2HWVA 5F64A 1P4XA 3DBLB 4UNOA 1BW5A 5HLTA 3S2HJ 2L7MP 3GUDA 3E97A 3O8HA 5EGOA 2Y9ZA 4OIPF 1MH4A 4BHBA 3VYRB 4M3GA 4A3EJ 5ICEA 1ZG1A 3K4KA 3D5LA 1QZEA 2JPCA 1G2HA 1OYWA 3S14J 1FTZA 4EQQA 2LD5A 3WU1B 1S3JA 2V1DA 1OCPA 2ZFUA 5EGOB 4KISA 4NC6A 4N9IA 1DQUA 2DA4A 4A3MJ 2LF7A 1GDTA 3P5JA 3M1CA 1ZLKA 3R61A 5A2QZ 2O03A 2V1NA 2BY0A 1FNNA 3L00A 4XORA 3AG1H 3ZN0A 3F6OA 3I56I 2ELJA 4AWXB 4CZZA 1Y0UA 2R3SA 1ACIA 1TW3A 3HOWJ 3I0TA 2VI6A 3WTWC 4LIUA 4UB8C 4UV9A 2BYVE 1YE9A 4MLOA 2X6XA 3CDIA 2UUZA 3OV8A 2E7WA 2KFDA 2XAUA 1KONA 3OYCA 4GDFA 1F1ZA 4I99C 1UZCA 1T2KA 4F91B 4BBSJ 2ZXJA 2EFPA 1MBKA 5DM6F 4L0ZB 1FP2A 1WRJA 3I3LA 4M9ZA 3V42A 4KIFA 4G8XA 3TEDA 5IYDJ 2YUSA 2BHZA 1G3TA 4U0VA 1QU3A 1FMVA 3TDZC 1S8NA 3JRFA 4I0BA 4EV0A 2VBZA 3CUQC 3OYGA 1PUEE 1J7KA 4E6KG 1KQ9A 2EWNA 2VL8A 5ICCA 4UVAA 2R7RA 1ZG3A 3A1YA 3HSFA 3WGIA 2L5QA 2R7SA 2LTPA 3LAPA 1YJNI 1TQIA 2WAQN 2R5ZB 3H3UA 4CXFA 3L9FA 1OFCX 4GRIA 2ZJRF 4M9XA 2W82A 3WODF 2PN6A 4XKVA 3JW4A 3HOTA 2HDCA 3Q3SA 3CCRI 1UB9A 4KITB 2X6YA 1XC5A 1XPXA 1XMXA 3AG4H 3PSIA 4JOMA 4ZTJA 3G2BA 4FETA 1WWXA 2MH9A 3KP6A 2MBFA 3WTTC 1IC8A 4MQVA 3RQ4A 2L9VA 1TP4A 3OYKA 1Z67A 4HF2A 1FZPB 5DV5A 4HAMA 1UMQA 3U21A 3H9JA 2VQCA 4YFXF 2DN0A 2EPFA 5C44J 4AIDA 4AYBN 3IWZA 5B66C 2JPBA 2LFBA 4HSRA 3VYUB 3CD6I 2QQAA 2ISZA 2Y0MA 1D0YA 1QPIA 2X51A 1BJZA 1JJ8C 3TW6A 2MFZA 3NQOA 2LP0A 2EBIA 2ZJQF 3S3MA 5BOXA 3DFGA 1K78A 1IGNA 3ZQQA 4HRIA 3FM3A 2WY7Q 3HTSB 2P5KA 4HSTA 3FXMA 3TOBA 2IS4A 2IA2A 2IVMA 2E2HJ 1JKOC 3EETA 3REOA 1NK3P 4B09A 1HLVA 2L4AA 2OF7A 2YR2A 1YI2I 1G59A 1ZH5A 3OS1A 3CCUI 3HBLA 2V9KA 1ZARA 3F72A 2VBXA 3KYCB 3BR6A 3JRBA 3GTGJ 2P6TA 4LFUA 2R7UA 3KEOA 4AC0A 2LYCA 4KMUX 3ZQGA 3E6CC 4IX7A 4BXUA 3WTXC 1J5YA 5LHHA 2ZB9A 1ZQ3P 2O5RA 4M71A 2M7AA 1R4MB 5IP6A 2A69F 4A0XA 3KLNA 3FZVA 1IXCA 2K02A 2HEOA 5D5UB 3KZIC 2IA0A 2K9SA 4MQ9F 3JAMZ 1MBHA 2MA3A 3F22A 1KA8A 1SFXA 2P7VB 2MC3A 3CMEI 1IN8A 3DEUA 3F8CA 2K7LA 3MKLA 4F3QA 3S3NA 5J47A 4G6DA 2K3FA 1YQAA 1B8IA 3TOAA 3HRMA 3SDGA 3KEYA 1I50J 3F6VA 1N78A 1O4XA 4LD5A 5D5XB 4RB3C 2P6SA 1K7AA 1FSEA 2LR8A 3RSNA 3DKXA 3IAM2 1SEUA 1QO0D 2A3SA 4M3BA 4ZYHA 1WJFA 4YEJA 1BOBA 2MG4A 3KE2A 3J80Z 3ULQB 3ZQ7A 4XSXF 4PGGA 3A01B 3WG7H 3SEQA 2ZC2A 5EEAA 5M3MJ 2D45A 5GP9A 3ZP5A 2A6EF 1U6GA 1V4RA 2Y0SA 2NVUB 4DZPA 3H0GJ 3CO6C 1IRXA 3FM5A 3L09A 1DP7P 3OYBA 1LFBA 1QA6A 4S05A 1XGNA 2EZHA 1MMGA 3ZQLA 2PFBA 2LY2A 1Z7UA 2A5YB 4EM2A 2FQ4A 3E5QA 3J81Z 4U0YA 3I9V2 2HOAA 4PK4A 3BROA 1KQ8A 2X85A 3GTKJ 1BI0A 1LE8A 2CQNA 1YW9A 2OTJI 1V5EA 2WC2A 1JTYA 4PUSA 2ZMEB 3G73A 3CC4I 3Q0UA 4B3AA 1G4DA 4DNCA 3SJMA 4KJZA 3KEQA 3IKVA 5JR3A 4L18B 2FMYA 2ME6A 5C4XJ 5HOOA 4HYEA 3F8MA 2W57A 3S8PA 4ZYEA 5J1UA 4ENJA 2NNNA 2QKMB 4IQ4A 5LHGA 3DP7A 2Q1ZB 3MKZA 2WA0A 5LGUA 2WV1A 3S93A 1O3RA 4XR6A 3GTPJ 1D8KA 1ERDA 2QCOA 1SMTA 3TO9A 3AKZA 5L3DA 1S72I 5FLVA 2Z5UA 1H8AC 3L2QA 3QRFF 1J0RA 3CZ6A 3PO2J 1S5LC 1Z9CA 2VPRA 2XGCA 1WJDA 3LFKA 4I98B 3C1DA 3CJRB 2DXIA 4AVPA 2FMLA 2HPIA 1QPMA 3QYFA 5CQEA 2Z33A 4QWQA 3D5SC 3H5RA 1HSTA 3FBNB 1HW2A 1Y6IA 4Y13A 2KQRA 3ZMSA 1K61A 1X3UA 3CDLA 3NARA 3AL0C 5CJ9A 5CYVA 5IYCJ 4DOZA 2GA1A 4RM2A 3FXLA 1W0UA 2K9LA 1Y1WJ 3TP3A 5KAIC 1B8IB 4LK1F 1P4AA 4BKXA 1J59A 1K4SA 1WPKA 1SFOJ 3JSPA 2ESNA 3ZR8X 2RV8A 5F27A 2QA4I 1FLIA 3C2GA 4L5IA 4E7HA 3FX3A 5HS7A 1T8IA 3W2AA 1MJAA 4IO9F 1Z7LA 1FIAA 3EYYA 2K85A 4LJZF 4A0ZA 3F8BA 2HYGD 4MO7A 3JTGA 3EQLF 2L0KA 2OJED 4I09A 1RR8C 4JYKA 3KZYA 3ZQCA 5ILSA 1VQMI 3TL4X 1B72B 3LSIA 1YX3A 3PL8A 4EMSA 4A5NA 1LB2A 1XMKA 5GTHC 1C0WA 1MDMA 4FE4A 1A04A 2XDVA 3M8JA 1KU7A 1XMAA 3IUOA 1PP8F 1KQ0A 1Y8RB 2M87A 3R4KA 4UUSA 3KFWX 2XUBA 2O9LA 1WHUA 2DT5A 1HDDC 3UR3C 2WBMA 3HOXJ 3DXJF 1R6RA 1IV8A 1I3QJ 3QPHA 2HTJA 3BDDA 3QPLA 5ILUA 4CYCA 5FD6A 3A0HC 3K0LA 5JVGF 2HOSA 3ECHA 2FD5A 2RDPA 5J3LA 3B6CA 4RA2A 4LGWA 2FJ1A 5E17F 2DT6A 4U0WA 2H27A 5KHDA 2HQNA 2F4MB 1MZBA 2BBYA 2NXNB 1UG0A
chains in the Genus database with same CATH topology
2FBHA 2A6HF 4CYDA 3L2CA 1WSUA 2ACJA 1B6AA 3BJOA 5FGMA 5ED4A 4JBAA 3BJAA 4HLYA 1UHWA 2CSOA 3KCCA 4U88A 2EFWA 4BH9A 5BPDA 3TO7A 2XGXA 4Q48A 4RB0A 1BIAA 5BS6A 3I54A 1XSVA 3E3VA 4B8XA 3WTSC 2BE5F 1U3EM 2GA2A 1USTA 3RTRA 3LWFA 3HSRA 3K2ZA 3ROUA 3KP7A 3TKYA 1B9NA 5FD5A 5F6FA 4ZZDA 3CJNA 2BGCA 2EV5A 3K1NA 2DPUA 5BQTA 2FU4A 1TQMA 3ECOA 3FWEA 5D8LB 4HW0A 5DCMA 2ZNZA 3AAFA 3C18A 2QLZA 3CUOA 1BC8C 1KU9A 4HX4A 2X0LA 5K1YA 1T38A 4KYWA 2OU2A 3CUQB 4HBLA 3KP5A 2ESHA 3I5UA 4IVNA 3KETA 1JGSA 3KZZA 4KN4X 1BJAA 1I1GA 2WV0A 2RGVA 1E17A 5D5VB 4XSZF 2STWA 1XDUA 2LDUA 1T0FA 4ON0A 4BYYA 1BI3A 3I4PA 1WKMA 2L54A 2MD5A 3V7CA 3HUGA 4Y15A 3K1PA 3T8RA 1EH8A 2WWYA 1B4AA 3IKTA 1TBXA 3LA7A 4UVBA 5E18F 1ZLJA 3RKWA 2XAHA 1CF7B 2P8TA 1ZHFA 1G3YA 4WCGA 1U5TC 4WXHA 3RYPA 3N97A 2MLGA 4A2UA 3CO7C 4GGGA 2B0LA 2IPQX 5BMZA 1R5GA 1F9NA 3FMSA 4RAYA 1HW1A 1IZ1A 1FYLA 1J75A 1W7PB 1IN5A 1O3TA 2PEXA 1XDSA 3HHGA 2DQRA 4KUMA 2K86A 1OR7A 3TQNA 5LEJA 5DD8A 4PCQA 2O0YA 4WX9A 2G9WA 4YFNF 2CG4A 5EEGA 4YFKF 1YFHA 1YS7A 2G7HA 1S7AA 2EJRA 2F5DA 2LNBA 1ODDA 4MTEA 3GFLA 2GWRA 3GX4X 3IRRA 3J80K 1TQPA 4LG0A 4FHTA 1BI2A 3P9IA 1R1TA 4LG0B 4ENKA 3V8JA 1E2XA 2DAOA 2D1VA 3M9AA 4I7HA 5AONA 1ZG5A 3JAMK 2DU9A 2DQLA 2HGCA 3GZ6A 1OYYA 3GZ5A 4UHTA 3GW2A 1V3FA 1QQIA 4H0EA 3ERED 4M72A 3SHFA 1YS6A 3GEZA 3M8EA 2EFNA 4S04A 5HS8A 4ETSA 2V1UA 2FE3A 2YX4A 1DPUA 1IN4A 1LDKB 4KA4A 4CHUA 1R36A 5J8CA 3DPTA 4WF2A 1KYZA 4G94A 3V7RA 1B9MA 1MKMA 2XAQA 4KNYA 4O3MA 1G3SA 5H6QA 5AIQA 1I5ZA 3R6SA 3Q9SA 2H09A 2XRNA 4MTDA 1B1BA 2YU3A 5JHUA 1JE8A 4CICA 3RKXA 2IT0A 1ZN2A 2VC1A 3J7AO 1IN6A 2KIMA 3I59A 1W5TA 2DK8A 3FMRA 3D0SA 4EJWA 3I53A 2GQQA 3DKWA 3L7WA 1K79A 5LLQA 2JZYA 4HV5A 3V8LA 3MWMA 3QPTA 3HSEA 3I58A 4RS8A 5DUKA 3S2WA 4R8HA 2H94A 3BP8A 3T5XA 3SQNA 3GO5A 3U1DA 1Q1HA 2IW5A 5FLXK 2KIFA 4Q5SF 3BWGA 4KICA 1U78A 4M6XA 4PGHA 1FBQA 3MEXA 2X4HA 4A6EA 4ESJA 4MEXF 3T0YA 2XV4S 5K5RA 2W24A 4R1HA 2VT2A 3T1BA 1NHAA 3DF8A 3FXUA 3Q5FA 1XCBA 5KVRA 2WTEA 2ZO4A 4XRFA 1W5SA 3J81K 2FSWA 4P55A 2UXNA 1ULYA 2W85A 4KFCA 4D0PA 4I2OA 1W7PA 3F8FA 4FX4A 5E8GA 2HR3A 3MCZA 1BIBA 4HX7A 1O7FA 4RB2C 1J2XA 2VBWA 1W7PD 2EA2A 2CO5A 3ISPA 5LEKA 2QBYB 2W84A 2CFXA 3WE2A 1OYIA 5TRDA 1MGTA 3WG9A 1XGOA 2XAFA 4RGUA 4OIOF 1DUXC 4HDUA 4AIJA 4A5MA 1HSJA 4F7ZA 1GHCA 2HQRA 2P5LC 2PG4A 3RDIA 3PQJA 3ZMZA 4N9HA 5HLIA 3VFZA 1D8JA 1Z91A 3B73A 2EA4A 2F5CA 4RGSA 5D6EA 3U2RA 4IRGA 4FT8A 2P7CB 5KK1A 3HHHA 3E6MA 2XKOA 1R00A 1FYKA 4GO1A 1KU2A 3O2PE 2XAGA 1O57A 2DTRA 1H0MA 1FT9A 1L0OC 4EJVA 1R22A 4HF1A 1IUYA 4UXNA 3K9TA 3QU3A 3U9GA 2VOOA 5K5OA 1UHMA 1JXSA 3LSTA 2FOKA 1FPQA 1JHHA 3F3XA 1XD7A 4LMYA 1MJ9A 3ABTA 3HRUA 4O6JA 3GFJA 1U8RA 1HKQA 2EFOA 2ZKZA 5HS9A 2H6BA 3RPUA 3JSOA 3C3WA 1S7OA 2FNPA 4Z2YA 2FEZA 5LRRA 2UZKA 4IRIA 5DCFA 2ZBKA 1BBYA 3PFIA 2Y75A 1QNTA 1XCVA 3BZ6A 2D2WA 3VODA 4XBFA 2MH2A 4CDGA 4WXDA 2ISYA 2CWEA 2GXBA 2KIUA 2W25A 1JHFA 3MAJA 1USSA 1YW8A 4NQWA 5CVJA 2R7DA 4A0YA 2NAZA 1TNTA 2M1BA 4FX0A 4HZFA 2DPDA 3ZMVA 1LEBA 2O6GE 4U7DA 3ML6A 2LF8A 5FFZA 3P9KA 3B02A 2RVCA 5D4RA 3TO6A 2M5WA 5HDKA 1FBUA 2QVOA 3CLOA 2VN2A 3GLXA 4WXCA 4OU0A 4XLNF 1YIOA 1LQ1A 1FWZA 2CGPA 1R1VA 2OD5A 2RQPA 4KN7X 3GFMA 1TW2A 4BHPA 1IAWA 5LHIA 3G3ZA 2KRFA 4XLPF 4ENMA 1T6SA 5E1ZB 2UXXA 1SAXA 2LKPA 5D4SA 4JQFA 4K2EA 2EFQA 2K27A 1IRFA 1SFEA 3LA2A 4HOBA 1GXPA 4A12A 1P92A 1LDJA 4P9FA 4HQEA 3TDUC 3M7GA 1FYMA 1T98A 2KJCA 5L3BA 5CLSA 2A68F 2QYOA 4EJUA 6PAXA 5LGTA 1PDNC 1SD4A 2GAUA 3DPLC 1HKTA 2QQBA 4Y17A 4MHGA 1I1SA 2VBYA 1OPCA 4HF0A 3CTAA 2Z9OA 1P2FA 3E5UA 2TDXA 5D6FA 2QUFA 2M8EA 1SD6A 2VOPA 3I59B 2L3DA 4GCVA 1CGPA 2VXZA 2QENA 4LLLA 1Z6RA 5BPIA 1BM9A 2CW0F 1CF7A 2BV6A 1KU3A 4PZJA 2HYFA 2Q0OA 5DDGA 2V1XA 3KP2A 3WTUC 5CVRA 1GXQA 4G7OF 3GVAA 1RNLA 4OIQF 3WGGA 2EB7A 3R60A 3R0AA 1O3QA 2PBIA 2HFHA 1K78B 4EJOA 4WK8F 1WQ2A 3K69A 2HZTA 2FNAA 2KKOA 1ZAOA 1IXSB 2L01A 3RYRA 2IRFG 1DPRA 5E1XA 1VTNC 1IRGA 2J5PA 1R23A 3BY6A 4EGZA 1MJBA 1P6RA 5D5WB 3V8KA 3EDPA 1W4MA 5FO5A 4UV8A 5DYMA 2FRHA 2K4JA 2DO7A 1WI9A 4IHTA 5F1RA 3Q9VA 4EJTA 2FBKA 5DCMB 1U5TB 1ZYRF 3QU6A 3T8TA 2OAZA 4MNUA 1H9GA 1RZ4A 2P5VA 3E5XA 3IC7A 2DLLA 2K4BA 4ESBA 4RGRA 2KJBA 1U2WA 4JK1X 1FC3A 2A07F 3SZPA 4L9TA 4RAZA 4LB5A 4ASNA 1ON1A 4GXOA 1S29A 3ZMTA 4EM1A 1I6XA 3SFZA 5D8KB 2QQ9A 4M73A 5L3FA 3P7NA 3V7SA 3HTUA 3EYIA 2XAJA 2HKOA 1XSXA 5E8IA 4KIGA 2ZNYA 3LQRA 2J5OA 5HLHA 4HQMA 3GFIA 2XASA 2CQKA 4R79A 1ZGJA 2XHKA 1G3WA 3EUHA 2OA4A 2VE8A 2RC4A 4ZH4F 4LLNA 2FBIA 2L4MA 1LDDA 5LBQA 3HOSA 3NEUA 2P4WA 1RIOH 3GXOA 1YG2A 2YPRA 4L9VA 5DEQA 1U5TA 4M9SA 4U7BA 5H20A 1IF1A 1MD0A 5K5QA 2E1CA 3BPXA 4LLGF 5AIPA 2FA5A 2AXLA 3DV8A 2F5EA 2PMHA 3C7JA 4ZYGA 4HX8A 4YG2F 4GYIA 3W6KB 3E6DA 5LGNA 5E20A 2AS5F 3WU0A 5EEHA 3BOQA 2GZWA 1I27A 2GIVA 3FXQA 1S6LA 5IT3A 3SXYA 3QOPA 4BNCA 2PJPA 1UFMA 4UUVA 1ZREA 1QGPA 5CVUA 1FBSA 2L02A 2NRAC 3ZN1A 4L9JA 1KYWA 1P4WA 1XSDA 1IN7A 3P9CA 2FXAA 5ICGA 2OQGA 3RKYA 2EK5A 2QWWA 1ZRCA 1BI1A 3WTYC 4KMFA 1XGMA 4P96A 2IA1A 1LJ9A 1RI7A 3QP6A 4ZYDA 3H92A 3MZYA 2VC0A 3V4GA 3QP5A 2ZFWA 2O61A 1KGSA 2DBBA 5H6RA 4BAYA 2EV0A 4NHJA 2JT1A 4KIBA 2R7FA 2F5FA 1F4KA 2QBYA 4L9NA 5J8FA 2ZMEA 4P5OA 2HKXA 3MFKA 1QZYA 1Z1DA 3W6JB 5DUIA 2H6CA 1FY7A 3RIRA 4O5VA 1IW7F 2DW4A 4LB6B 2Z3YA 5L3CA 1FP1D 2VT3A 1F5TA 1STZA 5JVTA 4BQAA 5L3GA 1TNSA 1FX7A 2XVCA 4WWCA 2OZUA 3FHZA 2O3FA 5L3EA 4ZZLA 4DQ2A 5FFXA 1OKRA 2Y48A 2RKHA 4G7HF 2UWMA 1UCRA 3WGHA 4HDVA 2ZJ2A 2Z99A 3ZMDA 5JI6A 2BEOA 4E70A 4RB1A 2FQ3A 2NNYA 5IT9K 2MLKA 3WTVC 1QBJA 1O7LA 3I71A 5HLGA 1L3LA 2OBPA 4RGXA 3WE3A 2VE9A 1AOYA 3HRSA 4OINF 1OMIA 2E1NA 2M45A 3E6BA 1SD7A 3MQ0A 1RUOA 3OOPA 5E1WA 3O6BB 1R5HA 4IJAA 5CVVA 2OZ6A 4AIKA 2V79A 4HA8A 1XN7A 1Z6TA 1R58A 1REPC 3R0JA 4KDPA 3ELKA 3PQKA 1PP7U 2HOEA 2M30A 3IL2A 5CVIA 1SFUA 3O3KA 3ABUA 5LRSA 4HV6A 1K6OA 1EH7A 1HW5A 3LA3A 2A61A 1EH6A 3M8FA 1HKSA 4IHSA 3HIFA 1B59A 3COAC 3QAHA 2IP2A 3F8NA 4PDKA 1ON2A 3LQQA 2ADUA 4Q4ZF 4EVIA 4MEYF 1IXRC 1TLHB 2V6CA 1LEAA 1FSHA 1FOKA 1R1UA 3FF5A 1LNWA 2C6YA 3JTHA 1BN5A 5HVQC 2PI0A 3VEPA 1LVAA 4MGRA 2PMUA 3GF2A 4ESFA 3KLOA 4YIFA 4EGYA 2YX7A 5ERIA 4NB5A 1XGSA 2EV6A 2XKPA 1O3SA 2XROA 4IPAA 1H9TA 2NYXA 3I64A 4YIIA 1D5VA 5ICFA 1HQCA 5A2QK 3FMQA 2ELHA 1HXDA 4G9YA 4G7ZF 2FF4A 1XB4A 2PLYA 2HTSA 2GXGA 2LSOA 1GVJA 1RUNA 3RJPA 4IXAA 2CYYA 1EV7A 1ZRFA 3K1MA 1TTYA 5HDGA 2RNJA 1BOAA 4P9UA 2OQRA 3MZHA 1T39A 2YSRA 2VONA 2ZCWA 3IWFA 4OOIA 1D3YA 4I01A 3WTZA 2Q8KA 5FLXZ 1SMYF 3N4MA 2STTA 4CO8A 4AIHA 1YO5C 3GYHX 4BHCA 1ZRDA 4OMYA 4OIRF 4GYGA 4KT5C 3DQVC 2JTVA 1R7JA 1YTYA 3VOEA 2PQ8A 2XIGA 3RI4A 1QZZA 5FB2A 3F21A 3FXRA 3ZMUA 4L0YB 5TJJA 1MDMB 1ZGAA 4EM0B 1YW7A 4I0AA 1G6NA 2D1HA 2Q2EA 2DFIA 5JFRA 2JSCA 2JRTA 3IRQA 5IT9Z 3CDHA 1Z05A 5DD4A 3LAJA 1SD5A 1BC7C 3GWZA 4LK0F 1ONVA 3ZPLA 4AD9A 1YLFA 2F2EA 2RN7A 4TV7A 2G7UA 3VB2A 4IRHA 3SZTA 4G6QA 3NRVA 4M6YA 1J9IA 3CUQA 2IJLA 4ENNA 2NS0A 3BJ6A 1AWCA 4UVCA 2V9VA 2QZ8A 5HDNA 3M1EA 4A6DA 3BPVA 1DDNA 2E7XA 3RPQA 2COMA 2O8XA 4L5JA 4IF4A 4I02A 4N0BA 4Q47A 5J6XA 4OMZA 3KP4A 2QM3A 2ETHA 3KP3A 1HBXG 3HYIA 5ILVA 3HRTA 1YYVA 3TGNA 3H3ZA 4CGZA 2VODA 3F23A 2HS5A 2DK5A 3IHUA 4HLXA 2DI3A 4QLCU 4M74A 2HWVA 5F64A 1P4XA 4UNOA 3GUDA 3E97A 4OIPF 4BHBA 5ICEA 1ZG1A 3D5LA 2JPCA 1OYWA 4EQQA 3WU1B 1S3JA 2V1DA 4N9IA 2LF7A 1ZLKA 3R61A 5A2QZ 2O03A 1FNNA 3L00A 3ZN0A 3F6OA 4AWXB 4CZZA 1Y0UA 2R3SA 1TW3A 3I0TA 3WTWC 4UV9A 2BYVE 3OV8A 2E7WA 1F1ZA 1T2KA 2EFPA 2ZXJA 4L0ZB 1FP2A 1WRJA 4M9ZA 4KIFA 4G8XA 1G3TA 4U0VA 3TDZC 1S8NA 4I0BA 4EV0A 2VBZA 3CUQC 1PUEE 1J7KA 1KQ9A 2EWNA 5ICCA 4UVAA 1ZG3A 3HSFA 3WGIA 3LAPA 1TQIA 3H3UA 4CXFA 3L9FA 4M9XA 3WODF 2HDCA 2PN6A 3HOTA 3JW4A 1UB9A 1WWXA 2MH9A 3KP6A 2MBFA 3WTTC 4MQVA 4HF2A 1FZPB 5DV5A 4HAMA 4YFXF 3IWZA 2JPBA 2QQAA 2ISZA 2Y0MA 3NQOA 5BOXA 1K78A 3DFGA 3FM3A 3HTSB 2P5KA 3TOBA 2IA2A 2IVMA 3EETA 3REOA 4B09A 2L4AA 2YR2A 1ZH5A 1ZARA 3F72A 2VBXA 2P6TA 4LFUA 3KEOA 4KMUX 3E6CC 4BXUA 3WTXC 1J5YA 5LHHA 4M71A 2A69F 4A0XA 3KLNA 2HEOA 1IXCA 2K02A 3FZVA 5D5UB 2IA0A 4MQ9F 3JAMZ 3F22A 2MA3A 1KA8A 1SFXA 2P7VB 2MC3A 1IN8A 3DEUA 3F8CA 2K7LA 4G6DA 1YQAA 3TOAA 3HRMA 3F6VA 4LD5A 5D5XB 4RB3C 2P6SA 1K7AA 1FSEA 1QO0D 2A3SA 4ZYHA 3KE2A 3J80Z 3ULQB 3ZQ7A 4XSXF 4PGGA 2D45A 3ZP5A 2A6EF 1U6GA 1V4RA 3CO6C 3FM5A 3L09A 1DP7P 4S05A 1XGNA 2PFBA 1Z7UA 2A5YB 4EM2A 3E5QA 3J81Z 4U0YA 3BROA 1KQ8A 1BI0A 1YW9A 2WC2A 3G73A 2ZMEB 1G4DA 4DNCA 3KEQA 3IKVA 5JR3A 4L18B 2FMYA 5HOOA 4HYEA 3F8MA 2W57A 4ZYEA 4ENJA 2NNNA 5LHGA 3DP7A 5LGUA 1O3RA 1D8KA 1SMTA 3TO9A 5L3DA 2Z5UA 3QRFF 1J0RA 1Z9CA 3LFKA 4I98B 3C1DA 4AVPA 2FMLA 2Z33A 1QPMA 4QWQA 1HSTA 1HW2A 4Y13A 3ZMSA 1X3UA 5CJ9A 5CYVA 2GA1A 4LK1F 1P4AA 1J59A 3JSPA 2ESNA 2RV8A 1FLIA 4L5IA 3FX3A 5HS7A 1MJAA 3EYYA 4LJZF 4A0ZA 3F8BA 2HYGD 3JTGA 3EQLF 4I09A 3KZYA 5ILSA 4EMSA 4A5NA 1LB2A 1XMKA 1C0WA 1MDMA 1A04A 1KU7A 1XMAA 1PP8F 1KQ0A 2M87A 3R4KA 3KFWX 2XUBA 2DT5A 3DXJF 3QPHA 2HTJA 3BDDA 5ILUA 5FD6A 3K0LA 3ECHA 2RDPA 4LGWA 5E17F 4U0WA 2H27A 2HQNA 1MZBA 2BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBH A;  2A6H F;  4CYD A;  3L2C A;  1WSU A;  2ACJ A;  1B6A A;  3BJO A;  5FGM A;  5ED4 A;  4JBA A;  3BJA A;  4HLY A;  1UHW A;  2CSO A;  3KCC A;  4U88 A;  2EFW A;  4BH9 A;  5BPD A;  3TO7 A;  2XGX A;  4Q48 A;  4RB0 A;  1BIA A;  5BS6 A;  3I54 A;  1XSV A;  3E3V A;  4B8X A;  3WTS C;  2BE5 F;  1U3E M;  2GA2 A;  1UST A;  3RTR A;  3LWF A;  3HSR A;  3K2Z A;  3ROU A;  3KP7 A;  3TKY A;  1B9N A;  5FD5 A;  5F6F A;  4ZZD A;  3CJN A;  2BGC A;  2EV5 A;  3K1N A;  2DPU A;  5BQT A;  2FU4 A;  1TQM A;  3ECO A;  3FWE A;  5D8L B;  4HW0 A;  5DCM A;  2ZNZ A;  3AAF A;  3C18 A;  2QLZ A;  3CUO A;  1BC8 C;  1KU9 A;  4HX4 A;  2X0L A;  5K1Y A;  1T38 A;  4KYW A;  2OU2 A;  3CUQ B;  4HBL A;  3KP5 A;  2ESH A;  3I5U A;  4IVN A;  3KET A;  1JGS A;  3KZZ A;  4KN4 X;  1BJA A;  1I1G A;  2WV0 A;  2RGV A;  1E17 A;  5D5V B;  4XSZ F;  2STW A;  1XDU A;  2LDU A;  1T0F A;  4ON0 A;  4BYY A;  1BI3 A;  3I4P A;  1WKM A;  2L54 A;  2MD5 A;  3V7C A;  3HUG A;  4Y15 A;  3K1P A;  3T8R A;  1EH8 A;  2WWY A;  1B4A A;  3IKT A;  1TBX A;  3LA7 A;  4UVB A;  5E18 F;  1ZLJ A;  3RKW A;  2XAH A;  1CF7 B;  2P8T A;  1ZHF A;  1G3Y A;  4WCG A;  1U5T C;  4WXH A;  3RYP A;  3N97 A;  2MLG A;  4A2U A;  3CO7 C;  4GGG A;  2B0L A;  2IPQ X;  5BMZ A;  1R5G A;  1F9N A;  3FMS A;  4RAY A;  1HW1 A;  1IZ1 A;  1FYL A;  1J75 A;  1W7P B;  1IN5 A;  1O3T A;  2PEX A;  1XDS A;  3HHG A;  2DQR A;  4KUM A;  2K86 A;  1OR7 A;  3TQN A;  5LEJ A;  5DD8 A;  4PCQ A;  2O0Y A;  4WX9 A;  2G9W A;  4YFN F;  2CG4 A;  5EEG A;  4YFK F;  1YFH A;  1YS7 A;  2G7H A;  1S7A A;  2EJR A;  2F5D A;  2LNB A;  1ODD A;  4MTE A;  3GFL A;  2GWR A;  3GX4 X;  3IRR A;  3J80 K;  1TQP A;  4LG0 A;  4FHT A;  1BI2 A;  3P9I A;  1R1T A;  4LG0 B;  4ENK A;  3V8J A;  1E2X A;  2DAO A;  2D1V A;  3M9A A;  4I7H A;  5AON A;  1ZG5 A;  3JAM K;  2DU9 A;  2DQL A;  2HGC A;  3GZ6 A;  1OYY A;  3GZ5 A;  4UHT A;  3GW2 A;  1V3F A;  1QQI A;  4H0E A;  3ERE D;  4M72 A;  3SHF A;  1YS6 A;  3GEZ A;  3M8E A;  2EFN A;  4S04 A;  5HS8 A;  4ETS A;  2V1U A;  2FE3 A;  2YX4 A;  1DPU A;  1IN4 A;  1LDK B;  4KA4 A;  4CHU A;  1R36 A;  5J8C A;  3DPT A;  4WF2 A;  1KYZ A;  4G94 A;  3V7R A;  1B9M A;  1MKM A;  2XAQ A;  4KNY A;  4O3M A;  1G3S A;  5H6Q A;  5AIQ A;  1I5Z A;  3R6S A;  3Q9S A;  2H09 A;  2XRN A;  4MTD A;  1B1B A;  2YU3 A;  5JHU A;  1JE8 A;  4CIC A;  3RKX A;  2IT0 A;  1ZN2 A;  2VC1 A;  3J7A O;  1IN6 A;  2KIM A;  3I59 A;  1W5T A;  2DK8 A;  3FMR A;  3D0S A;  4EJW A;  3I53 A;  2GQQ A;  3DKW A;  3L7W A;  1K79 A;  5LLQ A;  2JZY A;  4HV5 A;  3V8L A;  3MWM A;  3QPT A;  3HSE A;  3I58 A;  4RS8 A;  5DUK A;  3S2W A;  4R8H A;  2H94 A;  3BP8 A;  3T5X A;  3SQN A;  3GO5 A;  3U1D A;  1Q1H A;  2IW5 A;  5FLX K;  2KIF A;  4Q5S F;  3BWG A;  4KIC A;  1U78 A;  4M6X A;  4PGH A;  1FBQ A;  3MEX A;  2X4H A;  4A6E A;  4ESJ A;  4MEX F;  3T0Y A;  2XV4 S;  5K5R A;  2W24 A;  4R1H A;  2VT2 A;  3T1B A;  1NHA A;  3DF8 A;  3FXU A;  3Q5F A;  1XCB A;  5KVR A;  2WTE A;  2ZO4 A;  4XRF A;  1W5S A;  3J81 K;  2FSW A;  4P55 A;  2UXN A;  1ULY A;  2W85 A;  4KFC A;  4D0P A;  4I2O A;  1W7P A;  3F8F A;  4FX4 A;  5E8G A;  2HR3 A;  3MCZ A;  1BIB A;  4HX7 A;  1O7F A;  4RB2 C;  1J2X A;  2VBW A;  1W7P D;  2EA2 A;  2CO5 A;  3ISP A;  5LEK A;  2QBY B;  2W84 A;  2CFX A;  3WE2 A;  1OYI A;  5TRD A;  1MGT A;  3WG9 A;  1XGO A;  2XAF A;  4RGU A;  4OIO F;  1DUX C;  4HDU A;  4AIJ A;  4A5M A;  1HSJ A;  4F7Z A;  1GHC A;  2HQR A;  2P5L C;  2PG4 A;  3RDI A;  3PQJ A;  3ZMZ A;  4N9H A;  5HLI A;  3VFZ A;  1D8J A;  1Z91 A;  3B73 A;  2EA4 A;  2F5C A;  4RGS A;  5D6E A;  3U2R A;  4IRG A;  4FT8 A;  2P7C B;  5KK1 A;  3HHH A;  3E6M A;  2XKO A;  1R00 A;  1FYK A;  4GO1 A;  1KU2 A;  3O2P E;  2XAG A;  1O57 A;  2DTR A;  1H0M A;  1FT9 A;  1L0O C;  4EJV A;  1R22 A;  4HF1 A;  1IUY A;  4UXN A;  3K9T A;  3QU3 A;  3U9G A;  2VOO A;  5K5O A;  1UHM A;  1JXS A;  3LST A;  2FOK A;  1FPQ A;  1JHH A;  3F3X A;  1XD7 A;  4LMY A;  1MJ9 A;  3ABT A;  3HRU A;  4O6J A;  3GFJ A;  1U8R A;  1HKQ A;  2EFO A;  2ZKZ A;  5HS9 A;  2H6B A;  3RPU A;  3JSO A;  3C3W A;  1S7O A;  2FNP A;  4Z2Y A;  2FEZ A;  5LRR A;  2UZK A;  4IRI A;  5DCF A;  2ZBK A;  1BBY A;  3PFI A;  2Y75 A;  1QNT A;  1XCV A;  3BZ6 A;  2D2W A;  3VOD A;  4XBF A;  2MH2 A;  4CDG A;  4WXD A;  2ISY A;  2CWE A;  2GXB A;  2KIU A;  2W25 A;  1JHF A;  3MAJ A;  1USS A;  1YW8 A;  4NQW A;  5CVJ A;  2R7D A;  4A0Y A;  2NAZ A;  1TNT A;  2M1B A;  4FX0 A;  4HZF A;  2DPD A;  3ZMV A;  1LEB A;  2O6G E;  4U7D A;  3ML6 A;  2LF8 A;  5FFZ A;  3P9K A;  3B02 A;  2RVC A;  5D4R A;  3TO6 A;  2M5W A;  5HDK A;  1FBU A;  2QVO A;  3CLO A;  2VN2 A;  3GLX A;  4WXC A;  4OU0 A;  4XLN F;  1YIO A;  1LQ1 A;  1FWZ A;  2CGP A;  1R1V A;  2OD5 A;  2RQP A;  4KN7 X;  3GFM A;  1TW2 A;  4BHP A;  1IAW A;  5LHI A;  3G3Z A;  2KRF A;  4XLP F;  4ENM A;  1T6S A;  5E1Z B;  2UXX A;  1SAX A;  2LKP A;  5D4S A;  4JQF A;  4K2E A;  2EFQ A;  2K27 A;  1IRF A;  1SFE A;  3LA2 A;  4HOB A;  1GXP A;  4A12 A;  1P92 A;  1LDJ A;  4P9F A;  4HQE A;  3TDU C;  3M7G A;  1FYM A;  1T98 A;  2KJC A;  5L3B A;  5CLS A;  2A68 F;  2QYO A;  4EJU A;  6PAX A;  5LGT A;  1PDN C;  1SD4 A;  2GAU A;  3DPL C;  1HKT A;  2QQB A;  4Y17 A;  4MHG A;  1I1S A;  2VBY A;  1OPC A;  4HF0 A;  3CTA A;  2Z9O A;  1P2F A;  3E5U A;  2TDX A;  5D6F A;  2QUF A;  2M8E A;  1SD6 A;  2VOP A;  3I59 B;  2L3D A;  4GCV A;  1CGP A;  2VXZ A;  2QEN A;  4LLL A;  1Z6R A;  5BPI A;  1BM9 A;  2CW0 F;  1CF7 A;  2BV6 A;  1KU3 A;  4PZJ A;  2HYF A;  2Q0O A;  5DDG A;  2V1X A;  3KP2 A;  3WTU C;  5CVR A;  1GXQ A;  4G7O F;  3GVA A;  1RNL A;  4OIQ F;  3WGG A;  2EB7 A;  3R60 A;  3R0A A;  1O3Q A;  2PBI A;  2HFH A;  1K78 B;  4EJO A;  4WK8 F;  1WQ2 A;  3K69 A;  2HZT A;  2FNA A;  2KKO A;  1ZAO A;  1IXS B;  2L01 A;  3RYR A;  2IRF G;  1DPR A;  5E1X A;  1VTN C;  1IRG A;  2J5P A;  1R23 A;  3BY6 A;  4EGZ A;  1MJB A;  1P6R A;  5D5W B;  3V8K A;  3EDP A;  1W4M A;  5FO5 A;  4UV8 A;  5DYM A;  2FRH A;  2K4J A;  2DO7 A;  1WI9 A;  4IHT A;  5F1R A;  3Q9V A;  4EJT A;  2FBK A;  5DCM B;  1U5T B;  1ZYR F;  3QU6 A;  3T8T A;  2OAZ A;  4MNU A;  1H9G A;  1RZ4 A;  2P5V A;  3E5X A;  3IC7 A;  2DLL A;  2K4B A;  4ESB A;  4RGR A;  2KJB A;  1U2W A;  4JK1 X;  1FC3 A;  2A07 F;  3SZP A;  4L9T A;  4RAZ A;  4LB5 A;  4ASN A;  1ON1 A;  4GXO A;  1S29 A;  3ZMT A;  4EM1 A;  1I6X A;  3SFZ A;  5D8K B;  2QQ9 A;  4M73 A;  5L3F A;  3P7N A;  3V7S A;  3HTU A;  3EYI A;  2XAJ A;  2HKO A;  1XSX A;  5E8I A;  4KIG A;  2ZNY A;  3LQR A;  2J5O A;  5HLH A;  4HQM A;  3GFI A;  2XAS A;  2CQK A;  4R79 A;  1ZGJ A;  2XHK A;  1G3W A;  3EUH A;  2OA4 A;  2VE8 A;  2RC4 A;  4ZH4 F;  4LLN A;  2FBI A;  2L4M A;  1LDD A;  5LBQ A;  3HOS A;  3NEU A;  2P4W A;  1RIO H;  3GXO A;  1YG2 A;  2YPR A;  4L9V A;  5DEQ A;  1U5T A;  4M9S A;  4U7B A;  5H20 A;  1IF1 A;  1MD0 A;  5K5Q A;  2E1C A;  3BPX A;  4LLG F;  5AIP A;  2FA5 A;  2AXL A;  3DV8 A;  2F5E A;  2PMH A;  3C7J A;  4ZYG A;  4HX8 A;  4YG2 F;  4GYI A;  3W6K B;  3E6D A;  5LGN A;  5E20 A;  2AS5 F;  3WU0 A;  5EEH A;  3BOQ A;  2GZW A;  1I27 A;  2GIV A;  3FXQ A;  1S6L A;  5IT3 A;  3SXY A;  3QOP A;  4BNC A;  2PJP A;  1UFM A;  4UUV A;  1ZRE A;  1QGP A;  5CVU A;  1FBS A;  2L02 A;  2NRA C;  3ZN1 A;  4L9J A;  1KYW A;  1P4W A;  1XSD A;  1IN7 A;  3P9C A;  2FXA A;  5ICG A;  2OQG A;  3RKY A;  2EK5 A;  2QWW A;  1ZRC A;  1BI1 A;  3WTY C;  4KMF A;  1XGM A;  4P96 A;  2IA1 A;  1LJ9 A;  1RI7 A;  3QP6 A;  4ZYD A;  3H92 A;  3MZY A;  2VC0 A;  3V4G A;  3QP5 A;  2ZFW A;  2O61 A;  1KGS A;  2DBB A;  5H6R A;  4BAY A;  2EV0 A;  4NHJ A;  2JT1 A;  4KIB A;  2R7F A;  2F5F A;  1F4K A;  2QBY A;  4L9N A;  5J8F A;  2ZME A;  4P5O A;  2HKX A;  3MFK A;  1QZY A;  1Z1D A;  3W6J B;  5DUI A;  2H6C A;  1FY7 A;  3RIR A;  4O5V A;  1IW7 F;  2DW4 A;  4LB6 B;  2Z3Y A;  5L3C A;  1FP1 D;  2VT3 A;  1F5T A;  1STZ A;  5JVT A;  4BQA A;  5L3G A;  1TNS A;  1FX7 A;  2XVC A;  4WWC A;  2OZU A;  3FHZ A;  2O3F A;  5L3E A;  4ZZL A;  4DQ2 A;  5FFX A;  1OKR A;  2Y48 A;  2RKH A;  4G7H F;  2UWM A;  1UCR A;  3WGH A;  4HDV A;  2ZJ2 A;  2Z99 A;  3ZMD A;  5JI6 A;  2BEO A;  4E70 A;  4RB1 A;  2FQ3 A;  2NNY A;  5IT9 K;  2MLK A;  3WTV C;  1QBJ A;  1O7L A;  3I71 A;  5HLG A;  1L3L A;  2OBP A;  4RGX A;  3WE3 A;  2VE9 A;  1AOY A;  3HRS A;  4OIN F;  1OMI A;  2E1N A;  2M45 A;  3E6B A;  1SD7 A;  3MQ0 A;  1RUO A;  3OOP A;  5E1W A;  3O6B B;  1R5H A;  4IJA A;  5CVV A;  2OZ6 A;  4AIK A;  2V79 A;  4HA8 A;  1XN7 A;  1Z6T A;  1R58 A;  1REP C;  3R0J A;  4KDP A;  3ELK A;  3PQK A;  1PP7 U;  2HOE A;  2M30 A;  3IL2 A;  5CVI A;  1SFU A;  3O3K A;  3ABU A;  5LRS A;  4HV6 A;  1K6O A;  1EH7 A;  1HW5 A;  3LA3 A;  2A61 A;  1EH6 A;  3M8F A;  1HKS A;  4IHS A;  3HIF A;  1B59 A;  3COA C;  3QAH A;  2IP2 A;  3F8N A;  4PDK A;  1ON2 A;  3LQQ A;  2ADU A;  4Q4Z F;  4EVI A;  4MEY F;  1IXR C;  1TLH B;  2V6C A;  1LEA A;  1FSH A;  1FOK A;  1R1U A;  3FF5 A;  1LNW A;  2C6Y A;  3JTH A;  1BN5 A;  5HVQ C;  2PI0 A;  3VEP A;  1LVA A;  4MGR A;  2PMU A;  3GF2 A;  4ESF A;  3KLO A;  4YIF A;  4EGY A;  2YX7 A;  5ERI A;  4NB5 A;  1XGS A;  2EV6 A;  2XKP A;  1O3S A;  2XRO A;  4IPA A;  1H9T A;  2NYX A;  3I64 A;  4YII A;  1D5V A;  5ICF A;  1HQC A;  5A2Q K;  3FMQ A;  2ELH A;  1HXD A;  4G9Y A;  4G7Z F;  2FF4 A;  1XB4 A;  2PLY A;  2HTS A;  2GXG A;  2LSO A;  1GVJ A;  1RUN A;  3RJP A;  4IXA A;  2CYY A;  1EV7 A;  1ZRF A;  3K1M A;  1TTY A;  5HDG A;  2RNJ A;  1BOA A;  4P9U A;  2OQR A;  3MZH A;  1T39 A;  2YSR A;  2VON A;  2ZCW A;  3IWF A;  4OOI A;  1D3Y A;  4I01 A;  3WTZ A;  2Q8K A;  5FLX Z;  1SMY F;  3N4M A;  2STT A;  4CO8 A;  4AIH A;  1YO5 C;  3GYH X;  4BHC A;  1ZRD A;  4OMY A;  4OIR F;  4GYG A;  4KT5 C;  3DQV C;  2JTV A;  1R7J A;  1YTY A;  3VOE A;  2PQ8 A;  2XIG A;  3RI4 A;  1QZZ A;  5FB2 A;  3F21 A;  3FXR A;  3ZMU A;  4L0Y B;  5TJJ A;  1MDM B;  1ZGA A;  4EM0 B;  1YW7 A;  4I0A A;  1G6N A;  2D1H A;  2Q2E A;  2DFI A;  5JFR A;  2JSC A;  2JRT A;  3IRQ A;  5IT9 Z;  3CDH A;  1Z05 A;  5DD4 A;  3LAJ A;  1SD5 A;  1BC7 C;  3GWZ A;  4LK0 F;  1ONV A;  3ZPL A;  4AD9 A;  1YLF A;  2F2E A;  2RN7 A;  4TV7 A;  2G7U A;  3VB2 A;  4IRH A;  3SZT A;  4G6Q A;  3NRV A;  4M6Y A;  1J9I A;  3CUQ A;  2IJL A;  4ENN A;  2NS0 A;  3BJ6 A;  1AWC A;  4UVC A;  2V9V A;  2QZ8 A;  5HDN A;  3M1E A;  4A6D A;  3BPV A;  1DDN A;  2E7X A;  3RPQ A;  2COM A;  2O8X A;  4L5J A;  4IF4 A;  4I02 A;  4N0B A;  4Q47 A;  5J6X A;  4OMZ A;  3KP4 A;  2QM3 A;  2ETH A;  3KP3 A;  1HBX G;  3HYI A;  5ILV A;  3HRT A;  1YYV A;  3TGN A;  3H3Z A;  4CGZ A;  2VOD A;  3F23 A;  2HS5 A;  2DK5 A;  3IHU A;  4HLX A;  2DI3 A;  4QLC U;  4M74 A;  2HWV A;  5F64 A;  1P4X A;  4UNO A;  3GUD A;  3E97 A;  4OIP F;  4BHB A;  5ICE A;  1ZG1 A;  3D5L A;  2JPC A;  1OYW A;  4EQQ A;  3WU1 B;  1S3J A;  2V1D A;  4N9I A;  2LF7 A;  1ZLK A;  3R61 A;  5A2Q Z;  2O03 A;  1FNN A;  3L00 A;  3ZN0 A;  3F6O A;  4AWX B;  4CZZ A;  1Y0U A;  2R3S A;  1TW3 A;  3I0T A;  3WTW C;  4UV9 A;  2BYV E;  3OV8 A;  2E7W A;  1F1Z A;  1T2K A;  2EFP A;  2ZXJ A;  4L0Z B;  1FP2 A;  1WRJ A;  4M9Z A;  4KIF A;  4G8X A;  1G3T A;  4U0V A;  3TDZ C;  1S8N A;  4I0B A;  4EV0 A;  2VBZ A;  3CUQ C;  1PUE E;  1J7K A;  1KQ9 A;  2EWN A;  5ICC A;  4UVA A;  1ZG3 A;  3HSF A;  3WGI A;  3LAP A;  1TQI A;  3H3U A;  4CXF A;  3L9F A;  4M9X A;  3WOD F;  2HDC A;  2PN6 A;  3HOT A;  3JW4 A;  1UB9 A;  1WWX A;  2MH9 A;  3KP6 A;  2MBF A;  3WTT C;  4MQV A;  4HF2 A;  1FZP B;  5DV5 A;  4HAM A;  4YFX F;  3IWZ A;  2JPB A;  2QQA A;  2ISZ A;  2Y0M A;  3NQO A;  5BOX A;  1K78 A;  3DFG A;  3FM3 A;  3HTS B;  2P5K A;  3TOB A;  2IA2 A;  2IVM A;  3EET A;  3REO A;  4B09 A;  2L4A A;  2YR2 A;  1ZH5 A;  1ZAR A;  3F72 A;  2VBX A;  2P6T A;  4LFU A;  3KEO A;  4KMU X;  3E6C C;  4BXU A;  3WTX C;  1J5Y A;  5LHH A;  4M71 A;  2A69 F;  4A0X A;  3KLN A;  2HEO A;  1IXC A;  2K02 A;  3FZV A;  5D5U B;  2IA0 A;  4MQ9 F;  3JAM Z;  3F22 A;  2MA3 A;  1KA8 A;  1SFX A;  2P7V B;  2MC3 A;  1IN8 A;  3DEU A;  3F8C A;  2K7L A;  4G6D A;  1YQA A;  3TOA A;  3HRM A;  3F6V A;  4LD5 A;  5D5X B;  4RB3 C;  2P6S A;  1K7A A;  1FSE A;  1QO0 D;  2A3S A;  4ZYH A;  3KE2 A;  3J80 Z;  3ULQ B;  3ZQ7 A;  4XSX F;  4PGG A;  2D45 A;  3ZP5 A;  2A6E F;  1U6G A;  1V4R A;  3CO6 C;  3FM5 A;  3L09 A;  1DP7 P;  4S05 A;  1XGN A;  2PFB A;  1Z7U A;  2A5Y B;  4EM2 A;  3E5Q A;  3J81 Z;  4U0Y A;  3BRO A;  1KQ8 A;  1BI0 A;  1YW9 A;  2WC2 A;  3G73 A;  2ZME B;  1G4D A;  4DNC A;  3KEQ A;  3IKV A;  5JR3 A;  4L18 B;  2FMY A;  5HOO A;  4HYE A;  3F8M A;  2W57 A;  4ZYE A;  4ENJ A;  2NNN A;  5LHG A;  3DP7 A;  5LGU A;  1O3R A;  1D8K A;  1SMT A;  3TO9 A;  5L3D A;  2Z5U A;  3QRF F;  1J0R A;  1Z9C A;  3LFK A;  4I98 B;  3C1D A;  4AVP A;  2FML A;  2Z33 A;  1QPM A;  4QWQ A;  1HST A;  1HW2 A;  4Y13 A;  3ZMS A;  1X3U A;  5CJ9 A;  5CYV A;  2GA1 A;  4LK1 F;  1P4A A;  1J59 A;  3JSP A;  2ESN A;  2RV8 A;  1FLI A;  4L5I A;  3FX3 A;  5HS7 A;  1MJA A;  3EYY A;  4LJZ F;  4A0Z A;  3F8B A;  2HYG D;  3JTG A;  3EQL F;  4I09 A;  3KZY A;  5ILS A;  4EMS A;  4A5N A;  1LB2 A;  1XMK A;  1C0W A;  1MDM A;  1A04 A;  1KU7 A;  1XMA A;  1PP8 F;  1KQ0 A;  2M87 A;  3R4K A;  3KFW X;  2XUB A;  2DT5 A;  3DXJ F;  3QPH A;  2HTJ A;  3BDD A;  5ILU A;  5FD6 A;  3K0L A;  3ECH A;  2RDP A;  4LGW A;  5E17 F;  4U0W A;  2H27 A;  2HQN A;  1MZB A;  2BBY A; 
#chains in the Genus database with same CATH topology
 4S0H B;  1TL8 A;  2FBH A;  2A6H F;  4CYD A;  3L2C A;  3ZRG A;  5DTD A;  1WJA A;  1YHQ I;  1WSU A;  1UJ8 A;  1B6A A;  2ACJ A;  3BJO A;  2DA5 A;  2HNH A;  5J40 A;  4ZYA A;  5FGM A;  5ED4 A;  2LC2 A;  4JBA A;  4UY8 I;  4HEA 2;  3BJA A;  4HLY A;  1UHW A;  2CSO A;  3KCC A;  2F4I A;  4A3J J;  3QPS A;  4U88 A;  2EFW A;  4BH9 A;  4QIW N;  3W3C A;  1AHD P;  5BPD A;  3TO7 A;  2M34 A;  2XGX A;  2DMP A;  3JRH A;  4Q48 A;  4RB0 A;  1BIA A;  2ECB A;  5BS6 A;  3I54 A;  5EZH A;  2DFF A;  1XSV A;  5IYB J;  2OTL I;  3E3V A;  4B8X A;  3WTS C;  2BE5 F;  3N05 A;  3TMO A;  1U3E M;  2GA2 A;  3E7L A;  1UST A;  3TP0 A;  3RTR A;  2OCC H;  3LWF A;  2GBY A;  3HSR A;  2K9Q A;  3K7A J;  1A6Q A;  2Y30 A;  3K2Z A;  1D5Y A;  4HNV A;  3OIQ A;  5K7Z A;  2DYS H;  3C2B A;  1T0F C;  2DJN A;  3ROU A;  3KP7 A;  1TWH J;  4C9Y A;  3RPU D;  2MD0 A;  1MMD A;  2AQE A;  3TKY A;  1B9N A;  1VI0 A;  5IOZ A;  5FD5 A;  4EEF G;  3B6A A;  5F6F A;  4QPQ A;  4YEL A;  2ZXW H;  4ZZD A;  3CJN A;  5IP7 J;  4XLH A;  2BGC A;  2EV5 A;  4Y33 A;  3K1N A;  5BQT A;  2FU4 A;  2DPU A;  1TQM A;  4PJJ A;  3CJT B;  3ECO A;  3S1R J;  3FWE A;  4CCK A;  5D8L B;  4HW0 A;  2M0M A;  4Y4R A;  2QSG X;  1VQ5 I;  2E19 A;  2VJ4 A;  2FOW A;  5DCM A;  3CF5 F;  1S9H A;  2ZNZ A;  3LSJ A;  3AAF A;  3C18 A;  4F93 B;  3OS2 A;  5KCM A;  2W1O A;  3IH4 A;  4II3 A;  2QLZ A;  1JUM A;  3CUO A;  1BC8 C;  4BAC A;  2R7V A;  2MAB A;  2JQ7 A;  1KU9 A;  4HX4 A;  3Q0V A;  1OCO H;  3K70 C;  2X0L A;  2DA3 A;  3CJQ B;  5K1Y A;  1SFK A;  1T38 A;  4FIS A;  2DDA A;  4KYW A;  2OU2 A;  4XRS A;  2MSY A;  3CUQ B;  4HBL A;  4XL9 A;  3K6G A;  3KP5 A;  2ESH A;  2MGQ A;  3I5U A;  2JJ7 A;  3FK6 A;  4IVN A;  1JGS A;  3KET A;  2O8K A;  3A2K A;  3K2A A;  3CMY A;  3KZZ A;  4KN4 X;  1BJA A;  2L7K A;  1I1G A;  2WV0 A;  4A3F J;  2RGV A;  2P81 A;  1E17 A;  5D5V B;  2FUG 2;  4XSZ F;  2E5N A;  2STW A;  5H2F C;  1XDU A;  2LDU A;  1T0F A;  4IEJ A;  2HXI A;  2YU9 J;  4ON0 A;  4BYY A;  1TC3 C;  1WJE A;  1BI3 A;  3NWT A;  4PJM A;  2KIQ A;  3I4P A;  1WKM A;  1OIS A;  2L54 A;  2MD5 A;  3V7C A;  4A3B J;  3G71 I;  3CCE I;  4G12 A;  3HUG A;  4Y15 A;  3K1P A;  4E7S A;  2OCE A;  3T8R A;  4IZZ A;  1OCZ H;  3EUK L;  3BTC A;  1EH8 A;  2HDD A;  2WWY A;  4BQQ A;  1VQ9 I;  1B4A A;  3CQZ J;  4DYQ A;  3IKT A;  1SVM A;  3K4M A;  1TBX A;  3LA7 A;  4AVZ A;  4UVB A;  5E18 F;  1ZLJ A;  3BLY A;  3RKW A;  2XAH A;  3IH2 A;  1CF7 B;  2P8T A;  1ZHF A;  1G3Y A;  1P9Q C;  1LPQ A;  4WCG A;  1U5T C;  4WXH A;  2Y0S N;  3RYP A;  3N97 A;  2MLG A;  5JLW A;  1S7E A;  2XPU A;  4A2U A;  4PFO A;  3LMM A;  3DU5 A;  3S16 J;  3CO7 C;  4GGG A;  2B0L A;  2IPQ X;  4Y52 J;  3VYT B;  4A3D J;  2ZSI B;  2Z16 A;  1R5G A;  5BMZ A;  1F9N A;  3FMS A;  4RAY A;  2B63 J;  1HW1 A;  1IZ1 A;  2DT7 B;  2V26 A;  2BXY A;  1FYL A;  1J75 A;  2H1L A;  1W7P B;  1IN5 A;  2HXO A;  3RKQ A;  1O3T A;  2EIK H;  3CCQ I;  2PEX A;  1XDS A;  3BC8 A;  3HHG A;  2DQR A;  4KUM A;  2K86 A;  1X2N A;  4J19 A;  4RAG A;  3HOZ J;  4BEH B;  1OR7 A;  5CQG A;  3TQN A;  2CFO A;  5LEJ A;  5DD8 A;  2RAE A;  3HOY J;  2KRC A;  2O0Y A;  4PCQ A;  4WX9 A;  2F5V A;  2G9W A;  4YFN F;  2CG4 A;  4E7L A;  3DTE A;  1SAN A;  2DMU A;  4BY1 J;  3DTK A;  3LOC A;  1V5F A;  5EEG A;  1KZH A;  4YFK F;  3G6E I;  1YFH A;  1YS7 A;  1RET A;  2G7H A;  1IG7 A;  1S7A A;  2EJR A;  2F5D A;  2LNB A;  1ODD A;  4MTE A;  3GFL A;  4DZJ A;  3S32 A;  2GWR A;  3TW7 A;  3IRR A;  2CH0 A;  3GX4 X;  1SAU A;  4DJA A;  2XB0 X;  3F9K A;  3J80 K;  1TQP A;  4LG0 A;  2EH3 A;  4FHT A;  5F1J A;  4ZDP A;  2K9M A;  3BG5 A;  2X6O A;  4P1W A;  1BI2 A;  3DLL F;  5J1R A;  3P9I A;  1R1T A;  4RLQ A;  4LG0 B;  4ENK A;  3V8J A;  9ANT A;  1ZTR A;  2D5V A;  1E2X A;  3LSR A;  3ZQF A;  2DAO A;  2D1V A;  3KPH A;  3JRD A;  3M9A A;  4I7H A;  5AON A;  4QPO A;  3JAM K;  3LNQ A;  1ZG5 A;  2DU9 A;  2DQL A;  2HGC A;  2XGD A;  4DGW B;  4HPQ A;  3GZ6 A;  1OYY A;  2IBD A;  3CP2 A;  3GZ5 A;  1DU6 A;  3BTI A;  4B43 A;  4BDZ A;  4NC8 A;  4XMY A;  4UHT A;  4C3H J;  3GW2 A;  1V3F A;  4LIV A;  5GPA A;  3BG3 A;  1QQI A;  1LVK A;  1JT6 A;  4XLC A;  4H0E A;  3ERE D;  4M72 A;  3SHF A;  2IAI A;  1YS6 A;  3GEZ A;  3M8E A;  4A3C J;  2DMN A;  2A05 A;  1DGR M;  2XRL A;  4AU7 A;  3MN2 A;  2EFN A;  4BQN A;  3LFU A;  1UAA A;  3FXK A;  4S04 A;  5HS8 A;  4IOC F;  4ETS A;  2PMZ A;  2V1U A;  3FIW A;  1FOW A;  4BXX J;  2FE3 A;  1QVT A;  2YX4 A;  4IHW A;  2JVG A;  5HOD A;  1MMA A;  1WI3 A;  3H3V K;  4IL6 C;  3QOE A;  1DPU A;  5J4Y A;  1IN4 A;  1LDK B;  4KA4 A;  5J4V A;  4CHU A;  1R36 A;  5KAF C;  5J8C A;  2ECC A;  3DPT A;  2JUG A;  4WF2 A;  1KYZ A;  4YIR X;  5TGT A;  4XN3 A;  4G94 A;  4PSW A;  2LH9 A;  2QGU A;  1V55 H;  3HOU J;  3V7R A;  2TCT A;  2HDW A;  2QKL B;  4DYR A;  1B9M A;  4XRS G;  4J01 A;  1MKM A;  4XIC A;  1F36 A;  2EIJ H;  2XAQ A;  3ONQ A;  3JRC A;  4KNY A;  4O3M A;  3ZQH A;  2HVQ A;  4MFD A;  1G3S A;  5H6Q A;  5AIQ A;  1I5Z A;  4CCO A;  3R6S A;  3H9G A;  3Q9S A;  2H09 A;  3KX2 A;  4XLF A;  1R4N B;  3CF2 A;  2JA5 J;  2XRN A;  4MTD A;  3S1N J;  2LBF B;  3HL2 A;  3VYS B;  3OR2 C;  1B1B A;  2YU3 A;  5JHU A;  4IHX A;  1JE8 A;  4CIC A;  4BS9 A;  2KL4 A;  3RKX A;  2IT0 A;  1ZN2 A;  2VC1 A;  2VQH A;  4L5E A;  2ZXI A;  5GAH J;  3J7A O;  1IN6 A;  3DU6 A;  2KIM A;  3I59 A;  2DA1 A;  1W5T A;  1JUP A;  2DK8 A;  3FMR A;  3D0S A;  4EJW A;  2KHM A;  3I53 A;  2P0W A;  2GQQ A;  1WVR A;  2HVR A;  3DKW A;  2R7W A;  3OYE A;  3L2V A;  3EUA A;  3L7W A;  3W2W A;  1W36 D;  1JKQ C;  1T08 B;  1K79 A;  4XLA A;  3PUF A;  5LLQ A;  5GAE J;  2JZY A;  3DPU A;  2IGO A;  1ORK A;  4HV5 A;  1GV5 A;  3V8L A;  3MWM A;  3QPT A;  1OLT A;  3HSE A;  3I58 A;  3GCM A;  4RS8 A;  4B44 A;  2F48 A;  3I4M J;  5DUK A;  3OIO A;  2CQX A;  3S2W A;  1YIT I;  4ZDO A;  1IRZ A;  3OYA A;  2E60 A;  3F0C A;  4R8H A;  3A0B C;  5CPR B;  2H94 A;  3BP8 A;  3T5X A;  3S1Q J;  4DIQ A;  3SQN A;  3GO5 A;  2NOJ B;  5B3S H;  1YJ9 I;  4XKC A;  1MIJ A;  4CA0 A;  1LUJ B;  2JA2 A;  3U1D A;  1Q1H A;  2IW5 A;  5FLX K;  3BCA A;  2KIF A;  5EDN A;  4Q5S F;  1B72 A;  3BWG A;  4KIC A;  4N4N B;  1WCM J;  1U78 A;  4M6X A;  3ZOB A;  2M8G X;  4PGH A;  1FBQ A;  4N4O B;  3GLL A;  3MEX A;  2X4H A;  4A6E A;  5GPC A;  4ESJ A;  4MEX F;  1BA5 A;  3BT9 A;  3T0Y A;  2XV4 S;  5K5R A;  3CC2 I;  1JKR C;  1UHS A;  2W24 A;  4R1H A;  2VT2 A;  3H5A A;  3T1B A;  1JI8 A;  3WHB A;  2KPM A;  1NHA A;  5K7H A;  3DF8 A;  4CCM A;  3FXU A;  4BUP A;  3Q5F A;  1XCB A;  5GTI C;  2BY2 A;  5KVR A;  2WTE A;  2ZO4 A;  3IH3 A;  4XRF A;  3AL0 B;  1W5S A;  3SZG A;  2JRM A;  3J81 K;  1X58 A;  4F52 A;  2FSW A;  1GLN A;  4ZC3 A;  4P55 A;  2UXN A;  1ULY A;  2W85 A;  4KFC A;  4D0P A;  4I2O A;  1OR7 C;  1W7P A;  3F8F A;  4FX4 A;  5M5W J;  5E8G A;  4B48 A;  2HR3 A;  2V4J C;  1H88 C;  2WB1 N;  1IDY A;  1T33 A;  3MCZ A;  1BIB A;  4CH7 A;  4HX7 A;  1O7F A;  4RB2 C;  1NH3 A;  4EAT A;  1BR4 A;  3K4C A;  1J2X A;  2VBW A;  5E3O A;  3FDY A;  1W7P D;  2EA2 A;  3HKZ N;  2CO5 A;  3ISP A;  2TRT A;  5LEK A;  2QBY B;  2DMT A;  2W84 A;  3O8G A;  1X2M A;  3PUB A;  2CFX A;  3WE2 A;  1BL0 A;  1RKT A;  1IV6 A;  1OYI A;  3BQY A;  5TRD A;  2VJ5 A;  4X0G A;  2X1C A;  3PNT A;  4II2 A;  1MGT A;  3WG9 A;  1XGO A;  4BBR J;  2XAF A;  4RGU A;  2LKS A;  4OIO F;  1DUX C;  3L1P A;  2AO9 A;  4HDU A;  4AIJ A;  2LG4 A;  2XB5 A;  2R7O A;  4A5M A;  1HSJ A;  1XTA A;  5FRM A;  2VPL A;  4F7Z A;  1GHC A;  2HQR A;  2P5L C;  3OL4 A;  2K5C A;  3VDX A;  2PG4 A;  3RDI A;  3PQJ A;  3ZMZ A;  4N9H A;  5HLI A;  3MMY B;  2L7F P;  4IHV A;  3FIS A;  2XF7 A;  3OS0 A;  1MSE C;  2CV0 A;  2DA2 A;  3RCO A;  3VFZ A;  1D8J A;  1Z91 A;  3B73 A;  2EA4 A;  2F5C A;  1OCC H;  2NS8 A;  4RGS A;  5D6E A;  3U2R A;  1W36 C;  2WAQ A;  4IRG A;  1WGX A;  2ZJP F;  2R93 J;  4FT8 A;  2P7C B;  3OYD A;  5KK1 A;  3HHH A;  3E6M A;  2XKO A;  1MBG A;  1FTT A;  1R00 A;  2QSH X;  1FYK A;  4GO1 A;  1KU2 A;  1WJ5 A;  3O2P E;  2XAG A;  2L9R A;  3PNV A;  1O57 A;  2DTR A;  2Y31 A;  3VSK A;  1FT9 A;  4JP0 A;  5C4J J;  3NAU A;  1H0M A;  1APL C;  1A35 A;  2CUZ A;  1L0O C;  4EJV A;  4RMN A;  2W00 A;  1R22 A;  2M4K A;  1EF4 A;  4HF1 A;  1SC7 A;  3JRA A;  5B1A H;  1IUY A;  4UXN A;  3K9T A;  2OV7 A;  3QU3 A;  3CMA I;  3U9G A;  2VOO A;  2XF5 A;  5K5O A;  1UHM A;  3VSL A;  3LSK A;  1RES A;  4QTR A;  1JXS A;  3PIP F;  3LST A;  2Y9Y A;  4U87 A;  3CCY A;  2E2J J;  2FOK A;  1FPQ A;  2LK2 A;  4M3E A;  5FRO A;  1JHH A;  1A6I A;  1U8B A;  2QEX I;  4I76 A;  4D7N A;  3F3X A;  2HPM A;  1XD7 A;  4LMY A;  1A36 A;  1MJ9 A;  3ABT A;  3HRU A;  4O6J A;  4DW6 A;  3GFJ A;  1JUS A;  2B7E A;  2F4O B;  5E79 C;  4RLF A;  1FJL A;  5FRN A;  1U8R A;  1HKQ A;  3GTL J;  2EFO A;  2ZKZ A;  1HCR A;  5HS9 A;  2L2O A;  2E35 A;  2H6B A;  3BG9 A;  3HEF A;  3RPU A;  3JSO A;  3C3W A;  3LSG A;  2HQ5 A;  2KIS A;  1S7O A;  1T56 A;  1VQL I;  2FNP A;  4Z2Y A;  2R5Y B;  3HOV J;  1MNE A;  2FEZ A;  2BVL A;  2KLO A;  5LRR A;  2CMP A;  2MW8 A;  1Y8Q B;  2UZK A;  4IRI A;  5DCF A;  4Y7N J;  2ZBK A;  1BBY A;  1JJ6 C;  3WU2 C;  2R5Y A;  1U9N A;  3PFI A;  3CCV I;  1GT0 C;  2Y75 A;  1OQY A;  1QNT A;  2UV1 A;  5FJ8 J;  1XCV A;  3BZ6 A;  4ITV A;  1Y1V J;  2D2W A;  1EJ9 A;  1AU7 A;  3JRI A;  3VOD A;  1IJW C;  2COB A;  1BR1 A;  4XBF A;  3GTJ J;  2DA7 A;  1TWF J;  2MH2 A;  4V2F A;  4NQW B;  4CDG A;  2L7Z A;  2CUE A;  4MIM A;  4WXD A;  2ISY A;  1R49 A;  2CWE A;  4E7Z A;  2GXB A;  1IO2 A;  4CYC B;  2KIU A;  2W25 A;  3OYN A;  1DP3 A;  1JHF A;  3MAJ A;  3PNY A;  5IP9 J;  1USS A;  3H0D A;  4UUT A;  1YW8 A;  4NQW A;  1UG2 A;  3CC7 I;  5CKT A;  5CVJ A;  3QYE A;  2R7D A;  2Z2S B;  4A0Y A;  2NAZ A;  5HNH A;  1TNT A;  1ETX A;  2M1B A;  4FX0 A;  4HZF A;  2DPD A;  4D5C A;  5J1Y A;  4D9J A;  4PFP A;  1OCT C;  3ZMV A;  2DOD A;  3J7Z I;  3CCM I;  1LEB A;  1ETK A;  2MYS A;  2O6G E;  3OYJ A;  1I6H J;  3RQI A;  4U7D A;  3BR3 A;  3ML6 A;  2RQQ A;  2LF8 A;  2NOG A;  5FFZ A;  5DM7 F;  1D0Z A;  3QOD A;  2QF7 A;  3P9K A;  4M3D A;  3X2Q H;  3B02 A;  2GLO A;  4GFB A;  1VQN I;  2RVC A;  5D4R A;  2L9N A;  3TO6 A;  2M5W A;  5HDK A;  1FBU A;  2QVO A;  4XQF A;  3M3Y J;  1LFP A;  4XKB A;  3CLO A;  2VN2 A;  1TT0 A;  1YRN B;  3GLX A;  2VB6 A;  3OYM A;  1ETW A;  1LKX A;  2JSP A;  1M1E B;  4WXC A;  4OU0 A;  4XLN F;  1YIO A;  1LQ1 A;  1FWZ A;  2CGP A;  3JRE A;  2PJR B;  3WHC A;  1R1V A;  2OD5 A;  2RQP A;  4KN7 X;  3GFM A;  1TW2 A;  4IQJ A;  3DCF A;  3CES A;  1EA3 A;  2XF6 A;  4BHP A;  2WAF A;  1IAW A;  5LHI A;  3G3Z A;  2KRF A;  3AG3 H;  4W97 A;  5IY5 H;  4XLP F;  4ENM A;  2PJR A;  1T6S A;  5E1Z B;  2UXX A;  2A6T A;  1SAX A;  3LL7 A;  4PJ0 C;  2LKP A;  5D4S A;  3G1M A;  4JQF A;  3HGY A;  4BJT A;  4K2E A;  2EFQ A;  2K27 A;  2IGN A;  2M3A A;  3OYF A;  3ASO H;  4D1Q A;  4A3G J;  3CCL I;  1TWC J;  3OY9 A;  2X9D A;  3S15 J;  4BEH A;  1IRF A;  1SFE A;  3LA2 A;  4HOB A;  3CLQ A;  3L2W A;  3DBR B;  1GXP A;  2CV1 A;  4A12 A;  1N75 A;  1TWA J;  3AG2 H;  1P92 A;  1LDJ A;  4P9F A;  4HQE A;  3BCB A;  2XGE A;  3TDU C;  3M7G A;  5FKM A;  1FYM A;  1MBJ A;  1RR7 A;  2E1M B;  3S17 J;  1T98 A;  2IGK A;  1D1C A;  2JMW A;  4BL0 B;  4BGD A;  2KJC A;  4F55 A;  3HM5 A;  5L3B A;  1X3Z B;  2R0Q C;  2DA6 A;  5CLS A;  1JGG A;  2A68 F;  2QYO A;  4EJU A;  2IEK A;  6PAX A;  5LGT A;  2E1O A;  2Y69 H;  1PDN C;  3E0J B;  5FLM J;  2W7N A;  1SD4 A;  2GAU A;  1MMN A;  3DPL C;  1HKT A;  2QQB A;  3KYD B;  4M3F A;  1PJR A;  2V9P A;  1X1C A;  4Y17 A;  2VIX A;  4MHG A;  1I1S A;  4CCL A;  2LVS A;  2VBY A;  1OPC A;  4HF0 A;  1RRJ A;  2PMZ N;  3CTA A;  3K70 D;  3SDB A;  2HVS A;  2Z9O A;  1P2F A;  3E5U A;  2TDX A;  4OAY A;  5D6F A;  3HKZ A;  2QUF A;  3BR1 A;  3MD2 A;  1ZGW A;  2M8E A;  1TT5 B;  1SD6 A;  4RM3 A;  2VOP A;  4E7K A;  3I59 B;  4AM3 A;  2L3D A;  4GCV A;  4UUS B;  2XSD C;  1CGP A;  4V2G A;  4E4H A;  2VXZ A;  3BTJ A;  2QEN A;  4AUX A;  2XPV A;  2CU7 A;  3PO3 J;  2E34 A;  2Z1D A;  2RRE A;  4LLL A;  1MNM C;  1Z6R A;  5BPI A;  1BM9 A;  5F04 A;  2CW0 F;  1CF7 A;  2VKV A;  2BV6 A;  4NDL A;  1KU3 A;  4PZJ A;  5EYR A;  1YX5 A;  2HYF A;  2VUM J;  1R5I D;  2AHQ A;  4CCJ A;  2CS3 A;  1ZKG A;  2Q0O A;  3GZN B;  3BR0 A;  3LSP A;  5DDG A;  2V1X A;  2BY1 A;  2BXZ A;  3GBG A;  4H4K C;  3BR5 A;  1WJB A;  3ABL H;  3KP2 A;  3WTU C;  5CVR A;  1X4P A;  3QQA A;  1DU0 A;  2DJI A;  1NK2 P;  1A31 A;  3OYI A;  1GXQ A;  1X4O A;  1YOV B;  2KMU A;  4G7O F;  3S1M J;  1QRY A;  3GVA A;  1RNL A;  4OIQ F;  3TBI A;  3WGG A;  4IHY A;  2EB7 A;  1Z3Y A;  2VKE A;  4W1U A;  4J00 A;  3HPG A;  3R60 A;  1X1P A;  1VQO I;  3R0A A;  1O3Q A;  2PBI A;  2HI3 A;  2HFH A;  1K78 B;  3KIO A;  4EJO A;  4WK8 F;  1WQ2 A;  2BOL A;  3CCS I;  3K69 A;  1MW7 A;  2KKO A;  2HZT A;  1TZL A;  1ZAO A;  2FNA A;  1IXS B;  2L01 A;  1PVE A;  2R4G A;  3RYR A;  1DPR A;  2M0C A;  5E1X A;  2IRF G;  1VTN C;  1IRG A;  2J5P A;  3BTL A;  3CP8 A;  5F0C A;  2H1K A;  4KT6 A;  1WJC A;  1R23 A;  5E3N A;  4D5F A;  2GIZ A;  3BY6 A;  1MH3 A;  4EGZ A;  1MJB A;  1P6R A;  1Z21 A;  3JR9 A;  3U1K A;  5D5W B;  3V8K A;  3SFI A;  3EDP A;  1W4M A;  5JHF A;  4C30 A;  4FAS D;  3EUH C;  3HPH A;  5FO5 A;  1K83 J;  1CQT A;  4UV8 A;  5DYM A;  2FRH A;  2LLK A;  3PSF A;  2K4J A;  4PJN A;  2DO7 A;  2OUM A;  5K7F A;  1WI9 A;  3BG6 A;  4IHT A;  1LFU P;  1R9T J;  5F1R A;  3Q9V A;  1Z3X A;  4EJT A;  2FBK A;  5DCM B;  1U5T B;  2VQG A;  1ZYR F;  1ZR2 A;  3GTO J;  2KP6 A;  3QU6 A;  1PUF B;  3T8T A;  3BQZ A;  2OAZ A;  2I5U A;  1H9G A;  4MNU A;  2FX0 A;  3J7A Y;  2CRG A;  1RZ4 A;  2EIM H;  2P5V A;  1ETO A;  3DLA A;  1I39 A;  5GAG J;  1IUF A;  3E5X A;  4OWR B;  3IC7 A;  1ITY A;  2GXA A;  2DLL A;  1JT0 A;  2K4B A;  2IXS A;  4B47 A;  3L2U A;  4ESB A;  1E0E A;  1W1W E;  4RGR A;  2KJB A;  1U2W A;  4JK1 X;  1FC3 A;  3GTQ J;  2A07 F;  3SZP A;  4BQO A;  5E3M A;  4L9T A;  4FCY A;  4DBR A;  4RAZ A;  4LB5 A;  1WZ2 A;  4ASN A;  1ON1 A;  2CUJ A;  3FK7 A;  1S29 A;  4GXO A;  2JN6 A;  3ZMT A;  4EM1 A;  1I6X A;  3CCJ I;  1WH5 A;  1XS9 A;  3SFZ A;  1X3W B;  3HB9 A;  1VQ8 I;  5D8K B;  4I6Z A;  2QQ9 A;  4M73 A;  4A3I J;  2KDO A;  5L3F A;  3S3O A;  2IS1 A;  3M4O J;  4BJ5 C;  3P7N A;  1FEX A;  2EZI A;  3V7S A;  4JX6 A;  1VZ0 A;  1BW6 A;  3HTU A;  2LMD A;  3EYI A;  3DBH B;  2WY8 Q;  4XON A;  2XAJ A;  2HKO A;  1XSX A;  2EIL H;  3BZK A;  3FKI J;  5E8I A;  1VQ6 I;  4KIG A;  2ZNY A;  3LQR A;  2J5O A;  2KZV A;  5HLH A;  4Y3O A;  4HQM A;  2LBF A;  2XAS A;  3GFI A;  1FOY A;  4ANJ A;  2CQK A;  4R79 A;  1ZGJ A;  2WB1 A;  4CUG A;  2XHK A;  1G3W A;  3RZD J;  2VAS A;  5BNG A;  3RZO J;  2M2E A;  2XPW A;  3EUH A;  4LG3 A;  3IV5 A;  2OA4 A;  2VE8 A;  2RC4 A;  1V5G A;  3H35 A;  4ZH4 F;  4LLN A;  1NG6 A;  2FBI A;  2H8R A;  5LFA A;  3SYT A;  2L4M A;  1LDD A;  5LBQ A;  3HOS A;  2X48 A;  3FBI B;  2P4W A;  3NEU A;  3VPR A;  2HQA A;  1RIO H;  3PM1 A;  2VXD A;  3GXO A;  5M5Y J;  1YG2 A;  2CQ7 A;  2YPR A;  4L9V A;  5DEQ A;  1U5T A;  4C3J J;  4M9S A;  3OR1 C;  2R7T A;  4XNF A;  4UB6 C;  3H5N A;  4U7B A;  5H20 A;  1IF1 A;  2NVT J;  1GV2 A;  3DTI A;  1WFX A;  2EZK A;  1MD0 A;  5K5Q A;  2E1C A;  3BPX A;  4LLG F;  3OSF A;  5AIP A;  3HG9 A;  2ME0 A;  3OMY A;  2FA5 A;  4B1R A;  1VFC A;  4ZJZ A;  2AXL A;  3DV8 A;  2F5E A;  1PYV A;  2K40 A;  2PMH A;  1RPW A;  3C7J A;  3FXJ A;  2LY9 A;  1FIP A;  4HX8 A;  4ZYG A;  4RBO A;  4AYB A;  2HZD A;  4YG2 F;  2VKD A;  4GYI A;  2M7B A;  3W6K B;  3ZQI A;  3E6D A;  5LGN A;  3S2D J;  5E20 A;  3H36 A;  2AS5 F;  3WU0 A;  2JA8 J;  1JKP C;  5EEH A;  4XOP A;  1SVO A;  1SVL A;  2GZW A;  3BOQ A;  3L2R A;  1I27 A;  3MKW B;  2GIV A;  3FXQ A;  4A3L J;  5JLX A;  1S6L A;  5IT3 A;  3SXY A;  1W5C C;  2ID6 A;  3W2V A;  3QOP A;  2X1D A;  4BNC A;  1FOX A;  2PJP A;  1UFM A;  4UUV A;  1ZRE A;  1YJW I;  1ZK8 A;  1HA8 A;  2V7F A;  2EQR A;  1QGP A;  3ABM H;  5CVU A;  3PFY A;  4Z6Y A;  1HOM A;  1FBS A;  2CUF A;  3ERM A;  2L02 A;  3NWS A;  1E3P A;  2KT0 A;  3ZN1 A;  2NRA C;  4L9J A;  1KYW A;  3D1N I;  1VND A;  1P4W A;  1XSD A;  1IN7 A;  3P9C A;  2FXA A;  5ICG A;  3M07 A;  3HDD A;  4C2M J;  4XID A;  4XOT A;  2OQG A;  3RKY A;  3OYH A;  2EK5 A;  2QWW A;  1ZRC A;  1F43 A;  1BI1 A;  3WTY C;  4KMF A;  1XGM A;  2ZXH A;  4F92 B;  2LY1 A;  4P96 A;  2IA1 A;  1LJ9 A;  1Y0N A;  2XC7 A;  5EJC A;  4PSX A;  4DYC A;  1G8X A;  1VQ4 I;  3LSM A;  4NNJ A;  1RI7 A;  3QP6 A;  4ZYD A;  3H92 A;  3A01 A;  3MZY A;  2VC0 A;  1NG7 A;  1DGW Y;  2GOM A;  3V4G A;  3QP5 A;  2ZFW A;  2O61 A;  1KGS A;  2DBB A;  1VQP I;  1GVD A;  5H6R A;  4BAY A;  2I10 A;  4BU2 A;  3K4N A;  2EV0 A;  2DDB A;  4NHJ A;  2JT1 A;  4KIB A;  2R7F A;  2F5F A;  2LKX A;  3AFH A;  1F4K A;  2QBY A;  3QYB A;  1VQK I;  4L9N A;  3OIP A;  4QSH A;  2JWT A;  1A5J A;  5J8F A;  2AXT C;  2ZME A;  4HNU A;  2DYR H;  4P5O A;  2HKX A;  3MFK A;  1H89 C;  4CSW A;  1QZY A;  1Z1D A;  3W6J B;  5DUI A;  2H6C A;  4LIT A;  2JA6 J;  1FY7 A;  3RIR A;  3OL3 A;  4O5V A;  3IAS 2;  1IW7 F;  2DW4 A;  4LB6 B;  2Z3Y A;  2DOF A;  5L3C A;  1FP1 D;  2DFH A;  2VT3 A;  4B3X A;  2NS7 A;  1F5T A;  2N8G A;  4E7I A;  3D5R C;  3A4C A;  1STZ A;  5JVT A;  2R7X A;  2KRH A;  2VKH A;  4BQA A;  5L3G A;  1TNS A;  3EPZ A;  1FX7 A;  1MND A;  5KNL A;  1XG1 A;  2DFE A;  2XVC A;  2NVX J;  5IOY A;  4WWC A;  2OZU A;  3FHZ A;  2O3F A;  5F08 A;  5L3E A;  4ZZL A;  4DQ2 A;  2DCE A;  5FFX A;  1OKR A;  2Y48 A;  3H9Q A;  2CQQ A;  3K4J A;  2RKH A;  4ZDL A;  1T95 A;  4G7H F;  2G0E A;  2UWM A;  1UCR A;  1K4T A;  1QHG A;  3UKG A;  3WGH A;  4HDV A;  2ZJ2 A;  5EG0 A;  2Z99 A;  3ZMD A;  3ASN H;  2HU9 A;  5FKL A;  5IPA A;  2ELK A;  2QQ8 A;  2E1M C;  5JI6 A;  1X19 A;  1ZEL A;  2BEO A;  4E70 A;  4A69 C;  3K4B A;  4RB1 A;  2K3P A;  2OPT A;  2FQ3 A;  2LOO A;  2HYJ A;  2NNY A;  2R92 J;  5IT9 K;  5EG0 B;  2MLK A;  3WTV C;  1ETV A;  1QBJ A;  1HF0 A;  1K6Y A;  2CV2 A;  3GME A;  1O7L A;  3I71 A;  5HLG A;  1L3L A;  1XX5 A;  2OBP A;  4RGX A;  3WE3 A;  5HNF A;  5C3E J;  2VE9 A;  2BW3 B;  2IS2 A;  1AOY A;  4MFE A;  4ABZ A;  3HRS A;  4OIN F;  1OMI A;  2E1N A;  2M45 A;  3A03 A;  2X1E A;  3E6B A;  1SD7 A;  2BW3 A;  3E1S A;  3MQ0 A;  1RUO A;  3OOP A;  5E1W A;  3O6B B;  1AKH A;  2DOA A;  1R5H A;  5M5X J;  2AQF A;  3CMM A;  2LRE A;  2W48 A;  2RNG A;  4IJA A;  5CVV A;  2OZ6 A;  5E3L A;  4AIK A;  1MBF A;  2WAE A;  1AKH B;  2V79 A;  1FMW A;  1UEL B;  4HA8 A;  1XN7 A;  1Z6T A;  1YIJ I;  1R58 A;  1V54 H;  1REP C;  1TWG J;  2HOT A;  3R0J A;  4BY7 J;  4NUB A;  1QVU A;  4IKF A;  4KDP A;  1RC9 A;  3ELK A;  3PQK A;  4BDY A;  1PP7 U;  2HOE A;  2M30 A;  3IL2 A;  5CVI A;  1SFU A;  3O3K A;  3ABU A;  3KYL A;  5LRS A;  3G4S I;  4CCN A;  4HV6 A;  1K6O A;  1EH7 A;  5F0F A;  3SEZ A;  1HW5 A;  3LA3 A;  3ZCO A;  2VLA A;  1P7I A;  2A61 A;  1EH6 A;  3M8F A;  5DS9 A;  2V6E A;  1HKS A;  2KDZ A;  2WAD A;  4IHS A;  2VJI A;  4NBQ A;  3HIF A;  2JA7 J;  1J09 A;  1NTC A;  2JK3 A;  1MBE A;  1B59 A;  3COA C;  4OAZ A;  1D0X A;  3QAH A;  2IP2 A;  4C2T A;  3F8N A;  4PDK A;  1ON2 A;  3LQQ A;  2ADU A;  4Q4Z F;  2NVQ J;  4EVI A;  1N77 A;  3W6V A;  4MEY F;  4YRV A;  1IXR C;  1TLH B;  2BY3 A;  2V6C A;  1LEA A;  2W4S A;  1FSH A;  1FOK A;  1R1U A;  3FF5 A;  3FXO A;  1LNW A;  2BHY A;  2C6Y A;  3JTH A;  5EZG A;  3I4N J;  2IGM A;  4XM3 A;  1E3O C;  2A5W A;  3G1L A;  3HC7 A;  4JX5 A;  1BN5 A;  5HVQ C;  2PI0 A;  2R7Z J;  2MC4 A;  3VEP A;  1LVA A;  2IS6 A;  3HZJ A;  3UNG C;  4BXF A;  3Q0W A;  4MGR A;  4RAF A;  4HNT A;  2PMU A;  3GF2 A;  4ESF A;  1ETY A;  3KLO A;  4YIF A;  2QSF X;  4EGY A;  2YX7 A;  3I55 I;  1ENH A;  3VWB A;  5ERI A;  4NB5 A;  1XGS A;  1LE8 B;  2EV6 A;  2XKP A;  1O3S A;  2L9S A;  2Q2E B;  4IPA A;  2XRO A;  2NYX A;  3I64 A;  4YII A;  3QWL A;  5LD2 C;  1H9T A;  2VJJ A;  1D5V A;  3FKJ A;  5ICF A;  1HQC A;  3FMQ A;  5A2Q K;  1JTX A;  2ELH A;  1HXD A;  4G9Y A;  1Z77 A;  4G7Z F;  3GTM J;  2FF4 A;  1XB4 A;  1VQ7 I;  2Y2Z A;  1HC8 A;  1X1D A;  4M6V A;  2HTS A;  2PLY A;  2GXG A;  2LSO A;  4BJ6 C;  1GVJ A;  1RUN A;  3RJP A;  4IXA A;  2CYY A;  1EV7 A;  3OOU A;  2NVY J;  4HG2 A;  1D1A A;  1ZRF A;  1Q1V A;  2PX9 A;  1HDP A;  3K1M A;  1R71 A;  4A93 J;  2BZT A;  1TTY A;  4D7M A;  5HDG A;  2RNJ A;  1BOA A;  1BR2 A;  1MMS A;  2CW7 A;  3G1O A;  1P7J A;  3DKY A;  2R5Z A;  5FKK A;  4P9U A;  2OQR A;  1Z0X A;  3MKY B;  4IOA F;  3MZH A;  3MVP A;  1T39 A;  4C3I J;  2ICW G;  5TIS C;  2YSR A;  3DEE A;  2VON A;  2E36 A;  5EF6 A;  1U9O A;  2OC6 A;  2ZCW A;  3IWF A;  4OOI A;  2GM4 A;  5B1B H;  1D3Y A;  1X1B A;  4I01 A;  1YRN A;  3MZ8 A;  1RKW A;  2E5Z A;  3WTZ A;  3HUG B;  4G6T B;  2Q8K A;  5FLX Z;  3H1C A;  2O7O A;  5M3F J;  2ZME C;  1SMY F;  4ZTF A;  3OWT A;  3BR2 A;  1X1A A;  3N4M A;  2STT A;  4CO8 A;  3ZGK A;  4AIH A;  1YO5 C;  3GYH X;  4LOC A;  1ZR4 A;  4BHC A;  3ZXS A;  1ZRD A;  3A02 A;  2JVH A;  3J7Y J;  1U0J A;  4OMY A;  4GYG A;  4OIR F;  2LRD A;  4KT5 C;  4RDU A;  3DQV C;  2JTV A;  3ESW B;  1R7J A;  1YTY A;  3VOE A;  2DOE A;  1Y56 A;  2PQ8 A;  2X6W A;  2XIG A;  3DWL E;  3RI4 A;  3BG7 A;  3HGG A;  5FKO A;  1QZZ A;  5FB2 A;  5B5E C;  4JX4 A;  3F21 A;  1W0T A;  3FXR A;  3ZMU A;  4L0Y B;  5TJJ A;  1MDM B;  2XSJ C;  2CJJ A;  1ZGA A;  4EM0 B;  4BE2 A;  1YW7 A;  1IDZ A;  2YS9 A;  3IP4 B;  4I0A A;  1WH7 A;  1G6N A;  2D1H A;  2Q2E A;  2DFI A;  4XK4 A;  4XRM A;  2R7Q A;  5JFR A;  2JSC A;  2JRT A;  1PUF A;  3IRQ A;  5IT9 Z;  3C2H A;  3CDH A;  4NC7 A;  3BZC A;  4DBQ A;  1Z05 A;  5DD4 A;  3LAJ A;  2GOX B;  1SD5 A;  3K10 A;  1BC7 C;  3GWZ A;  4LK0 F;  1ONV A;  3HJE A;  2M9H A;  4V19 K;  3ZPL A;  4AD9 A;  1YLF A;  2F2E A;  2RN7 A;  2EZL A;  4TV7 A;  4C2U A;  2G7U A;  3VB2 A;  4IRH A;  1OCR H;  3SZT A;  2DMQ A;  4G6Q A;  2K9N A;  1D1B A;  2F6C A;  2JUC A;  3PIO F;  1OJL A;  3NRV A;  4M6Y A;  1J9I A;  4XLE A;  4BE0 A;  1AA7 A;  3CUQ A;  1GUU A;  1VF9 A;  4PJL A;  4CZC A;  2IJL A;  2CW8 A;  4ENN A;  3LSH A;  2NS0 A;  3BJ6 A;  2I8D A;  3JCU C;  1AWC A;  4FE7 A;  2EIN H;  2E71 A;  4UVC A;  3JRG A;  3OSG A;  2V9V A;  2ID3 A;  2QZ8 A;  1E3H A;  5HDN A;  4FTH A;  2H8W A;  3M1E A;  4A6D A;  3BPV A;  1DDN A;  2KZG A;  4FQG A;  2E7X A;  1QHH D;  3ABK H;  3RPQ A;  2M4G A;  1ETQ A;  2COM A;  2O8X A;  4L5J A;  4IF4 A;  5GAD J;  4I02 A;  4N0B A;  4Q47 A;  3K4L A;  2ZSH B;  4XKW A;  5J6X A;  4OMZ A;  4BE1 A;  3KP4 A;  1N25 A;  2DTZ A;  2QM3 A;  1Y39 A;  2ETH A;  3FHN A;  4E7J A;  3PJR A;  3KP3 A;  3DEW A;  1HBX G;  3HXL A;  4A3K J;  3HYI A;  5FKN A;  4B4C A;  5F0H A;  3OYL A;  2VQL A;  2B9S A;  5ILV A;  2E2I J;  3HRT A;  1YYV A;  4X1E A;  4XN0 A;  3TGN A;  1MSF C;  1I3A A;  3H3Z A;  4CGZ A;  2VOD A;  3F23 A;  2HS5 A;  2DK5 A;  3IHU A;  4HLX A;  2DI3 A;  2BVM A;  4QLC U;  4M74 A;  4X6A J;  1POG A;  1EKE A;  2HWV A;  5F64 A;  1P4X A;  3DBL B;  4UNO A;  1BW5 A;  5HLT A;  3S2H J;  2L7M P;  3GUD A;  3E97 A;  3O8H A;  5EGO A;  2Y9Z A;  4OIP F;  1MH4 A;  4BHB A;  3VYR B;  4M3G A;  4A3E J;  5ICE A;  1ZG1 A;  3K4K A;  3D5L A;  1QZE A;  2JPC A;  1G2H A;  1OYW A;  3S14 J;  1FTZ A;  4EQQ A;  2LD5 A;  3WU1 B;  1S3J A;  2V1D A;  1OCP A;  2ZFU A;  5EGO B;  4KIS A;  4NC6 A;  4N9I A;  1DQU A;  2DA4 A;  4A3M J;  2LF7 A;  1GDT A;  3P5J A;  3M1C A;  1ZLK A;  3R61 A;  5A2Q Z;  2O03 A;  2V1N A;  2BY0 A;  1FNN A;  3L00 A;  4XOR A;  3AG1 H;  3ZN0 A;  3F6O A;  3I56 I;  2ELJ A;  4AWX B;  4CZZ A;  1Y0U A;  2R3S A;  1ACI A;  1TW3 A;  3HOW J;  3I0T A;  2VI6 A;  3WTW C;  4LIU A;  4UB8 C;  4UV9 A;  2BYV E;  1YE9 A;  4MLO A;  2X6X A;  3CDI A;  2UUZ A;  3OV8 A;  2E7W A;  2KFD A;  2XAU A;  1KON A;  3OYC A;  4GDF A;  1F1Z A;  4I99 C;  1UZC A;  1T2K A;  4F91 B;  4BBS J;  2ZXJ A;  2EFP A;  1MBK A;  5DM6 F;  4L0Z B;  1FP2 A;  1WRJ A;  3I3L A;  4M9Z A;  3V42 A;  4KIF A;  4G8X A;  3TED A;  5IYD J;  2YUS A;  2BHZ A;  1G3T A;  4U0V A;  1QU3 A;  1FMV A;  3TDZ C;  1S8N A;  3JRF A;  4I0B A;  4EV0 A;  2VBZ A;  3CUQ C;  3OYG A;  1PUE E;  1J7K A;  4E6K G;  1KQ9 A;  2EWN A;  2VL8 A;  5ICC A;  4UVA A;  2R7R A;  1ZG3 A;  3A1Y A;  3HSF A;  3WGI A;  2L5Q A;  2R7S A;  2LTP A;  3LAP A;  1YJN I;  1TQI A;  2WAQ N;  2R5Z B;  3H3U A;  4CXF A;  3L9F A;  1OFC X;  4GRI A;  2ZJR F;  4M9X A;  2W82 A;  3WOD F;  2PN6 A;  4XKV A;  3JW4 A;  3HOT A;  2HDC A;  3Q3S A;  3CCR I;  1UB9 A;  4KIT B;  2X6Y A;  1XC5 A;  1XPX A;  1XMX A;  3AG4 H;  3PSI A;  4JOM A;  4ZTJ A;  3G2B A;  4FET A;  1WWX A;  2MH9 A;  3KP6 A;  2MBF A;  3WTT C;  1IC8 A;  4MQV A;  3RQ4 A;  2L9V A;  1TP4 A;  3OYK A;  1Z67 A;  4HF2 A;  1FZP B;  5DV5 A;  4HAM A;  1UMQ A;  3U21 A;  3H9J A;  2VQC A;  4YFX F;  2DN0 A;  2EPF A;  5C44 J;  4AID A;  4AYB N;  3IWZ A;  5B66 C;  2JPB A;  2LFB A;  4HSR A;  3VYU B;  3CD6 I;  2QQA A;  2ISZ A;  2Y0M A;  1D0Y A;  1QPI A;  2X51 A;  1BJZ A;  1JJ8 C;  3TW6 A;  2MFZ A;  3NQO A;  2LP0 A;  2EBI A;  2ZJQ F;  3S3M A;  5BOX A;  3DFG A;  1K78 A;  1IGN A;  3ZQQ A;  4HRI A;  3FM3 A;  2WY7 Q;  3HTS B;  2P5K A;  4HST A;  3FXM A;  3TOB A;  2IS4 A;  2IA2 A;  2IVM A;  2E2H J;  1JKO C;  3EET A;  3REO A;  1NK3 P;  4B09 A;  1HLV A;  2L4A A;  2OF7 A;  2YR2 A;  1YI2 I;  1G59 A;  1ZH5 A;  3OS1 A;  3CCU I;  3HBL A;  2V9K A;  1ZAR A;  3F72 A;  2VBX A;  3KYC B;  3BR6 A;  3JRB A;  3GTG J;  2P6T A;  4LFU A;  2R7U A;  3KEO A;  4AC0 A;  2LYC A;  4KMU X;  3ZQG A;  3E6C C;  4IX7 A;  4BXU A;  3WTX C;  1J5Y A;  5LHH A;  2ZB9 A;  1ZQ3 P;  2O5R A;  4M71 A;  2M7A A;  1R4M B;  5IP6 A;  2A69 F;  4A0X A;  3KLN A;  3FZV A;  1IXC A;  2K02 A;  2HEO A;  5D5U B;  3KZI C;  2IA0 A;  2K9S A;  4MQ9 F;  3JAM Z;  1MBH A;  2MA3 A;  3F22 A;  1KA8 A;  1SFX A;  2P7V B;  2MC3 A;  3CME I;  1IN8 A;  3DEU A;  3F8C A;  2K7L A;  3MKL A;  4F3Q A;  3S3N A;  5J47 A;  4G6D A;  2K3F A;  1YQA A;  1B8I A;  3TOA A;  3HRM A;  3SDG A;  3KEY A;  1I50 J;  3F6V A;  1N78 A;  1O4X A;  4LD5 A;  5D5X B;  4RB3 C;  2P6S A;  1K7A A;  1FSE A;  2LR8 A;  3RSN A;  3DKX A;  3IAM 2;  1SEU A;  1QO0 D;  2A3S A;  4M3B A;  4ZYH A;  1WJF A;  4YEJ A;  1BOB A;  2MG4 A;  3KE2 A;  3J80 Z;  3ULQ B;  3ZQ7 A;  4XSX F;  4PGG A;  3A01 B;  3WG7 H;  3SEQ A;  2ZC2 A;  5EEA A;  5M3M J;  2D45 A;  5GP9 A;  3ZP5 A;  2A6E F;  1U6G A;  1V4R A;  2Y0S A;  2NVU B;  4DZP A;  3H0G J;  3CO6 C;  1IRX A;  3FM5 A;  3L09 A;  1DP7 P;  3OYB A;  1LFB A;  1QA6 A;  4S05 A;  1XGN A;  2EZH A;  1MMG A;  3ZQL A;  2PFB A;  2LY2 A;  1Z7U A;  2A5Y B;  4EM2 A;  2FQ4 A;  3E5Q A;  3J81 Z;  4U0Y A;  3I9V 2;  2HOA A;  4PK4 A;  3BRO A;  1KQ8 A;  2X85 A;  3GTK J;  1BI0 A;  1LE8 A;  2CQN A;  1YW9 A;  2OTJ I;  1V5E A;  2WC2 A;  1JTY A;  4PUS A;  2ZME B;  3G73 A;  3CC4 I;  3Q0U A;  4B3A A;  1G4D A;  4DNC A;  3SJM A;  4KJZ A;  3KEQ A;  3IKV A;  5JR3 A;  4L18 B;  2FMY A;  2ME6 A;  5C4X J;  5HOO A;  4HYE A;  3F8M A;  2W57 A;  3S8P A;  4ZYE A;  5J1U A;  4ENJ A;  2NNN A;  2QKM B;  4IQ4 A;  5LHG A;  3DP7 A;  2Q1Z B;  3MKZ A;  2WA0 A;  5LGU A;  2WV1 A;  3S93 A;  1O3R A;  4XR6 A;  3GTP J;  1D8K A;  1ERD A;  2QCO A;  1SMT A;  3TO9 A;  3AKZ A;  5L3D A;  1S72 I;  5FLV A;  2Z5U A;  1H8A C;  3L2Q A;  3QRF F;  1J0R A;  3CZ6 A;  3PO2 J;  1S5L C;  1Z9C A;  2VPR A;  2XGC A;  1WJD A;  3LFK A;  4I98 B;  3C1D A;  3CJR B;  2DXI A;  4AVP A;  2FML A;  2HPI A;  1QPM A;  3QYF A;  5CQE A;  2Z33 A;  4QWQ A;  3D5S C;  3H5R A;  1HST A;  3FBN B;  1HW2 A;  1Y6I A;  4Y13 A;  2KQR A;  3ZMS A;  1K61 A;  1X3U A;  3CDL A;  3NAR A;  3AL0 C;  5CJ9 A;  5CYV A;  5IYC J;  4DOZ A;  2GA1 A;  4RM2 A;  3FXL A;  1W0U A;  2K9L A;  1Y1W J;  3TP3 A;  5KAI C;  1B8I B;  4LK1 F;  1P4A A;  4BKX A;  1J59 A;  1K4S A;  1WPK A;  1SFO J;  3JSP A;  2ESN A;  3ZR8 X;  2RV8 A;  5F27 A;  2QA4 I;  1FLI A;  3C2G A;  4L5I A;  4E7H A;  3FX3 A;  5HS7 A;  1T8I A;  3W2A A;  1MJA A;  4IO9 F;  1Z7L A;  1FIA A;  3EYY A;  2K85 A;  4LJZ F;  4A0Z A;  3F8B A;  2HYG D;  4MO7 A;  3JTG A;  3EQL F;  2L0K A;  2OJE D;  4I09 A;  1RR8 C;  4JYK A;  3KZY A;  3ZQC A;  5ILS A;  1VQM I;  3TL4 X;  1B72 B;  3LSI A;  1YX3 A;  3PL8 A;  4EMS A;  4A5N A;  1LB2 A;  1XMK A;  5GTH C;  1C0W A;  1MDM A;  4FE4 A;  1A04 A;  2XDV A;  3M8J A;  1KU7 A;  1XMA A;  3IUO A;  1PP8 F;  1KQ0 A;  1Y8R B;  2M87 A;  3R4K A;  4UUS A;  3KFW X;  2XUB A;  2O9L A;  1WHU A;  2DT5 A;  1HDD C;  3UR3 C;  2WBM A;  3HOX J;  3DXJ F;  1R6R A;  1IV8 A;  1I3Q J;  3QPH A;  2HTJ A;  3BDD A;  3QPL A;  5ILU A;  4CYC A;  5FD6 A;  3A0H C;  3K0L A;  5JVG F;  2HOS A;  3ECH A;  2FD5 A;  2RDP A;  5J3L A;  3B6C A;  4RA2 A;  4LGW A;  2FJ1 A;  5E17 F;  2DT6 A;  4U0W A;  2H27 A;  5KHD A;  2HQN A;  2F4M B;  1MZB A;  2BBY A;  2NXN B;  1UG0 A; 
#chains in the Genus database with same CATH homology
 2FBH A;  2A6H F;  4CYD A;  3L2C A;  1WSU A;  2ACJ A;  1B6A A;  3BJO A;  5FGM A;  5ED4 A;  4JBA A;  3BJA A;  4HLY A;  1UHW A;  2CSO A;  3KCC A;  4U88 A;  2EFW A;  4BH9 A;  5BPD A;  3TO7 A;  2XGX A;  4Q48 A;  4RB0 A;  1BIA A;  5BS6 A;  3I54 A;  1XSV A;  3E3V A;  4B8X A;  3WTS C;  2BE5 F;  1U3E M;  2GA2 A;  1UST A;  3RTR A;  3LWF A;  3HSR A;  3K2Z A;  3ROU A;  3KP7 A;  3TKY A;  1B9N A;  5FD5 A;  5F6F A;  4ZZD A;  3CJN A;  2BGC A;  2EV5 A;  3K1N A;  2DPU A;  5BQT A;  2FU4 A;  1TQM A;  3ECO A;  3FWE A;  5D8L B;  4HW0 A;  5DCM A;  2ZNZ A;  3AAF A;  3C18 A;  2QLZ A;  3CUO A;  1BC8 C;  1KU9 A;  4HX4 A;  2X0L A;  5K1Y A;  1T38 A;  4KYW A;  2OU2 A;  3CUQ B;  4HBL A;  3KP5 A;  2ESH A;  3I5U A;  4IVN A;  3KET A;  1JGS A;  3KZZ A;  4KN4 X;  1BJA A;  1I1G A;  2WV0 A;  2RGV A;  1E17 A;  5D5V B;  4XSZ F;  2STW A;  1XDU A;  2LDU A;  1T0F A;  4ON0 A;  4BYY A;  1BI3 A;  3I4P A;  1WKM A;  2L54 A;  2MD5 A;  3V7C A;  3HUG A;  4Y15 A;  3K1P A;  3T8R A;  1EH8 A;  2WWY A;  1B4A A;  3IKT A;  1TBX A;  3LA7 A;  4UVB A;  5E18 F;  1ZLJ A;  3RKW A;  2XAH A;  1CF7 B;  2P8T A;  1ZHF A;  1G3Y A;  4WCG A;  1U5T C;  4WXH A;  3RYP A;  3N97 A;  2MLG A;  4A2U A;  3CO7 C;  4GGG A;  2B0L A;  2IPQ X;  5BMZ A;  1R5G A;  1F9N A;  3FMS A;  4RAY A;  1HW1 A;  1IZ1 A;  1FYL A;  1J75 A;  1W7P B;  1IN5 A;  1O3T A;  2PEX A;  1XDS A;  3HHG A;  2DQR A;  4KUM A;  2K86 A;  1OR7 A;  3TQN A;  5LEJ A;  5DD8 A;  4PCQ A;  2O0Y A;  4WX9 A;  2G9W A;  4YFN F;  2CG4 A;  5EEG A;  4YFK F;  1YFH A;  1YS7 A;  2G7H A;  1S7A A;  2EJR A;  2F5D A;  2LNB A;  1ODD A;  4MTE A;  3GFL A;  2GWR A;  3GX4 X;  3IRR A;  3J80 K;  1TQP A;  4LG0 A;  4FHT A;  1BI2 A;  3P9I A;  1R1T A;  4LG0 B;  4ENK A;  3V8J A;  1E2X A;  2DAO A;  2D1V A;  3M9A A;  4I7H A;  5AON A;  1ZG5 A;  3JAM K;  2DU9 A;  2DQL A;  2HGC A;  3GZ6 A;  1OYY A;  3GZ5 A;  4UHT A;  3GW2 A;  1V3F A;  1QQI A;  4H0E A;  3ERE D;  4M72 A;  3SHF A;  1YS6 A;  3GEZ A;  3M8E A;  2EFN A;  4S04 A;  5HS8 A;  4ETS A;  2V1U A;  2FE3 A;  2YX4 A;  1DPU A;  1IN4 A;  1LDK B;  4KA4 A;  4CHU A;  1R36 A;  5J8C A;  3DPT A;  4WF2 A;  1KYZ A;  4G94 A;  3V7R A;  1B9M A;  1MKM A;  2XAQ A;  4KNY A;  4O3M A;  1G3S A;  5H6Q A;  5AIQ A;  1I5Z A;  3R6S A;  3Q9S A;  2H09 A;  2XRN A;  4MTD A;  1B1B A;  2YU3 A;  5JHU A;  1JE8 A;  4CIC A;  3RKX A;  2IT0 A;  1ZN2 A;  2VC1 A;  3J7A O;  1IN6 A;  2KIM A;  3I59 A;  1W5T A;  2DK8 A;  3FMR A;  3D0S A;  4EJW A;  3I53 A;  2GQQ A;  3DKW A;  3L7W A;  1K79 A;  5LLQ A;  2JZY A;  4HV5 A;  3V8L A;  3MWM A;  3QPT A;  3HSE A;  3I58 A;  4RS8 A;  5DUK A;  3S2W A;  4R8H A;  2H94 A;  3BP8 A;  3T5X A;  3SQN A;  3GO5 A;  3U1D A;  1Q1H A;  2IW5 A;  5FLX K;  2KIF A;  4Q5S F;  3BWG A;  4KIC A;  1U78 A;  4M6X A;  4PGH A;  1FBQ A;  3MEX A;  2X4H A;  4A6E A;  4ESJ A;  4MEX F;  3T0Y A;  2XV4 S;  5K5R A;  2W24 A;  4R1H A;  2VT2 A;  3T1B A;  1NHA A;  3DF8 A;  3FXU A;  3Q5F A;  1XCB A;  5KVR A;  2WTE A;  2ZO4 A;  4XRF A;  1W5S A;  3J81 K;  2FSW A;  4P55 A;  2UXN A;  1ULY A;  2W85 A;  4KFC A;  4D0P A;  4I2O A;  1W7P A;  3F8F A;  4FX4 A;  5E8G A;  2HR3 A;  3MCZ A;  1BIB A;  4HX7 A;  1O7F A;  4RB2 C;  1J2X A;  2VBW A;  1W7P D;  2EA2 A;  2CO5 A;  3ISP A;  5LEK A;  2QBY B;  2W84 A;  2CFX A;  3WE2 A;  1OYI A;  5TRD A;  1MGT A;  3WG9 A;  1XGO A;  2XAF A;  4RGU A;  4OIO F;  1DUX C;  4HDU A;  4AIJ A;  4A5M A;  1HSJ A;  4F7Z A;  1GHC A;  2HQR A;  2P5L C;  2PG4 A;  3RDI A;  3PQJ A;  3ZMZ A;  4N9H A;  5HLI A;  3VFZ A;  1D8J A;  1Z91 A;  3B73 A;  2EA4 A;  2F5C A;  4RGS A;  5D6E A;  3U2R A;  4IRG A;  4FT8 A;  2P7C B;  5KK1 A;  3HHH A;  3E6M A;  2XKO A;  1R00 A;  1FYK A;  4GO1 A;  1KU2 A;  3O2P E;  2XAG A;  1O57 A;  2DTR A;  1H0M A;  1FT9 A;  1L0O C;  4EJV A;  1R22 A;  4HF1 A;  1IUY A;  4UXN A;  3K9T A;  3QU3 A;  3U9G A;  2VOO A;  5K5O A;  1UHM A;  1JXS A;  3LST A;  2FOK A;  1FPQ A;  1JHH A;  3F3X A;  1XD7 A;  4LMY A;  1MJ9 A;  3ABT A;  3HRU A;  4O6J A;  3GFJ A;  1U8R A;  1HKQ A;  2EFO A;  2ZKZ A;  5HS9 A;  2H6B A;  3RPU A;  3JSO A;  3C3W A;  1S7O A;  2FNP A;  4Z2Y A;  2FEZ A;  5LRR A;  2UZK A;  4IRI A;  5DCF A;  2ZBK A;  1BBY A;  3PFI A;  2Y75 A;  1QNT A;  1XCV A;  3BZ6 A;  2D2W A;  3VOD A;  4XBF A;  2MH2 A;  4CDG A;  4WXD A;  2ISY A;  2CWE A;  2GXB A;  2KIU A;  2W25 A;  1JHF A;  3MAJ A;  1USS A;  1YW8 A;  4NQW A;  5CVJ A;  2R7D A;  4A0Y A;  2NAZ A;  1TNT A;  2M1B A;  4FX0 A;  4HZF A;  2DPD A;  3ZMV A;  1LEB A;  2O6G E;  4U7D A;  3ML6 A;  2LF8 A;  5FFZ A;  3P9K A;  3B02 A;  2RVC A;  5D4R A;  3TO6 A;  2M5W A;  5HDK A;  1FBU A;  2QVO A;  3CLO A;  2VN2 A;  3GLX A;  4WXC A;  4OU0 A;  4XLN F;  1YIO A;  1LQ1 A;  1FWZ A;  2CGP A;  1R1V A;  2OD5 A;  2RQP A;  4KN7 X;  3GFM A;  1TW2 A;  4BHP A;  1IAW A;  5LHI A;  3G3Z A;  2KRF A;  4XLP F;  4ENM A;  1T6S A;  5E1Z B;  2UXX A;  1SAX A;  2LKP A;  5D4S A;  4JQF A;  4K2E A;  2EFQ A;  2K27 A;  1IRF A;  1SFE A;  3LA2 A;  4HOB A;  1GXP A;  4A12 A;  1P92 A;  1LDJ A;  4P9F A;  4HQE A;  3TDU C;  3M7G A;  1FYM A;  1T98 A;  2KJC A;  5L3B A;  5CLS A;  2A68 F;  2QYO A;  4EJU A;  6PAX A;  5LGT A;  1PDN C;  1SD4 A;  2GAU A;  3DPL C;  1HKT A;  2QQB A;  4Y17 A;  4MHG A;  1I1S A;  2VBY A;  1OPC A;  4HF0 A;  3CTA A;  2Z9O A;  1P2F A;  3E5U A;  2TDX A;  5D6F A;  2QUF A;  2M8E A;  1SD6 A;  2VOP A;  3I59 B;  2L3D A;  4GCV A;  1CGP A;  2VXZ A;  2QEN A;  4LLL A;  1Z6R A;  5BPI A;  1BM9 A;  2CW0 F;  1CF7 A;  2BV6 A;  1KU3 A;  4PZJ A;  2HYF A;  2Q0O A;  5DDG A;  2V1X A;  3KP2 A;  3WTU C;  5CVR A;  1GXQ A;  4G7O F;  3GVA A;  1RNL A;  4OIQ F;  3WGG A;  2EB7 A;  3R60 A;  3R0A A;  1O3Q A;  2PBI A;  2HFH A;  1K78 B;  4EJO A;  4WK8 F;  1WQ2 A;  3K69 A;  2HZT A;  2FNA A;  2KKO A;  1ZAO A;  1IXS B;  2L01 A;  3RYR A;  2IRF G;  1DPR A;  5E1X A;  1VTN C;  1IRG A;  2J5P A;  1R23 A;  3BY6 A;  4EGZ A;  1MJB A;  1P6R A;  5D5W B;  3V8K A;  3EDP A;  1W4M A;  5FO5 A;  4UV8 A;  5DYM A;  2FRH A;  2K4J A;  2DO7 A;  1WI9 A;  4IHT A;  5F1R A;  3Q9V A;  4EJT A;  2FBK A;  5DCM B;  1U5T B;  1ZYR F;  3QU6 A;  3T8T A;  2OAZ A;  4MNU A;  1H9G A;  1RZ4 A;  2P5V A;  3E5X A;  3IC7 A;  2DLL A;  2K4B A;  4ESB A;  4RGR A;  2KJB A;  1U2W A;  4JK1 X;  1FC3 A;  2A07 F;  3SZP A;  4L9T A;  4RAZ A;  4LB5 A;  4ASN A;  1ON1 A;  4GXO A;  1S29 A;  3ZMT A;  4EM1 A;  1I6X A;  3SFZ A;  5D8K B;  2QQ9 A;  4M73 A;  5L3F A;  3P7N A;  3V7S A;  3HTU A;  3EYI A;  2XAJ A;  2HKO A;  1XSX A;  5E8I A;  4KIG A;  2ZNY A;  3LQR A;  2J5O A;  5HLH A;  4HQM A;  3GFI A;  2XAS A;  2CQK A;  4R79 A;  1ZGJ A;  2XHK A;  1G3W A;  3EUH A;  2OA4 A;  2VE8 A;  2RC4 A;  4ZH4 F;  4LLN A;  2FBI A;  2L4M A;  1LDD A;  5LBQ A;  3HOS A;  3NEU A;  2P4W A;  1RIO H;  3GXO A;  1YG2 A;  2YPR A;  4L9V A;  5DEQ A;  1U5T A;  4M9S A;  4U7B A;  5H20 A;  1IF1 A;  1MD0 A;  5K5Q A;  2E1C A;  3BPX A;  4LLG F;  5AIP A;  2FA5 A;  2AXL A;  3DV8 A;  2F5E A;  2PMH A;  3C7J A;  4ZYG A;  4HX8 A;  4YG2 F;  4GYI A;  3W6K B;  3E6D A;  5LGN A;  5E20 A;  2AS5 F;  3WU0 A;  5EEH A;  3BOQ A;  2GZW A;  1I27 A;  2GIV A;  3FXQ A;  1S6L A;  5IT3 A;  3SXY A;  3QOP A;  4BNC A;  2PJP A;  1UFM A;  4UUV A;  1ZRE A;  1QGP A;  5CVU A;  1FBS A;  2L02 A;  2NRA C;  3ZN1 A;  4L9J A;  1KYW A;  1P4W A;  1XSD A;  1IN7 A;  3P9C A;  2FXA A;  5ICG A;  2OQG A;  3RKY A;  2EK5 A;  2QWW A;  1ZRC A;  1BI1 A;  3WTY C;  4KMF A;  1XGM A;  4P96 A;  2IA1 A;  1LJ9 A;  1RI7 A;  3QP6 A;  4ZYD A;  3H92 A;  3MZY A;  2VC0 A;  3V4G A;  3QP5 A;  2ZFW A;  2O61 A;  1KGS A;  2DBB A;  5H6R A;  4BAY A;  2EV0 A;  4NHJ A;  2JT1 A;  4KIB A;  2R7F A;  2F5F A;  1F4K A;  2QBY A;  4L9N A;  5J8F A;  2ZME A;  4P5O A;  2HKX A;  3MFK A;  1QZY A;  1Z1D A;  3W6J B;  5DUI A;  2H6C A;  1FY7 A;  3RIR A;  4O5V A;  1IW7 F;  2DW4 A;  4LB6 B;  2Z3Y A;  5L3C A;  1FP1 D;  2VT3 A;  1F5T A;  1STZ A;  5JVT A;  4BQA A;  5L3G A;  1TNS A;  1FX7 A;  2XVC A;  4WWC A;  2OZU A;  3FHZ A;  2O3F A;  5L3E A;  4ZZL A;  4DQ2 A;  5FFX A;  1OKR A;  2Y48 A;  2RKH A;  4G7H F;  2UWM A;  1UCR A;  3WGH A;  4HDV A;  2ZJ2 A;  2Z99 A;  3ZMD A;  5JI6 A;  2BEO A;  4E70 A;  4RB1 A;  2FQ3 A;  2NNY A;  5IT9 K;  2MLK A;  3WTV C;  1QBJ A;  1O7L A;  3I71 A;  5HLG A;  1L3L A;  2OBP A;  4RGX A;  3WE3 A;  2VE9 A;  1AOY A;  3HRS A;  4OIN F;  1OMI A;  2E1N A;  2M45 A;  3E6B A;  1SD7 A;  3MQ0 A;  1RUO A;  3OOP A;  5E1W A;  3O6B B;  1R5H A;  4IJA A;  5CVV A;  2OZ6 A;  4AIK A;  2V79 A;  4HA8 A;  1XN7 A;  1Z6T A;  1R58 A;  1REP C;  3R0J A;  4KDP A;  3ELK A;  3PQK A;  1PP7 U;  2HOE A;  2M30 A;  3IL2 A;  5CVI A;  1SFU A;  3O3K A;  3ABU A;  5LRS A;  4HV6 A;  1K6O A;  1EH7 A;  1HW5 A;  3LA3 A;  2A61 A;  1EH6 A;  3M8F A;  1HKS A;  4IHS A;  3HIF A;  1B59 A;  3COA C;  3QAH A;  2IP2 A;  3F8N A;  4PDK A;  1ON2 A;  3LQQ A;  2ADU A;  4Q4Z F;  4EVI A;  4MEY F;  1IXR C;  1TLH B;  2V6C A;  1LEA A;  1FSH A;  1FOK A;  1R1U A;  3FF5 A;  1LNW A;  2C6Y A;  3JTH A;  1BN5 A;  5HVQ C;  2PI0 A;  3VEP A;  1LVA A;  4MGR A;  2PMU A;  3GF2 A;  4ESF A;  3KLO A;  4YIF A;  4EGY A;  2YX7 A;  5ERI A;  4NB5 A;  1XGS A;  2EV6 A;  2XKP A;  1O3S A;  2XRO A;  4IPA A;  1H9T A;  2NYX A;  3I64 A;  4YII A;  1D5V A;  5ICF A;  1HQC A;  5A2Q K;  3FMQ A;  2ELH A;  1HXD A;  4G9Y A;  4G7Z F;  2FF4 A;  1XB4 A;  2PLY A;  2HTS A;  2GXG A;  2LSO A;  1GVJ A;  1RUN A;  3RJP A;  4IXA A;  2CYY A;  1EV7 A;  1ZRF A;  3K1M A;  1TTY A;  5HDG A;  2RNJ A;  1BOA A;  4P9U A;  2OQR A;  3MZH A;  1T39 A;  2YSR A;  2VON A;  2ZCW A;  3IWF A;  4OOI A;  1D3Y A;  4I01 A;  3WTZ A;  2Q8K A;  5FLX Z;  1SMY F;  3N4M A;  2STT A;  4CO8 A;  4AIH A;  1YO5 C;  3GYH X;  4BHC A;  1ZRD A;  4OMY A;  4OIR F;  4GYG A;  4KT5 C;  3DQV C;  2JTV A;  1R7J A;  1YTY A;  3VOE A;  2PQ8 A;  2XIG A;  3RI4 A;  1QZZ A;  5FB2 A;  3F21 A;  3FXR A;  3ZMU A;  4L0Y B;  5TJJ A;  1MDM B;  1ZGA A;  4EM0 B;  1YW7 A;  4I0A A;  1G6N A;  2D1H A;  2Q2E A;  2DFI A;  5JFR A;  2JSC A;  2JRT A;  3IRQ A;  5IT9 Z;  3CDH A;  1Z05 A;  5DD4 A;  3LAJ A;  1SD5 A;  1BC7 C;  3GWZ A;  4LK0 F;  1ONV A;  3ZPL A;  4AD9 A;  1YLF A;  2F2E A;  2RN7 A;  4TV7 A;  2G7U A;  3VB2 A;  4IRH A;  3SZT A;  4G6Q A;  3NRV A;  4M6Y A;  1J9I A;  3CUQ A;  2IJL A;  4ENN A;  2NS0 A;  3BJ6 A;  1AWC A;  4UVC A;  2V9V A;  2QZ8 A;  5HDN A;  3M1E A;  4A6D A;  3BPV A;  1DDN A;  2E7X A;  3RPQ A;  2COM A;  2O8X A;  4L5J A;  4IF4 A;  4I02 A;  4N0B A;  4Q47 A;  5J6X A;  4OMZ A;  3KP4 A;  2QM3 A;  2ETH A;  3KP3 A;  1HBX G;  3HYI A;  5ILV A;  3HRT A;  1YYV A;  3TGN A;  3H3Z A;  4CGZ A;  2VOD A;  3F23 A;  2HS5 A;  2DK5 A;  3IHU A;  4HLX A;  2DI3 A;  4QLC U;  4M74 A;  2HWV A;  5F64 A;  1P4X A;  4UNO A;  3GUD A;  3E97 A;  4OIP F;  4BHB A;  5ICE A;  1ZG1 A;  3D5L A;  2JPC A;  1OYW A;  4EQQ A;  3WU1 B;  1S3J A;  2V1D A;  4N9I A;  2LF7 A;  1ZLK A;  3R61 A;  5A2Q Z;  2O03 A;  1FNN A;  3L00 A;  3ZN0 A;  3F6O A;  4AWX B;  4CZZ A;  1Y0U A;  2R3S A;  1TW3 A;  3I0T A;  3WTW C;  4UV9 A;  2BYV E;  3OV8 A;  2E7W A;  1F1Z A;  1T2K A;  2EFP A;  2ZXJ A;  4L0Z B;  1FP2 A;  1WRJ A;  4M9Z A;  4KIF A;  4G8X A;  1G3T A;  4U0V A;  3TDZ C;  1S8N A;  4I0B A;  4EV0 A;  2VBZ A;  3CUQ C;  1PUE E;  1J7K A;  1KQ9 A;  2EWN A;  5ICC A;  4UVA A;  1ZG3 A;  3HSF A;  3WGI A;  3LAP A;  1TQI A;  3H3U A;  4CXF A;  3L9F A;  4M9X A;  3WOD F;  2HDC A;  2PN6 A;  3HOT A;  3JW4 A;  1UB9 A;  1WWX A;  2MH9 A;  3KP6 A;  2MBF A;  3WTT C;  4MQV A;  4HF2 A;  1FZP B;  5DV5 A;  4HAM A;  4YFX F;  3IWZ A;  2JPB A;  2QQA A;  2ISZ A;  2Y0M A;  3NQO A;  5BOX A;  1K78 A;  3DFG A;  3FM3 A;  3HTS B;  2P5K A;  3TOB A;  2IA2 A;  2IVM A;  3EET A;  3REO A;  4B09 A;  2L4A A;  2YR2 A;  1ZH5 A;  1ZAR A;  3F72 A;  2VBX A;  2P6T A;  4LFU A;  3KEO A;  4KMU X;  3E6C C;  4BXU A;  3WTX C;  1J5Y A;  5LHH A;  4M71 A;  2A69 F;  4A0X A;  3KLN A;  2HEO A;  1IXC A;  2K02 A;  3FZV A;  5D5U B;  2IA0 A;  4MQ9 F;  3JAM Z;  3F22 A;  2MA3 A;  1KA8 A;  1SFX A;  2P7V B;  2MC3 A;  1IN8 A;  3DEU A;  3F8C A;  2K7L A;  4G6D A;  1YQA A;  3TOA A;  3HRM A;  3F6V A;  4LD5 A;  5D5X B;  4RB3 C;  2P6S A;  1K7A A;  1FSE A;  1QO0 D;  2A3S A;  4ZYH A;  3KE2 A;  3J80 Z;  3ULQ B;  3ZQ7 A;  4XSX F;  4PGG A;  2D45 A;  3ZP5 A;  2A6E F;  1U6G A;  1V4R A;  3CO6 C;  3FM5 A;  3L09 A;  1DP7 P;  4S05 A;  1XGN A;  2PFB A;  1Z7U A;  2A5Y B;  4EM2 A;  3E5Q A;  3J81 Z;  4U0Y A;  3BRO A;  1KQ8 A;  1BI0 A;  1YW9 A;  2WC2 A;  3G73 A;  2ZME B;  1G4D A;  4DNC A;  3KEQ A;  3IKV A;  5JR3 A;  4L18 B;  2FMY A;  5HOO A;  4HYE A;  3F8M A;  2W57 A;  4ZYE A;  4ENJ A;  2NNN A;  5LHG A;  3DP7 A;  5LGU A;  1O3R A;  1D8K A;  1SMT A;  3TO9 A;  5L3D A;  2Z5U A;  3QRF F;  1J0R A;  1Z9C A;  3LFK A;  4I98 B;  3C1D A;  4AVP A;  2FML A;  2Z33 A;  1QPM A;  4QWQ A;  1HST A;  1HW2 A;  4Y13 A;  3ZMS A;  1X3U A;  5CJ9 A;  5CYV A;  2GA1 A;  4LK1 F;  1P4A A;  1J59 A;  3JSP A;  2ESN A;  2RV8 A;  1FLI A;  4L5I A;  3FX3 A;  5HS7 A;  1MJA A;  3EYY A;  4LJZ F;  4A0Z A;  3F8B A;  2HYG D;  3JTG A;  3EQL F;  4I09 A;  3KZY A;  5ILS A;  4EMS A;  4A5N A;  1LB2 A;  1XMK A;  1C0W A;  1MDM A;  1A04 A;  1KU7 A;  1XMA A;  1PP8 F;  1KQ0 A;  2M87 A;  3R4K A;  3KFW X;  2XUB A;  2DT5 A;  3DXJ F;  3QPH A;  2HTJ A;  3BDD A;  5ILU A;  5FD6 A;  3K0L A;  3ECH A;  2RDP A;  4LGW A;  5E17 F;  4U0W A;  2H27 A;  2HQN A;  1MZB A;  2BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...