1GWKA

Carbohydrate binding module family29
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
141
structure length
141
Chain Sequence
b'RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
molecule tags Carbohydrate binding domain
source organism Piromyces equi
publication title Promiscuity in Ligand-Binding: The Three-Dimensional Structure of a Piromyces Carbohydrate-Binding Module,Cbm29-2,in Complex with Cello- and Mannohexaose
pubmed doi rcsb
total genus 27
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1gwkA00
2LRPA 3ZYBA 4BQ4A 1L7LA 4LKFA 1WCUA 1W9FA 1OH3A 4YW7A 1W8WA 1W8TA 2Q1FA 4LKEA 4YW6A 1W8ZA 1W90A 1UOJA 1OKOA 1WZXA 2JWPA 4CPBA 4CP9A 4BQ2A 1GWMA 2WYFA 1WMXA 3ORJA 4LK7A 5D21A 3ZYHA 4AL9A 4BQ3A 2KR2A 2O14A 2LROA 4CP9B 3ZYFA 4BQ5A 4LJHA 2K46A 4CPBD 3UT0A 1GWLA 2C24A 2VXJA 4LKDA 1GWKA 4A6SA 1W8UA 4YWAA 4LK6A 1HN0A 1V0AA 3F95A
chains in the Genus database with same CATH superfamily
1QJY1 1F15A 1YJKA 2V5YA 3FHQA 3V0AA 1FYUA 4MSVA 4XUQA 1W8TA 4FPFA 2WZR3 3AVSA 1QNWA 4LPLA 4OHZA 2OS2A 4Q4X2 5C6CA 1YFYA 1RJ7A 2E9QA 3JBG1 2HWE1 1Z7S2 1DQ6A 5C5UA 4ZXKA 2GH2A 2XUMA 1S2KA 1ZRDA 4CRQA 1YFWA 1ZBA1 1VBA2 2B46X 1NX9A 1QJFA 1UYXA 2IFWA 1QH6A 2QQJA 3OGJA 5DN2A 2ZPXA 2FDFA 2NPIA 4DMIA 4UBHA 2R073 4LR4A 4BLJA 2DVBA 4WM8C 3S57A 2XONA 4IV1B 3OD4A 4XEZA 1UZYA 2Q8DA 4JGYC 1W04A 3F2ZA 1O3SA 5JMOA 4V2VA 2ZGRA 4OHWA 2RR11 1W8WA 2J1UA 2UURA 3GZTB 4V2WA 1H2KA 1RMU3 5K0UC 5JXJA 4AEJA 2J22A 1WLTA 4TYSA 2OQ6A 4Q5OA 3S5QA 1OLRA 4XUTA 2RDQA 1GOFA 2WWUA 2Z4FA 3UETA 4RHV3 2XLFA 2Q8CA 3SMHA 3D0JA 1C3HA 4Q4V2 1QF3A 4DRVA 1CWPA 4ZONA 1YUDA 1YWKA 1HQWA 2ZBJA 3BOPA 4MGZE 1PGL2 2RJKA 1EV11 2UYBA 3D5OA 1JZ2A 2VUDA 5IYYA 4TTGA 3ASIA 3LFIA 1KD7A 2B8MA 2WZEA 3AVRA 1PMHX 1ODMA 5GLWA 4UWDA 1AX1A 2PQSA 4AQ2A 4OZXA 4NRQA 4LLFA 4XF0A 5G04L 1DU3D 4Z92B 2MNGA 4QHOA 4LTAA 1VBD2 1DGLA 4QU1A 3DUIA 5E6HA 1O3TA 4FPLA 2XOMA 1APNA 1UY3A 4YARA 2CNAA 1VMFA 1RUJ2 3A0KA 3B93A 4INDA 3O1SA 2JD4A 1EUUA 4PBOA 3OD0A 4BQYA 3HPNA 3I2HA 5IK5A 1G86A 1WA6X 3FUQA 4LE4A 1KFXL 1CAXA 3U11A 1ZZ9A 2A3XA 3ZR6A 1HB2A 3P5BA 1XYOA 5FXVA 2VUJA 3KF5A 3WNXA 5CU1A 3WW1A 5DAXA 2O8QA 3BPZA 3VBUC 2LROA 5DUVA 3K2OA 3E6DA 4Q4Y3 2B4KA 3POFA 5L73A 5I8TA 1JI6A 1GQGA 2BRTA 2V4VA 4YW3A 2QQOA 2OKXA 1BQPA 3GJBA 4DB5A 2NMNA 4AXOA 5JSOA 3DXTA 3POJA 2P6CA 3WP3A 3T1MA 1JYIA 1XBFA 2ZEZA 2XHNA 5FYBA 1RUH3 1DHKB 3ZYIB 2JG8A 3CL1A 1QKQA 2IXLA 1RXFA 4EJRA 1SDDB 2ZGNA 4ZZ5A 1J3RA 4IGPA 2BVVA 1MEC1 5F5AA 3B01A 3PTYA 4OI1A 1A6CA 4ARYA 2Q30A 4JKLA 1O5UA 3RZJA 3KD4A 4GQ7A 2FZ1A 3CKHA 2X05A 3KHCA 4B1LA 1GP5A 4CU7A 1TNRA 4CSWA 4D3WA 2C5DA 1VRH3 3LA2A 5I0UA 3WDWA 4HKWA 4OHYA 3H1YA 1VLNA 2BWAA 2Y6JA 5FYMA 1ND2A 1W6MB 2ENRA 3ILRA 1NE4A 1UKRA 1YI7A 2NMOA 2W68A 2XBO3 3AB0A 4P02B 4A42A 3SXWA 2WO2A 2C26A 4QKFA 5CFDC 3HT1A 1W28A 3WG1A 1F2NA 4YW6A 5IVEA 4I0BA 4QQOA 1MS5A 2I45A 1DFQA 1LHOA 2ID4A 4LBNA 5BNOB 1YCIA 2RDSA 4CEWC 4I3PA 4OMDA 3K77A 2ZGKA 4JDNA 2NYYA 3N9PA 3MBWA 5T55A 1N3QA 2J1TA 2Q8OA 2D40A 1W6NA 1FPN1 5DXDA 3H8RA 1Q43A 1YO8A 5T50A 3GZUC 4XILA 1O8SA 3JBG3 4HKOA 4QDQA 1WCSA 3DGTA 1LAJA 5FUNA 1PGW2 4HXCA 2VMEA 1SDWA 2HJIA 3BGAA 3A7QA 3AP7A 1BK0A 2I2SA 5A6XA 3ZMNA 4Y1UA 2XL7A 1WCUA 1V6JA 3OCPA 3MF6A 2BW8A 1XXNA 3DKQA 4AI8A 1S0BA 1LOCA 4QT6A 4PI0A 4E8CA 4UFMA 4F83A 5KC5A 5HCHA 3O1OA 1VBC3 1RHI1 2RM23 3FN9A 1WGPA 1KQRA 4H55A 2BOJA 3WD5A 3WDXA 5FY0A 3AP6A 1O8PA 4MGIE 1WBFA 2B9UA 3RZKA 5C3OA 3RSJA 3RDIA 4WZFA 1JYCA 4NIDA 3RMXA 2WNVC 2XQXA 2DVAA 3HQXA 3LQCA 2CY6A 4P5HA 2Z79A 3BTZA 5CG9A 2HYKA 2YUEA 4ZPIA 5LASA 4WZCA 3J4UH 1C8NA 2BGOA 4GWNA 5H9SA 3OGSA 5EV7A 5B4XA 5J36A 4FQZA 2Q4SA 1AR73 1RUF2 2YU2A 3ITQA 1WW4A 2KA3A 1OQEA 2GC3A 3U14A 4MZUA 3RWKX 2Q1ZB 1VAMA 4MV2A 3TRSB 4KWLA 5AFBA 3HBKA 1SHWB 3PL0A 4C91A 1RIRA 2QQLA 5IVYA 5FY9A 4BU2A 2XKOA 2ZACA 4QU2A 5H9RA 2ZX3A 4JCKA 5GM0A 4Q8KA 2E7AA 5JAXA 3WNPA 4BWOA 1UKGA 2GC2A 2VZVA 2FQPA 3PDQA 2QQVA 1PGSA 3H3UA 1IQAA 2BUKA 4MGYE 4IDZA 4YM2A 3VDAA 4DXRA 3T0DA 4G4FA 4I3GA 4Q4X3 3H1WA 1R1ZA 5KXEA 2XJRA 1ZYBA 5DAVA 2D5FA 2EIEA 1GNZA 2WT2A 2VPVA 3WDYA 5KBFA 3WG4A 4W8JA 4PIXA 3I2GA 4DY3A 3T0BA 1D4VB 3O7OA 1WLCA 4QWNA 1WZXA 2BJSA 4K3UA 4YM0A 3LOIA 3RJRA 3WSOA 2NM1A 3HNBM 2VMHA 4JHTA 5C4WC 4AOCA 4XXAA 1ASJ3 1B35C 1I3HA 1EUTA 1UWWA 1UU4A 3C7OA 3E5QA 1ZZ8A 3LEGA 4H7MA 4Y26A 3DPRB 4BDVB 1KITA 1YFUA 5F3EA 3IIAA 3FL7A 2WA3A 4DEVA 4LBQA 3ZYPA 2XJUA 3CU7A 1W0NA 2DVGA 4QX8A 1ULDA 3UESA 4BMBA 1RC6A 2PN5A 2ZGSA 3J7HA 3AP4A 4HSJA 4NE9A 3GBWA 2RS13 1E5HA 5E8AA 3JD72 2BU9A 1X9TA 5FYTA 5ISLA 1W9WA 4LA2A 2G4IA 4P9WA 4LO5B 2ETEA 1VE0A 3AZWA 4MX3A 4BJ0A 2YBPA 3ORJA 4B8EA 2AZ5A 1IKQA 3KVAA 1DDLA 3MIDA 4LMFA 1AZDA 2HWF3 5I93A 4WVMB 4QX0A 4DXSA 4HONA 4EWEA 3R4UA 5CKQA 5FY5A 1H2NA 4Y5SA 2PAKA 2WAOA 1H9WA 4NO4A 4P00B 3KB5A 3WQ1A 4JHZA 1RUC2 5FZDA 4I2OA 4R9DA 3VBSB 4BQ4A 5JWPA 3HNMA 3MICA 3N9LA 2HWD2 4I0AA 5GLVA 5F5IA 4BQ1A 1AL22 5KXCA 4I0WB 3J8F1 1FV2A 4BK4A 4CUCA 1OOPA 3MFAA 4EN0A 2VZ3A 1KRIA 1BVP1 1RUI1 3THTA 3ATGA 4IV3A 2RE9A 3V65A 4KBBA 3DKWA 4PT6A 3U78A 2R061 4BQ3A 3C7FA 4TZDA 3HEIA 3JBG2 1JOJA 1AR91 2OUHA 3O0XA 4M4RA 4COYA 1WLDA 4CCNA 2P37A 2A1XA 2R49A 3RMYA 1AX0A 1CAVA 2C4XA 3V0AB 1UD1A 1H2LA 1ENQA 1SCRA 2YZ4A 5T52A 2AGSA 3EBRA 5FZ8A 5A7QA 2ARCA 4FPGA 3UK9A 2AEZA 1AR62 4JKMA 4ZU7A 3HT2A 1AYN1 2QDRA 3VBFB 2WT1A 3NJXA 4G9SB 4HOOA 4LIVA 2C1FA 2ZMLA 3PUQA 2VU9A 4Q29A 4PDWC 3SKVA 2DFBA 2XDVA 2VQAA 5C4WB 4CDQB 3ABZA 4LBKA 4Y20B 1C8M1 2DBNA 4XVHA 3ZYHA 3SH5A 1O3RA 5F6KA 4DOUA 4AI3A 4IV3C 5J3UA 4E8DA 3ETQA 4JAAA 2V73A 3U1XA 1QH7A 2JB4A 4CDXC 3DYOA 3HQUA 1OURA 1H1MA 4AFBA 4HLTA 4E9KA 2D98A 1S0IA 2A6WA 4IE0A 1EV13 3ROUA 5TSWA 4CDQA 3VL8A 3IKWA 1FX5A 1ZRIA 5C8CC 1BJQA 2WYSA 3M3OA 4C0HA 3NQHA 1FMD1 1GICA 1ND2C 3N7MA 2W91A 3JB8A 2BDRA 4DUXA 3ZVXA 1PO12 1EYBA 2HEVF 4FTBA 2GH8A 3NNGA 3AMQA 1AXYA 5JCTA 1JYXA 2JJ6A 4XBLA 4L0PA 3B94A 3GBFA 5FK8A 2W46A 4Y24A 3Q8AA 1NKGA 1B09A 5JXIA 1XPWA 1YIPA 1FNYA 1VRBA 5CKNA 1HV1A 2WABA 2JG8B 4TLFA 5A6QA 2VG9A 1LB2A 1S4CA 1PM4A 2QCSB 3PUAA 5FUIA 1QWRA 5JZGB 4RS5A 3NKTA 3Q9OA 1A8MA 1VRH2 3RRDA 5FTTC 3ZYBA 1UYPA 4E2QA 3TN91 4BK5A 1NE6A 3NRUA 1MS8A 4Q1PA 5CFDB 2GALA 3I2OA 2W0XA 1S1AA 2WFF2 4KU8A 3BU7A 5GLUA 1RB8G 5FZMA 5L19A 5DUXA 2D7FA 2ZXQA 2XUEA 1QJY3 2GU9A 3H50A 2YC2A 3KLSA 3S5AA 3X29B 5LK7B 3LFMA 2GZWA 4CCLA 4RQPB 2IXJA 2VVDA 3BYWA 4W4ZA 1G9CA 5FLJA 5A32A 1IKPA 3UT0A 2RR13 2HKXA 2PMWB 5EWSA 1NQJA 1E57A 5FZ3A 5HCAA 5FMOL 5IHRA 3CZJA 3VLBB 3ACHA 1HQNA 3MPPG 2P3JA 3OB8A 5I91A 2PHLA 2XGXA 3HN3A 2DUOA 1XB9A 2BQPA 2AH2A 3KGLA 2GNMA 4GWMA 4QDSA 2E53A 4AR2A 1FOD3 3KWVA 4WM8B 3H8OA 4COZA 4RR3A 1YNAA 4KI5M 1WA4A 4B29A 4CPBA 4H2AA 4QQ2A 2OA2A 5A7WA 2HWC3 5FMCA 2HWD1 1X82A 3ZFFA 2XR4A 4LKSA 1G6NA 2W87A 4BPZA 5IAXA 4AGGA 2FZ2A 2W2IA 3O0VA 1YQ6A 2MEV3 5IATA 3WHUA 1COV1 3JQXA 1LESA 4FOQA 4GXLA 2W1UA 4HMZA 2ZMKA 4Q2FA 4CUAA 3I7DA 2G9FA 4MXWA 2VTXA 5L9BA 3UL2A 5FR3A 1PO23 3GM8A 5C3SA 5H9QA 1U5IA 3POYA 3J7MA 3L2YA 1OH3A 1F8VA 2Y33A 4FP2A 1U5YA 4XQ4A 3M70A 1ALYA 1D7PM 3U37A 1SPPA 2PA7A 3V0BB 1W2OA 1OFNA 3RI9A 1D0GA 3MW4A 5CKMA 4COUA 1SLTA 4PF1A 4HK8A 4LK7A 4WM7A 3DEMA 1ND3B 3OGRA 2AYHA 2WA4A 4B7EA 2QVSB 3AYAA 2WQZC 2DCTA 4NRMA 3VBSA 3CZUA 1V9U1 5LA9A 2BV4A 3CIHA 1LGBA 3VKFC 3ZFFB 4XPVA 4B4QA 2DTWA 3BTXA 4WVMA 3I3DA 2BFUL 3CJXA 3AFGA 2TBVA 4CYDA 2VXRA 4GMP0 1W6NB 4IETA 3FBYA 4YM3A 3DXUA 1JMUB 1OMIA 4J1XA 3ZXJA 3KT1A 1C5IA 3OUHA 1QY4A 4Q4V3 1JN2P 4FQ4A 2VZOA 5C9AB 4DNYA 1R1A3 2E7TA 1JS9A 2VE1A 4CXWA 2ZHMA 3I2IA 2QTWB 1IG0A 5FO7B 1CAWA 1J3QA 5JSPA 1F4AA 3TEWA 1BBT1 2XVLA 3N35A 1HRI3 1XNAA 2WWSA 3FFQA 3VZOA 4BHPA 1ZX5A 1DQ2A 4J1WA 4CTEA 1UNBA 4AVVA 3BKZA 5ABJC 2WNUA 3POSA 5FXZA 4RFT0 3C3VA 3KCCA 1CONA 1QJX3 2XJSA 1R093 3OSDA 4M4PA 4C1WA 1US3A 3EYPA 2X29A 3ZM8A 4F8AA 1JZ7A 1JYVA 4R9CA 5CG8A 3ETPA 3VD5A 2K9ZA 5F5QA 5CBLA 3TEYA 3NV4A 5GLTA 1R1A2 2D44A 2YMZA 2V72A 2ZAHA 4ISQA 1R083 4YVWA 3WQBA 4EROA 2QQIA 2ZZQA 5FZEA 3I8TA 4GB31 3U0ZA 1AJOA 3KT7A 4FVVA 1GQHA 2LTNA 4JDOA 2EAKA 5F9TA 5BNNA 3HWJA 3ACIA 1AR83 1U5XA 4AGRA 3JZVA 2YBSA 3AMMA 2UWCA 2XWJB 4IW3A 3UJOA 4CU9A 1RHI3 2RM21 4CCJA 2VCAA 1FMD2 5FZGA 3WQ7A 3FHIB 2D93A 3EHKA 4JTNA 3A4UA 4HPKA 5HCBA 3A0NA 2GAUA 1LHWA 1RHI2 2QQMA 2ZGPA 4LOSA 4XF9A 4Y3OA 3IDBB 1ZBA2 2JDYA 5BXXA 3VZNA 4FPJA 5KWRA 1PZ7A 4P9XA 3ZMOA 3FWEA 1DGRA 2HWB2 1GOHA 4YGEA 1OLMA 3WW2A 5JZGA 2OXBA 3W58A 2VM9A 4IGQA 5EYYA 3WW3A 5DPNA 5A70A 1K5JA 3VDDC 4FFIA 2ZX0A 2EXHA 4KBZA 1QJY2 1H1AA 3LZZA 5DG2A 4A6SA 2HEYF 1ZBA3 2HWF1 2GN7A 1RTVA 4NR1A 4PF5A 4Q4Y2 4BA6A 4A4AA 3RGBA 4B7KA 1AXKA 1VBB1 1STMA 1UOBA 2VCMA 3BCWA 3FUOA 4NN0A 4NOTA 4OHVA 3VBHA 2OYZA 1GANA 1W0PA 1MS4A 5DDJ3 4ZS2A 4Y5TA 1RUD2 2DUQA 5C3QA 2ZGLA 5C71A 2DTYA 2EA7A 1AR82 2QZ3A 3OBZA 3MIGA 3A23A 4HG6B 4MLOA 4JV4A 3LDRA 4E4SA 2B45X 1IPSA 3IWZA 4OVEA 4FPOB 4OQ8A 3TWIA 2HBTA 2JG9C 4IV1A 1H4GA 3C7HA 3O14A 1X9PA 2ZHNA 4QKDA 5DAQA 1GWLA 3Q8FA 4XMAA 1FV3A 2VULA 1MZ6A 3NSTA 4HVOA 1EP0A 1ND3A 4KWJA 4LUMA 4S2DA 3CJIB 4XF4A 2RR12 3ZLIA 4CP0A 3OG2A 4ZU4A 1I6XA 1DYOA 1SLCA 3KV9A 5BNNC 3ZXGA 3VHRA 4YZ2A 3AX4A 4CUBA 1Q56A 2E51A 4FTSA 1UZZA 3M7AA 3D3AA 5A3UA 1YQ5A 5FPAA 3AJZA 1YI9A 1SFPA 2A7AA 3VBHC 4QXBA 4GH4C 5EHDA 3MV01 1W6OA 3AL6A 1EPWA 2P4EA 4K40A 4R8HA 4CDUB 4D7YA 4IL7A 4YZ3A 1Y3TA 5C3RA 5GZFA 1YQ2A 1MS0A 2A71A 2IFRA 2VAUA 5DUWA 4ARXA 3WNLA 3VBOB 4GB32 1B35B 1ASJ1 3T2OA 2C24A 3HAGA 1VALA 2QUOA 5BY5A 3I4IA 2TUNA 3ZOIA 1TMF2 1PVXA 3BIEA 5HPOA 3S7EA 2CL2A 2ZEWA 3JD71 3NNMA 5J98B 5IFPA 4QPYA 5LZ6A 3E1F1 3H7YA 3ZN5A 4XZPA 1UAIA 4J25A 1DQ4A 1QIQA 3SCHA 5GZCA 1UU5A 4ISRA 1GYKA 4OYUA 1BXHA 2AR6A 1UIJA 2VVFA 1U12A 4NPRA 2EF6A 3WNNA 1ULEA 4Y1XA 2V09A 4GWIA 2R041 3NVCA 4HSLA 3PURA 4N8MA 3U10A 3N4MA 4QAWA 2RS53 4AI0A 5FO8B 1EPZA 4O7XA 1CVNA 4A2UA 3A22A 1DF0A 3N36A 1D4M2 3R05A 1LOGA 4LLOA 4QX3A 5FZLA 3O12A 4XXPA 2JDNA 1AR93 1AL0G 5FKBA 3ZFGB 5BUVA 4RGAA 3NAPA 3OF1A 3T4HB 4XQDA 4EQVA 1LEMA 2WO7A 1XYPA 3MUZ1 4Q4X1 1CIYA 1UX6A 2RMU3 1ZBE1 1RUI3 3VN4A 2JE7A 1SPPB 2FCTA 3PTRB 5FXWA 2JDMA 1LHVA 3WZ1A 5BNOA 4JKKA 3IN9A 2DYCA 2Y6FA 1RUE3 1XOYA 3ILNA 2JDAA 1POV0 1LJ7A 1VBC1 5A3WA 5GZDA 2VCBA 4URAA 4D7SA 2VW1A 4QMAA 3ZX7A 4HN1A 4CZSA 4XBNA 2B42B 2E6VA 2IVIB 2WLQA 4M3CB 4MXVA 2FCVA 1VMHA 1YLLA 5CADA 4LHKA 1AYN3 3JB4C 5T5OA 1YFXA 3B5LB 4LHSA 5FY7A 2DVDA 1HB4A 5E16A 1ND3C 5AVPA 1GP6A 3NAPC 4BZ4A 4G3YC 5JOWA 4AFAA 3VKNA 3LAGA 1CX1A 4DUVA 5C70A 3KZ4C 3GHNA 5C9AA 3O0WA 1QOTA 1S0EA 1C8M3 2VTFA 1UQXA 2VNGA 3MLJA 1LTEA 1LEDA 4PQ9A 3KT4A 2Y6LA 4I30A 4RGGA 1IS5A 1ZM1A 2PLV1 1LENA 3RYPA 4A7KA 1OQDA 3WP4A 4MUVA 1GZCA 1OHFA 3MIEA 1F35A 4QGMA 1HQLA 1S0DA 5J96B 3VKLA 1YC61 1O4YA 4L8QA 3IM0A 2VNOA 3MDPA 1AYM2 5CZKA 4RN5A 5FYIA 5C8CB 4RL7A 2BNNA 1ZZ7A 3B7MA 3CDZB 3N9OA 5LBEA 3WNKA 3VV1A 1E5SA 4CU8A 2ERFA 5FMDA 2EIBA 5FOJB 2C0ZA 1PMJX 4ASMB 3DECA 4UF0B 5FPUA 2FDJA 4AFMA 4BE3A 1G8WA 1SBFA 2A6YA 3AZVA 5F6LB 5FREA 1RUJ1 4WBBA 5IAVA 2G1MA 1ULGA 1V9U2 2AC1A 3MIHA 3T2QA 3DF0A 2YC4A 1C4RA 1UXZA 2MEV2 1V6KA 3IAQA 4HKLA 5IT6A 2NP0A 1JW6A 3R4SA 4XAAA 4XUPA 5D8AA 1NCRB 5EJ3A 3RZZA 3AL5A 5IVBA 4LXLA 1AR81 3PJYA 3WINE 1SBEA 4MXWB 3RNSA 5F32A 4CP9A 4AVSA 4H3WA 3BIWE 1AYM3 3WR0A 2WFF3 3J26N 4GAZA 4XJZA 3MHZA 3T3YA 3PVBB 2E32A 1SEFA 3U07A 5FBJA 1U0AA 4HETA 3LKJA 1K42A 4LJHA 2JKXA 4SLIA 1VBD1 5HV0A 4QXKA 1OPOA 5LBFA 2XB6C 4L2NA 3TB0A 3B9CA 4N43C 4CP1A 2VZRA 3UKNA 2HEWF 1ENSA 3RPQA 1OUXA 5FLIA 1CAUA 4P9GA 1Q8QA 4P9IA 2RS51 2WJSA 4O65A 1RUC3 1ZRFA 3GCXA 2RS33 4E27A 3WW4A 2PAMA 3VL9A 4NHXA 3WVJA 4AQTA 4E2SA 1UN1A 5JI7A 2ZGTA 5LCWL 3LB9A 1LRHA 3ALQA 1I5PA 5DABA 3H9AA 2D6KA 2YB7A 2XL9A 2G9ZA 1DGWA 4FTEA 3TNQA 4XJAA 4AK3A 3NNJA 4R9BA 4Q4W1 3SH4A 1CAXB 1GQPA 2D3PA 1P8JA 2GC0A 2HWC1 3UGFA 3LDBA 2JG9B 4CCKA 1F31A 3MI8A 4CEYB 2DU0A 5FYCA 1SFNA 3IDEA 2ZGMA 4QQLA 1SFYA 1NLQA 2WINB 3LEIA 1N1YA 2UWBA 3DV8A 1L7QA 2CGOA 2GMEA 2WYFA 3KHBA 4KU7A 4QXCA 3U75A 3EQEA 3LF7A 2HWE2 3AM2A 1VAVA 3AMPA 4V1PA 3SISA 4BQWA 1LOBA 2X5IB 5AC93 1H6YA 3CHXA 4ATEA 3PVEA 1NY72 2X53S 2XJPA 4Y1ZA 5FBZA 5I0SA 1HB3A 4XIOA 1XU1A 2WS91 1BEV2 3AYDA 1Q5OA 4YG0A 4PDWB 1WUVA 3RS6A 4IEYA 1O7FA 2Y6GA 5A3PA 4YG6A 5T5PA 4FP3A 4DZGA 2PHFA 4QX5A 2W92A 1RUH2 2Y6KA 4AHWA 4H7LA 1PIV1 4PLMA 3IT8A 5L9RA 3PMSA 1OT5A 3H7JA 3EB7A 1BBT3 1VBE1 2Y0IA 2FMDA 2XG3A 1AR92 1D2SA 5IVJA 4UFKA 5FZIA 4AI9A 1Q3EA 1K12A 3K4DA 1M06G 2XQRA 2KM2A 1JHNA 3NNFA 1XNKA 3FMGA 4OHXA 4ZHNA 1H8VA 2JDHA 2Y60A 4NAOA 2JEMA 2VQUA 4U36A 1PO13 1WW6A 3N7KA 1GP4A 1AYN2 3T0AA 1NCRA 2WAAA 4BOWA 4LT5A 3ZKUA 3ZN6A 4JX0A 1J83A 4XC9A 4ONUA 3VBRB 1AR72 3WF2A 4ET7A 4FFGA 4YGCA 3ZXLA 3POEA 4WVVA 1XRUA 4QKNA 4CDWA 1DLLA 1MS1A 5ABJB 1QQP3 1W8ZA 1UPIA 4GALA 4P5YA 4OMCA 4XFAA 5GKAC 3OGVA 2CV6A 1EAH3 1W8HA 3CJIA 2D3SA 2C9KA 3O1MA 4Y22A 3DYMA 4X8NA 4LOTA 5FJKA 1XNCA 1S55A 1W3XA 4W50A 1Y9GA 2R1BA 1W9YA 3WQ0A 2R7EB 1H4HA 4JGYB 4B4PA 1DP0A 3HJRA 2IVJA 1BYHA 4XF3A 3O1VA 4P08A 3M2MA 5CAZA 1MEC2 1BKZA 1WW5A 4XFHA 1COV2 4EZHA 2JKBA 2BPA2 3KM5A 3KS7A 4UFLA 4YFWA 4N53A 1ZA4A 4IEWA 5KHJA 1V6IA 4GZ9A 2AUYA 1WMEA 1GZTA 1J1TA 4NPMA 1PMIA 1TMF1 4WM7C 1SACA 1U5ZA 2K0GA 3ZN6B 2GC1A 2W1WA 4W65A 1KS4A 1CIWA 2YHJA 5FZBA 4Y5Z0 2AREA 4UYBA 4XFIA 4AHYA 4E4HA 3AJYA 5A80A 4CDWC 1VBB2 4DXTA 1CJDA 3VBUB 2VJXA 4LHNA 2DURA 5BYNA 5IWFA 1JYNA 1F5JA 2XKPA 4TLGA 4E4DX 4RFRB 5DQ0A 1NQDA 3GZEA 2YFUA 1MACA 5J7MA 5J09A 3KGZA 4PCRA 3SKJE 1XU2A 3EO6A 2TEPA 5A3MA 4CA9A 2LRPA 3K51A 1W6PA 2R042 4CE8A 5CIRA 1O4TA 4JQRA 5GZEA 4N9IA 4DQAA 4M0NA 4QM8A 1VMJA 2OW4A 2JD9A 4AG4A 5FDBA 1QOSA 1O3QA 4EYUA 1TME2 4MHRA 1A3KA 1V70A 5BV6A 5EJZB 4ZZ8A 1QOOA 3SITA 1HRI1 1RUG2 1RUD3 3AYEA 1QXJA 1DQ1A 1RVF1 1DG6A 1CQ9A 3BOWA 3VHNA 1QDOA 1W99A 2VMGA 2Z2SB 3C7GA 2SLIA 1CPNA 4AEDB 3NV3A 1W03A 1N1TA 2RJLA 3ZFGA 1DZQA 4FFFA 5I0DA 3CF6E 2QBXA 4QHZA 3ZFEA 1AUYA 1WD4A 1VIWB 4Y22B 2DCKA 5ACA1 2J7MA 2R072 3ZSLA 2DVFA 3FX3A 4Q1RA 5F3GA 2RS12 1LHNA 2IXHA 3K75B 3POBA 1WBLA 1RUE1 4XFFA 1VBA3 4QGNA 2DCJA 2JE9A 4KH9A 4XDPA 1JZ3A 3H3LA 2HWB3 1UMZA 2FDIA 1OF4A 2YYOA 1GZWB 3MIBA 1QDCA 5BNPC 2JX9A 3OBTA 3SQOA 1DZTA 2BGPA 5EJ1B 2ET1A 1W9SA 3HMYA 4B4RA 4E4ZA 5FQ0A 2YG0A 3HIFA 4LO7A 3GDBA 2FHRA 5FZOB 5CA6A 2VD7A 2P6HA 1QNYA 5L7OC 1J84A 1O6UA 3AYCA 4LBJA 3ZO0B 4LULA 2RS52 5FZAA 3WP6A 3KCYA 3KVBA 2GP3A 1R081 1S2BA 4FOVA 3E5XA 3USUB 3RFRA 4A3ZA 3MLLA 4FAHA 4YGDA 1RUI2 3JXSA 1GUIA 2MPFA 4IERA 4QX1A 3P6BA 4WV8A 3IB3A 3VBOC 5HI0A 1GLHA 1NA1C 2YXSA 1RUNA 4L11A 4NHKA 1VBD3 1B35A 1KDKA 2YFZA 1ZZ6A 4A3XA 3KV6A 1S0FA 3ZR5A 5FP3A 5AVAA 2VW2A 3O1PA 2O1QA 1DYKA 1H8TC 3PVNA 2ZAAA 5A3NA 2PHDA 2UY9A 2WNEA 1OA3A 4COVA 2W1QA 4QPGB 3OGGA 5BNPA 4GMP1 3PUIA 1GZWA 1QGLA 1JXNA 1GFF2 1QQP1 2X09A 1VBB3 4FPHA 4C90A 4IEXA 4CCMA 5KR7A 2ZCWA 3KV4A 2Q1MA 3ZIXA 1C57A 2GDFA 4GULA 4NWWA 4BIOA 4LK6A 1OXCA 2ARXA 2XLGA 4EWDA 1ZZCA 4AE2A 1RMU2 5L7OA 1IS4A 5LBBA 3DL3A 3BALA 1IQDC 4YVWB 4MHUA 1Y9QA 1LULA 2EVXA 3ZXEA 2RV9A 2GNBA 4XACA 4AI2A 5D2AA 3GYDA 2UYAA 2MEV1 5FZKA 1SLBA 1COV3 3T1LA 2JG9A 1QMJA 4JQTA 1HXS1 5F3IA 5CFCC 4JGZB 2XXZA 2WNVB 3KQ4B 4AYUA 4XTPA 3W21A 5IJRA 1BCXA 1MQTB 5K8SA 4R9AA 4DUWA 5DMYA 5IVVA 1FI2A 1NCQC 1AYM1 3J8F3 3D4KA 1W3VA 1WMFA 1PO22 2RM22 3MLKA 2FMYA 1HRV3 1X7NA 4UAPA 1ZREA 4MG2A 3ZXDA 1W2UA 4CDXA 1OF3A 1PVC3 4KGQA 2WZR2 3NJYA 4XDOA 2XHKA 4OQ9A 4YW7A 5LA1A 5FP8A 4Y1VA 3UV9A 5FMOS 2CAVA 2Z69A 2PELA 3OBAA 4NHYA 1UL9A 2VBPA 5FAXA 1PO21 4DFSA 5BNPB 5KXDA 1WMDA 1O5LA 4LHLA 3NKGA 4MOAA 1ACCA 3RQ0A 2WN3A 1HW5A 4GIQA 2ZX1A 2VOTA 2AENA 3ZSJA 4ZKTB 5CEHA 2YY1A 4DS0A 2D5HA 2DBIA 1WWYA 4QKBA 2PHUA 4XFGA 2VXJA 4QPIB 1A8DA 5FWJA 4YWAA 4N90A 3PU8A 1HN0A 1Y43B 2VVEA 1POQA 2FCUA 4BCUA 4Q8LA 2EXKA 2WS92 2JB8A 1V6NA 3GHMA 4NIGA 2J1EA 2Q0AA 4AEDA 1F4HA 2DU1A 1UZ0A 2P3IA 4Q4W3 1RITA 2KD7A 5JR2A 4JRLA 1PO11 4KWUA 2NZ9A 3CO2A 1D2QA 2VBDA 4RHV2 3I3EA 2DFCA 3MGUA 2VZ1A 3KMHA 2G9GA 3UJQA 3ACGA 5I8SA 4UW4A 4AFCA 2PXJA 5JVVA 5FWEA 1PVC2 2H6BA 3CJIC 1OVSA 4JVAA 3JUUA 1MPXA 3R0RA 1W06A 5DUUA 5AC92 1TME1 3GZAA 1EAH1 3VUOA 1MS9A 4FAGA 1EY2A 1FOD1 1N1VA 3AFKA 2A6ZA 2ES3A 1WD3A 2ZGQA 5C8CA 2JDUA 2CSGA 2CAUA 4PHZA 3R6SA 3VDDA 2WFF1 3VBRC 1RYYA 5CISA 2WS93 4JRAA 2D6OX 2R043 3FE5A 4CDUC 1AXZA 4XFCA 1K3IA 1R082 2VZSA 4KG8A 2B5HA 3HVDA 1HV0A 2SBAA 4WVZA 5IUQA 4XHBA 4LO8A 5F1RA 1Z7S3 1GV9A 2F4PA 1CX4A 2IUWA 5D8AC 1VJ2A 3W9AA 1IGOA 4P9YA 1NCQB 2O8OA 2GMPA 2ZZJA 2QNKA 2OPKA 4NWVA 5GJ6A 1OKQA 3E6BA 4YW1A 3UKVA 4A45A 5LY1A 4PI2A 3WF0A 4CU6A 1ZA7A 4PQQA 3VD7A 4EZ4A 2VR4A 5C8WA 3H42B 1H1IA 3N9NA 5GLZA 3T2TA 3OBRA 3LD8A 3P3PA 1HRI2 3FBMA 2PTMA 2EXJA 2NQYA 2DDUA 3VDBA 1RVF2 2VMCA 5CFCA 1Z78A 2R062 2R0HA 2VZTA 3S0MA 4AEMA 4QD2A 4XMIA 2A3YA 2QQPA 1W90A 1BBT2 1W05A 4MO3M 2WO3A 3THCA 1D4M1 4ZS3A 5J48A 3I3QA 1YYNA 4OFGA 5EZWA 4CDWB 5K0UB 3HOBA 3TAYA 2O14A 2B7YA 5J1XA 1JZ6A 2VCCA 3QH7A 4EWAA 1RUC1 1VB4A 2D6MA 2HBUA 2VOKA 4IQPA 5FKCA 3SEPA 4CDXB 4DIQA 3V0BA 1CGPA 4UFJA 3TNPB 3J7NA 1DIWA 4Q0UA 4QPIC 2BOIA 4XURA 1AR63 2BWCA 1SLIA 2WQ8A 2D6LX 3CLPA 3ZFGC 3GCWA 4U2AA 1CZVA 1MQTA 1K5MB 3CMGA 3MF9A 1CAVB 1DZRA 1VPHA 4W6WA 3QH6A 4K21A 1UMHA 5HXMA 1QU0A 1O4ZA 4Q0VA 5I0TA 3W59A 2BERA 2Y38A 3VGIA 5JOZA 2E26A 2EIDA 4XF1A 1A78A 5DDJ1 3M8LA 1GKBA 1SLAA 2E63A 1URXA 2VL4A 1LR5A 3I97A 5F2SA 1W6QA 3DN7A 4NHLA 4A44A 5FZ7A 3OYWA 1S0GA 4CPBD 2UWAA 4CEWA 1CAUB 3M4FA 5FOBB 3IAPA 1KFUL 1SZBA 3H3ZA 1ZBE3 3LSEA 2ZEYA 5E88A 1J1LA 5FQ0B 4QB2A 3RZMA 2VECA 4ES9A 1JU3A 5FP4A 3POGA 1TQ5A 2WN2A 4HL0A 4O9GA 3E6CC 2HWF2 1UF2C 1RUG3 5K7PA 2EICA 2ZMNA 3IMMA 4KL1A 3SEEA 4UI9L 5DZGA 3J9SA 3UNPA 3WNOA 3WG2A 2IXKA 1NA1B 4LNVA 5FYVA 4DO0A 4DPNA 4JC1A 3DPRC 1GNHA 1PIV3 1MS3A 3I3MA 1HN1A 5LA2A 5FY1A 3LIGA 3VD4A 4CP9B 2JDPA 4OCTA 1JZ8A 1H8TA 1JYTA 4XETA 2G19A 5CFDA 1YQCA 1W6OB 1JOPA 2ILMA 4IE7A 4NROA 1G9BA 3HD8B 1LOAA 3BTYA 3LCPA 1V0AA 4AVAA 5E1RA 4I09A 4BYYA 5A33A 5F3CA 5E89A 5KXBA 3WOGA 5JI9A 2W5FA 1PHMA 4OULA 4C1XA 2YBKA 4QB1A 2WDBA 1CAWB 1N47A 4YW5A 4EN6B 2Y8KA 2UU8A 4ES8A 1QXRA 4XAEA 1NT0A 4Y4RA 2RDNA 1RUE2 2PAEA 2J1AA 3KF3A 1UYZA 1X8EA 2WFPA 2YU1A 5DZFA 2KR2A 3S7IA 1TG7A 3TEZA 1ONAA 2VOXA 1JTZX 3W5MA 1MZ5A 1W8FA 2BEOA 4AFDA 3BPSA 1C28A 5KHHA 4HVRA 3FHAA 5JOYA 5CFCB 2CWSA 4JGZC 2BYVE 1LODA 2CTVA 4IEQA 2YDEA 5EXOA 1NA1A 1NY71 2J1RA 3QOPA 2ET7A 4NIAA 2OX0A 1L7LA 1V6OA 3WCRA 4P9LA 4N7UA 3WP5A 2QJVA 1HIXA 4LBMA 1LOEA 4QPGA 4H14A 4I02A 5H9PA 4Q0QA 2WZPP 4YVSA 4QPWA 5BNOC 4HANA 1PVC1 4OLLA 1XJAA 3VHOA 2EAAA 2ZHKA 2N7GA 2D6NA 5FUPA 1LU1A 3ZKYA 3OY8B 2HH9A 1MQTC 4GKXA 2LALA 4FPCA 3ACLA 3CEWA 4YPJA 5FPZA 3ZDVA 2RS32 4YW4A 2JE8A 3BB6A 1C8M2 1PK6B 5B4NA 2W94A 2VUAA 1V6MA 3NV1A 1OD3A 1TNFA 3M1HA 4L97A 3I49A 3I3BA 1W9FA 2XMLA 5F8PA 5IVFA 3PIGA 1D0HA 5A1FA 4CXYA 2PQQA 3AKSA 5JPMB 3PJQA 1WMXA 2VNVA 3FFZA 2OZ6A 2B9VA 4F3JA 2JECA 2PHXA 4UW5A 4BH9A 4IV3B 2P3YA 4HN0A 2WLPA 3B02A 4CEYC 3USSA 1CZTA 4FOWA 1BEV3 5AFEA 3O5SA 5FY8A 2I74A 4IEUA 1R1A1 2R1DA 3WDTA 4FCAA 3IZOA 2JENA 3GXUA 3LPGA 3LPFA 4Q26A 2YC0A 4MGKE 3WY6A 3O1RA 3WG3A 3LIHA 1AX2A 3KCXA 2LW8A 2OVUA 1E5IA 1ND2B 4RQPA 5CYYA 5FPLA 1VB2A 1Y9MA 4XW3A 5JXGA 3WF4A 3K46A 4Z2WA 4Q27A 2PFWA 2VBBA 1AF9A 1XC6A 2PHRA 1AL23 2DF7A 2DV9A 3RWNA 1K45A 2WIIB 3TYJA 1VAKA 2D43A 2A3WA 2VTXJ 1Z7S1 2W1SA 3SHRA 3V56A 2YV8A 5D8AB 3I59B 2J1SA 3TBDA 1KJLA 3HN1A 4GKYA 1T6BX 2HYXA 4WVWA 4XJ9A 1UO9A 5DDJ2 1KEXA 4IXLA 3FC0A 1CN1A 3WUDA 1L7RA 2D97A 3QD6A 4B3NA 2WUHA 3NL1A 4OUEA 4PLOA 5FK7A 2ORZA 1I9RA 2RDRA 1O91A 3TOJA 1JHJA 4MGQA 4RQPC 4MGTA 5KC6A 3ENRA 4XTMA 2HWE3 1WLWA 3NJVA 1W0OA 3HQRA 3K3OA 1US2A 4D6SA 5LWBA 4P9JA 4RD7A 5LB6A 5CVRA 2WKKA 3ES4A 2ORXA 4LBLA 2F6BA 4BISA 4Z8BA 5SV8A 2ADDA 4S2FA 4ORFA 5HBAA 1W6QB 4K7JA 3BN6A 1ZVFA 3KSCA 4AQSA 2RS31 2ZABA 3A21A 4C8DA 4M00A 2HLEA 1BLZA 2ZX4A 1H30A 3VZJA 5FZCA 5JUVA 1I5ZA 3RG0A 4OI0A 4CCOA 2YGMA 4M3CE 4LKEA 3T30A 4EE2A 3C2UA 1X50A 4W6YA 3VBSC 3E5UA 5T3NA 2XLAA 4LA3A 1W2TA 3VDDB 4DXZA 1OSGA 3RZGA 1LKNA 1W6MA 1GOGA 3W5NA 2VQTA 4Z07A 5ABJA 1OVPA 3IDAA 3IDCB 5I0RA 2YPDA 3AP5A 4F7ZA 4AVTA 1AVBA 3RZLA 4PIYA 5K9YA 2K2SA 2PLV3 4O9EA 2IZWA 1QJZA 3AMHA 4BXSV 4YLZA 2RG4A 5A3TA 1TE1B 3OY8A 3NW4A 5DG1A 2E31A 4CCCA 1OH4A 4NAMA 1K5MC 2A6VA 5AC91 5C3PA 2AACA 1OPMA 4GA9A 3ES1A 5ACA2 1PNGA 1BK1A 3I59A 1ODNA 3POIA 4S2HA 1UOJA 1OLQA 5LA0A 1Y4WA 2GN3A 3N7LA 1DQ0A 4R4ZA 4XBQA 5FPXA 2CU5A 1QJU1 1RUF3 3WUCA 3ZYJB 4QX2A 5A3OA 1C5HA 2VGDA 1OQ1A 4CDQC 3WF3A 1W8OA 2E7QA 1ULOA 4Y20A 3ZFFC 4L9BA 4IE5A 4JDMA 4M0HA 1WKYA 4M3CA 4AWDA 4IEOA 1HRV2 4QGLA 4BB3A 5JOXA 1RUD1 1QEXA 3APBA 2WBKA 4X6RB 4GH4B 5FZ1A 1NXMA 1OKOA 2WQ4A 1JH5A 3N9QA 3NO8A 1X8MA 3PMEA 2ZKLA 1K5MA 2D3RA 3JQWA 3LA3A 3OOXA 4QQHA 4LEJA 3B00A 2ZTNA 5A33B 4R4XA 1LNSA 1QJEA 1FMD3 1AHSA 4QXHA 3ZPOA 1HX6A 1RL3A 1W2NA 2VOWA 2VUCA 4XHXA 1YQ8A 5ANNA 2HWB1 5A7SA 5LRSA 3SC7X 4YG3A 4Q0SA 1OOPB 2X10A 5IK7A 1ENXA 1DCSA 4JGZA 1HXS3 4NMIA 4YNIA 3SH3A 3ON7A 1SCSA 3I2JA 3ZFEB 2AEYA 2XJTA 2OUJA 1NOVA 2GNTA 2ZOEB 5EP9A 3VHPA 3AXEA 4GJZA 5JZGC 2R32A 3L9JT 1FPN3 4IV1C 2OT7A 5FFOC 3ZSKA 3N9MA 4MVTA 1KGYA 5EIYB 5C5TA 5L7OB 1FPN2 1XYNA 4NIHA 1ZNPA 4PBPA 2BGCA 2P17A 2PLV2 2VW0A 5FCCA 5L9VA 2LM3A 3I2DA 4YZ4A 2BVBA 1HXS2 3VB9A 5IVCA 4LO6B 4YVSB 5A6ZA 1TMF3 3ZYGA 2JG8C 3SLIA 3B69A 4IESA 1GWKA 3CNAA 4KMQA 3MEPA 5FYYA 1BHGA 2QKDA 3IBMA 1QXPA 1CZSA 1YJLA 3AKTA 3LA7A 2Q8EA 1FATA 4BM8A 1OA2A 5A6YA 4NPLA 1HLCA 4AAXA 1LCLA 4W6XA 3OUIA 1OA4A 2IXCA 2FD8A 4QX7A 3JU9A 4OUSA 4AZZA 3VKOA 3DYPA 4D7TA 5A7PA 3VBOA 4NHMA 5F39A 4Q4Y1 3FJSA 5ERLA 1NZIA 2LS6A 2NLRA 1WCQA 2RMU2 2A5ZA 4D0QA 1G9DA 1YEWA 2WSVA 1REDA 1RINA 5JR7B 4LE3A 3MIFA 5CNAA 3OPZA 3S30A 1IOAA 1QJU2 3CBNA 5IK8A 2VMIA 3I54A 1XNBA 4XABA 3ZIWA 1PGL1 4IGOA 5KHIA 4GMP3 3UGGA 3F95A 5SV5A 4XJWA 3W20A 4DRRA 5APAA 1VBE3 1OC1A 1RVF3 2H0VA 1QJX2 1DYPA 1UMIA 4FO9A 5FP7A 4DINB 2WNVA 5LY2A 2RVAA 1NUKA 5C33A 4X8PA 5JLVA 1UPSA 2CGNA 2VQ0A 2XVGA 1GWMA 1R64A 4M3CF 5D21A 2WZ8A 5F7UA 1UYYA 4Q0PA 4HVQA 3SNMA 1W39A 4A7YA 1YRZA 4HFSA 5ACA3 2O0OA 4LITA 5LBCA 4NIIA 2DCZA 4UBGA 5A7OA 1XNDA 5FY4A 4XDQA 3B3QE 3GF6A 2BBAA 1PX3A 2Z42A 4QHBA 2XPJA 1MEC3 3THDA 4UFHA 2P3KA 1NCQA 4XQWA 1NYWA 4CDUA 5FIXA 3RZHA 4L99A 3ZN4A 2QQNA 3AMNA 3INAA 3UGHA 2WWJA 3MUY1 1NCRC 5FMBA 3BUCA 1CPMA 4EN7B 3MYXA 1E5RA 1ZZBA 4RS5C 4YZ1A 2X5IA 5BNNB 5HV4A 1KXGA 3N7JA 2QZ2A 3IMNA 4Z2AA 3RJ2X 3ZSEA 1GR3A 1O59A 2NN8A 3VKMA 3K4ZA 1L3JA 2F17A 4IE6A 2FDGA 1RUJ3 2LUWA 2P2KA 4GWJA 4ATFA 2PHTA 3UYJA 5BNQA 2PYTA 3KQRA 3S6PA 2UY8A 3WT3A 4D6QA 2DCYA 2K46A 2V5DA 4JZRA 4RA0A 2GMMA 5FZ4A 1BMV1 3GJAA 3ZSMA 3VBUA 1HB1A 3J8F2 4XFBA 2W39A 3VZKA 3AKRA 3ILFA 4Q4W2 5FZOA 3LGRA 3GNEA 1PZ8A 4UXAA 3P1IA 4K20A 1ZRRA 3E97A 1YHFA 5FPBA 4FXKB 1Q8SA 2JDKA 4FOYA 4AHZA 2GSYA 2CYFA 4XJ8A 3QBQA 1MZEA 1V00A 3TEXA 4N53B 5IW0A 5LK5A 4C0BA 5C9AC 1PGW1 2J1VA 2P34A 2VZUA 2VO5A 3K3NA 4XUNA 4AVBA 3PLQA 4WM8A 2ZS6B 1DGRN 3HNYM 3NWKA 1W2AX 1MVEA 2ZA9A 4R52A 2C9AA 2CHHA 5JSRA 1CJPA 1SBDA 1W9TA 2A6XA 4GH4A 3G7DA 4LBQD 5LEJA 4OI4A 4AW7A 1IZ3A 3G6JB 1UOFA 3O1UA 5FLHA 2D6PA 1Q8OA 3ZPYA 3BODA 1ULCA 5LATA 1HDKA 4RHV1 5EPAA 4D8MA 4UW3A 2PHWA 4Y4YA 1OI6A 4CP2A 3WF1A 1RXGA 1GBGA 2VZQA 1OFSA 5GALA 5BPXA 3VBRA 1HRV1 3EMRA 2ATFA 1JYWA 3C7EA 1ULFA 5A7NA 1BMV2 3LE0A 5B2GB 4YW2A 4KNCA 1RMU1 3U4XA 1XE7A 1UZWA 1YXWA 1N1SA 1W8NA 2EXIA 3VDCA 1GMMA 4QM9A 4I01A 2VC9A 1BZWA 3O1TA 2W3JA 3D0SA 4D69A 3THPA 3MFCA 2FDHA 5JDBA 2JDZA 4UF0A 3SCFA 5KHGA 1LGNA 5K4LA 1REEA 2YPJA 3KV5A 2XJVA 1NAEA 2C6SA 1PK6C 1UY1A 2Q1FA 3DPRA 5A3LA 1QHDA 3OPWA 1UY4A 3GALA 1LECA 3DCQA 1BEV1 4QQPA 1I1EA 4PDWA 3FZ3A 3PUSA 4RGKA 4N43A 4RR3B 4J6GA 1X36A 2QDNA 2ZEXA 4L92A 1DBNA 2RS11 2DUPA 1T6GC 4LKDA 5J37A 3OJBA 4KQ7A 4XCBA 3WDUA 4FT8A 2BNOA 1DLCA 4GJYA 3I2KA 4K9SA 2YROA 2KXLA 3M3QA 1N3PA 1UOGA 5A32B 5FXXA 4Z82A 1FXZA 3ACFA 3VZMA 2JWPA 1TME3 1Q8PA 2EIGA 1W6PB 3IPVA 1XE8A 3PNAA 2E33A 1H9PA 4AL9A 1J58A 1PK6A 2A75A 3HBZA 4LORA 4DY5A 1AJKA 3M3IA 1ULPA 4BXFA 4D94A 5FYUA 1OUSA 4YYOA 3NV2A 2WC2A 2Y6HA 3K4AA 4IE4A 3VBHB 5FZHA 4B1MA 3WV6A 4AGVA 1ST8A 1JUIA 3EXUA 3QCWA 4KGGA 4N9HA 3TN93 1TZOA 5F5CA 4HBNA 2R16A 3JCIA 2IC1A 3OEBA 2WRAA 3IPVB 2I07B 1OOPC 3TN92 3ZYRA 5FJHA 4CXXA 3C8XA 5JIUA 1YIFA 5FYSA 1HKDA 1PNFA 4FBFA 2ZJCA 2OIIA 1XSRA 5FV3A 2HWC2 3ELNA 3Q8BA 4OZOA 5FO9B 4TSVA 1POV1 2YGLA 2WT0A 1X33A 4NJ4A 5HCFA 1EAH2 4LBQB 2QE3A 4BQ2A 4CEYA 4K1ZA 1CD3G 1FOD2 2QFEA 5EQUA 1IHMA 2BZDA 1UIKA 1NLRA 3H0OA 3PIJA 5KHKA 4TWTA 4YSFA 2WNOA 1N3OA 3V64A 5C4WA 3J7LA 1DGWX 2WNUC 1VP6A 1BVVA 2ADEA 4COWA 2DWRA 4BMEA 1XQNA 2WZR1 3FLTA 3N3HA 1XNTA 1NG0A 2GP5A 4OUMA 3LWCA 3QLQA 3I2FA 3LDKA 5LEKA 1S2EA 5A7WB 3UKTA 2BNMA 5A1LA 3FLRA 2ZHLA 2HWD3 1S0CA 2R30A 1D4M3 2QQKA 3WDVA 3PVOA 5FP9A 3ZXFA 5I8YA 5CB7A 1ASJ2 3OTFA 3D6EA 1DQ5A 1PZ9A 1WCKA 3ST7A 2Y64A 3PU3A 3RVHA 2VZPA 2CDPA 2XWBB 5JPNB 4QPIA 1H2MA 3EJKA 2R071 3PUHA 4RYDA 4AAPA 1CR7A 1REFA 3K48A 5D1IA 2JIJA 4EN8B 1T2XA 3WX5A 5A1AA 5FZFA 3ZDSA 4RR3C 2WL1A 2ZX2A 4UT5A 5DAPA 4ASLA 1JU4A 4YGBA 3ZYFA 1G9AA 1HJFA 1JODA 5LRRA 3BU0A 4LQRA 2WSUA 4ZY9A 3ZXKA 1XSQA 2ZGOA 4UFIA 4A6OA 5GZGA 2W9XA 5T54A 4X6QB 4XYXA 4AHXA 4PJYA 3OUJA 5G05L 4N7IA 1LGCA 1LHUA 1Z0HA 4XCAA 1SG3A 2QQWA 1V9U3 2Y34A 4XE9A 4AEDC 1Q8VA 2QQUA 3ME2A 4BIFA 1UZVA 2VMFA 2JXAA 1AR71 1SLLA 4HPKB 3H8XA 2P1BA 2X5IC 4QB6A 4RS5B 3RI8A 4XZUG 5FYZA 3MPBA 4XUOA 3WXPA 4XOGA 2EALA 1IPKA 4OI2A 5EYXA 1IPJA 4K8FA 2CGPA 2XBO1 4CVUA 1VBA1 1A34A 1KS5A 3MW3A 2JIGA 3NJZA 4QDRA 1QQP2 2ARBA 1W8UA 2MHFA 3LEKA 3T08A 1C1LA 3NAPB 4BLIA 3AP9A 1AL21 3CQOA 2Y0OA 4NUBA 3M3EA 1RJ8A 2OPWA 4LKFA 4MGSA 4Y33A 1JZ5A 3H1MA 3H8UA 3HR9A 1KJRA 1Y7BA 2W47A 2XVKA 3SCGA 2A73B 4HK9A 4KG0A 2TNFA 1VBC2 5FZ0A 4ITCA 5HXVA 1PM7A 2ZGUA 1FT9A 3AC0A 4FFHA 5EFUA 1H6XA 2V4AA 4QPGC 1OD5A 4HT1T 4JTOA 2CWMA 3MW2A 2WNUB 2FBEA 2W52A 4ASKA 5IFTA 1TEIA 1JZ4A 3R4DB 1RUH1 1GNYA 1IS6A 4NVPA 4N53C 4EV0A 3L2HA 4Y1YA 2ZKNA 1G7YA 4M01A 1UCXA 1M4WA 3NNLA 1ENRA 1MR5A 4LBOA 2CDOA 1NZCA 4TXWA 5M0TA 4PIZA 2OQ7A 4FI9A 4YRDA 4AQ6A 4FPKA 5JMCA 3M3CA 1H8TB 1GSLA 1EV12 1WW7A 5T5JA 2P5BA 2JICA 1CESA 1VRH1 3GGLA 3D8CA 4MYEA 4AF9A 3VBFA 3ZFEC 1QJX1 3VD9A 1R091 3NMBA 4AI1A 4S2GA 3P3NA 2BBVA 4UW6A 1JUHA 3BVCA 5F37A 1OBNA 4EN9B 4CCEA 5C7GA 2GNDA 3WNMA 1G9FA 3AZYA 4YFZA 3BI3A 4YVWC 4FPEA 3RYRA 3IIIA 2VH9A 1KDMA 3T09A 4GB33 3B9IA 5JIAA 2RMU1 4PLNA 4YVSC 5FZ9A 5F2WA 1JOBA 3MV11 3AZZA 2R063 4WM7B 5DAWA 1MZFA 5ANQA 4AVCA 2Z5WA 4CEWB 4D6RA 4E2GA 2VY0A 1RUOA 4IEZA 1PX4A 1SQ4A 3VZLA 1NLSA 2IXIA 1RGSA 2BFUS 3AKQA 3ZXAC 4N43B 4JGYA 3JD73 4O61A 3T4VA 3LSDA 2J42A 1IG3A 3D82A 1FNZA 3USUA 3LEMA 1MVQA 1LOFC 1XE0A 2X8KA 4LO4B 3WHTA 1GU3A 2XJQA 4K8RB 1JBCA 1HJGA 1WCDJ 3VBFC 2R6QA 1F9KA 2Q5TA 4BQ5A 2W95A 1ZBE2 2B39A 2VOVA 2RHPA 3AKPA 5FPVA 2BTVC 5JXHA 1UW8A 1RUG1 1LU2A 4SBVA 3U4SA 2BP6A 1QJU3 1RUF1 4A7ZA 5LW9A 1J3PA 2VNRA 1F5FA 4IEPA 3WCSA 4META 4HZFA 1R092 3BTAA 5DZEA 4FSJA 2WR9A 4P14A 4NRPA 4XIKA 2F4LA 3OPTA 2FDKA 4LUKA 1AR61 1V6LA 2VMDA 5FZ6A 5T5LA 3WLUA 3VD3A 1NXD1 4DEQA 1TVGA 1OLME 4CUGA 1IS3A 1H0BA 2ARAA 3OEAA 1VBE2 4YM1A 4ZXEA 4AEKA 3AXDA 2RJ2A 4URTA 4CCDA 4IEVA 4UOJA 2R0FA 5IK4A 1UY0A 4K6BA 3T2PA 4FPYA 5L36A 3AZXA 1UY2A 1UXXX 4FXGB 5FRAA 2IWGB 3PHMA 4IUGA 3URFA 3QACA 1J59A 2Y26A 1FAYA 2XBO2 2H6CA 4MH0E 1VR3A 3FLPA 3GBGA 2W08A 3Q8CA 4ZU5A 5FYHA 4YZ5A 4K1YA 3LOBA 3POWA 2A70A 1ZRCA 3OYWB 3WEZA 3ECQA 4LIUA 4A41A 4RSUA 2H0BA 4MADA 1SMVA 2XH6A 2WO1A 4TN7A 4XJUA 1PIV2 1UU6A 1UX7A 3Q8EA 3MZHA 3MO4A 1POV3 2L9LA 1S0JA 4BQXA 1GZ9A 3AK0A 4GD4A 4KWKA 4Q4V1 4Z1VA 2OZJA 3RYKA 1LOFA 5K0UA 1C1FA
chains in the Genus database with same CATH topology
2LRPA 3ZYBA 4BQ4A 1L7LA 4LKFA 1WCUA 1W9FA 1OH3A 4YW7A 1W8WA 1W8TA 2Q1FA 4LKEA 4YW6A 1W8ZA 1W90A 1UOJA 1OKOA 1WZXA 2JWPA 4CPBA 4CP9A 4BQ2A 1GWMA 2WYFA 1WMXA 3ORJA 4LK7A 5D21A 3ZYHA 4AL9A 4BQ3A 2KR2A 2O14A 2LROA 4CP9B 3ZYFA 4BQ5A 4LJHA 2K46A 4CPBD 3UT0A 1GWLA 2C24A 2VXJA 4LKDA 1GWKA 4A6SA 1W8UA 4YWAA 4LK6A 1HN0A 1V0AA 3F95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRP A;  3ZYB A;  4BQ4 A;  1L7L A;  4LKF A;  1WCU A;  1W9F A;  1OH3 A;  4YW7 A;  1W8W A;  1W8T A;  2Q1F A;  4LKE A;  4YW6 A;  1W8Z A;  1W90 A;  1UOJ A;  1OKO A;  1WZX A;  2JWP A;  4CPB A;  4CP9 A;  4BQ2 A;  1GWM A;  2WYF A;  1WMX A;  3ORJ A;  4LK7 A;  5D21 A;  3ZYH A;  4AL9 A;  4BQ3 A;  2KR2 A;  2O14 A;  2LRO A;  4CP9 B;  3ZYF A;  4BQ5 A;  4LJH A;  2K46 A;  4CPB D;  3UT0 A;  1GWL A;  2C24 A;  2VXJ A;  4LKD A;  1GWK A;  4A6S A;  1W8U A;  4YWA A;  4LK6 A;  1HN0 A;  1V0A A;  3F95 A; 
#chains in the Genus database with same CATH topology
 1QJY 1;  1F15 A;  1YJK A;  2V5Y A;  3FHQ A;  3V0A A;  1FYU A;  4MSV A;  4XUQ A;  1W8T A;  4FPF A;  2WZR 3;  3AVS A;  1QNW A;  4LPL A;  4OHZ A;  2OS2 A;  4Q4X 2;  5C6C A;  1YFY A;  1RJ7 A;  2E9Q A;  3JBG 1;  2HWE 1;  1Z7S 2;  1DQ6 A;  5C5U A;  4ZXK A;  2GH2 A;  2XUM A;  1S2K A;  1ZRD A;  4CRQ A;  1YFW A;  1ZBA 1;  1VBA 2;  2B46 X;  1NX9 A;  1QJF A;  1UYX A;  2IFW A;  1QH6 A;  2QQJ A;  3OGJ A;  5DN2 A;  2ZPX A;  2FDF A;  2NPI A;  4DMI A;  4UBH A;  2R07 3;  4LR4 A;  4BLJ A;  2DVB A;  4WM8 C;  3S57 A;  2XON A;  4IV1 B;  3OD4 A;  4XEZ A;  1UZY A;  2Q8D A;  4JGY C;  1W04 A;  3F2Z A;  1O3S A;  5JMO A;  4V2V A;  2ZGR A;  4OHW A;  2RR1 1;  1W8W A;  2J1U A;  2UUR A;  3GZT B;  4V2W A;  1H2K A;  1RMU 3;  5K0U C;  5JXJ A;  4AEJ A;  2J22 A;  1WLT A;  4TYS A;  2OQ6 A;  4Q5O A;  3S5Q A;  1OLR A;  4XUT A;  2RDQ A;  1GOF A;  2WWU A;  2Z4F A;  3UET A;  4RHV 3;  2XLF A;  2Q8C A;  3SMH A;  3D0J A;  1C3H A;  4Q4V 2;  1QF3 A;  4DRV A;  1CWP A;  4ZON A;  1YUD A;  1YWK A;  1HQW A;  2ZBJ A;  3BOP A;  4MGZ E;  1PGL 2;  2RJK A;  1EV1 1;  2UYB A;  3D5O A;  1JZ2 A;  2VUD A;  5IYY A;  4TTG A;  3ASI A;  3LFI A;  1KD7 A;  2B8M A;  2WZE A;  3AVR A;  1PMH X;  1ODM A;  5GLW A;  4UWD A;  1AX1 A;  2PQS A;  4AQ2 A;  4OZX A;  4NRQ A;  4LLF A;  4XF0 A;  5G04 L;  1DU3 D;  4Z92 B;  2MNG A;  4QHO A;  4LTA A;  1VBD 2;  1DGL A;  4QU1 A;  3DUI A;  5E6H A;  1O3T A;  4FPL A;  2XOM A;  1APN A;  1UY3 A;  4YAR A;  2CNA A;  1VMF A;  1RUJ 2;  3A0K A;  3B93 A;  4IND A;  3O1S A;  2JD4 A;  1EUU A;  4PBO A;  3OD0 A;  4BQY A;  3HPN A;  3I2H A;  5IK5 A;  1G86 A;  1WA6 X;  3FUQ A;  4LE4 A;  1KFX L;  1CAX A;  3U11 A;  1ZZ9 A;  2A3X A;  3ZR6 A;  1HB2 A;  3P5B A;  1XYO A;  5FXV A;  2VUJ A;  3KF5 A;  3WNX A;  5CU1 A;  3WW1 A;  5DAX A;  2O8Q A;  3BPZ A;  3VBU C;  2LRO A;  5DUV A;  3K2O A;  3E6D A;  4Q4Y 3;  2B4K A;  3POF A;  5L73 A;  5I8T A;  1JI6 A;  1GQG A;  2BRT A;  2V4V A;  4YW3 A;  2QQO A;  2OKX A;  1BQP A;  3GJB A;  4DB5 A;  2NMN A;  4AXO A;  5JSO A;  3DXT A;  3POJ A;  2P6C A;  3WP3 A;  3T1M A;  1JYI A;  1XBF A;  2ZEZ A;  2XHN A;  5FYB A;  1RUH 3;  1DHK B;  3ZYI B;  2JG8 A;  3CL1 A;  1QKQ A;  2IXL A;  1RXF A;  4EJR A;  1SDD B;  2ZGN A;  4ZZ5 A;  1J3R A;  4IGP A;  2BVV A;  1MEC 1;  5F5A A;  3B01 A;  3PTY A;  4OI1 A;  1A6C A;  4ARY A;  2Q30 A;  4JKL A;  1O5U A;  3RZJ A;  3KD4 A;  4GQ7 A;  2FZ1 A;  3CKH A;  2X05 A;  3KHC A;  4B1L A;  1GP5 A;  4CU7 A;  1TNR A;  4CSW A;  4D3W A;  2C5D A;  1VRH 3;  3LA2 A;  5I0U A;  3WDW A;  4HKW A;  4OHY A;  3H1Y A;  1VLN A;  2BWA A;  2Y6J A;  5FYM A;  1ND2 A;  1W6M B;  2ENR A;  3ILR A;  1NE4 A;  1UKR A;  1YI7 A;  2NMO A;  2W68 A;  2XBO 3;  3AB0 A;  4P02 B;  4A42 A;  3SXW A;  2WO2 A;  2C26 A;  4QKF A;  5CFD C;  3HT1 A;  1W28 A;  3WG1 A;  1F2N A;  4YW6 A;  5IVE A;  4I0B A;  4QQO A;  1MS5 A;  2I45 A;  1DFQ A;  1LHO A;  2ID4 A;  4LBN A;  5BNO B;  1YCI A;  2RDS A;  4CEW C;  4I3P A;  4OMD A;  3K77 A;  2ZGK A;  4JDN A;  2NYY A;  3N9P A;  3MBW A;  5T55 A;  1N3Q A;  2J1T A;  2Q8O A;  2D40 A;  1W6N A;  1FPN 1;  5DXD A;  3H8R A;  1Q43 A;  1YO8 A;  5T50 A;  3GZU C;  4XIL A;  1O8S A;  3JBG 3;  4HKO A;  4QDQ A;  1WCS A;  3DGT A;  1LAJ A;  5FUN A;  1PGW 2;  4HXC A;  2VME A;  1SDW A;  2HJI A;  3BGA A;  3A7Q A;  3AP7 A;  1BK0 A;  2I2S A;  5A6X A;  3ZMN A;  4Y1U A;  2XL7 A;  1WCU A;  1V6J A;  3OCP A;  3MF6 A;  2BW8 A;  1XXN A;  3DKQ A;  4AI8 A;  1S0B A;  1LOC A;  4QT6 A;  4PI0 A;  4E8C A;  4UFM A;  4F83 A;  5KC5 A;  5HCH A;  3O1O A;  1VBC 3;  1RHI 1;  2RM2 3;  3FN9 A;  1WGP A;  1KQR A;  4H55 A;  2BOJ A;  3WD5 A;  3WDX A;  5FY0 A;  3AP6 A;  1O8P A;  4MGI E;  1WBF A;  2B9U A;  3RZK A;  5C3O A;  3RSJ A;  3RDI A;  4WZF A;  1JYC A;  4NID A;  3RMX A;  2WNV C;  2XQX A;  2DVA A;  3HQX A;  3LQC A;  2CY6 A;  4P5H A;  2Z79 A;  3BTZ A;  5CG9 A;  2HYK A;  2YUE A;  4ZPI A;  5LAS A;  4WZC A;  3J4U H;  1C8N A;  2BGO A;  4GWN A;  5H9S A;  3OGS A;  5EV7 A;  5B4X A;  5J36 A;  4FQZ A;  2Q4S A;  1AR7 3;  1RUF 2;  2YU2 A;  3ITQ A;  1WW4 A;  2KA3 A;  1OQE A;  2GC3 A;  3U14 A;  4MZU A;  3RWK X;  2Q1Z B;  1VAM A;  4MV2 A;  3TRS B;  4KWL A;  5AFB A;  3HBK A;  1SHW B;  3PL0 A;  4C91 A;  1RIR A;  2QQL A;  5IVY A;  5FY9 A;  4BU2 A;  2XKO A;  2ZAC A;  4QU2 A;  5H9R A;  2ZX3 A;  4JCK A;  5GM0 A;  4Q8K A;  2E7A A;  5JAX A;  3WNP A;  4BWO A;  1UKG A;  2GC2 A;  2VZV A;  2FQP A;  3PDQ A;  2QQV A;  1PGS A;  3H3U A;  1IQA A;  2BUK A;  4MGY E;  4IDZ A;  4YM2 A;  3VDA A;  4DXR A;  3T0D A;  4G4F A;  4I3G A;  4Q4X 3;  3H1W A;  1R1Z A;  5KXE A;  2XJR A;  1ZYB A;  5DAV A;  2D5F A;  2EIE A;  1GNZ A;  2WT2 A;  2VPV A;  3WDY A;  5KBF A;  3WG4 A;  4W8J A;  4PIX A;  3I2G A;  4DY3 A;  3T0B A;  1D4V B;  3O7O A;  1WLC A;  4QWN A;  1WZX A;  2BJS A;  4K3U A;  4YM0 A;  3LOI A;  3RJR A;  3WSO A;  2NM1 A;  3HNB M;  2VMH A;  4JHT A;  5C4W C;  4AOC A;  4XXA A;  1ASJ 3;  1B35 C;  1I3H A;  1EUT A;  1UWW A;  1UU4 A;  3C7O A;  3E5Q A;  1ZZ8 A;  3LEG A;  4H7M A;  4Y26 A;  3DPR B;  4BDV B;  1KIT A;  1YFU A;  5F3E A;  3IIA A;  3FL7 A;  2WA3 A;  4DEV A;  4LBQ A;  3ZYP A;  2XJU A;  3CU7 A;  1W0N A;  2DVG A;  4QX8 A;  1ULD A;  3UES A;  4BMB A;  1RC6 A;  2PN5 A;  2ZGS A;  3J7H A;  3AP4 A;  4HSJ A;  4NE9 A;  3GBW A;  2RS1 3;  1E5H A;  5E8A A;  3JD7 2;  2BU9 A;  1X9T A;  5FYT A;  5ISL A;  1W9W A;  4LA2 A;  2G4I A;  4P9W A;  4LO5 B;  2ETE A;  1VE0 A;  3AZW A;  4MX3 A;  4BJ0 A;  2YBP A;  3ORJ A;  4B8E A;  2AZ5 A;  1IKQ A;  3KVA A;  1DDL A;  3MID A;  4LMF A;  1AZD A;  2HWF 3;  5I93 A;  4WVM B;  4QX0 A;  4DXS A;  4HON A;  4EWE A;  3R4U A;  5CKQ A;  5FY5 A;  1H2N A;  4Y5S A;  2PAK A;  2WAO A;  1H9W A;  4NO4 A;  4P00 B;  3KB5 A;  3WQ1 A;  4JHZ A;  1RUC 2;  5FZD A;  4I2O A;  4R9D A;  3VBS B;  4BQ4 A;  5JWP A;  3HNM A;  3MIC A;  3N9L A;  2HWD 2;  4I0A A;  5GLV A;  5F5I A;  4BQ1 A;  1AL2 2;  5KXC A;  4I0W B;  3J8F 1;  1FV2 A;  4BK4 A;  4CUC A;  1OOP A;  3MFA A;  4EN0 A;  2VZ3 A;  1KRI A;  1BVP 1;  1RUI 1;  3THT A;  3ATG A;  4IV3 A;  2RE9 A;  3V65 A;  4KBB A;  3DKW A;  4PT6 A;  3U78 A;  2R06 1;  4BQ3 A;  3C7F A;  4TZD A;  3HEI A;  3JBG 2;  1JOJ A;  1AR9 1;  2OUH A;  3O0X A;  4M4R A;  4COY A;  1WLD A;  4CCN A;  2P37 A;  2A1X A;  2R49 A;  3RMY A;  1AX0 A;  1CAV A;  2C4X A;  3V0A B;  1UD1 A;  1H2L A;  1ENQ A;  1SCR A;  2YZ4 A;  5T52 A;  2AGS A;  3EBR A;  5FZ8 A;  5A7Q A;  2ARC A;  4FPG A;  3UK9 A;  2AEZ A;  1AR6 2;  4JKM A;  4ZU7 A;  3HT2 A;  1AYN 1;  2QDR A;  3VBF B;  2WT1 A;  3NJX A;  4G9S B;  4HOO A;  4LIV A;  2C1F A;  2ZML A;  3PUQ A;  2VU9 A;  4Q29 A;  4PDW C;  3SKV A;  2DFB A;  2XDV A;  2VQA A;  5C4W B;  4CDQ B;  3ABZ A;  4LBK A;  4Y20 B;  1C8M 1;  2DBN A;  4XVH A;  3ZYH A;  3SH5 A;  1O3R A;  5F6K A;  4DOU A;  4AI3 A;  4IV3 C;  5J3U A;  4E8D A;  3ETQ A;  4JAA A;  2V73 A;  3U1X A;  1QH7 A;  2JB4 A;  4CDX C;  3DYO A;  3HQU A;  1OUR A;  1H1M A;  4AFB A;  4HLT A;  4E9K A;  2D98 A;  1S0I A;  2A6W A;  4IE0 A;  1EV1 3;  3ROU A;  5TSW A;  4CDQ A;  3VL8 A;  3IKW A;  1FX5 A;  1ZRI A;  5C8C C;  1BJQ A;  2WYS A;  3M3O A;  4C0H A;  3NQH A;  1FMD 1;  1GIC A;  1ND2 C;  3N7M A;  2W91 A;  3JB8 A;  2BDR A;  4DUX A;  3ZVX A;  1PO1 2;  1EYB A;  2HEV F;  4FTB A;  2GH8 A;  3NNG A;  3AMQ A;  1AXY A;  5JCT A;  1JYX A;  2JJ6 A;  4XBL A;  4L0P A;  3B94 A;  3GBF A;  5FK8 A;  2W46 A;  4Y24 A;  3Q8A A;  1NKG A;  1B09 A;  5JXI A;  1XPW A;  1YIP A;  1FNY A;  1VRB A;  5CKN A;  1HV1 A;  2WAB A;  2JG8 B;  4TLF A;  5A6Q A;  2VG9 A;  1LB2 A;  1S4C A;  1PM4 A;  2QCS B;  3PUA A;  5FUI A;  1QWR A;  5JZG B;  4RS5 A;  3NKT A;  3Q9O A;  1A8M A;  1VRH 2;  3RRD A;  5FTT C;  3ZYB A;  1UYP A;  4E2Q A;  3TN9 1;  4BK5 A;  1NE6 A;  3NRU A;  1MS8 A;  4Q1P A;  5CFD B;  2GAL A;  3I2O A;  2W0X A;  1S1A A;  2WFF 2;  4KU8 A;  3BU7 A;  5GLU A;  1RB8 G;  5FZM A;  5L19 A;  5DUX A;  2D7F A;  2ZXQ A;  2XUE A;  1QJY 3;  2GU9 A;  3H50 A;  2YC2 A;  3KLS A;  3S5A A;  3X29 B;  5LK7 B;  3LFM A;  2GZW A;  4CCL A;  4RQP B;  2IXJ A;  2VVD A;  3BYW A;  4W4Z A;  1G9C A;  5FLJ A;  5A32 A;  1IKP A;  3UT0 A;  2RR1 3;  2HKX A;  2PMW B;  5EWS A;  1NQJ A;  1E57 A;  5FZ3 A;  5HCA A;  5FMO L;  5IHR A;  3CZJ A;  3VLB B;  3ACH A;  1HQN A;  3MPP G;  2P3J A;  3OB8 A;  5I91 A;  2PHL A;  2XGX A;  3HN3 A;  2DUO A;  1XB9 A;  2BQP A;  2AH2 A;  3KGL A;  2GNM A;  4GWM A;  4QDS A;  2E53 A;  4AR2 A;  1FOD 3;  3KWV A;  4WM8 B;  3H8O A;  4COZ A;  4RR3 A;  1YNA A;  4KI5 M;  1WA4 A;  4B29 A;  4CPB A;  4H2A A;  4QQ2 A;  2OA2 A;  5A7W A;  2HWC 3;  5FMC A;  2HWD 1;  1X82 A;  3ZFF A;  2XR4 A;  4LKS A;  1G6N A;  2W87 A;  4BPZ A;  5IAX A;  4AGG A;  2FZ2 A;  2W2I A;  3O0V A;  1YQ6 A;  2MEV 3;  5IAT A;  3WHU A;  1COV 1;  3JQX A;  1LES A;  4FOQ A;  4GXL A;  2W1U A;  4HMZ A;  2ZMK A;  4Q2F A;  4CUA A;  3I7D A;  2G9F A;  4MXW A;  2VTX A;  5L9B A;  3UL2 A;  5FR3 A;  1PO2 3;  3GM8 A;  5C3S A;  5H9Q A;  1U5I A;  3POY A;  3J7M A;  3L2Y A;  1OH3 A;  1F8V A;  2Y33 A;  4FP2 A;  1U5Y A;  4XQ4 A;  3M70 A;  1ALY A;  1D7P M;  3U37 A;  1SPP A;  2PA7 A;  3V0B B;  1W2O A;  1OFN A;  3RI9 A;  1D0G A;  3MW4 A;  5CKM A;  4COU A;  1SLT A;  4PF1 A;  4HK8 A;  4LK7 A;  4WM7 A;  3DEM A;  1ND3 B;  3OGR A;  2AYH A;  2WA4 A;  4B7E A;  2QVS B;  3AYA A;  2WQZ C;  2DCT A;  4NRM A;  3VBS A;  3CZU A;  1V9U 1;  5LA9 A;  2BV4 A;  3CIH A;  1LGB A;  3VKF C;  3ZFF B;  4XPV A;  4B4Q A;  2DTW A;  3BTX A;  4WVM A;  3I3D A;  2BFU L;  3CJX A;  3AFG A;  2TBV A;  4CYD A;  2VXR A;  4GMP 0;  1W6N B;  4IET A;  3FBY A;  4YM3 A;  3DXU A;  1JMU B;  1OMI A;  4J1X A;  3ZXJ A;  3KT1 A;  1C5I A;  3OUH A;  1QY4 A;  4Q4V 3;  1JN2 P;  4FQ4 A;  2VZO A;  5C9A B;  4DNY A;  1R1A 3;  2E7T A;  1JS9 A;  2VE1 A;  4CXW A;  2ZHM A;  3I2I A;  2QTW B;  1IG0 A;  5FO7 B;  1CAW A;  1J3Q A;  5JSP A;  1F4A A;  3TEW A;  1BBT 1;  2XVL A;  3N35 A;  1HRI 3;  1XNA A;  2WWS A;  3FFQ A;  3VZO A;  4BHP A;  1ZX5 A;  1DQ2 A;  4J1W A;  4CTE A;  1UNB A;  4AVV A;  3BKZ A;  5ABJ C;  2WNU A;  3POS A;  5FXZ A;  4RFT 0;  3C3V A;  3KCC A;  1CON A;  1QJX 3;  2XJS A;  1R09 3;  3OSD A;  4M4P A;  4C1W A;  1US3 A;  3EYP A;  2X29 A;  3ZM8 A;  4F8A A;  1JZ7 A;  1JYV A;  4R9C A;  5CG8 A;  3ETP A;  3VD5 A;  2K9Z A;  5F5Q A;  5CBL A;  3TEY A;  3NV4 A;  5GLT A;  1R1A 2;  2D44 A;  2YMZ A;  2V72 A;  2ZAH A;  4ISQ A;  1R08 3;  4YVW A;  3WQB A;  4ERO A;  2QQI A;  2ZZQ A;  5FZE A;  3I8T A;  4GB3 1;  3U0Z A;  1AJO A;  3KT7 A;  4FVV A;  1GQH A;  2LTN A;  4JDO A;  2EAK A;  5F9T A;  5BNN A;  3HWJ A;  3ACI A;  1AR8 3;  1U5X A;  4AGR A;  3JZV A;  2YBS A;  3AMM A;  2UWC A;  2XWJ B;  4IW3 A;  3UJO A;  4CU9 A;  1RHI 3;  2RM2 1;  4CCJ A;  2VCA A;  1FMD 2;  5FZG A;  3WQ7 A;  3FHI B;  2D93 A;  3EHK A;  4JTN A;  3A4U A;  4HPK A;  5HCB A;  3A0N A;  2GAU A;  1LHW A;  1RHI 2;  2QQM A;  2ZGP A;  4LOS A;  4XF9 A;  4Y3O A;  3IDB B;  1ZBA 2;  2JDY A;  5BXX A;  3VZN A;  4FPJ A;  5KWR A;  1PZ7 A;  4P9X A;  3ZMO A;  3FWE A;  1DGR A;  2HWB 2;  1GOH A;  4YGE A;  1OLM A;  3WW2 A;  5JZG A;  2OXB A;  3W58 A;  2VM9 A;  4IGQ A;  5EYY A;  3WW3 A;  5DPN A;  5A70 A;  1K5J A;  3VDD C;  4FFI A;  2ZX0 A;  2EXH A;  4KBZ A;  1QJY 2;  1H1A A;  3LZZ A;  5DG2 A;  4A6S A;  2HEY F;  1ZBA 3;  2HWF 1;  2GN7 A;  1RTV A;  4NR1 A;  4PF5 A;  4Q4Y 2;  4BA6 A;  4A4A A;  3RGB A;  4B7K A;  1AXK A;  1VBB 1;  1STM A;  1UOB A;  2VCM A;  3BCW A;  3FUO A;  4NN0 A;  4NOT A;  4OHV A;  3VBH A;  2OYZ A;  1GAN A;  1W0P A;  1MS4 A;  5DDJ 3;  4ZS2 A;  4Y5T A;  1RUD 2;  2DUQ A;  5C3Q A;  2ZGL A;  5C71 A;  2DTY A;  2EA7 A;  1AR8 2;  2QZ3 A;  3OBZ A;  3MIG A;  3A23 A;  4HG6 B;  4MLO A;  4JV4 A;  3LDR A;  4E4S A;  2B45 X;  1IPS A;  3IWZ A;  4OVE A;  4FPO B;  4OQ8 A;  3TWI A;  2HBT A;  2JG9 C;  4IV1 A;  1H4G A;  3C7H A;  3O14 A;  1X9P A;  2ZHN A;  4QKD A;  5DAQ A;  1GWL A;  3Q8F A;  4XMA A;  1FV3 A;  2VUL A;  1MZ6 A;  3NST A;  4HVO A;  1EP0 A;  1ND3 A;  4KWJ A;  4LUM A;  4S2D A;  3CJI B;  4XF4 A;  2RR1 2;  3ZLI A;  4CP0 A;  3OG2 A;  4ZU4 A;  1I6X A;  1DYO A;  1SLC A;  3KV9 A;  5BNN C;  3ZXG A;  3VHR A;  4YZ2 A;  3AX4 A;  4CUB A;  1Q56 A;  2E51 A;  4FTS A;  1UZZ A;  3M7A A;  3D3A A;  5A3U A;  1YQ5 A;  5FPA A;  3AJZ A;  1YI9 A;  1SFP A;  2A7A A;  3VBH C;  4QXB A;  4GH4 C;  5EHD A;  3MV0 1;  1W6O A;  3AL6 A;  1EPW A;  2P4E A;  4K40 A;  4R8H A;  4CDU B;  4D7Y A;  4IL7 A;  4YZ3 A;  1Y3T A;  5C3R A;  5GZF A;  1YQ2 A;  1MS0 A;  2A71 A;  2IFR A;  2VAU A;  5DUW A;  4ARX A;  3WNL A;  3VBO B;  4GB3 2;  1B35 B;  1ASJ 1;  3T2O A;  2C24 A;  3HAG A;  1VAL A;  2QUO A;  5BY5 A;  3I4I A;  2TUN A;  3ZOI A;  1TMF 2;  1PVX A;  3BIE A;  5HPO A;  3S7E A;  2CL2 A;  2ZEW A;  3JD7 1;  3NNM A;  5J98 B;  5IFP A;  4QPY A;  5LZ6 A;  3E1F 1;  3H7Y A;  3ZN5 A;  4XZP A;  1UAI A;  4J25 A;  1DQ4 A;  1QIQ A;  3SCH A;  5GZC A;  1UU5 A;  4ISR A;  1GYK A;  4OYU A;  1BXH A;  2AR6 A;  1UIJ A;  2VVF A;  1U12 A;  4NPR A;  2EF6 A;  3WNN A;  1ULE A;  4Y1X A;  2V09 A;  4GWI A;  2R04 1;  3NVC A;  4HSL A;  3PUR A;  4N8M A;  3U10 A;  3N4M A;  4QAW A;  2RS5 3;  4AI0 A;  5FO8 B;  1EPZ A;  4O7X A;  1CVN A;  4A2U A;  3A22 A;  1DF0 A;  3N36 A;  1D4M 2;  3R05 A;  1LOG A;  4LLO A;  4QX3 A;  5FZL A;  3O12 A;  4XXP A;  2JDN A;  1AR9 3;  1AL0 G;  5FKB A;  3ZFG B;  5BUV A;  4RGA A;  3NAP A;  3OF1 A;  3T4H B;  4XQD A;  4EQV A;  1LEM A;  2WO7 A;  1XYP A;  3MUZ 1;  4Q4X 1;  1CIY A;  1UX6 A;  2RMU 3;  1ZBE 1;  1RUI 3;  3VN4 A;  2JE7 A;  1SPP B;  2FCT A;  3PTR B;  5FXW A;  2JDM A;  1LHV A;  3WZ1 A;  5BNO A;  4JKK A;  3IN9 A;  2DYC A;  2Y6F A;  1RUE 3;  1XOY A;  3ILN A;  2JDA A;  1POV 0;  1LJ7 A;  1VBC 1;  5A3W A;  5GZD A;  2VCB A;  4URA A;  4D7S A;  2VW1 A;  4QMA A;  3ZX7 A;  4HN1 A;  4CZS A;  4XBN A;  2B42 B;  2E6V A;  2IVI B;  2WLQ A;  4M3C B;  4MXV A;  2FCV A;  1VMH A;  1YLL A;  5CAD A;  4LHK A;  1AYN 3;  3JB4 C;  5T5O A;  1YFX A;  3B5L B;  4LHS A;  5FY7 A;  2DVD A;  1HB4 A;  5E16 A;  1ND3 C;  5AVP A;  1GP6 A;  3NAP C;  4BZ4 A;  4G3Y C;  5JOW A;  4AFA A;  3VKN A;  3LAG A;  1CX1 A;  4DUV A;  5C70 A;  3KZ4 C;  3GHN A;  5C9A A;  3O0W A;  1QOT A;  1S0E A;  1C8M 3;  2VTF A;  1UQX A;  2VNG A;  3MLJ A;  1LTE A;  1LED A;  4PQ9 A;  3KT4 A;  2Y6L A;  4I30 A;  4RGG A;  1IS5 A;  1ZM1 A;  2PLV 1;  1LEN A;  3RYP A;  4A7K A;  1OQD A;  3WP4 A;  4MUV A;  1GZC A;  1OHF A;  3MIE A;  1F35 A;  4QGM A;  1HQL A;  1S0D A;  5J96 B;  3VKL A;  1YC6 1;  1O4Y A;  4L8Q A;  3IM0 A;  2VNO A;  3MDP A;  1AYM 2;  5CZK A;  4RN5 A;  5FYI A;  5C8C B;  4RL7 A;  2BNN A;  1ZZ7 A;  3B7M A;  3CDZ B;  3N9O A;  5LBE A;  3WNK A;  3VV1 A;  1E5S A;  4CU8 A;  2ERF A;  5FMD A;  2EIB A;  5FOJ B;  2C0Z A;  1PMJ X;  4ASM B;  3DEC A;  4UF0 B;  5FPU A;  2FDJ A;  4AFM A;  4BE3 A;  1G8W A;  1SBF A;  2A6Y A;  3AZV A;  5F6L B;  5FRE A;  1RUJ 1;  4WBB A;  5IAV A;  2G1M A;  1ULG A;  1V9U 2;  2AC1 A;  3MIH A;  3T2Q A;  3DF0 A;  2YC4 A;  1C4R A;  1UXZ A;  2MEV 2;  1V6K A;  3IAQ A;  4HKL A;  5IT6 A;  2NP0 A;  1JW6 A;  3R4S A;  4XAA A;  4XUP A;  5D8A A;  1NCR B;  5EJ3 A;  3RZZ A;  3AL5 A;  5IVB A;  4LXL A;  1AR8 1;  3PJY A;  3WIN E;  1SBE A;  4MXW B;  3RNS A;  5F32 A;  4CP9 A;  4AVS A;  4H3W A;  3BIW E;  1AYM 3;  3WR0 A;  2WFF 3;  3J26 N;  4GAZ A;  4XJZ A;  3MHZ A;  3T3Y A;  3PVB B;  2E32 A;  1SEF A;  3U07 A;  5FBJ A;  1U0A A;  4HET A;  3LKJ A;  1K42 A;  4LJH A;  2JKX A;  4SLI A;  1VBD 1;  5HV0 A;  4QXK A;  1OPO A;  5LBF A;  2XB6 C;  4L2N A;  3TB0 A;  3B9C A;  4N43 C;  4CP1 A;  2VZR A;  3UKN A;  2HEW F;  1ENS A;  3RPQ A;  1OUX A;  5FLI A;  1CAU A;  4P9G A;  1Q8Q A;  4P9I A;  2RS5 1;  2WJS A;  4O65 A;  1RUC 3;  1ZRF A;  3GCX A;  2RS3 3;  4E27 A;  3WW4 A;  2PAM A;  3VL9 A;  4NHX A;  3WVJ A;  4AQT A;  4E2S A;  1UN1 A;  5JI7 A;  2ZGT A;  5LCW L;  3LB9 A;  1LRH A;  3ALQ A;  1I5P A;  5DAB A;  3H9A A;  2D6K A;  2YB7 A;  2XL9 A;  2G9Z A;  1DGW A;  4FTE A;  3TNQ A;  4XJA A;  4AK3 A;  3NNJ A;  4R9B A;  4Q4W 1;  3SH4 A;  1CAX B;  1GQP A;  2D3P A;  1P8J A;  2GC0 A;  2HWC 1;  3UGF A;  3LDB A;  2JG9 B;  4CCK A;  1F31 A;  3MI8 A;  4CEY B;  2DU0 A;  5FYC A;  1SFN A;  3IDE A;  2ZGM A;  4QQL A;  1SFY A;  1NLQ A;  2WIN B;  3LEI A;  1N1Y A;  2UWB A;  3DV8 A;  1L7Q A;  2CGO A;  2GME A;  2WYF A;  3KHB A;  4KU7 A;  4QXC A;  3U75 A;  3EQE A;  3LF7 A;  2HWE 2;  3AM2 A;  1VAV A;  3AMP A;  4V1P A;  3SIS A;  4BQW A;  1LOB A;  2X5I B;  5AC9 3;  1H6Y A;  3CHX A;  4ATE A;  3PVE A;  1NY7 2;  2X53 S;  2XJP A;  4Y1Z A;  5FBZ A;  5I0S A;  1HB3 A;  4XIO A;  1XU1 A;  2WS9 1;  1BEV 2;  3AYD A;  1Q5O A;  4YG0 A;  4PDW B;  1WUV A;  3RS6 A;  4IEY A;  1O7F A;  2Y6G A;  5A3P A;  4YG6 A;  5T5P A;  4FP3 A;  4DZG A;  2PHF A;  4QX5 A;  2W92 A;  1RUH 2;  2Y6K A;  4AHW A;  4H7L A;  1PIV 1;  4PLM A;  3IT8 A;  5L9R A;  3PMS A;  1OT5 A;  3H7J A;  3EB7 A;  1BBT 3;  1VBE 1;  2Y0I A;  2FMD A;  2XG3 A;  1AR9 2;  1D2S A;  5IVJ A;  4UFK A;  5FZI A;  4AI9 A;  1Q3E A;  1K12 A;  3K4D A;  1M06 G;  2XQR A;  2KM2 A;  1JHN A;  3NNF A;  1XNK A;  3FMG A;  4OHX A;  4ZHN A;  1H8V A;  2JDH A;  2Y60 A;  4NAO A;  2JEM A;  2VQU A;  4U36 A;  1PO1 3;  1WW6 A;  3N7K A;  1GP4 A;  1AYN 2;  3T0A A;  1NCR A;  2WAA A;  4BOW A;  4LT5 A;  3ZKU A;  3ZN6 A;  4JX0 A;  1J83 A;  4XC9 A;  4ONU A;  3VBR B;  1AR7 2;  3WF2 A;  4ET7 A;  4FFG A;  4YGC A;  3ZXL A;  3POE A;  4WVV A;  1XRU A;  4QKN A;  4CDW A;  1DLL A;  1MS1 A;  5ABJ B;  1QQP 3;  1W8Z A;  1UPI A;  4GAL A;  4P5Y A;  4OMC A;  4XFA A;  5GKA C;  3OGV A;  2CV6 A;  1EAH 3;  1W8H A;  3CJI A;  2D3S A;  2C9K A;  3O1M A;  4Y22 A;  3DYM A;  4X8N A;  4LOT A;  5FJK A;  1XNC A;  1S55 A;  1W3X A;  4W50 A;  1Y9G A;  2R1B A;  1W9Y A;  3WQ0 A;  2R7E B;  1H4H A;  4JGY B;  4B4P A;  1DP0 A;  3HJR A;  2IVJ A;  1BYH A;  4XF3 A;  3O1V A;  4P08 A;  3M2M A;  5CAZ A;  1MEC 2;  1BKZ A;  1WW5 A;  4XFH A;  1COV 2;  4EZH A;  2JKB A;  2BPA 2;  3KM5 A;  3KS7 A;  4UFL A;  4YFW A;  4N53 A;  1ZA4 A;  4IEW A;  5KHJ A;  1V6I A;  4GZ9 A;  2AUY A;  1WME A;  1GZT A;  1J1T A;  4NPM A;  1PMI A;  1TMF 1;  4WM7 C;  1SAC A;  1U5Z A;  2K0G A;  3ZN6 B;  2GC1 A;  2W1W A;  4W65 A;  1KS4 A;  1CIW A;  2YHJ A;  5FZB A;  4Y5Z 0;  2ARE A;  4UYB A;  4XFI A;  4AHY A;  4E4H A;  3AJY A;  5A80 A;  4CDW C;  1VBB 2;  4DXT A;  1CJD A;  3VBU B;  2VJX A;  4LHN A;  2DUR A;  5BYN A;  5IWF A;  1JYN A;  1F5J A;  2XKP A;  4TLG A;  4E4D X;  4RFR B;  5DQ0 A;  1NQD A;  3GZE A;  2YFU A;  1MAC A;  5J7M A;  5J09 A;  3KGZ A;  4PCR A;  3SKJ E;  1XU2 A;  3EO6 A;  2TEP A;  5A3M A;  4CA9 A;  2LRP A;  3K51 A;  1W6P A;  2R04 2;  4CE8 A;  5CIR A;  1O4T A;  4JQR A;  5GZE A;  4N9I A;  4DQA A;  4M0N A;  4QM8 A;  1VMJ A;  2OW4 A;  2JD9 A;  4AG4 A;  5FDB A;  1QOS A;  1O3Q A;  4EYU A;  1TME 2;  4MHR A;  1A3K A;  1V70 A;  5BV6 A;  5EJZ B;  4ZZ8 A;  1QOO A;  3SIT A;  1HRI 1;  1RUG 2;  1RUD 3;  3AYE A;  1QXJ A;  1DQ1 A;  1RVF 1;  1DG6 A;  1CQ9 A;  3BOW A;  3VHN A;  1QDO A;  1W99 A;  2VMG A;  2Z2S B;  3C7G A;  2SLI A;  1CPN A;  4AED B;  3NV3 A;  1W03 A;  1N1T A;  2RJL A;  3ZFG A;  1DZQ A;  4FFF A;  5I0D A;  3CF6 E;  2QBX A;  4QHZ A;  3ZFE A;  1AUY A;  1WD4 A;  1VIW B;  4Y22 B;  2DCK A;  5ACA 1;  2J7M A;  2R07 2;  3ZSL A;  2DVF A;  3FX3 A;  4Q1R A;  5F3G A;  2RS1 2;  1LHN A;  2IXH A;  3K75 B;  3POB A;  1WBL A;  1RUE 1;  4XFF A;  1VBA 3;  4QGN A;  2DCJ A;  2JE9 A;  4KH9 A;  4XDP A;  1JZ3 A;  3H3L A;  2HWB 3;  1UMZ A;  2FDI A;  1OF4 A;  2YYO A;  1GZW B;  3MIB A;  1QDC A;  5BNP C;  2JX9 A;  3OBT A;  3SQO A;  1DZT A;  2BGP A;  5EJ1 B;  2ET1 A;  1W9S A;  3HMY A;  4B4R A;  4E4Z A;  5FQ0 A;  2YG0 A;  3HIF A;  4LO7 A;  3GDB A;  2FHR A;  5FZO B;  5CA6 A;  2VD7 A;  2P6H A;  1QNY A;  5L7O C;  1J84 A;  1O6U A;  3AYC A;  4LBJ A;  3ZO0 B;  4LUL A;  2RS5 2;  5FZA A;  3WP6 A;  3KCY A;  3KVB A;  2GP3 A;  1R08 1;  1S2B A;  4FOV A;  3E5X A;  3USU B;  3RFR A;  4A3Z A;  3MLL A;  4FAH A;  4YGD A;  1RUI 2;  3JXS A;  1GUI A;  2MPF A;  4IER A;  4QX1 A;  3P6B A;  4WV8 A;  3IB3 A;  3VBO C;  5HI0 A;  1GLH A;  1NA1 C;  2YXS A;  1RUN A;  4L11 A;  4NHK A;  1VBD 3;  1B35 A;  1KDK A;  2YFZ A;  1ZZ6 A;  4A3X A;  3KV6 A;  1S0F A;  3ZR5 A;  5FP3 A;  5AVA A;  2VW2 A;  3O1P A;  2O1Q A;  1DYK A;  1H8T C;  3PVN A;  2ZAA A;  5A3N A;  2PHD A;  2UY9 A;  2WNE A;  1OA3 A;  4COV A;  2W1Q A;  4QPG B;  3OGG A;  5BNP A;  4GMP 1;  3PUI A;  1GZW A;  1QGL A;  1JXN A;  1GFF 2;  1QQP 1;  2X09 A;  1VBB 3;  4FPH A;  4C90 A;  4IEX A;  4CCM A;  5KR7 A;  2ZCW A;  3KV4 A;  2Q1M A;  3ZIX A;  1C57 A;  2GDF A;  4GUL A;  4NWW A;  4BIO A;  4LK6 A;  1OXC A;  2ARX A;  2XLG A;  4EWD A;  1ZZC A;  4AE2 A;  1RMU 2;  5L7O A;  1IS4 A;  5LBB A;  3DL3 A;  3BAL A;  1IQD C;  4YVW B;  4MHU A;  1Y9Q A;  1LUL A;  2EVX A;  3ZXE A;  2RV9 A;  2GNB A;  4XAC A;  4AI2 A;  5D2A A;  3GYD A;  2UYA A;  2MEV 1;  5FZK A;  1SLB A;  1COV 3;  3T1L A;  2JG9 A;  1QMJ A;  4JQT A;  1HXS 1;  5F3I A;  5CFC C;  4JGZ B;  2XXZ A;  2WNV B;  3KQ4 B;  4AYU A;  4XTP A;  3W21 A;  5IJR A;  1BCX A;  1MQT B;  5K8S A;  4R9A A;  4DUW A;  5DMY A;  5IVV A;  1FI2 A;  1NCQ C;  1AYM 1;  3J8F 3;  3D4K A;  1W3V A;  1WMF A;  1PO2 2;  2RM2 2;  3MLK A;  2FMY A;  1HRV 3;  1X7N A;  4UAP A;  1ZRE A;  4MG2 A;  3ZXD A;  1W2U A;  4CDX A;  1OF3 A;  1PVC 3;  4KGQ A;  2WZR 2;  3NJY A;  4XDO A;  2XHK A;  4OQ9 A;  4YW7 A;  5LA1 A;  5FP8 A;  4Y1V A;  3UV9 A;  5FMO S;  2CAV A;  2Z69 A;  2PEL A;  3OBA A;  4NHY A;  1UL9 A;  2VBP A;  5FAX A;  1PO2 1;  4DFS A;  5BNP B;  5KXD A;  1WMD A;  1O5L A;  4LHL A;  3NKG A;  4MOA A;  1ACC A;  3RQ0 A;  2WN3 A;  1HW5 A;  4GIQ A;  2ZX1 A;  2VOT A;  2AEN A;  3ZSJ A;  4ZKT B;  5CEH A;  2YY1 A;  4DS0 A;  2D5H A;  2DBI A;  1WWY A;  4QKB A;  2PHU A;  4XFG A;  2VXJ A;  4QPI B;  1A8D A;  5FWJ A;  4YWA A;  4N90 A;  3PU8 A;  1HN0 A;  1Y43 B;  2VVE A;  1POQ A;  2FCU A;  4BCU A;  4Q8L A;  2EXK A;  2WS9 2;  2JB8 A;  1V6N A;  3GHM A;  4NIG A;  2J1E A;  2Q0A A;  4AED A;  1F4H A;  2DU1 A;  1UZ0 A;  2P3I A;  4Q4W 3;  1RIT A;  2KD7 A;  5JR2 A;  4JRL A;  1PO1 1;  4KWU A;  2NZ9 A;  3CO2 A;  1D2Q A;  2VBD A;  4RHV 2;  3I3E A;  2DFC A;  3MGU A;  2VZ1 A;  3KMH A;  2G9G A;  3UJQ A;  3ACG A;  5I8S A;  4UW4 A;  4AFC A;  2PXJ A;  5JVV A;  5FWE A;  1PVC 2;  2H6B A;  3CJI C;  1OVS A;  4JVA A;  3JUU A;  1MPX A;  3R0R A;  1W06 A;  5DUU A;  5AC9 2;  1TME 1;  3GZA A;  1EAH 1;  3VUO A;  1MS9 A;  4FAG A;  1EY2 A;  1FOD 1;  1N1V A;  3AFK A;  2A6Z A;  2ES3 A;  1WD3 A;  2ZGQ A;  5C8C A;  2JDU A;  2CSG A;  2CAU A;  4PHZ A;  3R6S A;  3VDD A;  2WFF 1;  3VBR C;  1RYY A;  5CIS A;  2WS9 3;  4JRA A;  2D6O X;  2R04 3;  3FE5 A;  4CDU C;  1AXZ A;  4XFC A;  1K3I A;  1R08 2;  2VZS A;  4KG8 A;  2B5H A;  3HVD A;  1HV0 A;  2SBA A;  4WVZ A;  5IUQ A;  4XHB A;  4LO8 A;  5F1R A;  1Z7S 3;  1GV9 A;  2F4P A;  1CX4 A;  2IUW A;  5D8A C;  1VJ2 A;  3W9A A;  1IGO A;  4P9Y A;  1NCQ B;  2O8O A;  2GMP A;  2ZZJ A;  2QNK A;  2OPK A;  4NWV A;  5GJ6 A;  1OKQ A;  3E6B A;  4YW1 A;  3UKV A;  4A45 A;  5LY1 A;  4PI2 A;  3WF0 A;  4CU6 A;  1ZA7 A;  4PQQ A;  3VD7 A;  4EZ4 A;  2VR4 A;  5C8W A;  3H42 B;  1H1I A;  3N9N A;  5GLZ A;  3T2T A;  3OBR A;  3LD8 A;  3P3P A;  1HRI 2;  3FBM A;  2PTM A;  2EXJ A;  2NQY A;  2DDU A;  3VDB A;  1RVF 2;  2VMC A;  5CFC A;  1Z78 A;  2R06 2;  2R0H A;  2VZT A;  3S0M A;  4AEM A;  4QD2 A;  4XMI A;  2A3Y A;  2QQP A;  1W90 A;  1BBT 2;  1W05 A;  4MO3 M;  2WO3 A;  3THC A;  1D4M 1;  4ZS3 A;  5J48 A;  3I3Q A;  1YYN A;  4OFG A;  5EZW A;  4CDW B;  5K0U B;  3HOB A;  3TAY A;  2O14 A;  2B7Y A;  5J1X A;  1JZ6 A;  2VCC A;  3QH7 A;  4EWA A;  1RUC 1;  1VB4 A;  2D6M A;  2HBU A;  2VOK A;  4IQP A;  5FKC A;  3SEP A;  4CDX B;  4DIQ A;  3V0B A;  1CGP A;  4UFJ A;  3TNP B;  3J7N A;  1DIW A;  4Q0U A;  4QPI C;  2BOI A;  4XUR A;  1AR6 3;  2BWC A;  1SLI A;  2WQ8 A;  2D6L X;  3CLP A;  3ZFG C;  3GCW A;  4U2A A;  1CZV A;  1MQT A;  1K5M B;  3CMG A;  3MF9 A;  1CAV B;  1DZR A;  1VPH A;  4W6W A;  3QH6 A;  4K21 A;  1UMH A;  5HXM A;  1QU0 A;  1O4Z A;  4Q0V A;  5I0T A;  3W59 A;  2BER A;  2Y38 A;  3VGI A;  5JOZ A;  2E26 A;  2EID A;  4XF1 A;  1A78 A;  5DDJ 1;  3M8L A;  1GKB A;  1SLA A;  2E63 A;  1URX A;  2VL4 A;  1LR5 A;  3I97 A;  5F2S A;  1W6Q A;  3DN7 A;  4NHL A;  4A44 A;  5FZ7 A;  3OYW A;  1S0G A;  4CPB D;  2UWA A;  4CEW A;  1CAU B;  3M4F A;  5FOB B;  3IAP A;  1KFU L;  1SZB A;  3H3Z A;  1ZBE 3;  3LSE A;  2ZEY A;  5E88 A;  1J1L A;  5FQ0 B;  4QB2 A;  3RZM A;  2VEC A;  4ES9 A;  1JU3 A;  5FP4 A;  3POG A;  1TQ5 A;  2WN2 A;  4HL0 A;  4O9G A;  3E6C C;  2HWF 2;  1UF2 C;  1RUG 3;  5K7P A;  2EIC A;  2ZMN A;  3IMM A;  4KL1 A;  3SEE A;  4UI9 L;  5DZG A;  3J9S A;  3UNP A;  3WNO A;  3WG2 A;  2IXK A;  1NA1 B;  4LNV A;  5FYV A;  4DO0 A;  4DPN A;  4JC1 A;  3DPR C;  1GNH A;  1PIV 3;  1MS3 A;  3I3M A;  1HN1 A;  5LA2 A;  5FY1 A;  3LIG A;  3VD4 A;  4CP9 B;  2JDP A;  4OCT A;  1JZ8 A;  1H8T A;  1JYT A;  4XET A;  2G19 A;  5CFD A;  1YQC A;  1W6O B;  1JOP A;  2ILM A;  4IE7 A;  4NRO A;  1G9B A;  3HD8 B;  1LOA A;  3BTY A;  3LCP A;  1V0A A;  4AVA A;  5E1R A;  4I09 A;  4BYY A;  5A33 A;  5F3C A;  5E89 A;  5KXB A;  3WOG A;  5JI9 A;  2W5F A;  1PHM A;  4OUL A;  4C1X A;  2YBK A;  4QB1 A;  2WDB A;  1CAW B;  1N47 A;  4YW5 A;  4EN6 B;  2Y8K A;  2UU8 A;  4ES8 A;  1QXR A;  4XAE A;  1NT0 A;  4Y4R A;  2RDN A;  1RUE 2;  2PAE A;  2J1A A;  3KF3 A;  1UYZ A;  1X8E A;  2WFP A;  2YU1 A;  5DZF A;  2KR2 A;  3S7I A;  1TG7 A;  3TEZ A;  1ONA A;  2VOX A;  1JTZ X;  3W5M A;  1MZ5 A;  1W8F A;  2BEO A;  4AFD A;  3BPS A;  1C28 A;  5KHH A;  4HVR A;  3FHA A;  5JOY A;  5CFC B;  2CWS A;  4JGZ C;  2BYV E;  1LOD A;  2CTV A;  4IEQ A;  2YDE A;  5EXO A;  1NA1 A;  1NY7 1;  2J1R A;  3QOP A;  2ET7 A;  4NIA A;  2OX0 A;  1L7L A;  1V6O A;  3WCR A;  4P9L A;  4N7U A;  3WP5 A;  2QJV A;  1HIX A;  4LBM A;  1LOE A;  4QPG A;  4H14 A;  4I02 A;  5H9P A;  4Q0Q A;  2WZP P;  4YVS A;  4QPW A;  5BNO C;  4HAN A;  1PVC 1;  4OLL A;  1XJA A;  3VHO A;  2EAA A;  2ZHK A;  2N7G A;  2D6N A;  5FUP A;  1LU1 A;  3ZKY A;  3OY8 B;  2HH9 A;  1MQT C;  4GKX A;  2LAL A;  4FPC A;  3ACL A;  3CEW A;  4YPJ A;  5FPZ A;  3ZDV A;  2RS3 2;  4YW4 A;  2JE8 A;  3BB6 A;  1C8M 2;  1PK6 B;  5B4N A;  2W94 A;  2VUA A;  1V6M A;  3NV1 A;  1OD3 A;  1TNF A;  3M1H A;  4L97 A;  3I49 A;  3I3B A;  1W9F A;  2XML A;  5F8P A;  5IVF A;  3PIG A;  1D0H A;  5A1F A;  4CXY A;  2PQQ A;  3AKS A;  5JPM B;  3PJQ A;  1WMX A;  2VNV A;  3FFZ A;  2OZ6 A;  2B9V A;  4F3J A;  2JEC A;  2PHX A;  4UW5 A;  4BH9 A;  4IV3 B;  2P3Y A;  4HN0 A;  2WLP A;  3B02 A;  4CEY C;  3USS A;  1CZT A;  4FOW A;  1BEV 3;  5AFE A;  3O5S A;  5FY8 A;  2I74 A;  4IEU A;  1R1A 1;  2R1D A;  3WDT A;  4FCA A;  3IZO A;  2JEN A;  3GXU A;  3LPG A;  3LPF A;  4Q26 A;  2YC0 A;  4MGK E;  3WY6 A;  3O1R A;  3WG3 A;  3LIH A;  1AX2 A;  3KCX A;  2LW8 A;  2OVU A;  1E5I A;  1ND2 B;  4RQP A;  5CYY A;  5FPL A;  1VB2 A;  1Y9M A;  4XW3 A;  5JXG A;  3WF4 A;  3K46 A;  4Z2W A;  4Q27 A;  2PFW A;  2VBB A;  1AF9 A;  1XC6 A;  2PHR A;  1AL2 3;  2DF7 A;  2DV9 A;  3RWN A;  1K45 A;  2WII B;  3TYJ A;  1VAK A;  2D43 A;  2A3W A;  2VTX J;  1Z7S 1;  2W1S A;  3SHR A;  3V56 A;  2YV8 A;  5D8A B;  3I59 B;  2J1S A;  3TBD A;  1KJL A;  3HN1 A;  4GKY A;  1T6B X;  2HYX A;  4WVW A;  4XJ9 A;  1UO9 A;  5DDJ 2;  1KEX A;  4IXL A;  3FC0 A;  1CN1 A;  3WUD A;  1L7R A;  2D97 A;  3QD6 A;  4B3N A;  2WUH A;  3NL1 A;  4OUE A;  4PLO A;  5FK7 A;  2ORZ A;  1I9R A;  2RDR A;  1O91 A;  3TOJ A;  1JHJ A;  4MGQ A;  4RQP C;  4MGT A;  5KC6 A;  3ENR A;  4XTM A;  2HWE 3;  1WLW A;  3NJV A;  1W0O A;  3HQR A;  3K3O A;  1US2 A;  4D6S A;  5LWB A;  4P9J A;  4RD7 A;  5LB6 A;  5CVR A;  2WKK A;  3ES4 A;  2ORX A;  4LBL A;  2F6B A;  4BIS A;  4Z8B A;  5SV8 A;  2ADD A;  4S2F A;  4ORF A;  5HBA A;  1W6Q B;  4K7J A;  3BN6 A;  1ZVF A;  3KSC A;  4AQS A;  2RS3 1;  2ZAB A;  3A21 A;  4C8D A;  4M00 A;  2HLE A;  1BLZ A;  2ZX4 A;  1H30 A;  3VZJ A;  5FZC A;  5JUV A;  1I5Z A;  3RG0 A;  4OI0 A;  4CCO A;  2YGM A;  4M3C E;  4LKE A;  3T30 A;  4EE2 A;  3C2U A;  1X50 A;  4W6Y A;  3VBS C;  3E5U A;  5T3N A;  2XLA A;  4LA3 A;  1W2T A;  3VDD B;  4DXZ A;  1OSG A;  3RZG A;  1LKN A;  1W6M A;  1GOG A;  3W5N A;  2VQT A;  4Z07 A;  5ABJ A;  1OVP A;  3IDA A;  3IDC B;  5I0R A;  2YPD A;  3AP5 A;  4F7Z A;  4AVT A;  1AVB A;  3RZL A;  4PIY A;  5K9Y A;  2K2S A;  2PLV 3;  4O9E A;  2IZW A;  1QJZ A;  3AMH A;  4BXS V;  4YLZ A;  2RG4 A;  5A3T A;  1TE1 B;  3OY8 A;  3NW4 A;  5DG1 A;  2E31 A;  4CCC A;  1OH4 A;  4NAM A;  1K5M C;  2A6V A;  5AC9 1;  5C3P A;  2AAC A;  1OPM A;  4GA9 A;  3ES1 A;  5ACA 2;  1PNG A;  1BK1 A;  3I59 A;  1ODN A;  3POI A;  4S2H A;  1UOJ A;  1OLQ A;  5LA0 A;  1Y4W A;  2GN3 A;  3N7L A;  1DQ0 A;  4R4Z A;  4XBQ A;  5FPX A;  2CU5 A;  1QJU 1;  1RUF 3;  3WUC A;  3ZYJ B;  4QX2 A;  5A3O A;  1C5H A;  2VGD A;  1OQ1 A;  4CDQ C;  3WF3 A;  1W8O A;  2E7Q A;  1ULO A;  4Y20 A;  3ZFF C;  4L9B A;  4IE5 A;  4JDM A;  4M0H A;  1WKY A;  4M3C A;  4AWD A;  4IEO A;  1HRV 2;  4QGL A;  4BB3 A;  5JOX A;  1RUD 1;  1QEX A;  3APB A;  2WBK A;  4X6R B;  4GH4 B;  5FZ1 A;  1NXM A;  1OKO A;  2WQ4 A;  1JH5 A;  3N9Q A;  3NO8 A;  1X8M A;  3PME A;  2ZKL A;  1K5M A;  2D3R A;  3JQW A;  3LA3 A;  3OOX A;  4QQH A;  4LEJ A;  3B00 A;  2ZTN A;  5A33 B;  4R4X A;  1LNS A;  1QJE A;  1FMD 3;  1AHS A;  4QXH A;  3ZPO A;  1HX6 A;  1RL3 A;  1W2N A;  2VOW A;  2VUC A;  4XHX A;  1YQ8 A;  5ANN A;  2HWB 1;  5A7S A;  5LRS A;  3SC7 X;  4YG3 A;  4Q0S A;  1OOP B;  2X10 A;  5IK7 A;  1ENX A;  1DCS A;  4JGZ A;  1HXS 3;  4NMI A;  4YNI A;  3SH3 A;  3ON7 A;  1SCS A;  3I2J A;  3ZFE B;  2AEY A;  2XJT A;  2OUJ A;  1NOV A;  2GNT A;  2ZOE B;  5EP9 A;  3VHP A;  3AXE A;  4GJZ A;  5JZG C;  2R32 A;  3L9J T;  1FPN 3;  4IV1 C;  2OT7 A;  5FFO C;  3ZSK A;  3N9M A;  4MVT A;  1KGY A;  5EIY B;  5C5T A;  5L7O B;  1FPN 2;  1XYN A;  4NIH A;  1ZNP A;  4PBP A;  2BGC A;  2P17 A;  2PLV 2;  2VW0 A;  5FCC A;  5L9V A;  2LM3 A;  3I2D A;  4YZ4 A;  2BVB A;  1HXS 2;  3VB9 A;  5IVC A;  4LO6 B;  4YVS B;  5A6Z A;  1TMF 3;  3ZYG A;  2JG8 C;  3SLI A;  3B69 A;  4IES A;  1GWK A;  3CNA A;  4KMQ A;  3MEP A;  5FYY A;  1BHG A;  2QKD A;  3IBM A;  1QXP A;  1CZS A;  1YJL A;  3AKT A;  3LA7 A;  2Q8E A;  1FAT A;  4BM8 A;  1OA2 A;  5A6Y A;  4NPL A;  1HLC A;  4AAX A;  1LCL A;  4W6X A;  3OUI A;  1OA4 A;  2IXC A;  2FD8 A;  4QX7 A;  3JU9 A;  4OUS A;  4AZZ A;  3VKO A;  3DYP A;  4D7T A;  5A7P A;  3VBO A;  4NHM A;  5F39 A;  4Q4Y 1;  3FJS A;  5ERL A;  1NZI A;  2LS6 A;  2NLR A;  1WCQ A;  2RMU 2;  2A5Z A;  4D0Q A;  1G9D A;  1YEW A;  2WSV A;  1RED A;  1RIN A;  5JR7 B;  4LE3 A;  3MIF A;  5CNA A;  3OPZ A;  3S30 A;  1IOA A;  1QJU 2;  3CBN A;  5IK8 A;  2VMI A;  3I54 A;  1XNB A;  4XAB A;  3ZIW A;  1PGL 1;  4IGO A;  5KHI A;  4GMP 3;  3UGG A;  3F95 A;  5SV5 A;  4XJW A;  3W20 A;  4DRR A;  5APA A;  1VBE 3;  1OC1 A;  1RVF 3;  2H0V A;  1QJX 2;  1DYP A;  1UMI A;  4FO9 A;  5FP7 A;  4DIN B;  2WNV A;  5LY2 A;  2RVA A;  1NUK A;  5C33 A;  4X8P A;  5JLV A;  1UPS A;  2CGN A;  2VQ0 A;  2XVG A;  1GWM A;  1R64 A;  4M3C F;  5D21 A;  2WZ8 A;  5F7U A;  1UYY A;  4Q0P A;  4HVQ A;  3SNM A;  1W39 A;  4A7Y A;  1YRZ A;  4HFS A;  5ACA 3;  2O0O A;  4LIT A;  5LBC A;  4NII A;  2DCZ A;  4UBG A;  5A7O A;  1XND A;  5FY4 A;  4XDQ A;  3B3Q E;  3GF6 A;  2BBA A;  1PX3 A;  2Z42 A;  4QHB A;  2XPJ A;  1MEC 3;  3THD A;  4UFH A;  2P3K A;  1NCQ A;  4XQW A;  1NYW A;  4CDU A;  5FIX A;  3RZH A;  4L99 A;  3ZN4 A;  2QQN A;  3AMN A;  3INA A;  3UGH A;  2WWJ A;  3MUY 1;  1NCR C;  5FMB A;  3BUC A;  1CPM A;  4EN7 B;  3MYX A;  1E5R A;  1ZZB A;  4RS5 C;  4YZ1 A;  2X5I A;  5BNN B;  5HV4 A;  1KXG A;  3N7J A;  2QZ2 A;  3IMN A;  4Z2A A;  3RJ2 X;  3ZSE A;  1GR3 A;  1O59 A;  2NN8 A;  3VKM A;  3K4Z A;  1L3J A;  2F17 A;  4IE6 A;  2FDG A;  1RUJ 3;  2LUW A;  2P2K A;  4GWJ A;  4ATF A;  2PHT A;  3UYJ A;  5BNQ A;  2PYT A;  3KQR A;  3S6P A;  2UY8 A;  3WT3 A;  4D6Q A;  2DCY A;  2K46 A;  2V5D A;  4JZR A;  4RA0 A;  2GMM A;  5FZ4 A;  1BMV 1;  3GJA A;  3ZSM A;  3VBU A;  1HB1 A;  3J8F 2;  4XFB A;  2W39 A;  3VZK A;  3AKR A;  3ILF A;  4Q4W 2;  5FZO A;  3LGR A;  3GNE A;  1PZ8 A;  4UXA A;  3P1I A;  4K20 A;  1ZRR A;  3E97 A;  1YHF A;  5FPB A;  4FXK B;  1Q8S A;  2JDK A;  4FOY A;  4AHZ A;  2GSY A;  2CYF A;  4XJ8 A;  3QBQ A;  1MZE A;  1V00 A;  3TEX A;  4N53 B;  5IW0 A;  5LK5 A;  4C0B A;  5C9A C;  1PGW 1;  2J1V A;  2P34 A;  2VZU A;  2VO5 A;  3K3N A;  4XUN A;  4AVB A;  3PLQ A;  4WM8 A;  2ZS6 B;  1DGR N;  3HNY M;  3NWK A;  1W2A X;  1MVE A;  2ZA9 A;  4R52 A;  2C9A A;  2CHH A;  5JSR A;  1CJP A;  1SBD A;  1W9T A;  2A6X A;  4GH4 A;  3G7D A;  4LBQ D;  5LEJ A;  4OI4 A;  4AW7 A;  1IZ3 A;  3G6J B;  1UOF A;  3O1U A;  5FLH A;  2D6P A;  1Q8O A;  3ZPY A;  3BOD A;  1ULC A;  5LAT A;  1HDK A;  4RHV 1;  5EPA A;  4D8M A;  4UW3 A;  2PHW A;  4Y4Y A;  1OI6 A;  4CP2 A;  3WF1 A;  1RXG A;  1GBG A;  2VZQ A;  1OFS A;  5GAL A;  5BPX A;  3VBR A;  1HRV 1;  3EMR A;  2ATF A;  1JYW A;  3C7E A;  1ULF A;  5A7N A;  1BMV 2;  3LE0 A;  5B2G B;  4YW2 A;  4KNC A;  1RMU 1;  3U4X A;  1XE7 A;  1UZW A;  1YXW A;  1N1S A;  1W8N A;  2EXI A;  3VDC A;  1GMM A;  4QM9 A;  4I01 A;  2VC9 A;  1BZW A;  3O1T A;  2W3J A;  3D0S A;  4D69 A;  3THP A;  3MFC A;  2FDH A;  5JDB A;  2JDZ A;  4UF0 A;  3SCF A;  5KHG A;  1LGN A;  5K4L A;  1REE A;  2YPJ A;  3KV5 A;  2XJV A;  1NAE A;  2C6S A;  1PK6 C;  1UY1 A;  2Q1F A;  3DPR A;  5A3L A;  1QHD A;  3OPW A;  1UY4 A;  3GAL A;  1LEC A;  3DCQ A;  1BEV 1;  4QQP A;  1I1E A;  4PDW A;  3FZ3 A;  3PUS A;  4RGK A;  4N43 A;  4RR3 B;  4J6G A;  1X36 A;  2QDN A;  2ZEX A;  4L92 A;  1DBN A;  2RS1 1;  2DUP A;  1T6G C;  4LKD A;  5J37 A;  3OJB A;  4KQ7 A;  4XCB A;  3WDU A;  4FT8 A;  2BNO A;  1DLC A;  4GJY A;  3I2K A;  4K9S A;  2YRO A;  2KXL A;  3M3Q A;  1N3P A;  1UOG A;  5A32 B;  5FXX A;  4Z82 A;  1FXZ A;  3ACF A;  3VZM A;  2JWP A;  1TME 3;  1Q8P A;  2EIG A;  1W6P B;  3IPV A;  1XE8 A;  3PNA A;  2E33 A;  1H9P A;  4AL9 A;  1J58 A;  1PK6 A;  2A75 A;  3HBZ A;  4LOR A;  4DY5 A;  1AJK A;  3M3I A;  1ULP A;  4BXF A;  4D94 A;  5FYU A;  1OUS A;  4YYO A;  3NV2 A;  2WC2 A;  2Y6H A;  3K4A A;  4IE4 A;  3VBH B;  5FZH A;  4B1M A;  3WV6 A;  4AGV A;  1ST8 A;  1JUI A;  3EXU A;  3QCW A;  4KGG A;  4N9H A;  3TN9 3;  1TZO A;  5F5C A;  4HBN A;  2R16 A;  3JCI A;  2IC1 A;  3OEB A;  2WRA A;  3IPV B;  2I07 B;  1OOP C;  3TN9 2;  3ZYR A;  5FJH A;  4CXX A;  3C8X A;  5JIU A;  1YIF A;  5FYS A;  1HKD A;  1PNF A;  4FBF A;  2ZJC A;  2OII A;  1XSR A;  5FV3 A;  2HWC 2;  3ELN A;  3Q8B A;  4OZO A;  5FO9 B;  4TSV A;  1POV 1;  2YGL A;  2WT0 A;  1X33 A;  4NJ4 A;  5HCF A;  1EAH 2;  4LBQ B;  2QE3 A;  4BQ2 A;  4CEY A;  4K1Z A;  1CD3 G;  1FOD 2;  2QFE A;  5EQU A;  1IHM A;  2BZD A;  1UIK A;  1NLR A;  3H0O A;  3PIJ A;  5KHK A;  4TWT A;  4YSF A;  2WNO A;  1N3O A;  3V64 A;  5C4W A;  3J7L A;  1DGW X;  2WNU C;  1VP6 A;  1BVV A;  2ADE A;  4COW A;  2DWR A;  4BME A;  1XQN A;  2WZR 1;  3FLT A;  3N3H A;  1XNT A;  1NG0 A;  2GP5 A;  4OUM A;  3LWC A;  3QLQ A;  3I2F A;  3LDK A;  5LEK A;  1S2E A;  5A7W B;  3UKT A;  2BNM A;  5A1L A;  3FLR A;  2ZHL A;  2HWD 3;  1S0C A;  2R30 A;  1D4M 3;  2QQK A;  3WDV A;  3PVO A;  5FP9 A;  3ZXF A;  5I8Y A;  5CB7 A;  1ASJ 2;  3OTF A;  3D6E A;  1DQ5 A;  1PZ9 A;  1WCK A;  3ST7 A;  2Y64 A;  3PU3 A;  3RVH A;  2VZP A;  2CDP A;  2XWB B;  5JPN B;  4QPI A;  1H2M A;  3EJK A;  2R07 1;  3PUH A;  4RYD A;  4AAP A;  1CR7 A;  1REF A;  3K48 A;  5D1I A;  2JIJ A;  4EN8 B;  1T2X A;  3WX5 A;  5A1A A;  5FZF A;  3ZDS A;  4RR3 C;  2WL1 A;  2ZX2 A;  4UT5 A;  5DAP A;  4ASL A;  1JU4 A;  4YGB A;  3ZYF A;  1G9A A;  1HJF A;  1JOD A;  5LRR A;  3BU0 A;  4LQR A;  2WSU A;  4ZY9 A;  3ZXK A;  1XSQ A;  2ZGO A;  4UFI A;  4A6O A;  5GZG A;  2W9X A;  5T54 A;  4X6Q B;  4XYX A;  4AHX A;  4PJY A;  3OUJ A;  5G05 L;  4N7I A;  1LGC A;  1LHU A;  1Z0H A;  4XCA A;  1SG3 A;  2QQW A;  1V9U 3;  2Y34 A;  4XE9 A;  4AED C;  1Q8V A;  2QQU A;  3ME2 A;  4BIF A;  1UZV A;  2VMF A;  2JXA A;  1AR7 1;  1SLL A;  4HPK B;  3H8X A;  2P1B A;  2X5I C;  4QB6 A;  4RS5 B;  3RI8 A;  4XZU G;  5FYZ A;  3MPB A;  4XUO A;  3WXP A;  4XOG A;  2EAL A;  1IPK A;  4OI2 A;  5EYX A;  1IPJ A;  4K8F A;  2CGP A;  2XBO 1;  4CVU A;  1VBA 1;  1A34 A;  1KS5 A;  3MW3 A;  2JIG A;  3NJZ A;  4QDR A;  1QQP 2;  2ARB A;  1W8U A;  2MHF A;  3LEK A;  3T08 A;  1C1L A;  3NAP B;  4BLI A;  3AP9 A;  1AL2 1;  3CQO A;  2Y0O A;  4NUB A;  3M3E A;  1RJ8 A;  2OPW A;  4LKF A;  4MGS A;  4Y33 A;  1JZ5 A;  3H1M A;  3H8U A;  3HR9 A;  1KJR A;  1Y7B A;  2W47 A;  2XVK A;  3SCG A;  2A73 B;  4HK9 A;  4KG0 A;  2TNF A;  1VBC 2;  5FZ0 A;  4ITC A;  5HXV A;  1PM7 A;  2ZGU A;  1FT9 A;  3AC0 A;  4FFH A;  5EFU A;  1H6X A;  2V4A A;  4QPG C;  1OD5 A;  4HT1 T;  4JTO A;  2CWM A;  3MW2 A;  2WNU B;  2FBE A;  2W52 A;  4ASK A;  5IFT A;  1TEI A;  1JZ4 A;  3R4D B;  1RUH 1;  1GNY A;  1IS6 A;  4NVP A;  4N53 C;  4EV0 A;  3L2H A;  4Y1Y A;  2ZKN A;  1G7Y A;  4M01 A;  1UCX A;  1M4W A;  3NNL A;  1ENR A;  1MR5 A;  4LBO A;  2CDO A;  1NZC A;  4TXW A;  5M0T A;  4PIZ A;  2OQ7 A;  4FI9 A;  4YRD A;  4AQ6 A;  4FPK A;  5JMC A;  3M3C A;  1H8T B;  1GSL A;  1EV1 2;  1WW7 A;  5T5J A;  2P5B A;  2JIC A;  1CES A;  1VRH 1;  3GGL A;  3D8C A;  4MYE A;  4AF9 A;  3VBF A;  3ZFE C;  1QJX 1;  3VD9 A;  1R09 1;  3NMB A;  4AI1 A;  4S2G A;  3P3N A;  2BBV A;  4UW6 A;  1JUH A;  3BVC A;  5F37 A;  1OBN A;  4EN9 B;  4CCE A;  5C7G A;  2GND A;  3WNM A;  1G9F A;  3AZY A;  4YFZ A;  3BI3 A;  4YVW C;  4FPE A;  3RYR A;  3III A;  2VH9 A;  1KDM A;  3T09 A;  4GB3 3;  3B9I A;  5JIA A;  2RMU 1;  4PLN A;  4YVS C;  5FZ9 A;  5F2W A;  1JOB A;  3MV1 1;  3AZZ A;  2R06 3;  4WM7 B;  5DAW A;  1MZF A;  5ANQ A;  4AVC A;  2Z5W A;  4CEW B;  4D6R A;  4E2G A;  2VY0 A;  1RUO A;  4IEZ A;  1PX4 A;  1SQ4 A;  3VZL A;  1NLS A;  2IXI A;  1RGS A;  2BFU S;  3AKQ A;  3ZXA C;  4N43 B;  4JGY A;  3JD7 3;  4O61 A;  3T4V A;  3LSD A;  2J42 A;  1IG3 A;  3D82 A;  1FNZ A;  3USU A;  3LEM A;  1MVQ A;  1LOF C;  1XE0 A;  2X8K A;  4LO4 B;  3WHT A;  1GU3 A;  2XJQ A;  4K8R B;  1JBC A;  1HJG A;  1WCD J;  3VBF C;  2R6Q A;  1F9K A;  2Q5T A;  4BQ5 A;  2W95 A;  1ZBE 2;  2B39 A;  2VOV A;  2RHP A;  3AKP A;  5FPV A;  2BTV C;  5JXH A;  1UW8 A;  1RUG 1;  1LU2 A;  4SBV A;  3U4S A;  2BP6 A;  1QJU 3;  1RUF 1;  4A7Z A;  5LW9 A;  1J3P A;  2VNR A;  1F5F A;  4IEP A;  3WCS A;  4MET A;  4HZF A;  1R09 2;  3BTA A;  5DZE A;  4FSJ A;  2WR9 A;  4P14 A;  4NRP A;  4XIK A;  2F4L A;  3OPT A;  2FDK A;  4LUK A;  1AR6 1;  1V6L A;  2VMD A;  5FZ6 A;  5T5L A;  3WLU A;  3VD3 A;  1NXD 1;  4DEQ A;  1TVG A;  1OLM E;  4CUG A;  1IS3 A;  1H0B A;  2ARA A;  3OEA A;  1VBE 2;  4YM1 A;  4ZXE A;  4AEK A;  3AXD A;  2RJ2 A;  4URT A;  4CCD A;  4IEV A;  4UOJ A;  2R0F A;  5IK4 A;  1UY0 A;  4K6B A;  3T2P A;  4FPY A;  5L36 A;  3AZX A;  1UY2 A;  1UXX X;  4FXG B;  5FRA A;  2IWG B;  3PHM A;  4IUG A;  3URF A;  3QAC A;  1J59 A;  2Y26 A;  1FAY A;  2XBO 2;  2H6C A;  4MH0 E;  1VR3 A;  3FLP A;  3GBG A;  2W08 A;  3Q8C A;  4ZU5 A;  5FYH A;  4YZ5 A;  4K1Y A;  3LOB A;  3POW A;  2A70 A;  1ZRC A;  3OYW B;  3WEZ A;  3ECQ A;  4LIU A;  4A41 A;  4RSU A;  2H0B A;  4MAD A;  1SMV A;  2XH6 A;  2WO1 A;  4TN7 A;  4XJU A;  1PIV 2;  1UU6 A;  1UX7 A;  3Q8E A;  3MZH A;  3MO4 A;  1POV 3;  2L9L A;  1S0J A;  4BQX A;  1GZ9 A;  3AK0 A;  4GD4 A;  4KWK A;  4Q4V 1;  4Z1V A;  2OZJ A;  3RYK A;  1LOF A;  5K0U A;  1C1F A; 
#chains in the Genus database with same CATH homology
 2LRP A;  3ZYB A;  4BQ4 A;  1L7L A;  4LKF A;  1WCU A;  1W9F A;  1OH3 A;  4YW7 A;  1W8W A;  1W8T A;  2Q1F A;  4LKE A;  4YW6 A;  1W8Z A;  1W90 A;  1UOJ A;  1OKO A;  1WZX A;  2JWP A;  4CPB A;  4CP9 A;  4BQ2 A;  1GWM A;  2WYF A;  1WMX A;  3ORJ A;  4LK7 A;  5D21 A;  3ZYH A;  4AL9 A;  4BQ3 A;  2KR2 A;  2O14 A;  2LRO A;  4CP9 B;  3ZYF A;  4BQ5 A;  4LJH A;  2K46 A;  4CPB D;  3UT0 A;  1GWL A;  2C24 A;  2VXJ A;  4LKD A;  1GWK A;  4A6S A;  1W8U A;  4YWA A;  4LK6 A;  1HN0 A;  1V0A A;  3F95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...