1GWKA

Carbohydrate binding module family29
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Promiscuity in Ligand-Binding: The Three-Dimensional Structure of a Piromyces Carbohydrate-Binding Module,Cbm29-2,in Complex with Cello- and Mannohexaose
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
total genus 27
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1gwkA00
4LK7A 4LKFA 2LRPA 3F95A 4LKDA 2KR2A 3ZYFA 1W8TA 2O14A 1W8ZA 1UOJA 1HN0A 1W9FA 4AL9A 4CP9B 1GWMA 2VXJA 1WMXA 2Q1FA 4LJHA 4A6SA 4BQ3A 2LROA 4YWAA 1GWKA 1W90A 2C24A 1W8WA 1W8UA 2WYFA 4BQ5A 4CP9A 2JWPA 4LKEA 1OKOA 3UT0A 1WCUA 4YW6A 1GWLA 2K46A 3ORJA 4YW7A 4LK6A 1L7LA 1V0AA 4BQ2A 1WZXA 3ZYHA 4CPBD 4BQ4A 4CPBA 1OH3A 5D21A 3ZYBA
chains in the Genus database with same CATH superfamily
2ZGQA 1MQTB 5EV7A 1AR83 3MEPA 4XW3A 3LEMA 1DQ5A 4P9WA 4BM8A 4B1MA 4AAXA 3RJRA 5JIUA 3NAPC 3RI9A 3KZ4C 1VBB1 4MXWA 3O1RA 3T4HB 2P34A 1EV13 1GP6A 1ZZ7A 1VBA1 2J1TA 2EA7A 4JDNA 3ZR5A 3LDBA 3ZX7A 3JD72 4Y5SA 3POJA 4ISRA 5FPVA 4ASMB 1QNYA 1H1IA 1N3PA 4QD2A 1FMD2 4Y5Z0 5LBCA 1AJOA 4KGQA 4S2GA 4IETA 4HXCA 5L19A 4AZZA 3BU7A 4IW3A 3ZMNA 3BKZA 4I3GA 4PLMA 2WWUA 4OHXA 3BOPA 1CIYA 2PHWA 3VHNA 1Q5OA 1VALA 3WP4A 4D8MA 4N43A 4O65A 1LOCA 2DBNA 3M70A 3T2PA 4Q8KA 1XNCA 1S0BA 4Q26A 2HKXA 4LULA 5T52A 3HJRA 4BH9A 3K3OA 2GN7A 1OA2A 1K5MA 2QTWB 5D2AA 1YYNA 1RUG1 2AEYA 3C7FA 5J37A 1AL21 1XPWA 2Q1ZB 3MIDA 5FZCA 1S0CA 2GH2A 2WNOA 2GZWA 3EMRA 3FHAA 4FPCA 4LPLA 2WLPA 1XE8A 4YW6A 1B35A 4IEOA 4YYOA 1HQNA 5HCFA 3BPSA 1C8M2 2ZX0A 1F4HA 2LUWA 3PLQA 2CGNA 4BLIA 4P9LA 2DU1A 3I59A 3LEIA 1SPPB 2V5DA 4E2GA 1OH4A 3H9AA 4ONUA 3DXUA 5CISA 4TZDA 4XDQA 3GHNA 3WQ0A 3WP5A 3H7YA 3IDAA 4PIYA 3P6BA 1SACA 1WA4A 4LBMA 3LSEA 3K2OA 4MV2A 3J8F1 1IPSA 1FV2A 3PUHA 1IPKA 1QJEA 2BV4A 2CDPA 3G6JB 3LPFA 3LE0A 5FYMA 2B9VA 1LRHA 3V64A 1RUJ3 1FV3A 5JOZA 1PVXA 4MLOA 3U4SA 2G9GA 2VZPA 1VE0A 3AYEA 4OFGA 4AQ6A 4JQTA 1OVPA 5FREA 1ZRFA 3NNLA 1IKQA 5CAZA 4NIGA 1QQP2 3N36A 3PUAA 4LK7A 4R9AA 4FPHA 2JE9A 1VBC3 3U75A 5L36A 4KNCA 2C1FA 2IFWA 3KS7A 4JGZC 4CDXC 1QY4A 3NAPB 4OQ9A 4NIDA 1ND3A 2ZAHA 3M3OA 2F4PA 4JDMA 4DY3A 3HBKA 4YW3A 1KJRA 4DINB 3JD71 2JD9A 1IGOA 2D93A 5FYBA 4Y1YA 1S0JA 3CZUA 5KXEA 3GCWA 2XBO2 4WM7C 5T5LA 3JCIA 4W6YA 4D0QA 4XXAA 2CU5A 4JRLA 2AC1A 3A21A 5L9VA 3RMXA 1V0AA 2BFUL 3N4MA 1MVQA 3MLJA 4AI9A 2VVFA 2GNTA 3SKVA 2ZKLA 2E6VA 2VC9A 1QJY3 3VKFC 2Y6FA 2WO1A 5L7OA 4RQPB 1BJQA 1UU6A 2X8KA 1MEC2 4QX7A 5LA9A 1ND2B 2OX0A 1HJGA 1IPJA 3Q8CA 2VULA 5FZ3A 4BYYA 1RIRA 1RUC3 1TME3 3M3IA 1XYNA 1URXA 2Y64A 2A6VA 3WQ1A 1XBFA 2BYVE 2EIDA 3GDBA 4SBVA 3MPPG 1RUH3 4CVUA 2D6KA 1KD7A 3THTA 1JHNA 2DVBA 1GU3A 2VBPA 3LEKA 3IIAA 1UPSA 2J42A 1DGRA 4UW4A 4EE2A 1UKGA 4E2QA 1OPMA 1UXXX 1XNTA 4X6QB 1LGCA 1R082 1NZCA 3RI8A 5JSOA 1C8M1 1Y9MA 1ZZ6A 1RUD2 4C8DA 5LZ6A 3OG2A 2PXJA 2P3IA 1NQJA 2ARBA 1OH3A 3JB4C 3HQXA 4GB32 3TEXA 5BNQA 1FOD2 2Y6KA 4AK3A 2VOXA 4LBJA 4QPGA 5FMDA 4F3JA 3HBZA 5FZMA 3WOGA 1LGNA 3JXSA 1PMHX 2OW4A 2WNUB 4AL9A 2WR9A 3OGRA 3VZMA 3ZXFA 2QQIA 2GH8A 4LOTA 2PHUA 1ULEA 1X8MA 3N9QA 3ZYIB 2BBVA 5IATA 1NE6A 4KI5M 1UZZA 5FMCA 4L8QA 3DPRC 1SLTA 1SLLA 4MGIE 5AVPA 3VZKA 2YY1A 4WVWA 1QHDA 2JG8A 4FQ4A 2HWF2 3S5AA 1GZWB 1RUE1 2ZXQA 4UXAA 5CYYA 5JOXA 2W08A 4LLOA 1D4M3 1VMFA 3IDEA 1QQP1 5FMOS 5FZAA 1QJZA 1TE1B 5FZBA 2VJXA 2LRPA 3HPNA 4MGQA 5T55A 2FMYA 1BZWA 3QBQA 1Q8OA 2ZMLA 1WD4A 5LK7B 4YARA 4DOUA 5CZKA 3IDBB 1PHMA 3WX5A 5E1RA 3V0AA 5EPAA 3UESA 5A33A 5KC6A 2BERA 3AXEA 2JXAA 4AQSA 2W3JA 1KFUL 3AMMA 1W06A 5F3EA 1MS0A 4I01A 5C3QA 2XBO1 3FMGA 1MS3A 3WF3A 1ZRCA 5FXVA 4WM7B 4CXYA 3NV1A 4IE7A 3OYWB 4AI2A 3LOIA 5IJRA 2PELA 4ITCA 3VBHC 3WDVA 4UW5A 3RS6A 3ZN4A 4B29A 2EXKA 4CP1A 2RM21 3A0NA 5CNAA 1J84A 1GQPA 4XEZA 5JOWA 1O8SA 3UYJA 2ZEXA 1A3KA 1MEC1 4Z1VA 2UY9A 4CUAA 5I0SA 2X53S 1OSGA 1T2XA 1XE7A 5HV0A 4ZONA 2ARAA 5K9YA 3H8RA 2RDSA 5T54A 4UW6A 3AYAA 3OJBA 4IGPA 4LJHA 3VBFB 3WG1A 3VBOC 1PVC2 2RJLA 2ZX3A 5I0RA 2DCTA 4MHUA 4EROA 3RYPA 5IVEA 4YZ5A 3KV4A 2PAMA 3WW1A 2D5FA 2GMMA 1OKOA 3W5NA 1OURA 3WNXA 3ILFA 1R081 1ULGA 4XUNA 4HPKA 2JJ6A 4M0NA 5FOBB 3RMYA 5GLTA 3WNPA 4PI2A 5D21A 4EN8B 3HAGA 3CNAA 3IMNA 4GB31 4GKYA 1K42A 1VJ2A 1FOD1 4XFBA 4AVTA 1UX6A 2D97A 5FRAA 2W5FA 3ITQA 3MF9A 2VMFA 3OCPA 1YI7A 5FY7A 3EJKA 3OY8A 3PIJA 1JHJA 1V6MA 4XC9A 1HDKA 1C5HA 3H3UA 2C4XA 4JCKA 1W9FA 3T2QA 4IV1B 4PF1A 5C4WA 3GJBA 1W03A 2RE9A 1W8OA 4WVZA 4RFRB 4NAMA 5C33A 2DTYA 5HCAA 1AR93 4ZU7A 2UWBA 3BVCA 4CP2A 4GWNA 3VN4A 2EICA 4Y20B 5KHJA 2B7YA 3BB6A 2PHDA 5FFOC 3DPRB 4XE9A 5ANNA 4M3CF 5DUXA 5J09A 4ZXEA 2HWF1 4CDWA 2R16A 3VKMA 2VAUA 3NJVA 4H7MA 2VZSA 2IXKA 4AGRA 2ET7A 1REEA 2GALA 1EAH2 1O91A 4NRQA 1CPNA 4OI4A 3PDQA 5A3UA 1VR3A 1RMU3 1OA3A 5HCBA 5E8AA 1MR5A 4AFMA 4XUTA 3SH4A 2YPJA 2Y0IA 1ONAA 3GZUC 1WWYA 2HWB3 2MEV3 4N9IA 2XQXA 4Z92B 5E88A 4P5HA 1WLDA 4Y22B 4RA0A 2HLEA 2BOIA 3I2KA 4FXKB 4NIHA 3W59A 2Q8EA 4JRAA 1CQ9A 1X33A 1GOFA 2X05A 3MW4A 3PU3A 4WM8C 2WBKA 1YWKA 1JOPA 5A7OA 1UO9A 4MO3M 3SCGA 3ZR6A 2E31A 3VHPA 2HBTA 4YGDA 4HMZA 1LEDA 1W3XA 5FY5A 3VBHB 5CFCB 1J3QA 4CRQA 1HB2A 5BYNA 4DIQA 3UKNA 2G1MA 1TVGA 4XQ4A 2P6HA 3C3VA 1ST8A 4RR3C 2QDRA 1BK0A 1UOJA 3ACLA 4URAA 1POQA 4RGAA 3M1HA 4GIQA 3LCPA 3VD3A 3WW4A 4YGCA 5BNPA 4M3CE 1UY4A 2OXBA 4P9IA 3VBRB 2CSGA 3POWA 1LHUA 1PVC1 1VAMA 3KMHA 2P2KA 2XB6C 4QX1A 5F3IA 2TBVA 3VD5A 4AEDA 1AYN3 1NA1A 2VTXJ 3VZNA 1GWLA 2Y34A 3CO2A 2RJ2A 3NWKA 1CIWA 1OHFA 2AR6A 4Q29A 1IS6A 1JBCA 1COV2 1W6MA 3P3NA 3U14A 2WA3A 1XYPA 1UY2A 4X6RB 4UT5A 3ZKYA 4OHWA 2YMZA 4MGKE 1W8TA 4G9SB 4TWTA 3ZKUA 2R062 4HSLA 3DYMA 2IXIA 2A7AA 3M3QA 4H55A 5C5UA 4GD4A 4LBKA 1KXGA 3U11A 4XILA 4BQWA 2JG9C 4YVWA 2W39A 4R9CA 1VLNA 4KBBA 5A3OA 2W0XA 5IK4A 2WFPA 3AB0A 2ARCA 1XYOA 4EQVA 2BWCA 1CAWA 2Y38A 4HKOA 3ROUA 2HWC3 2NLRA 2XUMA 1LCLA 4WVVA 3AZYA 4IQPA 3THPA 4A6OA 4W4ZA 4Y24A 4AVCA 1C4RA 5C8WA 3FFQA 2JDAA 3H1MA 4M4PA 1V9U2 1DQ6A 1H8TA 3ACIA 3K51A 1EAH1 3K4DA 2QQNA 4N7IA 1ENRA 2VUAA 3AXDA 2VZQA 1RVF2 3R05A 4O9GA 2RS32 1XU1A 4IDZA 5ABJA 4IE5A 4XJWA 5EYYA 4M3CA 5FZ0A 3MDPA 5CBLA 4RFT0 3FBMA 4N53C 5FJHA 1YQCA 2PHXA 3GHMA 3URFA 4QQPA 1PX4A 2GP3A 5DZGA 4JKLA 4D69A 1P8JA 2W1UA 2YFUA 4XABA 4E2SA 4KG8A 4XDOA 3H3ZA 1KDMA 1WGPA 4FPKA 3SCHA 4D7SA 4PI0A 2R0FA 4XETA 3ZYGA 1SDWA 2DTWA 1ZZ8A 3U1XA 3NNMA 1I1EA 2DUOA 3EO6A 4DXRA 3J9SA 1UIKA 5DQ0A 4Q4Y1 3VL9A 3ZYRA 1GR3A 1E57A 3KGZA 5I8TA 3ZO0B 1L7RA 2G9ZA 5D8AC 3PVBB 3FUOA 3RRDA 4CU8A 5A1AA 3DYOA 1VRH3 5AFBA 3CHXA 2O8QA 4N9HA 2Y0OA 2YBPA 2R1BA 5IVFA 3H8XA 1POV3 3FC0A 5JOYA 2XOMA 5IVVA 5CFDB 3ILRA 3VBOA 2WT0A 3WR0A 4A7ZA 4QHZA 3C7HA 1MS5A 2V73A 1NCQB 1JYNA 1COV1 2MNGA 4JGYC 2EF6A 4QPIC 5A7PA 4YM2A 2AYHA 5FZKA 5HV4A 3HEIA 1X82A 5FYIA 1CX1A 3O7OA 4YVSB 1XJAA 1Q43A 4GKXA 4CE8A 2R061 3R4SA 2JDZA 4MUVA 1JYIA 1JS9A 1JW6A 2HWE3 4QX0A 5DN2A 1G8WA 3RZJA 2NM1A 1DGLA 4Z2WA 4UBGA 2ADEA 4YW1A 4DPNA 4CEYB 1SBDA 5CG8A 2FDHA 3DEMA 1O4ZA 3OD0A 3SNMA 2W91A 3THDA 4AFBA 3VKNA 3C2UA 1CAVA 3ME2A 2BRTA 1H0BA 5B4XA 2JIJA 2J1EA 1BKZA 4K9SA 1Y7BA 2VMGA 2JB8A 1QJX2 3I2FA 5K0UB 1V9U1 1PO23 4LEJA 1LU1A 1S2EA 3MICA 4PBOA 2WT2A 4IEPA 2OZ6A 4B4QA 1RVF1 3F2ZA 3MIGA 4J1WA 5F1RA 1YQ8A 2RS31 1GNZA 1MS8A 1RUI3 3POYA 4HK8A 5LK5A 4ARXA 1LAJA 1G9AA 2D44A 3HOBA 1OF3A 1WLWA 4LBQD 4N53B 4BDVB 3IBMA 4RN5A 1W0OA 4LOSA 3MZHA 2QQVA 1J1LA 1Q8QA 4NPRA 1BHGA 1QOOA 1RITA 3WG3A 1W2OA 5DG1A 5FY8A 4IE4A 2X10A 2WZPP 3ZYPA 1RUJ2 4Q2FA 1ZNPA 4E4DX 1W6OB 2BNNA 4BHPA 4WM8A 2E7QA 5A80A 1CX4A 4MOAA 2WQZC 3C7EA 3Q9OA 3WF2A 4XQDA 2R072 3J4UH 4Q4X1 1Z7S3 4EWDA 3ZN6B 2PQSA 1F15A 1CZSA 3NV2A 3GGLA 1A6CA 3QACA 1VBC2 4UFMA 2UY8A 5D8AB 4RR3A 3HNYM 4BOWA 2HEYF 3TBDA 2VVDA 2RMU3 4OHYA 4Y3OA 4CDQC 5K4LA 1J58A 2E33A 3WNMA 4PLOA 3VDDC 3RZMA 5FZ1A 2H6BA 4B4PA 2JB4A 5FZ4A 3VBUB 3ZFGB 1YRZA 5JPNB 3M4FA 3I2OA 1BMV2 5FZGA 2CAUA 3ES4A 4QPIB 4YM1A 1DYPA 2XG3A 3OPZA 1GLHA 4XDPA 4QHOA 4BXFA 1YUDA 2YU1A 5FZ6A 4QPWA 5FZOA 5BNOA 1R093 5FYSA 4Q0PA 2R1DA 3VDCA 4AW7A 1QJU1 3KSCA 4LUMA 3DN7A 5I0TA 3D3AA 1CWPA 4COUA 4PDWB 1NXD1 3USUA 1IS5A 2VR4A 4WVMB 4Q8LA 3SXWA 2EXHA 4TTGA 2Z4FA 2LM3A 2VBDA 4CXXA 4FP3A 4HG6B 1Y9QA 3ZDVA 4QB6A 1J1TA 5J3UA 4NWWA 2B8MA 2JE8A 2X29A 4AHXA 5IAVA 4O9EA 1WBFA 4CDUA 4FAGA 5LA0A 1X36A 1QJX1 3C8XA 1CD3G 4HZFA 3WCRA 3KHBA 5FY9A 1MQTC 4NAOA 1N1SA 4WV8A 2ZGPA 2B42B 4K8FA 4LKDA 2R6QA 3MHZA 2V4AA 1YO8A 3MW2A 2VCBA 1LECA 4JTOA 3SCFA 1W6QA 1PGSA 2A5ZA 3MF6A 3N7MA 1PIV3 2VQAA 1V6OA 3IZOA 2RS13 1F31A 2Y8KA 2ZHMA 4CCMA 3LAGA 3VKOA 4B1LA 4BPZA 3SEEA 5F5CA 3TN93 1OLMA 5DPNA 1Q8PA 2WL1A 2XKPA 1Q8SA 3S0MA 4LT5A 2PFWA 4BQ4A 1PZ7A 2GMEA 2WWSA 4ZZ8A 2WN2A 4XOGA 3AKSA 4AR2A 3VD9A 3AVRA 1ULOA 2Q0AA 4RHV3 3WW2A 4IEUA 5FR3A 5DAWA 4NR1A 2HYXA 2KR2A 2YV8A 2R043 2JDPA 2R071 3GBFA 3MPBA 4MYEA 3WZ1A 3CIHA 3DL3A 1C3HA 5AC92 2Q5TA 1ZBA3 1KITA 2WO7A 4A6SA 4F7ZA 5F2SA 2BFUS 2ZMKA 2PLV2 2R30A 4Q5OA 5FWEA 3WDUA 3KCCA 3CU7A 5KXDA 2ZS6B 4B3NA 3NKTA 5LA2A 1W8NA 2WZR3 3KGLA 4E8CA 1H2LA 1AYM1 1RJ7A 1PGL1 2J1SA 1RYYA 2YGMA 4ET7A 4OI0A 3A23A 4GWIA 3OBRA 2XJVA 5C3PA 2P3YA 4XFCA 3LA2A 2EIGA 4JGYA 4OUMA 1YCIA 4LXLA 4XIKA 1QF3A 2CHHA 1V6NA 5FYHA 5JXHA 1R1ZA 5IUQA 4XCAA 4BK5A 4DQAA 1U5YA 3ACFA 4I2OA 2YROA 5K8SA 5F5AA 2OIIA 2G19A 3ACHA 2QFEA 5IK7A 1LOBA 3B69A 3JBG1 2Q30A 1LKNA 3QOPA 3TNQA 3B93A 4CU7A 1CAUA 2ERFA 3T30A 3DECA 5CB7A 1ASJ2 4FFFA 1RUF3 2HEWF 2PHLA 1O3QA 2QZ3A 5DABA 1AX0A 4DNYA 1OOPA 1RL3A 4QKNA 2RR13 2RS53 3SH3A 2YC0A 1BBT3 1UCXA 1TMF2 1GZ9A 1V6KA 1XB9A 5FYVA 4R8HA 5JMCA 1UMZA 5I0UA 2Q8DA 4DXSA 2R0HA 4L9BA 1UW8A 2D3PA 2ILMA 1HKDA 3I2GA 2QQPA 2E26A 3AL5A 4QGLA 2BOJA 1HV0A 3RWNA 1SLCA 4Y1VA 1F8VA 3MLKA 5FQ0B 2ZGTA 2VOVA 4FBFA 1AR62 3W20A 1ZBE3 1QXJA 1QDCA 3IPVA 5FLJA 4HVQA 4NPMA 4NPLA 1PNFA 4QU1A 1ND3B 1HXS3 5D1IA 3MIHA 4NO4A 4RQPC 3ZYFA 4AFDA 1LOFC 5EFUA 4YGEA 1ND2C 1DLCA 2VZ3A 1R1A2 1YIPA 2P1BA 5AC91 2X5IC 3RGBA 3LB9A 3CBNA 3PIGA 1DCSA 5JDBA 2DFCA 1E5HA 2JDUA 4YW2A 4AWDA 4EYUA 3PUQA 2PLV1 1ULCA 3PMSA 1DLLA 1H2KA 2BEOA 3ACGA 2E53A 2YFZA 2CWMA 4CCLA 4DO0A 1NG0A 4ORFA 5JMOA 3A4UA 3K4AA 1XOYA 4Q0SA 3EQEA 3IM0A 1W39A 1UY1A 5F5IA 4CPBA 4RS5A 4R4XA 1C1FA 5FZFA 4KWKA 3MFCA 2IVJA 4DRRA 1H2NA 3VDDA 1NLRA 2VMDA 2XVLA 4BWOA 1JYXA 4GALA 4A3XA 1WW4A 1C8NA 2ZHNA 4Q4W2 4A3ZA 4DMIA 5H9SA 1O4YA 1YXWA 3W21A 3JB8A 4L0PA 2WNUC 4OYUA 4XURA 1OQ1A 1Z78A 5BXXA 4MH0E 3WNLA 1PGW1 1RHI3 4PQQA 1GWMA 1EP0A 2Z42A 4BQ3A 4MHRA 5LCWL 2C0ZA 4JQRA 2ZA9A 2C6SA 1SFNA 3N9OA 2YG0A 4CP9A 4Y1ZA 2LALA 2AENA 3E5QA 4GQ7A 4KU8A 2OQ7A 2RV9A 4IEXA 1HRI1 1FX5A 1CZTA 5JPMB 3UGGA 1PK6B 2CL2A 3MGUA 4K7JA 1ASJ1 2QQWA 1SFYA 1CR7A 1W2NA 2OQ6A 5J98B 1YQ2A 1WLCA 1C1LA 2OPKA 1MZFA 4MGYE 2TEPA 4INDA 3PVNA 4E4HA 3N7LA 2J1RA 4N90A 3AX4A 5LBEA 3V0BA 5A7WA 1PO12 2DU0A 4LE4A 4NJ4A 2EAAA 2WS92 2WC2A 4FXGB 3WSOA 1TMF1 4QAWA 2XLGA 3X29B 1DU3D 1O3RA 2EIBA 1HIXA 3TYJA 4M4RA 4BIOA 3AMHA 3I54A 1YJKA 4K3UA 3PJYA 2C24A 5J36A 4PHZA 2HWD2 4UF0B 4C91A 5JZGB 5LA1A 1FMD1 2P4EA 2DVFA 3V0BB 1U0AA 2WNVA 1W8FA 3AZXA 4BLJA 4W6WA 5C8CA 2VVEA 2VW2A 1AR61 2ORZA 4HT1T 2H6CA 3LSDA 3N3HA 4PQ9A 3LGRA 4OQ8A 5A7SA 1S1AA 5JVVA 2ZGKA 2FDJA 5FY0A 3B00A 3IN9A 2OKXA 4ZS2A 1JYCA 1NYWA 1YFUA 1R1A1 3I2HA 4NHLA 4UFJA 5AFEA 3ZSEA 1IOAA 2PHFA 1DQ2A 2KD7A 4OZXA 2X5IB 4V1PA 3VBFC 1H1MA 2DUQA 4L2NA 3KT4A 2A73B 2HJIA 5FZ8A 4A7KA 1BEV2 1AR73 3V65A 2DURA 1QOSA 4K20A 3KV5A 2G9FA 2XHKA 3UGFA 2PAKA 2VZOA 4AFAA 4EZHA 3ATGA 5SV5A 3K46A 1DP0A 3WDTA 3I3BA 4JHTA 3S7EA 5DZEA 4NOTA 2J1AA 3ZSKA 1KS5A 1I3HA 5ACA3 4W50A 5FDBA 4Q4W1 1NOVA 1K12A 3UV9A 1NE4A 1GYKA 4GH4A 5A70A 3MIFA 1CN1A 4IV1C 1ZRDA 1ODNA 1SPPA 4BA6A 1SFPA 4XYXA 2ZBJA 3O1VA 2FDGA 4D6SA 1OQDA 3NSTA 5F39A 4AEMA 2GC2A 5FP8A 3FFZA 4LO4B 1EPZA 5IK5A 4HOOA 2WSUA 4XFHA 4LBOA 1E5SA 1VBE2 4K40A 2YHJA 3RQ0A 1HQLA 5B4NA 3M8LA 3EBRA 5L73A 4ATEA 5FO9B 3MUY1 1S2KA 3ZYBA 2WN3A 5A6XA 3HN3A 2B5HA 3C7OA 4LIUA 3TAYA 1VBB3 3I97A 4XMAA 4LO8A 1VBA3 1PO11 3ZSMA 2WS91 1BK1A 5FYCA 2Q8CA 2TNFA 5FK7A 5TSWA 3ZFEC 4E27A 4AVVA 5EP9A 4D7TA 1OF4A 4IV3C 4XXPA 5ANQA 4EN0A 1YNAA 2VZ1A 3NAPA 2NMNA 2XJPA 3H7JA 2I74A 2WYFA 2HWD1 5FZEA 1O3SA 4NE9A 4QQ2A 5HXMA 2FCUA 3AKPA 4OMCA 4BQXA 1XNKA 1JU3A 2RHPA 4W8JA 1PNGA 4D6QA 1JYTA 2AGSA 5FIXA 1DF0A 2WFF2 4I02A 4FFHA 4D94A 2QJVA 4XZUG 5A3MA 5DUWA 3LZZA 3RZHA 3T08A 4IERA 4YZ3A 4ES8A 1MACA 1WA6X 2IC1A 4QDSA 4ZHNA 3RG0A 3ZXDA 4AXOA 1RUG3 2VZVA 4YRDA 3E6DA 5F32A 2GU9A 2O0OA 5CG9A 3R4DB 3KT7A 1AL23 3AL6A 4JX0A 1JZ3A 4FO9A 3SKJE 4LITA 3C7GA 2FBEA 2ZTNA 3CDZB 4AQTA 2IXCA 1SLIA 3VBRC 2UYAA 4QQHA 5H9QA 5G04L 3ILNA 4FPFA 1BEV1 4GZ9A 1ZZBA 1KDKA 2D5HA 4LNVA 3VBSC 5FOJB 4FFIA 4AG4A 1YHFA 1XXNA 4ZPIA 2FQPA 4K6BA 4HLTA 3OOXA 2VPVA 1VP6A 5EYXA 4QXHA 5FY4A 1RUD1 4NHYA 4KU7A 3NNGA 3TEYA 3I2JA 5EJZB 2V09A 1HB1A 5C3RA 3FHQA 3J8F3 1WCKA 3D0JA 4MZUA 3HT2A 4K21A 1NA1B 2WNUA 4OZOA 3VZOA 3POEA 2R32A 4YSFA 3RWKX 4M0HA 1CJDA 2R7EB 3ZPOA 3OGVA 1F5JA 1HRV2 2IZWA 3N7KA 1JYVA 3NMBA 4Q0UA 1QOTA 3ORJA 1VBE1 4I0BA 1LGBA 5C9AC 5DDJ2 4ZXKA 2VU9A 1X9PA 1N3OA 4YVWB 1OFNA 2O14A 5FP7A 1JXNA 4Q4V2 3VHOA 2BPA2 2BU9A 5IVCA 3JD73 2YC2A 3B3QE 4CYDA 5A3PA 4KMQA 2OYZA 2JD4A 1CAWB 2VECA 1C5IA 2XJSA 3ZFEB 5HCHA 1XQNA 3J7HA 3PVOA 4JC1A 1STMA 2ZPXA 4IV3B 3O1OA 2XH6A 4JGZA 3WNOA 4CDXA 2D6MA 5FY1A 2XUEA 3MW3A 5FLHA 1US3A 3QH7A 3A7QA 1JH5A 1ZRIA 2DWRA 4QDQA 3U78A 1CONA 1N1YA 1PZ8A 2W94A 1W99A 2WFF1 3AYDA 2WSVA 3AMPA 4WM7A 1GZTA 1EYBA 1WKYA 2CDOA 3OYWA 1G7YA 4FT8A 2B9UA 2WINB 4BZ4A 1FXZA 5ABJB 5LY1A 1UMIA 3AFGA 4M3CB 4CCCA 1F9KA 3ZMOA 5DZFA 1IQDC 5C5TA 4XFGA 4IEQA 4MGZE 4OI1A 2EAKA 4KH9A 1NCRC 1WD3A 5IHRA 4AYUA 2VXJA 4ATFA 1ZREA 1X7NA 3CLPA 3VV1A 3RZGA 2D3SA 3EXUA 1SDDB 5IAXA 1LTEA 1C8M3 1PIV2 4FQZA 4YW4A 3VBFA 1RXGA 4C1XA 5CFDC 4XFFA 3BCWA 2C5DA 3VBSB 1NLSA 4ZKTB 4FOYA 4WBBA 5FUPA 4XBQA 4XACA 1NCQC 1DZQA 2PN5A 1CAXB 2ZX2A 4CEWC 4RGKA 1UL9A 4GWJA 5FK8A 4IEVA 3I2DA 1BLZA 2PYTA 2YXSA 4Y33A 4YVSC 2DVGA 4RHV2 1UOFA 1VAKA 4D7YA 1HN0A 4A4AA 1JOJA 3BIWE 3D82A 5I91A 1D2SA 2D6PA 1OC1A 5IW0A 1LULA 3WW3A 1QWRA 3RJ2X 4CEYC 4IV1A 2BUKA 4C1WA 3BOWA 3BYWA 1T6BX 2Y33A 3OUIA 3QD6A 4FVVA 4R4ZA 4YG3A 3U37A 1RUE3 5FZDA 2Y6LA 1UPIA 1HRV1 4OCTA 1QQP3 1ENXA 1SLAA 3D4KA 4Y20A 1LR5A 2VCMA 2XLFA 5DDJ1 1WMFA 3DPRA 4XJ8A 5C9AB 5K0UC 2I2SA 3UGHA 3HNMA 2YDEA 1UU5A 1YQ5A 2IUWA 2CNAA 3WNNA 1TNRA 2A70A 5FPUA 1YFWA 3N9NA 1NX9A 2A6XA 2VCCA 3E5XA 1W2UA 4Q4V1 4YZ4A 1JZ8A 1WMEA 1XC6A 2NMOA 3AYCA 3IDCB 4P00B 1W6NB 1GICA 3SQOA 2BBAA 2XBO3 4CTEA 4K1ZA 3B01A 2VZTA 4QGMA 1K45A 2DCKA 1YC61 3FL7A 4FI9A 1L7QA 2WZEA 5CKQA 3OBZA 3GZTB 3AKRA 2W2IA 2ZOEB 4LHLA 5F2WA 1JU4A 4H2AA 5ERLA 4LE3A 1FPN2 2RM23 4AGGA 1JMUB 2ARXA 2UYBA 5CKNA 5A7QA 2MPFA 4Y22A 5LBBA 2FZ1A 1Y4WA 1MEC3 1W05A 3BU0A 1X50A 2F6BA 1QNWA 1S0IA 4BIFA 3OPTA 4HL0A 3T1MA 1SZBA 5CFCA 3VBHA 2RDQA 2SLIA 3WF0A 4HKLA 1VBD2 3QH6A 3AM2A 3K4ZA 1AR82 1OUSA 1PX3A 3B94A 4NUBA 3T3YA 5CADA 1NCRB 1QU0A 4CXWA 1VAVA 5A3NA 3AZZA 1JI6A 1R083 1W8UA 3J7MA 2VW1A 3JQXA 1EV12 1N47A 3CJIB 4FFGA 3BODA 4L92A 2D6LX 4QWNA 4GB33 4XTPA 1H2MA 1FOD3 4URTA 1TEIA 5EWSA 2JENA 3ZFGC 1PMJX 3VBUC 3N7JA 1JTZX 5I93A 2VMIA 4GMP1 1UX7A 5FZIA 3NW4A 1ZYBA 2VGDA 1LODA 3RZKA 1ZBE2 4CEWB 4JTNA 4A41A 3LFMA 1DGRN 5FKCA 1CZVA 5JIAA 2GSYA 2V4VA 3I2IA 4KWLA 3I49A 3OGJA 1HLCA 3ELNA 5H9RA 4LBQB 2ZX4A 3RVHA 4PDWC 4W6XA 5FPBA 5FZ7A 1DFQA 5I8YA 4BB3A 3RFRA 1WW7A 2DUPA 2HWF3 3ZXLA 1D2QA 3H0OA 3MBWA 2B46X 4LHNA 1XNDA 3AJZA 5LATA 1YI9A 4YFZA 1MS9A 5T5PA 1W04A 1W8HA 1FT9A 5FPAA 4LKFA 2VMCA 2Z79A 4PCRA 4LHKA 1AX2A 3KQ4B 2D40A 4OHVA 4XFAA 1VMJA 4B7KA 2FZ2A 3ZFFC 4FPLA 3KD4A 3WD5A 2YU2A 2B39A 1W6PA 2DF7A 2VNVA 3KB5A 3MFAA 4O61A 3ZXGA 5FCCA 3O1PA 2VQUA 3E5UA 5EIYB 1DYOA 1UNBA 2VOKA 3UNPA 5KXCA 1FPN1 1QEXA 2A6WA 2VE1A 1RC6A 4E4ZA 5APAA 4YZ1A 5GKAC 2QBXA 4TYSA 5CVRA 4U2AA 4GULA 1ZM1A 4JHZA 4UW3A 5FBZA 1UXZA 3DGTA 3WG4A 1W9TA 3NQHA 3E97A 4P08A 1OA4A 3WT3A 5F8PA 5A6ZA 2ZGMA 2ZX1A 1BCXA 1SEFA 1XRUA 3H1YA 1VBD1 3K48A 1PVC3 1AR81 4NHXA 2NPIA 1FNYA 2E7TA 4AVBA 1KGYA 1I9RA 5C3SA 4Y4RA 2ZZJA 5JR7B 3LDKA 1XSQA 3IT8A 1QH7A 2NYYA 4G4FA 1UOBA 1XNBA 1V6LA 1EV11 3P3PA 4OMDA 4TN7A 3UT0A 2XWBB 4EV0A 2NP0A 3CMGA 1NUKA 2P6CA 1OLME 4NROA 2DVAA 3RNSA 4F83A 5JWPA 2ZGSA 4N43C 2VXRA 3BI3A 5DMYA 1HQWA 2OPWA 2W46A 3ECQA 5CFDA 1WMDA 2VO5A 4FTSA 4UWDA 2TUNA 1V70A 2F4LA 2VCAA 2ZABA 1K5MC 1NCQA 3PTRB 5FXXA 5T50A 5BNNB 3FUQA 1HB4A 4JKKA 1QJY2 4XF1A 3RPQA 5F3GA 3T0AA 3O0VA 4IEZA 2ZHLA 1F4AA 1H1AA 4QU2A 4UFLA 1JZ6A 3PVEA 1J83A 1H30A 1GBGA 1RUC2 1TME2 2VBBA 2CY6A 4HVRA 2A1XA 2JKBA 2JG9A 2QQOA 2A3XA 3VUOA 1LJ7A 4CEYA 1OMIA 1AXZA 3IAQA 1EAH3 3S5QA 1A34A 1RUH2 2XQRA 4Y26A 3I3EA 2WDBA 3G7DA 1NY72 2GC1A 5EJ1B 4DEQA 2P5BA 5FO8B 2P3KA 4FPEA 3BTAA 3PUSA 2VQ0A 3HWJA 3QLQA 3SH5A 2I07B 2UWAA 2A75A 2VUJA 3PUIA 4JV4A 4Y4YA 3DUIA 1JODA 5K0UA 5LEKA 3AP5A 4HETA 4OHZA 1UMHA 2VY0A 3ZFFB 2A71A 3OB8A 4IEWA 3ZYJB 4RD7A 1S4CA 4IESA 4DUWA 4FTEA 1H9WA 5FP4A 3VDAA 5FP3A 3VZLA 5IFPA 2WO2A 4LMFA 2FDKA 3RZZA 1OXCA 5IT6A 1H8VA 4J25A 1E5RA 4XAAA 4I0AA 4AEJA 5FYZA 3U10A 4N53A 4QQOA 1RINA 3AP6A 2OVUA 2Y26A 3B02A 3PMEA 4LTAA 4XJAA 1JN2P 1OD3A 4BQ1A 1RUJ1 2IWGB 2QNKA 3CQOA 2A6YA 3RYKA 3E6BA 2WRAA 4Q4Y3 1ND3C 4HFSA 2WO3A 3SHRA 3F95A 4MXWB 3T0DA 1IZ3A 1W6OA 1D4M2 2VZUA 1VBB2 5GJ6A 3HT1A 3LA7A 3WHUA 4AVAA 3B5LB 1N1VA 4C0HA 1VBC1 4GA9A 4RGGA 2LW8A 2GNDA 3ZN6A 4NRMA 3UL2A 2E32A 3PL0A 3IPVB 1LOGA 5LWBA 2QKDA 3B7MA 5D8AA 1US2A 4AI0A 3CL1A 4QGNA 1AF9A 1AZDA 1COV3 4P9JA 4QKBA 3T2OA 4KL1A 2K9ZA 3L2YA 4NVPA 4YW7A 1ULFA 2BJSA 1U12A 4N43B 4XUOA 1G9DA 1UY3A 3L2HA 1XE0A 5FJKA 2VNRA 5FUNA 3WF4A 2R063 2XR4A 1EPWA 3KV6A 1GZCA 2V5YA 3FN9A 4IGOA 4NRPA 1BVP1 3HIFA 1BMV1 1Q56A 2W92A 4XBNA 2D3RA 5JXJA 3MV01 1K5MB 2WAOA 1QXRA 3WLUA 1C28A 3PNAA 2QQMA 1QJY1 4QPIA 2J7MA 4CCDA 5F37A 3BUCA 1B35B 2QZ2A 1CPMA 1RUC1 1TME1 1W90A 4L99A 4O7XA 1BQPA 3FLRA 2JWPA 5FPZA 4RS5B 4PDWA 1X9TA 1UYYA 4XJ9A 2N7GA 4Z07A 1XU2A 3I59B 4ASKA 1V9U3 1AJKA 1PK6C 1QIQA 4QPGC 3VD4A 5JR2A 1L7LA 1RUH1 1MZ5A 3NNFA 1W2AX 1NY71 1RVF3 1SBEA 1UKRA 2RS33 3D6EA 3ES1A 1VPHA 3M3CA 3MV11 4ASLA 2AZ5A 1UYXA 4PF5A 1R64A 3U07A 1A8DA 2JECA 3OEBA 2KM2A 3KCXA 4DFSA 4UBHA 1JZ2A 2BGPA 2RVAA 5A32A 2OUHA 2VMHA 4QB1A 5KWRA 3KCYA 3VGIA 2LROA 2L9LA 2JG8C 4EN6B 4YWAA 4I3PA 5AVAA 1RUNA 4AI1A 3R0RA 2OT7A 2OA2A 2EALA 3LF7A 5JZGC 4LLFA 1WCUA 4NHKA 1AR92 3NKGA 2W87A 2WAAA 3FX3A 5GLUA 1FAYA 2WQ8A 4CPBD 3AMQA 3U4XA 3WF1A 4CCOA 4GMP0 4Q4X3 5FYTA 3CEWA 3KHCA 2E7AA 1OPOA 2ATFA 4LR4A 2DFBA 4QX5A 3ZIXA 5FXWA 5BUVA 3POGA 4S2FA 1D4M1 3NNJA 3QCWA 4B4RA 5C70A 2WUHA 3DF0A 1SQ4A 5KHHA 4M01A 2JE7A 3LA3A 5FTTC 3TNPB 3WVJA 2D43A 1HJFA 2CYFA 4K8RB 1OBNA 1RMU2 5GM0A 1RGSA 2WNVB 1SHWB 2YGLA 4RL7A 5LY2A 1WW5A 5C8CB 2A3YA 2XVGA 4V2WA 5B2GB 5L9RA 1NLQA 1VMHA 2HWB2 2MEV2 2ZCWA 1W0PA 2SBAA 3WCSA 2VNGA 5BV6A 1TZOA 2E63A 1G86A 5L7OB 1MPXA 2JDKA 4I0WB 2Q4SA 5F5QA 4CDQA 2YYOA 5E16A 2BVVA 4FPOB 4XVHA 1QJU3 3BTXA 3GF6A 4TXWA 2DV9A 4BMBA 2DYCA 3E1F1 5GZFA 4EZ4A 3HVDA 4FOQA 4P9YA 4Q1RA 3T0BA 3LPGA 3T09A 1EY2A 1LB2A 4IL7A 1HX6A 4ZU4A 1H4GA 5FYUA 1KQRA 4HONA 1CGPA 4LQRA 2GMPA 5KXBA 1DGWX 2RDRA 1XSRA 5KHGA 2JDNA 1UAIA 3APBA 3R6SA 3N35A 3UJQA 5ISLA 2ENRA 5FXZA 5GLVA 5HXVA 2VH9A 2C26A 2YZ4A 2ADDA 2PA7A 3N9MA 4MADA 5FPXA 5FLIA 1QJX3 1KEXA 3SEPA 1JYWA 1H6XA 4KG0A 4XUQA 5J96B 2BGCA 4ZY9A 1ZX5A 3KT1A 4CZSA 4QPGB 1WZXA 2BZDA 1AYN2 1KFXL 3JUUA 1BYHA 3VDBA 4BJ0A 1GQGA 4GH4B 1SCSA 4A45A 1O7FA 5A6QA 5CKMA 4HK9A 3FZ3A 2ZEZA 4IXLA 5C4WC 1WCSA 2DCJA 4R9DA 3NJXA 3NVCA 4CCNA 2AEZA 1D4VB 1O59A 3GBGA 1DIWA 2EXJA 1MQTA 1JZ4A 5F9TA 1XNAA 1YLLA 2D98A 3NO8A 4YNIA 3ZDSA 5C7GA 1AX1A 3ETQA 4L11A 2X09A 4KBZA 2Y60A 2JG8B 4CDWC 1IKPA 5A1LA 1GP4A 1JUHA 2VG9A 1U5ZA 4DRVA 1U5XA 1LNSA 1AR91 4N8MA 1QXPA 3AMNA 1HN1A 3O12A 2LS6A 1RUE2 2J1UA 5I8SA 2LTNA 1LHOA 5FV3A 3ZVXA 4E8DA 3BTYA 1S55A 3O5SA 2R073 5DXDA 1JUIA 2HWC2 5IWFA 5FQ0A 5IK8A 2XLAA 3NV3A 4S2DA 4MGTA 1GV9A 1KRIA 1UU4A 5FAXA 3V0AB 4YG6A 4A2UA 3D5OA 5A33B 3LQCA 2UURA 4QX3A 4LBLA 1J59A 5T5OA 5LBFA 3H8OA 4HBNA 3BGAA 3J26N 5JAXA 1IG0A 4EN7B 2HEVF 1OQEA 1GOGA 3HQUA 1RMU1 2JIGA 2Q1FA 4PLNA 3H3LA 2WT1A 1IG3A 4YM0A 3Q8AA 4S2HA 5GZDA 4COWA 2W52A 4SLIA 5A3LA 1AYM3 2ZKNA 3FJSA 4QX8A 1PZ9A 2J22A 3MO4A 2HWB1 2MEV1 1OLQA 1S0DA 2YBSA 3MYXA 4AHZA 2C9AA 3WP3A 3T1LA 2RM22 2W1QA 4B7EA 4CSWA 4XHBA 2WQ4A 2FMDA 3MIEA 5FP9A 4M00A 1WCDJ 1DG6A 5BNPC 2BGOA 3BPZA 4BU2A 4Y1UA 1MZ6A 1UZ0A 3TRSB 2Q1MA 2VUDA 5DUVA 1NXMA 1UZYA 3LIGA 4AEDC 3ETPA 4AVSA 1UWWA 3MI8A 4BE3A 1NA1C 3JBG3 5IYYA 3CZJA 2XPJA 3OBTA 3POFA 2F17A 4XTMA 3O1MA 3E6CC 1NAEA 3O0WA 2Z2SB 2GDFA 2Q8OA 4HPKB 2XKOA 2CAVA 2OZJA 5FMBA 2GAUA 2B45X 3GZAA 4DS0A 1VRH2 3WV6A 3LIHA 3BALA 1V6JA 4OUEA 4UFIA 5JSRA 4XHXA 1QH6A 1AYN1 2ZZQA 2W1SA 1WUVA 3OY8B 2UU8A 1GKBA 2Z5WA 1PK6A 5FYYA 4HN1A 4GAZA 4UAPA 4UYBA 3THCA 3WDXA 5F7UA 3HR9A 1Q8VA 1SLBA 2FCTA 2JEMA 3H42B 4YVWC 5FUIA 4E4SA 5C4WB 2ET1A 2PAEA 2VMEA 3ASIA 3OF1A 4XUPA 4KGGA 1YIFA 1UN1A 5KR7A 4ZU5A 4OUSA 3UK9A 2FDFA 4TSVA 3PHMA 2NZ9A 1RXFA 2FCVA 2XXZA 1KJLA 1K5JA 3W5MA 4AI8A 3HQRA 4DXTA 1HB3A 2IXJA 3HMYA 2HWE2 4PBPA 4CDWB 2IXLA 1G9FA 1Q3EA 1I5PA 2VZRA 1DBNA 2XJTA 1H8TC 3H50A 4QXCA 4EWAA 1WBLA 2YBKA 3O1TA 2GP5A 4UF0A 5JZGA 5HPOA 3UJOA 4A44A 1RUOA 2BNMA 2HWC1 1OI6A 4C0BA 3KV9A 5AC93 4CCKA 5ABJC 2WWJA 4KWUA 5JI9A 4XF4A 1DQ4A 1SBFA 1TQ5A 1ZA7A 3EB7A 3U0ZA 4JGZB 1PO22 4CDXB 4F8AA 2PLV3 4ZS3A 2VM9A 4BXSV 3VD7A 4RQPA 2W95A 2VQTA 1LOFA 4Q1PA 5F6LB 1ND2A 4OI2A 1UQXA 4FPYA 1MZEA 1Z0HA 2X5IA 3UKTA 1RUI2 2ZGRA 4DUVA 2EXIA 3I3QA 1GFF2 3DCQA 4IE6A 3FBYA 4EJRA 5DAPA 1OVSA 4OULA 4D6RA 2PMWB 4FCAA 3AC0A 1UD1A 2AREA 2XHNA 4IUGA 1DZRA 1V6IA 2FD8A 3WQBA 1JZ7A 5BNPB 5LEJA 3VZJA 3NJYA 1NT0A 2WABA 1I6XA 1WW6A 1W9WA 4AEDB 2D7FA 2GNBA 4QXKA 3VB9A 3JQWA 1Z7S2 2BWAA 1HRI3 2GC3A 1LU2A 5KC5A 1H6YA 4BMEA 2WJSA 3OEAA 2FDIA 1T6GC 1W8WA 2GN3A 1F2NA 1KS4A 1LOEA 1ASJ3 2QQKA 1OKQA 3ABZA 3SC7X 4CUGA 3KF5A 1W6MB 2ETEA 1A8MA 3EYPA 3WEZA 1VRH1 1GP5A 4BCUA 4MG2A 4DZGA 1H4HA 4YGBA 2RMU2 1POV1 3AVSA 5F6KA 2DCZA 3ZYHA 2PTMA 1S0EA 3OSDA 2FHRA 4FPJA 4EN9B 2ZMNA 3AK0A 4MVTA 1TMF3 2DCYA 3ZOIA 1PMIA 4XZPA 4L97A 5I0DA 1ENSA 1WLTA 3AKTA 3WQ7A 1GZWA 3INAA 3AP7A 2O1QA 4XF9A 2JDMA 1QKQA 2XONA 4P14A 3S6PA 3TEZA 2J1VA 4GWMA 5KBFA 1FMD3 1R092 1I5ZA 2PQQA 4MXVA 1VB4A 4AE2A 1AR63 2HWE1 3VL8A 3K75B 4UFKA 4LO7A 1AUYA 4J6GA 3RDIA 4A42A 1ULDA 1H8TB 5J1XA 5HBAA 4UI9L 4QDRA 1SMVA 1LHVA 1HV1A 4R9BA 2CGOA 1AHSA 1R1A3 5JXGA 2WKKA 5JUVA 4DY5A 2A6ZA 3BTZA 5FZLA 2K0GA 3GNEA 4ARYA 1ACCA 4DEVA 4LO5B 5T5JA 3DXTA 1ZZ9A 4GJYA 1PO21 1ZRRA 2XMLA 2XL9A 1Y43B 1AVBA 3ST7A 3DV8A 1FATA 4XIOA 5CU1A 1FNZA 3LKJA 2ZAAA 2AH2A 3LWCA 4H14A 4BQ5A 2JICA 4ZZ5A 1RUI1 4CUCA 1GUIA 3CJIC 1E5IA 4XJUA 2RDNA 2C9KA 2DBIA 2RS12 4FPGA 2IXHA 4HVOA 3POIA 2VD7A 4LA2A 5FO7B 3DKWA 4BQ2A 3LOBA 4Q0QA 2PHRA 1UF2C 2WIIB 3TN92 4Q4W3 3D0SA 2W68A 2YPDA 2VTFA 2ZGNA 5IVJA 1M06G 3PURA 2JKXA 3ON7A 2QUOA 5LASA 3V56A 5K7PA 3CJXA 4XCBA 4Q4Y2 4LBNA 4LIVA 5IVYA 1CVNA 4Y1XA 3SMHA 3L9JT 3GALA 4DUXA 4CCJA 2OS2A 2ZJCA 2W47A 4I30A 3CF6E 4KWJA 4RSUA 2MHFA 2R042 5LRRA 4COZA 1REDA 4E9KA 1Z7S1 1IS3A 3VBOB 2WYSA 2QQJA 5J7MA 1ZBA2 4I09A 3NL1A 3LDRA 1WCQA 3MUZ1 2ZHKA 1APNA 1MS4A 3SLIA 2RMU1 1ZZCA 1O8PA 1VRBA 5BNOC 1O5LA 1PO13 2BP6A 4LKSA 3D8CA 1GOHA 2WS93 2WZR2 4GXLA 1GMMA 2UWCA 1LENA 3FE5A 2V72A 4XF3A 3GM8A 2WNEA 4ISQA 2ORXA 1D0HA 3AZWA 4HSJA 3WDWA 4HKWA 3I3MA 2HWD3 2D6NA 3MLLA 1L3JA 5FMOL 3S30A 1DQ1A 1SCRA 4LUKA 3NJZA 1R091 4P02B 4NWVA 3EHKA 5CA6A 1CAVB 2XVKA 5CFCC 1K3IA 1OD5A 4CDUC 5JXIA 5DAXA 3P1IA 5KHKA 1QJFA 2BQPA 3ZFEA 4NIAA 4AHWA 4TLGA 4CCEA 4IV3A 5LB6A 5J48A 5FPLA 4AOCA 5GZCA 3OD4A 2ZGLA 3B9CA 4DXZA 3B9IA 3GYDA 1ENQA 3WINE 2P17A 2XWJB 2VUCA 3IWZA 3Q8BA 3KVBA 4HN0A 5FKBA 4CP0A 2DDUA 1RUF2 1J3PA 4OVEA 3WXPA 2P37A 3N9LA 4QXBA 5FZHA 4CU9A 5KHIA 2W9XA 5EXOA 1O3TA 1W6PB 3O1UA 5GZEA 3BIEA 4RYDA 1BEV3 2RR12 2RS52 1GQHA 3AP4A 3WG2A 3WP6A 2HYKA 1WMXA 5GZGA 1REFA 3UETA 1BBT2 2WA4A 2VOTA 1IQAA 4AI3A 4Z2AA 4WZCA 1PIV1 3TB0A 1RUD3 2RS11 3J7NA 4P9GA 3H1WA 1LESA 4JZRA 3HN1A 3RYRA 3VBRA 4YM3A 2A3WA 4WM8B 3TN91 3MIBA 3S57A 2P3JA 1HW5A 2RJKA 3JU9A 3VBSA 5EJ3A 2Z69A 3OPWA 2Y6JA 2YUEA 5E89A 4Q4X2 5BNNC 4CA9A 4MSVA 1F5FA 1CAXA 3KLSA 4RR3B 1M4WA 2VL4A 1HXS2 4G3YC 4RHV1 4YW5A 3WY6A 1IHMA 2GC0A 1ZA4A 4H3WA 4DB5A 2QE3A 2ES3A 1GANA 4QPYA 2R041 2D6OX 3ALQA 5A6YA 2OUJA 2ZGOA 3I3DA 4YLZA 1GWKA 1VBE3 1SG3A 2VW0A 3HNBM 1ZBA1 5LW9A 4N7UA 2HBUA 4Q27A 1FI2A 2AACA 3OUJA 4LK6A 4BISA 1W0NA 4W65A 2VNOA 3M7AA 3OGGA 1DDLA 1AXKA 2YC4A 5FZOB 5BNOB 1RB8G 2CGPA 2WZR1 2ZEWA 2G4IA 2GNMA 3WUCA 1D7PM 3AFKA 3PU8A 5C9AA 1MS1A 1QJU2 3NRUA 3USUB 4AHYA 1LEMA 3JZVA 4IEYA 1UYPA 2JG9B 4B8EA 3RZLA 1PM7A 3GBWA 2XJQA 1W6NA 3AKQA 2XJRA 1OT5A 4U36A 1W9SA 1RHI2 2WFF3 1Y9GA 3T4VA 3WUDA 3LD8A 4CDUB 1ULPA 3ZPYA 4FOWA 1QDOA 1X8EA 1OOPC 4COVA 4AFCA 2PHTA 3VHRA 4CUBA 3Q8FA 5M0TA 1N3QA 4J1XA 4AQ2A 1RJ8A 5FZ9A 4AAPA 4AEKA 3KM5A 4Y5TA 2QQLA 4XFIA 1CESA 2BVBA 4XF0A 1W6QB 2CWSA 1RUF1 1UIJA 5EZWA 3TOJA 2XGXA 3N9PA 3ZSJA 1O6UA 3W9AA 1VIWB 3T2TA 4FP2A 2ID4A 2RR11 2RS51 2WLQA 1YFYA 1GNHA 1QMJA 4MGSA 4P9XA 1BBT1 5CEHA 4A7YA 3WNKA 4KQ7A 1NCRA 1W9YA 3IKWA 1S2BA 4GJZA 3DKQA 3GXUA 3Q8EA 4LA3A 1B09A 1UZWA 3CJIA 1POV0 2I45A 1GSLA 4PT6A 3ZXAC 1EUUA 2WZ8A 4XBLA 1C57A 1O4TA 2KA3A 4NMIA 1ZBE1 5A3TA 5C6CA 3O1SA 5A7NA 2BNOA 1HXS1 4CEWA 2W1WA 4CU6A 5FWJA 3POBA 3LFIA 2NN8A 4AF9A 2CTVA 2E51A 4YVSA 1HRV3 5JSPA 3UKVA 1B35C 4FSJA 3P5BA 1LHNA 3FLTA 1FYUA 2ZEYA 4LBQA 4LKEA 4RS5C 2KXLA 3AZVA 1YFXA 2BTVC 2IVIB 3J7LA 4K1YA 5DDJ3 5G05L 2B4KA 5GLWA 1AYM2 2DVDA 1PGL2 4QX2A 1AR72 4EWEA 1AXYA 5IVBA 3IB3A 3CKHA 3R4UA 5EQUA 2AUYA 4Q4V3 1O5UA 4JGYB 2JX9A 4PIZA 4QM9A 2RG4A 3K3NA 3ZIWA 3ZM8A 4AGVA 3GZEA 4COYA 1G9CA 2Y6GA 4QKFA 4QKDA 5C71A 1NQDA 1N1TA 2E9QA 3SISA 1ALYA 5BPXA 4UFHA 1S0GA 1DYKA 3GCXA 3W58A 3TWIA 4NIIA 4Z8BA 4YFWA 5ACA2 2VOWA 1U5IA 1NKGA 4QT6A 2Y6HA 3ZXEA 4WZFA 3BN6A 4FTBA 1NZIA 2JDHA 2CV6A 2XJUA 1JZ5A 1MVEA 4XAEA 1CAUB 5C3OA 2NQYA 4UOJA 1UY0A 4YG0A 3JBG2 5EHDA 1RHI1 1ZVFA 3ZXKA 3WDYA 5JLVA 1W3VA 3ZSLA 1F35A 1YEWA 5DUUA 1S0FA 4QHBA 1CJPA 1GNYA 1OOPB 1JOBA 1TNFA 1TG7A 3A0KA 3I4IA 4NHMA 3WHTA 2VTXA 2XL7A 3AJYA 3GJAA 4XPVA 1OFSA 5A32B 4JAAA 1BVVA 5BY5A 3VKLA 1DGWA 3KVAA 3H8UA 1IS4A 1W28A 2BDRA 1VBA2 4H7LA 3S7IA 2WNVC 5E6HA 5IFTA 5JCTA 5C8CC 1V00A 1DQ0A 3A22A 3NV4A 3TEWA 4D3WA 2QDNA 4GMP3 4PJYA 2ZGUA 4V2VA 3I7DA 1Y3TA 2R49A 5L7OC 5JI7A 2IFRA 4QB2A 5LRSA 1VB2A 1W2TA 1YJLA 3SITA 1LOAA 4IGQA 4PIXA 2O8OA 5F3CA 4XQWA 4JKMA 5FBJA 3FWEA 4JDOA 4FAHA 2XDVA 3ZFGA 3VBUA 2H0BA 3M2MA 1AL0G 1W8ZA 3KQRA 3LEGA 5CIRA 3O14A 4QMAA 1YQ6A 4QM8A 1OLRA 3ENRA 4XJZA 5GLZA 1UZVA 1ODMA 1RTVA 3PTYA 5BNNA 1RUG2 4BQYA 4R52A 1AL22 2YB7A 3IAPA 3USSA 1DHKB 2K2SA 5T3NA 3POSA 5HI0A 1OUXA 3DYPA 4X8NA 4CDQB 3OTFA 1G6NA 5DG2A 2EIEA 2K46A 3ZN5A 4WVMA 3VDDB 4BK4A 4NN0A 1AR71 3ZLIA 1QGLA 4ES9A 4JVAA 4GH4C 4FOVA 1UOGA 2QVSB 3KF3A 4X8PA 4XMIA 4YZ2A 1H9PA 5GALA 4LHSA 3OUHA 4Q0VA 5SV8A 3ZXJA 3OGSA 1BXHA 4TLFA 2EVXA 1UYZA 5H9PA 3PJQA 2JDYA 4IE0A 2QCSB 4MX3A 5DAQA 1J3RA 3KWVA 4HANA 1PGW2 1EUTA 5ACA1 4CP9B 1LHWA 3IMMA 4META 3AP9A 3FLPA 3J8F2 3VLBB 3IIIA 1FPN3 3O0XA 3ZFFA 2H0VA 1A78A 3HD8B 3OBAA 1G9BA 4YPJA 2BW8A 4OLLA 1HRI2 4LO6B 3K77A 4P5YA 4QQLA 3RSJA 3I8TA 4C90A 5A1FA 1D0GA 4LORA 5L9BA 5A3WA 2ZACA 1PM4A 4Z82A 5DAVA 2QQUA 3FHIB 5A7WB 1DZTA 2HH9A 3M3EA 1VBD3
chains in the Genus database with same CATH topology
4LK7A 4LKFA 2LRPA 3F95A 4LKDA 2KR2A 3ZYFA 1W8TA 2O14A 1W8ZA 1UOJA 1HN0A 1W9FA 4AL9A 4CP9B 1GWMA 2VXJA 1WMXA 2Q1FA 4LJHA 4A6SA 4BQ3A 2LROA 4YWAA 1GWKA 1W90A 2C24A 1W8WA 1W8UA 2WYFA 4BQ5A 4CP9A 2JWPA 4LKEA 1OKOA 3UT0A 1WCUA 4YW6A 1GWLA 2K46A 3ORJA 4YW7A 4LK6A 1L7LA 1V0AA 4BQ2A 1WZXA 3ZYHA 4CPBD 4BQ4A 4CPBA 1OH3A 5D21A 3ZYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  4LKF A;  2LRP A;  3F95 A;  4LKD A;  2KR2 A;  3ZYF A;  1W8T A;  2O14 A;  1W8Z A;  1UOJ A;  1HN0 A;  1W9F A;  4AL9 A;  4CP9 B;  1GWM A;  2VXJ A;  1WMX A;  2Q1F A;  4LJH A;  4A6S A;  4BQ3 A;  2LRO A;  4YWA A;  1GWK A;  1W90 A;  2C24 A;  1W8W A;  1W8U A;  2WYF A;  4BQ5 A;  4CP9 A;  2JWP A;  4LKE A;  1OKO A;  3UT0 A;  1WCU A;  4YW6 A;  1GWL A;  2K46 A;  3ORJ A;  4YW7 A;  4LK6 A;  1L7L A;  1V0A A;  4BQ2 A;  1WZX A;  3ZYH A;  4CPB D;  4BQ4 A;  4CPB A;  1OH3 A;  5D21 A;  3ZYB A; 
#chains in the Genus database with same CATH topology
 2ZGQ A;  1MQT B;  5EV7 A;  1AR8 3;  3MEP A;  4XW3 A;  3LEM A;  1DQ5 A;  4P9W A;  4BM8 A;  4B1M A;  4AAX A;  3RJR A;  5JIU A;  3NAP C;  3RI9 A;  3KZ4 C;  1VBB 1;  4MXW A;  3O1R A;  3T4H B;  2P34 A;  1EV1 3;  1GP6 A;  1ZZ7 A;  1VBA 1;  2J1T A;  2EA7 A;  4JDN A;  3ZR5 A;  3LDB A;  3ZX7 A;  3JD7 2;  4Y5S A;  3POJ A;  4ISR A;  5FPV A;  4ASM B;  1QNY A;  1H1I A;  1N3P A;  4QD2 A;  1FMD 2;  4Y5Z 0;  5LBC A;  1AJO A;  4KGQ A;  4S2G A;  4IET A;  4HXC A;  5L19 A;  4AZZ A;  3BU7 A;  4IW3 A;  3ZMN A;  3BKZ A;  4I3G A;  4PLM A;  2WWU A;  4OHX A;  3BOP A;  1CIY A;  2PHW A;  3VHN A;  1Q5O A;  1VAL A;  3WP4 A;  4D8M A;  4N43 A;  4O65 A;  1LOC A;  2DBN A;  3M70 A;  3T2P A;  4Q8K A;  1XNC A;  1S0B A;  4Q26 A;  2HKX A;  4LUL A;  5T52 A;  3HJR A;  4BH9 A;  3K3O A;  2GN7 A;  1OA2 A;  1K5M A;  2QTW B;  5D2A A;  1YYN A;  1RUG 1;  2AEY A;  3C7F A;  5J37 A;  1AL2 1;  1XPW A;  2Q1Z B;  3MID A;  5FZC A;  1S0C A;  2GH2 A;  2WNO A;  2GZW A;  3EMR A;  3FHA A;  4FPC A;  4LPL A;  2WLP A;  1XE8 A;  4YW6 A;  1B35 A;  4IEO A;  4YYO A;  1HQN A;  5HCF A;  3BPS A;  1C8M 2;  2ZX0 A;  1F4H A;  2LUW A;  3PLQ A;  2CGN A;  4BLI A;  4P9L A;  2DU1 A;  3I59 A;  3LEI A;  1SPP B;  2V5D A;  4E2G A;  1OH4 A;  3H9A A;  4ONU A;  3DXU A;  5CIS A;  4TZD A;  4XDQ A;  3GHN A;  3WQ0 A;  3WP5 A;  3H7Y A;  3IDA A;  4PIY A;  3P6B A;  1SAC A;  1WA4 A;  4LBM A;  3LSE A;  3K2O A;  4MV2 A;  3J8F 1;  1IPS A;  1FV2 A;  3PUH A;  1IPK A;  1QJE A;  2BV4 A;  2CDP A;  3G6J B;  3LPF A;  3LE0 A;  5FYM A;  2B9V A;  1LRH A;  3V64 A;  1RUJ 3;  1FV3 A;  5JOZ A;  1PVX A;  4MLO A;  3U4S A;  2G9G A;  2VZP A;  1VE0 A;  3AYE A;  4OFG A;  4AQ6 A;  4JQT A;  1OVP A;  5FRE A;  1ZRF A;  3NNL A;  1IKQ A;  5CAZ A;  4NIG A;  1QQP 2;  3N36 A;  3PUA A;  4LK7 A;  4R9A A;  4FPH A;  2JE9 A;  1VBC 3;  3U75 A;  5L36 A;  4KNC A;  2C1F A;  2IFW A;  3KS7 A;  4JGZ C;  4CDX C;  1QY4 A;  3NAP B;  4OQ9 A;  4NID A;  1ND3 A;  2ZAH A;  3M3O A;  2F4P A;  4JDM A;  4DY3 A;  3HBK A;  4YW3 A;  1KJR A;  4DIN B;  3JD7 1;  2JD9 A;  1IGO A;  2D93 A;  5FYB A;  4Y1Y A;  1S0J A;  3CZU A;  5KXE A;  3GCW A;  2XBO 2;  4WM7 C;  5T5L A;  3JCI A;  4W6Y A;  4D0Q A;  4XXA A;  2CU5 A;  4JRL A;  2AC1 A;  3A21 A;  5L9V A;  3RMX A;  1V0A A;  2BFU L;  3N4M A;  1MVQ A;  3MLJ A;  4AI9 A;  2VVF A;  2GNT A;  3SKV A;  2ZKL A;  2E6V A;  2VC9 A;  1QJY 3;  3VKF C;  2Y6F A;  2WO1 A;  5L7O A;  4RQP B;  1BJQ A;  1UU6 A;  2X8K A;  1MEC 2;  4QX7 A;  5LA9 A;  1ND2 B;  2OX0 A;  1HJG A;  1IPJ A;  3Q8C A;  2VUL A;  5FZ3 A;  4BYY A;  1RIR A;  1RUC 3;  1TME 3;  3M3I A;  1XYN A;  1URX A;  2Y64 A;  2A6V A;  3WQ1 A;  1XBF A;  2BYV E;  2EID A;  3GDB A;  4SBV A;  3MPP G;  1RUH 3;  4CVU A;  2D6K A;  1KD7 A;  3THT A;  1JHN A;  2DVB A;  1GU3 A;  2VBP A;  3LEK A;  3IIA A;  1UPS A;  2J42 A;  1DGR A;  4UW4 A;  4EE2 A;  1UKG A;  4E2Q A;  1OPM A;  1UXX X;  1XNT A;  4X6Q B;  1LGC A;  1R08 2;  1NZC A;  3RI8 A;  5JSO A;  1C8M 1;  1Y9M A;  1ZZ6 A;  1RUD 2;  4C8D A;  5LZ6 A;  3OG2 A;  2PXJ A;  2P3I A;  1NQJ A;  2ARB A;  1OH3 A;  3JB4 C;  3HQX A;  4GB3 2;  3TEX A;  5BNQ A;  1FOD 2;  2Y6K A;  4AK3 A;  2VOX A;  4LBJ A;  4QPG A;  5FMD A;  4F3J A;  3HBZ A;  5FZM A;  3WOG A;  1LGN A;  3JXS A;  1PMH X;  2OW4 A;  2WNU B;  4AL9 A;  2WR9 A;  3OGR A;  3VZM A;  3ZXF A;  2QQI A;  2GH8 A;  4LOT A;  2PHU A;  1ULE A;  1X8M A;  3N9Q A;  3ZYI B;  2BBV A;  5IAT A;  1NE6 A;  4KI5 M;  1UZZ A;  5FMC A;  4L8Q A;  3DPR C;  1SLT A;  1SLL A;  4MGI E;  5AVP A;  3VZK A;  2YY1 A;  4WVW A;  1QHD A;  2JG8 A;  4FQ4 A;  2HWF 2;  3S5A A;  1GZW B;  1RUE 1;  2ZXQ A;  4UXA A;  5CYY A;  5JOX A;  2W08 A;  4LLO A;  1D4M 3;  1VMF A;  3IDE A;  1QQP 1;  5FMO S;  5FZA A;  1QJZ A;  1TE1 B;  5FZB A;  2VJX A;  2LRP A;  3HPN A;  4MGQ A;  5T55 A;  2FMY A;  1BZW A;  3QBQ A;  1Q8O A;  2ZML A;  1WD4 A;  5LK7 B;  4YAR A;  4DOU A;  5CZK A;  3IDB B;  1PHM A;  3WX5 A;  5E1R A;  3V0A A;  5EPA A;  3UES A;  5A33 A;  5KC6 A;  2BER A;  3AXE A;  2JXA A;  4AQS A;  2W3J A;  1KFU L;  3AMM A;  1W06 A;  5F3E A;  1MS0 A;  4I01 A;  5C3Q A;  2XBO 1;  3FMG A;  1MS3 A;  3WF3 A;  1ZRC A;  5FXV A;  4WM7 B;  4CXY A;  3NV1 A;  4IE7 A;  3OYW B;  4AI2 A;  3LOI A;  5IJR A;  2PEL A;  4ITC A;  3VBH C;  3WDV A;  4UW5 A;  3RS6 A;  3ZN4 A;  4B29 A;  2EXK A;  4CP1 A;  2RM2 1;  3A0N A;  5CNA A;  1J84 A;  1GQP A;  4XEZ A;  5JOW A;  1O8S A;  3UYJ A;  2ZEX A;  1A3K A;  1MEC 1;  4Z1V A;  2UY9 A;  4CUA A;  5I0S A;  2X53 S;  1OSG A;  1T2X A;  1XE7 A;  5HV0 A;  4ZON A;  2ARA A;  5K9Y A;  3H8R A;  2RDS A;  5T54 A;  4UW6 A;  3AYA A;  3OJB A;  4IGP A;  4LJH A;  3VBF B;  3WG1 A;  3VBO C;  1PVC 2;  2RJL A;  2ZX3 A;  5I0R A;  2DCT A;  4MHU A;  4ERO A;  3RYP A;  5IVE A;  4YZ5 A;  3KV4 A;  2PAM A;  3WW1 A;  2D5F A;  2GMM A;  1OKO A;  3W5N A;  1OUR A;  3WNX A;  3ILF A;  1R08 1;  1ULG A;  4XUN A;  4HPK A;  2JJ6 A;  4M0N A;  5FOB B;  3RMY A;  5GLT A;  3WNP A;  4PI2 A;  5D21 A;  4EN8 B;  3HAG A;  3CNA A;  3IMN A;  4GB3 1;  4GKY A;  1K42 A;  1VJ2 A;  1FOD 1;  4XFB A;  4AVT A;  1UX6 A;  2D97 A;  5FRA A;  2W5F A;  3ITQ A;  3MF9 A;  2VMF A;  3OCP A;  1YI7 A;  5FY7 A;  3EJK A;  3OY8 A;  3PIJ A;  1JHJ A;  1V6M A;  4XC9 A;  1HDK A;  1C5H A;  3H3U A;  2C4X A;  4JCK A;  1W9F A;  3T2Q A;  4IV1 B;  4PF1 A;  5C4W A;  3GJB A;  1W03 A;  2RE9 A;  1W8O A;  4WVZ A;  4RFR B;  4NAM A;  5C33 A;  2DTY A;  5HCA A;  1AR9 3;  4ZU7 A;  2UWB A;  3BVC A;  4CP2 A;  4GWN A;  3VN4 A;  2EIC A;  4Y20 B;  5KHJ A;  2B7Y A;  3BB6 A;  2PHD A;  5FFO C;  3DPR B;  4XE9 A;  5ANN A;  4M3C F;  5DUX A;  5J09 A;  4ZXE A;  2HWF 1;  4CDW A;  2R16 A;  3VKM A;  2VAU A;  3NJV A;  4H7M A;  2VZS A;  2IXK A;  4AGR A;  2ET7 A;  1REE A;  2GAL A;  1EAH 2;  1O91 A;  4NRQ A;  1CPN A;  4OI4 A;  3PDQ A;  5A3U A;  1VR3 A;  1RMU 3;  1OA3 A;  5HCB A;  5E8A A;  1MR5 A;  4AFM A;  4XUT A;  3SH4 A;  2YPJ A;  2Y0I A;  1ONA A;  3GZU C;  1WWY A;  2HWB 3;  2MEV 3;  4N9I A;  2XQX A;  4Z92 B;  5E88 A;  4P5H A;  1WLD A;  4Y22 B;  4RA0 A;  2HLE A;  2BOI A;  3I2K A;  4FXK B;  4NIH A;  3W59 A;  2Q8E A;  4JRA A;  1CQ9 A;  1X33 A;  1GOF A;  2X05 A;  3MW4 A;  3PU3 A;  4WM8 C;  2WBK A;  1YWK A;  1JOP A;  5A7O A;  1UO9 A;  4MO3 M;  3SCG A;  3ZR6 A;  2E31 A;  3VHP A;  2HBT A;  4YGD A;  4HMZ A;  1LED A;  1W3X A;  5FY5 A;  3VBH B;  5CFC B;  1J3Q A;  4CRQ A;  1HB2 A;  5BYN A;  4DIQ A;  3UKN A;  2G1M A;  1TVG A;  4XQ4 A;  2P6H A;  3C3V A;  1ST8 A;  4RR3 C;  2QDR A;  1BK0 A;  1UOJ A;  3ACL A;  4URA A;  1POQ A;  4RGA A;  3M1H A;  4GIQ A;  3LCP A;  3VD3 A;  3WW4 A;  4YGC A;  5BNP A;  4M3C E;  1UY4 A;  2OXB A;  4P9I A;  3VBR B;  2CSG A;  3POW A;  1LHU A;  1PVC 1;  1VAM A;  3KMH A;  2P2K A;  2XB6 C;  4QX1 A;  5F3I A;  2TBV A;  3VD5 A;  4AED A;  1AYN 3;  1NA1 A;  2VTX J;  3VZN A;  1GWL A;  2Y34 A;  3CO2 A;  2RJ2 A;  3NWK A;  1CIW A;  1OHF A;  2AR6 A;  4Q29 A;  1IS6 A;  1JBC A;  1COV 2;  1W6M A;  3P3N A;  3U14 A;  2WA3 A;  1XYP A;  1UY2 A;  4X6R B;  4UT5 A;  3ZKY A;  4OHW A;  2YMZ A;  4MGK E;  1W8T A;  4G9S B;  4TWT A;  3ZKU A;  2R06 2;  4HSL A;  3DYM A;  2IXI A;  2A7A A;  3M3Q A;  4H55 A;  5C5U A;  4GD4 A;  4LBK A;  1KXG A;  3U11 A;  4XIL A;  4BQW A;  2JG9 C;  4YVW A;  2W39 A;  4R9C A;  1VLN A;  4KBB A;  5A3O A;  2W0X A;  5IK4 A;  2WFP A;  3AB0 A;  2ARC A;  1XYO A;  4EQV A;  2BWC A;  1CAW A;  2Y38 A;  4HKO A;  3ROU A;  2HWC 3;  2NLR A;  2XUM A;  1LCL A;  4WVV A;  3AZY A;  4IQP A;  3THP A;  4A6O A;  4W4Z A;  4Y24 A;  4AVC A;  1C4R A;  5C8W A;  3FFQ A;  2JDA A;  3H1M A;  4M4P A;  1V9U 2;  1DQ6 A;  1H8T A;  3ACI A;  3K51 A;  1EAH 1;  3K4D A;  2QQN A;  4N7I A;  1ENR A;  2VUA A;  3AXD A;  2VZQ A;  1RVF 2;  3R05 A;  4O9G A;  2RS3 2;  1XU1 A;  4IDZ A;  5ABJ A;  4IE5 A;  4XJW A;  5EYY A;  4M3C A;  5FZ0 A;  3MDP A;  5CBL A;  4RFT 0;  3FBM A;  4N53 C;  5FJH A;  1YQC A;  2PHX A;  3GHM A;  3URF A;  4QQP A;  1PX4 A;  2GP3 A;  5DZG A;  4JKL A;  4D69 A;  1P8J A;  2W1U A;  2YFU A;  4XAB A;  4E2S A;  4KG8 A;  4XDO A;  3H3Z A;  1KDM A;  1WGP A;  4FPK A;  3SCH A;  4D7S A;  4PI0 A;  2R0F A;  4XET A;  3ZYG A;  1SDW A;  2DTW A;  1ZZ8 A;  3U1X A;  3NNM A;  1I1E A;  2DUO A;  3EO6 A;  4DXR A;  3J9S A;  1UIK A;  5DQ0 A;  4Q4Y 1;  3VL9 A;  3ZYR A;  1GR3 A;  1E57 A;  3KGZ A;  5I8T A;  3ZO0 B;  1L7R A;  2G9Z A;  5D8A C;  3PVB B;  3FUO A;  3RRD A;  4CU8 A;  5A1A A;  3DYO A;  1VRH 3;  5AFB A;  3CHX A;  2O8Q A;  4N9H A;  2Y0O A;  2YBP A;  2R1B A;  5IVF A;  3H8X A;  1POV 3;  3FC0 A;  5JOY A;  2XOM A;  5IVV A;  5CFD B;  3ILR A;  3VBO A;  2WT0 A;  3WR0 A;  4A7Z A;  4QHZ A;  3C7H A;  1MS5 A;  2V73 A;  1NCQ B;  1JYN A;  1COV 1;  2MNG A;  4JGY C;  2EF6 A;  4QPI C;  5A7P A;  4YM2 A;  2AYH A;  5FZK A;  5HV4 A;  3HEI A;  1X82 A;  5FYI A;  1CX1 A;  3O7O A;  4YVS B;  1XJA A;  1Q43 A;  4GKX A;  4CE8 A;  2R06 1;  3R4S A;  2JDZ A;  4MUV A;  1JYI A;  1JS9 A;  1JW6 A;  2HWE 3;  4QX0 A;  5DN2 A;  1G8W A;  3RZJ A;  2NM1 A;  1DGL A;  4Z2W A;  4UBG A;  2ADE A;  4YW1 A;  4DPN A;  4CEY B;  1SBD A;  5CG8 A;  2FDH A;  3DEM A;  1O4Z A;  3OD0 A;  3SNM A;  2W91 A;  3THD A;  4AFB A;  3VKN A;  3C2U A;  1CAV A;  3ME2 A;  2BRT A;  1H0B A;  5B4X A;  2JIJ A;  2J1E A;  1BKZ A;  4K9S A;  1Y7B A;  2VMG A;  2JB8 A;  1QJX 2;  3I2F A;  5K0U B;  1V9U 1;  1PO2 3;  4LEJ A;  1LU1 A;  1S2E A;  3MIC A;  4PBO A;  2WT2 A;  4IEP A;  2OZ6 A;  4B4Q A;  1RVF 1;  3F2Z A;  3MIG A;  4J1W A;  5F1R A;  1YQ8 A;  2RS3 1;  1GNZ A;  1MS8 A;  1RUI 3;  3POY A;  4HK8 A;  5LK5 A;  4ARX A;  1LAJ A;  1G9A A;  2D44 A;  3HOB A;  1OF3 A;  1WLW A;  4LBQ D;  4N53 B;  4BDV B;  3IBM A;  4RN5 A;  1W0O A;  4LOS A;  3MZH A;  2QQV A;  1J1L A;  1Q8Q A;  4NPR A;  1BHG A;  1QOO A;  1RIT A;  3WG3 A;  1W2O A;  5DG1 A;  5FY8 A;  4IE4 A;  2X10 A;  2WZP P;  3ZYP A;  1RUJ 2;  4Q2F A;  1ZNP A;  4E4D X;  1W6O B;  2BNN A;  4BHP A;  4WM8 A;  2E7Q A;  5A80 A;  1CX4 A;  4MOA A;  2WQZ C;  3C7E A;  3Q9O A;  3WF2 A;  4XQD A;  2R07 2;  3J4U H;  4Q4X 1;  1Z7S 3;  4EWD A;  3ZN6 B;  2PQS A;  1F15 A;  1CZS A;  3NV2 A;  3GGL A;  1A6C A;  3QAC A;  1VBC 2;  4UFM A;  2UY8 A;  5D8A B;  4RR3 A;  3HNY M;  4BOW A;  2HEY F;  3TBD A;  2VVD A;  2RMU 3;  4OHY A;  4Y3O A;  4CDQ C;  5K4L A;  1J58 A;  2E33 A;  3WNM A;  4PLO A;  3VDD C;  3RZM A;  5FZ1 A;  2H6B A;  4B4P A;  2JB4 A;  5FZ4 A;  3VBU B;  3ZFG B;  1YRZ A;  5JPN B;  3M4F A;  3I2O A;  1BMV 2;  5FZG A;  2CAU A;  3ES4 A;  4QPI B;  4YM1 A;  1DYP A;  2XG3 A;  3OPZ A;  1GLH A;  4XDP A;  4QHO A;  4BXF A;  1YUD A;  2YU1 A;  5FZ6 A;  4QPW A;  5FZO A;  5BNO A;  1R09 3;  5FYS A;  4Q0P A;  2R1D A;  3VDC A;  4AW7 A;  1QJU 1;  3KSC A;  4LUM A;  3DN7 A;  5I0T A;  3D3A A;  1CWP A;  4COU A;  4PDW B;  1NXD 1;  3USU A;  1IS5 A;  2VR4 A;  4WVM B;  4Q8L A;  3SXW A;  2EXH A;  4TTG A;  2Z4F A;  2LM3 A;  2VBD A;  4CXX A;  4FP3 A;  4HG6 B;  1Y9Q A;  3ZDV A;  4QB6 A;  1J1T A;  5J3U A;  4NWW A;  2B8M A;  2JE8 A;  2X29 A;  4AHX A;  5IAV A;  4O9E A;  1WBF A;  4CDU A;  4FAG A;  5LA0 A;  1X36 A;  1QJX 1;  3C8X A;  1CD3 G;  4HZF A;  3WCR A;  3KHB A;  5FY9 A;  1MQT C;  4NAO A;  1N1S A;  4WV8 A;  2ZGP A;  2B42 B;  4K8F A;  4LKD A;  2R6Q A;  3MHZ A;  2V4A A;  1YO8 A;  3MW2 A;  2VCB A;  1LEC A;  4JTO A;  3SCF A;  1W6Q A;  1PGS A;  2A5Z A;  3MF6 A;  3N7M A;  1PIV 3;  2VQA A;  1V6O A;  3IZO A;  2RS1 3;  1F31 A;  2Y8K A;  2ZHM A;  4CCM A;  3LAG A;  3VKO A;  4B1L A;  4BPZ A;  3SEE A;  5F5C A;  3TN9 3;  1OLM A;  5DPN A;  1Q8P A;  2WL1 A;  2XKP A;  1Q8S A;  3S0M A;  4LT5 A;  2PFW A;  4BQ4 A;  1PZ7 A;  2GME A;  2WWS A;  4ZZ8 A;  2WN2 A;  4XOG A;  3AKS A;  4AR2 A;  3VD9 A;  3AVR A;  1ULO A;  2Q0A A;  4RHV 3;  3WW2 A;  4IEU A;  5FR3 A;  5DAW A;  4NR1 A;  2HYX A;  2KR2 A;  2YV8 A;  2R04 3;  2JDP A;  2R07 1;  3GBF A;  3MPB A;  4MYE A;  3WZ1 A;  3CIH A;  3DL3 A;  1C3H A;  5AC9 2;  2Q5T A;  1ZBA 3;  1KIT A;  2WO7 A;  4A6S A;  4F7Z A;  5F2S A;  2BFU S;  2ZMK A;  2PLV 2;  2R30 A;  4Q5O A;  5FWE A;  3WDU A;  3KCC A;  3CU7 A;  5KXD A;  2ZS6 B;  4B3N A;  3NKT A;  5LA2 A;  1W8N A;  2WZR 3;  3KGL A;  4E8C A;  1H2L A;  1AYM 1;  1RJ7 A;  1PGL 1;  2J1S A;  1RYY A;  2YGM A;  4ET7 A;  4OI0 A;  3A23 A;  4GWI A;  3OBR A;  2XJV A;  5C3P A;  2P3Y A;  4XFC A;  3LA2 A;  2EIG A;  4JGY A;  4OUM A;  1YCI A;  4LXL A;  4XIK A;  1QF3 A;  2CHH A;  1V6N A;  5FYH A;  5JXH A;  1R1Z A;  5IUQ A;  4XCA A;  4BK5 A;  4DQA A;  1U5Y A;  3ACF A;  4I2O A;  2YRO A;  5K8S A;  5F5A A;  2OII A;  2G19 A;  3ACH A;  2QFE A;  5IK7 A;  1LOB A;  3B69 A;  3JBG 1;  2Q30 A;  1LKN A;  3QOP A;  3TNQ A;  3B93 A;  4CU7 A;  1CAU A;  2ERF A;  3T30 A;  3DEC A;  5CB7 A;  1ASJ 2;  4FFF A;  1RUF 3;  2HEW F;  2PHL A;  1O3Q A;  2QZ3 A;  5DAB A;  1AX0 A;  4DNY A;  1OOP A;  1RL3 A;  4QKN A;  2RR1 3;  2RS5 3;  3SH3 A;  2YC0 A;  1BBT 3;  1UCX A;  1TMF 2;  1GZ9 A;  1V6K A;  1XB9 A;  5FYV A;  4R8H A;  5JMC A;  1UMZ A;  5I0U A;  2Q8D A;  4DXS A;  2R0H A;  4L9B A;  1UW8 A;  2D3P A;  2ILM A;  1HKD A;  3I2G A;  2QQP A;  2E26 A;  3AL5 A;  4QGL A;  2BOJ A;  1HV0 A;  3RWN A;  1SLC A;  4Y1V A;  1F8V A;  3MLK A;  5FQ0 B;  2ZGT A;  2VOV A;  4FBF A;  1AR6 2;  3W20 A;  1ZBE 3;  1QXJ A;  1QDC A;  3IPV A;  5FLJ A;  4HVQ A;  4NPM A;  4NPL A;  1PNF A;  4QU1 A;  1ND3 B;  1HXS 3;  5D1I A;  3MIH A;  4NO4 A;  4RQP C;  3ZYF A;  4AFD A;  1LOF C;  5EFU A;  4YGE A;  1ND2 C;  1DLC A;  2VZ3 A;  1R1A 2;  1YIP A;  2P1B A;  5AC9 1;  2X5I C;  3RGB A;  3LB9 A;  3CBN A;  3PIG A;  1DCS A;  5JDB A;  2DFC A;  1E5H A;  2JDU A;  4YW2 A;  4AWD A;  4EYU A;  3PUQ A;  2PLV 1;  1ULC A;  3PMS A;  1DLL A;  1H2K A;  2BEO A;  3ACG A;  2E53 A;  2YFZ A;  2CWM A;  4CCL A;  4DO0 A;  1NG0 A;  4ORF A;  5JMO A;  3A4U A;  3K4A A;  1XOY A;  4Q0S A;  3EQE A;  3IM0 A;  1W39 A;  1UY1 A;  5F5I A;  4CPB A;  4RS5 A;  4R4X A;  1C1F A;  5FZF A;  4KWK A;  3MFC A;  2IVJ A;  4DRR A;  1H2N A;  3VDD A;  1NLR A;  2VMD A;  2XVL A;  4BWO A;  1JYX A;  4GAL A;  4A3X A;  1WW4 A;  1C8N A;  2ZHN A;  4Q4W 2;  4A3Z A;  4DMI A;  5H9S A;  1O4Y A;  1YXW A;  3W21 A;  3JB8 A;  4L0P A;  2WNU C;  4OYU A;  4XUR A;  1OQ1 A;  1Z78 A;  5BXX A;  4MH0 E;  3WNL A;  1PGW 1;  1RHI 3;  4PQQ A;  1GWM A;  1EP0 A;  2Z42 A;  4BQ3 A;  4MHR A;  5LCW L;  2C0Z A;  4JQR A;  2ZA9 A;  2C6S A;  1SFN A;  3N9O A;  2YG0 A;  4CP9 A;  4Y1Z A;  2LAL A;  2AEN A;  3E5Q A;  4GQ7 A;  4KU8 A;  2OQ7 A;  2RV9 A;  4IEX A;  1HRI 1;  1FX5 A;  1CZT A;  5JPM B;  3UGG A;  1PK6 B;  2CL2 A;  3MGU A;  4K7J A;  1ASJ 1;  2QQW A;  1SFY A;  1CR7 A;  1W2N A;  2OQ6 A;  5J98 B;  1YQ2 A;  1WLC A;  1C1L A;  2OPK A;  1MZF A;  4MGY E;  2TEP A;  4IND A;  3PVN A;  4E4H A;  3N7L A;  2J1R A;  4N90 A;  3AX4 A;  5LBE A;  3V0B A;  5A7W A;  1PO1 2;  2DU0 A;  4LE4 A;  4NJ4 A;  2EAA A;  2WS9 2;  2WC2 A;  4FXG B;  3WSO A;  1TMF 1;  4QAW A;  2XLG A;  3X29 B;  1DU3 D;  1O3R A;  2EIB A;  1HIX A;  3TYJ A;  4M4R A;  4BIO A;  3AMH A;  3I54 A;  1YJK A;  4K3U A;  3PJY A;  2C24 A;  5J36 A;  4PHZ A;  2HWD 2;  4UF0 B;  4C91 A;  5JZG B;  5LA1 A;  1FMD 1;  2P4E A;  2DVF A;  3V0B B;  1U0A A;  2WNV A;  1W8F A;  3AZX A;  4BLJ A;  4W6W A;  5C8C A;  2VVE A;  2VW2 A;  1AR6 1;  2ORZ A;  4HT1 T;  2H6C A;  3LSD A;  3N3H A;  4PQ9 A;  3LGR A;  4OQ8 A;  5A7S A;  1S1A A;  5JVV A;  2ZGK A;  2FDJ A;  5FY0 A;  3B00 A;  3IN9 A;  2OKX A;  4ZS2 A;  1JYC A;  1NYW A;  1YFU A;  1R1A 1;  3I2H A;  4NHL A;  4UFJ A;  5AFE A;  3ZSE A;  1IOA A;  2PHF A;  1DQ2 A;  2KD7 A;  4OZX A;  2X5I B;  4V1P A;  3VBF C;  1H1M A;  2DUQ A;  4L2N A;  3KT4 A;  2A73 B;  2HJI A;  5FZ8 A;  4A7K A;  1BEV 2;  1AR7 3;  3V65 A;  2DUR A;  1QOS A;  4K20 A;  3KV5 A;  2G9F A;  2XHK A;  3UGF A;  2PAK A;  2VZO A;  4AFA A;  4EZH A;  3ATG A;  5SV5 A;  3K46 A;  1DP0 A;  3WDT A;  3I3B A;  4JHT A;  3S7E A;  5DZE A;  4NOT A;  2J1A A;  3ZSK A;  1KS5 A;  1I3H A;  5ACA 3;  4W50 A;  5FDB A;  4Q4W 1;  1NOV A;  1K12 A;  3UV9 A;  1NE4 A;  1GYK A;  4GH4 A;  5A70 A;  3MIF A;  1CN1 A;  4IV1 C;  1ZRD A;  1ODN A;  1SPP A;  4BA6 A;  1SFP A;  4XYX A;  2ZBJ A;  3O1V A;  2FDG A;  4D6S A;  1OQD A;  3NST A;  5F39 A;  4AEM A;  2GC2 A;  5FP8 A;  3FFZ A;  4LO4 B;  1EPZ A;  5IK5 A;  4HOO A;  2WSU A;  4XFH A;  4LBO A;  1E5S A;  1VBE 2;  4K40 A;  2YHJ A;  3RQ0 A;  1HQL A;  5B4N A;  3M8L A;  3EBR A;  5L73 A;  4ATE A;  5FO9 B;  3MUY 1;  1S2K A;  3ZYB A;  2WN3 A;  5A6X A;  3HN3 A;  2B5H A;  3C7O A;  4LIU A;  3TAY A;  1VBB 3;  3I97 A;  4XMA A;  4LO8 A;  1VBA 3;  1PO1 1;  3ZSM A;  2WS9 1;  1BK1 A;  5FYC A;  2Q8C A;  2TNF A;  5FK7 A;  5TSW A;  3ZFE C;  4E27 A;  4AVV A;  5EP9 A;  4D7T A;  1OF4 A;  4IV3 C;  4XXP A;  5ANQ A;  4EN0 A;  1YNA A;  2VZ1 A;  3NAP A;  2NMN A;  2XJP A;  3H7J A;  2I74 A;  2WYF A;  2HWD 1;  5FZE A;  1O3S A;  4NE9 A;  4QQ2 A;  5HXM A;  2FCU A;  3AKP A;  4OMC A;  4BQX A;  1XNK A;  1JU3 A;  2RHP A;  4W8J A;  1PNG A;  4D6Q A;  1JYT A;  2AGS A;  5FIX A;  1DF0 A;  2WFF 2;  4I02 A;  4FFH A;  4D94 A;  2QJV A;  4XZU G;  5A3M A;  5DUW A;  3LZZ A;  3RZH A;  3T08 A;  4IER A;  4YZ3 A;  4ES8 A;  1MAC A;  1WA6 X;  2IC1 A;  4QDS A;  4ZHN A;  3RG0 A;  3ZXD A;  4AXO A;  1RUG 3;  2VZV A;  4YRD A;  3E6D A;  5F32 A;  2GU9 A;  2O0O A;  5CG9 A;  3R4D B;  3KT7 A;  1AL2 3;  3AL6 A;  4JX0 A;  1JZ3 A;  4FO9 A;  3SKJ E;  4LIT A;  3C7G A;  2FBE A;  2ZTN A;  3CDZ B;  4AQT A;  2IXC A;  1SLI A;  3VBR C;  2UYA A;  4QQH A;  5H9Q A;  5G04 L;  3ILN A;  4FPF A;  1BEV 1;  4GZ9 A;  1ZZB A;  1KDK A;  2D5H A;  4LNV A;  3VBS C;  5FOJ B;  4FFI A;  4AG4 A;  1YHF A;  1XXN A;  4ZPI A;  2FQP A;  4K6B A;  4HLT A;  3OOX A;  2VPV A;  1VP6 A;  5EYX A;  4QXH A;  5FY4 A;  1RUD 1;  4NHY A;  4KU7 A;  3NNG A;  3TEY A;  3I2J A;  5EJZ B;  2V09 A;  1HB1 A;  5C3R A;  3FHQ A;  3J8F 3;  1WCK A;  3D0J A;  4MZU A;  3HT2 A;  4K21 A;  1NA1 B;  2WNU A;  4OZO A;  3VZO A;  3POE A;  2R32 A;  4YSF A;  3RWK X;  4M0H A;  1CJD A;  2R7E B;  3ZPO A;  3OGV A;  1F5J A;  1HRV 2;  2IZW A;  3N7K A;  1JYV A;  3NMB A;  4Q0U A;  1QOT A;  3ORJ A;  1VBE 1;  4I0B A;  1LGB A;  5C9A C;  5DDJ 2;  4ZXK A;  2VU9 A;  1X9P A;  1N3O A;  4YVW B;  1OFN A;  2O14 A;  5FP7 A;  1JXN A;  4Q4V 2;  3VHO A;  2BPA 2;  2BU9 A;  5IVC A;  3JD7 3;  2YC2 A;  3B3Q E;  4CYD A;  5A3P A;  4KMQ A;  2OYZ A;  2JD4 A;  1CAW B;  2VEC A;  1C5I A;  2XJS A;  3ZFE B;  5HCH A;  1XQN A;  3J7H A;  3PVO A;  4JC1 A;  1STM A;  2ZPX A;  4IV3 B;  3O1O A;  2XH6 A;  4JGZ A;  3WNO A;  4CDX A;  2D6M A;  5FY1 A;  2XUE A;  3MW3 A;  5FLH A;  1US3 A;  3QH7 A;  3A7Q A;  1JH5 A;  1ZRI A;  2DWR A;  4QDQ A;  3U78 A;  1CON A;  1N1Y A;  1PZ8 A;  2W94 A;  1W99 A;  2WFF 1;  3AYD A;  2WSV A;  3AMP A;  4WM7 A;  1GZT A;  1EYB A;  1WKY A;  2CDO A;  3OYW A;  1G7Y A;  4FT8 A;  2B9U A;  2WIN B;  4BZ4 A;  1FXZ A;  5ABJ B;  5LY1 A;  1UMI A;  3AFG A;  4M3C B;  4CCC A;  1F9K A;  3ZMO A;  5DZF A;  1IQD C;  5C5T A;  4XFG A;  4IEQ A;  4MGZ E;  4OI1 A;  2EAK A;  4KH9 A;  1NCR C;  1WD3 A;  5IHR A;  4AYU A;  2VXJ A;  4ATF A;  1ZRE A;  1X7N A;  3CLP A;  3VV1 A;  3RZG A;  2D3S A;  3EXU A;  1SDD B;  5IAX A;  1LTE A;  1C8M 3;  1PIV 2;  4FQZ A;  4YW4 A;  3VBF A;  1RXG A;  4C1X A;  5CFD C;  4XFF A;  3BCW A;  2C5D A;  3VBS B;  1NLS A;  4ZKT B;  4FOY A;  4WBB A;  5FUP A;  4XBQ A;  4XAC A;  1NCQ C;  1DZQ A;  2PN5 A;  1CAX B;  2ZX2 A;  4CEW C;  4RGK A;  1UL9 A;  4GWJ A;  5FK8 A;  4IEV A;  3I2D A;  1BLZ A;  2PYT A;  2YXS A;  4Y33 A;  4YVS C;  2DVG A;  4RHV 2;  1UOF A;  1VAK A;  4D7Y A;  1HN0 A;  4A4A A;  1JOJ A;  3BIW E;  3D82 A;  5I91 A;  1D2S A;  2D6P A;  1OC1 A;  5IW0 A;  1LUL A;  3WW3 A;  1QWR A;  3RJ2 X;  4CEY C;  4IV1 A;  2BUK A;  4C1W A;  3BOW A;  3BYW A;  1T6B X;  2Y33 A;  3OUI A;  3QD6 A;  4FVV A;  4R4Z A;  4YG3 A;  3U37 A;  1RUE 3;  5FZD A;  2Y6L A;  1UPI A;  1HRV 1;  4OCT A;  1QQP 3;  1ENX A;  1SLA A;  3D4K A;  4Y20 A;  1LR5 A;  2VCM A;  2XLF A;  5DDJ 1;  1WMF A;  3DPR A;  4XJ8 A;  5C9A B;  5K0U C;  2I2S A;  3UGH A;  3HNM A;  2YDE A;  1UU5 A;  1YQ5 A;  2IUW A;  2CNA A;  3WNN A;  1TNR A;  2A70 A;  5FPU A;  1YFW A;  3N9N A;  1NX9 A;  2A6X A;  2VCC A;  3E5X A;  1W2U A;  4Q4V 1;  4YZ4 A;  1JZ8 A;  1WME A;  1XC6 A;  2NMO A;  3AYC A;  3IDC B;  4P00 B;  1W6N B;  1GIC A;  3SQO A;  2BBA A;  2XBO 3;  4CTE A;  4K1Z A;  3B01 A;  2VZT A;  4QGM A;  1K45 A;  2DCK A;  1YC6 1;  3FL7 A;  4FI9 A;  1L7Q A;  2WZE A;  5CKQ A;  3OBZ A;  3GZT B;  3AKR A;  2W2I A;  2ZOE B;  4LHL A;  5F2W A;  1JU4 A;  4H2A A;  5ERL A;  4LE3 A;  1FPN 2;  2RM2 3;  4AGG A;  1JMU B;  2ARX A;  2UYB A;  5CKN A;  5A7Q A;  2MPF A;  4Y22 A;  5LBB A;  2FZ1 A;  1Y4W A;  1MEC 3;  1W05 A;  3BU0 A;  1X50 A;  2F6B A;  1QNW A;  1S0I A;  4BIF A;  3OPT A;  4HL0 A;  3T1M A;  1SZB A;  5CFC A;  3VBH A;  2RDQ A;  2SLI A;  3WF0 A;  4HKL A;  1VBD 2;  3QH6 A;  3AM2 A;  3K4Z A;  1AR8 2;  1OUS A;  1PX3 A;  3B94 A;  4NUB A;  3T3Y A;  5CAD A;  1NCR B;  1QU0 A;  4CXW A;  1VAV A;  5A3N A;  3AZZ A;  1JI6 A;  1R08 3;  1W8U A;  3J7M A;  2VW1 A;  3JQX A;  1EV1 2;  1N47 A;  3CJI B;  4FFG A;  3BOD A;  4L92 A;  2D6L X;  4QWN A;  4GB3 3;  4XTP A;  1H2M A;  1FOD 3;  4URT A;  1TEI A;  5EWS A;  2JEN A;  3ZFG C;  1PMJ X;  3VBU C;  3N7J A;  1JTZ X;  5I93 A;  2VMI A;  4GMP 1;  1UX7 A;  5FZI A;  3NW4 A;  1ZYB A;  2VGD A;  1LOD A;  3RZK A;  1ZBE 2;  4CEW B;  4JTN A;  4A41 A;  3LFM A;  1DGR N;  5FKC A;  1CZV A;  5JIA A;  2GSY A;  2V4V A;  3I2I A;  4KWL A;  3I49 A;  3OGJ A;  1HLC A;  3ELN A;  5H9R A;  4LBQ B;  2ZX4 A;  3RVH A;  4PDW C;  4W6X A;  5FPB A;  5FZ7 A;  1DFQ A;  5I8Y A;  4BB3 A;  3RFR A;  1WW7 A;  2DUP A;  2HWF 3;  3ZXL A;  1D2Q A;  3H0O A;  3MBW A;  2B46 X;  4LHN A;  1XND A;  3AJZ A;  5LAT A;  1YI9 A;  4YFZ A;  1MS9 A;  5T5P A;  1W04 A;  1W8H A;  1FT9 A;  5FPA A;  4LKF A;  2VMC A;  2Z79 A;  4PCR A;  4LHK A;  1AX2 A;  3KQ4 B;  2D40 A;  4OHV A;  4XFA A;  1VMJ A;  4B7K A;  2FZ2 A;  3ZFF C;  4FPL A;  3KD4 A;  3WD5 A;  2YU2 A;  2B39 A;  1W6P A;  2DF7 A;  2VNV A;  3KB5 A;  3MFA A;  4O61 A;  3ZXG A;  5FCC A;  3O1P A;  2VQU A;  3E5U A;  5EIY B;  1DYO A;  1UNB A;  2VOK A;  3UNP A;  5KXC A;  1FPN 1;  1QEX A;  2A6W A;  2VE1 A;  1RC6 A;  4E4Z A;  5APA A;  4YZ1 A;  5GKA C;  2QBX A;  4TYS A;  5CVR A;  4U2A A;  4GUL A;  1ZM1 A;  4JHZ A;  4UW3 A;  5FBZ A;  1UXZ A;  3DGT A;  3WG4 A;  1W9T A;  3NQH A;  3E97 A;  4P08 A;  1OA4 A;  3WT3 A;  5F8P A;  5A6Z A;  2ZGM A;  2ZX1 A;  1BCX A;  1SEF A;  1XRU A;  3H1Y A;  1VBD 1;  3K48 A;  1PVC 3;  1AR8 1;  4NHX A;  2NPI A;  1FNY A;  2E7T A;  4AVB A;  1KGY A;  1I9R A;  5C3S A;  4Y4R A;  2ZZJ A;  5JR7 B;  3LDK A;  1XSQ A;  3IT8 A;  1QH7 A;  2NYY A;  4G4F A;  1UOB A;  1XNB A;  1V6L A;  1EV1 1;  3P3P A;  4OMD A;  4TN7 A;  3UT0 A;  2XWB B;  4EV0 A;  2NP0 A;  3CMG A;  1NUK A;  2P6C A;  1OLM E;  4NRO A;  2DVA A;  3RNS A;  4F83 A;  5JWP A;  2ZGS A;  4N43 C;  2VXR A;  3BI3 A;  5DMY A;  1HQW A;  2OPW A;  2W46 A;  3ECQ A;  5CFD A;  1WMD A;  2VO5 A;  4FTS A;  4UWD A;  2TUN A;  1V70 A;  2F4L A;  2VCA A;  2ZAB A;  1K5M C;  1NCQ A;  3PTR B;  5FXX A;  5T50 A;  5BNN B;  3FUQ A;  1HB4 A;  4JKK A;  1QJY 2;  4XF1 A;  3RPQ A;  5F3G A;  3T0A A;  3O0V A;  4IEZ A;  2ZHL A;  1F4A A;  1H1A A;  4QU2 A;  4UFL A;  1JZ6 A;  3PVE A;  1J83 A;  1H30 A;  1GBG A;  1RUC 2;  1TME 2;  2VBB A;  2CY6 A;  4HVR A;  2A1X A;  2JKB A;  2JG9 A;  2QQO A;  2A3X A;  3VUO A;  1LJ7 A;  4CEY A;  1OMI A;  1AXZ A;  3IAQ A;  1EAH 3;  3S5Q A;  1A34 A;  1RUH 2;  2XQR A;  4Y26 A;  3I3E A;  2WDB A;  3G7D A;  1NY7 2;  2GC1 A;  5EJ1 B;  4DEQ A;  2P5B A;  5FO8 B;  2P3K A;  4FPE A;  3BTA A;  3PUS A;  2VQ0 A;  3HWJ A;  3QLQ A;  3SH5 A;  2I07 B;  2UWA A;  2A75 A;  2VUJ A;  3PUI A;  4JV4 A;  4Y4Y A;  3DUI A;  1JOD A;  5K0U A;  5LEK A;  3AP5 A;  4HET A;  4OHZ A;  1UMH A;  2VY0 A;  3ZFF B;  2A71 A;  3OB8 A;  4IEW A;  3ZYJ B;  4RD7 A;  1S4C A;  4IES A;  4DUW A;  4FTE A;  1H9W A;  5FP4 A;  3VDA A;  5FP3 A;  3VZL A;  5IFP A;  2WO2 A;  4LMF A;  2FDK A;  3RZZ A;  1OXC A;  5IT6 A;  1H8V A;  4J25 A;  1E5R A;  4XAA A;  4I0A A;  4AEJ A;  5FYZ A;  3U10 A;  4N53 A;  4QQO A;  1RIN A;  3AP6 A;  2OVU A;  2Y26 A;  3B02 A;  3PME A;  4LTA A;  4XJA A;  1JN2 P;  1OD3 A;  4BQ1 A;  1RUJ 1;  2IWG B;  2QNK A;  3CQO A;  2A6Y A;  3RYK A;  3E6B A;  2WRA A;  4Q4Y 3;  1ND3 C;  4HFS A;  2WO3 A;  3SHR A;  3F95 A;  4MXW B;  3T0D A;  1IZ3 A;  1W6O A;  1D4M 2;  2VZU A;  1VBB 2;  5GJ6 A;  3HT1 A;  3LA7 A;  3WHU A;  4AVA A;  3B5L B;  1N1V A;  4C0H A;  1VBC 1;  4GA9 A;  4RGG A;  2LW8 A;  2GND A;  3ZN6 A;  4NRM A;  3UL2 A;  2E32 A;  3PL0 A;  3IPV B;  1LOG A;  5LWB A;  2QKD A;  3B7M A;  5D8A A;  1US2 A;  4AI0 A;  3CL1 A;  4QGN A;  1AF9 A;  1AZD A;  1COV 3;  4P9J A;  4QKB A;  3T2O A;  4KL1 A;  2K9Z A;  3L2Y A;  4NVP A;  4YW7 A;  1ULF A;  2BJS A;  1U12 A;  4N43 B;  4XUO A;  1G9D A;  1UY3 A;  3L2H A;  1XE0 A;  5FJK A;  2VNR A;  5FUN A;  3WF4 A;  2R06 3;  2XR4 A;  1EPW A;  3KV6 A;  1GZC A;  2V5Y A;  3FN9 A;  4IGO A;  4NRP A;  1BVP 1;  3HIF A;  1BMV 1;  1Q56 A;  2W92 A;  4XBN A;  2D3R A;  5JXJ A;  3MV0 1;  1K5M B;  2WAO A;  1QXR A;  3WLU A;  1C28 A;  3PNA A;  2QQM A;  1QJY 1;  4QPI A;  2J7M A;  4CCD A;  5F37 A;  3BUC A;  1B35 B;  2QZ2 A;  1CPM A;  1RUC 1;  1TME 1;  1W90 A;  4L99 A;  4O7X A;  1BQP A;  3FLR A;  2JWP A;  5FPZ A;  4RS5 B;  4PDW A;  1X9T A;  1UYY A;  4XJ9 A;  2N7G A;  4Z07 A;  1XU2 A;  3I59 B;  4ASK A;  1V9U 3;  1AJK A;  1PK6 C;  1QIQ A;  4QPG C;  3VD4 A;  5JR2 A;  1L7L A;  1RUH 1;  1MZ5 A;  3NNF A;  1W2A X;  1NY7 1;  1RVF 3;  1SBE A;  1UKR A;  2RS3 3;  3D6E A;  3ES1 A;  1VPH A;  3M3C A;  3MV1 1;  4ASL A;  2AZ5 A;  1UYX A;  4PF5 A;  1R64 A;  3U07 A;  1A8D A;  2JEC A;  3OEB A;  2KM2 A;  3KCX A;  4DFS A;  4UBH A;  1JZ2 A;  2BGP A;  2RVA A;  5A32 A;  2OUH A;  2VMH A;  4QB1 A;  5KWR A;  3KCY A;  3VGI A;  2LRO A;  2L9L A;  2JG8 C;  4EN6 B;  4YWA A;  4I3P A;  5AVA A;  1RUN A;  4AI1 A;  3R0R A;  2OT7 A;  2OA2 A;  2EAL A;  3LF7 A;  5JZG C;  4LLF A;  1WCU A;  4NHK A;  1AR9 2;  3NKG A;  2W87 A;  2WAA A;  3FX3 A;  5GLU A;  1FAY A;  2WQ8 A;  4CPB D;  3AMQ A;  3U4X A;  3WF1 A;  4CCO A;  4GMP 0;  4Q4X 3;  5FYT A;  3CEW A;  3KHC A;  2E7A A;  1OPO A;  2ATF A;  4LR4 A;  2DFB A;  4QX5 A;  3ZIX A;  5FXW A;  5BUV A;  3POG A;  4S2F A;  1D4M 1;  3NNJ A;  3QCW A;  4B4R A;  5C70 A;  2WUH A;  3DF0 A;  1SQ4 A;  5KHH A;  4M01 A;  2JE7 A;  3LA3 A;  5FTT C;  3TNP B;  3WVJ A;  2D43 A;  1HJF A;  2CYF A;  4K8R B;  1OBN A;  1RMU 2;  5GM0 A;  1RGS A;  2WNV B;  1SHW B;  2YGL A;  4RL7 A;  5LY2 A;  1WW5 A;  5C8C B;  2A3Y A;  2XVG A;  4V2W A;  5B2G B;  5L9R A;  1NLQ A;  1VMH A;  2HWB 2;  2MEV 2;  2ZCW A;  1W0P A;  2SBA A;  3WCS A;  2VNG A;  5BV6 A;  1TZO A;  2E63 A;  1G86 A;  5L7O B;  1MPX A;  2JDK A;  4I0W B;  2Q4S A;  5F5Q A;  4CDQ A;  2YYO A;  5E16 A;  2BVV A;  4FPO B;  4XVH A;  1QJU 3;  3BTX A;  3GF6 A;  4TXW A;  2DV9 A;  4BMB A;  2DYC A;  3E1F 1;  5GZF A;  4EZ4 A;  3HVD A;  4FOQ A;  4P9Y A;  4Q1R A;  3T0B A;  3LPG A;  3T09 A;  1EY2 A;  1LB2 A;  4IL7 A;  1HX6 A;  4ZU4 A;  1H4G A;  5FYU A;  1KQR A;  4HON A;  1CGP A;  4LQR A;  2GMP A;  5KXB A;  1DGW X;  2RDR A;  1XSR A;  5KHG A;  2JDN A;  1UAI A;  3APB A;  3R6S A;  3N35 A;  3UJQ A;  5ISL A;  2ENR A;  5FXZ A;  5GLV A;  5HXV A;  2VH9 A;  2C26 A;  2YZ4 A;  2ADD A;  2PA7 A;  3N9M A;  4MAD A;  5FPX A;  5FLI A;  1QJX 3;  1KEX A;  3SEP A;  1JYW A;  1H6X A;  4KG0 A;  4XUQ A;  5J96 B;  2BGC A;  4ZY9 A;  1ZX5 A;  3KT1 A;  4CZS A;  4QPG B;  1WZX A;  2BZD A;  1AYN 2;  1KFX L;  3JUU A;  1BYH A;  3VDB A;  4BJ0 A;  1GQG A;  4GH4 B;  1SCS A;  4A45 A;  1O7F A;  5A6Q A;  5CKM A;  4HK9 A;  3FZ3 A;  2ZEZ A;  4IXL A;  5C4W C;  1WCS A;  2DCJ A;  4R9D A;  3NJX A;  3NVC A;  4CCN A;  2AEZ A;  1D4V B;  1O59 A;  3GBG A;  1DIW A;  2EXJ A;  1MQT A;  1JZ4 A;  5F9T A;  1XNA A;  1YLL A;  2D98 A;  3NO8 A;  4YNI A;  3ZDS A;  5C7G A;  1AX1 A;  3ETQ A;  4L11 A;  2X09 A;  4KBZ A;  2Y60 A;  2JG8 B;  4CDW C;  1IKP A;  5A1L A;  1GP4 A;  1JUH A;  2VG9 A;  1U5Z A;  4DRV A;  1U5X A;  1LNS A;  1AR9 1;  4N8M A;  1QXP A;  3AMN A;  1HN1 A;  3O12 A;  2LS6 A;  1RUE 2;  2J1U A;  5I8S A;  2LTN A;  1LHO A;  5FV3 A;  3ZVX A;  4E8D A;  3BTY A;  1S55 A;  3O5S A;  2R07 3;  5DXD A;  1JUI A;  2HWC 2;  5IWF A;  5FQ0 A;  5IK8 A;  2XLA A;  3NV3 A;  4S2D A;  4MGT A;  1GV9 A;  1KRI A;  1UU4 A;  5FAX A;  3V0A B;  4YG6 A;  4A2U A;  3D5O A;  5A33 B;  3LQC A;  2UUR A;  4QX3 A;  4LBL A;  1J59 A;  5T5O A;  5LBF A;  3H8O A;  4HBN A;  3BGA A;  3J26 N;  5JAX A;  1IG0 A;  4EN7 B;  2HEV F;  1OQE A;  1GOG A;  3HQU A;  1RMU 1;  2JIG A;  2Q1F A;  4PLN A;  3H3L A;  2WT1 A;  1IG3 A;  4YM0 A;  3Q8A A;  4S2H A;  5GZD A;  4COW A;  2W52 A;  4SLI A;  5A3L A;  1AYM 3;  2ZKN A;  3FJS A;  4QX8 A;  1PZ9 A;  2J22 A;  3MO4 A;  2HWB 1;  2MEV 1;  1OLQ A;  1S0D A;  2YBS A;  3MYX A;  4AHZ A;  2C9A A;  3WP3 A;  3T1L A;  2RM2 2;  2W1Q A;  4B7E A;  4CSW A;  4XHB A;  2WQ4 A;  2FMD A;  3MIE A;  5FP9 A;  4M00 A;  1WCD J;  1DG6 A;  5BNP C;  2BGO A;  3BPZ A;  4BU2 A;  4Y1U A;  1MZ6 A;  1UZ0 A;  3TRS B;  2Q1M A;  2VUD A;  5DUV A;  1NXM A;  1UZY A;  3LIG A;  4AED C;  3ETP A;  4AVS A;  1UWW A;  3MI8 A;  4BE3 A;  1NA1 C;  3JBG 3;  5IYY A;  3CZJ A;  2XPJ A;  3OBT A;  3POF A;  2F17 A;  4XTM A;  3O1M A;  3E6C C;  1NAE A;  3O0W A;  2Z2S B;  2GDF A;  2Q8O A;  4HPK B;  2XKO A;  2CAV A;  2OZJ A;  5FMB A;  2GAU A;  2B45 X;  3GZA A;  4DS0 A;  1VRH 2;  3WV6 A;  3LIH A;  3BAL A;  1V6J A;  4OUE A;  4UFI A;  5JSR A;  4XHX A;  1QH6 A;  1AYN 1;  2ZZQ A;  2W1S A;  1WUV A;  3OY8 B;  2UU8 A;  1GKB A;  2Z5W A;  1PK6 A;  5FYY A;  4HN1 A;  4GAZ A;  4UAP A;  4UYB A;  3THC A;  3WDX A;  5F7U A;  3HR9 A;  1Q8V A;  1SLB A;  2FCT A;  2JEM A;  3H42 B;  4YVW C;  5FUI A;  4E4S A;  5C4W B;  2ET1 A;  2PAE A;  2VME A;  3ASI A;  3OF1 A;  4XUP A;  4KGG A;  1YIF A;  1UN1 A;  5KR7 A;  4ZU5 A;  4OUS A;  3UK9 A;  2FDF A;  4TSV A;  3PHM A;  2NZ9 A;  1RXF A;  2FCV A;  2XXZ A;  1KJL A;  1K5J A;  3W5M A;  4AI8 A;  3HQR A;  4DXT A;  1HB3 A;  2IXJ A;  3HMY A;  2HWE 2;  4PBP A;  4CDW B;  2IXL A;  1G9F A;  1Q3E A;  1I5P A;  2VZR A;  1DBN A;  2XJT A;  1H8T C;  3H50 A;  4QXC A;  4EWA A;  1WBL A;  2YBK A;  3O1T A;  2GP5 A;  4UF0 A;  5JZG A;  5HPO A;  3UJO A;  4A44 A;  1RUO A;  2BNM A;  2HWC 1;  1OI6 A;  4C0B A;  3KV9 A;  5AC9 3;  4CCK A;  5ABJ C;  2WWJ A;  4KWU A;  5JI9 A;  4XF4 A;  1DQ4 A;  1SBF A;  1TQ5 A;  1ZA7 A;  3EB7 A;  3U0Z A;  4JGZ B;  1PO2 2;  4CDX B;  4F8A A;  2PLV 3;  4ZS3 A;  2VM9 A;  4BXS V;  3VD7 A;  4RQP A;  2W95 A;  2VQT A;  1LOF A;  4Q1P A;  5F6L B;  1ND2 A;  4OI2 A;  1UQX A;  4FPY A;  1MZE A;  1Z0H A;  2X5I A;  3UKT A;  1RUI 2;  2ZGR A;  4DUV A;  2EXI A;  3I3Q A;  1GFF 2;  3DCQ A;  4IE6 A;  3FBY A;  4EJR A;  5DAP A;  1OVS A;  4OUL A;  4D6R A;  2PMW B;  4FCA A;  3AC0 A;  1UD1 A;  2ARE A;  2XHN A;  4IUG A;  1DZR A;  1V6I A;  2FD8 A;  3WQB A;  1JZ7 A;  5BNP B;  5LEJ A;  3VZJ A;  3NJY A;  1NT0 A;  2WAB A;  1I6X A;  1WW6 A;  1W9W A;  4AED B;  2D7F A;  2GNB A;  4QXK A;  3VB9 A;  3JQW A;  1Z7S 2;  2BWA A;  1HRI 3;  2GC3 A;  1LU2 A;  5KC5 A;  1H6Y A;  4BME A;  2WJS A;  3OEA A;  2FDI A;  1T6G C;  1W8W A;  2GN3 A;  1F2N A;  1KS4 A;  1LOE A;  1ASJ 3;  2QQK A;  1OKQ A;  3ABZ A;  3SC7 X;  4CUG A;  3KF5 A;  1W6M B;  2ETE A;  1A8M A;  3EYP A;  3WEZ A;  1VRH 1;  1GP5 A;  4BCU A;  4MG2 A;  4DZG A;  1H4H A;  4YGB A;  2RMU 2;  1POV 1;  3AVS A;  5F6K A;  2DCZ A;  3ZYH A;  2PTM A;  1S0E A;  3OSD A;  2FHR A;  4FPJ A;  4EN9 B;  2ZMN A;  3AK0 A;  4MVT A;  1TMF 3;  2DCY A;  3ZOI A;  1PMI A;  4XZP A;  4L97 A;  5I0D A;  1ENS A;  1WLT A;  3AKT A;  3WQ7 A;  1GZW A;  3INA A;  3AP7 A;  2O1Q A;  4XF9 A;  2JDM A;  1QKQ A;  2XON A;  4P14 A;  3S6P A;  3TEZ A;  2J1V A;  4GWM A;  5KBF A;  1FMD 3;  1R09 2;  1I5Z A;  2PQQ A;  4MXV A;  1VB4 A;  4AE2 A;  1AR6 3;  2HWE 1;  3VL8 A;  3K75 B;  4UFK A;  4LO7 A;  1AUY A;  4J6G A;  3RDI A;  4A42 A;  1ULD A;  1H8T B;  5J1X A;  5HBA A;  4UI9 L;  4QDR A;  1SMV A;  1LHV A;  1HV1 A;  4R9B A;  2CGO A;  1AHS A;  1R1A 3;  5JXG A;  2WKK A;  5JUV A;  4DY5 A;  2A6Z A;  3BTZ A;  5FZL A;  2K0G A;  3GNE A;  4ARY A;  1ACC A;  4DEV A;  4LO5 B;  5T5J A;  3DXT A;  1ZZ9 A;  4GJY A;  1PO2 1;  1ZRR A;  2XML A;  2XL9 A;  1Y43 B;  1AVB A;  3ST7 A;  3DV8 A;  1FAT A;  4XIO A;  5CU1 A;  1FNZ A;  3LKJ A;  2ZAA A;  2AH2 A;  3LWC A;  4H14 A;  4BQ5 A;  2JIC A;  4ZZ5 A;  1RUI 1;  4CUC A;  1GUI A;  3CJI C;  1E5I A;  4XJU A;  2RDN A;  2C9K A;  2DBI A;  2RS1 2;  4FPG A;  2IXH A;  4HVO A;  3POI A;  2VD7 A;  4LA2 A;  5FO7 B;  3DKW A;  4BQ2 A;  3LOB A;  4Q0Q A;  2PHR A;  1UF2 C;  2WII B;  3TN9 2;  4Q4W 3;  3D0S A;  2W68 A;  2YPD A;  2VTF A;  2ZGN A;  5IVJ A;  1M06 G;  3PUR A;  2JKX A;  3ON7 A;  2QUO A;  5LAS A;  3V56 A;  5K7P A;  3CJX A;  4XCB A;  4Q4Y 2;  4LBN A;  4LIV A;  5IVY A;  1CVN A;  4Y1X A;  3SMH A;  3L9J T;  3GAL A;  4DUX A;  4CCJ A;  2OS2 A;  2ZJC A;  2W47 A;  4I30 A;  3CF6 E;  4KWJ A;  4RSU A;  2MHF A;  2R04 2;  5LRR A;  4COZ A;  1RED A;  4E9K A;  1Z7S 1;  1IS3 A;  3VBO B;  2WYS A;  2QQJ A;  5J7M A;  1ZBA 2;  4I09 A;  3NL1 A;  3LDR A;  1WCQ A;  3MUZ 1;  2ZHK A;  1APN A;  1MS4 A;  3SLI A;  2RMU 1;  1ZZC A;  1O8P A;  1VRB A;  5BNO C;  1O5L A;  1PO1 3;  2BP6 A;  4LKS A;  3D8C A;  1GOH A;  2WS9 3;  2WZR 2;  4GXL A;  1GMM A;  2UWC A;  1LEN A;  3FE5 A;  2V72 A;  4XF3 A;  3GM8 A;  2WNE A;  4ISQ A;  2ORX A;  1D0H A;  3AZW A;  4HSJ A;  3WDW A;  4HKW A;  3I3M A;  2HWD 3;  2D6N A;  3MLL A;  1L3J A;  5FMO L;  3S30 A;  1DQ1 A;  1SCR A;  4LUK A;  3NJZ A;  1R09 1;  4P02 B;  4NWV A;  3EHK A;  5CA6 A;  1CAV B;  2XVK A;  5CFC C;  1K3I A;  1OD5 A;  4CDU C;  5JXI A;  5DAX A;  3P1I A;  5KHK A;  1QJF A;  2BQP A;  3ZFE A;  4NIA A;  4AHW A;  4TLG A;  4CCE A;  4IV3 A;  5LB6 A;  5J48 A;  5FPL A;  4AOC A;  5GZC A;  3OD4 A;  2ZGL A;  3B9C A;  4DXZ A;  3B9I A;  3GYD A;  1ENQ A;  3WIN E;  2P17 A;  2XWJ B;  2VUC A;  3IWZ A;  3Q8B A;  3KVB A;  4HN0 A;  5FKB A;  4CP0 A;  2DDU A;  1RUF 2;  1J3P A;  4OVE A;  3WXP A;  2P37 A;  3N9L A;  4QXB A;  5FZH A;  4CU9 A;  5KHI A;  2W9X A;  5EXO A;  1O3T A;  1W6P B;  3O1U A;  5GZE A;  3BIE A;  4RYD A;  1BEV 3;  2RR1 2;  2RS5 2;  1GQH A;  3AP4 A;  3WG2 A;  3WP6 A;  2HYK A;  1WMX A;  5GZG A;  1REF A;  3UET A;  1BBT 2;  2WA4 A;  2VOT A;  1IQA A;  4AI3 A;  4Z2A A;  4WZC A;  1PIV 1;  3TB0 A;  1RUD 3;  2RS1 1;  3J7N A;  4P9G A;  3H1W A;  1LES A;  4JZR A;  3HN1 A;  3RYR A;  3VBR A;  4YM3 A;  2A3W A;  4WM8 B;  3TN9 1;  3MIB A;  3S57 A;  2P3J A;  1HW5 A;  2RJK A;  3JU9 A;  3VBS A;  5EJ3 A;  2Z69 A;  3OPW A;  2Y6J A;  2YUE A;  5E89 A;  4Q4X 2;  5BNN C;  4CA9 A;  4MSV A;  1F5F A;  1CAX A;  3KLS A;  4RR3 B;  1M4W A;  2VL4 A;  1HXS 2;  4G3Y C;  4RHV 1;  4YW5 A;  3WY6 A;  1IHM A;  2GC0 A;  1ZA4 A;  4H3W A;  4DB5 A;  2QE3 A;  2ES3 A;  1GAN A;  4QPY A;  2R04 1;  2D6O X;  3ALQ A;  5A6Y A;  2OUJ A;  2ZGO A;  3I3D A;  4YLZ A;  1GWK A;  1VBE 3;  1SG3 A;  2VW0 A;  3HNB M;  1ZBA 1;  5LW9 A;  4N7U A;  2HBU A;  4Q27 A;  1FI2 A;  2AAC A;  3OUJ A;  4LK6 A;  4BIS A;  1W0N A;  4W65 A;  2VNO A;  3M7A A;  3OGG A;  1DDL A;  1AXK A;  2YC4 A;  5FZO B;  5BNO B;  1RB8 G;  2CGP A;  2WZR 1;  2ZEW A;  2G4I A;  2GNM A;  3WUC A;  1D7P M;  3AFK A;  3PU8 A;  5C9A A;  1MS1 A;  1QJU 2;  3NRU A;  3USU B;  4AHY A;  1LEM A;  3JZV A;  4IEY A;  1UYP A;  2JG9 B;  4B8E A;  3RZL A;  1PM7 A;  3GBW A;  2XJQ A;  1W6N A;  3AKQ A;  2XJR A;  1OT5 A;  4U36 A;  1W9S A;  1RHI 2;  2WFF 3;  1Y9G A;  3T4V A;  3WUD A;  3LD8 A;  4CDU B;  1ULP A;  3ZPY A;  4FOW A;  1QDO A;  1X8E A;  1OOP C;  4COV A;  4AFC A;  2PHT A;  3VHR A;  4CUB A;  3Q8F A;  5M0T A;  1N3Q A;  4J1X A;  4AQ2 A;  1RJ8 A;  5FZ9 A;  4AAP A;  4AEK A;  3KM5 A;  4Y5T A;  2QQL A;  4XFI A;  1CES A;  2BVB A;  4XF0 A;  1W6Q B;  2CWS A;  1RUF 1;  1UIJ A;  5EZW A;  3TOJ A;  2XGX A;  3N9P A;  3ZSJ A;  1O6U A;  3W9A A;  1VIW B;  3T2T A;  4FP2 A;  2ID4 A;  2RR1 1;  2RS5 1;  2WLQ A;  1YFY A;  1GNH A;  1QMJ A;  4MGS A;  4P9X A;  1BBT 1;  5CEH A;  4A7Y A;  3WNK A;  4KQ7 A;  1NCR A;  1W9Y A;  3IKW A;  1S2B A;  4GJZ A;  3DKQ A;  3GXU A;  3Q8E A;  4LA3 A;  1B09 A;  1UZW A;  3CJI A;  1POV 0;  2I45 A;  1GSL A;  4PT6 A;  3ZXA C;  1EUU A;  2WZ8 A;  4XBL A;  1C57 A;  1O4T A;  2KA3 A;  4NMI A;  1ZBE 1;  5A3T A;  5C6C A;  3O1S A;  5A7N A;  2BNO A;  1HXS 1;  4CEW A;  2W1W A;  4CU6 A;  5FWJ A;  3POB A;  3LFI A;  2NN8 A;  4AF9 A;  2CTV A;  2E51 A;  4YVS A;  1HRV 3;  5JSP A;  3UKV A;  1B35 C;  4FSJ A;  3P5B A;  1LHN A;  3FLT A;  1FYU A;  2ZEY A;  4LBQ A;  4LKE A;  4RS5 C;  2KXL A;  3AZV A;  1YFX A;  2BTV C;  2IVI B;  3J7L A;  4K1Y A;  5DDJ 3;  5G05 L;  2B4K A;  5GLW A;  1AYM 2;  2DVD A;  1PGL 2;  4QX2 A;  1AR7 2;  4EWE A;  1AXY A;  5IVB A;  3IB3 A;  3CKH A;  3R4U A;  5EQU A;  2AUY A;  4Q4V 3;  1O5U A;  4JGY B;  2JX9 A;  4PIZ A;  4QM9 A;  2RG4 A;  3K3N A;  3ZIW A;  3ZM8 A;  4AGV A;  3GZE A;  4COY A;  1G9C A;  2Y6G A;  4QKF A;  4QKD A;  5C71 A;  1NQD A;  1N1T A;  2E9Q A;  3SIS A;  1ALY A;  5BPX A;  4UFH A;  1S0G A;  1DYK A;  3GCX A;  3W58 A;  3TWI A;  4NII A;  4Z8B A;  4YFW A;  5ACA 2;  2VOW A;  1U5I A;  1NKG A;  4QT6 A;  2Y6H A;  3ZXE A;  4WZF A;  3BN6 A;  4FTB A;  1NZI A;  2JDH A;  2CV6 A;  2XJU A;  1JZ5 A;  1MVE A;  4XAE A;  1CAU B;  5C3O A;  2NQY A;  4UOJ A;  1UY0 A;  4YG0 A;  3JBG 2;  5EHD A;  1RHI 1;  1ZVF A;  3ZXK A;  3WDY A;  5JLV A;  1W3V A;  3ZSL A;  1F35 A;  1YEW A;  5DUU A;  1S0F A;  4QHB A;  1CJP A;  1GNY A;  1OOP B;  1JOB A;  1TNF A;  1TG7 A;  3A0K A;  3I4I A;  4NHM A;  3WHT A;  2VTX A;  2XL7 A;  3AJY A;  3GJA A;  4XPV A;  1OFS A;  5A32 B;  4JAA A;  1BVV A;  5BY5 A;  3VKL A;  1DGW A;  3KVA A;  3H8U A;  1IS4 A;  1W28 A;  2BDR A;  1VBA 2;  4H7L A;  3S7I A;  2WNV C;  5E6H A;  5IFT A;  5JCT A;  5C8C C;  1V00 A;  1DQ0 A;  3A22 A;  3NV4 A;  3TEW A;  4D3W A;  2QDN A;  4GMP 3;  4PJY A;  2ZGU A;  4V2V A;  3I7D A;  1Y3T A;  2R49 A;  5L7O C;  5JI7 A;  2IFR A;  4QB2 A;  5LRS A;  1VB2 A;  1W2T A;  1YJL A;  3SIT A;  1LOA A;  4IGQ A;  4PIX A;  2O8O A;  5F3C A;  4XQW A;  4JKM A;  5FBJ A;  3FWE A;  4JDO A;  4FAH A;  2XDV A;  3ZFG A;  3VBU A;  2H0B A;  3M2M A;  1AL0 G;  1W8Z A;  3KQR A;  3LEG A;  5CIR A;  3O14 A;  4QMA A;  1YQ6 A;  4QM8 A;  1OLR A;  3ENR A;  4XJZ A;  5GLZ A;  1UZV A;  1ODM A;  1RTV A;  3PTY A;  5BNN A;  1RUG 2;  4BQY A;  4R52 A;  1AL2 2;  2YB7 A;  3IAP A;  3USS A;  1DHK B;  2K2S A;  5T3N A;  3POS A;  5HI0 A;  1OUX A;  3DYP A;  4X8N A;  4CDQ B;  3OTF A;  1G6N A;  5DG2 A;  2EIE A;  2K46 A;  3ZN5 A;  4WVM A;  3VDD B;  4BK4 A;  4NN0 A;  1AR7 1;  3ZLI A;  1QGL A;  4ES9 A;  4JVA A;  4GH4 C;  4FOV A;  1UOG A;  2QVS B;  3KF3 A;  4X8P A;  4XMI A;  4YZ2 A;  1H9P A;  5GAL A;  4LHS A;  3OUH A;  4Q0V A;  5SV8 A;  3ZXJ A;  3OGS A;  1BXH A;  4TLF A;  2EVX A;  1UYZ A;  5H9P A;  3PJQ A;  2JDY A;  4IE0 A;  2QCS B;  4MX3 A;  5DAQ A;  1J3R A;  3KWV A;  4HAN A;  1PGW 2;  1EUT A;  5ACA 1;  4CP9 B;  1LHW A;  3IMM A;  4MET A;  3AP9 A;  3FLP A;  3J8F 2;  3VLB B;  3III A;  1FPN 3;  3O0X A;  3ZFF A;  2H0V A;  1A78 A;  3HD8 B;  3OBA A;  1G9B A;  4YPJ A;  2BW8 A;  4OLL A;  1HRI 2;  4LO6 B;  3K77 A;  4P5Y A;  4QQL A;  3RSJ A;  3I8T A;  4C90 A;  5A1F A;  1D0G A;  4LOR A;  5L9B A;  5A3W A;  2ZAC A;  1PM4 A;  4Z82 A;  5DAV A;  2QQU A;  3FHI B;  5A7W B;  1DZT A;  2HH9 A;  3M3E A;  1VBD 3; 
#chains in the Genus database with same CATH homology
 4LK7 A;  4LKF A;  2LRP A;  3F95 A;  4LKD A;  2KR2 A;  3ZYF A;  1W8T A;  2O14 A;  1W8Z A;  1UOJ A;  1HN0 A;  1W9F A;  4AL9 A;  4CP9 B;  1GWM A;  2VXJ A;  1WMX A;  2Q1F A;  4LJH A;  4A6S A;  4BQ3 A;  2LRO A;  4YWA A;  1GWK A;  1W90 A;  2C24 A;  1W8W A;  1W8U A;  2WYF A;  4BQ5 A;  4CP9 A;  2JWP A;  4LKE A;  1OKO A;  3UT0 A;  1WCU A;  4YW6 A;  1GWL A;  2K46 A;  3ORJ A;  4YW7 A;  4LK6 A;  1L7L A;  1V0A A;  4BQ2 A;  1WZX A;  3ZYH A;  4CPB D;  4BQ4 A;  4CPB A;  1OH3 A;  5D21 A;  3ZYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...