1GWAA

Triiodide derivative of porcine pancreas elastase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Triiodide Derivatization and Combinatorial Counter-Ion Replacement: Two Methods for Enhancing Phasing Signal Using Laboratory Cu Kalpha X-Ray Equipment
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gwaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gwaA01
1C2DA 2ZU1A 5CMXH 4JMYA 3T28A 1PQ7A 1HAYB 1Z8RA 3SW2B 1YPGH 2J9NA 2QIQA 1A5IA 3TJUA 1P2MA 1H1BA 2P59A 2VIPA 1EX3A 4MTBA 1HAVB 1AO5A 2VIVA 6GCHG 1IHSH 1T8NA 5K0HA 2XXLA 2G81E 4U2WA 3M7QA 2GP9B 3Q76A 1O34A 1GMCG 1NESE 4ABEA 1AKSA 3ZV9A 1BTXA 2G55A 5JDUB 3S9AA 1P01A 1Y3XA 4AFQA 3PM3A 1C2IA 1JRTA 3F9HA 1OPHB 5DP9A 1TFXA 2QAAA 7GCHF 1K28D 4KELA 1NO9H 5DP4A 5A0AE 4YZUA 2M5TA 1TNJA 4CREA 1O3LA 2ZDNA 3GISB 3ZVEA 1XX9A 2Y81A 1DUEA 3A85A 2QXJA 1ZGVA 4DOQA 1C1NA 1FIWA 3T62A 1QURH 2GZ8A 1W8BH 2WYJA 3OSYA 2D2DA 1ABIH 1CHOF 3DHKH 4NA8A 3UIRA 1O2HA 4AB9A 1BOQA 1RTFB 1HAXB 1K21H 3TGIE 4BTTB 1GMDF 3A84A 1P0SH 5SGAE 2PUXB 4FXGH 5L6NH 2P3FH 1N8OB 3PTNA 3SJIA 3VB7A 1E34B 2H9EH 2K1QA 1GWAA 1HPGA 4KKDA 2NU3E 4X1SU 1IQGA 1GBBA 4TPIZ 1O3KA 5LGOA 1FY1A 3BTTE 4A7IB 4X1QU 1H9LB 4IN1A 1A5GH 2J4IA 4J2YB 2FOMB 4D9QA 1EAWA 4HI3A 1QJ7B 2C8YB 1MBMA 1BHXF 3WY8A 2DE8A 3P17H 2H9TH 2F9NA 5F8TA 2P94A 1TA6A 3A80A 2XCFA 1AY6H 1FY8E 4ESTE 1ELTA 3BG8A 4QT8C 3VB6A 1T4UH 2ZDKA 4DIHH 6LPRA 4AOQA 2Y6TA 3E1XB 4ABFA 1BTHH 3TH4H 1WTHD 2ANWA 3LGVA 2IOTA 3A7XA 7LPRA 2QYIA 1XKBC 2VINA 3M35A 1IOEA 1D4PB 4OS1A 4Y0ZE 4RSPA 2BB4A 2GD4B 3LDXH 1J17T 3ATKA 5GIBA 4AN7A 1BBRK 1GGDB 2OC7A 3ZZDA 4F49A 1O2ZA 2BOHB 4JYVH 5JBBS 4XE4A 1RIWB 3SHCH 1DFPA 5FX5A 1O3AA 3SGAE 1AB9C 1ZHMA 4GLYA 4UONA 3K9XB 1GHVH 1SPJA 3URDA 2ODYB 4BAQB 3KNXA 1GHYH 4FUJA 1MAYA 1BTUA 1NU9A 4AGKA 2WPKS 4WXIA 2A1DB 1YCPK 3RU4T 2TGAA 1GHWH 4I32A 3H5CB 3HKIB 3U8TH 2PW8H 2HRVA 3RMMH 4JK6A 3M7TA 2ZDVH 3GY5A 3I77A 1TAWA 4X2VA 4YT7H 1IHTH 1RJXB 4IS5A 3ZZ9A 1QIXB 1K1PA 3M5NA 1TGBA 1ARBA 2P95A 3GCHB 3HK6B 1OP8A 3LH1A 2TGDA 1THSH 1YPKH 1S6HA 2BDCA 1KXBA 3URCA 4OS4A 1KTSB 5C1YA 2HGTH 2ODQA 1TNHA 2KAIB 2R2MB 1DSUA 1LHFH 4Z0KA 1JWTA 1RS0A 2F9OA 1JOUB 1YBWA 2HPQH 4D7FA 1UVPA 4D9RA 4JYTA 3U8OH 1ETRH 1DDJA 2JETC 4DW2U 3STIA 2CF9H 3GCTG 4O3TA 1L1GA 3AVZA 3PO1B 2QY0B 3SO3A 4MPWA 2ZWLH 4HGCA 1A0LA 2G4UA 2SGEE 3NK8A 3SV9A 1W7GH 5E0JA 2WUBA 1ANCA 1UTPA 1XM1A 1ORFA 1A1RA 1F7ZA 2R3UA 1O5BB 4K1SA 3QWCH 1KIGH 1SGNE 4HFPB 1NPMA 4E7RG 1C1QA 3VB5A 1BBRE 1MCTA 5EQRA 3PWBA 3T25A 4JZFH 2XBVA 4LZ1H 1MTNB 3SV2H 1UO6A 2BLWA 5DP5A 1RGQA 1THPB 1GL0E 1MTSA 1DM4B 3MHWU 4B2BA 2H2ZA 2FOCA 1CVWH 1FLEE 1TGTA 1WQVH 3LGYA 1LKBA 1CGJE 4OGXA 1FAXA 3RXEA 2BM2A 1TNIA 2GCTB 1ETSH 4ABJA 1W13U 1P09A 1OX1A 4DCDA 1ANBA 1O2MA 1ACBE 2FTLE 1TYNA 2R3YA 4Y0YE 3MNXA 1T8OA 2O8MA 4OS2A 3VGCC 1AZZA 1AFQB 1OWDA 2ZFQH 4B2CA 3BTEE 1GMHF 1UJ1A 4K1TA 4B74A 1FDPA 2GV7A 1V2WT 1ZRKA 2A2XH 1O3FA 2A5IA 4ZMAH 2XWBI 2OTVA 3KGPA 3M61U 1HB0B 4WXVA 1Y5UT 1SLVB 5BRRE 2XBXA 2VWMA 4MNWA 1A7SA 2GTBA 1BTPA 1GDUA 1MTVA 1GJ4H 1HAIH 4BNRA 3BTGE 3PB1E 1IQEA 2SGQE 3BG4B 1S5SA 3KF2A 1CT2E 1EJNA 4ISIH 1EAIA 2WV5A 4X2XA 2ILNA 2VNTA 1TMUH 2ZP0H 4X2WA 2KAIA 4FVBA 5E2OA 1ZPCA 3ATLA 2V0BA 4WH8A 2ZECA 1NRQH 4K60A 2Q6FA 1EAXA 3U1IB 2RCEA 5LPFA 4THNH 1C5YB 3S0NA 4K3JA 1V2NT 4O03A 1TBQH 2CF8H 7GCHG 4DGJA 2HNTC 1OYTH 1TLDA 1QTFA 2QCYA 4ISLA 5EGMA 1PPHE 1TMTH 2WUCA 3ZZ5A 2SFAA 3PWCA 5F03A 1YCPH 4K8BA 1N1LA 2ZCHP 3U1JB 4Q80A 1C5RA 1ZZZA 2ZO3H 3O8RA 3V0XA 3LT3A 4Q7YA 1MU8B 1O3JA 1F5RA 4U32A 3GDSA 5J4QA 2PLXA 4B73A 3QTOH 2UWPA 2QF3A 1RRKA 1O3HA 1NRRH 2ZTXA 4OGYA 2J38A 2FDAA 1GMDG 5ESBA 5B6OA 1TE0A 1VCWA 2PKSC 2ZTZA 2W5EA 1GDNA 4K69A 4IMQA 4OS5A 2C8ZB 1DY8A 3MNBA 4RKJB 3VXEH 4Q7ZA 1GG6B 2G00A 3RXSA 2PKAB 3M7UA 4FUGA 4Y76A 1B0FA 3KHVA 1TX8A 2ZPRA 4WWYA 2IN2A 1C5PA 1GVZA 3OU0A 3LIWA 5DO4H 1MKWK 1GBLA 1IAUA 1GBDA 3AW1A 1LO6A 2BXUH 4UEHH 1AN1E 1BRBE 3MI4A 2BY9X 2XC4A 1EZSC 4XOJA 2XBWA 4CRAA 1BB0B 1LVBA 5GCHF 3UREA 3UNQA 1O30A 2TRMA 1F2SE 2OD3B 4H6TA 1SL3A 1YLDA 2GZ7A 2VVVA 1GI5A 3T27A 4NIVA 3ZZBA 4K1EA 4LXBH 4AGJA 3EA9A 1BRCE 1Z1JA 1UTQA 1KXDA 2OUAA 4X6MA 1GI6A 4FUFA 1TBZH 1Z1IA 2ALPA 1IQLA 1C1VH 1O2RA 1T8MA 1F0RA 3SGBE 1QBOA 1O2IA 1RIWC 5LPEA 1WOFA 2VU8E 2BD2A 1OOKB 5AFZH 5A8ZA 1XUKA 1SOTA 2BQ7B 1UTLM 3F9FA 1C9TA 4X2YA 1NC6A 1CSOE 2HALA 2OBQA 4NSVA 4ZKNU 1CU1A 4TY6A 2ZFTA 1YPMH 2HWLB 1K9OE 1NU7B 2OLGA 3FP8E 3M5MA 1NS3A 2AYWA 5T6FA 1W11U 2ODPA 2ZDAH 4E7NA 1TOCB 1C5UA 2AIQA 4XFQA 1V3XA 1BHXB 1VITG 1PJPA 2HVXA 3RM0H 4X1NU 2F9BH 2AGEX 4JZ1A 8GCHG 1JBUH 4B2AA 1O2JA 1O2NA 1NRSH 4YOGA 9LPRA 2A4RA 3ZYDA 1UVTH 3KQBA 3NWUA 1PFXC 3UQVA 3GCHC 1EJMA 2Z94A 3U8RH 3Q77A 3RXFA 1H4WA 5DG6A 2Y5FA 1TBRH 4NIXA 1GHXH 2FOBA 1F0SA 1TALA 4JZEH 4CH8B 1BDAA 4X8VH 1ZR0A 1QR3E 5LPRA 1EASA 1KYNA 1FY5A 2BLOA 1TNKA 1SHHB 4YLQH 3MU0A 3GCTF 3QN7A 4IN2A 1ZRBA 1ZJKA 4VGCB 1MUEB 3RP2A 5HXFA 1GBEA 3PO1C 1CT4E 2IJOB 1UVSH 2BQ6B 1LHDH 1U6QA 2A4OA 1MQ6A 4LOYH 5JPMH 4I8LA 1B0EA 2BQWB 1AWFH 1T31A 2FYRA 2UUYA 4H42U 3ESTA 2ZI2H 1GCTB 4IC5A 1CA8B 1H9HE 3BTWE 2I6QA 3SV8A 1OP0A 2R2WU 3LU9B 3ENSB 4LZ4B 2Q6GA 1HFDA 4CHAC 1MTUA 1NRNH 1C9PA 1FV9A 2O8WA 4GSOA 1VITH 3S7HB 3A8AA 3SGQE 1P2NA 1QL9A 2LPRA 4NA7A 4UFFH 1HAZB 2GV6A 1FI8A 5DP6A 1UTOA 1RXPA 1OWJA 2XRCA 1SLWB 3LJJA 2PSXA 4KTUA 1BTYA 3D49H 4ABHA 1FN8A 3GDVA 2THFB 2ZIQH 3QGJA 2AERH 2QGRA 3HATH 1CT0E 2GCTC 1V2OT 2WPIS 4XSKU 1W2KH 1ZSJA 4K2YA 1C5VA 5FBIA 1MBQA 1PQAA 1MKWH 2VJ1A 3GY6A 4R0IA 1C5LH 4WF8A 2OQUA 1G2LA 3ZVFA 1JMOH 4KTSA 1DITH 3VB3A 4I8HA 1W3CA 5DGJA 3B8JA 1GVKB 2FIRH 2BD3A 4O9VA 1KXFA 1VJAU 1W0ZU 4A1XA 1GMHG 1P12E 3A81A 2DUCA 1WYKA 3PROA 5DP8A 5FBEA 5FXLA 2V6NA 1SGFG 1UVOA 2AIPA 1AQ7A 2ZEBA 1GI3A 1O3CA 3ZVDA 1GI7B 2BD7A 2VWNA 1C5TA 1XUGA 2STAE 1O2OA 1QB9A 3PLKA 1J16A 3EAJA 1GJ6A 3TU7H 4RN6A 1XXDA 4GHTA 2D26C 2ZKSA 2BD8A 2BD5A 2NU4E 1BTWA 1HCGA 3OY6U 3RC6A 3TH3H 2O9QA 1BQYA 1O2GH 4UE7H 5FAHA 3SU1A 1XUFA 1CQQA 3VFEA 3L3TA 1LMWB 2ULLA 5J4SA 2AGGX 1MH0A 3GY7A 8KME2 2BVSH 4NWKA 1V2ST 4ZROA 1GBTA 1FN6A 5EXNA 3ZZ3A 4X6OA 1CO7E 3W95A 2XC5A 2ANKH 1WSSH 1UTMA 1DICA 1OXGA 1CA0B 2ZU2A 4X6PA 4JZDH 4FUDA 3B23B 2ZFRH 2C8XB 2VGCB 5IYTA 2A7CA 1TWXB 1Y3UA 1HGTH 4NSYA 1GHAF 2FYQA 5C2ZA 2B5TB 5EQQA 1AU8A 3M3SA 2ZCLP 4CRCA 4I33A 1DVAH 1GJAB 1BTZA 3QZQA 1PPBH 2FLBH 2O8LA 3EDXB 4INKA 1GI2A 2ZDLA 3E3TA 1HAOH 2ZDMA 3C27B 5A09A 3TH2H 1ELEE 1Q31A 1NTPA 1K1IA 3N7OA 1K2I1 5CHAC 2FESH 1GI4A 1FONA 2F3CE 1IQHA 2VWLA 2PHBA 4I8JA 1EPTB 1MZAA 1Z6EA 1ZJDA 1SBWA 1SGIB 3EQ0H 1TONA 4DIIH 1P2OA 1HJ8A 1ZMNA 1A46H 2HPPH 4Q7XA 3ODFA 1P02A 5CE1A 2A31A 1DPOA 2FI4E 5FCKA 4A6LA 1GJ8B 1GBHA 3SJ9A 5EU8A 1TQ0B 1NY22 2P93A 5DP7A 1SGDE 3S9BA 1TX7A 1P2IA 5GCHG 1BITA 2F91A 3PYHA 1S82A 2AMQA 1LHEH 3QLPH 1HAHH 3RMLH 1QRZA 1RFNA 2ZPQA 2CHAC 2B9LA 4I7YH 2Z3CA 3RXLA 3CP7A 2EI6A 3SU4A 1KTTB 1SQAA 2BX4A 4JK5A 3MOCA 1S6FA 4ZHLU 5K7RA 4YTAA 1MAXA 4AG2A 2D8WA 3P8NA 3FANA 2EI8A 1GJCB 2A7HA 2VVCA 2O8UA 1VGCB 1KLIH 5GXPA 2PFEA 2SGAA 2Q1JA 4Z6AH 1SI5H 5EW1H 1XUIA 3K6ZA 1DXPA 3DFLA 1BMMH 1P06A 2BY8X 2F9PA 3PMBB 3HGNA 1SG8B 4WVPE 1O3PB 3P92A 1C2JA 2BXTH 1H9IE 1FY4A 3TNSA 4INHA 3EE0B 1VITF 1O5CB 1O2TA 2QA9E 1KLJH 3RC4A 5T6GA 1O3EA 2FOGA 4X8UH 1AVWA 8GCHF 3Q00A 3UR9A 4IMZA 4AFSA 1ESBA 1MCVA 3MNCA 2VIWA 1O2QA 3KN2A 4MG3A 3GY4A 5EQSA 2BX3A 6CHAB 2SNWA 3A89A 3R0FA 2SGFE 3D23A 3NPSA 4GAWA 1EB2A 1THRH 2FLRH 2ZGBH 2WV4A 1QB1A 2AFQB 1C1WH 2BYAX 1XMNB 1AMHA 1ELCA 2PWXA 3RM2H 1ZPBA 2OC0A 3SQEE 3SZNA 1QHRB 1YYY1 1ZYOA 3TITA 2XW9A 1EPTA 4HZHA 3MMGA 1V2QT 1QQUA 2XTTB 1D3TB 1ETTH 1N6YA 2ZTYA 3GYMA 4ZHMU 4WMEA 1SGRE 1YM0A 4BANB 2GCHG 2STBE 2ZHEH 1P2QA 2C93B 1AE5A 5A0BA 1SLXB 1SGCA 1D9IA 4GHQA 5JBTA 1GBMA 3IWMA 1BT7A 3A8CA 2Y5HA 3A86A 2BZ6H 3F6UH 4CRFA 2JKHA 2V35A 4CRGA 3HPTB 1FZZA 7KMEH 2PGBB 5T3HA 2AMPA 1O3NA 3ATMA 2PR3A 2XCNA 4WMDA 5E2PA 1S81A 2G51A 3VXFH 2JH6D 5C3NA 3TGJE 1WTGH 3LH3A 1YPJH 2GMTB 2Z9KA 3KQEA 1AVXA 1T4VH 5BPEA 1TRNA 3FFGA 2FOFA 4UDWH 4WMFA 5EOKA 3TK9A 3W94A 3PLPA 3ZZCA 1GBJA 2VB0A 3SUGA 2FOHA 3SUDA 3ZV8A 1CBWB 3VB4A 2V3HH 1DWEH 1E37B 1PPGE 3I29A 3Q3KA 2HNTF 4YO9A 3LGTA 1GBIA 2FOAA 1BMAA 2Z9GA 3NZIA 3K2UA 3AAUA 1O5AB 3MU5A 1LVYA 2OBOA 4KGAA 1SFIA 1ZMLA 2FP7B 1P2JA 4ISNA 1HXEH 1EZQA 2O8TA 5A8YA 2C3SA 4AG1A 1HNEE 1O5DH 4FUCA 1C1MA 1FPCH 2ZQ1A 4BXWA 3E16B 1ANDA 3A87A 3LC3A 1BMLA 1C4U2 2FX4A 1O33A 1O32A 4YOJA 3QDZB 1OWKA 1DY9A 1RTKA 1GJBB 1V2PT 3CENA 1G3BA 1P3CA 1IQKA 3S69A 4JYUH 1LPZB 1SOZA 2Y80A 4GCHF 4X6NA 3P8GA 1H8DH 3D62A 3SU2A 1A0HB 1UMAH 2ZHDA 3SHAH 1LVMA 2QV1A 1VR1H 2FX6A 1W12U 1K22H 4UFEH 1O38A 2J92A 1Z71A 1KSNA 6ESTA 2RG3A 3RXVA 5A8XA 1QL7A 4U30A 2GKVE 2CXVA 2ZZUH 3ATIA 1GJ9B 1TOMH 1PPZA 4K8YA 1F92A 1GHAG 3RDZA 1E0FD 1N8OC 1YPHC 1CGIE 1ZTJA 2J95A 1ZGIA 2GT8A 2NWNA 3ZYEA 1QCPA 4BAKB 2CGAA 1OKXA 3KIDU 3TK6A 4NFEA 4H6SB 3FZDA 3UUZA 1HIAB 1ELVA 2JH0D 1XUJA 3U69H 1MD8A 3GCOA 1K1LA 2FTMA 5L2ZH 1TPAE 3BTKE 1BA8B 1A5HA 1O5GH 5F6MA 1UK3A 1MZDA 1SQTA 1LDTT 3ZVAA 3E91A 4Y11E 1D3QB 4Y10E 5EW2H 1C5ZB 1ZHRA 2R0LA 3JZ1B 4HTCH 1EP6A 1V2MT 2P3UB 2VIQA 3RXRA 1O37A 3EA8A 1DWBH 1PYTD 3MO9A 1L4ZA 1V2UT 1F0UA 2GT7A 3U98H 3SU6A 2G5VA 1IQNA 2RA0A 1VCPA 2Q6DA 1F0TA 2R9PA 2ZFPH 4SGAE 2FM2A 3TVJB 1P05A 3SNAA 1ANEA 3RU4E 1FIZA 1QRXA 1BZXE 2ZG0H 3QK1A 2Z3EA 3P95A 1EB1H 3RXDA 1GGDC 1M9UA 1XVOA 1AUJA 5EXMA 1VGCC 1KXCA 3DFJA 2Y7XA 5TJXA 1UTNA 1GHBG 1S84A 3SN8A 4E05H 1C1OA 2SNVA 2ZPSA 1O3OA 1MTWA 1ZMJA 2EI7A 3HKJB 1TNLA 1L4DA 1GVLA 1J8AA 1QA0A 4SGBE 5JB8S 3CS7A 4DJZB 2H6MA 3EGKH 3UOUA 1HRTH 4CH2B 4DG4A 1EAUA 2FI3E 1G37A 3GOVB 1P11E 5AHGH 8ESTE 1YPLH 3UR6A 2NU0E 3MH5A 3RXJA 1LKAA 1A4WH 4B1TA 2CMYA 2BDHA 3R3GB 2D1JA 2FI5E 5C1XA 4X8TH 2TGPZ 2ASUB 3UOPA 3V3MA 4I8GA 2J34A 2Z9JA 1ELDE 2FS8A 2VIDA 3D65E 6CHAC 1L1NA 3E6PH 1C2GA 1C5NH 1GL1A 4J1YA 1ABJH 3QUMP 5C20A 2BD9A 3SI4H 2FZZA 1HDTH 2GZ9A 1FMGA 3P70B 1O3GA 1WBGB 1HIAA 2W3IA 1K1OA 1QB6A 1AGJA 1UHBB 3HGPA 1EKBB 3BTHE 3BTME 3SV6A 4UFDH 1FXYA 4FU8A 3P8FA 1L2EA 1SSXA 2J2UA 4FUIA 3MWIU 4LK4A 3SNBA 1N6XA 3B9FH 1O35A 1TIOA 2GCHF 2WPLS 2BD4A 1NROH 2ZGJA 3P6ZB 4ZXXH 3S7KB 1O36A 3SOSA 1F5KU 3UQOA 4INLA 3SQHE 4PROA 1HBTH 1P10A 2ZA5A 2W7SA 1WCZA 4CRBA 3ZZ8A 4BAOB 5ETXA 1C5OH 2AEIH 1E38B 2G52A 2JETB 4JZIA 4UD9H 2EEKA 1DXWA 4TY7A 1L1JA 1J15A 3SJKA 3MU1A 4NWLA 1C5WB 1HJAB 1MTNC 4NIWA 1B5GH 3SBKA 5DP3A 4IBLH 2B8OH 2P16A 1SGQE 4BAHB 4NFFA 2P8OB 2XYAA 1EATA 1GBKA 2ALVA 3LONA 3RXMA 1O2WA 2FO9A 3RXQA 5JBAS 1QRWA 1FAKH 4GUXA 4FVDA 1K1JA 4AX9H 2VVUA 3OTJE 1AFQC 3BIUH 4MLFB 1C2FA 2HNTE 5C5NA 3MH6A 4O97A 2UUFB 2AMDA 1G36A 1DLKB 3AASA 2PSYA 1BIOA 2ZHWH 1NT1A 4DT7B 5DPAA 1MD7A 1SGYE 3PTBA 1EP5A 3VPKA 2H9HA 1YKTA 1O3DA 2A5KA 1D6RA 1TX6A 5A2MH 1QA7A 4TWYA 3TJOA 2ZGXH 4ZAEA 5FPTA 1QGFA 1Y5AT 2Z3DA 3BG4C 1G30B 2AS9A 2Z9IA 1YPHE 3DA9B 1NRPH 3SNDA 2F9UA 5GPIB 4NZLA 3T26A 2ZHFH 4DURA 1SR5C 1LHCH 1S83A 3A8DA 3TLOA 4ABAA 4TWWA 1ZSLA 1GBCA 1O2UA 1PPFE 1UHBA 3HK3B 1BMNH 4ZH8A 4H4FA 1D3PB 3M5LA 3M3VA 3K65B 4GCHG 3RXAA 1V2VT 5HM2A 3A83A 3MO6A 4Y71A 2YNAA 2TIOA 4MNXA 4Y7BA 1C5MD 4YESB 2RA3A 2ZU4A 1KY9A 3TK5A 2DE9A 3KEEA 1FNIA 1C2MA 1QNJA 2EC9H 2PV9B 1DLEA 1TNGA 3LOXA 5G4BA 4OS7A 1AI8H 1TRYA 1A2CH 1G3EA 1K1MA 1C2HA 1KLTA 1GBFA 4A92A 3M3TA 1OWEA 5GDSH 3GY2A 1CGHA 1Y8TA 1T7CA 3QO6A 2QXIA 4B76A 4AFZA 1FY3A 2GGVB 4A5TS 4ISHH 2YOLA 1GG6C 3U9AH 5EG4A 1FUJA 1MMJN 1IQFA 3I78A 4R8TB 3CS0A 1TPSA 3FVFB 4O3UA 1TQ7B 3DUXH 1LHGH 3T29A 3RLWH 1XKAC 1EJAA 3NUMA 2PKSB 3IG6B 3RU4D 2SGPE 1E36B 1QQ4A 4FUBA 2UUJB 2ANMH 3QGNB 1G32B 4ZKRU 5E8EH 1SGPE 1WQSA 2ZFFH 3RXOA 1ID5H 1X7AC 4CR5A 1A61H 1P8VC 1GJDB 1QFKH 2JH5D 1AVGH 4AYYB 1J14A 1BRUP 1NFYA 4FU9A 4ZUHA 5AF9H 1RTLA 1E35B 3FP7E 1MU6B 1P04A 5LH8A 1JRSA 5I25A 1ZPZA 1GDQA 3FP6E 1O2LA 4AFUA 2OC8A 3F9GA 2FOEA 1Z8JB 4D8NA 4WJG2 1Y5BT 2H5DA 3ZZ6A 1JIMA 2ZGHA 2OP9A 1DOJA 2I6SA 1JIRA 5DK1A 5ESTE 2BLQA 4MNVA 1Z8GA 3MO3A 1ZTKA 1HYLA 3ZZAA 1C1PA 1SMFE 3Q3YA 1OWHA 3L33A 1TPOA 1C4Y2 1EOLA 1A0JA 2ESTE 1GHBF 4YLUA 4F4OC 1LPGB 1O2SA 2OQ5A 1Y3WA 1XVMA 1DUAA 3MYWA 5IDKA 1D3DB 4YT6H 1HAVA 1LQEA 1S0QA 2WPHS 1C5SA 1V2KT 2C4FH 5TCAA 5FHTA 1HUTH 2YNBA 3NCLA 3SJ8A 3BEFB 1HV7A 4BTUB 4E06H 1O0DH 4IW4E 2VH0A 3RXHA 3GDUA 5EODA 3ZVCA 4X8SH 1LPKB 2Y7ZA 2A45B 3A7VA 1JXPA 2LNCA 3BEIB 4RKOB 1FQ3A 3MTYA 4K5ZA 1EOJA 2IPHA 2C8WB 5H4IB 4JCNA 4AORA 2F9VA 4MDSA 1DANH 1TA2A 1LQDB 2OCVB 2VH6A 2FWWA 3SNEA 2QN5T 3FAOA 3Q3XA 3SJOA 3RXUA 2FPZA 1BJVA 1YCPM 2Z9LA 1SQOA 3E90B 3RMNH 3RMOH 3M36A 1Z7KA 2BOKA 1SGFA 1V2RT 4WH6A 1OS8A 1CHGA 2H1UA 1WAYB 2AH4X 3GYLB 1GHZA 3ATWA 1PPCE 3UY9A 1SB1H 5C1UA 1XUHA 5L2YH 4VGCC 1ZTLA 1QY6A 1A3BH 1TRMA 2J94A 4Q2KA 4XBBA 5C5OA 4ZKSU 3QTVH 4U01A 3LKWA 3A82A 5AVDA 1W10U 2BHGA 3RXBA 1GCTC 3UWJH 1UCYK 1S0RA 4CR9A 1QJ6B 4NIYA 3BV9B 4NZQA 1BUIA 1QL8A 1W0YH 4GVUA 3ZVGA 4CBOA 1O31A 2ZNKH 1C5QA 4TYDA 4ABDA 3NXPA 4NCYA 3LC5A 1HJAC 3A7ZA 1IQMA 1GBAA 3FZZA 2F83A 3SUFA 2Z7FE 1B7XB 1C1RA 1YGCH 3NKKA 1DWCH 2P8OC 3RXKA 4MPXA 2UUKB 1QBVH 5HYOA 1LVOA 3BF6H 4YOIA 2A4QA 4CHAB 3SORA 1SVPA 3RXCA 4AZ2B 3GCNA 3UFAA 1Y3VA 2BY6X 2QF0A 3ELAH 1INCA 1GJ5H 5EPYA 1V6DA 5E0HA 3RUOA 2Y5GA 1TGCA 3RLYH 1AWHB 1ESTA 1UTKA 1DX5M 5GWZA 2PUQH 2TGTA 2ZQ2A 4AB8A 5HM9A 3GY3A 4B75A 2H5CA 1IQJA 4WY3A 1YF4A 2A5AA 3M5OA 1KXEA 4B71A 3RXIA 4I8KA 1TB6H 1C5XB 1ELBA 4ZKOU 2G8TA 1GI1A 1O2VA 2NU1E 3JZ2B 2AGIX 1YC0A 1ELGA 1C2LA 1C2KA 1T32A 2C90B 3LGUA 2B7DH 3AW0A 1Q2WA 2ZHQH 2VIOA 2RDLA 4KTCA 1MKXK 3UNSA 3SNCA 4D76A 2P3TB 7ESTE 3KL6A 2TPIZ 4IC6A 2ZGCA 1IQIA 2BVRH 2QXGA 3C1KA 3V7TA 4A1VA 1EUFA 2FMJA 4MPVA 5ABWA 4BAMB 2W26A 4Y8XA 1DT2A 1NZQH 1F5LA 2TBSA 3F68H 3UNRA 1EQ9A 6GCHF 2CN0H 4IGDA 1BBRH 1UCYE 1XXFA 2EA3A 3RXTA 3TGKE 1GMCF 1EXFA 1SGEE 1HJ9A 3EA7A 2GDEH 2BVXH 1G9IE 1NFXA 4X0WU 2A4GA 1O2XA 1C1UH 3O8CA 1EZUC 3PMAB 1GCDA 3BSQA 2BTCE 3MH7A 1CA0C 3KCGH 4FUEA 1O3IA 1UK2A 1SHYA 2VGCC 3DD2H 4I31A 1AUTC 3O8BA 1AZ8A 1C2EA 3RXPA 1DS2E 4ISOA 5C67A 5L30H 3A8BA 3MU4A 4Y8ZA 1G3DA 4KP0A 3QX5H 8LPRA 4ABGA 1SC8U 5FPSA 3SV7A 1W7XH 1Q3XA 1O2YA 2CJIA 5FX6A 3TJVA 4X1RU 3ZZ7A 3OX7U 3RXGA 3E0NB 4OS6A 2XWAA 2QXHA 1S85A 1Z8IB 2HOBA 3E8LA 1CHOG 2SGDE 1ZOMA 1KDQB 1NFWA 3ZZ4A 4FUHA 1NM6A 3V12A 1VCQA 3KQCA 1YPEH 1A3EH 1AHTH 3OYPA 4ZXYH 3BTDE 3H7TA 1P9UA 1EPTC 1YLCA 1HXFH 2ANYA 3BTFE 3SUEA 3KQDA 1BCUH 3PLBA 1DE7H 1GPZA 2BY7X 1UCYH 3TIUA 3TJNA 1Y3YA 1ELAA 1WUNH 3K6YA 3MH4A 5F8XA 9ESTA 4MNYA 5JYIA 5GJ4B 3BIVH 1ESAA 1GI0A 1H8IH 5CHAB 1FJSA 2NU2E 1TABE 1NFUA 3IITA 1AE8H 1P57B 1WU1A 5FPYA 1PQ5A 1Z6JH 2R0KA 4ZHAA 2ZC9H 3MFJA 1BJUA 1BRAA 2BZAA 1HLTH 1OP2A 4GPGA 2UWLA 3BTQE 1ZHPA 3VEQB 2OXSA 1O5EH 1SGTA 1VJ9U 3L6PA 3TNTA 1GJ7B 2CV3A 1DWDH 1TGSZ 5EPNA 2BMGB 1O3MA 4UFGH 1G2MA 3F9EA 2BDAA 5E0GA 1D6WA 2XNIA 1QBNA 1O39A 2OC1A 2ZFSA 3A7WA 3QZRA 3GICB 2CHAB 1L0ZA 3O8DA 3G01A 4MVNA 2GVFA 2ZU3A 3E0PB 5DKMA 2ZCKP 4D7GA 3V13A 4CBNA 3SU5A 2WPMS 1ARCA 3UWIA 1WV7H 2XC0A 4MPUA 2A0QB 1KXAA 2PTNA 4ABIA 1OWIA 2BY5X 1C1TA 1P2KA 1AB9B 5T6DA 5JBCS 2ZU5A 3A7TA 1TPPA 1T8LA 1V2JT 2BDGA 1MKXH 1P3EA 1AD8H 4DVAU 5F8ZA 5A0CA 1J9CH 4ASHA 1W14U 2XBYA 1VZQH 2A2QH 3BEUA 1ZSKA 4TPYA 4AYVB 3PMJA 2V3OH 2G4TA 1Y59T 2A32A 1OSSA 2GX4A 2FEQH 1OYQA 2BDIA 3DT0H 3ODDA 1KDQA 2FS9A 4Y8YA 3A7YA 1AIXH 3M37A 5DJ7A 4A1TA 1K1NA 1NN6A 1EZXC 2ZF0H 3MU8A 5I46H 1UTJA 1PQ8A 1ZLRA 3BN9A 1V2LT 5PTPA 1AKSB 3LPRA 1V2TT 3ITIA 5AFYH 1ELFA 2PKAA 3STJA 2UWOA 1LTOA 1O2PA 3MNSA 2W7UA 3SU3A 3OY5U 1PYTC 1DSTA 1C1SA 3RC5A 4Y79A 3S9CA 3ZVBA 2WYGA 3A88A 3LGWA 2OINA 2VWOA 5JB9S 1P9SA 4BTIB 4XBDA 2Z6BD 1HAPH 3P8OA 1P03A 1TGNA 2WPJS 2GDDA 4NGAH 1G3CA 1UK4A 4XDEA 3SI3H 2FODA 4DY7B 3F1SB 2GMTC 3LJOA 4BXSA 4X1PU 3PV4A 1MQ5A 2PTCE 1TMBH 4FU7A 1QJ1B 4Y7AA 3LGIA 1O5FH 1YP9A 1UVUH 4CRDA 5FCRA 2A7JA 4M7GA 2W3KA 3TPIZ 4ABBA 3PMHB 1CBWC 1HAGE 2FXRA 2QC2A 1GI8B 3GY8A 4XBCA 2B0FA 2G5NA 1PPEE 3H7OA 1O2KA 4Y6DA 2BDBA 1LCYA 4YM9A 4NG9H 1SLUB 4NA9H 4BOHA 4MQAA 2PGQB 5HMAA 1C4V2 1FPHH 2BDYA 3UTUH 2HLCA 2WINI 3T5FH 2Y82A 3SU0A 1AFEH 2BLVA 5HGGA 3UPEA 3T2NA 3VGCB 3EYDA 1RD3B 5TCCA 3AAVA 1GI9B 1CE5A 1O3BA 1SFQB 5EXLA
chains in the Genus database with same CATH superfamily
1C2DA 2ZU1A 5CMXH 4JMYA 3T28A 1PQ7A 5F53A 1HAYB 1Z8RA 3SW2B 1YPGH 2J9NA 2QIQA 1A5IA 3TJUA 1P2MA 1H1BA 1MABB 2QE7D 2P59A 2VIPA 3F3BA 1EX3A 1K0HA 4MTBA 1HAVB 1AO5A 2VIVA 6GCHG 1IHSH 1T8NA 5K0HA 2XXLA 2G81E 4U2WA 3M7QA 2GP9B 3Q76A 1O34A 1GMCG 1NESE 4ABEA 1AKSA 3ZV9A 1BTXA 2G55A 5JDUB 2V3MA 3S9AA 3WW7A 1P01A 1Y3XA 4AFQA 3PM3A 1C2IA 1JRTA 3F9HA 1OPHB 5DP9A 1TFXA 2QAAA 7GCHF 1K28D 4KELA 1NO9H 5DP4A 4B6FA 5A0AE 3OTPA 4YZUA 2M5TA 1TNJA 4CREA 1O3LA 2ZDNA 3GISB 3ZVEA 1XX9A 2Y81A 1DUEA 3A85A 2QXJA 1ZGVA 4DOQA 1C1NA 1FIWA 3T62A 1QURH 2GZ8A 1W8BH 2WYJA 3OSYA 2D2DA 1ABIH 1CHOF 3DHKH 4NA8A 3UIRA 1O2HA 4AB9A 1BOQA 1RTFB 1HAXB 1K21H 3TGIE 4BTTB 1GMDF 3A84A 1P0SH 5SGAE 2PUXB 4FXGH 5L6NH 2P3FH 1N8OB 1H8ED 3PTNA 3SJIA 3VB7A 1E34B 2H9EH 2K1QA 1GWAA 1HPGA 4KKDA 2NU3E 3KYGA 1IQGA 1GBBA 4X1SU 4TPIZ 1O3KA 5LGOA 1FY1A 3BTTE 4A7IB 4X1QU 1H9LB 4IN1A 1A5GH 2J4IA 4J2YB 2FOMB 4D9QA 1EAWA 1YLNA 4HI3A 1QJ7B 2C8YB 1MBMA 1BHXF 3WY8A 2DE8A 3P17H 2H9TH 2F9NA 5F8TA 2P94A 1TA6A 3A80A 2XCFA 1AY6H 1FY8E 4ESTE 1ELTA 3BG8A 4QT8C 3VB6A 1T4UH 2ZDKA 4DIHH 6LPRA 4AOQA 2Y6TA 3E1XB 4ABFA 5C17A 1BTHH 2J98B 3TH4H 1WTHD 2ANWA 3LGVA 2IOTA 3A7XA 7LPRA 4P02A 2QYIA 1XKBC 2VINA 3M35A 1IOEA 1D4PB 4OS1A 4Y0ZE 4RSPA 2BB4A 2GD4B 3LDXH 1J17T 3ATKA 5GIBA 4AN7A 1BBRK 3PV5A 1GGDB 2OC7A 3ZZDA 4F49A 1O2ZA 2BOHB 4JYVH 5JBBS 4XE4A 1RIWB 3SHCH 1DFPA 5FX5A 1O3AA 3SGAE 1AB9C 1ZHMA 4GLYA 4UONA 3K9XB 1GHVH 1SPJA 3URDA 2ODYB 4BAQB 3KNXA 1GHYH 3KYFA 4FUJA 1MAYA 1BTUA 1NU9A 4AGKA 2WPKS 4WXIA 2A1DB 1YCPK 3RU4T 2TGAA 1GHWH 4I32A 3H5CB 3HKIB 3U8TH 2PW8H 2HRVA 3RMMH 4JK6A 3M7TA 2ZDVH 3GY5A 3I77A 1TAWA 4X2VA 4YT7H 1IHTH 1RJXB 4IS5A 3ZZ9A 1QIXB 1K1PA 3M5NA 1TGBA 1ARBA 2P95A 3GCHB 3HK6B 1OP8A 3LH1A 2TGDA 1THSH 1YPKH 1S6HA 2BDCA 1KXBA 3URCA 4OS4A 1KTSB 5C1YA 2HGTH 2ODQA 1TNHA 2KAIB 2R2MB 1DSUA 1LHFH 4Z0KA 1JWTA 1RS0A 2F9OA 1JOUB 1YBWA 2HPQH 4D7FA 1UVPA 4D9RA 4JYTA 3U8OH 1ETRH 1DDJA 2JETC 4DW2U 3STIA 2CF9H 3GCTG 4O3TA 1L1GA 3AVZA 3PO1B 4OM9A 2QY0B 3SO3A 4MPWA 2ZWLH 4HGCA 1A0LA 2G4UA 2SGEE 3NK8A 3SV9A 1W7GH 5E0JA 2WUBA 1ANCA 1UTPA 1XM1A 1ORFA 1A1RA 1F7ZA 2R3UA 1O5BB 4K1SA 3QWCH 1KIGH 1SGNE 4HFPB 1NPMA 4E7RG 1C1QA 3VB5A 1BBRE 2J98A 1MCTA 5EQRA 3PWBA 3T25A 4JZFH 2XBVA 4LZ1H 1MTNB 3SV2H 1UO6A 2BLWA 5DP5A 1RGQA 1THPB 1GL0E 1MTSA 1DM4B 3MHWU 4B2BA 2H2ZA 2FOCA 1CVWH 1FLEE 1TGTA 1WQVH 3LGYA 2PP6A 1LKBA 1CGJE 4OGXA 1FAXA 3RXEA 2BM2A 1TNIA 2GCTB 1ETSH 3UB0A 4ABJA 1W13U 1P09A 1OX1A 4DCDA 1ANBA 1O2MA 1ACBE 2FTLE 1TYNA 5GNDA 2R3YA 4Y0YE 3MNXA 1T8OA 2O8MA 4OS2A 3VGCC 1AZZA 1AFQB 1OWDA 2ZFQH 4B2CA 3BTEE 1GMHF 1UJ1A 4K1TA 4B74A 1FDPA 2GV7A 5FL7D 4DT4A 1V2WT 1ZRKA 2A2XH 1O3FA 2A5IA 4ZMAH 2XWBI 2OTVA 3KGPA 3M61U 1HB0B 4WXVA 1Y5UT 1SLVB 2AHME 5BRRE 2XBXA 2VWMA 4MNWA 1A7SA 2GTBA 1BTPA 1GDUA 1MTVA 1GJ4H 1HAIH 4BNRA 3BTGE 2OK5A 3PB1E 1IQEA 2SGQE 3BG4B 1S5SA 3KF2A 1CT2E 1EJNA 4ISIH 1EAIA 2WV5A 4X2XA 2ILNA 2VNTA 1TMUH 2ZP0H 4X2WA 2KAIA 4FVBA 5E2OA 3N99A 1ZPCA 3ATLA 2V0BA 4WH8A 2ZECA 1NRQH 4K60A 2Q6FA 1EAXA 3U1IB 2RCEA 5C0TA 5LPFA 4THNH 1C5YB 3S0NA 4K3JA 1V2NT 4O03A 1TBQH 2CF8H 7GCHG 4DGJA 2HNTC 1OYTH 1TLDA 1QTFA 2QCYA 4ISLA 5EGMA 1PPHE 1TMTH 2WUCA 3ZZ5A 2SFAA 3PWCA 5F03A 1YCPH 4K8BA 1N1LA 2ZCHP 3U1JB 4Q80A 1C5RA 1ZZZA 2ZO3H 3O8RA 3V0XA 3LT3A 4Q7YA 1MU8B 1O3JA 1F5RA 4U32A 3GDSA 5J4QA 2PLXA 4B73A 3QTOH 2UWPA 2QF3A 1RRKA 1O3HA 1NRRH 2ZTXA 4OGYA 2J38A 2FDAA 4I86A 1GMDG 5ESBA 5B6OA 1TE0A 1VCWA 2L74A 2PKSC 1NBME 2ZTZA 2W5EA 1GDNA 4K69A 4IMQA 4OS5A 2C8ZB 1DY8A 3MNBA 4RKJB 3VXEH 4Q7ZA 1GG6B 2G00A 2CK3D 3RXSA 2PKAB 3M7UA 4FUGA 4Y76A 1B0FA 2XNDD 1SQRA 3KHVA 1TX8A 4B6EA 2ZPRA 4WWYA 2IN2A 1C5PA 3EE7A 1GVZA 3OU0A 3LIWA 5DO4H 1MKWK 1GBLA 1IAUA 1GBDA 3AW1A 1LO6A 2BXUH 4UEHH 1AN1E 1BRBE 3MI4A 2BY9X 2XC4A 1EZSC 4XOJA 2XBWA 4CRAA 1BB0B 1LVBA 5GCHF 3UREA 3UNQA 1O30A 2TRMA 1F2SE 2OD3B 4H6TA 2YMSC 1SL3A 1YLDA 2JDID 2GZ7A 2VVVA 1GI5A 3T27A 4NIVA 3ZZBA 4K1EA 4LXBH 4AGJA 3EA9A 1BRCE 1Z1JA 1UTQA 1KXDA 2OUAA 4X6MA 1GI6A 4FUFA 1TBZH 3WWBA 1Z1IA 2ALPA 1IQLA 1C1VH 1O2RA 1T8MA 1F0RA 3SGBE 1QBOA 1O2IA 1RIWC 5LPEA 1WOFA 2VU8E 2BD2A 3VG8A 1OOKB 5AFZH 5A8ZA 1XUKA 1SOTA 2BQ7B 1UTLM 3F9FA 1C9TA 4X2YA 1NC6A 1CSOE 2HALA 2OBQA 4NSVA 4ZKNU 1CU1A 4TY6A 2ZFTA 1YPMH 2HWLB 1K9OE 1NU7B 2OLGA 3FP8E 3M5MA 1NS3A 2AYWA 5T6FA 1W11U 2ODPA 2ZDAH 4E7NA 1TOCB 1C5UA 2AIQA 4XFQA 1V3XA 1BHXB 1VITG 1PJPA 2HVXA 3RM0H 4X1NU 2F9BH 2AGEX 4JZ1A 8GCHG 1JBUH 4B2AA 1O2JA 1O2NA 1NRSH 4YOGA 2VBCA 9LPRA 2A4RA 3ZYDA 1UVTH 3KQBA 3NWUA 1PFXC 3UQVA 4HG6A 3GCHC 1EJMA 2Z94A 3U8RH 3Q77A 3RXFA 1H4WA 5DG6A 2Y5FA 1TBRH 4NIXA 1GHXH 2FOBA 1F0SA 1TALA 4JZEH 4CH8B 1BDAA 5C94A 4X8VH 1ZR0A 1QR3E 1KMHB 5LPRA 1EASA 1KYNA 1FY5A 2BLOA 1TNKA 1SHHB 4YLQH 3MU0A 3GCTF 3QN7A 4IN2A 2KZ4A 1ZRBA 1ZJKA 4VGCB 1MUEB 3RP2A 5HXFA 1GBEA 3PO1C 1CT4E 2IJOB 1UVSH 2BQ6B 1LHDH 1U6QA 2A4OA 1MQ6A 4LOYH 5JPMH 4I8LA 1B0EA 2BQWB 1AWFH 1T31A 2FYRA 2UUYA 4H42U 3ESTA 2ZI2H 1GCTB 4IC5A 4RT1A 1CA8B 1H9HE 3BTWE 2I6QA 3SV8A 1OP0A 2R2WU 3LU9B 1YY3A 3ENSB 4LZ4B 2Q6GA 1HFDA 4CHAC 1MTUA 1NRNH 1C9PA 1FV9A 2O8WA 4GSOA 1VITH 3S7HB 3A8AA 3SGQE 1P2NA 1QL9A 2LPRA 4NA7A 4UFFH 1HAZB 2GV6A 1FI8A 5DP6A 1UTOA 1RXPA 1OWJA 2XRCA 1SLWB 3LJJA 2PSXA 4KTUA 1BTYA 3D49H 4ABHA 1FN8A 3GDVA 2THFB 2ZIQH 3QGJA 3FOAA 2AERH 2QGRA 3HATH 1CT0E 2GCTC 1V2OT 2WPIS 4XSKU 1W2KH 1ZSJA 4K2YA 1C5VA 5FBIA 1MBQA 1PQAA 1MKWH 2VJ1A 3GY6A 4R0IA 1C5LH 4WF8A 2OQUA 1G2LA 3ZVFA 1JMOH 4KTSA 1DITH 1QZ8A 2WV9A 3VB3A 3DSPA 4I8HA 1W3CA 5DGJA 3B8JA 1GVKB 2FIRH 2BD3A 4O9VA 1KXFA 1VJAU 1W0ZU 4A1XA 1GMHG 1P12E 3A81A 2DUCA 1WYKA 3PROA 5DP8A 5FBEA 5FXLA 2V6NA 1SGFG 1UVOA 2AIPA 1AQ7A 2ZEBA 1GI3A 1O3CA 3ZVDA 1GI7B 2BD7A 2VWNA 1C5TA 1XUGA 2STAE 1O2OA 1QB9A 3PLKA 1J16A 3EAJA 1GJ6A 3TU7H 4RN6A 1XXDA 4GHTA 2D26C 2ZKSA 2BD8A 2BD5A 2NU4E 1BTWA 1HCGA 3OY6U 3RC6A 3TH3H 5IK2D 2O9QA 4FETA 1BQYA 1O2GH 4UE7H 5FAHA 3SU1A 1XUFA 4ASUD 1CQQA 3VFEA 3L3TA 1NBMD 1LMWB 2ULLA 5J4SA 2AGGX 1MH0A 3GY7A 8KME2 2BVSH 4NWKA 1V2ST 4ZROA 1GBTA 1FN6A 5EXNA 3ZZ3A 4X6OA 1CO7E 3W95A 2RFKC 2XC5A 2ANKH 1WSSH 1UTMA 1DICA 1OXGA 1CA0B 2ZU2A 4X6PA 4JZDH 4FUDA 3B23B 2ZFRH 2C8XB 2VGCB 5IYTA 2A7CA 1TWXB 1Y3UA 3ZIAD 1HGTH 4NSYA 1GHAF 2FYQA 5C2ZA 2B5TB 5EQQA 1AU8A 3M3SA 2ZCLP 2F4LA 4CRCA 4I33A 1DVAH 1GJAB 1BTZA 3QZQA 1PPBH 2FLBH 2O8LA 3EDXB 4INKA 1GI2A 2ZDLA 3E3TA 3WWFA 2ZDMA 3C27B 4Z1MD 1HAOH 5A09A 3TH2H 5EJLA 1ELEE 1Q31A 1NTPA 1K1IA 3N7OA 1K2I1 5CHAC 4Q63A 2WZQA 2FESH 1GI4A 1FONA 2F3CE 2HVYB 1IQHA 2VWLA 2PHBA 4I8JA 1EPTB 1MZAA 1Z6EA 2KFWA 1ZJDA 1SBWA 1SGIB 3EQ0H 1TONA 4DIIH 1P2OA 1HJ8A 1ZMNA 1A46H 2HPPH 4Q7XA 3ODFA 1P02A 5CE1A 2A31A 3OAAD 1DPOA 2FI4E 5FCKA 2JJ1D 4A6LA 1GJ8B 1GBHA 3SJ9A 5EU8A 1TQ0B 1NY22 2P93A 5DP7A 1SGDE 3S9BA 1TX7A 1P2IA 5GCHG 1BITA 2F91A 3PYHA 1S82A 2AMQA 1LHEH 1SKYE 3QLPH 1HAHH 2K0QA 3RMLH 1QRZA 1RFNA 2ZPQA 2CHAC 2B9LA 4I7YH 2Z3CA 3RXLA 3CP7A 2EI6A 3SU4A 1KTTB 1SQAA 2BX4A 4JK5A 3MOCA 1S6FA 4ZHLU 5K7RA 4YTAA 1MAXA 4AG2A 2D8WA 3P8NA 3FANA 2EI8A 1GJCB 2A7HA 2VVCA 2O8UA 1VGCB 1KLIH 5GXPA 2PFEA 2SGAA 2Q1JA 4Z6AH 1SI5H 5EW1H 1XUIA 3K6ZA 1DXPA 4Q4LA 3DFLA 1BMMH 1P06A 2BY8X 2F9PA 3PMBB 3HGNA 1SG8B 4WVPE 1O3PB 3P92A 1C2JA 2BXTH 1H9IE 1FY4A 3TNSA 4INHA 3EE0B 1VITF 1O5CB 1O2TA 2QA9E 1KLJH 3RC4A 5T6GA 1O3EA 2FOGA 4X8UH 1AVWA 8GCHF 3Q00A 3UR9A 4IMZA 4AFSA 5CHBA 1ESBA 1MCVA 3MNCA 2VIWA 1O2QA 3KN2A 4MG3A 3GY4A 5EQSA 2BX3A 6CHAB 2SNWA 3A89A 3R0FA 2SGFE 3D23A 3NPSA 4GAWA 1EB2A 1THRH 2FLRH 1W0JD 2ZGBH 2WV4A 1QB1A 2AFQB 1C1WH 2BYAX 1XMNB 1AMHA 1ELCA 2PWXA 3RM2H 1ZPBA 2OC0A 3SQEE 3SZNA 1QHRB 1YYY1 1ZYOA 3TITA 2XW9A 1EPTA 4HZHA 3MMGA 1V2QT 1QQUA 2W6ID 2XTTB 1D3TB 1ETTH 1N6YA 2ZTYA 3GYMA 4ZHMU 3PV2A 4WMEA 1SGRE 1YM0A 4BANB 2GCHG 2STBE 2ZHEH 1P2QA 2C93B 1AE5A 5A0BA 1SLXB 1SGCA 1D9IA 4GHQA 5JBTA 1GBMA 3IWMA 1BT7A 3A8CA 2Y5HA 3A86A 2BZ6H 3F6UH 4CRFA 2JKHA 5KGOA 2V35A 4CRGA 3HPTB 1FZZA 7KMEH 2PGBB 5T3HA 2AMPA 1O3NA 3ATMA 2PR3A 2XCNA 4WMDA 5E2PA 1S81A 2G51A 3VXFH 2JH6D 5C3NA 3TGJE 1WTGH 3LH3A 1YPJH 2GMTB 2Z9KA 3KQEA 1AVXA 1T4VH 5BPEA 1TRNA 3FFGA 2FOFA 4UDWH 4WMFA 5EOKA 3TK9A 3W94A 3PLPA 1COWD 3ZZCA 1GBJA 2VB0A 3SUGA 2FOHA 3SUDA 3ZV8A 1CBWB 3VB4A 2V3HH 1DWEH 1E37B 1PPGE 3I29A 3Q3KA 2HNTF 4YO9A 3LGTA 5C0UA 1GBIA 2FOAA 1BMAA 2Z9GA 3NZIA 3K2UA 3AAUA 1O5AB 3MU5A 1LVYA 2OBOA 4KGAA 1SFIA 1ZMLA 2FP7B 1P2JA 4ISNA 1HXEH 1EZQA 2O8TA 5A8YA 2C3SA 4AG1A 1HNEE 1O5DH 4FUCA 1C1MA 1FPCH 2ZQ1A 4P00A 4BXWA 3E16B 1ANDA 3A87A 3LC3A 1BMLA 1C4U2 2FX4A 1O33A 2K8IA 1O32A 4YOJA 1W0KD 3QDZB 1OWKA 1DY9A 1RTKA 1GJBB 1V2PT 3CENA 1G3BA 1P3CA 3FN8A 1IQKA 3S69A 4JYUH 1LPZB 1SOZA 2Y80A 4GCHF 4X6NA 3P8GA 1H8DH 3D62A 3SU2A 1A0HB 1UMAH 2ZHDA 3SHAH 1LVMA 2QV1A 5EJZA 1VR1H 2FX6A 1W12U 1K22H 4UFEH 1O38A 2J92A 1Z71A 1KSNA 6ESTA 2RG3A 3RXVA 5A8XA 1QL7A 4U30A 2GKVE 2CXVA 2ZZUH 3ATIA 2M2AA 1GJ9B 1TOMH 1PPZA 4K8YA 1F92A 1GHAG 3RDZA 1E0FD 1N8OC 3KQ5A 1YPHC 1CGIE 1ZTJA 2J95A 5T1VA 1ZGIA 2GT8A 2NWNA 3ZYEA 1QCPA 3N7DA 4BAKB 2W6JD 4ZCNA 2CGAA 1OKXA 3KIDU 3TK6A 4NFEA 4H6SB 3FZDA 3UUZA 1HIAB 1ELVA 2JH0D 1XUJA 3U69H 1MD8A 3GCOA 4XRNA 1K1LA 2FTMA 5L2ZH 1TPAE 3BTKE 1BA8B 1A5HA 1O5GH 5F6MA 1UK3A 1MZDA 1SQTA 1LDTT 3ZVAA 3E91A 2F43B 4Y11E 3CNRA 1D3QB 1VKYA 4Y10E 5EW2H 1C5ZB 2KCOA 1ZHRA 2R0LA 3JZ1B 4HTCH 1EP6A 1V2MT 2P3UB 2VIQA 3RXRA 3FO8D 1O37A 3EA8A 1DWBH 1PYTD 3MO9A 1L4ZA 1V2UT 1F0UA 2GT7A 3U98H 3SU6A 2G5VA 1IQNA 2RA0A 1VCPA 2Q6DA 1F0TA 2R9PA 2ZFPH 4SGAE 2FM2A 3TVJB 1P05A 3SNAA 1ANEA 3RU4E 4AC9A 1FIZA 1QRXA 1BZXE 2ZG0H 3QK1A 2Z3EA 3P95A 1EB1H 3RXDA 1GGDC 1M9UA 1XVOA 1AUJA 5EXMA 1VGCC 1KXCA 3DFJA 2Y7XA 5TJXA 1UTNA 1GHBG 1S84A 3SN8A 4E05H 1C1OA 2SNVA 2ZPSA 1O3OA 2WSSD 1MTWA 1ZMJA 2EI7A 3HKJB 1TNLA 1L4DA 1GVLA 3F2FA 1J8AA 1QA0A 4SGBE 5JB8S 3CS7A 3OEED 4DJZB 2H6MA 3EGKH 3UOUA 1HRTH 4CH2B 4DG4A 1EAUA 2FI3E 1G37A 3GOVB 1P11E 5AHGH 8ESTE 1YPLH 3SYJA 3UR6A 2NU0E 3MH5A 4RI0A 3RXJA 2EQNA 1LKAA 1A4WH 4B1TA 2CMYA 2BDHA 3R3GB 2D1JA 2FI5E 5C1XA 4X8TH 2TGPZ 2ASUB 3UOPA 3V3MA 4I8GA 2J34A 2Z9JA 1ELDE 2FS8A 2VIDA 3D65E 6CHAC 1L1NA 3E6PH 1C2GA 1C5NH 1GL1A 4J1YA 1ABJH 3QUMP 5C20A 2BD9A 3SI4H 2FZZA 1HDTH 2GZ9A 1FMGA 3P70B 1O3GA 1WBGB 1HIAA 2W3IA 1K1OA 1QB6A 1AGJA 1UHBB 3HGPA 1EKBB 2KM0A 3BTHE 3BTME 3SV6A 4UFDH 1FXYA 4FU8A 3P8FA 1L2EA 1SSXA 2J2UA 4FUIA 3MWIU 4LK4A 3SNBA 1N6XA 3B9FH 1O35A 1TIOA 2GCHF 2WPLS 2BD4A 1NROH 2ZGJA 3P6ZB 4ZXXH 3S7KB 1O36A 3SOSA 1F5KU 3UQOA 4INLA 3SQHE 4PROA 1HBTH 1P10A 2ZA5A 2W7SA 1WCZA 4CRBA 3ZZ8A 4BAOB 5ETXA 1C5OH 2AEIH 1E38B 2G52A 2JETB 4JZIA 4UD9H 2EEKA 1DXWA 4TY7A 1L1JA 1J15A 3SJKA 3MU1A 2J97A 4NWLA 1C5WB 1HJAB 1MTNC 4NIWA 3F2GA 4TSFD 1B5GH 3SBKA 4YXWD 1E1RD 5DP3A 4IBLH 2B8OH 2P16A 3SZEA 1SGQE 4BAHB 1OHHD 4NFFA 2P8OB 2XYAA 1EATA 1GBKA 2ALVA 3LONA 3RXMA 1O2WA 2FO9A 3F0OA 3RXQA 1QRWA 1FAKH 4GUXA 4FVDA 5JBAS 1K1JA 4AX9H 2VVUA 3OTJE 1AFQC 3BIUH 4MLFB 1C2FA 2HNTE 5C5NA 3MH6A 4O97A 2UUFB 2AMDA 1G36A 1DLKB 3AASA 2PSYA 1BIOA 2ZHWH 1NT1A 4DT7B 5DPAA 1MD7A 1SGYE 3PTBA 1EP5A 3VPKA 2H9HA 1YKTA 1O3DA 2A5KA 1D6RA 1TX6A 5A2MH 1QA7A 4TWYA 3TJOA 2ZGXH 4ZAEA 5FPTA 1QGFA 1Y5AT 2Z3DA 3BG4C 1G30B 3OE7D 2AS9A 2Z9IA 1YPHE 3DA9B 1NRPH 3SNDA 2F9UA 5GPIB 4NZLA 3T26A 2ZHFH 4DURA 1SR5C 1LHCH 1S83A 3A8DA 3TLOA 4ABAA 4TWWA 1ZSLA 1GBCA 1O2UA 1PPFE 1UHBA 3HK3B 1BMNH 2QF5A 4ZH8A 3W1EA 4H4FA 1D3PB 3M5LA 3M3VA 3K65B 4GCHG 3RXAA 1V2VT 5HM2A 3A83A 3MO6A 4Y71A 2YNAA 2TIOA 4MNXA 4Y7BA 1C5MD 4YESB 2RA3A 2ZU4A 1KY9A 3TK5A 2DE9A 3KEEA 1FNIA 1C2MA 1QNJA 2EC9H 2PV9B 1UW7A 1DLEA 1TNGA 3LOXA 5G4BA 4OS7A 1AI8H 1TRYA 1A2CH 1G3EA 1K1MA 1C2HA 1KLTA 1GBFA 5KECA 4A92A 3M3TA 1OWEA 5GDSH 3GY2A 1CGHA 1Y8TA 5DSFA 1T7CA 3QO6A 2QXIA 2LP6A 4B76A 4AFZA 1FY3A 2GGVB 4A5TS 4ISHH 2YOLA 1GG6C 3U9AH 5EG4A 1FUJA 1MMJN 1IQFA 3I78A 4R8TB 3CS0A 1TPSA 3FVFB 4O3UA 1TQ7B 3DUXH 1LHGH 3T29A 3RLWH 1XKAC 1EJAA 3NUMA 2PKSB 3IG6B 3RU4D 2SGPE 1E36B 1QQ4A 4FUBA 2UUJB 2ANMH 3QGNB 1G32B 4ZKRU 5E8EH 1SGPE 1WQSA 2L6OA 2ZFFH 3RXOA 2J5UA 1ID5H 2XOKD 1X7AC 3DSOA 3DSGA 4CR5A 5EJ1A 1A61H 1P8VC 1GJDB 1QFKH 2JH5D 1AVGH 4AYYB 1J14A 5HIZA 1BRUP 1NFYA 4FU9A 4ZUHA 5AF9H 2IJD1 1RTLA 1E35B 3FP7E 1MU6B 1P04A 5LH8A 1JRSA 5I25A 1ZPZA 1GDQA 3FP6E 2KCYA 1O2LA 4AFUA 2OC8A 3F9GA 2FOEA 1Z8JB 4D8NA 4WJG2 1Y5BT 2H5DA 3ZZ6A 1JIMA 2ZGHA 2OP9A 1DOJA 2I6SA 1JIRA 5DK1A 5ESTE 2BLQA 4MNVA 3GS9A 1Z8GA 3MO3A 1ZTKA 1HYLA 3ZZAA 1C1PA 1SMFE 3Q3YA 1OWHA 3L33A 1TPOA 1C4Y2 1EOLA 1A0JA 2ESTE 1GHBF 4YLUA 4F4OC 1LPGB 1O2SA 2OQ5A 2YMSB 4XD7D 1Y3WA 1XVMA 1DUAA 3MYWA 5IDKA 1D3DB 4YT6H 1HAVA 1LQEA 1S0QA 2WPHS 1C5SA 1V2KT 2C4FH 5TCAA 5FHTA 1HUTH 2YNBA 3NCLA 3SJ8A 3BEFB 1HV7A 4BTUB 4E06H 1O0DH 4IW4E 2VH0A 3RXHA 3GDUA 2KR7A 3F2HA 1S6LA 5EODA 3ZVCA 4X8SH 1LPKB 2Y7ZA 2A45B 3A7VA 1JXPA 2LNCA 3BEIB 4RKOB 1FQ3A 3MTYA 4K5ZA 1EOJA 2IPHA 2C8WB 5H4IB 4JCNA 4AORA 2F9VA 4MDSA 1DANH 1TA2A 1LQDB 2OCVB 3F0PA 2VH6A 5CDFE 2FWWA 3SNEA 2QN5T 3FAOA 3Q3XA 3SJOA 3RXUA 2FPZA 1BJVA 1YCPM 2Z9LA 1SQOA 3E90B 3RMNH 3RMOH 3M36A 1Z7KA 2BOKA 1SGFA 1V2RT 4WH6A 1OS8A 1CHGA 2H1UA 1WAYB 2AH4X 3GYLB 1GHZA 3ATWA 1PPCE 3UY9A 1SB1H 5C1UA 1XUHA 3OFND 5L2YH 4VGCC 1ZTLA 1QY6A 5B6LA 1A3BH 1TRMA 2J94A 4Q2KA 4XBBA 5C5OA 4ZKSU 3DCLA 3QTVH 4U01A 3LKWA 2EY4C 3A82A 5AVDA 1W10U 2BHGA 3RXBA 1GCTC 3PRDA 1WDIA 3UWJH 1UCYK 1S0RA 4CR9A 1QJ6B 4NIYA 3BV9B 4NZQA 1BUIA 1QL8A 1W0YH 2QF4A 4GVUA 3ZVGA 4CBOA 1O31A 2ZNKH 1C5QA 4TYDA 4ABDA 3NXPA 4NCYA 4RT0A 2KCAA 3LC5A 1HJAC 3A7ZA 1IQMA 1GBAA 5KEDA 3FZZA 2F83A 3SUFA 2Z7FE 1B7XB 1C1RA 5HKKD 1YGCH 3NKKA 1DWCH 2P8OC 3RXKA 4MPXA 2UUKB 1QBVH 5HYOA 1LVOA 3BF6H 4YOIA 2A4QA 4CHAB 3SORA 1SVPA 3RXCA 4AZ2B 3GCNA 3UFAA 1Y3VA 2BY6X 2QF0A 3ELAH 1INCA 1GJ5H 5EPYA 1V6DA 5E0HA 3RUOA 2Y5GA 1TGCA 3RLYH 1AWHB 1ESTA 1UTKA 1DX5M 5GWZA 2PUQH 2TGTA 2ZQ2A 4AB8A 5HM9A 2IPQX 3GY3A 4B75A 2H5CA 1IQJA 4WY3A 1YF4A 2A5AA 3M5OA 1KXEA 4B71A 3RXIA 3UAIC 4I8KA 1TB6H 1C5XB 1ELBA 4ZKOU 3PRBA 2G8TA 1GI1A 1O2VA 3NRLA 2NU1E 3JZ2B 2AGIX 1YC0A 1ELGA 1C2LA 1C2KA 1T32A 2C90B 3LGUA 1H8HD 2B7DH 3AW0A 1Q2WA 2ZHQH 2VIOA 2RDLA 4KTCA 1MKXK 3UNSA 3SNCA 4D76A 2P3TB 7ESTE 3KL6A 2TPIZ 4IC6A 2ZGCA 1IQIA 2BVRH 2QXGA 3C1KA 3V7TA 4A1VA 1EUFA 2FMJA 4MPVA 5ABWA 3H09A 4BAMB 2W26A 4Y8XA 1DT2A 1NZQH 2YMSD 1F5LA 2TBSA 3F68H 3UNRA 1EQ9A 6GCHF 2CN0H 4IGDA 1BBRH 1UCYE 1XXFA 2EA3A 3RXTA 3TGKE 1GMCF 1EXFA 1SGEE 1HJ9A 3EA7A 2GDEH 2BVXH 1G9IE 1NFXA 4X0WU 4M9FA 2A4GA 1O2XA 1C1UH 3O8CA 1EZUC 3PMAB 1GCDA 3BSQA 2BTCE 1WXRA 3MH7A 1CA0C 3KCGH 4FUEA 1O3IA 3N7EA 1UK2A 1SHYA 2VGCC 3FKSD 3DD2H 4I31A 5DN6D 1AUTC 3O8BA 1EFRD 1AZ8A 1C2EA 3RXPA 1DS2E 4ISOA 5C67A 5L30H 4ACBA 3A8BA 3MU4A 4Y8ZA 1G3DA 4KP0A 3QX5H 8LPRA 4ABGA 1SC8U 5FPSA 3SV7A 1W7XH 1Q3XA 1O2YA 2CJIA 5FX6A 3TJVA 4X1RU 3ZZ7A 3OX7U 3RXGA 3E0NB 4OS6A 2XWAA 2QXHA 1S85A 1Z8IB 2HOBA 3E8LA 1CHOG 2SGDE 1ZOMA 1KDQB 1NFWA 3ZZ4A 4FUHA 1NM6A 3V12A 1VCQA 3KQCA 1YPEH 1A3EH 1AHTH 3OYPA 4ZXYH 3BTDE 3H7TA 4TT3D 1P9UA 1EPTC 1YLCA 3AK5A 1HXFH 2ANYA 3BTFE 3SUEA 3KQDA 1BCUH 3PLBA 1DE7H 1GPZA 2BY7X 1UCYH 3TIUA 3TJNA 1Y3YA 1ELAA 1WUNH 3K6YA 3MH4A 5F8XA 9ESTA 4MNYA 5JYIA 5GJ4B 3BIVH 1ESAA 1GI0A 1H8IH 5CHAB 1FJSA 2NU2E 1TABE 1NFUA 3IITA 1AE8H 4F48B 1P57B 1WU1A 5FPYA 1PQ5A 1Z6JH 2R0KA 4ZHAA 2ZC9H 3MFJA 1BJUA 1BRAA 2BZAA 1HLTH 1E1QD 1OP2A 4GPGA 2UWLA 3BTQE 1ZHPA 3VEQB 2OXSA 1O5EH 1SGTA 1VJ9U 3L6PA 3TNTA 1GJ7B 2CV3A 1DWDH 1TGSZ 5EPNA 2BMGB 1O3MA 4UFGH 1G2MA 3F9EA 2BDAA 5E0GA 1D6WA 2XNIA 1QBNA 1O39A 2OC1A 2ZFSA 3A7WA 3QZRA 3GICB 2CHAB 2JJ2D 1L0ZA 3O8DA 3G01A 2KCPA 4F55A 4MVNA 2GVFA 2ZU3A 3E0PB 5DKMA 2ZCKP 4D7GA 3V13A 4CBNA 3SU5A 2WPMS 1YWUA 1ARCA 3UWIA 1WV7H 2XC0A 4MPUA 2A0QB 1KXAA 2PTNA 4ABIA 1OWIA 2BY5X 1C1TA 1P2KA 1AB9B 5T6DA 5JBCS 2ZU5A 3A7TA 1TPPA 1T8LA 1V2JT 2BDGA 1MKXH 1P3EA 1AD8H 4DVAU 5F8ZA 5A0CA 1J9CH 4ASHA 1W14U 2XBYA 1VZQH 2A2QH 3BEUA 1ZSKA 4TPYA 4AYVB 3PMJA 2V3OH 2G4TA 1Y59T 2A32A 1OSSA 2GX4A 2FEQH 1OYQA 2BDIA 3DT0H 3ODDA 1KDQA 2FS9A 4FOUC 4Y8YA 3A7YA 1AIXH 3M37A 2WHXA 5DJ7A 4A1TA 1K1NA 1NN6A 1EZXC 2ZF0H 3MU8A 1BMFD 5I46H 1UTJA 1PQ8A 3MQKC 1ZLRA 3BN9A 1V2LT 5PTPA 1AKSB 3LPRA 5EIYA 1V2TT 3ITIA 5AFYH 1ELFA 2PKAA 3STJA 2UWOA 1LTOA 1O2PA 3MNSA 2W7UA 3OEHD 3SU3A 3OY5U 1PYTC 1DSTA 1C1SA 3RC5A 4Y79A 3S9CA 3ZVBA 2WYGA 3A88A 3LGWA 2OINA 2VWOA 5JB9S 1P9SA 4BTIB 2RDEA 4XBDA 2Z6BD 1HAPH 3P8OA 1P03A 1TGNA 2WPJS 2GDDA 4NGAH 1G3CA 1UK4A 4XDEA 3SI3H 2KX4A 2FODA 4DY7B 3F1SB 2GMTC 3LJOA 4BXSA 4X1PU 3PV4A 1MQ5A 2PTCE 1TMBH 4FU7A 1QJ1B 4Y7AA 2LELA 1FX0B 3LGIA 1O5FH 1YP9A 1UVUH 4CRDA 5FCRA 2A7JA 4M7GA 2W3KA 2WPDD 3TPIZ 4ABBA 3PMHB 1CBWC 1E79D 1HAGE 2FXRA 2QC2A 1GI8B 3GY8A 3U28C 4XBCA 2HLDD 2B0FA 2G5NA 1PPEE 3H7OA 1O2KA 5HIYA 4Y6DA 2BDBA 1LCYA 4YM9A 4NG9H 1SLUB 4NA9H 4BOHA 4MQAA 2PGQB 5HMAA 4ACAA 1C4V2 1FPHH 2BDYA 3UTUH 2HLCA 2WINI 3T5FH 2Y82A 3SU0A 1AFEH 2BLVA 5HGGA 3UPEA 2GJGA 3T2NA 3VGCB 2V7QD 2JIZD 3EYDA 1RD3B 5TCCA 3AAVA 1GI9B 1CE5A 1O3BA 1SFQB 5EXLA
chains in the Genus database with same CATH topology
1C2DA 2ZU1A 5CMXH 4JMYA 3T28A 1PQ7A 1HAYB 1Z8RA 3SW2B 1YPGH 2J9NA 2QIQA 1A5IA 3TJUA 1P2MA 1H1BA 2P59A 2VIPA 1EX3A 4MTBA 1HAVB 1AO5A 2VIVA 6GCHG 1IHSH 1T8NA 5K0HA 2XXLA 2G81E 4U2WA 3M7QA 2GP9B 3Q76A 1O34A 1GMCG 1NESE 4ABEA 1AKSA 3ZV9A 1BTXA 2G55A 5JDUB 3S9AA 1P01A 1Y3XA 4AFQA 3PM3A 1C2IA 1JRTA 3F9HA 1OPHB 5DP9A 1TFXA 2QAAA 7GCHF 1K28D 4KELA 1NO9H 5DP4A 5A0AE 4YZUA 2M5TA 1TNJA 4CREA 1O3LA 2ZDNA 3GISB 3ZVEA 1XX9A 2Y81A 1DUEA 3A85A 2QXJA 1ZGVA 4DOQA 1C1NA 1FIWA 3T62A 1QURH 2GZ8A 1W8BH 2WYJA 3OSYA 2D2DA 1ABIH 1CHOF 3DHKH 4NA8A 3UIRA 1O2HA 4AB9A 1BOQA 1RTFB 1HAXB 1K21H 3TGIE 4BTTB 1GMDF 3A84A 1P0SH 5SGAE 2PUXB 4FXGH 5L6NH 2P3FH 1N8OB 3PTNA 3SJIA 3VB7A 1E34B 2H9EH 2K1QA 1GWAA 1HPGA 4KKDA 2NU3E 4X1SU 1IQGA 1GBBA 4TPIZ 1O3KA 5LGOA 1FY1A 3BTTE 4A7IB 4X1QU 1H9LB 4IN1A 1A5GH 2J4IA 4J2YB 2FOMB 4D9QA 1EAWA 4HI3A 1QJ7B 2C8YB 1MBMA 1BHXF 3WY8A 2DE8A 3P17H 2H9TH 2F9NA 5F8TA 2P94A 1TA6A 3A80A 2XCFA 1AY6H 1FY8E 4ESTE 1ELTA 3BG8A 4QT8C 3VB6A 1T4UH 2ZDKA 4DIHH 6LPRA 4AOQA 2Y6TA 3E1XB 4ABFA 1BTHH 3TH4H 1WTHD 2ANWA 3LGVA 2IOTA 3A7XA 7LPRA 2QYIA 1XKBC 2VINA 3M35A 1IOEA 1D4PB 4OS1A 4Y0ZE 4RSPA 2BB4A 2GD4B 3LDXH 1J17T 3ATKA 5GIBA 4AN7A 1BBRK 1GGDB 2OC7A 3ZZDA 4F49A 1O2ZA 2BOHB 4JYVH 5JBBS 4XE4A 1RIWB 3SHCH 1DFPA 5FX5A 1O3AA 3SGAE 1AB9C 1ZHMA 4GLYA 4UONA 3K9XB 1GHVH 1SPJA 3URDA 2ODYB 4BAQB 3KNXA 1GHYH 4FUJA 1MAYA 1BTUA 1NU9A 4AGKA 2WPKS 4WXIA 2A1DB 1YCPK 3RU4T 2TGAA 1GHWH 4I32A 3H5CB 3HKIB 3U8TH 2PW8H 2HRVA 3RMMH 4JK6A 3M7TA 2ZDVH 3GY5A 3I77A 1TAWA 4X2VA 4YT7H 1IHTH 1RJXB 4IS5A 3ZZ9A 1QIXB 1K1PA 3M5NA 1TGBA 1ARBA 2P95A 3GCHB 3HK6B 1OP8A 3LH1A 2TGDA 1THSH 1YPKH 1S6HA 2BDCA 1KXBA 3URCA 4OS4A 1KTSB 5C1YA 2HGTH 2ODQA 1TNHA 2KAIB 2R2MB 1DSUA 1LHFH 4Z0KA 1JWTA 1RS0A 2F9OA 1JOUB 1YBWA 2HPQH 4D7FA 1UVPA 4D9RA 4JYTA 3U8OH 1ETRH 1DDJA 2JETC 4DW2U 3STIA 2CF9H 3GCTG 4O3TA 1L1GA 3AVZA 3PO1B 2QY0B 3SO3A 4MPWA 2ZWLH 4HGCA 1A0LA 2G4UA 2SGEE 3NK8A 3SV9A 1W7GH 5E0JA 2WUBA 1ANCA 1UTPA 1XM1A 1ORFA 1A1RA 1F7ZA 2R3UA 1O5BB 4K1SA 3QWCH 1KIGH 1SGNE 4HFPB 1NPMA 4E7RG 1C1QA 3VB5A 1BBRE 1MCTA 5EQRA 3PWBA 3T25A 4JZFH 2XBVA 4LZ1H 1MTNB 3SV2H 1UO6A 2BLWA 5DP5A 1RGQA 1THPB 1GL0E 1MTSA 1DM4B 3MHWU 4B2BA 2H2ZA 2FOCA 1CVWH 1FLEE 1TGTA 1WQVH 3LGYA 1LKBA 1CGJE 4OGXA 1FAXA 3RXEA 2BM2A 1TNIA 2GCTB 1ETSH 4ABJA 1W13U 1P09A 1OX1A 4DCDA 1ANBA 1O2MA 1ACBE 2FTLE 1TYNA 2R3YA 4Y0YE 3MNXA 1T8OA 2O8MA 4OS2A 3VGCC 1AZZA 1AFQB 1OWDA 2ZFQH 4B2CA 3BTEE 1GMHF 1UJ1A 4K1TA 4B74A 1FDPA 2GV7A 1V2WT 1ZRKA 2A2XH 1O3FA 2A5IA 4ZMAH 2XWBI 2OTVA 3KGPA 3M61U 1HB0B 4WXVA 1Y5UT 1SLVB 5BRRE 2XBXA 2VWMA 4MNWA 1A7SA 2GTBA 1BTPA 1GDUA 1MTVA 1GJ4H 1HAIH 4BNRA 3BTGE 3PB1E 1IQEA 2SGQE 3BG4B 1S5SA 3KF2A 1CT2E 1EJNA 4ISIH 1EAIA 2WV5A 4X2XA 2ILNA 2VNTA 1TMUH 2ZP0H 4X2WA 2KAIA 4FVBA 5E2OA 1ZPCA 3ATLA 2V0BA 4WH8A 2ZECA 1NRQH 4K60A 2Q6FA 1EAXA 3U1IB 2RCEA 5LPFA 4THNH 1C5YB 3S0NA 4K3JA 1V2NT 4O03A 1TBQH 2CF8H 7GCHG 4DGJA 2HNTC 1OYTH 1TLDA 1QTFA 2QCYA 4ISLA 5EGMA 1PPHE 1TMTH 2WUCA 3ZZ5A 2SFAA 3PWCA 5F03A 1YCPH 4K8BA 1N1LA 2ZCHP 3U1JB 4Q80A 1C5RA 1ZZZA 2ZO3H 3O8RA 3V0XA 3LT3A 4Q7YA 1MU8B 1O3JA 1F5RA 4U32A 3GDSA 5J4QA 2PLXA 4B73A 3QTOH 2UWPA 2QF3A 1RRKA 1O3HA 1NRRH 2ZTXA 4OGYA 2J38A 2FDAA 1GMDG 5ESBA 5B6OA 1TE0A 1VCWA 2PKSC 2ZTZA 2W5EA 1GDNA 4K69A 4IMQA 4OS5A 2C8ZB 1DY8A 3MNBA 4RKJB 3VXEH 4Q7ZA 1GG6B 2G00A 3RXSA 2PKAB 3M7UA 4FUGA 4Y76A 1B0FA 3KHVA 1TX8A 2ZPRA 4WWYA 2IN2A 1C5PA 1GVZA 3OU0A 3LIWA 5DO4H 1MKWK 1GBLA 1IAUA 1GBDA 3AW1A 1LO6A 2BXUH 4UEHH 1AN1E 1BRBE 3MI4A 2BY9X 2XC4A 1EZSC 4XOJA 2XBWA 4CRAA 1BB0B 1LVBA 5GCHF 3UREA 3UNQA 1O30A 2TRMA 1F2SE 2OD3B 4H6TA 1SL3A 1YLDA 2GZ7A 2VVVA 1GI5A 3T27A 4NIVA 3ZZBA 4K1EA 4LXBH 4AGJA 3EA9A 1BRCE 1Z1JA 1UTQA 1KXDA 2OUAA 4X6MA 1GI6A 4FUFA 1TBZH 1Z1IA 2ALPA 1IQLA 1C1VH 1O2RA 1T8MA 1F0RA 3SGBE 1QBOA 1O2IA 1RIWC 5LPEA 1WOFA 2VU8E 2BD2A 1OOKB 5AFZH 5A8ZA 1XUKA 1SOTA 2BQ7B 1UTLM 3F9FA 1C9TA 4X2YA 1NC6A 1CSOE 2HALA 2OBQA 4NSVA 4ZKNU 1CU1A 4TY6A 2ZFTA 1YPMH 2HWLB 1K9OE 1NU7B 2OLGA 3FP8E 3M5MA 1NS3A 2AYWA 5T6FA 1W11U 2ODPA 2ZDAH 4E7NA 1TOCB 1C5UA 2AIQA 4XFQA 1V3XA 1BHXB 1VITG 1PJPA 2HVXA 3RM0H 4X1NU 2F9BH 2AGEX 4JZ1A 8GCHG 1JBUH 4B2AA 1O2JA 1O2NA 1NRSH 4YOGA 9LPRA 2A4RA 3ZYDA 1UVTH 3KQBA 3NWUA 1PFXC 3UQVA 3GCHC 1EJMA 2Z94A 3U8RH 3Q77A 3RXFA 1H4WA 5DG6A 2Y5FA 1TBRH 4NIXA 1GHXH 2FOBA 1F0SA 1TALA 4JZEH 4CH8B 1BDAA 4X8VH 1ZR0A 1QR3E 5LPRA 1EASA 1KYNA 1FY5A 2BLOA 1TNKA 1SHHB 4YLQH 3MU0A 3GCTF 3QN7A 4IN2A 1ZRBA 1ZJKA 4VGCB 1MUEB 3RP2A 5HXFA 1GBEA 3PO1C 1CT4E 2IJOB 1UVSH 2BQ6B 1LHDH 1U6QA 2A4OA 1MQ6A 4LOYH 5JPMH 4I8LA 1B0EA 2BQWB 1AWFH 1T31A 2FYRA 2UUYA 4H42U 3ESTA 2ZI2H 1GCTB 4IC5A 1CA8B 1H9HE 3BTWE 2I6QA 3SV8A 1OP0A 2R2WU 3LU9B 3ENSB 4LZ4B 2Q6GA 1HFDA 4CHAC 1MTUA 1NRNH 1C9PA 1FV9A 2O8WA 4GSOA 1VITH 3S7HB 3A8AA 3SGQE 1P2NA 1QL9A 2LPRA 4NA7A 4UFFH 1HAZB 2GV6A 1FI8A 5DP6A 1UTOA 1RXPA 1OWJA 2XRCA 1SLWB 3LJJA 2PSXA 4KTUA 1BTYA 3D49H 4ABHA 1FN8A 3GDVA 2THFB 2ZIQH 3QGJA 2AERH 2QGRA 3HATH 1CT0E 2GCTC 1V2OT 2WPIS 4XSKU 1W2KH 1ZSJA 4K2YA 1C5VA 5FBIA 1MBQA 1PQAA 1MKWH 2VJ1A 3GY6A 4R0IA 1C5LH 4WF8A 2OQUA 1G2LA 3ZVFA 1JMOH 4KTSA 1DITH 3VB3A 4I8HA 1W3CA 5DGJA 3B8JA 1GVKB 2FIRH 2BD3A 4O9VA 1KXFA 1VJAU 1W0ZU 4A1XA 1GMHG 1P12E 3A81A 2DUCA 1WYKA 3PROA 5DP8A 5FBEA 5FXLA 2V6NA 1SGFG 1UVOA 2AIPA 1AQ7A 2ZEBA 1GI3A 1O3CA 3ZVDA 1GI7B 2BD7A 2VWNA 1C5TA 1XUGA 2STAE 1O2OA 1QB9A 3PLKA 1J16A 3EAJA 1GJ6A 3TU7H 4RN6A 1XXDA 4GHTA 2D26C 2ZKSA 2BD8A 2BD5A 2NU4E 1BTWA 1HCGA 3OY6U 3RC6A 3TH3H 2O9QA 1BQYA 1O2GH 4UE7H 5FAHA 3SU1A 1XUFA 1CQQA 3VFEA 3L3TA 1LMWB 2ULLA 5J4SA 2AGGX 1MH0A 3GY7A 8KME2 2BVSH 4NWKA 1V2ST 4ZROA 1GBTA 1FN6A 5EXNA 3ZZ3A 4X6OA 1CO7E 3W95A 2XC5A 2ANKH 1WSSH 1UTMA 1DICA 1OXGA 1CA0B 2ZU2A 4X6PA 4JZDH 4FUDA 3B23B 2ZFRH 2C8XB 2VGCB 5IYTA 2A7CA 1TWXB 1Y3UA 1HGTH 4NSYA 1GHAF 2FYQA 5C2ZA 2B5TB 5EQQA 1AU8A 3M3SA 2ZCLP 4CRCA 4I33A 1DVAH 1GJAB 1BTZA 3QZQA 1PPBH 2FLBH 2O8LA 3EDXB 4INKA 1GI2A 2ZDLA 3E3TA 1HAOH 2ZDMA 3C27B 5A09A 3TH2H 1ELEE 1Q31A 1NTPA 1K1IA 3N7OA 1K2I1 5CHAC 2FESH 1GI4A 1FONA 2F3CE 1IQHA 2VWLA 2PHBA 4I8JA 1EPTB 1MZAA 1Z6EA 1ZJDA 1SBWA 1SGIB 3EQ0H 1TONA 4DIIH 1P2OA 1HJ8A 1ZMNA 1A46H 2HPPH 4Q7XA 3ODFA 1P02A 5CE1A 2A31A 1DPOA 2FI4E 5FCKA 4A6LA 1GJ8B 1GBHA 3SJ9A 5EU8A 1TQ0B 1NY22 2P93A 5DP7A 1SGDE 3S9BA 1TX7A 1P2IA 5GCHG 1BITA 2F91A 3PYHA 1S82A 2AMQA 1LHEH 3QLPH 1HAHH 3RMLH 1QRZA 1RFNA 2ZPQA 2CHAC 2B9LA 4I7YH 2Z3CA 3RXLA 3CP7A 2EI6A 3SU4A 1KTTB 1SQAA 2BX4A 4JK5A 3MOCA 1S6FA 4ZHLU 5K7RA 4YTAA 1MAXA 4AG2A 2D8WA 3P8NA 3FANA 2EI8A 1GJCB 2A7HA 2VVCA 2O8UA 1VGCB 1KLIH 5GXPA 2PFEA 2SGAA 2Q1JA 4Z6AH 1SI5H 5EW1H 1XUIA 3K6ZA 1DXPA 3DFLA 1BMMH 1P06A 2BY8X 2F9PA 3PMBB 3HGNA 1SG8B 4WVPE 1O3PB 3P92A 1C2JA 2BXTH 1H9IE 1FY4A 3TNSA 4INHA 3EE0B 1VITF 1O5CB 1O2TA 2QA9E 1KLJH 3RC4A 5T6GA 1O3EA 2FOGA 4X8UH 1AVWA 8GCHF 3Q00A 3UR9A 4IMZA 4AFSA 1ESBA 1MCVA 3MNCA 2VIWA 1O2QA 3KN2A 4MG3A 3GY4A 5EQSA 2BX3A 6CHAB 2SNWA 3A89A 3R0FA 2SGFE 3D23A 3NPSA 4GAWA 1EB2A 1THRH 2FLRH 2ZGBH 2WV4A 1QB1A 2AFQB 1C1WH 2BYAX 1XMNB 1AMHA 1ELCA 2PWXA 3RM2H 1ZPBA 2OC0A 3SQEE 3SZNA 1QHRB 1YYY1 1ZYOA 3TITA 2XW9A 1EPTA 4HZHA 3MMGA 1V2QT 1QQUA 2XTTB 1D3TB 1ETTH 1N6YA 2ZTYA 3GYMA 4ZHMU 4WMEA 1SGRE 1YM0A 4BANB 2GCHG 2STBE 2ZHEH 1P2QA 2C93B 1AE5A 5A0BA 1SLXB 1SGCA 1D9IA 4GHQA 5JBTA 1GBMA 3IWMA 1BT7A 3A8CA 2Y5HA 3A86A 2BZ6H 3F6UH 4CRFA 2JKHA 2V35A 4CRGA 3HPTB 1FZZA 7KMEH 2PGBB 5T3HA 2AMPA 1O3NA 3ATMA 2PR3A 2XCNA 4WMDA 5E2PA 1S81A 2G51A 3VXFH 2JH6D 5C3NA 3TGJE 1WTGH 3LH3A 1YPJH 2GMTB 2Z9KA 3KQEA 1AVXA 1T4VH 5BPEA 1TRNA 3FFGA 2FOFA 4UDWH 4WMFA 5EOKA 3TK9A 3W94A 3PLPA 3ZZCA 1GBJA 2VB0A 3SUGA 2FOHA 3SUDA 3ZV8A 1CBWB 3VB4A 2V3HH 1DWEH 1E37B 1PPGE 3I29A 3Q3KA 2HNTF 4YO9A 3LGTA 1GBIA 2FOAA 1BMAA 2Z9GA 3NZIA 3K2UA 3AAUA 1O5AB 3MU5A 1LVYA 2OBOA 4KGAA 1SFIA 1ZMLA 2FP7B 1P2JA 4ISNA 1HXEH 1EZQA 2O8TA 5A8YA 2C3SA 4AG1A 1HNEE 1O5DH 4FUCA 1C1MA 1FPCH 2ZQ1A 4BXWA 3E16B 1ANDA 3A87A 3LC3A 1BMLA 1C4U2 2FX4A 1O33A 1O32A 4YOJA 3QDZB 1OWKA