1GWKA

Carbohydrate binding module family29
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuity in Ligand-Binding: The Three-Dimensional Structure of a Piromyces Carbohydrate-Binding Module,Cbm29-2,in Complex with Cello- and Mannohexaose
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
molecule keywords NON-CATALYTIC PROTEIN 1
total genus 27
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1gwkA00
4LK7A 4CPBD 1V0AA 3ZYFA 1HN0A 3ZYHA 2VXJA 4LKDA 1OH3A 1W8UA 1W90A 2O14A 4LJHA 2K46A 1W8ZA 3ORJA 3UT0A 4AL9A 1W8WA 4CPBA 2LROA 4YW7A 4YW6A 1GWKA 4BQ2A 2KR2A 4LK6A 1WCUA 3F95A 1GWMA 4LKEA 5D21A 4A6SA 4CP9B 1GWLA 4CP9A 1UOJA 2WYFA 1OKOA 4BQ4A 4BQ3A 4BQ5A 4YWAA 1WZXA 2C24A 2Q1FA 2JWPA 4LKFA 3ZYBA 1WMXA 1W8TA 1W9FA 2LRPA 1L7LA
chains in the Genus database with same CATH superfamily
4NWVA 4D7YA 2VZUA 4AVVA 3SNMA 1POV0 5LA1A 3J8F3 1W39A 4XILA 4GH4C 2IXLA 4B4RA 2O8QA 2XB6C 2Y34A 3LAGA 2VQAA 4QXCA 4RSUA 5GZDA 4C1XA 4NIHA 3EQEA 1DG6A 4XUQA 2WWUA 2XJQA 1NQJA 3J7HA 3RYKA 2QVSB 3OBZA 1AHSA 2ZHLA 3I97A 1LRHA 3AP4A 3MZHA 1MQTC 4CE8A 1GNZA 1IKQA 4IEQA 2WNUA 2XOMA 4XETA 2O1QA 5T50A 1M06G 4TZDA 1QXRA 1ZZ6A 1C57A 1XXNA 3BYWA 4LA2A 4AWDA 2CWSA 2WABA 4GB32 1CPMA 1SPPB 5I93A 2RM21 4LK7A 2JDNA 3NV4A 2VZ1A 5FP7A 2VMEA 4CEWB 2VULA 1OQ1A 1OQEA 2VW2A 1JHJA 2J42A 1GZ9A 1OLME 2XHKA 2NMOA 2D98A 2ZMLA 4FPFA 2ET1A 4JGZA 4RQPC 4CDQA 1WA4A 4J6GA 4COYA 4LJHA 3AYCA 1GP6A 4FPHA 1EAH2 2GAUA 5IK7A 2HEYF 2RS11 1OC1A 1Z7S3 1AR92 2WRAA 1U5IA 4QDSA 5I0UA 4FFFA 4XJWA 3PUHA 3PLQA 1BBT2 3PVNA 2L9LA 1RMU2 3CJIB 4EJRA 3GZTB 2P5BA 1VRH1 3HQXA 4MHUA 2RDRA 4NHKA 1XE8A 4BZ4A 1AZDA 4NR1A 4JC1A 5F5AA 3U11A 3R4SA 3LFMA 4B7EA 2BOIA 2BRTA 3B94A 4XC9A 1OOPB 2HYXA 3I3BA 4KL1A 4LLFA 1LGNA 5DAPA 3VHOA 3CEWA 4XBQA 3HT1A 4XDPA 1W8NA 1OH3A 2X5IB 3T4HB 1A8DA 1Q8QA 1YIPA 4P9GA 3I2HA 1OFNA 3ZSMA 5AC91 3AP9A 3UL2A 3IIIA 4P9IA 2XLFA 2XHNA 1OI6A 3RVHA 3ZMOA 5AFBA 5JSOA 3M3IA 4LIVA 1JHNA 3WUDA 2WFF1 3H7YA 2DTWA 2BNMA 1KQRA 4CDXA 4GKYA 4ASKA 5C3SA 2BFUL 4BXSV 3UGFA 1QH7A 4CEYC 4UYBA 2UURA 2PA7A 1YJLA 4JGZC 4TSVA 3ZFEA 1QQP1 2A71A 3ZYHA 3POJA 5A3TA 1O3TA 2EA7A 4MGYE 1ASJ2 2PHTA 4H55A 4IEZA 5IAXA 1GYKA 1NCQC 3FJSA 4GH4A 3VBUA 3DF0A 4AG4A 4QWNA 4W50A 5M0TA 1PMJX 2EVXA 1GWMA 5F9TA 1A6CA 2FMYA 1DFQA 1YQ8A 2WNOA 1O8PA 1CR7A 2WLPA 3IM0A 4UT5A 3ETPA 4J1XA 1FNZA 2ENRA 2VQTA 4QX5A 4ET7A 3EMRA 4L8QA 4BPZA 4P02B 3RZKA 2YBPA 1ZRIA 2HWE1 3IT8A 5EXOA 4AE2A 5BNNA 1QJX1 1DYKA 1Z7S2 4LT5A 1NY72 2YV8A 1R082 5I0RA 1CZTA 2GN3A 2ZX0A 3DKQA 1K5MB 1TNFA 3M2MA 4OHVA 2NM1A 4XF1A 5J98B 5C8CC 2IXIA 3AXDA 1PNGA 3A4UA 3K51A 2WDBA 4URAA 2G9ZA 5FP3A 1GUIA 4OQ9A 2VOXA 4NOTA 5IAVA 2AREA 1WCUA 4CU8A 1COV1 1XNTA 2VG9A 1JZ8A 1C4RA 2I74A 4RS5B 1W0PA 5FY4A 3UJOA 2A6ZA 3AFGA 2BNOA 2EIEA 1TNRA 3B3QE 2BVBA 2HWC2 4PCRA 4I3PA 3S5QA 3E1F1 3KMHA 1JN2P 4NHLA 3VDDC 1PIV1 1OA4A 5JSRA 1C5HA 4E8DA 4QPGC 3NV2A 1RMU3 1QDOA 1RUF1 2JDKA 1LENA 2B4KA 3H3LA 3WLUA 2VPVA 3J8F1 5FY0A 5FZAA 4YLZA 1PO21 2VTFA 4LBQB 1AR62 2E6VA 4LO4B 4UBGA 5H9QA 1SLAA 4P5HA 4JDOA 1VR3A 2NP0A 2JIGA 1ZBE2 2WBKA 1L3JA 2DURA 3OYWA 1CAXB 4XJAA 1JTZX 2DVBA 4WZCA 5JXGA 1WW7A 3H1MA 3NO8A 1GV9A 4NPLA 4O9EA 4XTPA 4Q29A 4UFKA 1YHFA 4JX0A 2A3YA 4HN0A 3WDYA 1H9PA 2J1AA 5FY9A 1KEXA 1HQWA 1LULA 4M01A 2HYKA 1XJAA 3VBFB 2QE3A 3MBWA 3RI9A 4HL0A 2R071 2WS93 3IZOA 5KHJA 2XJRA 2DTYA 5APAA 4E4ZA 5ACA1 4W65A 5J37A 2X5IC 5E1RA 2RMU3 1AR81 5GALA 3W59A 4BISA 2WFF3 3ZSKA 5BNPB 3MF6A 3AYDA 4Q4X1 1H2MA 1O4YA 2HWD2 2WR9A 2BNNA 3POBA 2IFRA 3K46A 3K3NA 2VE1A 3WQBA 1X50A 3BI3A 1F31A 1QU0A 3MPPG 4AYUA 4D6QA 3DPRC 3ACGA 4NO4A 1GR3A 2MEV2 5DPNA 2D3PA 4JZRA 4WM8C 3ZMNA 4HBNA 1BK0A 1UO9A 5A80A 4AGVA 5HXVA 1C8M1 4NN0A 2HWB1 3WDVA 1BEV1 3K48A 4AQSA 3JBG3 1BKZA 5FP8A 5FZBA 2WZR2 4QXBA 1REDA 1BK1A 3KF5A 2HWF3 1JOBA 1LEMA 1W6QA 2OPKA 2VZRA 3I2FA 2B39A 2B9VA 3ZSEA 1RUE1 5C3QA 3GZUC 3ZFFA 3U10A 3OGSA 4YVSA 1F5JA 4AFBA 4CDUA 5ANQA 5EJ1B 5C3PA 3MV01 5GLZA 4FPJA 5HPOA 1PGL2 5DZFA 5C71A 3IAPA 4YG6A 5A1FA 1PK6B 1EV11 3CJXA 4Q1PA 2HBUA 1PZ9A 4AZZA 1MPXA 4GMP1 5J1XA 2BP6A 1K5MA 1VIWB 2ZKNA 3HBZA 3MLJA 1DQ1A 4I30A 4L97A 2QKDA 5F3IA 1L7RA 2DUPA 1UY3A 2J1RA 2Y0IA 5BYNA 4Y22B 4HK9A 4AAXA 4FTSA 4ISQA 4WVMA 4YNIA 4EROA 4JHTA 2VM9A 1HN0A 4R8HA 1SDDB 5HV0A 2QDNA 3HQRA 5JSPA 5C8CB 3LKJA 1KJLA 1US3A 4F8AA 2JD9A 3GDBA 4TYSA 4QU1A 4P9XA 2RS52 3UGHA 3VD9A 1GLHA 4MZUA 4XUNA 1CAUB 2AGSA 2RG4A 3QLQA 5FREA 5FZOA 3VKFC 4AI0A 2QQMA 4Q4Y2 2VVDA 1VBC2 1Y4WA 3MHZA 1UWWA 5BXXA 1AR82 3ETQA 5FMOL 3ZSJA 2C6SA 3MO4A 1E5HA 1U0AA 5FTTC 1KDKA 3CMGA 1POV3 1DDLA 1I3HA 5FOBB 4K8RB 2ATFA 3TB0A 5IVEA 5H9SA 4A45A 1YFUA 2FZ2A 1LEDA 3UKTA 5DDJ2 5KXBA 1OD3A 2YU2A 2EIGA 4XMAA 4OUSA 1SDWA 4HETA 2DVAA 3ZXEA 4ZS3A 2RJKA 1OT5A 1H6XA 3N36A 1XE7A 1R1A2 1HV0A 1REEA 3DV8A 2XMLA 3ZFGA 4QB1A 2A6WA 2E7TA 2OX0A 1MEC3 2VD7A 2Z79A 3ZKUA 2A7AA 1EPWA 2HLEA 3ABZA 2JG9B 3BALA 3ME2A 2OKXA 2AACA 4Y4RA 4LO5B 3KV6A 2OUJA 3K75B 1LOEA 4IESA 4RFRB 5EFUA 3VBUB 3G6JB 2WNVB 5T5JA 2WSUA 3I3EA 5JR2A 5FLJA 4NRPA 1V9U1 3HD8B 3NAPA 3MFCA 1QY4A 2XUMA 3K3OA 4QXKA 4WVWA 4YGEA 1UL9A 1UXXX 3FN9A 1AL0G 2Y38A 4YZ1A 5D8AC 2PQSA 3MW4A 3PVOA 4HSJA 4XIKA 5FK7A 4AVTA 1YWKA 4XQWA 1J83A 1GWKA 4CCEA 2KR2A 5JI7A 4DRVA 4CVUA 3I2IA 1VRH3 5FPZA 1GZCA 1GZWB 5CYYA 2AEYA 3C8XA 3UV9A 1XB9A 4PLNA 1GANA 5K7PA 1FV2A 4QHZA 2VY0A 5JDBA 4WZFA 4WM8B 3BTZA 2O0OA 3H1YA 1KRIA 2JDZA 3KHCA 2VXRA 4FPGA 4YZ5A 1UY4A 3AMNA 2OYZA 4DINB 3I2DA 4XCAA 5A6XA 3AMPA 4BOWA 2ILMA 2VL4A 2WNUB 3ZR5A 3RZLA 3O0XA 4I0WB 3PHMA 2GNBA 2XWJB 5FP4A 5FPBA 2IXJA 3I7DA 4PIYA 2WT1A 5B4XA 4PDWA 1LOGA 3B5LB 1WMFA 4K20A 5FYBA 3T2QA 2WIIB 4PF5A 3MEPA 4YW3A 4KI5M 1DYPA 3PTYA 4SLIA 4D3WA 5T5LA 2YYOA 5FYYA 3FLRA 3LF7A 2PAEA 3CDZB 3P5BA 3OG2A 3RGBA 4XFGA 5C9AC 3PUIA 2OUHA 1KJRA 1PK6A 2ZOEB 1DGWX 3PJYA 3M1HA 5FKCA 3ZFFB 2XR4A 1QQP3 2VCMA 2PHUA 5AVAA 3UK9A 4WM7B 4QKDA 4OI0A 5A3LA 4UW3A 1TVGA 4NRQA 3VD3A 3NNFA 2XJSA 5JMCA 2VNGA 2ZGRA 2B42B 2QQNA 4HVOA 1IOAA 4P9WA 2JE9A 1WLWA 1FOD1 2WO2A 3NMBA 4OI4A 4BQYA 1MS4A 4IV1A 3VBOA 4PDWC 5DUXA 5ERLA 4CPBA 4YZ2A 1EYBA 3DL3A 4ES9A 1U5YA 5C9AB 1HQNA 1AYM3 3CBNA 3BOWA 3OB8A 1YIFA 4BQ3A 1Z7S1 1WBFA 1HXS2 1UD1A 3KS7A 3RYRA 4B4PA 1W8HA 2P2KA 4YW4A 2ZXQA 2WWSA 2MNGA 1TQ5A 1YQ5A 2H0VA 2P3KA 4IL7A 1SHWB 4AGRA 4QKFA 1L7LA 3IMMA 1V0AA 2UY9A 3J7MA 4RA0A 1ASJ3 5EZWA 5CG9A 3WG1A 1RUH3 4YW1A 3H8OA 2MEV1 3M4FA 1VRH2 2P3YA 2ZS6B 1PO11 2CGNA 1W2AX 3C7EA 1MEC2 4IETA 2PHWA 3GNEA 3IWZA 3RSJA 2QDRA 5KHHA 4PIXA 5CFDA 3WG4A 2R042 2WNEA 1UU6A 1H8TB 3I2JA 4IV3A 5J96B 3KT4A 1JYVA 1L7QA 3UKNA 1W6PA 1UXZA 3ZFGB 3WUCA 1RJ7A 2QQKA 3ZFGC 5FAXA 3VBUC 1VBD3 3QBQA 2PLV3 2DVFA 3H9AA 4R9CA 3WSOA 3N9OA 1D4M1 1ZZBA 3KT7A 1R083 2VBBA 5JWPA 5FPLA 4HLTA 5JR7B 3VBSA 4TLGA 1G9DA 4PJYA 2C26A 5CFCC 1JXNA 3CHXA 2R1BA 3LA3A 4LXLA 2VZ3A 4Z82A 4C91A 4XFFA 4C1WA 3C7FA 1TG7A 4LLOA 2HKXA 5T3NA 2GP3A 4RS5A 4FPEA 5F1RA 2D93A 5CB7A 3Q8AA 4XMIA 5AFEA 4K6BA 1HLCA 1PO12 4CP9A 1PVC3 3N3HA 1QJEA 2ID4A 3J8F2 1DBNA 2AYHA 1H0BA 3AVSA 2NN8A 4CCDA 3I3QA 4L2NA 4D7SA 1QNWA 1E5SA 3TWIA 3BCWA 1LKNA 2EXIA 3O7OA 2JDPA 2HJIA 4Q4V1 3JZVA 4MSVA 4BA6A 1URXA 4AXOA 4OI2A 2W87A 3FWEA 1VLNA 2HBTA 1POQA 1J1LA 2VTXA 5I8SA 1ZX5A 2WWJA 2VNOA 4YM2A 1K5MC 3VV1A 5E6HA 5T55A 2FMDA 4IQPA 1PZ7A 4FP3A 4M3CB 3LDBA 2MHFA 1LOBA 1U5XA 1OPOA 5A3UA 3VHRA 1OUSA 1TMF2 1EUUA 5FYCA 2BUKA 2JICA 1SG3A 2WLQA 4FXGB 4AF9A 1RUE2 4YARA 1ODNA 4IV1C 3VBOC 5LW9A 3I3MA 2K9ZA 1NLQA 3HPNA 1F4AA 2QNKA 5A7WA 4OFGA 1J3PA 4AEMA 1ULCA 3W20A 4Z2WA 3WNMA 2X5IA 2K0GA 4YW2A 1X7NA 2D6LX 4TXWA 4XTMA 1LGBA 3MIBA 3TNQA 2XH6A 1W8UA 1VE0A 4YYOA 1CX1A 1K12A 2JB8A 2J1VA 2WZ8A 3WP3A 1HRV3 1V70A 3VZNA 2HWD3 3WF3A 2P3IA 1AX1A 5FK8A 5C70A 4CDXB 3OY8A 4WVZA 1YRZA 4N43C 2GMPA 2ZGKA 3BIWE 1RGSA 4ZU7A 5F7UA 1OKOA 3BTYA 1YO8A 2E31A 2IVJA 3AB0A 3T09A 1D0HA 3JBG2 3U37A 2G4IA 3W58A 2ORZA 4KU8A 4L11A 1RITA 4PLOA 5CFDB 4JVAA 1XNCA 2VMIA 3OPZA 4XUOA 3TNPB 3MIEA 4EN9B 3WVJA 4BWOA 1NA1A 1WW6A 4EN6B 1V9U3 2RR11 2EICA 4WM8A 3M70A 4AW7A 4MXWA 3POYA 5E16A 3PUSA 3DPRA 1ZZ7A 4H3WA 3ECQA 3ACIA 3L9JT 5DUVA 4PT6A 1Y9GA 1HW5A 5E89A 3RJ2X 2LROA 4OQ8A 4Z1VA 3WY6A 2EIDA 1ND2A 2CDOA 2BZDA 3N7JA 2YG0A 1AR61 1DYOA 3OUIA 5D21A 1F8VA 2WO1A 3OGGA 2DYCA 1VBA3 3EXUA 4AEDB 5FZLA 4Q1RA 2D6NA 4JKLA 5A7NA 1WW5A 2ZPXA 4MXWB 3VL8A 4NPRA 5LZ6A 4QQ2A 2F6BA 3KWVA 5DZEA 1PO13 4DS0A 2W95A 2A3XA 4L0PA 5LATA 2OQ7A 2PFWA 2ZEZA 5DG1A 1XNKA 5K0UB 1PGW1 2OT7A 4YVSB 4CCMA 1NYWA 2YMZA 4G4FA 1IKPA 4ISRA 3ZYIB 4ASLA 3AK0A 5FJHA 1XQNA 3E5XA 4XF4A 5KC6A 2WT2A 4W6YA 4Q4V2 4LHLA 2JX9A 1VBE3 3F95A 2QTWB 5JIAA 4AEDC 4LUKA 4DEQA 1JZ5A 2O8OA 2D6OX 2WYFA 4MG2A 2BV4A 4R4XA 5GZFA 2QUOA 4Q4X3 2Y6HA 1TE1B 2UYAA 2BGPA 4GXLA 2KA3A 2BFUS 4BYYA 3IDBB 1DIWA 2R062 4MYEA 3LA2A 3DKWA 4N53C 4E27A 4ITCA 4XJUA 1QNYA 5FDBA 3RG0A 1UU5A 4Q0SA 2XONA 4RYDA 4Q4W2 1TME2 5CAZA 2JG9A 3WZ1A 2RVAA 2Y26A 2ZEXA 1SZBA 1XSQA 4QGNA 2J22A 1W04A 3IDAA 1ULOA 3M3OA 5SV5A 4D8MA 2ZEWA 1I5ZA 2D7FA 4RR3B 3MI8A 4FI9A 1NX9A 1LGCA 4Z07A 4QKBA 1JUIA 2CTVA 2XPJA 3INAA 2VECA 5B2GB 5F6LB 3FLPA 1NZCA 1GQPA 4BQ1A 1MZ6A 5I8TA 4HXCA 4F3JA 3V0AA 1ZBE3 4KBZA 4OVEA 2QFEA 4QPIC 3SLIA 3ACLA 3D6EA 3ZN6B 1ULDA 4MGSA 2ZX4A 1AX0A 3BVCA 4H7LA 5GJ6A 5IYYA 3BKZA 4XABA 1OXCA 1H4GA 1BQPA 1RUF2 3WF2A 4FQZA 4IGPA 2WA3A 5EIYB 1MS5A 3BODA 3OSDA 5B4NA 3WCSA 2ERFA 1LNSA 4JTOA 1LOFC 1QJU2 2EXJA 1ZZ8A 4IGOA 5A3MA 5KXEA 4NIDA 2FCUA 3I59B 5FZMA 4HKWA 5A7PA 5CADA 2JE7A 1W9FA 3CNAA 3ILFA 2OIIA 3DGTA 1XYNA 4XUTA 4ZS2A 3VKNA 5FPXA 5IVVA 3UGGA 5J36A 2ZX1A 3TEWA 1QH6A 3ATGA 5F3CA 1W8OA 2FZ1A 3GHNA 3HIFA 3PU3A 3ZYJB 1RUOA 4LOSA 2OVUA 2BBVA 4OZXA 1VBA1 4UF0A 5BV6A 1R081 1Q43A 4OZOA 1O59A 4MUVA 1QJX2 5JOXA 1CD3G 2ZEYA 4P14A 2Z4FA 3S7EA 3MUZ1 1SMVA 3TBDA 2VNVA 2TBVA 1HB4A 4TWTA 3ASIA 4XFBA 1DZTA 4QPIA 2R32A 4DY5A 4UW6A 1K3IA 5F8PA 5FXWA 1S0IA 2JKBA 3MGUA 2W52A 2R16A 1W3VA 4CEWC 1R1ZA 3SEEA 3Q9OA 3LCPA 4LBJA 5SV8A 4MGQA 3KV4A 4CUAA 2JDUA 4OI1A 3KVAA 4GMP0 5FPUA 4CDUB 3MPBA 5FY8A 2XBO1 1W6QB 1HIXA 4Y1YA 5HCFA 1JOPA 4XJ8A 5A7OA 4Y22A 2ET7A 3HN3A 2JG9C 1FNYA 1RJ8A 3VKMA 3R05A 1MQTA 1CZSA 4XAAA 4N90A 1REFA 4UXAA 5FXZA 4QD2A 2X29A 1H9WA 4DIQA 4B1LA 1HXS3 3S0MA 1OUXA 1VBB1 2EALA 4BJ0A 3DPRB 4XBLA 5FZGA 2WKKA 5C8WA 4JKMA 4RD7A 3O1RA 5FMDA 5HCAA 1W99A 3B9CA 1PHMA 4IDZA 1R093 3THTA 1I6XA 1W9TA 5F39A 4XVHA 4BQXA 5LA2A 2VCAA 1W0OA 2YPDA 3M8LA 2WO7A 4XXAA 1W2NA 1QF3A 3VB9A 2HWF2 1GICA 2XVGA 4XJZA 3H3ZA 5KHKA 1DQ4A 3R4UA 4KGQA 4JQRA 5L9RA 4K3UA 3O1OA 5IW0A 4FAGA 5J09A 5J3UA 5JMOA 1ODMA 2KXLA 3H8RA 2ARAA 3LSDA 4CU6A 5CKQA 1UZZA 4MGTA 2JG8B 3WW3A 4V2WA 3H8UA 2F4PA 2EF6A 4AFCA 5BNQA 1MZ5A 5CKNA 2JDMA 1HXS1 2D5FA 3NW4A 1FAYA 1OHFA 3RWNA 2DBNA 4E4SA 3VBSB 2HWE2 2PELA 1OKQA 1COV2 1H4HA 1AYN3 2GNTA 1RHI3 3U0ZA 4GB31 4ASMB 4OULA 3R6SA 2Y60A 2MEV3 3AX4A 4W6XA 1UYZA 2FDJA 1YFWA 5LEJA 2BWCA 3KV5A 3LIGA 4KWLA 3THDA 1UYXA 3FUQA 2JENA 3I4IA 5DZGA 2DU1A 1OPMA 2R072 2UWBA 3U14A 2P1BA 2ARCA 5IVJA 1IS3A 2KD7A 4LNVA 4K1ZA 4F7ZA 1WLCA 2EAAA 4DQAA 1PNFA 1RC6A 5FLIA 1A8MA 3LA7A 3RMXA 1SLBA 2GP5A 2J1SA 4Y4YA 1PO23 4LKFA 1S2BA 1AR83 1VRBA 4Y33A 4EE2A 1HRI1 4LKEA 5LRRA 3KF3A 1KITA 2YUEA 4NRMA 1AJOA 2YZ4A 4NE9A 1JZ7A 2V09A 1V6MA 2PLV1 2XJPA 3O0WA 5A6YA 1BHGA 1DZRA 4DNYA 4WV8A 1ULFA 3WF4A 2Q30A 2E7QA 1IZ3A 2SLIA 1ND3A 1DQ6A 1ZNPA 1NCRC 2F17A 3RFRA 4CEYA 4U36A 2XQXA 4EV0A 1G6NA 3D3AA 3FE5A 2VVFA 4XOGA 4QM8A 1QJY2 1IQDC 2AR6A 1CONA 5FZEA 3TN93 1KS5A 3WG3A 1H2LA 2R0HA 2W1UA 3JB4C 2VZQA 3USUB 4CP9B 5EJZB 3ALQA 3UETA 4ZONA 4LE3A 4YM3A 2YGLA 1GSLA 1IS6A 4LIUA 3Q8FA 2DDUA 3IPVA 1UW8A 1W9YA 3D8CA 4CEYB 1ULEA 3C3VA 1RMU1 4NVPA 4M0NA 2IFWA 5CKMA 4DPNA 1UCXA 2DFBA 5IFTA 1WCSA 5BUVA 2VTXJ 5G05L 4S2GA 2ZZQA 5JLVA 4ZZ8A 2JEMA 1JZ4A 5H9RA 4J25A 4FOVA 2JDHA 1RUD2 2VH9A 2W39A 1NUKA 4C90A 4XFHA 1XRUA 4N43A 4NIIA 1CZVA 2Q8OA 1UN1A 1NA1B 2JDYA 2VU9A 3VZMA 2W1WA 4GD4A 5FZOB 3D82A 4CU9A 3ZVXA 4WM7A 2XBO3 3U78A 4YZ4A 2R073 4CDQC 3LEMA 3UKVA 3OBAA 1XC6A 2E33A 3VHPA 2Z5WA 2QJVA 1F35A 3DUIA 2WJSA 4GWIA 2PQQA 2HWE3 3O0VA 2H0BA 2ETEA 4RHV2 5GLUA 3BPSA 1CAVB 5DDJ1 2DV9A 1W6NA 1DGLA 2BOJA 3KM5A 4BQ2A 5DABA 1WMDA 1JYTA 1W2TA 4JKKA 2GMEA 1VBA2 2VGDA 1ZM1A 4KNCA 3D5OA 1OH4A 2XVLA 4AI9A 2TUNA 1RHI2 5FZKA 3S30A 3VZOA 2G9FA 3NL1A 5KR7A 3HJRA 2W47A 1XOYA 3HAGA 2ZAHA 2X8KA 4EN0A 4GH4B 1YYNA 4PF1A 4BIOA 2WS92 1C3HA 3RZGA 4CA9A 1PO22 1YUDA 2W92A 1BCXA 3B9IA 1JYWA 1N47A 4LO7A 3AKPA 3V56A 2B45X 3NV3A 4Q5OA 4K21A 5FZ4A 2N7GA 1YXWA 4GALA 4S2FA 1W05A 5L36A 3B7MA 4UBHA 3S57A 3GALA 3K2OA 4OHYA 2B7YA 1UMHA 3HNMA 1UOJA 1EY2A 2YBKA 3JCIA 4LA3A 1JMUB 4N9HA 3ZM8A 1C8NA 4ATFA 4DB5A 1A34A 1RUH2 4IEXA 3PJQA 1HB1A 1VMHA 5DUUA 3RYPA 5BNNB 3NAPB 4UFJA 1BEV3 2UYBA 3KT1A 3SHRA 4CU7A 2DCJA 1F9KA 2RHPA 5FZ9A 2WS91 4YGDA 1CGPA 3ORJA 2WT0A 1HKDA 4Y3OA 5JXJA 1TME1 4CYDA 1UZ0A 2D40A 1ENQA 2XG3A 3FC0A 3JD71 5FYTA 1VAKA 1LHUA 2AC1A 2XBO2 1BLZA 1RUG1 1W28A 4AR2A 2KM2A 3AKTA 4A3XA 2G19A 1H1IA 5CZKA 4GWNA 4XE9A 1WCKA 3MIDA 2BVVA 4Q4Y1 1JYCA 4NIGA 3ZX7A 3KCYA 5HCHA 4I09A 3Q8CA 3O12A 3WD5A 1OURA 2SBAA 1C1LA 1OOPC 2Y6JA 4NHYA 1D4M2 2R1DA 1NE4A 3AVRA 3NV1A 5FLHA 3WNXA 5FQ0A 2E51A 1UY0A 2C4XA 4XIOA 3JBG1 4UFLA 2BPA2 1ASJ1 4CDQB 4GB33 3VZJA 2RM23 3GHMA 4QT6A 3LSEA 4O9GA 3CZUA 2WN2A 3OCPA 1ULGA 5A6ZA 2GDFA 1W9WA 3T2TA 2DF7A 3PMEA 2FDKA 2RS53 1JU4A 2WNVA 3GCWA 5A33A 4A4AA 4BLJA 5C5UA 3JQWA 3ES1A 3RI8A 2JECA 1RUI2 5JZGC 2GNMA 1SFNA 1UKGA 3M3CA 1QJU3 3OY8B 3ZSLA 4UW4A 2Q1MA 1XPWA 5EHDA 3RZZA 2C9KA 5C4WC 1RVF1 5IVCA 3B02A 5DDJ3 3NKGA 4M00A 5F2WA 4AEJA 4RN5A 5C4WB 2RMU1 3E6BA 4AI1A 1N1YA 4AI8A 5T54A 1BXHA 1G9FA 4L92A 1Y9MA 3ZXJA 1ZA4A 1MS3A 2ZACA 1UU4A 1IPSA 1JU3A 1QJX3 2D5HA 2JJ6A 1HX6A 1SBDA 4YFZA 5IVYA 4D69A 4QQPA 4FTEA 4CDWA 5T52A 3IDEA 4E2GA 5DAWA 3ZXFA 4DUXA 1J1TA 3POSA 4MGZE 4LORA 4Q0QA 3TYJA 4GWJA 4MADA 3I3DA 1WMEA 3E97A 2Q1FA 4IW3A 1F2NA 1O7FA 2GC0A 4OHXA 1UPSA 1H8TA 4HPKA 1YNAA 1LHWA 1UZVA 2VW1A 3PTRB 1GQHA 2DCYA 3ZDSA 4YG3A 2GU9A 3QD6A 3RWKX 1BVP1 1OFSA 4JTNA 3ZR6A 1JYXA 4XFCA 1O6UA 3T0DA 4QPIB 5FIXA 5EP9A 2WN3A 1CQ9A 1OBNA 4A2UA 3OPWA 4RFT0 1FPN3 1MS8A 4MV2A 4HZFA 4DXRA 4QDQA 1VP6A 1VB2A 2BBAA 1CIYA 1MVEA 4BM8A 2AENA 2ZX2A 1O3RA 4I01A 3V65A 3OGVA 5K4LA 5LBBA 1WD3A 3RJRA 5DAXA 1SLTA 1X9PA 2WINB 3AKQA 5FZ7A 1NXD1 3BU7A 3OPTA 3TN91 2GC1A 2ARXA 2A3WA 2WFPA 1VMFA 2LM3A 3UNPA 5FZDA 3LDRA 2VMHA 4FTBA 1UY2A 2W91A 2YU1A 1T6BX 1TMF3 1KD7A 3FL7A 3KB5A 1RUD1 3T4VA 2RDSA 3WNLA 5C8CA 3O1VA 4PBPA 4JDNA 4L99A 1DCSA 1MZFA 5IHRA 1RUI3 2QQWA 2G9GA 2B5HA 2VUJA 3ES4A 1B35B 4LBLA 1H8VA 4ZHNA 1X9TA 4RS5C 4BU2A 4E8CA 1GOHA 1VMJA 1HRV1 4TN7A 2PAKA 5IJRA 3P6BA 4AHZA 4LQRA 1UMZA 2VQUA 5ABJA 4KWUA 2XQRA 5BNOA 1PZ8A 3IBMA 1DQ5A 1CVNA 3ZN4A 2JD4A 5IT6A 1T6GC 3N9PA 1GOGA 4IERA 2ADDA 1S0EA 3KGLA 3H8XA 1SCSA 4D7TA 2WQ8A 2A75A 1FX5A 4PI0A 1H2NA 5JXIA 3PU8A 1G7YA 2RE9A 5K0UC 3CQOA 3T30A 4HKOA 3FX3A 1D2QA 2ADEA 2RMU2 2Z42A 3BB6A 4M3CF 2Q4SA 2BGCA 4YW6A 2VQ0A 3VN4A 1EV13 1O4TA 5F32A 5BNOB 1JZ3A 3AMQA 4FPOB 5LASA 3ILNA 3HVDA 3J26N 4A6SA 2P4EA 4GWMA 4KQ7A 1M4WA 3MIFA 3QCWA 3RNSA 3W5MA 1AR63 4LBKA 1QHDA 5KHGA 1PX4A 3VL9A 1UZWA 4JHZA 3U4XA 1HB3A 2VR4A 2DU0A 4DUVA 4FP2A 5LWBA 2PHRA 3VKOA 1O5UA 2B46X 4CUGA 2NPIA 1S2KA 4NIAA 4HOOA 5BNPC 4LKDA 4QX1A 3VBHC 2R063 3P1IA 4Q4W3 1OF4A 4R9BA 3URFA 1O3QA 2ZTNA 4UOJA 1DLCA 4C0HA 1G8WA 2ZGLA 5F3EA 3RRDA 1LTEA 3GBGA 2XLGA 4UW5A 4A44A 2ES3A 1MS0A 1RXFA 3C2UA 4M3CA 2B8MA 2RS51 2IUWA 5GZEA 5JOYA 1GZWA 1ZBA2 2WFF2 3LB9A 1FXZA 2VZSA 4FPYA 4UFMA 4CDWB 5F2SA 4KU7A 5HI0A 3LQCA 4CDWC 1NLSA 3FBYA 2FCTA 3QH6A 4GJYA 5I8YA 1AYM2 1SQ4A 3AJZA 1S4CA 1K45A 3BGAA 3DCQA 4QDRA 5FRAA 3SMHA 3HOBA 3CJIA 3GCXA 4RQPA 3ZDVA 3IPVB 4LEJA 5FFOC 4PLMA 4AQ2A 4B29A 1Y7BA 1MVQA 4XXPA 1Y9QA 5L7OB 4QPYA 4NUBA 4AHXA 1ZRDA 5L7OC 3U1XA 4CUCA 1NCRB 4E2QA 1FMD2 1W2UA 2VMCA 2ZGTA 1V6IA 1GMMA 2A5ZA 4QHBA 4EZHA 1WUVA 1TME3 4BQ5A 2D97A 2CV6A 3AKSA 1EAH3 4YPJA 2ZBJA 2ZCWA 3KLSA 4HVRA 4BCUA 5KC5A 2QCSB 1YLLA 2BERA 2PMWB 4D6SA 5FUPA 2XDVA 4CCLA 2CAVA 2PHLA 4ZXEA 2OW4A 3TEXA 1HJFA 1NXMA 5DAQA 3DXTA 4Y1ZA 5E88A 3VD5A 1STMA 2QZ3A 5C4WA 1F5FA 1AR93 4OLLA 4V1PA 3Q8EA 3MW2A 1IS5A 1MQTB 1V6LA 1Q56A 1R1A3 4CCOA 1O91A 2NLRA 3M3EA 3EBRA 3W5NA 2V4VA 1VBB3 4J1WA 2HWD1 3WDTA 1YFYA 1CAVA 1B35A 1QOTA 3BTAA 2CNAA 2WNVC 4NAOA 4DFSA 5KXCA 4E4DX 3SISA 1QOSA 1S55A 3VDDB 4FBFA 2I45A 4Z8BA 3IB3A 3GM8A 3SKVA 5BNNC 4CP0A 1CIWA 2GC3A 3NAPC 3C7OA 3NNJA 3SCHA 3OBRA 3E6DA 5JIUA 2VCBA 3AZZA 1PVC2 4META 2X10A 2D44A 4XZPA 2E9QA 4AEDA 1X82A 3B69A 3FBMA 4QX2A 2O14A 1RUC3 4OCTA 1VBC1 3NJYA 4QPGA 2YXSA 3VD4A 2J7MA 1G9BA 1W6OB 3PUQA 5IFPA 5GLWA 3WNOA 3EO6A 1AYN2 4JGYB 5AVPA 4BMEA 1T2XA 3NSTA 3KQ4B 4GJZA 4LKSA 5LBFA 1CX4A 3WT3A 2BWAA 1IG0A 2OXBA 4WVVA 3V64A 5L9BA 1UOBA 4B4QA 2WAAA 2Y33A 4MH0E 4P9JA 3OGJA 1N1TA 4AQTA 2WAOA 5IK5A 4JRLA 2PHFA 2VMDA 4QPGB 2VVEA 3P3PA 4Q2FA 3G7DA 4Y20A 3CKHA 2WUHA 1YQ2A 1DQ2A 2W68A 4XF0A 4YW5A 2V73A 4HK8A 4QGLA 4CXXA 1S0GA 4MX3A 1O8SA 4LR4A 5FJKA 1SPPA 1S0FA 2ZJCA 3CF6E 3FFZA 1SLIA 4NAMA 5FOJB 5FZHA 1RYYA 3F2ZA 2QQLA 3KQRA 2PHDA 1DF0A 5FPVA 1AR72 3V0BB 4BXFA 1V6JA 2Y8KA 3EYPA 1FPN1 1ZZ9A 5K9YA 1WW4A 3POEA 4YVWB 2LW8A 2LS6A 4YWAA 1NY71 1HRV2 3EB7A 4ATEA 4EWAA 3AP7A 2OZJA 4FFIA 3DYPA 2EIBA 2Y6LA 3ROUA 4COUA 4DZGA 3VD7A 2WQZC 4FOQA 1VAMA 5I0SA 1V00A 5FZCA 3ZYFA 2HWB2 4X6QB 5EQUA 5F5IA 4OMCA 3AZWA 2DVDA 2V4AA 1AL22 4AOCA 4NJ4A 3KSCA 1QDCA 2RJ2A 1HB2A 4GIQA 2ZZJA 2DWRA 5HCBA 1OF3A 4CEWA 3CO2A 4NMIA 4DRRA 1UOFA 1LOAA 2ZGPA 3FFQA 4XW3A 3SCGA 2RM22 1N3PA 2IC1A 2P3JA 4G3YC 1ONAA 1DQ0A 3THPA 1OLRA 3PVEA 4N43B 1U12A 1MS9A 2BDRA 4LULA 4Q4X2 3USUA 1NT0A 4KG8A 5LY1A 1Q8PA 4CDXC 3ZFFC 1VBE2 2CWMA 1RUG2 4QQHA 4BHPA 3JD73 3OYWB 4I0AA 4HANA 4WBBA 1KFUL 1PMIA 4K40A 3USSA 2ZHNA 3OD4A 3ZKYA 1W6MA 1QOOA 2GC2A 2VUAA 1CAWB 3B01A 3LEGA 4LBQA 3AL6A 5FYZA 1RUNA 1KGYA 1Q3EA 4YGBA 3HN1A 1CWPA 5A7QA 3H42B 5I91A 3L2HA 2RJLA 1H2KA 1Y43B 2XGXA 1AVBA 1IPJA 1ALYA 2A1XA 3POIA 4HONA 2PHXA 4QX7A 4IEOA 3WEZA 2PXJA 2VUDA 2J1TA 1KDMA 1RUJ2 4QX8A 1AX2A 3N9QA 3SXWA 5LCWL 3NWKA 3QH7A 4IGQA 4M3CE 3WDWA 4CCNA 1RTVA 2XLAA 2R49A 3AKRA 2E53A 2ZA9A 2Q0AA 3LE0A 1WCDJ 5C3OA 3LGRA 3ZPOA 5C3RA 1P8JA 3WOGA 1NKGA 3WR0A 2E32A 3ZIWA 1WMXA 4GULA 3NJVA 4YM0A 3BN6A 3VBFC 3GZAA 5FYMA 4EYUA 4XJ9A 4EWEA 5CBLA 2X09A 1HRI3 1S2EA 5A7SA 4D6RA 5LK5A 4AGGA 2PYTA 3LOIA 1TZOA 1D7PM 2QQJA 2UWAA 1RUF3 1FI2A 2VW0A 5F6KA 3H0OA 3PNAA 4Q27A 5IK8A 2ZKLA 5L9VA 3O1SA 3OGRA 1WLDA 4GMP3 3ZFEB 4ES8A 4DO0A 4PIZA 1JYIA 5FZ6A 1ULPA 1C8M3 2DCZA 2WQ4A 1XSRA 1OD5A 1AXKA 2IXKA 4O65A 3T0AA 2DCTA 2RS12 4IE0A 4JGYA 1R1A1 5A70A 5FO7B 2YBSA 3OEAA 1WBLA 1UY1A 4FPCA 1PX3A 4JCKA 5JPMB 1GWLA 2D6PA 4CP1A 1WWYA 2UWCA 3MUY1 2JG8A 1H1MA 3M7AA 2R043 1NCRA 3SITA 4LBQD 1ND3C 5JOZA 3DYOA 4XF3A 3DN7A 5FY1A 1OA3A 5CFCB 2D3SA 5CFCA 1RUC1 2BW8A 3VBSC 1S0BA 3GJAA 1YCIA 1LHOA 4JAAA 4Q4Y3 4XF9A 3NQHA 1AXZA 4YVWA 3MV11 1GNYA 4MGIE 3BTXA 5DG2A 1SLCA 1POV1 1AF9A 4CTEA 1APNA 4LK6A 5FZFA 3A7QA 3ZXKA 2VZTA 4HSLA 1J3QA 1OA2A 2ZMNA 4V2VA 1AL21 1Y3TA 4NROA 2RS31 1H6YA 3ZPYA 2OA2A 4KG0A 4YVWC 4UWDA 3RDIA 2FDHA 1SFPA 1G9AA 1GU3A 3KVBA 1GFF2 2A73B 2YROA 4E9KA 2Q5TA 4H7MA 1BYHA 1NAEA 4N53A 4B7KA 1RUD3 3C7GA 3T1MA 2TEPA 3ENRA 4XPVA 2WZPP 1PIV3 3IMNA 2CGOA 3J7LA 4YSFA 1EV12 1U5ZA 4F83A 3RS6A 4KGGA 3AXEA 2ZHKA 4Q8KA 1AXYA 3AMHA 3SEPA 4FQ4A 2A6VA 4Z92B 3T0BA 5LBCA 4CRQA 3VDCA 3ZYGA 5A32A 4LOTA 1PGSA 2Q8EA 1ND2C 2TNFA 2XJTA 4KMQA 4UFIA 3RQ0A 1GBGA 5CG8A 1CAXA 1QEXA 3HEIA 1UQXA 2VAUA 2P37A 3I2GA 2C0ZA 3CJIC 3O14A 5JOWA 5BPXA 4AHWA 1H1AA 3FMGA 3VLBB 4K7JA 1RL3A 1QJZA 1BEV2 2W1QA 4AEKA 2W0XA 3NRUA 1D0GA 2JKXA 2Y64A 1JODA 1GZTA 3VBFA 4L9BA 1XE0A 2Z2SB 1Q8OA 2AZ5A 2PAMA 2IZWA 4YRDA 1K42A 2HWF1 3A23A 5DQ0A 5LK7B 2VZVA 1RUJ3 1GP5A 1RINA 2CY6A 4AI3A 4EWDA 2ZMKA 1B09A 1EAH1 1F4HA 3I59A 1QXJA 1XNAA 3WHUA 3R0RA 3GBWA 2V5YA 1VB4A 1YQCA 1MS1A 2ORXA 3ZN6A 3LPFA 4LTAA 3OD0A 4OMDA 5FZ8A 2P6HA 2MPFA 1Z0HA 3N9NA 5F5CA 1US2A 2RS13 1E5RA 4Q0PA 5FYSA 1MR5A 2Y6FA 1NOVA 1NA1C 4XCBA 1E5IA 4RQPB 5JCTA 1V6KA 1ZRCA 3KHBA 4Q4W1 4TTGA 2RV9A 2EXKA 3TOJA 5FUNA 3SC7X 2DVGA 2OQ6A 1R091 3HNYM 4BB3A 3VBHB 1J58A 3WQ1A 1R64A 2R041 1N3OA 5FZ1A 5A3OA 2YFUA 4YW7A 4CXWA 3N4MA 2YDEA 1MEC1 3JB8A 2DFCA 2R30A 2HEWF 3GJBA 3LZZA 1LOCA 2XWBB 3SKJE 2EXHA 3E5QA 3WF0A 2F4LA 1LOFA 3A22A 4N8MA 3U4SA 1LAJA 2WO3A 5K0UA 1PIV2 5E8AA 3N7MA 1GKBA 2YHJA 3CLPA 3VZLA 4PQQA 4LO8A 1OVSA 1CN1A 2VOTA 1FYUA 4PBOA 4BDVB 4BQWA 1SACA 1UOGA 4UI9L 2WNUC 3N9LA 1OLQA 1BBT1 2GH2A 2I07B 3QOPA 4MGKE 4UAPA 2P17A 1X8MA 1CAWA 4DEVA 5ABJC 2CGPA 1JI6A 4GA9A 3WNPA 4SBVA 2ZGQA 3JXSA 2CHHA 4ZKTB 2GMMA 4I3GA 4P00B 4QHOA 3LEIA 2WZR3 5FR3A 4XYXA 1AJKA 2B9UA 1VBB2 5FV3A 4B1MA 5FWEA 4E4HA 2QQOA 1VJ2A 1WGPA 3SCFA 2WA4A 1S0JA 4DXZA 2W46A 3HNBM 2XVKA 1KXGA 1FOD3 2ZGNA 1BVVA 3NJXA 2R0FA 2VO5A 4IV3C 4N53B 4NHXA 1RUJ1 2RR13 4QB6A 5FMBA 1JOJA 3WP4A 2W9XA 5HV4A 1RVF3 1D2SA 2Q8DA 3T2PA 4C8DA 1XNBA 3FZ3A 1ZBA1 1AR73 1MZEA 2IVIB 2ZAAA 1OVPA 1W2OA 3QACA 3V0AB 2E63A 5DUWA 1CJPA 4FPLA 5G04L 3AMMA 2RDNA 2BTVC 4OUEA 5ANNA 1FATA 2LTNA 1J59A 5FO9B 4RR3A 2GNDA 3U07A 2E7AA 2GALA 2RS32 5ACA2 1ZYBA 2R7EB 2WYSA 2XUEA 3H3UA 4INDA 3A0KA 3FHQA 1H30A 2VOWA 5FMCA 4CCKA 5CFDC 3T1LA 2OPWA 4MVTA 2ZHMA 5FYIA 1QKQA 4S2HA 4RL7A 4Y1UA 1DGRN 2D6KA 4NWWA 4DOUA 3UYJA 1WKYA 1WA6X 4BE3A 5LBEA 4AI2A 2YY1A 4HN1A 2Q1ZB 1LJ7A 1OLMA 2XJUA 1LCLA 4LITA 5CA6A 3DECA 3P3NA 3APBA 1GQGA 3M3QA 4AVCA 2FD8A 4IEPA 3W9AA 3ACHA 1UNBA 4FCAA 3ZYRA 4DXSA 1YC61 1W03A 3D4KA 1ENRA 1HJGA 2CL2A 4DUWA 4N7IA 4FAHA 5A3PA 4Q26A 1VALA 1C1FA 1FPN2 1BBT3 4HG6B 3WQ7A 5EYYA 1S0DA 3LD8A 5HXMA 4FVVA 1ACCA 1LECA 1N1VA 4Y26A 4W4ZA 5LA0A 1PGL1 2BEOA 3POWA 2A6XA 1AUYA 4IEVA 4ARYA 4EQVA 4EN8B 1XYPA 4QX0A 5FXVA 4ORFA 1B35C 4QX3A 4JGZB 5GZGA 3HR9A 4XBNA 5JAXA 3I2OA 4HPKB 4QU2A 2JB4A 3ON7A 2Q8CA 3WW1A 4A3ZA 3WINE 2AUYA 3KCCA 4HVQA 4JRAA 5L7OA 2WL1A 1C5IA 4XAEA 1IS4A 2ZABA 1NE6A 4LBMA 3WDXA 5C6CA 1VBC3 5KBFA 4XHXA 2BQPA 5JZGB 5A6QA 3AYAA 4DY3A 3ZOIA 3SH5A 5IATA 2W2IA 4IE5A 3VGIA 1WD4A 1Q8VA 2YC4A 5EV7A 1SEFA 2Z69A 5FYVA 2BGOA 3ILRA 5FY5A 5BNPA 2NMNA 3UESA 4CCJA 1R092 1FMD3 5EYXA 3SQOA 4H2AA 4OHZA 1RB8G 1YEWA 4AAPA 3IKWA 1UAIA 4Q0UA 2W08A 4ZY9A 1NLRA 2HWC3 2RR12 3OJBA 1EUTA 4IEYA 1JH5A 1PVC1 3OEBA 1JZ6A 5EWSA 2IWGB 1HDKA 3BPZA 1G9CA 2DBIA 3KD4A 1UYYA 3HQUA 2W5FA 1NG0A 2A70A 4MOAA 3A0NA 1IQAA 5JI9A 4XURA 1OOPA 1OQDA 3BUCA 3JQXA 3K4AA 5D8AA 4W6WA 4COWA 3VDBA 3PUAA 3I8TA 1TEIA 3TRSB 3T2OA 2RDQA 3JUUA 2ZX3A 1D4M3 3BOPA 4I0BA 3OOXA 4ARXA 4BK5A 1SFYA 2JE8A 3FHIB 3ST7A 2AEZA 3VBRC 5C33A 3GZEA 5I0DA 5D2AA 2JDAA 3POFA 4FFGA 1DZQA 3ELNA 3UJQA 5JUVA 3BIEA 3PVBB 3PURA 4A42A 5IVFA 1V9U2 5H9PA 4H14A 4M4RA 3PDQA 3VBHA 4XUPA 1KFXL 1JYNA 4OYUA 4IV3B 5FZIA 4KH9A 4O61A 1OMIA 2EAKA 4E2SA 1AR71 3WV6A 1Q5OA 3PMSA 2E26A 4QM9A 4CPBD 3J9SA 4NPMA 2P34A 3LDKA 2FCVA 3PL0A 2UU8A 4AQ6A 5LA9A 5JXHA 5GZCA 3HBKA 2UY8A 1DGWA 4KBBA 1UF2C 1S0CA 3VHNA 4I2OA 4HT1T 1AYN1 2D6MA 4XFAA 3AM2A 4YG0A 3ZO0B 4FT8A 1AYM1 4FFHA 1PVXA 4IE6A 4Y1VA 5GKAC 4BK4A 3AC0A 4AHYA 3CU7A 1DHKB 1UX6A 5CEHA 2XXZA 4R9DA 4XEZA 1XYOA 5IUQA 1NQDA 3MIHA 1LB2A 3L2YA 1QQP2 2CSGA 3K77A 4HKLA 2D3RA 4ZPIA 3KGZA 5LB6A 5FCCA 2VCCA 3WW2A 3WF1A 2AH2A 4N9IA 4A41A 4D0QA 5TSWA 4YFWA 3POGA 2A6YA 1ND3B 5FYUA 4P9LA 3IDCB 4GAZA 4XQDA 4HMZA 3ZIXA 3Q8BA 3S7IA 3TN92 4IE4A 2ZGOA 3WNKA 3ZXGA 3MDPA 1J84A 2CDPA 4CDUC 1RIRA 4QQLA 4YVSC 1H8TC 1ST8A 4Y24A 4XHBA 3UT0A 1HV1A 3GF6A 2VZOA 1RUC2 2IXCA 4W8JA 3AZXA 4BH9A 3I54A 1DP0A 3J7NA 4LUMA 3H50A 1XNDA 1LR5A 3W21A 4AVSA 5KWRA 3AZYA 2H6BA 2QQPA 1JS9A 4U2AA 5A3WA 5A1AA 3ACFA 2VZPA 4O7XA 4YGCA 1WZXA 3N9MA 1JW6A 4LBOA 5FBZA 5A32B 1RUH1 1JZ2A 3S6PA 4FXKB 1Q8SA 1CJDA 1O5LA 1UX7A 3R4DB 3IN9A 4QPWA 3O1TA 2QQUA 1UPIA 4HFSA 4QXHA 3HWJA 3VDAA 5AC92 1DU3D 3LEKA 4P5YA 3SH3A 4M4PA 4A7KA 5FO8B 2CAUA 4EN7B 1PGW2 2JIJA 2YGMA 4S2DA 5EJ3A 1WCQA 5L73A 1RUG3 2NQYA 2ZGUA 5A1LA 1YFXA 3AP6A 1VBD1 5C7GA 1HN1A 1RXGA 2HEVF 4XACA 5DN2A 3EHKA 3K4DA 1XU1A 3WG2A 3ZYPA 3TEZA 2PLV2 2PN5A 4CP2A 3S5AA 5C9AA 4URTA 1UKRA 2QZ2A 3WNNA 2FDGA 4XDQA 4JV4A 2C24A 5L19A 5LEKA 4IV1B 2FBEA 1FMD1 1ENSA 1QWRA 3VBOB 3ZXDA 3ZXAC 1AR91 1UIKA 2JXAA 5LY2A 3AL5A 1IGOA 1E57A 4XDOA 1A3KA 2XKPA 3H1WA 3AYEA 3FLTA 3NKTA 1W90A 2NZ9A 4K8FA 5FP9A 2FHRA 4FSJA 1PK6C 4LBNA 1C28A 4X6RB 2YFZA 2LUWA 3FUOA 4P08A 4RHV1 3WW4A 3B00A 4LO6B 4TLFA 5F3GA 1LODA 2YC0A 1D4VB 5CU1A 4IUGA 5CVRA 4AFMA 4B8EA 4CUBA 2QQIA 1IPKA 3WDUA 3T08A 1VBE1 4N7UA 2FDFA 1CESA 4LHSA 3HMYA 3LPGA 3OBTA 3MLLA 3J4UH 1S1AA 3MW3A 5DXDA 1ZVFA 4UF0B 4WVMB 2V72A 5DMYA 5JZGA 2DUOA 2VMGA 4ZZ5A 1KS4A 3LFIA 4Z2AA 4CXYA 4JDMA 5FXXA 4ZXKA 4QB2A 4R52A 1UIJA 4A6OA 4GKXA 3T3YA 2HWB3 1Z78A 5D8AB 3C7HA 2HWC1 4LHKA 5AC93 1ENXA 2Y0OA 3AJYA 1HQLA 3N7LA 5GM0A 1GP4A 3RMYA 4Y5Z0 5FYHA 2I2SA 3KZ4C 5A3NA 4YM1A 3A21A 1MACA 1RVF2 4GQ7A 1VPHA 2H6CA 5GLVA 2QBXA 4IXLA 4A7ZA 2WZEA 5J7MA 3D0JA 3RZHA 1FOD2 1SCRA 3IIAA 1K5JA 1BMV1 2XKOA 3IAQA 5FQ0B 1JBCA 2OZ6A 1QJY1 5FY7A 1A78A 1V6OA 5I0TA 3ZFEC 1W8WA 5C5TA 5BNOC 2WZR1 2VBDA 1VAVA 5FUIA 2VUCA 1C8M2 2DCKA 3TAYA 2YB7A 4LE4A 3X29B 3WX5A 5LRSA 3HT2A 2JG8C 3V0BA 2X53S 5FZ3A 4QGMA 1W8FA 4RR3C 5A33B 4CSWA 4IEUA 5F37A 3ZYBA 1ZZCA 5ACA3 3VUOA 1NCQA 4IEWA 1DGRA 1J3RA 1LHVA 3O1PA 3E6CC 3MFAA 2VC9A 3RZMA 3NVCA 1ZBA3 2D43A 3MYXA 5T5PA 1I1EA 2VXJA 2G1MA 4DMIA 2C5DA 1W06A 2NYYA 2ZGMA 4Y20B 4FOYA 5ABJB 3I49A 5FBJA 3N7KA 3RZJA 1I5PA 3GYDA 4AK3A 4I02A 2K2SA 1W9SA 2FDIA 4PQ9A 4Y5TA 3KCXA 3MLKA 1YQ6A 2WSVA 1X8EA 3VBRA 4K9SA 3ZXLA 5BY5A 4LMFA 4BLIA 5IVBA 4G9SB 2GH8A 1OSGA 2J1UA 5IK4A 1COV3 2HH9A 4COZA 1F15A 4RGKA 2R061 5J48A 2X05A 1W8TA 2LRPA 4OUMA 1IHMA 1YI9A 2ARBA 1SLLA 5IWFA 2OS2A 3O1MA 2J1EA 3SH4A 3NNGA 4PHZA 4FO9A 3TEYA 1PMHX 1G86A 1QJU1 1YI7A 2FQPA 2XJVA 2VJXA 3DEMA 1GNHA 3PIJA 4BMBA 4AVBA 3K4ZA 1TMF1 1PM4A 4QAWA 4RGGA 3AP5A 3VBRB 4EZ4A 4Q4V3 1VBD2 3WP5A 2LALA 1PM7A 4PDWB 3O1UA 3JU9A 5CISA 1I9RA 1N1SA 2GSYA 2XL7A 5FWJA 3WCRA 2GZWA 5GLTA 3CL1A 1BMV2 1W3XA 2VOVA 4D94A 1LU1A 1ND2B 1V6NA 1QMJA 4RGAA 1LESA 3GXUA 5DAVA 5T5OA 3NNMA 5CIRA 4WM7C 4ZU4A 1QJFA 1QJY3 2W94A 1UZYA 1W6MB 1RHI1 1ZREA 1QIQA 4M0HA 1SBEA 5EPAA 5KHIA 3ZLIA 1LU2A 3ITQA 4UFHA 3OF1A 2C9AA 3NJZA 4X8PA 4Y1XA 4BIFA 2GN7A 3BU0A 4MXVA 4XQ4A 4X8NA 2ZGSA 4LPLA 1W8ZA 4AVAA 5HBAA 5JPNB 3I2KA 1CAUA 1EP0A 2PTMA 5A7WB 3DYMA 3MF9A 3OUJA 1W0NA 4LHNA 2Y6GA 4FOWA 3OUHA 2W1SA 2BJSA 3LWCA 3WQ0A 4AFDA 1NZIA 3FHAA 1RUI1 4KWKA 2CU5A 1UYPA 2QQVA 3LIHA 1LHNA 4MO3M 5FKBA 3RPQA 3U75A 3ZN5A 2YC2A 3O5SA 5K8SA 1JUHA 4FPKA 4C0BA 1ZRRA 1W6NB 4COVA 3VKLA 3WHTA 1CPNA 3CIHA 4P9YA 4B3NA 2V5DA 3LOBA 1O4ZA 4DXTA 4XFIA 1X36A 2BYVE 1AL23 1SBFA 4Q8LA 5FZ0A 2IXHA 3AFKA 4QMAA 4ZU5A 5KXDA 1NCQB 3WP6A 4Q0VA 3CZJA 2VBPA 3VDDA 4R9AA 5FMOS 1UMIA 1X33A 1IG3A 2C1FA 3OTFA 3DXUA 3EJKA 1XU2A 4MLOA 1DLLA 4QKNA 4RHV3 3D0SA 5JVVA 4CCCA 1N3QA 3PIGA 2VOKA 4GZ9A 4ONUA 3N35A 1EPZA 4K1YA 3JD72 4QQOA 4A7YA 5FPAA 1ZBE1 4PI2A 3GGLA 1WLTA 2DUQA 3KV9A 4YZ3A 5D1IA 4XZUG 3VZKA 3GBFA 4Y5SA 2VMFA 1BZWA 2VNRA 4MHRA 3MIGA 3WXPA 2K46A 2RS33 4CZSA 4AFAA 4JGYC 4AL9A 2XL9A 1W6PB 3B93A 4JQTA 1QGLA 1XBFA 3E5UA 4IE7A 1W6OA 5ISLA 4NHMA 3AZVA 1ZRFA 1O3SA 4KWJA 1GOFA 2WC2A 3H7JA 1YJKA 2Y6KA 2CYFA 2YPJA 3NNLA 1ZA7A 5CNAA 3THCA 4BQ4A 1BJQA 1QXPA 4R4ZA 2JWPA 2R6QA 2BU9A 1FT9A 2W3JA 1HRI2 2P6CA 3MICA 4OHWA 1RUE3 5F5QA 1FV3A
chains in the Genus database with same CATH topology
4LK7A 4CPBD 1V0AA 3ZYFA 1HN0A 3ZYHA 2VXJA 4LKDA 1OH3A 1W8UA 1W90A 2O14A 4LJHA 2K46A 1W8ZA 3ORJA 3UT0A 4AL9A 1W8WA 4CPBA 2LROA 4YW7A 4YW6A 1GWKA 4BQ2A 2KR2A 4LK6A 1WCUA 3F95A 1GWMA 4LKEA 5D21A 4A6SA 4CP9B 1GWLA 4CP9A 1UOJA 2WYFA 1OKOA 4BQ4A 4BQ3A 4BQ5A 4YWAA 1WZXA 2C24A 2Q1FA 2JWPA 4LKFA 3ZYBA 1WMXA 1W8TA 1W9FA 2LRPA 1L7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  4CPB D;  1V0A A;  3ZYF A;  1HN0 A;  3ZYH A;  2VXJ A;  4LKD A;  1OH3 A;  1W8U A;  1W90 A;  2O14 A;  4LJH A;  2K46 A;  1W8Z A;  3ORJ A;  3UT0 A;  4AL9 A;  1W8W A;  4CPB A;  2LRO A;  4YW7 A;  4YW6 A;  1GWK A;  4BQ2 A;  2KR2 A;  4LK6 A;  1WCU A;  3F95 A;  1GWM A;  4LKE A;  5D21 A;  4A6S A;  4CP9 B;  1GWL A;  4CP9 A;  1UOJ A;  2WYF A;  1OKO A;  4BQ4 A;  4BQ3 A;  4BQ5 A;  4YWA A;  1WZX A;  2C24 A;  2Q1F A;  2JWP A;  4LKF A;  3ZYB A;  1WMX A;  1W8T A;  1W9F A;  2LRP A;  1L7L A; 
#chains in the Genus database with same CATH topology
 4NWV A;  4D7Y A;  2VZU A;  4AVV A;  3SNM A;  1POV 0;  5LA1 A;  3J8F 3;  1W39 A;  4XIL A;  4GH4 C;  2IXL A;  4B4R A;  2O8Q A;  2XB6 C;  2Y34 A;  3LAG A;  2VQA A;  4QXC A;  4RSU A;  5GZD A;  4C1X A;  4NIH A;  3EQE A;  1DG6 A;  4XUQ A;  2WWU A;  2XJQ A;  1NQJ A;  3J7H A;  3RYK A;  2QVS B;  3OBZ A;  1AHS A;  2ZHL A;  3I97 A;  1LRH A;  3AP4 A;  3MZH A;  1MQT C;  4CE8 A;  1GNZ A;  1IKQ A;  4IEQ A;  2WNU A;  2XOM A;  4XET A;  2O1Q A;  5T50 A;  1M06 G;  4TZD A;  1QXR A;  1ZZ6 A;  1C57 A;  1XXN A;  3BYW A;  4LA2 A;  4AWD A;  2CWS A;  2WAB A;  4GB3 2;  1CPM A;  1SPP B;  5I93 A;  2RM2 1;  4LK7 A;  2JDN A;  3NV4 A;  2VZ1 A;  5FP7 A;  2VME A;  4CEW B;  2VUL A;  1OQ1 A;  1OQE A;  2VW2 A;  1JHJ A;  2J42 A;  1GZ9 A;  1OLM E;  2XHK A;  2NMO A;  2D98 A;  2ZML A;  4FPF A;  2ET1 A;  4JGZ A;  4RQP C;  4CDQ A;  1WA4 A;  4J6G A;  4COY A;  4LJH A;  3AYC A;  1GP6 A;  4FPH A;  1EAH 2;  2GAU A;  5IK7 A;  2HEY F;  2RS1 1;  1OC1 A;  1Z7S 3;  1AR9 2;  2WRA A;  1U5I A;  4QDS A;  5I0U A;  4FFF A;  4XJW A;  3PUH A;  3PLQ A;  1BBT 2;  3PVN A;  2L9L A;  1RMU 2;  3CJI B;  4EJR A;  3GZT B;  2P5B A;  1VRH 1;  3HQX A;  4MHU A;  2RDR A;  4NHK A;  1XE8 A;  4BZ4 A;  1AZD A;  4NR1 A;  4JC1 A;  5F5A A;  3U11 A;  3R4S A;  3LFM A;  4B7E A;  2BOI A;  2BRT A;  3B94 A;  4XC9 A;  1OOP B;  2HYX A;  3I3B A;  4KL1 A;  4LLF A;  1LGN A;  5DAP A;  3VHO A;  3CEW A;  4XBQ A;  3HT1 A;  4XDP A;  1W8N A;  1OH3 A;  2X5I B;  3T4H B;  1A8D A;  1Q8Q A;  1YIP A;  4P9G A;  3I2H A;  1OFN A;  3ZSM A;  5AC9 1;  3AP9 A;  3UL2 A;  3III A;  4P9I A;  2XLF A;  2XHN A;  1OI6 A;  3RVH A;  3ZMO A;  5AFB A;  5JSO A;  3M3I A;  4LIV A;  1JHN A;  3WUD A;  2WFF 1;  3H7Y A;  2DTW A;  2BNM A;  1KQR A;  4CDX A;  4GKY A;  4ASK A;  5C3S A;  2BFU L;  4BXS V;  3UGF A;  1QH7 A;  4CEY C;  4UYB A;  2UUR A;  2PA7 A;  1YJL A;  4JGZ C;  4TSV A;  3ZFE A;  1QQP 1;  2A71 A;  3ZYH A;  3POJ A;  5A3T A;  1O3T A;  2EA7 A;  4MGY E;  1ASJ 2;  2PHT A;  4H55 A;  4IEZ A;  5IAX A;  1GYK A;  1NCQ C;  3FJS A;  4GH4 A;  3VBU A;  3DF0 A;  4AG4 A;  4QWN A;  4W50 A;  5M0T A;  1PMJ X;  2EVX A;  1GWM A;  5F9T A;  1A6C A;  2FMY A;  1DFQ A;  1YQ8 A;  2WNO A;  1O8P A;  1CR7 A;  2WLP A;  3IM0 A;  4UT5 A;  3ETP A;  4J1X A;  1FNZ A;  2ENR A;  2VQT A;  4QX5 A;  4ET7 A;  3EMR A;  4L8Q A;  4BPZ A;  4P02 B;  3RZK A;  2YBP A;  1ZRI A;  2HWE 1;  3IT8 A;  5EXO A;  4AE2 A;  5BNN A;  1QJX 1;  1DYK A;  1Z7S 2;  4LT5 A;  1NY7 2;  2YV8 A;  1R08 2;  5I0R A;  1CZT A;  2GN3 A;  2ZX0 A;  3DKQ A;  1K5M B;  1TNF A;  3M2M A;  4OHV A;  2NM1 A;  4XF1 A;  5J98 B;  5C8C C;  2IXI A;  3AXD A;  1PNG A;  3A4U A;  3K51 A;  2WDB A;  4URA A;  2G9Z A;  5FP3 A;  1GUI A;  4OQ9 A;  2VOX A;  4NOT A;  5IAV A;  2ARE A;  1WCU A;  4CU8 A;  1COV 1;  1XNT A;  2VG9 A;  1JZ8 A;  1C4R A;  2I74 A;  4RS5 B;  1W0P A;  5FY4 A;  3UJO A;  2A6Z A;  3AFG A;  2BNO A;  2EIE A;  1TNR A;  3B3Q E;  2BVB A;  2HWC 2;  4PCR A;  4I3P A;  3S5Q A;  3E1F 1;  3KMH A;  1JN2 P;  4NHL A;  3VDD C;  1PIV 1;  1OA4 A;  5JSR A;  1C5H A;  4E8D A;  4QPG C;  3NV2 A;  1RMU 3;  1QDO A;  1RUF 1;  2JDK A;  1LEN A;  2B4K A;  3H3L A;  3WLU A;  2VPV A;  3J8F 1;  5FY0 A;  5FZA A;  4YLZ A;  1PO2 1;  2VTF A;  4LBQ B;  1AR6 2;  2E6V A;  4LO4 B;  4UBG A;  5H9Q A;  1SLA A;  4P5H A;  4JDO A;  1VR3 A;  2NP0 A;  2JIG A;  1ZBE 2;  2WBK A;  1L3J A;  2DUR A;  3OYW A;  1CAX B;  4XJA A;  1JTZ X;  2DVB A;  4WZC A;  5JXG A;  1WW7 A;  3H1M A;  3NO8 A;  1GV9 A;  4NPL A;  4O9E A;  4XTP A;  4Q29 A;  4UFK A;  1YHF A;  4JX0 A;  2A3Y A;  4HN0 A;  3WDY A;  1H9P A;  2J1A A;  5FY9 A;  1KEX A;  1HQW A;  1LUL A;  4M01 A;  2HYK A;  1XJA A;  3VBF B;  2QE3 A;  3MBW A;  3RI9 A;  4HL0 A;  2R07 1;  2WS9 3;  3IZO A;  5KHJ A;  2XJR A;  2DTY A;  5APA A;  4E4Z A;  5ACA 1;  4W65 A;  5J37 A;  2X5I C;  5E1R A;  2RMU 3;  1AR8 1;  5GAL A;  3W59 A;  4BIS A;  2WFF 3;  3ZSK A;  5BNP B;  3MF6 A;  3AYD A;  4Q4X 1;  1H2M A;  1O4Y A;  2HWD 2;  2WR9 A;  2BNN A;  3POB A;  2IFR A;  3K46 A;  3K3N A;  2VE1 A;  3WQB A;  1X50 A;  3BI3 A;  1F31 A;  1QU0 A;  3MPP G;  4AYU A;  4D6Q A;  3DPR C;  3ACG A;  4NO4 A;  1GR3 A;  2MEV 2;  5DPN A;  2D3P A;  4JZR A;  4WM8 C;  3ZMN A;  4HBN A;  1BK0 A;  1UO9 A;  5A80 A;  4AGV A;  5HXV A;  1C8M 1;  4NN0 A;  2HWB 1;  3WDV A;  1BEV 1;  3K48 A;  4AQS A;  3JBG 3;  1BKZ A;  5FP8 A;  5FZB A;  2WZR 2;  4QXB A;  1RED A;  1BK1 A;  3KF5 A;  2HWF 3;  1JOB A;  1LEM A;  1W6Q A;  2OPK A;  2VZR A;  3I2F A;  2B39 A;  2B9V A;  3ZSE A;  1RUE 1;  5C3Q A;  3GZU C;  3ZFF A;  3U10 A;  3OGS A;  4YVS A;  1F5J A;  4AFB A;  4CDU A;  5ANQ A;  5EJ1 B;  5C3P A;  3MV0 1;  5GLZ A;  4FPJ A;  5HPO A;  1PGL 2;  5DZF A;  5C71 A;  3IAP A;  4YG6 A;  5A1F A;  1PK6 B;  1EV1 1;  3CJX A;  4Q1P A;  2HBU A;  1PZ9 A;  4AZZ A;  1MPX A;  4GMP 1;  5J1X A;  2BP6 A;  1K5M A;  1VIW B;  2ZKN A;  3HBZ A;  3MLJ A;  1DQ1 A;  4I30 A;  4L97 A;  2QKD A;  5F3I A;  1L7R A;  2DUP A;  1UY3 A;  2J1R A;  2Y0I A;  5BYN A;  4Y22 B;  4HK9 A;  4AAX A;  4FTS A;  4ISQ A;  4WVM A;  4YNI A;  4ERO A;  4JHT A;  2VM9 A;  1HN0 A;  4R8H A;  1SDD B;  5HV0 A;  2QDN A;  3HQR A;  5JSP A;  5C8C B;  3LKJ A;  1KJL A;  1US3 A;  4F8A A;  2JD9 A;  3GDB A;  4TYS A;  4QU1 A;  4P9X A;  2RS5 2;  3UGH A;  3VD9 A;  1GLH A;  4MZU A;  4XUN A;  1CAU B;  2AGS A;  2RG4 A;  3QLQ A;  5FRE A;  5FZO A;  3VKF C;  4AI0 A;  2QQM A;  4Q4Y 2;  2VVD A;  1VBC 2;  1Y4W A;  3MHZ A;  1UWW A;  5BXX A;  1AR8 2;  3ETQ A;  5FMO L;  3ZSJ A;  2C6S A;  3MO4 A;  1E5H A;  1U0A A;  5FTT C;  1KDK A;  3CMG A;  1POV 3;  1DDL A;  1I3H A;  5FOB B;  4K8R B;  2ATF A;  3TB0 A;  5IVE A;  5H9S A;  4A45 A;  1YFU A;  2FZ2 A;  1LED A;  3UKT A;  5DDJ 2;  5KXB A;  1OD3 A;  2YU2 A;  2EIG A;  4XMA A;  4OUS A;  1SDW A;  4HET A;  2DVA A;  3ZXE A;  4ZS3 A;  2RJK A;  1OT5 A;  1H6X A;  3N36 A;  1XE7 A;  1R1A 2;  1HV0 A;  1REE A;  3DV8 A;  2XML A;  3ZFG A;  4QB1 A;  2A6W A;  2E7T A;  2OX0 A;  1MEC 3;  2VD7 A;  2Z79 A;  3ZKU A;  2A7A A;  1EPW A;  2HLE A;  3ABZ A;  2JG9 B;  3BAL A;  3ME2 A;  2OKX A;  2AAC A;  4Y4R A;  4LO5 B;  3KV6 A;  2OUJ A;  3K75 B;  1LOE A;  4IES A;  4RFR B;  5EFU A;  3VBU B;  3G6J B;  2WNV B;  5T5J A;  2WSU A;  3I3E A;  5JR2 A;  5FLJ A;  4NRP A;  1V9U 1;  3HD8 B;  3NAP A;  3MFC A;  1QY4 A;  2XUM A;  3K3O A;  4QXK A;  4WVW A;  4YGE A;  1UL9 A;  1UXX X;  3FN9 A;  1AL0 G;  2Y38 A;  4YZ1 A;  5D8A C;  2PQS A;  3MW4 A;  3PVO A;  4HSJ A;  4XIK A;  5FK7 A;  4AVT A;  1YWK A;  4XQW A;  1J83 A;  1GWK A;  4CCE A;  2KR2 A;  5JI7 A;  4DRV A;  4CVU A;  3I2I A;  1VRH 3;  5FPZ A;  1GZC A;  1GZW B;  5CYY A;  2AEY A;  3C8X A;  3UV9 A;  1XB9 A;  4PLN A;  1GAN A;  5K7P A;  1FV2 A;  4QHZ A;  2VY0 A;  5JDB A;  4WZF A;  4WM8 B;  3BTZ A;  2O0O A;  3H1Y A;  1KRI A;  2JDZ A;  3KHC A;  2VXR A;  4FPG A;  4YZ5 A;  1UY4 A;  3AMN A;  2OYZ A;  4DIN B;  3I2D A;  4XCA A;  5A6X A;  3AMP A;  4BOW A;  2ILM A;  2VL4 A;  2WNU B;  3ZR5 A;  3RZL A;  3O0X A;  4I0W B;  3PHM A;  2GNB A;  2XWJ B;  5FP4 A;  5FPB A;  2IXJ A;  3I7D A;  4PIY A;  2WT1 A;  5B4X A;  4PDW A;  1LOG A;  3B5L B;  1WMF A;  4K20 A;  5FYB A;  3T2Q A;  2WII B;  4PF5 A;  3MEP A;  4YW3 A;  4KI5 M;  1DYP A;  3PTY A;  4SLI A;  4D3W A;  5T5L A;  2YYO A;  5FYY A;  3FLR A;  3LF7 A;  2PAE A;  3CDZ B;  3P5B A;  3OG2 A;  3RGB A;  4XFG A;  5C9A C;  3PUI A;  2OUH A;  1KJR A;  1PK6 A;  2ZOE B;  1DGW X;  3PJY A;  3M1H A;  5FKC A;  3ZFF B;  2XR4 A;  1QQP 3;  2VCM A;  2PHU A;  5AVA A;  3UK9 A;  4WM7 B;  4QKD A;  4OI0 A;  5A3L A;  4UW3 A;  1TVG A;  4NRQ A;  3VD3 A;  3NNF A;  2XJS A;  5JMC A;  2VNG A;  2ZGR A;  2B42 B;  2QQN A;  4HVO A;  1IOA A;  4P9W A;  2JE9 A;  1WLW A;  1FOD 1;  2WO2 A;  3NMB A;  4OI4 A;  4BQY A;  1MS4 A;  4IV1 A;  3VBO A;  4PDW C;  5DUX A;  5ERL A;  4CPB A;  4YZ2 A;  1EYB A;  3DL3 A;  4ES9 A;  1U5Y A;  5C9A B;  1HQN A;  1AYM 3;  3CBN A;  3BOW A;  3OB8 A;  1YIF A;  4BQ3 A;  1Z7S 1;  1WBF A;  1HXS 2;  1UD1 A;  3KS7 A;  3RYR A;  4B4P A;  1W8H A;  2P2K A;  4YW4 A;  2ZXQ A;  2WWS A;  2MNG A;  1TQ5 A;  1YQ5 A;  2H0V A;  2P3K A;  4IL7 A;  1SHW B;  4AGR A;  4QKF A;  1L7L A;  3IMM A;  1V0A A;  2UY9 A;  3J7M A;  4RA0 A;  1ASJ 3;  5EZW A;  5CG9 A;  3WG1 A;  1RUH 3;  4YW1 A;  3H8O A;  2MEV 1;  3M4F A;  1VRH 2;  2P3Y A;  2ZS6 B;  1PO1 1;  2CGN A;  1W2A X;  3C7E A;  1MEC 2;  4IET A;  2PHW A;  3GNE A;  3IWZ A;  3RSJ A;  2QDR A;  5KHH A;  4PIX A;  5CFD A;  3WG4 A;  2R04 2;  2WNE A;  1UU6 A;  1H8T B;  3I2J A;  4IV3 A;  5J96 B;  3KT4 A;  1JYV A;  1L7Q A;  3UKN A;  1W6P A;  1UXZ A;  3ZFG B;  3WUC A;  1RJ7 A;  2QQK A;  3ZFG C;  5FAX A;  3VBU C;  1VBD 3;  3QBQ A;  2PLV 3;  2DVF A;  3H9A A;  4R9C A;  3WSO A;  3N9O A;  1D4M 1;  1ZZB A;  3KT7 A;  1R08 3;  2VBB A;  5JWP A;  5FPL A;  4HLT A;  5JR7 B;  3VBS A;  4TLG A;  1G9D A;  4PJY A;  2C26 A;  5CFC C;  1JXN A;  3CHX A;  2R1B A;  3LA3 A;  4LXL A;  2VZ3 A;  4Z82 A;  4C91 A;  4XFF A;  4C1W A;  3C7F A;  1TG7 A;  4LLO A;  2HKX A;  5T3N A;  2GP3 A;  4RS5 A;  4FPE A;  5F1R A;  2D93 A;  5CB7 A;  3Q8A A;  4XMI A;  5AFE A;  4K6B A;  1HLC A;  1PO1 2;  4CP9 A;  1PVC 3;  3N3H A;  1QJE A;  2ID4 A;  3J8F 2;  1DBN A;  2AYH A;  1H0B A;  3AVS A;  2NN8 A;  4CCD A;  3I3Q A;  4L2N A;  4D7S A;  1QNW A;  1E5S A;  3TWI A;  3BCW A;  1LKN A;  2EXI A;  3O7O A;  2JDP A;  2HJI A;  4Q4V 1;  3JZV A;  4MSV A;  4BA6 A;  1URX A;  4AXO A;  4OI2 A;  2W87 A;  3FWE A;  1VLN A;  2HBT A;  1POQ A;  1J1L A;  2VTX A;  5I8S A;  1ZX5 A;  2WWJ A;  2VNO A;  4YM2 A;  1K5M C;  3VV1 A;  5E6H A;  5T55 A;  2FMD A;  4IQP A;  1PZ7 A;  4FP3 A;  4M3C B;  3LDB A;  2MHF A;  1LOB A;  1U5X A;  1OPO A;  5A3U A;  3VHR A;  1OUS A;  1TMF 2;  1EUU A;  5FYC A;  2BUK A;  2JIC A;  1SG3 A;  2WLQ A;  4FXG B;  4AF9 A;  1RUE 2;  4YAR A;  1ODN A;  4IV1 C;  3VBO C;  5LW9 A;  3I3M A;  2K9Z A;  1NLQ A;  3HPN A;  1F4A A;  2QNK A;  5A7W A;  4OFG A;  1J3P A;  4AEM A;  1ULC A;  3W20 A;  4Z2W A;  3WNM A;  2X5I A;  2K0G A;  4YW2 A;  1X7N A;  2D6L X;  4TXW A;  4XTM A;  1LGB A;  3MIB A;  3TNQ A;  2XH6 A;  1W8U A;  1VE0 A;  4YYO A;  1CX1 A;  1K12 A;  2JB8 A;  2J1V A;  2WZ8 A;  3WP3 A;  1HRV 3;  1V70 A;  3VZN A;  2HWD 3;  3WF3 A;  2P3I A;  1AX1 A;  5FK8 A;  5C70 A;  4CDX B;  3OY8 A;  4WVZ A;  1YRZ A;  4N43 C;  2GMP A;  2ZGK A;  3BIW E;  1RGS A;  4ZU7 A;  5F7U A;  1OKO A;  3BTY A;  1YO8 A;  2E31 A;  2IVJ A;  3AB0 A;  3T09 A;  1D0H A;  3JBG 2;  3U37 A;  2G4I A;  3W58 A;  2ORZ A;  4KU8 A;  4L11 A;  1RIT A;  4PLO A;  5CFD B;  4JVA A;  1XNC A;  2VMI A;  3OPZ A;  4XUO A;  3TNP B;  3MIE A;  4EN9 B;  3WVJ A;  4BWO A;  1NA1 A;  1WW6 A;  4EN6 B;  1V9U 3;  2RR1 1;  2EIC A;  4WM8 A;  3M70 A;  4AW7 A;  4MXW A;  3POY A;  5E16 A;  3PUS A;  3DPR A;  1ZZ7 A;  4H3W A;  3ECQ A;  3ACI A;  3L9J T;  5DUV A;  4PT6 A;  1Y9G A;  1HW5 A;  5E89 A;  3RJ2 X;  2LRO A;  4OQ8 A;  4Z1V A;  3WY6 A;  2EID A;  1ND2 A;  2CDO A;  2BZD A;  3N7J A;  2YG0 A;  1AR6 1;  1DYO A;  3OUI A;  5D21 A;  1F8V A;  2WO1 A;  3OGG A;  2DYC A;  1VBA 3;  3EXU A;  4AED B;  5FZL A;  4Q1R A;  2D6N A;  4JKL A;  5A7N A;  1WW5 A;  2ZPX A;  4MXW B;  3VL8 A;  4NPR A;  5LZ6 A;  4QQ2 A;  2F6B A;  3KWV A;  5DZE A;  1PO1 3;  4DS0 A;  2W95 A;  2A3X A;  4L0P A;  5LAT A;  2OQ7 A;  2PFW A;  2ZEZ A;  5DG1 A;  1XNK A;  5K0U B;  1PGW 1;  2OT7 A;  4YVS B;  4CCM A;  1NYW A;  2YMZ A;  4G4F A;  1IKP A;  4ISR A;  3ZYI B;  4ASL A;  3AK0 A;  5FJH A;  1XQN A;  3E5X A;  4XF4 A;  5KC6 A;  2WT2 A;  4W6Y A;  4Q4V 2;  4LHL A;  2JX9 A;  1VBE 3;  3F95 A;  2QTW B;  5JIA A;  4AED C;  4LUK A;  4DEQ A;  1JZ5 A;  2O8O A;  2D6O X;  2WYF A;  4MG2 A;  2BV4 A;  4R4X A;  5GZF A;  2QUO A;  4Q4X 3;  2Y6H A;  1TE1 B;  2UYA A;  2BGP A;  4GXL A;  2KA3 A;  2BFU S;  4BYY A;  3IDB B;  1DIW A;  2R06 2;  4MYE A;  3LA2 A;  3DKW A;  4N53 C;  4E27 A;  4ITC A;  4XJU A;  1QNY A;  5FDB A;  3RG0 A;  1UU5 A;  4Q0S A;  2XON A;  4RYD A;  4Q4W 2;  1TME 2;  5CAZ A;  2JG9 A;  3WZ1 A;  2RVA A;  2Y26 A;  2ZEX A;  1SZB A;  1XSQ A;  4QGN A;  2J22 A;  1W04 A;  3IDA A;  1ULO A;  3M3O A;  5SV5 A;  4D8M A;  2ZEW A;  1I5Z A;  2D7F A;  4RR3 B;  3MI8 A;  4FI9 A;  1NX9 A;  1LGC A;  4Z07 A;  4QKB A;  1JUI A;  2CTV A;  2XPJ A;  3INA A;  2VEC A;  5B2G B;  5F6L B;  3FLP A;  1NZC A;  1GQP A;  4BQ1 A;  1MZ6 A;  5I8T A;  4HXC A;  4F3J A;  3V0A A;  1ZBE 3;  4KBZ A;  4OVE A;  2QFE A;  4QPI C;  3SLI A;  3ACL A;  3D6E A;  3ZN6 B;  1ULD A;  4MGS A;  2ZX4 A;  1AX0 A;  3BVC A;  4H7L A;  5GJ6 A;  5IYY A;  3BKZ A;  4XAB A;  1OXC A;  1H4G A;  1BQP A;  1RUF 2;  3WF2 A;  4FQZ A;  4IGP A;  2WA3 A;  5EIY B;  1MS5 A;  3BOD A;  3OSD A;  5B4N A;  3WCS A;  2ERF A;  1LNS A;  4JTO A;  1LOF C;  1QJU 2;  2EXJ A;  1ZZ8 A;  4IGO A;  5A3M A;  5KXE A;  4NID A;  2FCU A;  3I59 B;  5FZM A;  4HKW A;  5A7P A;  5CAD A;  2JE7 A;  1W9F A;  3CNA A;  3ILF A;  2OII A;  3DGT A;  1XYN A;  4XUT A;  4ZS2 A;  3VKN A;  5FPX A;  5IVV A;  3UGG A;  5J36 A;  2ZX1 A;  3TEW A;  1QH6 A;  3ATG A;  5F3C A;  1W8O A;  2FZ1 A;  3GHN A;  3HIF A;  3PU3 A;  3ZYJ B;  1RUO A;  4LOS A;  2OVU A;  2BBV A;  4OZX A;  1VBA 1;  4UF0 A;  5BV6 A;  1R08 1;  1Q43 A;  4OZO A;  1O59 A;  4MUV A;  1QJX 2;  5JOX A;  1CD3 G;  2ZEY A;  4P14 A;  2Z4F A;  3S7E A;  3MUZ 1;  1SMV A;  3TBD A;  2VNV A;  2TBV A;  1HB4 A;  4TWT A;  3ASI A;  4XFB A;  1DZT A;  4QPI A;  2R32 A;  4DY5 A;  4UW6 A;  1K3I A;  5F8P A;  5FXW A;  1S0I A;  2JKB A;  3MGU A;  2W52 A;  2R16 A;  1W3V A;  4CEW C;  1R1Z A;  3SEE A;  3Q9O A;  3LCP A;  4LBJ A;  5SV8 A;  4MGQ A;  3KV4 A;  4CUA A;  2JDU A;  4OI1 A;  3KVA A;  4GMP 0;  5FPU A;  4CDU B;  3MPB A;  5FY8 A;  2XBO 1;  1W6Q B;  1HIX A;  4Y1Y A;  5HCF A;  1JOP A;  4XJ8 A;  5A7O A;  4Y22 A;  2ET7 A;  3HN3 A;  2JG9 C;  1FNY A;  1RJ8 A;  3VKM A;  3R05 A;  1MQT A;  1CZS A;  4XAA A;  4N90 A;  1REF A;  4UXA A;  5FXZ A;  4QD2 A;  2X29 A;  1H9W A;  4DIQ A;  4B1L A;  1HXS 3;  3S0M A;  1OUX A;  1VBB 1;  2EAL A;  4BJ0 A;  3DPR B;  4XBL A;  5FZG A;  2WKK A;  5C8W A;  4JKM A;  4RD7 A;  3O1R A;  5FMD A;  5HCA A;  1W99 A;  3B9C A;  1PHM A;  4IDZ A;  1R09 3;  3THT A;  1I6X A;  1W9T A;  5F39 A;  4XVH A;  4BQX A;  5LA2 A;  2VCA A;  1W0O A;  2YPD A;  3M8L A;  2WO7 A;  4XXA A;  1W2N A;  1QF3 A;  3VB9 A;  2HWF 2;  1GIC A;  2XVG A;  4XJZ A;  3H3Z A;  5KHK A;  1DQ4 A;  3R4U A;  4KGQ A;  4JQR A;  5L9R A;  4K3U A;  3O1O A;  5IW0 A;  4FAG A;  5J09 A;  5J3U A;  5JMO A;  1ODM A;  2KXL A;  3H8R A;  2ARA A;  3LSD A;  4CU6 A;  5CKQ A;  1UZZ A;  4MGT A;  2JG8 B;  3WW3 A;  4V2W A;  3H8U A;  2F4P A;  2EF6 A;  4AFC A;  5BNQ A;  1MZ5 A;  5CKN A;  2JDM A;  1HXS 1;  2D5F A;  3NW4 A;  1FAY A;  1OHF A;  3RWN A;  2DBN A;  4E4S A;  3VBS B;  2HWE 2;  2PEL A;  1OKQ A;  1COV 2;  1H4H A;  1AYN 3;  2GNT A;  1RHI 3;  3U0Z A;  4GB3 1;  4ASM B;  4OUL A;  3R6S A;  2Y60 A;  2MEV 3;  3AX4 A;  4W6X A;  1UYZ A;  2FDJ A;  1YFW A;  5LEJ A;  2BWC A;  3KV5 A;  3LIG A;  4KWL A;  3THD A;  1UYX A;  3FUQ A;  2JEN A;  3I4I A;  5DZG A;  2DU1 A;  1OPM A;  2R07 2;  2UWB A;  3U14 A;  2P1B A;  2ARC A;  5IVJ A;  1IS3 A;  2KD7 A;  4LNV A;  4K1Z A;  4F7Z A;  1WLC A;  2EAA A;  4DQA A;  1PNF A;  1RC6 A;  5FLI A;  1A8M A;  3LA7 A;  3RMX A;  1SLB A;  2GP5 A;  2J1S A;  4Y4Y A;  1PO2 3;  4LKF A;  1S2B A;  1AR8 3;  1VRB A;  4Y33 A;  4EE2 A;  1HRI 1;  4LKE A;  5LRR A;  3KF3 A;  1KIT A;  2YUE A;  4NRM A;  1AJO A;  2YZ4 A;  4NE9 A;  1JZ7 A;  2V09 A;  1V6M A;  2PLV 1;  2XJP A;  3O0W A;  5A6Y A;  1BHG A;  1DZR A;  4DNY A;  4WV8 A;  1ULF A;  3WF4 A;  2Q30 A;  2E7Q A;  1IZ3 A;  2SLI A;  1ND3 A;  1DQ6 A;  1ZNP A;  1NCR C;  2F17 A;  3RFR A;  4CEY A;  4U36 A;  2XQX A;  4EV0 A;  1G6N A;  3D3A A;  3FE5 A;  2VVF A;  4XOG A;  4QM8 A;  1QJY 2;  1IQD C;  2AR6 A;  1CON A;  5FZE A;  3TN9 3;  1KS5 A;  3WG3 A;  1H2L A;  2R0H A;  2W1U A;  3JB4 C;  2VZQ A;  3USU B;  4CP9 B;  5EJZ B;  3ALQ A;  3UET A;  4ZON A;  4LE3 A;  4YM3 A;  2YGL A;  1GSL A;  1IS6 A;  4LIU A;  3Q8F A;  2DDU A;  3IPV A;  1UW8 A;  1W9Y A;  3D8C A;  4CEY B;  1ULE A;  3C3V A;  1RMU 1;  4NVP A;  4M0N A;  2IFW A;  5CKM A;  4DPN A;  1UCX A;  2DFB A;  5IFT A;  1WCS A;  5BUV A;  2VTX J;  5G05 L;  4S2G A;  2ZZQ A;  5JLV A;  4ZZ8 A;  2JEM A;  1JZ4 A;  5H9R A;  4J25 A;  4FOV A;  2JDH A;  1RUD 2;  2VH9 A;  2W39 A;  1NUK A;  4C90 A;  4XFH A;  1XRU A;  4N43 A;  4NII A;  1CZV A;  2Q8O A;  1UN1 A;  1NA1 B;  2JDY A;  2VU9 A;  3VZM A;  2W1W A;  4GD4 A;  5FZO B;  3D82 A;  4CU9 A;  3ZVX A;  4WM7 A;  2XBO 3;  3U78 A;  4YZ4 A;  2R07 3;  4CDQ C;  3LEM A;  3UKV A;  3OBA A;  1XC6 A;  2E33 A;  3VHP A;  2Z5W A;  2QJV A;  1F35 A;  3DUI A;  2WJS A;  4GWI A;  2PQQ A;  2HWE 3;  3O0V A;  2H0B A;  2ETE A;  4RHV 2;  5GLU A;  3BPS A;  1CAV B;  5DDJ 1;  2DV9 A;  1W6N A;  1DGL A;  2BOJ A;  3KM5 A;  4BQ2 A;  5DAB A;  1WMD A;  1JYT A;  1W2T A;  4JKK A;  2GME A;  1VBA 2;  2VGD A;  1ZM1 A;  4KNC A;  3D5O A;  1OH4 A;  2XVL A;  4AI9 A;  2TUN A;  1RHI 2;  5FZK A;  3S30 A;  3VZO A;  2G9F A;  3NL1 A;  5KR7 A;  3HJR A;  2W47 A;  1XOY A;  3HAG A;  2ZAH A;  2X8K A;  4EN0 A;  4GH4 B;  1YYN A;  4PF1 A;  4BIO A;  2WS9 2;  1C3H A;  3RZG A;  4CA9 A;  1PO2 2;  1YUD A;  2W92 A;  1BCX A;  3B9I A;  1JYW A;  1N47 A;  4LO7 A;  3AKP A;  3V56 A;  2B45 X;  3NV3 A;  4Q5O A;  4K21 A;  5FZ4 A;  2N7G A;  1YXW A;  4GAL A;  4S2F A;  1W05 A;  5L36 A;  3B7M A;  4UBH A;  3S57 A;  3GAL A;  3K2O A;  4OHY A;  2B7Y A;  1UMH A;  3HNM A;  1UOJ A;  1EY2 A;  2YBK A;  3JCI A;  4LA3 A;  1JMU B;  4N9H A;  3ZM8 A;  1C8N A;  4ATF A;  4DB5 A;  1A34 A;  1RUH 2;  4IEX A;  3PJQ A;  1HB1 A;  1VMH A;  5DUU A;  3RYP A;  5BNN B;  3NAP B;  4UFJ A;  1BEV 3;  2UYB A;  3KT1 A;  3SHR A;  4CU7 A;  2DCJ A;  1F9K A;  2RHP A;  5FZ9 A;  2WS9 1;  4YGD A;  1CGP A;  3ORJ A;  2WT0 A;  1HKD A;  4Y3O A;  5JXJ A;  1TME 1;  4CYD A;  1UZ0 A;  2D40 A;  1ENQ A;  2XG3 A;  3FC0 A;  3JD7 1;  5FYT A;  1VAK A;  1LHU A;  2AC1 A;  2XBO 2;  1BLZ A;  1RUG 1;  1W28 A;  4AR2 A;  2KM2 A;  3AKT A;  4A3X A;  2G19 A;  1H1I A;  5CZK A;  4GWN A;  4XE9 A;  1WCK A;  3MID A;  2BVV A;  4Q4Y 1;  1JYC A;  4NIG A;  3ZX7 A;  3KCY A;  5HCH A;  4I09 A;  3Q8C A;  3O12 A;  3WD5 A;  1OUR A;  2SBA A;  1C1L A;  1OOP C;  2Y6J A;  4NHY A;  1D4M 2;  2R1D A;  1NE4 A;  3AVR A;  3NV1 A;  5FLH A;  3WNX A;  5FQ0 A;  2E51 A;  1UY0 A;  2C4X A;  4XIO A;  3JBG 1;  4UFL A;  2BPA 2;  1ASJ 1;  4CDQ B;  4GB3 3;  3VZJ A;  2RM2 3;  3GHM A;  4QT6 A;  3LSE A;  4O9G A;  3CZU A;  2WN2 A;  3OCP A;  1ULG A;  5A6Z A;  2GDF A;  1W9W A;  3T2T A;  2DF7 A;  3PME A;  2FDK A;  2RS5 3;  1JU4 A;  2WNV A;  3GCW A;  5A33 A;  4A4A A;  4BLJ A;  5C5U A;  3JQW A;  3ES1 A;  3RI8 A;  2JEC A;  1RUI 2;  5JZG C;  2GNM A;  1SFN A;  1UKG A;  3M3C A;  1QJU 3;  3OY8 B;  3ZSL A;  4UW4 A;  2Q1M A;  1XPW A;  5EHD A;  3RZZ A;  2C9K A;  5C4W C;  1RVF 1;  5IVC A;  3B02 A;  5DDJ 3;  3NKG A;  4M00 A;  5F2W A;  4AEJ A;  4RN5 A;  5C4W B;  2RMU 1;  3E6B A;  4AI1 A;  1N1Y A;  4AI8 A;  5T54 A;  1BXH A;  1G9F A;  4L92 A;  1Y9M A;  3ZXJ A;  1ZA4 A;  1MS3 A;  2ZAC A;  1UU4 A;  1IPS A;  1JU3 A;  1QJX 3;  2D5H A;  2JJ6 A;  1HX6 A;  1SBD A;  4YFZ A;  5IVY A;  4D69 A;  4QQP A;  4FTE A;  4CDW A;  5T52 A;  3IDE A;  4E2G A;  5DAW A;  3ZXF A;  4DUX A;  1J1T A;  3POS A;  4MGZ E;  4LOR A;  4Q0Q A;  3TYJ A;  4GWJ A;  4MAD A;  3I3D A;  1WME A;  3E97 A;  2Q1F A;  4IW3 A;  1F2N A;  1O7F A;  2GC0 A;  4OHX A;  1UPS A;  1H8T A;  4HPK A;  1YNA A;  1LHW A;  1UZV A;  2VW1 A;  3PTR B;  1GQH A;  2DCY A;  3ZDS A;  4YG3 A;  2GU9 A;  3QD6 A;  3RWK X;  1BVP 1;  1OFS A;  4JTN A;  3ZR6 A;  1JYX A;  4XFC A;  1O6U A;  3T0D A;  4QPI B;  5FIX A;  5EP9 A;  2WN3 A;  1CQ9 A;  1OBN A;  4A2U A;  3OPW A;  4RFT 0;  1FPN 3;  1MS8 A;  4MV2 A;  4HZF A;  4DXR A;  4QDQ A;  1VP6 A;  1VB2 A;  2BBA A;  1CIY A;  1MVE A;  4BM8 A;  2AEN A;  2ZX2 A;  1O3R A;  4I01 A;  3V65 A;  3OGV A;  5K4L A;  5LBB A;  1WD3 A;  3RJR A;  5DAX A;  1SLT A;  1X9P A;  2WIN B;  3AKQ A;  5FZ7 A;  1NXD 1;  3BU7 A;  3OPT A;  3TN9 1;  2GC1 A;  2ARX A;  2A3W A;  2WFP A;  1VMF A;  2LM3 A;  3UNP A;  5FZD A;  3LDR A;  2VMH A;  4FTB A;  1UY2 A;  2W91 A;  2YU1 A;  1T6B X;  1TMF 3;  1KD7 A;  3FL7 A;  3KB5 A;  1RUD 1;  3T4V A;  2RDS A;  3WNL A;  5C8C A;  3O1V A;  4PBP A;  4JDN A;  4L99 A;  1DCS A;  1MZF A;  5IHR A;  1RUI 3;  2QQW A;  2G9G A;  2B5H A;  2VUJ A;  3ES4 A;  1B35 B;  4LBL A;  1H8V A;  4ZHN A;  1X9T A;  4RS5 C;  4BU2 A;  4E8C A;  1GOH A;  1VMJ A;  1HRV 1;  4TN7 A;  2PAK A;  5IJR A;  3P6B A;  4AHZ A;  4LQR A;  1UMZ A;  2VQU A;  5ABJ A;  4KWU A;  2XQR A;  5BNO A;  1PZ8 A;  3IBM A;  1DQ5 A;  1CVN A;  3ZN4 A;  2JD4 A;  5IT6 A;  1T6G C;  3N9P A;  1GOG A;  4IER A;  2ADD A;  1S0E A;  3KGL A;  3H8X A;  1SCS A;  4D7T A;  2WQ8 A;  2A75 A;  1FX5 A;  4PI0 A;  1H2N A;  5JXI A;  3PU8 A;  1G7Y A;  2RE9 A;  5K0U C;  3CQO A;  3T30 A;  4HKO A;  3FX3 A;  1D2Q A;  2ADE A;  2RMU 2;  2Z42 A;  3BB6 A;  4M3C F;  2Q4S A;  2BGC A;  4YW6 A;  2VQ0 A;  3VN4 A;  1EV1 3;  1O4T A;  5F32 A;  5BNO B;  1JZ3 A;  3AMQ A;  4FPO B;  5LAS A;  3ILN A;  3HVD A;  3J26 N;  4A6S A;  2P4E A;  4GWM A;  4KQ7 A;  1M4W A;  3MIF A;  3QCW A;  3RNS A;  3W5M A;  1AR6 3;  4LBK A;  1QHD A;  5KHG A;  1PX4 A;  3VL9 A;  1UZW A;  4JHZ A;  3U4X A;  1HB3 A;  2VR4 A;  2DU0 A;  4DUV A;  4FP2 A;  5LWB A;  2PHR A;  3VKO A;  1O5U A;  2B46 X;  4CUG A;  2NPI A;  1S2K A;  4NIA A;  4HOO A;  5BNP C;  4LKD A;  4QX1 A;  3VBH C;  2R06 3;  3P1I A;  4Q4W 3;  1OF4 A;  4R9B A;  3URF A;  1O3Q A;  2ZTN A;  4UOJ A;  1DLC A;  4C0H A;  1G8W A;  2ZGL A;  5F3E A;  3RRD A;  1LTE A;  3GBG A;  2XLG A;  4UW5 A;  4A44 A;  2ES3 A;  1MS0 A;  1RXF A;  3C2U A;  4M3C A;  2B8M A;  2RS5 1;  2IUW A;  5GZE A;  5JOY A;  1GZW A;  1ZBA 2;  2WFF 2;  3LB9 A;  1FXZ A;  2VZS A;  4FPY A;  4UFM A;  4CDW B;  5F2S A;  4KU7 A;  5HI0 A;  3LQC A;  4CDW C;  1NLS A;  3FBY A;  2FCT A;  3QH6 A;  4GJY A;  5I8Y A;  1AYM 2;  1SQ4 A;  3AJZ A;  1S4C A;  1K45 A;  3BGA A;  3DCQ A;  4QDR A;  5FRA A;  3SMH A;  3HOB A;  3CJI A;  3GCX A;  4RQP A;  3ZDV A;  3IPV B;  4LEJ A;  5FFO C;  4PLM A;  4AQ2 A;  4B29 A;  1Y7B A;  1MVQ A;  4XXP A;  1Y9Q A;  5L7O B;  4QPY A;  4NUB A;  4AHX A;  1ZRD A;  5L7O C;  3U1X A;  4CUC A;  1NCR B;  4E2Q A;  1FMD 2;  1W2U A;  2VMC A;  2ZGT A;  1V6I A;  1GMM A;  2A5Z A;  4QHB A;  4EZH A;  1WUV A;  1TME 3;  4BQ5 A;  2D97 A;  2CV6 A;  3AKS A;  1EAH 3;  4YPJ A;  2ZBJ A;  2ZCW A;  3KLS A;  4HVR A;  4BCU A;  5KC5 A;  2QCS B;  1YLL A;  2BER A;  2PMW B;  4D6S A;  5FUP A;  2XDV A;  4CCL A;  2CAV A;  2PHL A;  4ZXE A;  2OW4 A;  3TEX A;  1HJF A;  1NXM A;  5DAQ A;  3DXT A;  4Y1Z A;  5E88 A;  3VD5 A;  1STM A;  2QZ3 A;  5C4W A;  1F5F A;  1AR9 3;  4OLL A;  4V1P A;  3Q8E A;  3MW2 A;  1IS5 A;  1MQT B;  1V6L A;  1Q56 A;  1R1A 3;  4CCO A;  1O91 A;  2NLR A;  3M3E A;  3EBR A;  3W5N A;  2V4V A;  1VBB 3;  4J1W A;  2HWD 1;  3WDT A;  1YFY A;  1CAV A;  1B35 A;  1QOT A;  3BTA A;  2CNA A;  2WNV C;  4NAO A;  4DFS A;  5KXC A;  4E4D X;  3SIS A;  1QOS A;  1S55 A;  3VDD B;  4FBF A;  2I45 A;  4Z8B A;  3IB3 A;  3GM8 A;  3SKV A;  5BNN C;  4CP0 A;  1CIW A;  2GC3 A;  3NAP C;  3C7O A;  3NNJ A;  3SCH A;  3OBR A;  3E6D A;  5JIU A;  2VCB A;  3AZZ A;  1PVC 2;  4MET A;  2X10 A;  2D44 A;  4XZP A;  2E9Q A;  4AED A;  1X82 A;  3B69 A;  3FBM A;  4QX2 A;  2O14 A;  1RUC 3;  4OCT A;  1VBC 1;  3NJY A;  4QPG A;  2YXS A;  3VD4 A;  2J7M A;  1G9B A;  1W6O B;  3PUQ A;  5IFP A;  5GLW A;  3WNO A;  3EO6 A;  1AYN 2;  4JGY B;  5AVP A;  4BME A;  1T2X A;  3NST A;  3KQ4 B;  4GJZ A;  4LKS A;  5LBF A;  1CX4 A;  3WT3 A;  2BWA A;  1IG0 A;  2OXB A;  4WVV A;  3V64 A;  5L9B A;  1UOB A;  4B4Q A;  2WAA A;  2Y33 A;  4MH0 E;  4P9J A;  3OGJ A;  1N1T A;  4AQT A;  2WAO A;  5IK5 A;  4JRL A;  2PHF A;  2VMD A;  4QPG B;  2VVE A;  3P3P A;  4Q2F A;  3G7D A;  4Y20 A;  3CKH A;  2WUH A;  1YQ2 A;  1DQ2 A;  2W68 A;  4XF0 A;  4YW5 A;  2V73 A;  4HK8 A;  4QGL A;  4CXX A;  1S0G A;  4MX3 A;  1O8S A;  4LR4 A;  5FJK A;  1SPP A;  1S0F A;  2ZJC A;  3CF6 E;  3FFZ A;  1SLI A;  4NAM A;  5FOJ B;  5FZH A;  1RYY A;  3F2Z A;  2QQL A;  3KQR A;  2PHD A;  1DF0 A;  5FPV A;  1AR7 2;  3V0B B;  4BXF A;  1V6J A;  2Y8K A;  3EYP A;  1FPN 1;  1ZZ9 A;  5K9Y A;  1WW4 A;  3POE A;  4YVW B;  2LW8 A;  2LS6 A;  4YWA A;  1NY7 1;  1HRV 2;  3EB7 A;  4ATE A;  4EWA A;  3AP7 A;  2OZJ A;  4FFI A;  3DYP A;  2EIB A;  2Y6L A;  3ROU A;  4COU A;  4DZG A;  3VD7 A;  2WQZ C;  4FOQ A;  1VAM A;  5I0S A;  1V00 A;  5FZC A;  3ZYF A;  2HWB 2;  4X6Q B;  5EQU A;  5F5I A;  4OMC A;  3AZW A;  2DVD A;  2V4A A;  1AL2 2;  4AOC A;  4NJ4 A;  3KSC A;  1QDC A;  2RJ2 A;  1HB2 A;  4GIQ A;  2ZZJ A;  2DWR A;  5HCB A;  1OF3 A;  4CEW A;  3CO2 A;  4NMI A;  4DRR A;  1UOF A;  1LOA A;  2ZGP A;  3FFQ A;  4XW3 A;  3SCG A;  2RM2 2;  1N3P A;  2IC1 A;  2P3J A;  4G3Y C;  1ONA A;  1DQ0 A;  3THP A;  1OLR A;  3PVE A;  4N43 B;  1U12 A;  1MS9 A;  2BDR A;  4LUL A;  4Q4X 2;  3USU A;  1NT0 A;  4KG8 A;  5LY1 A;  1Q8P A;  4CDX C;  3ZFF C;  1VBE 2;  2CWM A;  1RUG 2;  4QQH A;  4BHP A;  3JD7 3;  3OYW B;  4I0A A;  4HAN A;  4WBB A;  1KFU L;  1PMI A;  4K40 A;  3USS A;  2ZHN A;  3OD4 A;  3ZKY A;  1W6M A;  1QOO A;  2GC2 A;  2VUA A;  1CAW B;  3B01 A;  3LEG A;  4LBQ A;  3AL6 A;  5FYZ A;  1RUN A;  1KGY A;  1Q3E A;  4YGB A;  3HN1 A;  1CWP A;  5A7Q A;  3H42 B;  5I91 A;  3L2H A;  2RJL A;  1H2K A;  1Y43 B;  2XGX A;  1AVB A;  1IPJ A;  1ALY A;  2A1X A;  3POI A;  4HON A;  2PHX A;  4QX7 A;  4IEO A;  3WEZ A;  2PXJ A;  2VUD A;  2J1T A;  1KDM A;  1RUJ 2;  4QX8 A;  1AX2 A;  3N9Q A;  3SXW A;  5LCW L;  3NWK A;  3QH7 A;  4IGQ A;  4M3C E;  3WDW A;  4CCN A;  1RTV A;  2XLA A;  2R49 A;  3AKR A;  2E53 A;  2ZA9 A;  2Q0A A;  3LE0 A;  1WCD J;  5C3O A;  3LGR A;  3ZPO A;  5C3R A;  1P8J A;  3WOG A;  1NKG A;  3WR0 A;  2E32 A;  3ZIW A;  1WMX A;  4GUL A;  3NJV A;  4YM0 A;  3BN6 A;  3VBF C;  3GZA A;  5FYM A;  4EYU A;  4XJ9 A;  4EWE A;  5CBL A;  2X09 A;  1HRI 3;  1S2E A;  5A7S A;  4D6R A;  5LK5 A;  4AGG A;  2PYT A;  3LOI A;  1TZO A;  1D7P M;  2QQJ A;  2UWA A;  1RUF 3;  1FI2 A;  2VW0 A;  5F6K A;  3H0O A;  3PNA A;  4Q27 A;  5IK8 A;  2ZKL A;  5L9V A;  3O1S A;  3OGR A;  1WLD A;  4GMP 3;  3ZFE B;  4ES8 A;  4DO0 A;  4PIZ A;  1JYI A;  5FZ6 A;  1ULP A;  1C8M 3;  2DCZ A;  2WQ4 A;  1XSR A;  1OD5 A;  1AXK A;  2IXK A;  4O65 A;  3T0A A;  2DCT A;  2RS1 2;  4IE0 A;  4JGY A;  1R1A 1;  5A70 A;  5FO7 B;  2YBS A;  3OEA A;  1WBL A;  1UY1 A;  4FPC A;  1PX3 A;  4JCK A;  5JPM B;  1GWL A;  2D6P A;  4CP1 A;  1WWY A;  2UWC A;  3MUY 1;  2JG8 A;  1H1M A;  3M7A A;  2R04 3;  1NCR A;  3SIT A;  4LBQ D;  1ND3 C;  5JOZ A;  3DYO A;  4XF3 A;  3DN7 A;  5FY1 A;  1OA3 A;  5CFC B;  2D3S A;  5CFC A;  1RUC 1;  2BW8 A;  3VBS C;  1S0B A;  3GJA A;  1YCI A;  1LHO A;  4JAA A;  4Q4Y 3;  4XF9 A;  3NQH A;  1AXZ A;  4YVW A;  3MV1 1;  1GNY A;  4MGI E;  3BTX A;  5DG2 A;  1SLC A;  1POV 1;  1AF9 A;  4CTE A;  1APN A;  4LK6 A;  5FZF A;  3A7Q A;  3ZXK A;  2VZT A;  4HSL A;  1J3Q A;  1OA2 A;  2ZMN A;  4V2V A;  1AL2 1;  1Y3T A;  4NRO A;  2RS3 1;  1H6Y A;  3ZPY A;  2OA2 A;  4KG0 A;  4YVW C;  4UWD A;  3RDI A;  2FDH A;  1SFP A;  1G9A A;  1GU3 A;  3KVB A;  1GFF 2;  2A73 B;  2YRO A;  4E9K A;  2Q5T A;  4H7M A;  1BYH A;  1NAE A;  4N53 A;  4B7K A;  1RUD 3;  3C7G A;  3T1M A;  2TEP A;  3ENR A;  4XPV A;  2WZP P;  1PIV 3;  3IMN A;  2CGO A;  3J7L A;  4YSF A;  1EV1 2;  1U5Z A;  4F83 A;  3RS6 A;  4KGG A;  3AXE A;  2ZHK A;  4Q8K A;  1AXY A;  3AMH A;  3SEP A;  4FQ4 A;  2A6V A;  4Z92 B;  3T0B A;  5LBC A;  4CRQ A;  3VDC A;  3ZYG A;  5A32 A;  4LOT A;  1PGS A;  2Q8E A;  1ND2 C;  2TNF A;  2XJT A;  4KMQ A;  4UFI A;  3RQ0 A;  1GBG A;  5CG8 A;  1CAX A;  1QEX A;  3HEI A;  1UQX A;  2VAU A;  2P37 A;  3I2G A;  2C0Z A;  3CJI C;  3O14 A;  5JOW A;  5BPX A;  4AHW A;  1H1A A;  3FMG A;  3VLB B;  4K7J A;  1RL3 A;  1QJZ A;  1BEV 2;  2W1Q A;  4AEK A;  2W0X A;  3NRU A;  1D0G A;  2JKX A;  2Y64 A;  1JOD A;  1GZT A;  3VBF A;  4L9B A;  1XE0 A;  2Z2S B;  1Q8O A;  2AZ5 A;  2PAM A;  2IZW A;  4YRD A;  1K42 A;  2HWF 1;  3A23 A;  5DQ0 A;  5LK7 B;  2VZV A;  1RUJ 3;  1GP5 A;  1RIN A;  2CY6 A;  4AI3 A;  4EWD A;  2ZMK A;  1B09 A;  1EAH 1;  1F4H A;  3I59 A;  1QXJ A;  1XNA A;  3WHU A;  3R0R A;  3GBW A;  2V5Y A;  1VB4 A;  1YQC A;  1MS1 A;  2ORX A;  3ZN6 A;  3LPF A;  4LTA A;  3OD0 A;  4OMD A;  5FZ8 A;  2P6H A;  2MPF A;  1Z0H A;  3N9N A;  5F5C A;  1US2 A;  2RS1 3;  1E5R A;  4Q0P A;  5FYS A;  1MR5 A;  2Y6F A;  1NOV A;  1NA1 C;  4XCB A;  1E5I A;  4RQP B;  5JCT A;  1V6K A;  1ZRC A;  3KHB A;  4Q4W 1;  4TTG A;  2RV9 A;  2EXK A;  3TOJ A;  5FUN A;  3SC7 X;  2DVG A;  2OQ6 A;  1R09 1;  3HNY M;  4BB3 A;  3VBH B;  1J58 A;  3WQ1 A;  1R64 A;  2R04 1;  1N3O A;  5FZ1 A;  5A3O A;  2YFU A;  4YW7 A;  4CXW A;  3N4M A;  2YDE A;  1MEC 1;  3JB8 A;  2DFC A;  2R30 A;  2HEW F;  3GJB A;  3LZZ A;  1LOC A;  2XWB B;  3SKJ E;  2EXH A;  3E5Q A;  3WF0 A;  2F4L A;  1LOF A;  3A22 A;  4N8M A;  3U4S A;  1LAJ A;  2WO3 A;  5K0U A;  1PIV 2;  5E8A A;  3N7M A;  1GKB A;  2YHJ A;  3CLP A;  3VZL A;  4PQQ A;  4LO8 A;  1OVS A;  1CN1 A;  2VOT A;  1FYU A;  4PBO A;  4BDV B;  4BQW A;  1SAC A;  1UOG A;  4UI9 L;  2WNU C;  3N9L A;  1OLQ A;  1BBT 1;  2GH2 A;  2I07 B;  3QOP A;  4MGK E;  4UAP A;  2P17 A;  1X8M A;  1CAW A;  4DEV A;  5ABJ C;  2CGP A;  1JI6 A;  4GA9 A;  3WNP A;  4SBV A;  2ZGQ A;  3JXS A;  2CHH A;  4ZKT B;  2GMM A;  4I3G A;  4P00 B;  4QHO A;  3LEI A;  2WZR 3;  5FR3 A;  4XYX A;  1AJK A;  2B9U A;  1VBB 2;  5FV3 A;  4B1M A;  5FWE A;  4E4H A;  2QQO A;  1VJ2 A;  1WGP A;  3SCF A;  2WA4 A;  1S0J A;  4DXZ A;  2W46 A;  3HNB M;  2XVK A;  1KXG A;  1FOD 3;  2ZGN A;  1BVV A;  3NJX A;  2R0F A;  2VO5 A;  4IV3 C;  4N53 B;  4NHX A;  1RUJ 1;  2RR1 3;  4QB6 A;  5FMB A;  1JOJ A;  3WP4 A;  2W9X A;  5HV4 A;  1RVF 3;  1D2S A;  2Q8D A;  3T2P A;  4C8D A;  1XNB A;  3FZ3 A;  1ZBA 1;  1AR7 3;  1MZE A;  2IVI B;  2ZAA A;  1OVP A;  1W2O A;  3QAC A;  3V0A B;  2E63 A;  5DUW A;  1CJP A;  4FPL A;  5G04 L;  3AMM A;  2RDN A;  2BTV C;  4OUE A;  5ANN A;  1FAT A;  2LTN A;  1J59 A;  5FO9 B;  4RR3 A;  2GND A;  3U07 A;  2E7A A;  2GAL A;  2RS3 2;  5ACA 2;  1ZYB A;  2R7E B;  2WYS A;  2XUE A;  3H3U A;  4IND A;  3A0K A;  3FHQ A;  1H30 A;  2VOW A;  5FMC A;  4CCK A;  5CFD C;  3T1L A;  2OPW A;  4MVT A;  2ZHM A;  5FYI A;  1QKQ A;  4S2H A;  4RL7 A;  4Y1U A;  1DGR N;  2D6K A;  4NWW A;  4DOU A;  3UYJ A;  1WKY A;  1WA6 X;  4BE3 A;  5LBE A;  4AI2 A;  2YY1 A;  4HN1 A;  2Q1Z B;  1LJ7 A;  1OLM A;  2XJU A;  1LCL A;  4LIT A;  5CA6 A;  3DEC A;  3P3N A;  3APB A;  1GQG A;  3M3Q A;  4AVC A;  2FD8 A;  4IEP A;  3W9A A;  3ACH A;  1UNB A;  4FCA A;  3ZYR A;  4DXS A;  1YC6 1;  1W03 A;  3D4K A;  1ENR A;  1HJG A;  2CL2 A;  4DUW A;  4N7I A;  4FAH A;  5A3P A;  4Q26 A;  1VAL A;  1C1F A;  1FPN 2;  1BBT 3;  4HG6 B;  3WQ7 A;  5EYY A;  1S0D A;  3LD8 A;  5HXM A;  4FVV A;  1ACC A;  1LEC A;  1N1V A;  4Y26 A;  4W4Z A;  5LA0 A;  1PGL 1;  2BEO A;  3POW A;  2A6X A;  1AUY A;  4IEV A;  4ARY A;  4EQV A;  4EN8 B;  1XYP A;  4QX0 A;  5FXV A;  4ORF A;  1B35 C;  4QX3 A;  4JGZ B;  5GZG A;  3HR9 A;  4XBN A;  5JAX A;  3I2O A;  4HPK B;  4QU2 A;  2JB4 A;  3ON7 A;  2Q8C A;  3WW1 A;  4A3Z A;  3WIN E;  2AUY A;  3KCC A;  4HVQ A;  4JRA A;  5L7O A;  2WL1 A;  1C5I A;  4XAE A;  1IS4 A;  2ZAB A;  1NE6 A;  4LBM A;  3WDX A;  5C6C A;  1VBC 3;  5KBF A;  4XHX A;  2BQP A;  5JZG B;  5A6Q A;  3AYA A;  4DY3 A;  3ZOI A;  3SH5 A;  5IAT A;  2W2I A;  4IE5 A;  3VGI A;  1WD4 A;  1Q8V A;  2YC4 A;  5EV7 A;  1SEF A;  2Z69 A;  5FYV A;  2BGO A;  3ILR A;  5FY5 A;  5BNP A;  2NMN A;  3UES A;  4CCJ A;  1R09 2;  1FMD 3;  5EYX A;  3SQO A;  4H2A A;  4OHZ A;  1RB8 G;  1YEW A;  4AAP A;  3IKW A;  1UAI A;  4Q0U A;  2W08 A;  4ZY9 A;  1NLR A;  2HWC 3;  2RR1 2;  3OJB A;  1EUT A;  4IEY A;  1JH5 A;  1PVC 1;  3OEB A;  1JZ6 A;  5EWS A;  2IWG B;  1HDK A;  3BPZ A;  1G9C A;  2DBI A;  3KD4 A;  1UYY A;  3HQU A;  2W5F A;  1NG0 A;  2A70 A;  4MOA A;  3A0N A;  1IQA A;  5JI9 A;  4XUR A;  1OOP A;  1OQD A;  3BUC A;  3JQX A;  3K4A A;  5D8A A;  4W6W A;  4COW A;  3VDB A;  3PUA A;  3I8T A;  1TEI A;  3TRS B;  3T2O A;  2RDQ A;  3JUU A;  2ZX3 A;  1D4M 3;  3BOP A;  4I0B A;  3OOX A;  4ARX A;  4BK5 A;  1SFY A;  2JE8 A;  3FHI B;  3ST7 A;  2AEZ A;  3VBR C;  5C33 A;  3GZE A;  5I0D A;  5D2A A;  2JDA A;  3POF A;  4FFG A;  1DZQ A;  3ELN A;  3UJQ A;  5JUV A;  3BIE A;  3PVB B;  3PUR A;  4A42 A;  5IVF A;  1V9U 2;  5H9P A;  4H14 A;  4M4R A;  3PDQ A;  3VBH A;  4XUP A;  1KFX L;  1JYN A;  4OYU A;  4IV3 B;  5FZI A;  4KH9 A;  4O61 A;  1OMI A;  2EAK A;  4E2S A;  1AR7 1;  3WV6 A;  1Q5O A;  3PMS A;  2E26 A;  4QM9 A;  4CPB D;  3J9S A;  4NPM A;  2P34 A;  3LDK A;  2FCV A;  3PL0 A;  2UU8 A;  4AQ6 A;  5LA9 A;  5JXH A;  5GZC A;  3HBK A;  2UY8 A;  1DGW A;  4KBB A;  1UF2 C;  1S0C A;  3VHN A;  4I2O A;  4HT1 T;  1AYN 1;  2D6M A;  4XFA A;  3AM2 A;  4YG0 A;  3ZO0 B;  4FT8 A;  1AYM 1;  4FFH A;  1PVX A;  4IE6 A;  4Y1V A;  5GKA C;  4BK4 A;  3AC0 A;  4AHY A;  3CU7 A;  1DHK B;  1UX6 A;  5CEH A;  2XXZ A;  4R9D A;  4XEZ A;  1XYO A;  5IUQ A;  1NQD A;  3MIH A;  1LB2 A;  3L2Y A;  1QQP 2;  2CSG A;  3K77 A;  4HKL A;  2D3R A;  4ZPI A;  3KGZ A;  5LB6 A;  5FCC A;  2VCC A;  3WW2 A;  3WF1 A;  2AH2 A;  4N9I A;  4A41 A;  4D0Q A;  5TSW A;  4YFW A;  3POG A;  2A6Y A;  1ND3 B;  5FYU A;  4P9L A;  3IDC B;  4GAZ A;  4XQD A;  4HMZ A;  3ZIX A;  3Q8B A;  3S7I A;  3TN9 2;  4IE4 A;  2ZGO A;  3WNK A;  3ZXG A;  3MDP A;  1J84 A;  2CDP A;  4CDU C;  1RIR A;  4QQL A;  4YVS C;  1H8T C;  1ST8 A;  4Y24 A;  4XHB A;  3UT0 A;  1HV1 A;  3GF6 A;  2VZO A;  1RUC 2;  2IXC A;  4W8J A;  3AZX A;  4BH9 A;  3I54 A;  1DP0 A;  3J7N A;  4LUM A;  3H50 A;  1XND A;  1LR5 A;  3W21 A;  4AVS A;  5KWR A;  3AZY A;  2H6B A;  2QQP A;  1JS9 A;  4U2A A;  5A3W A;  5A1A A;  3ACF A;  2VZP A;  4O7X A;  4YGC A;  1WZX A;  3N9M A;  1JW6 A;  4LBO A;  5FBZ A;  5A32 B;  1RUH 1;  1JZ2 A;  3S6P A;  4FXK B;  1Q8S A;  1CJD A;  1O5L A;  1UX7 A;  3R4D B;  3IN9 A;  4QPW A;  3O1T A;  2QQU A;  1UPI A;  4HFS A;  4QXH A;  3HWJ A;  3VDA A;  5AC9 2;  1DU3 D;  3LEK A;  4P5Y A;  3SH3 A;  4M4P A;  4A7K A;  5FO8 B;  2CAU A;  4EN7 B;  1PGW 2;  2JIJ A;  2YGM A;  4S2D A;  5EJ3 A;  1WCQ A;  5L73 A;  1RUG 3;  2NQY A;  2ZGU A;  5A1L A;  1YFX A;  3AP6 A;  1VBD 1;  5C7G A;  1HN1 A;  1RXG A;  2HEV F;  4XAC A;  5DN2 A;  3EHK A;  3K4D A;  1XU1 A;  3WG2 A;  3ZYP A;  3TEZ A;  2PLV 2;  2PN5 A;  4CP2 A;  3S5A A;  5C9A A;  4URT A;  1UKR A;  2QZ2 A;  3WNN A;  2FDG A;  4XDQ A;  4JV4 A;  2C24 A;  5L19 A;  5LEK A;  4IV1 B;  2FBE A;  1FMD 1;  1ENS A;  1QWR A;  3VBO B;  3ZXD A;  3ZXA C;  1AR9 1;  1UIK A;  2JXA A;  5LY2 A;  3AL5 A;  1IGO A;  1E57 A;  4XDO A;  1A3K A;  2XKP A;  3H1W A;  3AYE A;  3FLT A;  3NKT A;  1W90 A;  2NZ9 A;  4K8F A;  5FP9 A;  2FHR A;  4FSJ A;  1PK6 C;  4LBN A;  1C28 A;  4X6R B;  2YFZ A;  2LUW A;  3FUO A;  4P08 A;  4RHV 1;  3WW4 A;  3B00 A;  4LO6 B;  4TLF A;  5F3G A;  1LOD A;  2YC0 A;  1D4V B;  5CU1 A;  4IUG A;  5CVR A;  4AFM A;  4B8E A;  4CUB A;  2QQI A;  1IPK A;  3WDU A;  3T08 A;  1VBE 1;  4N7U A;  2FDF A;  1CES A;  4LHS A;  3HMY A;  3LPG A;  3OBT A;  3MLL A;  3J4U H;  1S1A A;  3MW3 A;  5DXD A;  1ZVF A;  4UF0 B;  4WVM B;  2V72 A;  5DMY A;  5JZG A;  2DUO A;  2VMG A;  4ZZ5 A;  1KS4 A;  3LFI A;  4Z2A A;  4CXY A;  4JDM A;  5FXX A;  4ZXK A;  4QB2 A;  4R52 A;  1UIJ A;  4A6O A;  4GKX A;  3T3Y A;  2HWB 3;  1Z78 A;  5D8A B;  3C7H A;  2HWC 1;  4LHK A;  5AC9 3;  1ENX A;  2Y0O A;  3AJY A;  1HQL A;  3N7L A;  5GM0 A;  1GP4 A;  3RMY A;  4Y5Z 0;  5FYH A;  2I2S A;  3KZ4 C;  5A3N A;  4YM1 A;  3A21 A;  1MAC A;  1RVF 2;  4GQ7 A;  1VPH A;  2H6C A;  5GLV A;  2QBX A;  4IXL A;  4A7Z A;  2WZE A;  5J7M A;  3D0J A;  3RZH A;  1FOD 2;  1SCR A;  3IIA A;  1K5J A;  1BMV 1;  2XKO A;  3IAQ A;  5FQ0 B;  1JBC A;  2OZ6 A;  1QJY 1;  5FY7 A;  1A78 A;  1V6O A;  5I0T A;  3ZFE C;  1W8W A;  5C5T A;  5BNO C;  2WZR 1;  2VBD A;  1VAV A;  5FUI A;  2VUC A;  1C8M 2;  2DCK A;  3TAY A;  2YB7 A;  4LE4 A;  3X29 B;  3WX5 A;  5LRS A;  3HT2 A;  2JG8 C;  3V0B A;  2X53 S;  5FZ3 A;  4QGM A;  1W8F A;  4RR3 C;  5A33 B;  4CSW A;  4IEU A;  5F37 A;  3ZYB A;  1ZZC A;  5ACA 3;  3VUO A;  1NCQ A;  4IEW A;  1DGR A;  1J3R A;  1LHV A;  3O1P A;  3E6C C;  3MFA A;  2VC9 A;  3RZM A;  3NVC A;  1ZBA 3;  2D43 A;  3MYX A;  5T5P A;  1I1E A;  2VXJ A;  2G1M A;  4DMI A;  2C5D A;  1W06 A;  2NYY A;  2ZGM A;  4Y20 B;  4FOY A;  5ABJ B;  3I49 A;  5FBJ A;  3N7K A;  3RZJ A;  1I5P A;  3GYD A;  4AK3 A;  4I02 A;  2K2S A;  1W9S A;  2FDI A;  4PQ9 A;  4Y5T A;  3KCX A;  3MLK A;  1YQ6 A;  2WSV A;  1X8E A;  3VBR A;  4K9S A;  3ZXL A;  5BY5 A;  4LMF A;  4BLI A;  5IVB A;  4G9S B;  2GH8 A;  1OSG A;  2J1U A;  5IK4 A;  1COV 3;  2HH9 A;  4COZ A;  1F15 A;  4RGK A;  2R06 1;  5J48 A;  2X05 A;  1W8T A;  2LRP A;  4OUM A;  1IHM A;  1YI9 A;  2ARB A;  1SLL A;  5IWF A;  2OS2 A;  3O1M A;  2J1E A;  3SH4 A;  3NNG A;  4PHZ A;  4FO9 A;  3TEY A;  1PMH X;  1G86 A;  1QJU 1;  1YI7 A;  2FQP A;  2XJV A;  2VJX A;  3DEM A;  1GNH A;  3PIJ A;  4BMB A;  4AVB A;  3K4Z A;  1TMF 1;  1PM4 A;  4QAW A;  4RGG A;  3AP5 A;  3VBR B;  4EZ4 A;  4Q4V 3;  1VBD 2;  3WP5 A;  2LAL A;  1PM7 A;  4PDW B;  3O1U A;  3JU9 A;  5CIS A;  1I9R A;  1N1S A;  2GSY A;  2XL7 A;  5FWJ A;  3WCR A;  2GZW A;  5GLT A;  3CL1 A;  1BMV 2;  1W3X A;  2VOV A;  4D94 A;  1LU1 A;  1ND2 B;  1V6N A;  1QMJ A;  4RGA A;  1LES A;  3GXU A;  5DAV A;  5T5O A;  3NNM A;  5CIR A;  4WM7 C;  4ZU4 A;  1QJF A;  1QJY 3;  2W94 A;  1UZY A;  1W6M B;  1RHI 1;  1ZRE A;  1QIQ A;  4M0H A;  1SBE A;  5EPA A;  5KHI A;  3ZLI A;  1LU2 A;  3ITQ A;  4UFH A;  3OF1 A;  2C9A A;  3NJZ A;  4X8P A;  4Y1X A;  4BIF A;  2GN7 A;  3BU0 A;  4MXV A;  4XQ4 A;  4X8N A;  2ZGS A;  4LPL A;  1W8Z A;  4AVA A;  5HBA A;  5JPN B;  3I2K A;  1CAU A;  1EP0 A;  2PTM A;  5A7W B;  3DYM A;  3MF9 A;  3OUJ A;  1W0N A;  4LHN A;  2Y6G A;  4FOW A;  3OUH A;  2W1S A;  2BJS A;  3LWC A;  3WQ0 A;  4AFD A;  1NZI A;  3FHA A;  1RUI 1;  4KWK A;  2CU5 A;  1UYP A;  2QQV A;  3LIH A;  1LHN A;  4MO3 M;  5FKB A;  3RPQ A;  3U75 A;  3ZN5 A;  2YC2 A;  3O5S A;  5K8S A;  1JUH A;  4FPK A;  4C0B A;  1ZRR A;  1W6N B;  4COV A;  3VKL A;  3WHT A;  1CPN A;  3CIH A;  4P9Y A;  4B3N A;  2V5D A;  3LOB A;  1O4Z A;  4DXT A;  4XFI A;  1X36 A;  2BYV E;  1AL2 3;  1SBF A;  4Q8L A;  5FZ0 A;  2IXH A;  3AFK A;  4QMA A;  4ZU5 A;  5KXD A;  1NCQ B;  3WP6 A;  4Q0V A;  3CZJ A;  2VBP A;  3VDD A;  4R9A A;  5FMO S;  1UMI A;  1X33 A;  1IG3 A;  2C1F A;  3OTF A;  3DXU A;  3EJK A;  1XU2 A;  4MLO A;  1DLL A;  4QKN A;  4RHV 3;  3D0S A;  5JVV A;  4CCC A;  1N3Q A;  3PIG A;  2VOK A;  4GZ9 A;  4ONU A;  3N35 A;  1EPZ A;  4K1Y A;  3JD7 2;  4QQO A;  4A7Y A;  5FPA A;  1ZBE 1;  4PI2 A;  3GGL A;  1WLT A;  2DUQ A;  3KV9 A;  4YZ3 A;  5D1I A;  4XZU G;  3VZK A;  3GBF A;  4Y5S A;  2VMF A;  1BZW A;  2VNR A;  4MHR A;  3MIG A;  3WXP A;  2K46 A;  2RS3 3;  4CZS A;  4AFA A;  4JGY C;  4AL9 A;  2XL9 A;  1W6P B;  3B93 A;  4JQT A;  1QGL A;  1XBF A;  3E5U A;  4IE7 A;  1W6O A;  5ISL A;  4NHM A;  3AZV A;  1ZRF A;  1O3S A;  4KWJ A;  1GOF A;  2WC2 A;  3H7J A;  1YJK A;  2Y6K A;  2CYF A;  2YPJ A;  3NNL A;  1ZA7 A;  5CNA A;  3THC A;  4BQ4 A;  1BJQ A;  1QXP A;  4R4Z A;  2JWP A;  2R6Q A;  2BU9 A;  1FT9 A;  2W3J A;  1HRI 2;  2P6C A;  3MIC A;  4OHW A;  1RUE 3;  5F5Q A;  1FV3 A; 
#chains in the Genus database with same CATH homology
 4LK7 A;  4CPB D;  1V0A A;  3ZYF A;  1HN0 A;  3ZYH A;  2VXJ A;  4LKD A;  1OH3 A;  1W8U A;  1W90 A;  2O14 A;  4LJH A;  2K46 A;  1W8Z A;  3ORJ A;  3UT0 A;  4AL9 A;  1W8W A;  4CPB A;  2LRO A;  4YW7 A;  4YW6 A;  1GWK A;  4BQ2 A;  2KR2 A;  4LK6 A;  1WCU A;  3F95 A;  1GWM A;  4LKE A;  5D21 A;  4A6S A;  4CP9 B;  1GWL A;  4CP9 A;  1UOJ A;  2WYF A;  1OKO A;  4BQ4 A;  4BQ3 A;  4BQ5 A;  4YWA A;  1WZX A;  2C24 A;  2Q1F A;  2JWP A;  4LKF A;  3ZYB A;  1WMX A;  1W8T A;  1W9F A;  2LRP A;  1L7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...