1GX1A

Structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Structure of 2C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase: An Essential Enzyme for Isoprenoid Biosynthesis and Target for Antimicrobial Drug Development
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 44
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1gx1A00
1U3LA 1IV3A 2GZLA 3F6MA 3JVHA 4C8GA 3IKEA 3K2XA 3MBMA 3QHDA 3F0FA 1JN1A 1H47A 1IV1A 1KNJA 3Q8HA 3B6NA 4C8EA 5B8FA 1W55A 3T80A 1T0AA 3IEWA 3IKFA 3EORA 3ELCA 4C8IA 3F0DA 3GHZA 3F0GA 1YQNA 1W57A 4C81A 4C82A 3KE1A 1VHAA 3ERNA 1U3PA 3ESJA 2AMTA 2UZHA 1VH8A 2PMPA 3RE3A 3IEQA 3F0EA 1H48A 1KNKA 1GX1A 3FPIA 3P0ZA 1JY8A 1IV4A 1U40A 1U43A 3FBAA 1IV2A 3P10A 3K14A
chains in the Genus database with same CATH superfamily
3M4SA 3IKEA 5CA0A 5JH7A 3QUWA 3G4SF 1M90H 5IJ0A 1W55A 3VCZA 3CCRF 3RYCA 2H8CA 2GLZA 2HRUA 2HRYA 3CMAF 1ODEA 2Z1UA 5LP6C 1W57A 4YJ2A 2HS0A 3JALB 4NUTA 5LXTB 3WGKA 3D00A 4BW0B 3IMPA 3KJJA 3T80A 4BT7A 5LA6B 3VTIC 3CCJF 4IIJA 2KTVA 4F6RA 3LDTA 2UYKA 3F0FA 5IYZB 3WPXA 2H6LA 3LFOA 1JD1A 3HKBA 1W40A 4X1IA 2I6DA 1Q81H 2WALA 5HY2A 2RHLA 3ZP7A 1QVGF 3WJRA 2ZVZA 3WJPA 2AMTA 3M1XA 3HKDA 3CCEF 1VQMF 2Z1TA 4ZHQA 2UYNB 2H8EA 2NMUA 1RLGA 4BVSA 4TZZA 5ITZA 5A2QM 3OBYA 3MBMA 5G4VC 2OTMA 5J2TA 1QAHA 2OTLF 1VQOF 4YJ2B 2VAMA 4G4ZA 3UT5A 5LYJA 1IPAA 4ZHWA 1YGYA 4TUYA 4BVQA 1RQ2A 5KMGB 1K73H 1NJIH 1S72F 3S0HA 2B33A 3CC7F 3IEQA 1Z5VA 3HKCA 4I55A 2FGYA 2N48A 3VYSC 1U40A 1XBIA 2W8BC 2ZODA 2CVLA 2IG8A 4C8GA 3KHNA 4WBNB 3CCVF 4I50A 2R751 1RA4A 2G9IA 5KX5A 2K1SA 4G4XA 3C9TA 3GHZA 3HTNA 5HP7A 4G88A 1PF5A 3LWRC 3ERNA 3S0WA 3GYQA 5JCOA 2Q1XA 2AIFA 5EYPA 1VQ8F 1FFXB 1JY8A 2HQSC 1U43A 3DDNA 5LYJB 5EB0A 4ZI7B 1U3LA 3CXCF 3I3FA 3JALA 3WGMA 5LXTA 5FLXM 2VAWA 5FNVB 3NK7A 2EWCA 3RYHB 3LMEA 3CD6F 3CCSF 2BO1A 1YI2F 3WXMB 2Z1EA 2HP3A 2Z1FA 4O2BB 2QA4F 5IYZA 1VHAA 3OONA 4B45A 2IQQA 4U39A 5IJ9A 4NQ3A 2CW4A 4RHAA 3CC2F 3LWVC 1FNKA 5GIOC 3K14A 4G4WA 4IHJB 3JVHA 4PWTA 5KX5B 5EIBC 2KG4A 2UYNA 1H7MA 3JASB 5B8FA 5EIBD 3SIVA 5EYPB 4YJ3A 1VQ5F 5HY4A 2R6R1 1GO1A 4R40B 3AGKA 1K8AH 5EB1B 1QU9A 3U0OA 5KMGA 1UFYA 1SDSA 3D01A 2AIZP 5MN4A 3PLAC 3NMUC 2CZWA 2HP0B 2BTUA 1ZWZA 4BVTA 4DRXB 1T0AA 2HX0A 3CCQF 5CB4B 5HXZA 3I7TA 4HNAB 3CYPB 3S0YA 3TD5A 1Q7YH 3WJQA 1N8RH 3LWPC 5IJ9B 1YQNA 1SA0B 1SZQA 5GONB 2LCAA 5LP6B 4BY9D 3M84A 4WBNA 3K12A 3VYUC 1QVFF 4EB6B 1KNKA 1OFUA 3KIZA 3FD6A 3S03A 3V3TA 3CB2A 1X7PA 2HS3A 1FNJA 2DYYA 4YJ3B 1X25A 3TD3A 2VAPA 5BMVB 4BT6A 1FFXA 1W5FA 4G4YA 2VGMA 3JAWB 4C4WC 3CPWF 4ZI7A 4I4TB 3F0GA 1VQ7F 5FNVA 3RYFB 2ZAUA 3G6EF 2BTOA 3RYHA 5MN6A 1VQ4F 2KTUA 4X20B 4M8IA 3D54A 3KJKA 3V7EA 3JARB 3ZOPA 4O2BA 1IV4A 3IR9A 3E22B 3ZO8A 2OZBA 3K2XA 2CHSA 5HY1A 2ZF8A 3C8LA 1Q86H 1YIJF 4BVRA 1TUBB 1GO0A 1COMA 4TV9B 5EO3A 4O4JB 5CA1B 4IHJA 3JATB 1XV2A 4ZHYB 3S06A 2RHHA 3CCMF 3ON1A 3ESJA 3JASA 3HJWC 2RHJA 3WGNA 2UZHA 1J7HA 3VI6A 3F0EA 3VYTC 4NWOB 5G4UC 1W3EX 1JFFB 2FC3A 5J2UB 4X3LA 1YITF 5FJ4C 3HKEB 1H47A 3JAKB 3B6NA 3S02A 3WGJA 5EZYB 1VK3A 4LNUB 3EORA 1OAPA 4RQOA 1QD9A 2HP0A 2HVYD 3N4YA 3V7QA 1TVKB 4C82A 3RYIB 2UYJA 1W42A 2YYEA 1U3PA 3MQWA 4DRXA 5CB4A 4HNAA 5EWRA 2L26A 5HXUA 3MCAB 1CK2A 3C9UA 1SA0A 5GONA 3FBAA 5LP6A 3OBWA 1W5BA 5MN5A 3WGLA 1DBFA 4FFBB 3NVIB 3FFMA 1W5AA 3I56F 3HAXD 3N2KB 3O85A 1YJ9F 1JN1A 4EB6A 3R0PA 4BT5A 3K0TA 5JCOC 1UI9A 2RB9A 3F0DA 5HP8A 5IT9M 5JQGB 1PXWA 5BMVA 1CN7A 1KD1H 1W581 4O2AA 2BTQB 4X1YB 3JAWA 3RA6A 4BT2A 4X1KA 5GINC 3MDOA 1W5EA 4I4TA 1RLUA 3N4ZA 1YHQF 3RYFA 1IV2A 2UYPA 4TV8B 2GZLA 2VXYA 3QHDA 4X20A 3Q8HA 2ZVYA 3JARA 3IEWA 3E22A 3E20B 4O4IB 4EI9A 4ZK7A 5HWEA 3LWOC 4BT3A 4C8IA 3VIUA 1RQ7A 1YJNF 4U3JB 1W41A 4ZOLB 4O4HB 3NK6A 3L7QA 2RHOA 1TUBA 2ALEA 3C9SA 1CLIA 5C8YB 4TV9A 2I6RA 4O4JA 5CA1A 3FPIA 3JATA 3CMEF 3JAMM 3CCLF 2QI2A 2LBWA 2YXZA 3VO8A 3P10A 4O4LB 3HWUA 1VQ6F 1M1KH 3DC2A 5JVDB 2KGWA 1IV1A 1X7OA 5LOVB 3N2GA 4O2AB 2CHTA 3CCUF 4X1KB 1JFFA 5J2UA 4B62A 3HKEA 3KE1A 3JAKA 3LYBA 5EZYA 1T0KB 5DCVA 5CA0B 5JH7B 2IAFA 4LNUA 1VQPF 3I55F 2PHNA 1VQNF 3CPQA 5IJ0B 4B46A 5EAZA 1DT9A 3RYCB 1TVKA 3RYIA 5HY0A 3F6MA 1IV3A 4EI8A 4G4VA 3JCMM 3J81M 3G71F 2CSLA 1VQKF 3MCQA 1NMUB 4ZHVA 1K9MH 3E1YA 2QEXF 2ZOVA 3RA5A 4FFBA 3CC4F 2VGNA 2MQEA 3N2KA 3OW2F 4C81A 1VQLF 3GTZA 2V9YA 3VMFB 1R1MA 1Z5WA 2QTPA 4IIJB 2DT4A 3ZP4A 2PMPA 3RE3A 4F6RB 2Q1YA 5GAPK 2CWJA 4X3MA 2LBXA 3VOAA 4LCKA 3HKBB 2P6YA 4X1IB 5JQGA 1XRGA 3N2GB 2HS4A 5AVMA 1NQ3A 2F9ZC 4X1YA 1Q82H 1KNJA 4C8EA 1KQSF 1KC8H 5GANK 3CYQA 3FD5A 4ERHA 3IKFA 3HKDB 1FSZA 4TV8A 1GZ0A 2LBTA 4ZHQB 4BT4A 2GVIA 5ITZB 3QTYA 3PAFA 1E7KA 5J2TB 1XHOA 4O4IA 3NVKE 1W2BF 3P0ZA 4E6EA 3SIUA 3UT5B 4U3JA 2OHWA 1VQVA 4TUYB 4XCQA 4O4HA 4ZOLA 5C8YA 3V4DA 1W59A 3VOBA 4B5CA 3TD4A 3BYQA 3C9RA 3WPWA 1X52A 5LA6A 2OTJF 1ONIA 1VQ9F 3LWQC 4O4LA 3ELCA 3HKCB 1JJ2F 4I55B 5JVDA 5LOVA 4KWEA 4DXDA 1VH8A 3P4EA 1YJWF 1H48A 2Z01A 3CG6A 1GX1A 1Q8RA 4I50B 4EI7A 3J80M 2JNBA 5GIPC 3J7AR
chains in the Genus database with same CATH topology
1U3LA 1IV3A 2GZLA 3F6MA 3JVHA 4C8GA 3IKEA 3K2XA 3MBMA 3QHDA 3F0FA 1JN1A 1H47A 1IV1A 1KNJA 3Q8HA 3B6NA 4C8EA 5B8FA 1W55A 3T80A 1T0AA 3IEWA 3IKFA 3EORA 3ELCA 4C8IA 3F0DA 3GHZA 3F0GA 1YQNA 1W57A 4C81A 4C82A 3KE1A 1VHAA 3ERNA 1U3PA 3ESJA 2AMTA 2UZHA 1VH8A 2PMPA 3RE3A 3IEQA 3F0EA 1H48A 1KNKA 1GX1A 3FPIA 3P0ZA 1JY8A 1IV4A 1U40A 1U43A 3FBAA 1IV2A 3P10A 3K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  1IV3 A;  2GZL A;  3F6M A;  3JVH A;  4C8G A;  3IKE A;  3K2X A;  3MBM A;  3QHD A;  3F0F A;  1JN1 A;  1H47 A;  1IV1 A;  1KNJ A;  3Q8H A;  3B6N A;  4C8E A;  5B8F A;  1W55 A;  3T80 A;  1T0A A;  3IEW A;  3IKF A;  3EOR A;  3ELC A;  4C8I A;  3F0D A;  3GHZ A;  3F0G A;  1YQN A;  1W57 A;  4C81 A;  4C82 A;  3KE1 A;  1VHA A;  3ERN A;  1U3P A;  3ESJ A;  2AMT A;  2UZH A;  1VH8 A;  2PMP A;  3RE3 A;  3IEQ A;  3F0E A;  1H48 A;  1KNK A;  1GX1 A;  3FPI A;  3P0Z A;  1JY8 A;  1IV4 A;  1U40 A;  1U43 A;  3FBA A;  1IV2 A;  3P10 A;  3K14 A; 
#chains in the Genus database with same CATH topology
 3M4S A;  3IKE A;  5CA0 A;  5JH7 A;  3QUW A;  3G4S F;  1M90 H;  5IJ0 A;  1W55 A;  3VCZ A;  3CCR F;  3RYC A;  2H8C A;  2GLZ A;  2HRU A;  2HRY A;  3CMA F;  1ODE A;  2Z1U A;  5LP6 C;  1W57 A;  4YJ2 A;  2HS0 A;  3JAL B;  4NUT A;  5LXT B;  3WGK A;  3D00 A;  4BW0 B;  3IMP A;  3KJJ A;  3T80 A;  4BT7 A;  5LA6 B;  3VTI C;  3CCJ F;  4IIJ A;  2KTV A;  4F6R A;  3LDT A;  2UYK A;  3F0F A;  5IYZ B;  3WPX A;  2H6L A;  3LFO A;  1JD1 A;  3HKB A;  1W40 A;  4X1I A;  2I6D A;  1Q81 H;  2WAL A;  5HY2 A;  2RHL A;  3ZP7 A;  1QVG F;  3WJR A;  2ZVZ A;  3WJP A;  2AMT A;  3M1X A;  3HKD A;  3CCE F;  1VQM F;  2Z1T A;  4ZHQ A;  2UYN B;  2H8E A;  2NMU A;  1RLG A;  4BVS A;  4TZZ A;  5ITZ A;  5A2Q M;  3OBY A;  3MBM A;  5G4V C;  2OTM A;  5J2T A;  1QAH A;  2OTL F;  1VQO F;  4YJ2 B;  2VAM A;  4G4Z A;  3UT5 A;  5LYJ A;  1IPA A;  4ZHW A;  1YGY A;  4TUY A;  4BVQ A;  1RQ2 A;  5KMG B;  1K73 H;  1NJI H;  1S72 F;  3S0H A;  2B33 A;  3CC7 F;  3IEQ A;  1Z5V A;  3HKC A;  4I55 A;  2FGY A;  2N48 A;  3VYS C;  1U40 A;  1XBI A;  2W8B C;  2ZOD A;  2CVL A;  2IG8 A;  4C8G A;  3KHN A;  4WBN B;  3CCV F;  4I50 A;  2R75 1;  1RA4 A;  2G9I A;  5KX5 A;  2K1S A;  4G4X A;  3C9T A;  3GHZ A;  3HTN A;  5HP7 A;  4G88 A;  1PF5 A;  3LWR C;  3ERN A;  3S0W A;  3GYQ A;  5JCO A;  2Q1X A;  2AIF A;  5EYP A;  1VQ8 F;  1FFX B;  1JY8 A;  2HQS C;  1U43 A;  3DDN A;  5LYJ B;  5EB0 A;  4ZI7 B;  1U3L A;  3CXC F;  3I3F A;  3JAL A;  3WGM A;  5LXT A;  5FLX M;  2VAW A;  5FNV B;  3NK7 A;  2EWC A;  3RYH B;  3LME A;  3CD6 F;  3CCS F;  2BO1 A;  1YI2 F;  3WXM B;  2Z1E A;  2HP3 A;  2Z1F A;  4O2B B;  2QA4 F;  5IYZ A;  1VHA A;  3OON A;  4B45 A;  2IQQ A;  4U39 A;  5IJ9 A;  4NQ3 A;  2CW4 A;  4RHA A;  3CC2 F;  3LWV C;  1FNK A;  5GIO C;  3K14 A;  4G4W A;  4IHJ B;  3JVH A;  4PWT A;  5KX5 B;  5EIB C;  2KG4 A;  2UYN A;  1H7M A;  3JAS B;  5B8F A;  5EIB D;  3SIV A;  5EYP B;  4YJ3 A;  1VQ5 F;  5HY4 A;  2R6R 1;  1GO1 A;  4R40 B;  3AGK A;  1K8A H;  5EB1 B;  1QU9 A;  3U0O A;  5KMG A;  1UFY A;  1SDS A;  3D01 A;  2AIZ P;  5MN4 A;  3PLA C;  3NMU C;  2CZW A;  2HP0 B;  2BTU A;  1ZWZ A;  4BVT A;  4DRX B;  1T0A A;  2HX0 A;  3CCQ F;  5CB4 B;  5HXZ A;  3I7T A;  4HNA B;  3CYP B;  3S0Y A;  3TD5 A;  1Q7Y H;  3WJQ A;  1N8R H;  3LWP C;  5IJ9 B;  1YQN A;  1SA0 B;  1SZQ A;  5GON B;  2LCA A;  5LP6 B;  4BY9 D;  3M84 A;  4WBN A;  3K12 A;  3VYU C;  1QVF F;  4EB6 B;  1KNK A;  1OFU A;  3KIZ A;  3FD6 A;  3S03 A;  3V3T A;  3CB2 A;  1X7P A;  2HS3 A;  1FNJ A;  2DYY A;  4YJ3 B;  1X25 A;  3TD3 A;  2VAP A;  5BMV B;  4BT6 A;  1FFX A;  1W5F A;  4G4Y A;  2VGM A;  3JAW B;  4C4W C;  3CPW F;  4ZI7 A;  4I4T B;  3F0G A;  1VQ7 F;  5FNV A;  3RYF B;  2ZAU A;  3G6E F;  2BTO A;  3RYH A;  5MN6 A;  1VQ4 F;  2KTU A;  4X20 B;  4M8I A;  3D54 A;  3KJK A;  3V7E A;  3JAR B;  3ZOP A;  4O2B A;  1IV4 A;  3IR9 A;  3E22 B;  3ZO8 A;  2OZB A;  3K2X A;  2CHS A;  5HY1 A;  2ZF8 A;  3C8L A;  1Q86 H;  1YIJ F;  4BVR A;  1TUB B;  1GO0 A;  1COM A;  4TV9 B;  5EO3 A;  4O4J B;  5CA1 B;  4IHJ A;  3JAT B;  1XV2 A;  4ZHY B;  3S06 A;  2RHH A;  3CCM F;  3ON1 A;  3ESJ A;  3JAS A;  3HJW C;  2RHJ A;  3WGN A;  2UZH A;  1J7H A;  3VI6 A;  3F0E A;  3VYT C;  4NWO B;  5G4U C;  1W3E X;  1JFF B;  2FC3 A;  5J2U B;  4X3L A;  1YIT F;  5FJ4 C;  3HKE B;  1H47 A;  3JAK B;  3B6N A;  3S02 A;  3WGJ A;  5EZY B;  1VK3 A;  4LNU B;  3EOR A;  1OAP A;  4RQO A;  1QD9 A;  2HP0 A;  2HVY D;  3N4Y A;  3V7Q A;  1TVK B;  4C82 A;  3RYI B;  2UYJ A;  1W42 A;  2YYE A;  1U3P A;  3MQW A;  4DRX A;  5CB4 A;  4HNA A;  5EWR A;  2L26 A;  5HXU A;  3MCA B;  1CK2 A;  3C9U A;  1SA0 A;  5GON A;  3FBA A;  5LP6 A;  3OBW A;  1W5B A;  5MN5 A;  3WGL A;  1DBF A;  4FFB B;  3NVI B;  3FFM A;  1W5A A;  3I56 F;  3HAX D;  3N2K B;  3O85 A;  1YJ9 F;  1JN1 A;  4EB6 A;  3R0P A;  4BT5 A;  3K0T A;  5JCO C;  1UI9 A;  2RB9 A;  3F0D A;  5HP8 A;  5IT9 M;  5JQG B;  1PXW A;  5BMV A;  1CN7 A;  1KD1 H;  1W58 1;  4O2A A;  2BTQ B;  4X1Y B;  3JAW A;  3RA6 A;  4BT2 A;  4X1K A;  5GIN C;  3MDO A;  1W5E A;  4I4T A;  1RLU A;  3N4Z A;  1YHQ F;  3RYF A;  1IV2 A;  2UYP A;  4TV8 B;  2GZL A;  2VXY A;  3QHD A;  4X20 A;  3Q8H A;  2ZVY A;  3JAR A;  3IEW A;  3E22 A;  3E20 B;  4O4I B;  4EI9 A;  4ZK7 A;  5HWE A;  3LWO C;  4BT3 A;  4C8I A;  3VIU A;  1RQ7 A;  1YJN F;  4U3J B;  1W41 A;  4ZOL B;  4O4H B;  3NK6 A;  3L7Q A;  2RHO A;  1TUB A;  2ALE A;  3C9S A;  1CLI A;  5C8Y B;  4TV9 A;  2I6R A;  4O4J A;  5CA1 A;  3FPI A;  3JAT A;  3CME F;  3JAM M;  3CCL F;  2QI2 A;  2LBW A;  2YXZ A;  3VO8 A;  3P10 A;  4O4L B;  3HWU A;  1VQ6 F;  1M1K H;  3DC2 A;  5JVD B;  2KGW A;  1IV1 A;  1X7O A;  5LOV B;  3N2G A;  4O2A B;  2CHT A;  3CCU F;  4X1K B;  1JFF A;  5J2U A;  4B62 A;  3HKE A;  3KE1 A;  3JAK A;  3LYB A;  5EZY A;  1T0K B;  5DCV A;  5CA0 B;  5JH7 B;  2IAF A;  4LNU A;  1VQP F;  3I55 F;  2PHN A;  1VQN F;  3CPQ A;  5IJ0 B;  4B46 A;  5EAZ A;  1DT9 A;  3RYC B;  1TVK A;  3RYI A;  5HY0 A;  3F6M A;  1IV3 A;  4EI8 A;  4G4V A;  3JCM M;  3J81 M;  3G71 F;  2CSL A;  1VQK F;  3MCQ A;  1NMU B;  4ZHV A;  1K9M H;  3E1Y A;  2QEX F;  2ZOV A;  3RA5 A;  4FFB A;  3CC4 F;  2VGN A;  2MQE A;  3N2K A;  3OW2 F;  4C81 A;  1VQL F;  3GTZ A;  2V9Y A;  3VMF B;  1R1M A;  1Z5W A;  2QTP A;  4IIJ B;  2DT4 A;  3ZP4 A;  2PMP A;  3RE3 A;  4F6R B;  2Q1Y A;  5GAP K;  2CWJ A;  4X3M A;  2LBX A;  3VOA A;  4LCK A;  3HKB B;  2P6Y A;  4X1I B;  5JQG A;  1XRG A;  3N2G B;  2HS4 A;  5AVM A;  1NQ3 A;  2F9Z C;  4X1Y A;  1Q82 H;  1KNJ A;  4C8E A;  1KQS F;  1KC8 H;  5GAN K;  3CYQ A;  3FD5 A;  4ERH A;  3IKF A;  3HKD B;  1FSZ A;  4TV8 A;  1GZ0 A;  2LBT A;  4ZHQ B;  4BT4 A;  2GVI A;  5ITZ B;  3QTY A;  3PAF A;  1E7K A;  5J2T B;  1XHO A;  4O4I A;  3NVK E;  1W2B F;  3P0Z A;  4E6E A;  3SIU A;  3UT5 B;  4U3J A;  2OHW A;  1VQV A;  4TUY B;  4XCQ A;  4O4H A;  4ZOL A;  5C8Y A;  3V4D A;  1W59 A;  3VOB A;  4B5C A;  3TD4 A;  3BYQ A;  3C9R A;  3WPW A;  1X52 A;  5LA6 A;  2OTJ F;  1ONI A;  1VQ9 F;  3LWQ C;  4O4L A;  3ELC A;  3HKC B;  1JJ2 F;  4I55 B;  5JVD A;  5LOV A;  4KWE A;  4DXD A;  1VH8 A;  3P4E A;  1YJW F;  1H48 A;  2Z01 A;  3CG6 A;  1GX1 A;  1Q8R A;  4I50 B;  4EI7 A;  3J80 M;  2JNB A;  5GIP C;  3J7A R; 
#chains in the Genus database with same CATH homology
 1U3L A;  1IV3 A;  2GZL A;  3F6M A;  3JVH A;  4C8G A;  3IKE A;  3K2X A;  3MBM A;  3QHD A;  3F0F A;  1JN1 A;  1H47 A;  1IV1 A;  1KNJ A;  3Q8H A;  3B6N A;  4C8E A;  5B8F A;  1W55 A;  3T80 A;  1T0A A;  3IEW A;  3IKF A;  3EOR A;  3ELC A;  4C8I A;  3F0D A;  3GHZ A;  3F0G A;  1YQN A;  1W57 A;  4C81 A;  4C82 A;  3KE1 A;  1VHA A;  3ERN A;  1U3P A;  3ESJ A;  2AMT A;  2UZH A;  1VH8 A;  2PMP A;  3RE3 A;  3IEQ A;  3F0E A;  1H48 A;  1KNK A;  1GX1 A;  3FPI A;  3P0Z A;  1JY8 A;  1IV4 A;  1U40 A;  1U43 A;  3FBA A;  1IV2 A;  3P10 A;  3K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...