1GWAA

Triiodide derivative of porcine pancreas elastase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Triiodide Derivatization and Combinatorial Counter-Ion Replacement: Two Methods for Enhancing Phasing Signal Using Laboratory Cu Kalpha X-Ray Equipment
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gwaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gwaA01
2BDHA 2P8OB 1WQSA 2TPIZ 1A1RA 1LHFH 1BDAA 1MKXK 2D26C 2FOBA 2A2XH 4AORA 1NPMA 2W7SA 2H9EH 3MU0A 1FY4A 2EI6A 3RP2A 3MO3A 5I46H 4IW4E 1YCPH 4XSKU 2TBSA 3SU0A 4UONA 3PLPA 1VCPA 4CR5A 2W3KA 1YPHE 4FUIA 2ZFSA 4MDSA 2FXRA 1OYTH 3MI4A 3UR9A 1GHVH 1IQIA 1U6QA 1PPGE 1O5DH 3A7WA 2Z7FE 1AE5A 1K1OA 3BG8A 3T5FH 2HPQH 1KTTB 1LHGH 1MTWA 5L30H 1SQOA 1BMAA 2ANMH 2Q6FA 4E7RG 3MH7A 1THPB 4D8NA 2DE9A 2ZU2A 5DKMA 2VINA 1C2LA 5HYOA 2H9HA 3VPKA 1GBDA 1YPGH 3E0NB 1GI2A 1XXDA 2Z9GA 1MAYA 1GGDC 4A7IB 3QK1A 1FN8A 2AGGX 1BRUP 1AGJA 4XFQA 3LKWA 4ESTE 3PTNA 2QGRA 1S85A 1LVOA 2JETB 3LGWA 4ZKRU 1UVPA 4ZROA 2C93B 1O3NA 1W14U 2GDEH 3UR6A 1K1IA 1GMCG 1TGNA 4KELA 2ZDKA 2KAIB 1EZXC 3UOUA 2ALPA 4Y0ZE 3TJOA 2J94A 2ZPSA 5GWZA 5JBBS 3PWCA 3MO9A 4VGCB 1T31A 2J92A 1QGFA 1G36A 1DXWA 1FQ3A 2ZDMA 1O5AB 3QDZB 4UEHH 1HAHH 3FP6E 4FUDA 4I31A 2XTTB 4ZAEA 2NU4E 3RMNH 3O8DA 3GICB 3LGUA 3BTDE 3M7TA 4Y11E 1BBRE 1JBUH 2GT7A 5HGGA 5EPNA 1S5SA 2ZTYA 3A80A 3GDVA 3RUOA 5CMXH 1UK3A 1P57B 1CHGA 4ZH8A 2UUJB 3KCGH 3KQBA 3D62A 3W94A 1C4V2 1DLKB 4BTUB 4MNXA 1CO7E 1F5KU 2ZHFH 4I8KA 5E8EH 4B2AA 5FX6A 1ARBA 5E0GA 1TBZH 3LH3A 6GCHF 1ZSJA 2BDGA 1EXFA 2ESTE 2OTVA 4JYTA 1BTWA 1Y3VA 2FTLE 1FY5A 2RDLA 4DGJA 2GCHG 3OSYA 1QY6A 3P70B 1MTUA 1KXAA 1GVZA 1DY8A 1QL8A 1FUJA 5K0HA 4IMQA 1O38A 3SUFA 1LQDB 2ZTXA 1W0ZU 2C3SA 2GMTC 3KEEA 4NGAH 3T2NA 1NRPH 1CT0E 1KXBA 3LGIA 4H42U 1NZQH 1GMHF 1NRQH 4U32A 1THRH 1W8BH 1A61H 4KKDA 1DY9A 1FIZA 1GG6C 2VVUA 1KY9A 2PUXB 1BMLA 1MKWH 2SGAA 4ISOA 1OSSA 1C5OH 1O2XA 1Z7KA 5ESBA 1QB6A 1XUGA 4D7FA 2ULLA 1GL1A 4B73A 5JBAS 2QCYA 1GVKB 1TQ0B 1V2UT 2ZHDA 3ATLA 2BLQA 1JMOH 1GJDB 2FOFA 2BOKA 2Z6BD 1CE5A 1L2EA 1DT2A 2ZNKH 5E2OA 3RXFA 3ZZ9A 5C1UA 5L2ZH 4X1QU 2XNIA 5E0HA 2ZO3H 1QBNA 1O2LA 5EPYA 1SLUB 2BDIA 3GCOA 2P3UB 1HXEH 3PO1B 1IQLA 2BLOA 1Z6JH 4CBNA 2G5NA 2XBVA 3UUZA 3BTTE 2CGAA 3IITA 4LZ1H 3K6YA 1C2GA 1THSH 3M5MA 1V2TT 1HAZB 3TH4H 1C2IA 2EA3A 1TMUH 5AHGH 1BT7A 5C5NA 1P0SH 1TPAE 4TY7A 3SNDA 1A5IA 4NSYA 1INCA 1AFQC 1A4WH 1GGDB 1MCTA 1AVXA 1VCWA 1OS8A 1V2ST 2O8TA 2BD5A 2TGTA 2ZU5A 3RC5A 2RG3A 1GI0A 3OY5U 3TH3H 1S0QA 1BRCE 1DWDH 1G3DA 2FODA 5F8TA 4JK5A 4DIHH 2W5EA 2FWWA 3TJUA 4DCDA 2RCEA 2BY5X 1CGJE 1GHAG 3RXJA 1Z6EA 3DUXH 4FVDA 1OP2A 4ISIH 2BTCE 3EA8A 1O37A 4FUBA 2AGIX 1XVOA 1AO5A 1CHOG 2OP9A 2CN0H 2OUAA 5PTPA 1GI3A 4B76A 1O2VA 4MPXA 3SJ8A 2VB0A 4M7GA 3UREA 2Z3CA 2VH6A 2UUFB 1DXPA 3FZZA 5C3NA 1UK2A 1VITH 4MNWA 4I8LA 4ABJA 1RS0A 4JZEH 1BTZA 2F9VA 4K60A 1AMHA 1G30B 5G4BA 5HM2A 3T26A 1XMNB 3VB7A 3KQCA 1LHDH 3QZRA 1A0JA 1LTOA 1Y59T 1S83A 3BTME 4HI3A 1PPEE 1OWDA 1P03A 2BVXH 5E0JA 1C5PA 3TJNA 2DE8A 4DG4A 3FVFB 1TQ7B 3SQHE 2BQ6B 1C1UH 5F6MA 1BTXA 1RD3B 2H9TH 2BX3A 3GCTF 1O2MA 3BEUA 4DVAU 4TWYA 1ELBA 1MKWK 1NFWA 3ATWA 5J4QA 4IMZA 2VIDA 4D9RA 1FAXA 1O3LA 2F83A 2XWAA 4YM9A 1PQAA 2BZAA 1QA0A 3JZ2B 2BD4A 1P2QA 1ZTJA 5FCRA 1W3CA 3A7TA 3CS7A 1T4VH 1YPHC 1XKAC 3PMJA 1OP8A 3I78A 4DY7B 1PFXC 4WH8A 1IQEA 1BITA 1BTYA 1GG6B 2Z9IA 1QB1A 1LDTT 1O3AA 1UTQA 4A1XA 2FYRA 1DWEH 1ELCA 3QGNB 2FX4A 1O2IA 3RDZA 4BNRA 3H7TA 1GI5A 2Z9KA 1CQQA 2B9LA 1TRNA 4D9QA 3RMMH 3BG4C 3G01A 4AG1A 2FDAA 1ZR0A 1TOMH 3SU2A 3I29A 3UQOA 1LVMA 4YLUA 2ZGXH 1GJ8B 3BSQA 1IQMA 4CBOA 3KQDA 3ZVCA 4RKOB 2AEIH 2VVCA 1AU8A 2R2WU 3SHAH 1PPBH 2ZGCA 5A0BA 1ZLRA 2VU8E 3ZZ4A 1F5RA 1JWTA 2WYJA 2FPZA 1GJ4H 5CHAC 3DA9B 1AVGH 3PMBB 1HUTH 1IOEA 5EW1H 3S69A 1KLIH 3MNSA 2AIPA 1ANCA 3IWMA 3M37A 3SBKA 2J95A 5DP7A 1O2PA 3PB1E 4I8GA 3O8BA 1A5HA 3VB3A 1TE0A 4HFPB 3U9AH 2AMPA 1AFQB 2BVRH 3PV4A 1F0SA 6ESTA 4AFUA 1D6RA 4RN6A 2QN5T 3MU4A 1E37B 2R9PA 1JRTA 5IDKA 1GBMA 1C1TA 2WV4A 2F91A 3S9AA 1C1NA 2GKVE 1GHWH 2A32A 2HVXA 4NFFA 1BTUA 1Y5UT 1TPSA 3SUGA 4CRDA 1A0HB 2FI3E 5JPMH 2XYAA 5H4IB 1P2OA 3RC4A 2Y80A 3GDSA 2NU1E 2Y81A 1WTGH 3SJKA 3QZQA 3A7YA 1UTMA 1OP0A 5EXLA 2GTBA 1C5YB 4UFFH 2GT8A 3UTUH 2H5CA 1GPZA 3M3VA 2WUBA 4TPIZ 1O2YA 1P8VC 1TFXA 4CRFA 2ZECA 8GCHG 4AFSA 1IAUA 1OWIA 1RTLA 2G52A 3PYHA 4AN7A 5JB9S 1ANEA 1QRXA 3K9XB 3PWBA 4IC6A 4X8TH 4A6LA 1MTNB 2A4RA 4Q2KA 6CHAC 4BAMB 4BOHA 2V35A 1UCYH 3VXEH 2G81E 1C1RA 2BD2A 1F92A 1HAGE 1GJCB 1B7XB 4DT7B 5DJ7A 3MH4A 1JIRA 3V12A 1GBLA 2BZ6H 1H9IE 2VIWA 1V2PT 2BD8A 3SNEA 4K1SA 2CHAC 2UWOA 1O3DA 1V2VT 1TMBH 2Q6DA 2FS8A 5FPTA 1HYLA 4ABIA 4AYYB 4XBBA 3E6PH 1NROH 1T8LA 3SJ9A 1V2JT 4SGAE 1MQ6A 1B0FA 1P02A 1SGFG 3LU9B 1Z1JA 3RU4E 1FIWA 3ATMA 3RLWH 3SI4H 1HAOH 2OBOA 1JIMA 1HJ8A 1UTNA 4RSPA 5FBEA 5F03A 3GCNA 1EP5A 1VCQA 1PPZA 3OU0A 1GL0E 1Z8RA 4BANB 1GWAA 3EE0B 3FFGA 1C2HA 4U30A 3SW2B 3BG4B 3P17H 1KDQB 1HNEE 4PROA 3ESTA 1YM0A 2KAIA 5DPAA 1TNLA 2UWPA 2BDYA 3U1JB 2VIPA 4ABEA 1H8IH 3Q3XA 2TRMA 3A8AA 3PM3A 3ITIA 1L4ZA 1GHBF 2BD3A 2QF3A 3BIVH 2HNTF 3O8CA 3I77A 3UWJH 1J14A 2ILNA 3LC3A 2XBXA 1AB9C 3ZZBA 2ALVA 3SU4A 4H6TA 1PJPA 2XW9A 4GSOA 5HM9A 1K1JA 4AFZA 5AF9H 2VIOA 3A84A 3Q77A 1ZHMA 1NRNH 1O2WA 3R0FA 1PYTC 3QTVH 3P95A 4YT7H 5LPEA 1BIOA 4X8UH 4UE7H 1CA0B 4FU9A 1G3BA 1FLEE 2HLCA 2OC1A 1FJSA 1ZSLA 1ETSH 1VITF 2P59A 1TPOA 1B0EA 8ESTE 3MH5A 2G51A 3B23B 2BY8X 1SFIA 3AW0A 1N8OC 2AGEX 3ATIA 2BY7X 4WXVA 2A1DB 3A85A 3VB4A 1OWJA 1O35A 1YPEH 1P06A 2Y5GA 1DS2E 3D23A 1N6XA 3DFLA 3SN8A 4JYVH 3VGCC 1D9IA 2F9OA 4Y8ZA 1SHHB 1UCYK 5AVDA 1LPKB 1SGYE 3SJIA 1TIOA 2PHBA 1BMNH 1A46H 2VIQA 3MHWU 3RXUA 3SNBA 3A89A 1XUHA 2VWNA 1G32B 1E0FD 3GY6A 1E35B 5DP3A 3QX5H 4LK4A 1HJ9A 1BBRH 2C8ZB 4IGDA 1C5QA 1C5WB 2WV5A 3BF6H 4HZHA 5C5OA 2FS9A 4O3TA 1GJ9B 3SV8A 2PWXA 3LGVA 5T6FA 1LQEA 1C2MA 3QTOH 3D49H 2SGPE 3NKKA 4Y71A 4DW2U 1GBTA 1CA8B 2O8MA 2J2UA 2JH0D 2VWOA 4X2XA 2O8WA 1YLDA 1CBWC 2CHAB 1O5FH 2ZFRH 4J1YA 1SL3A 2A45B 1O5GH 1HAVA 2ZGJA 4CHAB 1T7CA 1O31A 1P10A 1YP9A 4FUEA 1TAWA 2FESH 3A7ZA 2ZU3A 2ZG0H 2TIOA 1FMGA 2EI8A 1SBWA 1EAWA 1DDJA 2VGCC 4K69A 1C4U2 5T3HA 3SHCH 2A4GA 2QXJA 2ZDNA 3Q3YA 1EKBB 1OKXA 1O2QA 1FN6A 1O3IA 4A1VA 1ZRBA 4AGKA 4LXBH 3A83A 3MU8A 2LPRA 2QXHA 3IG6B 3ZV8A 4BAKB 1EUFA 1TWXB 2JH6D 5FCKA 1P3EA 1CT2E 3C27B 3T27A 2FI5E 4CH2B 1O30A 2ZKSA 2IOTA 3ODFA 3KGPA 3V3MA 2Z3EA 3MNCA 3MO6A 5EOKA 1C9TA 4X1PU 2R3YA 1Y3YA 2GV6A 1TBQH 4NWKA 3A82A 2ZTZA 4Q7YA 4WMDA 1V2RT 4ZKSU 1AB9B 3ATKA 2F9UA 4K2YA 3UFAA 1RRKA 1H9LB 3RXMA 3TNSA 2NU2E 3LJJA 2QAAA 1K28D 1Z8IB 1TGTA 3S0NA 1LMWB 4WXIA 3S9BA 2PW8H 2FYQA 3QN7A 1HJAC 2UUYA 2PKAA 4Q7ZA 1ZPBA 5GDSH 4YOIA 1C5NH 2CV3A 3GCHC 5JDUB 1ELEE 1NFUA 8KME2 4Z0KA 3SGBE 5EQQA 3TK6A 1N8OB 2XRCA 1ZJKA 1BBRK 2BB4A 1OWHA 2DUCA 1NESE 3F9EA 1GI4A 1ELDE 4H6SB 5A8YA 2ZWLH 2FEQH 1SOTA 2BDBA 4MTBA 3VGCB 2EEKA 1K1LA 4GCHF 2ZFQH 1P2JA 1HFDA 4Q80A 1EB2A 3ZVDA 1SOZA 5A0AE 1IQGA 1YCPK 1TPPA 1O3MA 1GDQA 6GCHG 1O2ZA 1QJ7B 1QBOA 4JZ1A 3ZZ3A 1D3TB 1TX6A 5IYTA 1GDUA 3BTWE 1DUEA 1YPJH 2CMYA 2HGTH 2NU3E 3LJOA 1DE7H 3BTEE 1GBFA 3FZDA 1YBWA 3ELAH 3SV7A 3SUEA 4X1SU 4CRBA 2ZDLA 3BTGE 3EYDA 3RU4T 1O5BB 1DWCH 1GMHG 1C1OA 3LOXA 5T6DA 3A8BA 2SGDE 3ZV9A 1DWBH 3AAUA 3C1KA 1GI8B 1L4DA 3NWUA 4FUJA 1BTPA 4THNH 3M5OA 3SQEE 4NZLA 1MUEB 3SV2H 2YNBA 1ZOMA 3M35A 1G2MA 1HAPH 2P16A 1BRAA 4MVNA 1AHTH 5DO4H 4FUHA 1LVYA 1ZHRA 1P12E 1HBTH 1SR5C 3TIUA 1GI7B 1HAVB 1MZDA 1TGSZ 2PV9B 3GYLB 1TNHA 1EZSC 2VGCB 1TNJA 3OY6U 3V7TA 4I32A 1XKBC 3HPTB 3WY8A 5LGOA 2GD4B 4ZHAA 3GY2A 2BLVA 4TWWA 2JKHA 1DSUA 1IQFA 5J4SA 3KL6A 3OX7U 3EGKH 1J16A 1RTFB 4U2WA 5FBIA 3L6PA 3FP8E 1QTFA 3A8DA 2A0QB 1A3BH 1GMDF 2W7UA 4YESB 2QIQA 1GHYH 1K1PA 5JBCS 3RM2H 1W7XH 1RJXB 1YCPM 3NK8A 4FUCA 1FONA 1C2JA 1AVWA 4GHQA 2FZZA 2BY9X 2WPIS 1ABIH 2B8OH 4Y7AA 3TK5A 1D6WA 4JZFH 1GJAB 2G00A 1FY1A 1UVSH 2SFAA 3RXVA 4MPWA 1FXYA 3ZZCA 5I25A 3DFJA 2OC8A 1J15A 2OC0A 1BTHH 2Z9LA 1ZJDA 2WPJS 4FU7A 1BMMH 1G37A 1YPLH 4A5TS 4K5ZA 1C5ZB 5BPEA 3SUDA 2I6SA 4YT6H 5EQRA 1WTHD 4OGXA 2ANYA 1CGIE 1EOLA 3GISB 3Q00A 3ZVAA 1HJAB 2FX6A 1OXGA 2STBE 2ZGBH 3STIA 1SC8U 1PYTD 3GCHB 2ANWA 4OS6A 2QF0A 2PKAB 1EPTC 1FY3A 1NRRH 3TITA 5EGMA 5TCAA 3RXQA 1O3JA 3GY4A 3URDA 2Y7ZA 1BCUH 2GX4A 1UVUH 1PQ5A 2BQWB 3LC5A 1SGRE 1AUTC 1EJMA 2SNWA 3DHKH 1OPHB 2GMTB 2YNAA 1YPKH 1SLXB 1DOJA 4E05H 5C20A 4ZKNU 3E3TA 1S0RA 4SGBE 4UFGH 4B75A 3GCTG 2HALA 2OXSA 2R3UA 3A88A 1K2I1 5GCHG 3RXOA 4F4OC 1P2IA 3RXDA 1V2WT 5DG6A 5FPSA 1KDQA 3A87A 1SQAA 4BTTB 1ZZZA 4FUGA 1BUIA 2TGPZ 1NFYA 1UTKA 1HGTH 4NG9H 1AD8H 4YZUA 1HDTH 2THFB 1K1MA 1HRTH 1N6YA 4MQAA 3QUMP 1O0DH 4WH6A 7ESTE 2C8XB 4A1TA 1AE8H 1FZZA 2HNTE 1EQ9A 2ODPA 2AERH 1ZGVA 3S9CA 3T29A 4X8VH 1TA6A 1PPCE 2D2DA 3MFJA 2BX4A 3ZYDA 4B71A 1T8OA 3FANA 4FVBA 4INHA 2QC2A 3RXSA 3M7UA 3F68H 1A2CH 1GI9B 1QJ1B 1SGPE 3SGAE 2ZCLP 2BVSH 4HTCH 4AB8A 4ZKOU 3DT0H 5A8XA 1QHRB 1ZRKA 1P05A 3U8OH 2OCVB 3MU1A 1IQHA 1BJVA 2GZ9A 3CP7A 1NM6A 4MPUA 1MBQA 3MNXA 2B0FA 5EW2H 1D3QB 4D76A 1D3PB 1KIGH 3AW1A 2OBQA 2Z3DA 2PGBB 1WAYB 1O3OA 1GI1A 3GOVB 4WF8A 2GCTC 4ZXYH 1W7GH 2GDDA 4NIXA 2ZPQA 1MAXA 2PTNA 2ZU1A 4BXSA 5BRRE 2WPHS 4DJZB 4Z6AH 1QL9A 1JXPA 1SMFE 7GCHG 1VGCC 4DOQA 1JOUB 1O3GA 1CGHA 2UUKB 2BXTH 1K21H 2K1QA 1SGIB 1Y3WA 4CREA 2A7JA 3UNQA 5DK1A 1C1MA 3RXTA 5LPFA 8GCHF 2F9NA 1SLVB 2CXVA 1RTKA 3SZNA 3UY9A 3ZZ5A 3BEIB 3RXAA 2GP9B 3RXHA 4DURA 1Y5AT 1DICA 1RIWC 2P94A 3UNRA 1YKTA 2OD3B 1QNJA 2ZQ1A 3BEFB 3Q76A 1AN1E 2AH4X 4GPGA 3F6UH 2VWLA 1AI8H 1GBAA 4WY3A 1S81A 1EPTB 2FIRH 1SPJA 1D4PB 1AY6H 1ARCA 2FP7B 4O97A 1P04A 2O8LA 1DX5M 3ZYEA 4ZXXH 1GBJA 1C1SA 2ZA5A 1MD8A 2OINA 1TA2A 2UWLA 1H9HE 2FOEA 3GY5A 2FOGA 1O2UA 2Y5FA 4I7YH 1FPHH 4OS2A 1EAXA 4BAHB 3ODDA 2ZCHP 2P93A 2A7HA 1UJ1A 5DGJA 3EA9A 1ANDA 1FPCH 4XBCA 5AFYH 3KN2A 2BDAA 4GUXA 2FTMA 1GDNA 1B5GH 1GBBA 1ELAA 2SGEE 3LIWA 1M9UA 1MKXH 1C2DA 3H5CB 1NC6A 2D8WA 1OWKA 2IJOB 1YLCA 2XC5A 2EI7A 2PGQB 2XC4A 1EZUC 1G9IE 5A0CA 2OQUA 3SU3A 3MWIU 4Q7XA 3SU5A 3UIRA 7KMEH 2FLBH 3K65B 1P11E 1E36B 2ZP0H 1RFNA 4J2YB 1C2KA 2PR3A 4NSVA 5T6GA 4DIIH 2ZFTA 3RU4D 2PSYA 3SNAA 2BD9A 2CJIA 1ESBA 1V2MT 1MD7A 4X8SH 1ESAA 4AOQA 1PPFE 2JETC 1O3EA 1GHXH 5EU8A 1A3EH 1T8NA 1GJBB 1HLTH 5CHAB 4LZ4B 1TGCA 1QJ6B 1UHBA 1DVAH 1TX7A 2Z9JA 1QBVH 1FV9A 3A81A 3RXGA 1L1GA 1UTPA 2VH0A 3FAOA 1GCTC 1DUAA 1AKSA 1GJ5H 1GHBG 5FXLA 1V2KT 1O3PB 1SGNE 1LVBA 2Q6GA 5L6NH 1A7SA 4O3UA 4E7NA 2BY6X 1C5TA 3MTYA 1SGQE 3RC6A 3N7OA 5C2ZA 3OYPA 1J8AA 1IQNA 3L33A 3SU6A 1EATA 2BDCA 4AX9H 5DP4A 3TJVA 1SGFA 2HOBA 4NZQA 4JZIA 3ZZDA 1NY22 3RXCA 5EQSA 4NA7A 3V0XA 1VGCB 4K8YA 3UWIA 3TH2H 2QA9E 1DFPA 2XXLA 5L2YH 2P3TB 3ZZ8A 1K9OE 1V3XA 1XX9A 1SLWB 5A8ZA 4CRCA 1QIXB 1O2RA 1Q2WA 1EASA 3RXPA 4FU8A 4TYDA 2PTCE 1H4WA 1TYNA 2R0KA 2XCFA 2GGVB 4MNVA 3NPSA 4NWLA 4ZUHA 1TLDA 1BB0B 1CVWH 6CHAB 3EAJA 2OC7A 2QXGA 3M61U 4K8BA 1O5CB 5C1XA 1SHYA 4NA9H 5GJ4B 1GBIA 1Z1IA 2A2QH 1WSSH 1ZMJA 3LPRA 4H4FA 3F9HA 4CR9A 1KSNA 1WV7H 4KP0A 1T8MA 2Q1JA 4X6MA 4INKA 4WVPE 3H7OA 1S6HA 1MH0A 4WMFA 1O2HA 4X0WU 5EODA 1FDPA 3LT3A 5JYIA 1YPMH 4D7GA 1AZZA 2HNTC 3A7VA 1ZHPA 1ZYOA 3Q3KA 4A92A 1BJUA 2F9BH 3UNSA 5GXPA 1C1VH 1W10U 5HXFA 3TK9A 1N1LA 1F5LA 1AQ7A 4GAWA 1AWFH 5HMAA 4U01A 3PO1C 1TB6H 1ZPCA 1UTLM 1G3EA 3E16B 4ABGA 1TMTH 1TBRH 4AG2A 5C67A 1O2SA 1DM4B 1YF4A 2BXUH 3MNBA 4BAQB 1EZQA 4XOJA 1EJAA 3NCLA 2ZHWH 1PQ7A 3DD2H 2AYWA 1GMCF 5JB8S 3RXRA 2SGQE 3T62A 3E1XB 3ZVBA 2A5IA 1P2KA 2R2MB 4OS1A 5F8XA 3RMOH 3GY8A 1KYNA 1SVPA 4ASHA 9LPRA 3SO3A 3SORA 1KTSB 1WCZA 3MYWA 4R0IA 2A4OA 3KF2A 1ESTA 1V2OT 2AIQA 1C5MD 1QA7A 3MH6A 3NUMA 2RA3A 3TNTA 9ESTA 2ODQA 1Z71A 1NO9H 3SOSA 3ZVEA 1TOCB 3QLPH 4MLFB 4WJG2 2BD7A 1GCTB 1UHBB 2OQ5A 1XUKA 3A7XA 3PMHB 2GZ8A 1L1JA 4X6OA 1AKSB 2A5KA 1WUNH 2ZPRA 1WBGB 2V6NA 3HK6B 2TGAA 2G4TA 1KLJH 2VVVA 1KXCA 1O2KA 1EOJA 3HGPA 3SGQE 2STAE 1JRSA 2Y5HA 4B74A 5FPYA 1F0RA 4AFQA 1P9UA 4JZDH 2J4IA 2GCHF 1O33A 1RGQA 2H2ZA 1MZAA 2ZDAH 1EP6A 1SGDE 2A4QA 1AWHB 4Y10E 1LCYA 2C8WB 1ORFA 1P3CA 2CF9H 2ZC9H 4WMEA 3ZVGA 5A09A 5FHTA 3P92A 1QR3E 4CRAA 1GHZA 2W3IA 3D65E 3VEQB 3HK3B 1O36A 3M3SA 1O3FA 4X6NA 3P8GA 4CH8B 3F9FA 2FOAA 3O8RA 3TGKE 1VZQH 4XBDA 3SV6A 4OS7A 1OWEA 4IS5A 5EXMA 4Y8YA 5ESTE 2J34A 1GBCA 2LNCA 4GCHG 2XWBI 3U8RH 1LO6A 2ZFFH 2P3FH 5AFZH 4JCNA 5FAHA 5GPIB 5FX5A 3RM0H 4YLQH 1Q31A 1BHXB 2VNTA 3GYMA 1UO6A 1ANBA 1F0TA 3BTFE 4KTUA 4UDWH 1Y8TA 2FM2A 1CBWB 2J9NA 3PLBA 3PTBA 1G2LA 3RXIA 3ZZ7A 2XBWA 2AS9A 3RXEA 1BQYA 3LGTA 1XUIA 1S84A 4FUFA 3AASA 4FXGH 1BA8B 3M3TA 1W2KH 2G4UA 4ZHMU 2ZHEH 1QL7A 1E34B 3BTKE 5A2MH 1PPHE 1GJ7B 1CT4E 4QT8C 5C1YA 5B6OA 1TRMA 4NIYA 3TGJE 1MMJN 1XUFA 4ISNA 2AMDA 4AGJA 1GBHA 2FI4E 3BTHE 1CU1A 2A5AA 2H1UA 1IHTH 4RKJB 3KQEA 2PLXA 1YYY1 2FLRH 2FMJA 1F7ZA 1T32A 2IN2A 1GVLA 1HCGA 1UMAH 4ISLA 3VXFH 2CF8H 2WUCA 2BM2A 2V3OH 3GDUA 1GHAF 1QRZA 2QV1A 2NWNA 3M5LA 1O2JA 2H5DA 4KTCA 5GIBA 2HWLB 1O2TA 2O9QA 1CHOF 1FY8E 4B2CA 3F1SB 2VIVA 1KXDA 4GLYA 1A0LA 1XXFA 1P2MA 3EQ0H 5DP5A 1EJNA 4WWYA 3KHVA 2D1JA 4XDEA 1GBEA 3S7KB 1UVOA 1GMDG 1AZ8A 3B9FH 1GCDA 4AB9A 1YC0A 1SB1H 3HKJB 2WPKS 3T25A 2J38A 3BV9B 4NCYA 1XVMA 4UFDH 3TU7H 1MTVA 1O3KA 1O5EH 3BTQE 3V13A 1O34A 2ZGHA 2G5VA 1ZTKA 1NRSH 3QO6A 1NU7B 2ZQ2A 1EPTA 4Y8XA 3RLYH 2G8TA 1LKBA 3MU5A 3FP7E 4LOYH 1ELGA 5ABWA 1O2NA 2ZHQH 1W0YH 2VWMA 1D3DB 4TPYA 2GV7A 3E90B 1LPGB 1MTNC 1P2NA 1C5VA 2ZI2H 4B2BA 2FOCA 1T4UH 4OS5A 1ZTLA 3STJA 2OLGA 3KIDU 1VR1H 1UK4A 1Y5BT 2B7DH 1NN6A 1OYQA 3E0PB 1NT1A 1NFXA 3ENSB 3PMAB 1AUJA 3SNCA 3E91A 3QWCH 1LHEH 1H8DH 4OGYA 1UVTH 1SGEE 2WINI 4ZHLU 5GCHF 1HPGA 2BMGB 4YOJA 3HATH 5DP8A 1K22H 5DP6A 2F9PA 3R3GB 1C5SA 1O3HA 4IBLH 1ELTA 1ZGIA 4X2YA 2PKSC 1ACBE 1O2GH 4YOGA 1ZPZA 3JZ1B 3OTJE 4AZ2B 2V0BA 1WOFA 3EDXB 1HB0B 3U69H 1SFQB 3ZVFA 1XUJA 3A8CA 3HKIB 1Y3XA 4NA8A 1C9PA 1V2QT 4YTAA 2IPHA 1HV7A 3URCA 4Y79A 2GZ7A 2NU0E 2JH5D 2Y7XA 1P09A 2BLWA 2O8UA 1UTJA 1GBKA 1HAIH 1O3CA 1HIAA 5EG4A 2G55A 4BAOB 1EB1H 1NTPA 1ZMNA 2M5TA 1C1QA 2ZFPH 2BYAX 4K1EA 4JMYA 2HPPH 1GJ6A 1SQTA 1TRYA 5JBTA 3PLKA 1XM1A 4I8JA 4E06H 2ZEBA 1MU8B 2SNVA 3LONA 4K1TA 4AYVB 2QYIA 3P6ZB 4Y0YE 3BIUH 1L0ZA 1ELFA 1NS3A 5LH8A 1MU6B 1EAUA 2XCNA 1W12U 2PUQH 4ISHH 1O2OA 4KTSA 3SU1A 1ZMLA 1K1NA 3TLOA 4GHTA 4BXWA 1SG8B 1V2NT 4X6PA 3ZZAA 1CA0C 7GCHF 1FAKH 4F49A 3GY7A 5SGAE 4MG3A 4X1RU 1QQ4A 1KLTA 4GVUA 2SGFE 1L1NA 3EA7A 1ETTH 5LPRA 2FO9A 1LPZB 1BOQA 1P9SA 4IN2A 4ZMAH 1PQ8A 1VJ9U 3QGJA 4X1NU 1AFEH 1WU1A 2V3HH 4MPVA 1DPOA 3GY3A 1E38B 1V2LT 2QXIA 2ZU4A 2ODYB 5DP9A 4INLA 3HGNA 4Y76A 2VJ1A 4TY6A 1TNIA 1X7AC 2PFEA 1WQVH 2RA0A 3U98H 4ABHA 3UOPA 1F2SE 2YOLA 3MOCA 2WYGA 2W26A 1C5LH 2P8OC 4O9VA 2Z94A 1W11U 1UTOA 4I33A 2Y6TA 3SI3H 1CSOE 1QURH 1C1PA 6LPRA 1S6FA 1C5RA 4YO9A 3M36A 1AIXH 1EAIA 1ELVA 1SGTA 3SJOA 1J9CH 4Y7BA 2ZCKP 2FOHA 1DLEA 4NFEA 4NIWA 1ZSKA 3E8LA 1F0UA 3BN9A 1TONA 3LGYA 2FOMB 5EXNA 2I6QA 4CRGA 1TGBA 4ABDA 3M7QA 3T28A 2Y82A 5F8ZA 2F3CE 1C1WH 3RMLH 1Y3UA 4CHAC 2BQ7B 2ZF0H 5ETXA 4XE4A 2ZIQH 4R8TB 1ID5H 2ASUB 3VB6A 1H1BA 4O03A 2PKSB 1O3BA 1IQKA 3LH1A 2GVFA 4ABBA 3P8NA 2B5TB 1C5XB 2TGDA 3U8TH 1IQJA 1J17T 1WYKA 5CE1A 4JYUH 3SV9A 3KNXA 4HGCA 1G3CA 2P95A 1C4Y2 4UFEH 1GI6A 5TCCA 1BHXF 2ZZUH 3RXBA 1LKAA 1LHCH 2C4FH 1TALA 3K2UA 3NZIA 1QB9A 3VFEA 3ZZ6A 1QQUA 2ZDVH 2R0LA 4I8HA 3TPIZ 1KXEA 5E2PA 1DANH 3K6ZA 4B1TA 4X2VA 1C2FA 4IC5A 3CENA 3UQVA 1HXFH 1SGCA 3AVZA 3CS0A 3P8FA 2XBYA 4KGAA 3A86A 1C2EA 1Q3XA 4BTIB 1MQ5A 1BRBE 1FNIA 1HIAB 3VB5A 4VGCC 1FI8A 1BZXE 2C90B 2EC9H 4OS4A 2PSXA 4ABAA 3UPEA 4NIVA 1SSXA 1QRWA 3P8OA 2BHGA 7LPRA 1ETRH 1RXPA 1ABJH 2XC0A 1V6DA 2WPLS 1DSTA 4UD9H 3S7HB 1W13U 1C5UA 1HAYB 1MBMA 2BOHB 1IHSH 1QCPA 3B8JA 2GCTB 3TGIE 2AFQB 3RXKA 1UCYE 1KXFA 2QY0B 3NXPA 1YGCH 3U1IB 3F9GA 5K7RA 1EX3A 1NU9A 4JK6A 1Z8GA 1VITG 1HAXB 1Z8JB 1TNGA 1O32A 1OX1A 3PROA 1TABE 4K3JA 1O39A 4X2WA 2A31A 4Y6DA 1DITH 1TNKA 4MNYA 3AAVA 1SI5H 8LPRA 3MMGA 4IN1A 3RXLA 2WPMS 2H6MA 3L3TA 3W95A 1MCVA 1RIWB 3TVJB 1A5GH 2ANKH 2HRVA 2C8YB 1P01A 1MTSA 1TX8A 1VJAU 5TJXA 1QFKH 3M5NA 2AMQA 1S82A 3LDXH 4ABFA 2A7CA 1OOKB
chains in the Genus database with same CATH superfamily
2BDHA 2P8OB 1WQSA 2LELA 2TPIZ 1A1RA 1LHFH 1BDAA 1MKXK 4RI0A 2D26C 2FOBA 2A2XH 4AORA 1NPMA 2W7SA 2H9EH 3MU0A 1FY4A 2EI6A 3RP2A 3MO3A 5I46H 4IW4E 3AK5A 1YCPH 4XSKU 2TBSA 3SU0A 4UONA 3PLPA 1VCPA 3FKSD 4CR5A 2W3KA 1YPHE 4FUIA 2ZFSA 4MDSA 2FXRA 1OYTH 3MI4A 3UR9A 1GHVH 1IQIA 1U6QA 1PPGE 1O5DH 3A7WA 2Z7FE 1AE5A 1K1OA 3BG8A 3T5FH 2HPQH 1KTTB 1LHGH 1MTWA 5L30H 1SQOA 1BMAA 2ANMH 2Q6FA 4E7RG 3MH7A 1THPB 4D8NA 2DE9A 2ZU2A 5DKMA 2VINA 1C2LA 5HYOA 4ACBA 1YY3A 2H9HA 3VPKA 1GBDA 1YPGH 3E0NB 1GI2A 1XXDA 2Z9GA 3DSGA 1MAYA 1GGDC 4A7IB 3QK1A 1FN8A 2AGGX 1BRUP 1AGJA 4XFQA 3LKWA 4ESTE 3PTNA 2QGRA 2QF5A 1S85A 1LVOA 2JETB 3LGWA 4ZKRU 1UVPA 4ZROA 2C93B 1O3NA 1W14U 2GDEH 3UR6A 1K1IA 1GMCG 1TGNA 4KELA 2ZDKA 2KAIB 1EZXC 3UOUA 2ALPA 4Y0ZE 3TJOA 2W6JD 2J94A 2ZPSA 5GWZA 5JBBS 3PWCA 3MO9A 4VGCB 1T31A 2J92A 1QGFA 1G36A 1DXWA 1FQ3A 2ZDMA 1O5AB 3QDZB 4UEHH 1HAHH 3FP6E 4FUDA 4I31A 2XTTB 1COWD 4ZAEA 2NU4E 3RMNH 3O8DA 3GICB 3LGUA 3BTDE 3M7TA 4Y11E 1BBRE 1JBUH 2GT7A 5HGGA 5EPNA 1S5SA 2ZTYA 3A80A 3GDVA 3RUOA 5CMXH 1UK3A 1P57B 1CHGA 4ZH8A 2UUJB 3KCGH 3KQBA 3D62A 2J97A 5T1VA 3W94A 1C4V2 1DLKB 4BTUB 4MNXA 1CO7E 1F5KU 2ZHFH 4I8KA 5E8EH 4B2AA 5FX6A 2WPDD 1ARBA 5E0GA 1TBZH 3LH3A 6GCHF 1ZSJA 2BDGA 1EXFA 2ESTE 2OTVA 4JYTA 1BTWA 1Y3VA 2FTLE 1FY5A 2RDLA 4DGJA 2GCHG 3OSYA 1QY6A 3P70B 1MTUA 1KXAA 1GVZA 2CK3D 1DY8A 1QL8A 1FUJA 5K0HA 4IMQA 1O38A 3SUFA 1LQDB 2ZTXA 1W0ZU 2C3SA 2GMTC 3KEEA 4NGAH 3T2NA 1NRPH 1CT0E 1KXBA 3LGIA 4H42U 1NZQH 1GMHF 1NRQH 4U32A 1THRH 1W8BH 1A61H 4KKDA 1DY9A 1FIZA 1GG6C 2VVUA 1KY9A 2PUXB 1BMLA 1MKWH 2SGAA 4ISOA 1OSSA 1C5OH 1O2XA 1Z7KA 5C94A 5ESBA 1QB6A 1XUGA 4D7FA 2ULLA 1GL1A 4B73A 5JBAS 2QCYA 1GVKB 1TQ0B 5HKKD 1V2UT 2ZHDA 3ATLA 2BLQA 1JMOH 1GJDB 2FOFA 2BOKA 3DSOA 2Z6BD 1CE5A 1L2EA 1DT2A 2ZNKH 5E2OA 3RXFA 3ZZ9A 5C1UA 5L2ZH 4X1QU 2XNIA 5E0HA 5IK2D 2ZO3H 2HVYB 1QBNA 1O2LA 5EPYA 1SLUB 2BDIA 2F43B 3GCOA 2HLDD 2P3UB 1HXEH 3PO1B 1IQLA 2BLOA 1Z6JH 4FETA 4CBNA 1SQRA 2G5NA 2XBVA 3UUZA 3BTTE 2J98B 2CGAA 3IITA 4LZ1H 3K6YA 1C2GA 1THSH 3M5MA 1V2TT 1HAZB 3TH4H 1C2IA 2EA3A 1TMUH 5AHGH 1BT7A 5C5NA 1P0SH 1TPAE 4TY7A 3SNDA 1A5IA 4NSYA 1INCA 1AFQC 2QE7D 1A4WH 1GGDB 1MCTA 1AVXA 1VCWA 1OS8A 1V2ST 2O8TA 2BD5A 2TGTA 2ZU5A 3RC5A 2RG3A 1GI0A 3OY5U 3TH3H 1S0QA 1BRCE 1DWDH 1G3DA 3F2HA 2FODA 5F8TA 4JK5A 4DIHH 2W5EA 2FWWA 3TJUA 4DCDA 2RCEA 2BY5X 1CGJE 1GHAG 2XOKD 3RXJA 1Z6EA 3DUXH 4FVDA 1OP2A 4ISIH 2BTCE 3EA8A 1O37A 4FUBA 2AGIX 4FOUC 1XVOA 1AO5A 1CHOG 2OP9A 2CN0H 2OUAA 5PTPA 1GI3A 4B76A 1O2VA 4MPXA 3SJ8A 2VB0A 4M7GA 3UREA 2Z3CA 2VH6A 2UUFB 1DXPA 3FZZA 5C3NA 1UK2A 1VITH 4MNWA 4I8LA 4ABJA 1RS0A 4JZEH 1BTZA 2F9VA 4K60A 1AMHA 1G30B 5G4BA 5HM2A 3T26A 1XMNB 1NBME 3VB7A 3KQCA 1LHDH 3QZRA 1A0JA 1LTOA 1Y59T 1S83A 3BTME 4HI3A 1PPEE 1OWDA 1P03A 2BVXH 5E0JA 1C5PA 3TJNA 2DE8A 4DG4A 3FVFB 1TQ7B 3PV2A 4RT1A 2BQ6B 3SQHE 1C1UH 5F6MA 1BTXA 1RD3B 2H9TH 2BX3A 3GCTF 1O2MA 3BEUA 4DVAU 4TWYA 1ELBA 1MKWK 1NFWA 3ATWA 5J4QA 4IMZA 2VIDA 4D9RA 1FAXA 1O3LA 2F83A 2XWAA 4YM9A 1PQAA 2BZAA 1QA0A 3JZ2B 2BD4A 1P2QA 1ZTJA 5FCRA 1W3CA 3A7TA 3CS7A 1T4VH 1YPHC 1XKAC 3PMJA 1OP8A 3I78A 4DY7B 1PFXC 4WH8A 1IQEA 1BITA 1BTYA 1GG6B 2Z9IA 1QB1A 1LDTT 1O3AA 1UTQA 4A1XA 2EY4C 2FYRA 1DWEH 2W6ID 1ELCA 3QGNB 2FX4A 1O2IA 3RDZA 4BNRA 3H7TA 1GI5A 2Z9KA 1CQQA 2B9LA 1TRNA 4D9QA 3KYGA 3RMMH 3BG4C 3G01A 4AG1A 3KQ5A 2FDAA 2WHXA 1ZR0A 1TOMH 3SU2A 3I29A 3UQOA 1LVMA 4YLUA 2ZGXH 1GJ8B 3BSQA 1IQMA 2KCOA 4CBOA 3KQDA 3ZVCA 4RKOB 2YMSB 2AEIH 2VVCA 1AU8A 2R2WU 3SHAH 1PPBH 2ZGCA 5A0BA 1ZLRA 2VU8E 3ZZ4A 1F5RA 1JWTA 2WYJA 2FPZA 1GJ4H 5CHAC 3DA9B 2RFKC 1AVGH 3PMBB 1HUTH 1IOEA 5EW1H 3S69A 3ZIAD 5DN6D 1KLIH 3MNSA 2AIPA 1ANCA 3IWMA 3M37A 3SBKA 2J95A 5DP7A 1O2PA 3PB1E 4I8GA 3O8BA 1A5HA 3VB3A 1TE0A 4HFPB 2OK5A 3U9AH 2AMPA 1AFQB 2BVRH 3PV4A 3CNRA 1F0SA 6ESTA 4AFUA 1D6RA 4RN6A 2QN5T 3MU4A 1E37B 2R9PA 1JRTA 5IDKA 1GBMA 1C1TA 2WV4A 2F91A 3S9AA 1C1NA 2GKVE 2KCAA 1GHWH 2A32A 2HVXA 4NFFA 1BTUA 1Y5UT 1TPSA 3SUGA 4CRDA 1A0HB 2FI3E 5JPMH 2XYAA 5H4IB 1P2OA 3RC4A 2Y80A 3GDSA 2NU1E 1E1RD 2Y81A 1WTGH 3SJKA 3QZQA 3A7YA 1UTMA 1OP0A 5EXLA 2GTBA 1C5YB 4UFFH 2GT8A 3UTUH 2H5CA 1GPZA 3M3VA 2WUBA 4TPIZ 2WZQA 1O2YA 1P8VC 1TFXA 4CRFA 2ZECA 8GCHG 4AFSA 1IAUA 1OWIA 1RTLA 2G52A 3UB0A 3PYHA 4AN7A 5JB9S 1ANEA 1QRXA 3OE7D 3K9XB 3PWBA 4IC6A 4X8TH 4A6LA 1MTNB 2A4RA 4Q2KA 6CHAC 4BAMB 4BOHA 5KECA 2V35A 1UCYH 3VXEH 2G81E 1C1RA 2BD2A 1F92A 1HAGE 1GJCB 1B7XB 4DT7B 5DJ7A 3MH4A 1JIRA 3V12A 1GBLA 2BZ6H 1H9IE 2VIWA 1V2PT 2BD8A 3SNEA 4K1SA 2CHAC 2UWOA 1O3DA 1V2VT 1TMBH 1E1QD 2Q6DA 2FS8A 5FPTA 3F2FA 1HYLA 4ABIA 4AYYB 4XBBA 3E6PH 1NROH 1T8LA 2LP6A 3SJ9A 1V2JT 4SGAE 1MQ6A 1B0FA 1P02A 1SGFG 3W1EA 3LU9B 1Z1JA 3RU4E 1FIWA 3ATMA 3RLWH 3SI4H 1HAOH 2OBOA 1JIMA 1HJ8A 1UTNA 2KR7A 4RSPA 5FBEA 5F03A 3GCNA 1EP5A 1VCQA 1PPZA 3OU0A 1GL0E 1Z8RA 4BANB 1GWAA 3EE0B 3FFGA 1C2HA 4U30A 3SW2B 3BG4B 3P17H 1KDQB 1HNEE 4PROA 3ESTA 1YM0A 2KAIA 5DPAA 1TNLA 2UWPA 2BDYA 2V7QD 3U1JB 2KCYA 2VIPA 4ABEA 1H8IH 3Q3XA 2TRMA 3A8AA 3PM3A 3ITIA 1L4ZA 1GHBF 2BD3A 2QF3A 3BIVH 2HNTF 3O8CA 3N7EA 3I77A 3UWJH 1J14A 2ILNA 3LC3A 2XBXA 1AB9C 3PRDA 3ZZBA 2ALVA 3SU4A 4H6TA 1PJPA 2XW9A 4GSOA 5HM9A 1K1JA 4AFZA 5AF9H 2VIOA 3A84A 3Q77A 1ZHMA 1NRNH 1O2WA 3R0FA 1PYTC 3QTVH 3P95A 4YT7H 5LPEA 1BIOA 4X8UH 4UE7H 1CA0B 4FU9A 1G3BA 1FLEE 2HLCA 2OC1A 1FJSA 2GJGA 1ZSLA 1ETSH 1VITF 2P59A 1TPOA 2KX4A 1B0EA 8ESTE 3MH5A 2G51A 3B23B 2BY8X 1SFIA 3AW0A 1N8OC 3UAIC 2AGEX 2KCPA 2BY7X 3ATIA 4P02A 2A1DB 4WXVA 3A85A 3VB4A 1OWJA 1O35A 1YPEH 1P06A 2Y5GA 1DS2E 3D23A 1N6XA 3DFLA 3SN8A 4JYVH 3VGCC 1D9IA 2F9OA 4Y8ZA 1SHHB 1UCYK 5AVDA 1LPKB 1SGYE 3SJIA 1TIOA 2PHBA 1BMNH 1A46H 2VIQA 3MHWU 3RXUA 3SNBA 3A89A 2JIZD 1XUHA 2VWNA 1G32B 1E0FD 3GY6A 1E35B 5DP3A 3QX5H 4LK4A 1HJ9A 1BBRH 2C8ZB 4IGDA 1C5QA 1C5WB 2WV5A 3BF6H 4HZHA 5C5OA 2FS9A 4O3TA 1GJ9B 3SV8A 2PWXA 3LGVA 5T6FA 1LQEA 1C2MA 3QTOH 3D49H 2SGPE 3NKKA 4Y71A 4DW2U 1GBTA 1CA8B 2O8MA 2J2UA 2JH0D 2VWOA 4X2XA 2O8WA 1YLDA 1BMFD 1CBWC 2CHAB 1O5FH 2ZFRH 4J1YA 1SL3A 2A45B 1O5GH 1W0KD 1HAVA 2ZGJA 4CHAB 1T7CA 1O31A 1P10A 1YP9A 4FUEA 1TAWA 5C0UA 2FESH 2J98A 3A7ZA 2ZU3A 2ZG0H 2TIOA 2V3MA 1FMGA 2EI8A 1SBWA 1EAWA 1DDJA 2VGCC 4K69A 1C4U2 5T3HA 3SHCH 2A4GA 2QXJA 2ZDNA 3Q3YA 1EKBB 1OKXA 1O2QA 1FN6A 1O3IA 4A1VA 1ZRBA 3N7DA 4XD7D 4AGKA 4LXBH 3A83A 3MU8A 2LPRA 2QXHA 3IG6B 3ZV8A 4BAKB 1EUFA 1TWXB 2JH6D 5FCKA 1EFRD 1P3EA 1CT2E 3C27B 3T27A 2FI5E 4CH2B 1O30A 2ZKSA 2IOTA 3ODFA 3KGPA 3V3MA 2Z3EA 3MNCA 3MO6A 3SZEA 2PP6A 5EOKA 1C9TA 4X1PU 2R3YA 2K8IA 1Y3YA 2GV6A 1TBQH 4NWKA 3A82A 2ZTZA 4Q7YA 4WMDA 1V2RT 4ZKSU 1AB9B 3ATKA 2F9UA 1H8ED 4K2YA 3UFAA 1RRKA 1H9LB 3RXMA 3TNSA 2NU2E 3LJJA 2QAAA 1K28D 1Z8IB 1TGTA 3S0NA 1LMWB 4WXIA 3S9BA 2PW8H 2FYQA 3QN7A 1HJAC 2UUYA 2PKAA 4Q7ZA 1ZPBA 5GDSH 4YOIA 1C5NH 2CV3A 3GCHC 2RDEA 5JDUB 1ELEE 1NFUA 8KME2 4Z0KA 3SGBE 5EQQA 3TK6A 1N8OB 2XRCA 1ZJKA 1BBRK 2BB4A 1OWHA 2DUCA 1NESE 3F9EA 1GI4A 1ELDE 4H6SB 5A8YA 2ZWLH 2FEQH 1SOTA 2BDBA 4MTBA 3VGCB 2EEKA 1K1LA 4GCHF 2ZFQH 1P2JA 1HFDA 4Q80A 1EB2A 3ZVDA 1SOZA 5A0AE 1IQGA 1YCPK 1TPPA 1O3MA 1GDQA 5B6LA 6GCHG 1O2ZA 1QJ7B 1QBOA 4JZ1A 3ZZ3A 2L74A 1D3TB 1TX6A 5C17A 5IYTA 1GDUA 3BTWE 1DUEA 1YPJH 2CMYA 2HGTH 2NU3E 3LJOA 1DE7H 3BTEE 1GBFA 3FZDA 1YBWA 3ELAH 3SV7A 3SUEA 4X1SU 4CRBA 2ZDLA 3BTGE 3EYDA 3RU4T 1O5BB 1DWCH 1GMHG 4B6FA 1C1OA 1FX0B 3LOXA 5T6DA 3A8BA 2SGDE 3ZV9A 1DWBH 3AAUA 3C1KA 1GI8B 5KGOA 1L4DA 3NWUA 4FUJA 1BTPA 4THNH 3M5OA 3SQEE 4NZLA 1MUEB 3SV2H 2YNBA 1ZOMA 3M35A 1G2MA 1HAPH 2P16A 1BRAA 4MVNA 1AHTH 5DO4H 4FUHA 1LVYA 1ZHRA 1P12E 1HBTH 1SR5C 3TIUA 1GI7B 1HAVB 1MZDA 4F48B 1TGSZ 2PV9B 3GYLB 1TNHA 1EZSC 2VGCB 1TNJA 3OY6U 3KYFA 3V7TA 4I32A 1XKBC 3HPTB 3WY8A 5LGOA 2GD4B 4ZHAA 3EE7A 3GY2A 2BLVA 4TWWA 2JKHA 1DSUA 1IQFA 5J4SA 3KL6A 3OX7U 3EGKH 1J16A 1RTFB 4U2WA 5FBIA 3L6PA 3FP8E 3H09A 1QTFA 3A8DA 2A0QB 5HIZA 1A3BH 1GMDF 2W7UA 4YESB 2QIQA 4XRNA 1GHYH 1K1PA 5JBCS 3RM2H 1W7XH 1RJXB 1YCPM 3NK8A 4FUCA 2WSSD 1FONA 1C2JA 1AVWA 4GHQA 4Q4LA 2FZZA 2BY9X 2WPIS 1ABIH 2B8OH 4Y7AA 3TK5A 1D6WA 4JZFH 1GJAB 2G00A 1FY1A 1UVSH 2SFAA 3RXVA 4MPWA 1FXYA 3ZZCA 5I25A 3DFJA 2OC8A 1J15A 4B6EA 2OC0A 5F53A 1BTHH 2Z9LA 1ZJDA 2WPJS 4FU7A 1BMMH 1G37A 1YPLH 3U28C 4A5TS 4K5ZA 1C5ZB 5BPEA 3SUDA 2I6SA 4YT6H 5EQRA 1WTHD 4OGXA 2ANYA 5KEDA 1CGIE 5EJ1A 1EOLA 3GISB 5CDFE 3Q00A 3ZVAA 1HJAB 3F2GA 2FX6A 1OXGA 2STBE 3WWFA 2ZGBH 3STIA 1SC8U 1PYTD 3GCHB 2ANWA 4OS6A 2QF0A 2PKAB 1EPTC 1FY3A 1NRRH 3TITA 5EGMA 3OFND 5TCAA 3RXQA 1O3JA 3GY4A 3OAAD 3URDA 2Y7ZA 1BCUH 2GX4A 1UVUH 1PQ5A 2BQWB 3LC5A 1SGRE 1AUTC 1EJMA 2SNWA 3DHKH 1OPHB 2GMTB 4TSFD 1NBMD 2YNAA 5EJLA 1YPKH 1SLXB 1DOJA 4E05H 5C20A 4ZKNU 3E3TA 1S0RA 4SGBE 4UFGH 4B75A 3GCTG 2HALA 2OXSA 2R3UA 3A88A 1K2I1 5GCHG 3RXOA 4F4OC 1P2IA 3RXDA 1V2WT 5DG6A 5FPSA 1KDQA 3A87A 4DT4A 1SQAA 4BTTB 1ZZZA 4FUGA 1BUIA 2TGPZ 1NFYA 1UTKA 1HGTH 4NG9H 1AD8H 4YZUA 1HDTH 2JDID 2THFB 1K1MA 1HRTH 1N6YA 3F0PA 3QUMP 4MQAA 1H8HD 1O0DH 4WH6A 7ESTE 2C8XB 4A1TA 1AE8H 1FZZA 2HNTE 1EQ9A 2ODPA 2AERH 1ZGVA 3S9CA 3T29A 4X8VH 1TA6A 1PPCE 2D2DA 3MFJA 2BX4A 3ZYDA 4B71A 1T8OA 1WXRA 3FANA 4FVBA 4INHA 2QC2A 4ZCNA 3RXSA 3M7UA 3F68H 3DSPA 1A2CH 1GI9B 1QJ1B 1SGPE 2JJ1D 3SGAE 2ZCLP 2BVSH 4HTCH 4AB8A 4ZKOU 3DT0H 5A8XA 1QHRB 1ZRKA 1P05A 3U8OH 2OCVB 3MU1A 1IQHA 1BJVA 2GZ9A 3CP7A 1NM6A 4MPUA 1MBQA 3MNXA 2B0FA 5EW2H 1D3QB 4D76A 1D3PB 3WW7A 1KIGH 3AW1A 5HIYA 2OBQA 2Z3DA 2PGBB 1WAYB 4ASUD 1O3OA 1GI1A 3GOVB 4WF8A 2GCTC 4ZXYH 1W7GH 2GDDA 4NIXA 2ZPQA 1MAXA 2PTNA 2QF4A 2ZU1A 4BXSA 5BRRE 2WPHS 4DJZB 4Z6AH 1QL9A 1JXPA 1SMFE 7GCHG 4RT0A 1VGCC 4DOQA 1JOUB 1O3GA 1CGHA 4OM9A 2UUKB 2BXTH 1K21H 2K1QA 1SGIB 1Y3WA 4CREA 2A7JA 3UNQA 5DK1A 1C1MA 3RXTA 5LPFA 8GCHF 2F9NA 1SLVB 2CXVA 1RTKA 3SZNA 3UY9A 3ZZ5A 3BEIB 3RXAA 2GP9B 3RXHA 4DURA 1Y5AT 1DICA 1RIWC 2P94A 3UNRA 1YKTA 2OD3B 1QNJA 2ZQ1A 3BEFB 3Q76A 1AN1E 2AH4X 4GPGA 3F6UH 2VWLA 1AI8H 1GBAA 4WY3A 1S81A 1EPTB 2FIRH 1SPJA 1D4PB 5CHBA 1AY6H 1ARCA 2FP7B 4O97A 1P04A 2O8LA 1DX5M 3ZYEA 4ZXXH 1GBJA 1C1SA 2ZA5A 1MD8A 2OINA 1TA2A 2UWLA 1H9HE 2FOEA 3GY5A 2FOGA 1O2UA 2Y5FA 4I7YH 1FPHH 4OS2A 1EAXA 4BAHB 3ODDA 2ZCHP 2P93A 2A7HA 1UJ1A 5DGJA 3EA9A 1ANDA 1FPCH 4XBCA 5AFYH 3KN2A 2BDAA 4GUXA 2FTMA 1GDNA 1B5GH 1GBBA 1ELAA 2SGEE 3LIWA 1M9UA 1MKXH 1C2DA 3H5CB 1NC6A 2D8WA 1OWKA 2IJOB 1YLCA 2XC5A 2EI7A 2PGQB 2XC4A 5FL7D 1EZUC 1G9IE 5A0CA 2OQUA 3SU3A 3MWIU 4Q7XA 3SU5A 3UIRA 7KMEH 2FLBH 3K65B 1P11E 1E36B 2ZP0H 1KMHB 1RFNA 4J2YB 1C2KA 2PR3A 4NSVA 5T6GA 4DIIH 1SKYE 2ZFTA 3RU4D 2PSYA 3SNAA 2BD9A 2CJIA 1ESBA 1V2MT 1MD7A 4X8SH 1ESAA 4AOQA 1PPFE 2JETC 1O3EA 1GHXH 5EU8A 1A3EH 1T8NA 1GJBB 1HLTH 5CHAB 4LZ4B 1TGCA 1QJ6B 1UHBA 1DVAH 1TX7A 2Z9JA 1QBVH 1FV9A 3A81A 3FO8D 3RXGA 1L1GA 1UTPA 2VH0A 3FAOA 1GCTC 1DUAA 1AKSA 1GJ5H 1GHBG 5FXLA 1V2KT 1O3PB 1SGNE 1LVBA 2Q6GA 5L6NH 1A7SA 4O3UA 4E7NA 2BY6X 1C5TA 3MTYA 1SGQE 3RC6A 3NRLA 3N7OA 5C2ZA 3OYPA 3FOAA 1J8AA 1IQNA 3L33A 3SU6A 1EATA 2BDCA 4AX9H 5DP4A 3TJVA 1SGFA 2HOBA 4NZQA 4JZIA 3ZZDA 1NY22 1YLNA 3RXCA 5EQSA 4NA7A 3V0XA 1VGCB 4K8YA 3UWIA 2KM0A 3TH2H 2QA9E 1DFPA 2XXLA 5L2YH 2P3TB 3ZZ8A 1K9OE 1V3XA 1XX9A 1SLWB 5A8ZA 4CRCA 1QIXB 1O2RA 1Q2WA 1EASA 3RXPA 4FU8A 4TYDA 2PTCE 1H4WA 1TYNA 2R0KA 2XCFA 2GGVB 4MNVA 3NPSA 4NWLA 4ZUHA 1TLDA 1E79D 1BB0B 1CVWH 6CHAB 3EAJA 2OC7A 2QXGA 3M61U 4K8BA 1O5CB 5C1XA 2J5UA 1SHYA 4NA9H 5GJ4B 1GBIA 1Z1IA 2A2QH 1WSSH 1ZMJA 3LPRA 4H4FA 1OHHD 3F9HA 4CR9A 1KSNA 1WV7H 4KP0A 1T8MA 2Q1JA 4X6MA 4INKA 4WVPE 3H7OA 1S6HA 1MH0A 4WMFA 1O2HA 4X0WU 5EODA 1FDPA 3LT3A 5JYIA 1YPMH 4D7GA 4Z1MD 1AZZA 2HNTC 3A7VA 1ZHPA 1ZYOA 3Q3KA 4A92A 1BJUA 3MQKC 2F9BH 3UNSA 5GXPA 1C1VH 4F55A 2KFWA 1W10U 5HXFA 3TK9A 1N1LA 1F5LA 1AQ7A 4GAWA 1AWFH 5HMAA 4U01A 3PO1C 1TB6H 1ZPCA 1UTLM 1G3EA 3E16B 4ABGA 1TMTH 1TBRH 4AG2A 5C67A 1O2SA 1DM4B 1YF4A 2BXUH 3MNBA 4BAQB 1EZQA 4XOJA 1EJAA 3NCLA 2ZHWH 1PQ7A 3DD2H 2AYWA 1GMCF 3F3BA 5JB8S 3RXRA 2SGQE 3T62A 3E1XB 3ZVBA 2A5IA 3OEED 1P2KA 2R2MB 4OS1A 5F8XA 3RMOH 3GY8A 1KYNA 1SVPA 4ASHA 9LPRA 3SO3A 3SORA 1KTSB 1WCZA 3MYWA 4R0IA 2KZ4A 2A4OA 3KF2A 1ESTA 1V2OT 2AIQA 1C5MD 1QA7A 3MH6A 3NUMA 2RA3A 3TNTA 9ESTA 2ODQA 1Z71A 1NO9H 3SOSA 3ZVEA 1TOCB 3QLPH 4MLFB 4WJG2 2BD7A 1GCTB 1UHBB 5GNDA 2OQ5A 1XUKA 3A7XA 3PMHB 2GZ8A 1L1JA 4X6OA 1AKSB 2A5KA 1WUNH 2ZPRA 1WBGB 2V6NA 3HK6B 2TGAA 2G4TA 1KLJH 2VVVA 1KXCA 1O2KA 1EOJA 3HGPA 3SGQE 2STAE 1JRSA 2Y5HA 2M2AA 4B74A 5FPYA 1F0RA 3VG8A 1P9UA 4AFQA 4JZDH 2J4IA 2GCHF 1O33A 1RGQA 2H2ZA 1MZAA 2ZDAH 1VKYA 1EP6A 1SGDE 2A4QA 1AWHB 4Y10E 1LCYA 2C8WB 1ORFA 1P3CA 2CF9H 2ZC9H 1S6LA 4WMEA 3ZVGA 5A09A 5FHTA 3P92A 1QR3E 4CRAA 1GHZA 2W3IA 3D65E 3VEQB 3HK3B 1O36A 2VBCA 3M3SA 1O3FA 4X6NA 3P8GA 4CH8B 3F9FA 2FOAA 3O8RA 3TGKE 1VZQH 4XBDA 3SV6A 4OS7A 1OWEA 4IS5A 5EXMA 4Y8YA 5ESTE 2J34A 1GBCA 2LNCA 4GCHG 2XWBI 3U8RH 1LO6A 2ZFFH 2P3FH 5AFZH 4JCNA 5FAHA 5GPIB 5FX5A 3RM0H 4YLQH 1Q31A 1BHXB 2VNTA 3GYMA 1UO6A 1ANBA 1F0TA 3BTFE 4KTUA 4UDWH 1Y8TA 2FM2A 1CBWB 2J9NA 3PLBA 3PTBA 2L6OA 1G2LA 3RXIA 3SYJA 3ZZ7A 2XBWA 2AS9A 3RXEA 1BQYA 3LGTA 1XUIA 1S84A 4FUFA 3AASA 4FXGH 1BA8B 3M3TA 1W2KH 2G4UA 4P00A 4ZHMU 2ZHEH 1QL7A 1E34B 3BTKE 5A2MH 1PPHE 1GJ7B 1CT4E 4QT8C 5C1YA 5B6OA 1TRMA 2YMSC 4NIYA 3TGJE 1MMJN 1XUFA 4ISNA 2AMDA 4AGJA 2WV9A 1GBHA 2FI4E 3BTHE 1CU1A 2A5AA 2H1UA 1IHTH 4RKJB 3KQEA 2PLXA 1YYY1 2FLRH 2FMJA 1F7ZA 1T32A 2IN2A 1GVLA 1HCGA 1UMAH 4ISLA 3VXFH 2CF8H 2WUCA 2BM2A 2V3OH 3GDUA 1GHAF 4ACAA 1QRZA 2QV1A 2NWNA 3M5LA 1O2JA 2H5DA 4KTCA 5GIBA 2HWLB 1O2TA 2O9QA 1CHOF 1FY8E 4B2CA 3F1SB 2VIVA 1KXDA 4GLYA 1A0LA 1XXFA 1P2MA 3EQ0H 5DP5A 1EJNA 4WWYA 3KHVA 3PV5A 2D1JA 4XDEA 1GBEA 3S7KB 1UVOA 1GMDG 1AZ8A 3B9FH 1GCDA 4AB9A 1YC0A 1SB1H 3HKJB 2WPKS 3T25A 2J38A 3BV9B 4YXWD 4NCYA 1XVMA 4UFDH 3TU7H 1MTVA 1O3KA 2IJD1 1O5EH 3BTQE 3N99A 3V13A 1O34A 2ZGHA 2G5VA 1ZTKA 1NRSH 3QO6A 1NU7B 2ZQ2A 1EPTA 4Y8XA 3RLYH 2G8TA 1LKBA 3MU5A 3FP7E 4LOYH 1ELGA 3FN8A 5ABWA 5EIYA 1O2NA 2ZHQH 3OTPA 1W0YH 2VWMA 1D3DB 4TPYA 1WDIA 2GV7A 3E90B 1LPGB 1MTNC 1P2NA 1C5VA 2ZI2H 4B2BA 2FOCA 1T4UH 4OS5A 1ZTLA 3STJA 2OLGA 3KIDU 1VR1H 1UK4A 1Y5BT 2B7DH 1NN6A 1OYQA 3E0PB 1NT1A 3GS9A 1NFXA 3ENSB 3PMAB 1AUJA 3SNCA 3E91A 3QWCH 3PRBA 1LHEH 1H8DH 4OGYA 1UVTH 1SGEE 2WINI 4ZHLU 5GCHF 1HPGA 2BMGB 4YOJA 3HATH 5DP8A 3WWBA 1K22H 5DP6A 2F9PA 3R3GB 1C5SA 1O3HA 4IBLH 1ELTA 1ZGIA 4X2YA 2PKSC 1ACBE 1O2GH 4YOGA 1ZPZA 3JZ1B 3OTJE 4AZ2B 2V0BA 1WOFA 3EDXB 1HB0B 3U69H 1SFQB 3ZVFA 1XUJA 3A8CA 3HKIB 1Y3XA 4NA8A 1C9PA 1V2QT 4YTAA 2IPHA 1HV7A 3URCA 4Y79A 2GZ7A 1UW7A 2NU0E 2JH5D 2Y7XA 1P09A 2BLWA 2JJ2D 2O8UA 1UTJA 1GBKA 1HAIH 1O3CA 1HIAA 5EG4A 2G55A 4BAOB 1EB1H 1NTPA 1ZMNA 2M5TA 1C1QA 2ZFPH 2BYAX 4K1EA 4JMYA 2HPPH 1GJ6A 1SQTA 1TRYA 1QZ8A 5JBTA 3PLKA 1XM1A 4I8JA 4E06H 2ZEBA 1MU8B 2SNVA 3LONA 4K1TA 5C0TA 4AYVB 2QYIA 3P6ZB 4Y0YE 3BIUH 1L0ZA 1ELFA 1NS3A 5LH8A 1MU6B 1EAUA 2EQNA 2XCNA 1W12U 2PUQH 4ISHH 1O2OA 4KTSA 3SU1A 1ZMLA 1K1NA 3TLOA 4GHTA 4BXWA 1SG8B 1V2NT 4X6PA 3ZZAA 1CA0C 1YWUA 7GCHF 1FAKH 4F49A 3GY7A 5SGAE 4MG3A 4X1RU 1QQ4A 1KLTA 4GVUA 2SGFE 1L1NA 3EA7A 1ETTH 5LPRA 2FO9A 1LPZB 1BOQA 1P9SA 4IN2A 4HG6A 4AC9A 4ZMAH 1PQ8A 1VJ9U 2K0QA 3QGJA 4X1NU 1AFEH 1WU1A 2V3HH 4MPVA 1DPOA 3GY3A 1E38B 1V2LT 2QXIA 2ZU4A 2ODYB 5DP9A 2XNDD 4INLA 3HGNA 4Y76A 2VJ1A 4TY6A 1TNIA 1X7AC 2PFEA 1WQVH 2RA0A 3U98H 4ABHA 3UOPA 1F2SE 4M9FA 2YOLA 3MOCA 2WYGA 2W26A 1C5LH 2P8OC 4O9VA 2Z94A 1W11U 1UTOA 4I33A 2Y6TA 3SI3H 1CSOE 4TT3D 1QURH 1C1PA 6LPRA 1S6FA 1C5RA 2IPQX 3M36A 4YO9A 1AIXH 1EAIA 1ELVA 1SGTA 1W0JD 3SJOA 1J9CH 5EJZA 4Y7BA 2ZCKP 2FOHA 1DLEA 4NFEA 4NIWA 1ZSKA 3E8LA 1F0UA 3BN9A 1TONA 3LGYA 2FOMB 5EXNA 2I6QA 4CRGA 1TGBA 4ABDA 3M7QA 3T28A 2Y82A 5F8ZA 2F3CE 1C1WH 3RMLH 1Y3UA 4CHAC 2BQ7B 2ZF0H 5ETXA 4XE4A 2ZIQH 4R8TB 1ID5H 2ASUB 3VB6A 1H1BA 4O03A 2PKSB 1O3BA 1IQKA 3LH1A 2GVFA 4ABBA 3P8NA 2B5TB 1C5XB 2TGDA 3U8TH 1IQJA 1J17T 1WYKA 5CE1A 4JYUH 3SV9A 3KNXA 4HGCA 1G3CA 2P95A 1C4Y2 2F4LA 4UFEH 1GI6A 5TCCA 1BHXF 2ZZUH 3RXBA 1LKAA 1LHCH 2C4FH 1TALA 3K2UA 3NZIA 1QB9A 3VFEA 3ZZ6A 1QQUA 2ZDVH 4Q63A 2R0LA 4I8HA 3TPIZ 1KXEA 5E2PA 1DANH 3K6ZA 4B1TA 4X2VA 1C2FA 4IC5A 3CENA 3UQVA 1HXFH 1SGCA 3AVZA 3CS0A 3P8FA 2XBYA 4KGAA 3A86A 1C2EA 1Q3XA 5DSFA 4BTIB 1MQ5A 1BRBE 1FNIA 1HIAB 3VB5A 4VGCC 1FI8A 1BZXE 2C90B 2EC9H 4OS4A 2PSXA 4ABAA 3UPEA 4NIVA 1SSXA 1QRWA 3P8OA 2BHGA 4I86A 7LPRA 1ETRH 1RXPA 1ABJH 2AHME 1V6DA 2XC0A 2WPLS 1DSTA 4UD9H 3S7HB 1W13U 2YMSD 1C5UA 1HAYB 1MBMA 2BOHB 1IHSH 1QCPA 3B8JA 2GCTB 3TGIE 2AFQB 3RXKA 1UCYE 1KXFA 2QY0B 3NXPA 1YGCH 3U1IB 3F9GA 5K7RA 1EX3A 1NU9A 4JK6A 1MABB 1Z8GA 1VITG 1HAXB 1Z8JB 1TNGA 1O32A 1OX1A 3PROA 1TABE 4K3JA 1O39A 4X2WA 1K0HA 2A31A 4Y6DA 1DITH 1TNKA 4MNYA 3AAVA 1SI5H 3F0OA 8LPRA 3MMGA 4IN1A 3OEHD 3RXLA 2WPMS 2H6MA 3L3TA 3W95A 1MCVA 1RIWB 3TVJB 1A5GH 2ANKH 2HRVA 2C8YB 1P01A 1MTSA 3DCLA 1TX8A 1VJAU 5TJXA 1QFKH 3M5NA 2AMQA 1S82A 3LDXH 4ABFA 2A7CA 1OOKB
chains in the Genus database with same CATH topology
2BDHA 2P8OB 1WQSA 2TPIZ 1A1RA 1LHFH 1BDAA 1MKXK 2D26C 2FOBA 2A2XH 4AORA 1NPMA 2W7SA 2H9EH 3MU0A 1FY4A 2EI6A 3RP2A 3MO3A 5I46H 4IW4E 1YCPH 4XSKU 2TBSA 3SU0A 4UONA 3PLPA 1VCPA 4CR5A 2W3KA 1YPHE 4FUIA 2ZFSA 4MDSA 2FXRA 1OYTH 3MI4A 3UR9A 1GHVH 1IQIA 1U6QA 1PPGE 1O5DH 3A7WA 2Z7FE 1AE5A 1K1OA 3BG8A 3T5FH 2HPQH 1KTTB 1LHGH 1MTWA 5L30H 1SQOA 1BMAA 2ANMH 2Q6FA 4E7RG 3MH7A 1THPB 4D8NA 2DE9A 2ZU2A 5DKMA 2VINA 1C2LA 5HYOA 2H9HA 3VPKA 1GBDA 1YPGH 3E0NB 1GI2A 1XXDA 2Z9GA 1MAYA 1GGDC 4A7IB 3QK1A 1FN8A 2AGGX 1BRUP 1AGJA 4XFQA 3LKWA 4ESTE 3PTNA 2QGRA 1S85A 1LVOA 2JETB 3LGWA 4ZKRU 1UVPA 4ZROA 2C93B 1O3NA 1W14U 2GDEH 3UR6A 1K1IA 1GMCG 1TGNA 4KELA 2ZDKA 2KAIB 1EZXC 3UOUA 2ALPA 4Y0ZE 3TJOA 2J94A 2ZPSA 5GWZA 5JBBS 3PWCA 3MO9A 4VGCB 1T31A 2J92A 1QGFA 1G36A 1DXWA 1FQ3A 2ZDMA 1O5AB 3QDZB 4UEHH 1HAHH 3FP6E 4FUDA 4I31A 2XTTB 4ZAEA 2NU4E 3RMNH 3O8DA 3GICB 3LGUA 3BTDE 3M7TA 4Y11E 1BBRE 1JBUH 2GT7A 5HGGA 5EPNA 1S5SA 2ZTYA 3A80A 3GDVA 3RUOA 5CMXH 1UK3A 1P57B 1CHGA 4ZH8A 2UUJB 3KCGH 3KQBA 3D62A 3W94A 1C4V2 1DLKB 4BTUB 4MNXA 1CO7E 1F5KU 2ZHFH 4I8KA 5E8EH 4B2AA 5FX6A 1ARBA 5E0GA 1TBZH 3LH3A 6GCHF 1ZSJA 2BDGA 1EXFA 2ESTE 2OTVA 4JYTA 1BTWA 1Y3VA 2FTLE 1FY5A 2RDLA 4DGJA 2GCHG 3OSYA 1QY6A 3P70B 1MTUA 1KXAA 1GVZA 1DY8A 1QL8A 1FUJA 5K0HA 4IMQA 1O38A 3SUFA 1LQDB 2ZTXA 1W0ZU 2C3SA 2GMTC 3KEEA 4NGAH 3T2NA 1NRPH 1CT0E 1KXBA 3LGIA 4H42U 1NZQH 1GMHF 1NRQH 4U32A 1THRH 1W8BH 1A61H 4KKDA 1DY9A 1FIZA 1GG6C 2VVUA 1KY9A 2PUXB 1BMLA 1MKWH 2SGAA 4ISOA 1OSSA 1C5OH 1O2XA 1Z7KA 5ESBA 1QB6A 1XUGA 4D7FA 2ULLA 1GL1A 4B73A 5JBAS 2QCYA 1GVKB 1TQ0B 1V2UT 2ZHDA 3ATLA 2BLQA 1JMOH 1GJDB 2FOFA 2BOKA 2Z6BD 1CE5A 1L2EA 1DT2A 2ZNKH 5E2OA 3RXFA 3ZZ9A 5C1UA 5L2ZH 4X1QU 2XNIA 5E0HA 2ZO3H 1QBNA 1O2LA 5EPYA 1SLUB 2BDIA 3GCOA 2P3UB 1HXEH 3PO1B 1IQLA 2BLOA 1Z6JH 4CBNA 2G5NA 2XBVA 3UUZA 3BTTE 2CGAA 3IITA 4LZ1H 3K6YA 1C2GA 1THSH 3M5MA 1V2TT 1HAZB 3TH4H 1C2IA 2EA3A 1TMUH 5AHGH 1BT7A 5C5NA 1P0SH 1TPAE 4TY7A 3SNDA 1A5IA 4NSYA 1INCA 1AFQC 1A4WH 1GGDB 1MCTA 1AVXA 1VCWA 1OS8A 1V2ST 2O8TA 2BD5A 2TGTA 2ZU5A 3RC5A 2RG3A 1GI0A 3OY5U 3TH3H 1S0QA 1BRCE 1DWDH 1G3DA 2FODA 5F8TA 4JK5A 4DIHH 2W5EA 2FWWA 3TJUA 4DCDA 2RCEA 2BY5X 1CGJE 1GHAG 3RXJA 1Z6EA 3DUXH 4FVDA 1OP2A 4ISIH 2BTCE 3EA8A 1O37A 4FUBA 2AGIX 1XVOA 1AO5A 1CHOG 2OP9A 2CN0H 2OUAA 5PTPA 1GI3A 4B76A 1O2VA 4MPXA 3SJ8A 2VB0A 4M7GA 3UREA 2Z3CA 2VH6A 2UUFB 1DXPA 3FZZA 5C3NA 1UK2A 1VITH 4MNWA 4I8LA 4ABJA 1RS0A 4JZEH 1BTZA 2F9VA 4K60A 1AMHA 1G30B 5G4BA 5HM2A 3T26A 1XMNB 3VB7A 3KQCA 1LHDH 3QZRA 1A0JA 1LTOA 1Y59T 1S83A 3BTME 4HI3A 1PPEE 1OWDA 1P03A 2BVXH 5E0JA 1C5PA 3TJNA 2DE8A 4DG4A 3FVFB 1TQ7B 3SQHE 2BQ6B 1C1UH 5F6MA 1BTXA 1RD3B 2H9TH 2BX3A 3GCTF 1O2MA 3BEUA 4DVAU 4TWYA 1ELBA 1MKWK 1NFWA 3ATWA 5J4QA 4IMZA 2VIDA 4D9RA 1FAXA 1O3LA 2F83A 2XWAA 4YM9A 1PQAA 2BZAA 1QA0A 3JZ2B 2BD4A 1P2QA 1ZTJA 5FCRA 1W3CA 3A7TA 3CS7A 1T4VH 1YPHC 1XKAC 3PMJA 1OP8A 3I78A 4DY7B 1PFXC 4WH8A 1IQEA 1BITA 1BTYA 1GG6B 2Z9IA 1QB1A 1LDTT 1O3AA 1UTQA 4A1XA 2FYRA 1DWEH 1ELCA 3QGNB 2FX4A 1O2IA 3RDZA 4BNRA 3H7TA 1GI5A 2Z9KA 1CQQA 2B9LA 1TRNA 4D9QA 3RMMH 3BG4C 3G01A 4AG1A 2FDAA 1ZR0A 1TOMH 3SU2A 3I29A 3UQOA 1LVMA 4YLUA 2ZGXH 1GJ8B 3BSQA 1IQMA 4CBOA 3KQDA 3ZVCA 4RKOB 2AEIH 2VVCA 1AU8A 2R2WU 3SHAH 1PPBH 2ZGCA 5A0BA 1ZLRA 2VU8E 3ZZ4A 1F5RA 1JWTA 2WYJA 2FPZA 1GJ4H 5CHAC 3DA9B 1AVGH 3PMBB 1HUTH 1IOEA 5EW1H 3S69A 1KLIH 3MNSA 2AIPA 1ANCA 3IWMA 3M37A 3SBKA 2J95A 5DP7A 1O2PA 3PB1E 4I8GA 3O8BA 1A5HA 3VB3A 1TE0A 4HFPB 3U9AH 2AMPA 1AFQB 2BVRH 3PV4A 1F0SA 6ESTA 4AFUA 1D6RA 4RN6A 2QN5T 3MU4A 1E37B 2R9PA 1JRTA 5IDKA 1GBMA 1C1TA 2WV4A 2F91A 3S9AA 1C1NA 2GKVE 1GHWH 2A32A 2HVXA 4NFFA 1BTUA 1Y5UT 1TPSA 3SUGA 4CRDA 1A0HB 2FI3E 5JPMH 2XYAA 5H4IB 1P2OA 3RC4A 2Y80A 3GDSA 2NU1E 2Y81A 1WTGH 3SJKA 3QZQA 3A7YA 1UTMA 1OP0A 5EXLA 2GTBA 1C5YB 4UFFH 2GT8A 3UTUH 2H5CA 1GPZA 3M3VA 2WUBA 4TPIZ 1O2YA 1P8VC 1TFXA 4CRFA 2ZECA 8GCHG 4AFSA 1IAUA 1OWIA 1RTLA 2G52A 3PYHA 4AN7A 5JB9S 1ANEA 1QRXA 3K9XB 3PWBA 4IC6A 4X8TH 4A6LA 1MTNB 2A4RA 4Q2KA 6CHAC 4BAMB 4BOHA 2V35A 1UCYH 3VXEH 2G81E 1C1RA 2BD2A 1F92A 1HAGE 1GJCB 1B7XB 4DT7B 5DJ7A 3MH4A 1JIRA 3V12A 1GBLA 2BZ6H 1H9IE 2VIWA 1V2PT 2BD8A 3SNEA 4K1SA 2CHAC 2UWOA 1O3DA 1V2VT 1TMBH 2Q6DA 2FS8A 5FPTA 1HYLA 4ABIA 4AYYB 4XBBA 3E6PH 1NROH 1T8LA 3SJ9A 1V2JT 4SGAE 1MQ6A 1B0FA 1P02A 1SGFG 3LU9B 1Z1JA 3RU4E 1FIWA 3ATMA 3RLWH 3SI4H 1HAOH 2OBOA 1JIMA 1HJ8A 1UTNA 4RSPA 5FBEA 5F03A 3GCNA 1EP5A 1VCQA 1PPZA 3OU0A 1GL0E 1Z8RA 4BANB 1GWAA 3EE0B 3FFGA 1C2HA 4U30A 3SW2B 3BG4B 3P17H 1KDQB 1HNEE 4PROA 3ESTA 1YM0A 2KAIA 5DPAA 1TNLA 2UWPA 2BDYA 3U1JB 2VIPA 4ABEA 1H8IH 3Q3XA 2TRMA 3A8AA 3PM3A 3ITIA 1L4ZA 1GHBF 2BD3A 2QF3A 3BIVH 2HNTF 3O8CA 3I77A 3UWJH 1J14A 2ILNA 3LC3A 2XBXA 1AB9C 3ZZBA 2ALVA 3SU4A 4H6TA 1PJPA 2XW9A 4GSOA 5HM9A 1K1JA 4AFZA 5AF9H 2VIOA 3A84A 3Q77A 1ZHMA 1NRNH 1O2WA 3R0FA 1PYTC 3QTVH 3P95A 4YT7H 5LPEA 1BIOA 4X8UH 4UE7H 1CA0B 4FU9A 1G3BA 1FLEE 2HLCA 2OC1A 1FJSA 1ZSLA 1ETSH 1VITF 2P59A 1TPOA 1B0EA 8ESTE 3MH5A 2G51A 3B23B 2BY8X 1SFIA 3AW0A 1N8OC 2AGEX 3ATIA 2BY7X 4WXVA 2A1DB 3A85A 3VB4A 1OWJA 1O35A 1YPEH 1P06A 2Y5GA 1DS2E 3D23A 1N6XA 3DFLA 3SN8A 4JYVH 3VGCC 1D9IA 2F9OA 4Y8ZA 1SHHB 1UCYK 5AVDA 1LPKB 1SGYE 3SJIA 1TIOA 2PHBA 1BMNH 1A46H 2VIQA 3MHWU 3RXUA 3SNBA 3A89A 1XUHA 2VWNA 1G32B 1E0FD 3GY6A 1E35B 5DP3A 3QX5H 4LK4A 1HJ9A 1BBRH 2C8ZB 4IGDA 1C5QA 1C5WB 2WV5A 3BF6H 4HZHA 5C5OA 2FS9A 4O3TA 1GJ9B 3SV8A 2PWXA 3LGVA 5T6FA 1LQEA 1C2MA 3QTOH 3D49H 2SGPE 3NKKA 4Y71A 4DW2U 1GBTA 1CA8B 2O8MA 2J2UA 2JH0D 2VWOA 4X2XA 2O8WA 1YLDA 1CBWC 2CHAB 1O5FH 2ZFRH 4J1YA 1SL3A 2A45B 1O5GH 1HAVA 2ZGJA 4CHAB 1T7CA 1O31A 1P10A 1YP9A 4FUEA 1TAWA 2FESH 3A7ZA 2ZU3A 2ZG0H 2TIOA 1FMGA 2EI8A 1SBWA 1EAWA 1DDJA 2VGCC 4K69A 1C4U2 5T3HA 3SHCH 2A4GA 2QXJA 2ZDNA 3Q3YA 1EKBB 1OKXA 1O2QA 1FN6A 1O3IA 4A1VA 1ZRBA 4AGKA 4LXBH 3A83A 3MU8A 2LPRA 2QXHA 3IG6B 3ZV8A 4BAKB 1EUFA 1TWXB 2JH6D 5FCKA 1P3EA 1CT2E 3C27B 3T27A 2FI5E 4CH2B 1O30A 2ZKSA 2IOTA 3ODFA 3KGPA 3V3MA 2Z3EA 3MNCA 3MO6A 5EOKA 1C9TA 4X1PU 2R3YA 1Y3YA 2GV6A 1TBQH 4NWKA 3A82A 2ZTZA 4Q7YA 4WMDA 1V2RT 4ZKSU 1AB9B 3ATKA 2F9UA 4K2YA 3UFAA 1RRKA 1H9LB 3RXMA 3TNSA 2NU2E 3LJJA 2QAAA 1K28D 1Z8IB 1TGTA 3S0NA 1LMWB 4WXIA 3S9BA 2PW8H 2FYQA 3QN7A 1HJAC 2UUYA 2PKAA 4Q7ZA 1ZPBA 5GDSH 4YOIA 1C5NH 2CV3A 3GCHC 5JDUB 1ELEE 1NFUA 8KME2 4Z0KA 3SGBE 5EQQA 3TK6A 1N8OB 2XRCA 1ZJKA 1BBRK 2BB4A 1OWHA 2DUCA 1NESE 3F9EA 1GI4A 1ELDE 4H6SB 5A8YA 2ZWLH 2FEQH 1SOTA 2BDBA 4MTBA 3VGCB 2EEKA 1K1LA 4GCHF 2ZFQH 1P2JA 1HFDA 4Q80A 1EB2A 3ZVDA 1SOZA 5A0AE 1IQGA 1YCPK 1TPPA 1O3MA 1GDQA 6GCHG 1O2ZA 1QJ7B 1QBOA 4JZ1A 3ZZ3A 1D3TB 1TX6A 5IYTA 1GDUA 3BTWE 1DUEA 1YPJH 2CMYA 2HGTH 2NU3E 3LJOA 1DE7H 3BTEE 1GBFA 3FZDA 1YBWA 3ELAH 3SV7A 3SUEA 4X1SU 4CRBA 2ZDLA 3BTGE 3EYDA 3RU4T 1O5BB 1DWCH 1GMHG 1C1OA 3LOXA 5T6DA 3A8BA 2SGDE 3ZV9A 1DWBH 3AAUA 3C1KA 1GI8B 1L4DA 3NWUA 4FUJA 1BTPA 4THNH 3M5OA 3SQEE 4NZLA 1MUEB 3SV2H 2YNBA 1ZOMA 3M35A 1G2MA 1HAPH 2P16A 1BRAA 4MVNA 1AHTH 5DO4H 4FUHA 1LVYA 1ZHRA 1P12E 1HBTH 1SR5C 3TIUA 1GI7B 1HAVB 1MZDA 1TGSZ 2PV9B 3GYLB 1TNHA 1EZSC 2VGCB 1TNJA 3OY6U 3V7TA 4I32A 1XKBC 3HPTB 3WY8A 5LGOA 2GD4B 4ZHAA 3GY2A 2BLVA 4TWWA 2JKHA 1DSUA 1IQFA 5J4SA 3KL6A 3OX7U 3EGKH 1J16A 1RTFB 4U2WA 5FBIA 3L6PA 3FP8E 1QTFA 3A8DA 2A0QB 1A3BH 1GMDF 2W7UA 4YESB 2QIQA 1GHYH 1K1PA 5JBCS 3RM2H 1W7XH 1RJXB 1YCPM 3NK8A 4FUCA 1FONA 1C2JA 1AVWA 4GHQA 2FZZA 2BY9X 2WPIS 1ABIH 2B8OH 4Y7AA 3TK5A 1D6WA 4JZFH 1GJAB 2G00A 1FY1A 1UVSH 2SFAA 3RXVA 4MPWA 1FXYA 3ZZCA 5I25A 3DFJA 2OC8A 1J15A 2OC0A 1BTHH 2Z9LA 1ZJDA 2WPJS 4FU7A 1BMMH 1G37A 1YPLH 4A5TS 4K5ZA 1C5ZB 5BPEA 3SUDA 2I6SA 4YT6H 5EQRA 1WTHD 4OGXA 2ANYA 1CGIE 1EOLA 3GISB 3Q00A 3ZVAA 1HJAB 2FX6A 1OXGA 2STBE 2ZGBH 3STIA 1SC8U 1PYTD 3GCHB 2ANWA 4OS6A 2QF0A 2PKAB 1EPTC 1FY3A 1NRRH 3TITA 5EGMA 5TCAA 3RXQA 1O3JA 3GY4A 3URDA 2Y7ZA 1BCUH 2GX4A 1UVUH 1PQ5A 2BQWB 3LC5A 1SGRE 1AUTC 1EJMA 2SNWA 3DHKH 1OPHB 2GMTB 2YNAA 1YPKH 1SLXB 1DOJA 4E05H 5C20A 4ZKNU 3E3TA 1S0RA