1GWBA

Structure of glycoprotein 1b
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
265
structure length
265
Chain Sequence
PICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET GLYCOPROTEIN IB ALPHA CHAIN
publication title Crystal Structure of the Platelet Glycoprotein Ib-Alpha N-Terminal Domain Reveals an Unmasking Mechanism of Receptor Activation
pubmed doi rcsb
molecule tags Blood clotting
total genus 61
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1gwbA00
1K5DC 5B0NA 3WPBA 4CC4C 3RIZA 1YRGA 5HDHA 1QYYA 5CMPA 4RCWA 4QBZA 2P1QB 4MN8B 2RR6A 3E3ZA 2RA8A 3P72A 2UZYA 4P8SA 1U0ND 1FS2A 4WP6A 3G3AA 3RFSA 4BSUA 1DCEA 4ARRA 4LSCA 4Q3IA 4LSXC 3WPHA 3ULVA 4UFRA 3WPDA 3RJ0A 5FTTB 3ZYOA 4AY9X 2ASTB 4LSAA 3WPIA 5AWAA 2BEXA 4V2CA 2OMVA 3WPGA 4R6FA 2V9TB 4HQ1A 2O6RA 4R58A 4GLPA 1IO0A 2OMUA 3M19A 2P1MB 4K17A 4FHOA 3O53A 1G9UA 4PQ8A 4TZHA 3RGXA 4LXSA 4Z94G 4Q3GA 4OQTA 3ULAA 3DZEA 2P1OB 3C6OB 5GMFA 5GQRK 4YEBB 3ULUA 4M7EC 4QXEA 4FDWA 3VQ2A 2OMYA 2JE0A 4XGOA 3WPCA 4L3AA 1O6TA 2ID5A 5B0TA 5AWBA 4PEQB 4RCAB 4Z64C 1XKUA 4R5DA 1ZIWA 3E2JA 4ECOA 2P1PB 3A79B 1LTXA 3PMHG 3W3MA 4V2EA 5AWDA 3G06A 3RGZA 4PERA 1P8TA 3VQ1A 3W3NA 1O6SA 5HZLB 1FT8A 5D3IA 3OJAA 4C2BB 5GS0A 3UN9A 2XOTA 1KOHA 3ZYNA 2O6SA 3G3BA 1XWDC 4CNMA 4R0AA 4Z79A 4CP6A 1GWBA 2WQWA 4FS7A 4PSJA 4BSSA 2Z66A 1A9NA 1P9AG 3TSRE 3JB9j 3W3GA 3RW6A 1W8AA 3ZYJA 3W3JA 4NKHA 4R07A 2FT3A 2O6QA 5AWCA 4XSQA 1PGVA 4FMZA 3WPFA 1FO1A 2WQUA 3REZA 3OGLB 1D0BA 5IYXC 3ZYIA 5IJCA 4BV4R 2Q4GW 3C6PB 5GS2B 4LI2A 4AW4A 3OJAB 2Z81A 1A4YA 4CILA 4BSRA 4FCGA 3RFEA 4Y61B 3G39A 1OOKG 1K5GC 1OTOA 4LXRA 2Z65A 1P8VA 4CNCA 3G04C 3WN4A 5B4PA 4KXFB 4R5CA 2Y5QA 2IFGA 4I6JB 4U06A 3C6NB 2WQVA 4GT6A 4NKGA 2Z64A 2CA6A 3M18A 4Q62A 5IJDA 2A0ZA 2P1NB 5A5CA 2WQXA 4EZGA 1DFJI 5AZ5A 1H6TA 1OGQA 2V9SA 1M9LA 2OMWA 5IJBA 3W3LA 4WYKA 2JE1A 1OTMA 1WWLA 4R08A 3RW7A 5GMGA 2R9UA 1KOOA 4R6AA 3UL7A 2OMTA 4U08A 3CIGA 1FQVA 4CC4A 2V70A 1Z7XW 4IM6A 1OTNA 2Z63A 4V2DA 4LSXA 4C2AB 4H09A 4QC0A 3UL9A 3GOZA 1M0ZA 3CVRA 4J0MA 4G8AA 4U7LA 4R09A 4R6GA 3WPEA 1O6VA 3OGMB 2OMXA 2Z82A 1M10B 2ELLA 4U09A 2UZXA 4MQWX 5LFNA 1JL5A 2XWTC 2Z7XA 1SQ0B 4RWTC 5CMNA 4XOSA 2Z62A 3RFJA 4L3FA 1XEUA 4J4LA 3E6JA 3O6NA 4PKIG 4Z8GA 2JQDA 3BZ5A 1XECA 4FD0A 3OGKB 1M9SA 3KJ4A 3W3KA 4ARNA 4M7EA 4ECNA 5GMHA 4LI1A 2OMZA 1DS9A 4KT1A 1OZNA 4Z61C 2ASSB 4R6JA 1XCDA 2WFHA 2BNHA 3FXIA 3CIYA 4B8CD 2Z7XB 3E4GA 4P91A 3SB4A 3UL8A 4KNGA 1H6UA
chains in the Genus database with same CATH superfamily
1K5DC 5B0NA 3WPBA 4CC4C 3RIZA 1YRGA 5HDHA 1QYYA 5CMPA 4RCWA 4QBZA 2P1QB 4MN8B 2RR6A 3E3ZA 2RA8A 3P72A 2UZYA 4P8SA 1U0ND 1FS2A 4WP6A 3G3AA 3RFSA 4BSUA 1DCEA 4ARRA 4LSCA 4Q3IA 4LSXC 3WPHA 3ULVA 4UFRA 3WPDA 3RJ0A 5FTTB 3ZYOA 4AY9X 2ASTB 4LSAA 3WPIA 5AWAA 2BEXA 4V2CA 2OMVA 3WPGA 4R6FA 2V9TB 4HQ1A 2O6RA 4R58A 4GLPA 1IO0A 2OMUA 3M19A 2P1MB 4K17A 4FHOA 3O53A 1G9UA 4PQ8A 4TZHA 3RGXA 4LXSA 4Z94G 4Q3GA 4OQTA 3ULAA 3DZEA 2P1OB 3C6OB 5GMFA 5GQRK 4YEBB 3ULUA 4M7EC 4QXEA 4FDWA 3VQ2A 2OMYA 2JE0A 4XGOA 3WPCA 4L3AA 1O6TA 2ID5A 5B0TA 5AWBA 4PEQB 4RCAB 4Z64C 1XKUA 4R5DA 1ZIWA 3E2JA 4ECOA 2P1PB 3A79B 1LTXA 3PMHG 3W3MA 4V2EA 5AWDA 3G06A 3RGZA 4PERA 1P8TA 3VQ1A 3W3NA 1O6SA 5HZLB 1FT8A 4NZRM 5D3IA 3OJAA 4C2BB 5GS0A 3UN9A 2XOTA 1KOHA 3ZYNA 2O6SA 3G3BA 1XWDC 4CNMA 4R0AA 4Z79A 4CP6A 1GWBA 2WQWA 4FS7A 4PSJA 4BSSA 2Z66A 1A9NA 1P9AG 3TSRE 3JB9j 3W3GA 3RW6A 1W8AA 3ZYJA 3W3JA 4NKHA 4R07A 2FT3A 2O6QA 5AWCA 4XSQA 1PGVA 4FMZA 3WPFA 1FO1A 2WQUA 3REZA 3OGLB 1D0BA 5IYXC 3ZYIA 5IJCA 4BV4R 2Q4GW 3C6PB 5GS2B 4LI2A 4AW4A 3OJAB 2Z81A 1A4YA 4CILA 4BSRA 4FCGA 3RFEA 4Y61B 3G39A 1OOKG 1K5GC 1OTOA 4LXRA 2Z65A 1P8VA 4CNCA 3G04C 3WN4A 5B4PA 4KXFB 4R5CA 4NZTM 2Y5QA 2IFGA 4I6JB 4U06A 3C6NB 2WQVA 4GT6A 4NKGA 2Z64A 2CA6A 3M18A 4Q62A 5IJDA 2A0ZA 2P1NB 5A5CA 2WQXA 4EZGA 1DFJI 5AZ5A 1H6TA 1OGQA 2V9SA 1M9LA 2OMWA 5IJBA 3W3LA 4WYKA 2JE1A 1OTMA 1WWLA 4R08A 3RW7A 5GMGA 2R9UA 1KOOA 4R6AA 3UL7A 2OMTA 4U08A 3CIGA 1FQVA 4CC4A 2V70A 1Z7XW 4IM6A 1OTNA 2Z63A 4V2DA 4LSXA 4C2AB 4H09A 4QC0A 3UL9A 3GOZA 1M0ZA 3CVRA 4J0MA 4G8AA 4U7LA 4R09A 4R6GA 3WPEA 1O6VA 3OGMB 2OMXA 2Z82A 1M10B 2ELLA 4U09A 2UZXA 4MQWX 5LFNA 1JL5A 2XWTC 2Z7XA 1SQ0B 4RWTC 5CMNA 4XOSA 2Z62A 3RFJA 4L3FA 1XEUA 4J4LA 3E6JA 3O6NA 4PKIG 4Z8GA 2JQDA 3BZ5A 1XECA 4FD0A 3OGKB 1M9SA 3KJ4A 3W3KA 4ARNA 4M7EA 4ECNA 5GMHA 4LI1A 2OMZA 1DS9A 4KT1A 1OZNA 4Z61C 2ASSB 4R6JA 1XCDA 2WFHA 2BNHA 3FXIA 3CIYA 4B8CD 2Z7XB 3E4GA 4P91A 3SB4A 3UL8A 4KNGA 1H6UA
chains in the Genus database with same CATH topology
1K5DC 5B0NA 3WPBA 4CC4C 3RIZA 1YRGA 5HDHA 1QYYA 5CMPA 4RCWA 4QBZA 2P1QB 4MN8B 2RR6A 3E3ZA 2RA8A 3P72A 2UZYA 4P8SA 1U0ND 1FS2A 4WP6A 3G3AA 3RFSA 4BSUA 1DCEA 4ARRA 4LSCA 4Q3IA 4LSXC 3WPHA 3ULVA 4UFRA 3WPDA 3RJ0A 5FTTB 3ZYOA 4AY9X 2ASTB 4LSAA 3WPIA 5AWAA 2BEXA 4V2CA 2OMVA 3WPGA 4R6FA 2V9TB 4HQ1A 2O6RA 4R58A 4GLPA 1IO0A 2OMUA 3M19A 2P1MB 4K17A 4FHOA 3O53A 1G9UA 4PQ8A 4TZHA 3RGXA 4LXSA 4Z94G 4Q3GA 4OQTA 3ULAA 3DZEA 2P1OB 3C6OB 5GMFA 5GQRK 4YEBB 3ULUA 4M7EC 4QXEA 4FDWA 3VQ2A 2OMYA 2JE0A 4XGOA 3WPCA 4L3AA 1O6TA 2ID5A 5B0TA 5AWBA 4PEQB 4RCAB 4Z64C 1XKUA 4R5DA 1ZIWA 3E2JA 4ECOA 2P1PB 3A79B 1LTXA 3PMHG 3W3MA 4V2EA 5AWDA 3G06A 3RGZA 4PERA 1P8TA 3VQ1A 3W3NA 1O6SA 5HZLB 1FT8A 5D3IA 3OJAA 4C2BB 5GS0A 3UN9A 2XOTA 1KOHA 3ZYNA 2O6SA 3G3BA 1XWDC 4CNMA 4R0AA 4Z79A 4CP6A 1GWBA 2WQWA 4FS7A 4PSJA 4BSSA 2Z66A 1A9NA 1P9AG 3TSRE 3JB9j 3W3GA 3RW6A 1W8AA 3ZYJA 3W3JA 4NKHA 4R07A 2FT3A 2O6QA 5AWCA 4XSQA 1PGVA 4FMZA 3WPFA 1FO1A 2WQUA 3REZA 3OGLB 1D0BA 5IYXC 3ZYIA 5IJCA 4BV4R 2Q4GW 3C6PB 5GS2B 4LI2A 4AW4A 3OJAB 2Z81A 1A4YA 4CILA 4BSRA 4FCGA 3RFEA 4Y61B 3G39A 1OOKG 1K5GC 1OTOA 4LXRA 2Z65A 1P8VA 4CNCA 3G04C 3WN4A 5B4PA 4KXFB 4R5CA 2Y5QA 2IFGA 4I6JB 4U06A 3C6NB 2WQVA 4GT6A 4NKGA 2Z64A 2CA6A 3M18A 4Q62A 5IJDA 2A0ZA 2P1NB 5A5CA 2WQXA 4EZGA 1DFJI 5AZ5A 1H6TA 1OGQA 2V9SA 1M9LA 2OMWA 5IJBA 3W3LA 4WYKA 2JE1A 1OTMA 1WWLA 4R08A 3RW7A 5GMGA 2R9UA 1KOOA 4R6AA 3UL7A 2OMTA 4U08A 3CIGA 1FQVA 4CC4A 2V70A 1Z7XW 4IM6A 1OTNA 2Z63A 4V2DA 4LSXA 4C2AB 4H09A 4QC0A 3UL9A 3GOZA 1M0ZA 3CVRA 4J0MA 4G8AA 4U7LA 4R09A 4R6GA 3WPEA 1O6VA 3OGMB 2OMXA 2Z82A 1M10B 2ELLA 4U09A 2UZXA 4MQWX 5LFNA 1JL5A 2XWTC 2Z7XA 1SQ0B 4RWTC 5CMNA 4XOSA 2Z62A 3RFJA 4L3FA 1XEUA 4J4LA 3E6JA 3O6NA 4PKIG 4Z8GA 2JQDA 3BZ5A 1XECA 4FD0A 3OGKB 1M9SA 3KJ4A 3W3KA 4ARNA 4M7EA 4ECNA 5GMHA 4LI1A 2OMZA 1DS9A 4KT1A 1OZNA 4Z61C 2ASSB 4R6JA 1XCDA 2WFHA 2BNHA 3FXIA 3CIYA 4B8CD 2Z7XB 3E4GA 4P91A 3SB4A 3UL8A 4KNGA 1H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5D C;  5B0N A;  3WPB A;  4CC4 C;  3RIZ A;  1YRG A;  5HDH A;  1QYY A;  5CMP A;  4RCW A;  4QBZ A;  2P1Q B;  4MN8 B;  2RR6 A;  3E3Z A;  2RA8 A;  3P72 A;  2UZY A;  4P8S A;  1U0N D;  1FS2 A;  4WP6 A;  3G3A A;  3RFS A;  4BSU A;  1DCE A;  4ARR A;  4LSC A;  4Q3I A;  4LSX C;  3WPH A;  3ULV A;  4UFR A;  3WPD A;  3RJ0 A;  5FTT B;  3ZYO A;  4AY9 X;  2AST B;  4LSA A;  3WPI A;  5AWA A;  2BEX A;  4V2C A;  2OMV A;  3WPG A;  4R6F A;  2V9T B;  4HQ1 A;  2O6R A;  4R58 A;  4GLP A;  1IO0 A;  2OMU A;  3M19 A;  2P1M B;  4K17 A;  4FHO A;  3O53 A;  1G9U A;  4PQ8 A;  4TZH A;  3RGX A;  4LXS A;  4Z94 G;  4Q3G A;  4OQT A;  3ULA A;  3DZE A;  2P1O B;  3C6O B;  5GMF A;  5GQR K;  4YEB B;  3ULU A;  4M7E C;  4QXE A;  4FDW A;  3VQ2 A;  2OMY A;  2JE0 A;  4XGO A;  3WPC A;  4L3A A;  1O6T A;  2ID5 A;  5B0T A;  5AWB A;  4PEQ B;  4RCA B;  4Z64 C;  1XKU A;  4R5D A;  1ZIW A;  3E2J A;  4ECO A;  2P1P B;  3A79 B;  1LTX A;  3PMH G;  3W3M A;  4V2E A;  5AWD A;  3G06 A;  3RGZ A;  4PER A;  1P8T A;  3VQ1 A;  3W3N A;  1O6S A;  5HZL B;  1FT8 A;  5D3I A;  3OJA A;  4C2B B;  5GS0 A;  3UN9 A;  2XOT A;  1KOH A;  3ZYN A;  2O6S A;  3G3B A;  1XWD C;  4CNM A;  4R0A A;  4Z79 A;  4CP6 A;  1GWB A;  2WQW A;  4FS7 A;  4PSJ A;  4BSS A;  2Z66 A;  1A9N A;  1P9A G;  3TSR E;  3JB9 j;  3W3G A;  3RW6 A;  1W8A A;  3ZYJ A;  3W3J A;  4NKH A;  4R07 A;  2FT3 A;  2O6Q A;  5AWC A;  4XSQ A;  1PGV A;  4FMZ A;  3WPF A;  1FO1 A;  2WQU A;  3REZ A;  3OGL B;  1D0B A;  5IYX C;  3ZYI A;  5IJC A;  4BV4 R;  2Q4G W;  3C6P B;  5GS2 B;  4LI2 A;  4AW4 A;  3OJA B;  2Z81 A;  1A4Y A;  4CIL A;  4BSR A;  4FCG A;  3RFE A;  4Y61 B;  3G39 A;  1OOK G;  1K5G C;  1OTO A;  4LXR A;  2Z65 A;  1P8V A;  4CNC A;  3G04 C;  3WN4 A;  5B4P A;  4KXF B;  4R5C A;  2Y5Q A;  2IFG A;  4I6J B;  4U06 A;  3C6N B;  2WQV A;  4GT6 A;  4NKG A;  2Z64 A;  2CA6 A;  3M18 A;  4Q62 A;  5IJD A;  2A0Z A;  2P1N B;  5A5C A;  2WQX A;  4EZG A;  1DFJ I;  5AZ5 A;  1H6T A;  1OGQ A;  2V9S A;  1M9L A;  2OMW A;  5IJB A;  3W3L A;  4WYK A;  2JE1 A;  1OTM A;  1WWL A;  4R08 A;  3RW7 A;  5GMG A;  2R9U A;  1KOO A;  4R6A A;  3UL7 A;  2OMT A;  4U08 A;  3CIG A;  1FQV A;  4CC4 A;  2V70 A;  1Z7X W;  4IM6 A;  1OTN A;  2Z63 A;  4V2D A;  4LSX A;  4C2A B;  4H09 A;  4QC0 A;  3UL9 A;  3GOZ A;  1M0Z A;  3CVR A;  4J0M A;  4G8A A;  4U7L A;  4R09 A;  4R6G A;  3WPE A;  1O6V A;  3OGM B;  2OMX A;  2Z82 A;  1M10 B;  2ELL A;  4U09 A;  2UZX A;  4MQW X;  5LFN A;  1JL5 A;  2XWT C;  2Z7X A;  1SQ0 B;  4RWT C;  5CMN A;  4XOS A;  2Z62 A;  3RFJ A;  4L3F A;  1XEU A;  4J4L A;  3E6J A;  3O6N A;  4PKI G;  4Z8G A;  2JQD A;  3BZ5 A;  1XEC A;  4FD0 A;  3OGK B;  1M9S A;  3KJ4 A;  3W3K A;  4ARN A;  4M7E A;  4ECN A;  5GMH A;  4LI1 A;  2OMZ A;  1DS9 A;  4KT1 A;  1OZN A;  4Z61 C;  2ASS B;  4R6J A;  1XCD A;  2WFH A;  2BNH A;  3FXI A;  3CIY A;  4B8C D;  2Z7X B;  3E4G A;  4P91 A;  3SB4 A;  3UL8 A;  4KNG A;  1H6U A; 
#chains in the Genus database with same CATH topology
 1K5D C;  5B0N A;  3WPB A;  4CC4 C;  3RIZ A;  1YRG A;  5HDH A;  1QYY A;  5CMP A;  4RCW A;  4QBZ A;  2P1Q B;  4MN8 B;  2RR6 A;  3E3Z A;  2RA8 A;  3P72 A;  2UZY A;  4P8S A;  1U0N D;  1FS2 A;  4WP6 A;  3G3A A;  3RFS A;  4BSU A;  1DCE A;  4ARR A;  4LSC A;  4Q3I A;  4LSX C;  3WPH A;  3ULV A;  4UFR A;  3WPD A;  3RJ0 A;  5FTT B;  3ZYO A;  4AY9 X;  2AST B;  4LSA A;  3WPI A;  5AWA A;  2BEX A;  4V2C A;  2OMV A;  3WPG A;  4R6F A;  2V9T B;  4HQ1 A;  2O6R A;  4R58 A;  4GLP A;  1IO0 A;  2OMU A;  3M19 A;  2P1M B;  4K17 A;  4FHO A;  3O53 A;  1G9U A;  4PQ8 A;  4TZH A;  3RGX A;  4LXS A;  4Z94 G;  4Q3G A;  4OQT A;  3ULA A;  3DZE A;  2P1O B;  3C6O B;  5GMF A;  5GQR K;  4YEB B;  3ULU A;  4M7E C;  4QXE A;  4FDW A;  3VQ2 A;  2OMY A;  2JE0 A;  4XGO A;  3WPC A;  4L3A A;  1O6T A;  2ID5 A;  5B0T A;  5AWB A;  4PEQ B;  4RCA B;  4Z64 C;  1XKU A;  4R5D A;  1ZIW A;  3E2J A;  4ECO A;  2P1P B;  3A79 B;  1LTX A;  3PMH G;  3W3M A;  4V2E A;  5AWD A;  3G06 A;  3RGZ A;  4PER A;  1P8T A;  3VQ1 A;  3W3N A;  1O6S A;  5HZL B;  1FT8 A;  4NZR M;  5D3I A;  3OJA A;  4C2B B;  5GS0 A;  3UN9 A;  2XOT A;  1KOH A;  3ZYN A;  2O6S A;  3G3B A;  1XWD C;  4CNM A;  4R0A A;  4Z79 A;  4CP6 A;  1GWB A;  2WQW A;  4FS7 A;  4PSJ A;  4BSS A;  2Z66 A;  1A9N A;  1P9A G;  3TSR E;  3JB9 j;  3W3G A;  3RW6 A;  1W8A A;  3ZYJ A;  3W3J A;  4NKH A;  4R07 A;  2FT3 A;  2O6Q A;  5AWC A;  4XSQ A;  1PGV A;  4FMZ A;  3WPF A;  1FO1 A;  2WQU A;  3REZ A;  3OGL B;  1D0B A;  5IYX C;  3ZYI A;  5IJC A;  4BV4 R;  2Q4G W;  3C6P B;  5GS2 B;  4LI2 A;  4AW4 A;  3OJA B;  2Z81 A;  1A4Y A;  4CIL A;  4BSR A;  4FCG A;  3RFE A;  4Y61 B;  3G39 A;  1OOK G;  1K5G C;  1OTO A;  4LXR A;  2Z65 A;  1P8V A;  4CNC A;  3G04 C;  3WN4 A;  5B4P A;  4KXF B;  4R5C A;  4NZT M;  2Y5Q A;  2IFG A;  4I6J B;  4U06 A;  3C6N B;  2WQV A;  4GT6 A;  4NKG A;  2Z64 A;  2CA6 A;  3M18 A;  4Q62 A;  5IJD A;  2A0Z A;  2P1N B;  5A5C A;  2WQX A;  4EZG A;  1DFJ I;  5AZ5 A;  1H6T A;  1OGQ A;  2V9S A;  1M9L A;  2OMW A;  5IJB A;  3W3L A;  4WYK A;  2JE1 A;  1OTM A;  1WWL A;  4R08 A;  3RW7 A;  5GMG A;  2R9U A;  1KOO A;  4R6A A;  3UL7 A;  2OMT A;  4U08 A;  3CIG A;  1FQV A;  4CC4 A;  2V70 A;  1Z7X W;  4IM6 A;  1OTN A;  2Z63 A;  4V2D A;  4LSX A;  4C2A B;  4H09 A;  4QC0 A;  3UL9 A;  3GOZ A;  1M0Z A;  3CVR A;  4J0M A;  4G8A A;  4U7L A;  4R09 A;  4R6G A;  3WPE A;  1O6V A;  3OGM B;  2OMX A;  2Z82 A;  1M10 B;  2ELL A;  4U09 A;  2UZX A;  4MQW X;  5LFN A;  1JL5 A;  2XWT C;  2Z7X A;  1SQ0 B;  4RWT C;  5CMN A;  4XOS A;  2Z62 A;  3RFJ A;  4L3F A;  1XEU A;  4J4L A;  3E6J A;  3O6N A;  4PKI G;  4Z8G A;  2JQD A;  3BZ5 A;  1XEC A;  4FD0 A;  3OGK B;  1M9S A;  3KJ4 A;  3W3K A;  4ARN A;  4M7E A;  4ECN A;  5GMH A;  4LI1 A;  2OMZ A;  1DS9 A;  4KT1 A;  1OZN A;  4Z61 C;  2ASS B;  4R6J A;  1XCD A;  2WFH A;  2BNH A;  3FXI A;  3CIY A;  4B8C D;  2Z7X B;  3E4G A;  4P91 A;  3SB4 A;  3UL8 A;  4KNG A;  1H6U A; 
#chains in the Genus database with same CATH homology
 1K5D C;  5B0N A;  3WPB A;  4CC4 C;  3RIZ A;  1YRG A;  5HDH A;  1QYY A;  5CMP A;  4RCW A;  4QBZ A;  2P1Q B;  4MN8 B;  2RR6 A;  3E3Z A;  2RA8 A;  3P72 A;  2UZY A;  4P8S A;  1U0N D;  1FS2 A;  4WP6 A;  3G3A A;  3RFS A;  4BSU A;  1DCE A;  4ARR A;  4LSC A;  4Q3I A;  4LSX C;  3WPH A;  3ULV A;  4UFR A;  3WPD A;  3RJ0 A;  5FTT B;  3ZYO A;  4AY9 X;  2AST B;  4LSA A;  3WPI A;  5AWA A;  2BEX A;  4V2C A;  2OMV A;  3WPG A;  4R6F A;  2V9T B;  4HQ1 A;  2O6R A;  4R58 A;  4GLP A;  1IO0 A;  2OMU A;  3M19 A;  2P1M B;  4K17 A;  4FHO A;  3O53 A;  1G9U A;  4PQ8 A;  4TZH A;  3RGX A;  4LXS A;  4Z94 G;  4Q3G A;  4OQT A;  3ULA A;  3DZE A;  2P1O B;  3C6O B;  5GMF A;  5GQR K;  4YEB B;  3ULU A;  4M7E C;  4QXE A;  4FDW A;  3VQ2 A;  2OMY A;  2JE0 A;  4XGO A;  3WPC A;  4L3A A;  1O6T A;  2ID5 A;  5B0T A;  5AWB A;  4PEQ B;  4RCA B;  4Z64 C;  1XKU A;  4R5D A;  1ZIW A;  3E2J A;  4ECO A;  2P1P B;  3A79 B;  1LTX A;  3PMH G;  3W3M A;  4V2E A;  5AWD A;  3G06 A;  3RGZ A;  4PER A;  1P8T A;  3VQ1 A;  3W3N A;  1O6S A;  5HZL B;  1FT8 A;  5D3I A;  3OJA A;  4C2B B;  5GS0 A;  3UN9 A;  2XOT A;  1KOH A;  3ZYN A;  2O6S A;  3G3B A;  1XWD C;  4CNM A;  4R0A A;  4Z79 A;  4CP6 A;  1GWB A;  2WQW A;  4FS7 A;  4PSJ A;  4BSS A;  2Z66 A;  1A9N A;  1P9A G;  3TSR E;  3JB9 j;  3W3G A;  3RW6 A;  1W8A A;  3ZYJ A;  3W3J A;  4NKH A;  4R07 A;  2FT3 A;  2O6Q A;  5AWC A;  4XSQ A;  1PGV A;  4FMZ A;  3WPF A;  1FO1 A;  2WQU A;  3REZ A;  3OGL B;  1D0B A;  5IYX C;  3ZYI A;  5IJC A;  4BV4 R;  2Q4G W;  3C6P B;  5GS2 B;  4LI2 A;  4AW4 A;  3OJA B;  2Z81 A;  1A4Y A;  4CIL A;  4BSR A;  4FCG A;  3RFE A;  4Y61 B;  3G39 A;  1OOK G;  1K5G C;  1OTO A;  4LXR A;  2Z65 A;  1P8V A;  4CNC A;  3G04 C;  3WN4 A;  5B4P A;  4KXF B;  4R5C A;  2Y5Q A;  2IFG A;  4I6J B;  4U06 A;  3C6N B;  2WQV A;  4GT6 A;  4NKG A;  2Z64 A;  2CA6 A;  3M18 A;  4Q62 A;  5IJD A;  2A0Z A;  2P1N B;  5A5C A;  2WQX A;  4EZG A;  1DFJ I;  5AZ5 A;  1H6T A;  1OGQ A;  2V9S A;  1M9L A;  2OMW A;  5IJB A;  3W3L A;  4WYK A;  2JE1 A;  1OTM A;  1WWL A;  4R08 A;  3RW7 A;  5GMG A;  2R9U A;  1KOO A;  4R6A A;  3UL7 A;  2OMT A;  4U08 A;  3CIG A;  1FQV A;  4CC4 A;  2V70 A;  1Z7X W;  4IM6 A;  1OTN A;  2Z63 A;  4V2D A;  4LSX A;  4C2A B;  4H09 A;  4QC0 A;  3UL9 A;  3GOZ A;  1M0Z A;  3CVR A;  4J0M A;  4G8A A;  4U7L A;  4R09 A;  4R6G A;  3WPE A;  1O6V A;  3OGM B;  2OMX A;  2Z82 A;  1M10 B;  2ELL A;  4U09 A;  2UZX A;  4MQW X;  5LFN A;  1JL5 A;  2XWT C;  2Z7X A;  1SQ0 B;  4RWT C;  5CMN A;  4XOS A;  2Z62 A;  3RFJ A;  4L3F A;  1XEU A;  4J4L A;  3E6J A;  3O6N A;  4PKI G;  4Z8G A;  2JQD A;  3BZ5 A;  1XEC A;  4FD0 A;  3OGK B;  1M9S A;  3KJ4 A;  3W3K A;  4ARN A;  4M7E A;  4ECN A;  5GMH A;  4LI1 A;  2OMZ A;  1DS9 A;  4KT1 A;  1OZN A;  4Z61 C;  2ASS B;  4R6J A;  1XCD A;  2WFH A;  2BNH A;  3FXI A;  3CIY A;  4B8C D;  2Z7X B;  3E4G A;  4P91 A;  3SB4 A;  3UL8 A;  4KNG A;  1H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...