1GX1A

Structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Structure of 2C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase: An Essential Enzyme for Isoprenoid Biosynthesis and Target for Antimicrobial Drug Development
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 44
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1gx1A00
1VH8A 1H48A 1U40A 3T80A 2AMTA 1IV4A 1JN1A 1U3PA 1U43A 3ERNA 3FBAA 3IKEA 3MBMA 4C82A 1W55A 3ELCA 4C8EA 5B8FA 3K2XA 3P0ZA 3RE3A 3F0EA 1IV3A 3F6MA 4C8IA 1U3LA 1IV1A 1VHAA 2PMPA 3K14A 3ESJA 3F0FA 1T0AA 2GZLA 3F0DA 1GX1A 3IEWA 1KNJA 1JY8A 3IEQA 3JVHA 1YQNA 2UZHA 1H47A 3F0GA 3IKFA 3Q8HA 1W57A 3GHZA 1IV2A 3KE1A 3P10A 3FPIA 1KNKA 3QHDA 4C81A 3EORA 3B6NA 4C8GA
chains in the Genus database with same CATH superfamily
5CA1B 2HP3A 4BT4A 5IJ0A 3BYQA 1RLUA 2B33A 4B46A 1CK2A 3LWVC 3VTIC 4TUYA 5IJ0B 2Z1EA 1K9MH 3RE3A 5FLXM 4IIJA 3WGJA 4X1IA 4BT6A 4TUYB 3IEWA 3VCZA 2CVLA 3R0PA 4IIJB 3WPXA 1W3EX 2Z1UA 3MDOA 4X1IB 3FPIA 3JAWB 5CB4A 1CLIA 3CB2A 2NMUA 2Q1YA 1ONIA 3IKEA 4KWEA 5IYZA 3CPQA 5CB4B 2CHSA 3F0EA 5BMVA 1W5FA 3V4DA 5HP7A 4HNAA 5IYZB 3ZO8A 3J7AR 3F0DA 3N4YA 4LNUA 5BMVB 5GANK 2UZHA 4G88A 3OW2F 4HNAB 2OZBA 3KE1A 4EB6A 2EWCA 2Z1FA 3JAKA 2BTUA 4O2AA 1E7KA 3CYQA 2YXZA 1VH8A 4XCQA 5ITZA 3WPWA 4EB6B 3WGLA 3AGKA 3JAKB 4O2AB 1W581 1W55A 3CG6A 5LOVA 4FFBB 2G9IA 2OTMA 5ITZB 5EIBD 2YYEA 3C9UA 2P6YA 1YITF 1VQPF 2CHTA 2RHHA 1KNJA 1SA0A 2Z1TA 5GONA 3IKFA 3JASA 1VQMF 1ODEA 2R6R1 4IHJA 3P10A 1N8RH 1KNKA 1Q8RA 2ZOVA 3B6NA 4X20A 3U0OA 3P4EA 1SA0B 3S0HA 3J80M 3CCJF 4YJ3A 5GONB 3SIUA 3JASB 3FD5A 3LWQC 4IHJB 5G4VC 3JCMM 3V3TA 3G71F 2L26A 3JARA 4C8EA 5HXZA 2QA4F 2GLZA 4YJ3B 4BVQA 4O4HA 2N48A 3TD3A 3RA6A 3C9SA 3JAMM 1UFYA 2VXYA 1VQ5F 3JARB 4TZZA 2IQQA 2KG4A 3LFOA 4BT3A 2UYNA 3VO8A 4NQ3A 3L7QA 1QAHA 1T0KB 3NMUC 4WBNA 3GHZA 5EZYB 1W5BA 3NK7A 4C81A 1JFFA 1VQKF 4WBNB 2I6DA 5JQGA 3QTYA 5IJ9A 1JFFB 3UT5A 3MBMA 3DDNA 1OAPA 4EI7A 2HS4A 5HY0A 5EYPA 1NMUB 3WGNA 5JQGB 5IJ9B 3I55F 4X3MA 3UT5B 4O2BA 2LCAA 3HAXD 3CC7F 1YJWF 5EYPB 3CCMF 1TVKA 1UI9A 2LBXA 3HJWC 4O2BB 1GO1A 3RYFA 2LBWA 3CC4F 3FFMA 1TVKB 2AIZP 3CYPB 3G4SF 3WGMA 4BY9D 2HQSC 3C9RA 3RYFB 2QTPA 1X7PA 1Z5WA 2RB9A 1YJ9F 5MN5A 1VQ7F 5GAPK 5IT9M 4PWTA 1W40A 4C8IA 3RYCA 1Q7YH 1Q86H 3ESJA 3LMEA 2AIFA 3S03A 3RYCB 2UYKA 2ZAUA 3KIZA 4BVRA 2HX0A 4G4ZA 1VK3A 1W5AA 3LYBA 5HP8A 3FD6A 3T80A 2R751 3JATA 3K2XA 5MN4A 4DXDA 3V7EA 3S02A 2H6LA 1IV1A 1U3LA 1VHAA 1VQ8F 4C4WC 5AVMA 3JATB 2KGWA 3N4ZA 2CW4A 4G4XA 4G4YA 5JH7A 3SIVA 1IPAA 4B45A 1SZQA 4NWOB 5JH7B 2VAPA 1TUBA 3IR9A 4LNUB 2HRYA 3CCLF 1YIJF 2VGNA 3KJJA 3LWPC 1TUBB 2I6RA 3MCQA 4O4LA 1M1KH 3VI6A 3N2GA 4ZHYB 2ZF8A 1Q82H 5JVDA 3CCRF 3I7TA 4O4LB 5LOVB 3N2GB 5JVDB 1FFXA 3IEQA 1QU9A 2FGYA 3ON1A 1YJNF 1SDSA 1FNKA 3RA5A 3C9TA 2CSLA 1IV4A 1JN1A 4DRXA 2Z01A 3ELCA 3OBYA 4X20B 3RYHA 2QI2A 3N2KA 2CZWA 3CCSF 1XBIA 1W41A 2ZVYA 3CD6F 4U39A 5EAZA 4DRXB 5J2TA 3K14A 3RYHB 3N2KB 3CPWF 3O85A 4I50A 1FSZA 4O4HB 3JVHA 5EIBC 3E22A 4R40B 5J2TB 2UYJA 3IMPA 1VQVA 4I50B 5C8YA 3S06A 3VOBA 2UYNB 3E22B 5JCOC 1U40A 5FNVA 3CCVF 1S72F 1U3PA 5C8YB 3OONA 3VMFB 3PLAC 3P0ZA 3JALA 5EWRA 5HY4A 5FNVB 4ZHQA 4E6EA 2ZVZA 3CCEF 3VYTC 4BT7A 3HTNA 5HY2A 3JALB 4ZHQB 1QVGF 3Q8HA 4O4JA 1R1MA 3GYQA 1K73H 2WALA 1X52A 3K0TA 2K1SA 4O4JB 5JCOA 1VQ4F 4RQOA 3ERNA 1JD1A 3FBAA 5CA0A 4NUTA 3CCUF 1H7MA 4ZHVA 5KX5A 4EI9A 1K8AH 3GTZA 3F6MA 2VAWA 1RQ7A 5MN6A 1KQSF 5LXTA 1W5EA 3D00A 5CA0B 4RHAA 2ZODA 1QVFF 2CWJA 3KJKA 5KX5B 1NJIH 3D54A 1JJ2F 1YQNA 5LXTB 3CC2F 2Q1XA 1QD9A 5HY1A 3M1XA 4BT5A 5GIPC 1DBFA 3F0FA 1KC8H 2RHJA 3HKCA 4X1YA 4ZI7A 3LWOC 1M90H 1VQ9F 2F9ZC 4G4WA 3C8LA 3HKCB 2OTJF 3NVKE 1XV2A 5EO3A 3M84A 4X1YB 3WJPA 1XRGA 4ZI7B 2HP0A 1DT9A 3JAWA 1J7HA 3I3FA 5FJ4C 3ZOPA 2HP0B 3S0YA 2LBTA 1IV2A 1COMA 3QHDA 3K12A 1GO0A 4TV8A 3I56F 2IAFA 2PHNA 3MQWA 4TV8B 3CCQF 1Q81H 2BO1A 1YI2F 2H8EA 2MQEA 1FNJA 2PMPA 3CMAF 3HWUA 3S0WA 4BVTA 5LYJA 4BT2A 5GINC 3WXMB 4F6RA 2BTOA 3G6EF 4I55A 5LYJB 4LCKA 3EORA 3WGKA 4FFBA 4C8GA 1W42A 3HKBA 5LA6A 1X7OA 2HS0A 1FFXB 4F6RB 3CXCF 2DYYA 4I55B 4YJ2A 2HVYD 4O4IA 3PAFA 1U43A 3TD4A 4C82A 2QEXF 5HWEA 2IG8A 5B8FA 1NQ3A 1W2BF 3HKBB 5LA6B 5DCVA 4U3JA 2OHWA 1X25A 2KTUA 1PXWA 1RLGA 1IV3A 4YJ2B 5HXUA 3RYIA 1RQ2A 4O4IB 1YHQF 2KTVA 4ZHWA 3D01A 1T0AA 5EB0A 4U3JB 1VQ6F 2HRUA 1JY8A 1RA4A 5G4UC 3RYIB 3TD5A 1CN7A 1VQNF 3QUWA 2JNBA 1OFUA 3E1YA 5LP6C 4I4TA 2RHLA 3M4SA 3WJRA 3VIUA 1ZWZA 4ZOLA 5GIOC 2RHOA 3CMEF 2AMTA 3VYUC 3LWRC 3NVIB 4I4TB 4G4VA 1VQLF 1GZ0A 4B5CA 2V9YA 3DC2A 3OBWA 4ZOLB 5J2UA 3VOAA 5EZYA 2VAMA 1VQOF 2ALEA 5J2UB 3V7QA 1H47A 1PF5A 1KD1H 3F0GA 3KHNA 1YGYA 1W57A 2UYPA 2HS3A 5EB1B 2H8CA 4ZK7A 5LP6A 4BW0B 2FC3A 3HKDA 1H48A 2DT4A 2VGMA 3MCAB 3ZP7A 2GVIA 3ZP4A 3WJQA 5LP6B 2BTQB 4TV9A 5KMGA 3HKDB 4B62A 4X1KA 4X3LA 1Z5VA 1W59A 4TV9B 2GZLA 5KMGB 4ERHA 1GX1A 3NK6A 3HKEA 4M8IA 4X1KB 1XHOA 3LDTA 3E20B 5A2QM 5CA1A 2OTLF 3VYSC 2W8BC 3J81M 4BVSA 3HKEB 4EI8A
chains in the Genus database with same CATH topology
1VH8A 1H48A 1U40A 3T80A 2AMTA 1IV4A 1JN1A 1U3PA 1U43A 3ERNA 3FBAA 3IKEA 3MBMA 4C82A 1W55A 3ELCA 4C8EA 5B8FA 3K2XA 3P0ZA 3RE3A 3F0EA 1IV3A 3F6MA 4C8IA 1U3LA 1IV1A 1VHAA 2PMPA 3K14A 3ESJA 3F0FA 1T0AA 2GZLA 3F0DA 1GX1A 3IEWA 1KNJA 1JY8A 3IEQA 3JVHA 1YQNA 2UZHA 1H47A 3F0GA 3IKFA 3Q8HA 1W57A 3GHZA 1IV2A 3KE1A 3P10A 3FPIA 1KNKA 3QHDA 4C81A 3EORA 3B6NA 4C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH8 A;  1H48 A;  1U40 A;  3T80 A;  2AMT A;  1IV4 A;  1JN1 A;  1U3P A;  1U43 A;  3ERN A;  3FBA A;  3IKE A;  3MBM A;  4C82 A;  1W55 A;  3ELC A;  4C8E A;  5B8F A;  3K2X A;  3P0Z A;  3RE3 A;  3F0E A;  1IV3 A;  3F6M A;  4C8I A;  1U3L A;  1IV1 A;  1VHA A;  2PMP A;  3K14 A;  3ESJ A;  3F0F A;  1T0A A;  2GZL A;  3F0D A;  1GX1 A;  3IEW A;  1KNJ A;  1JY8 A;  3IEQ A;  3JVH A;  1YQN A;  2UZH A;  1H47 A;  3F0G A;  3IKF A;  3Q8H A;  1W57 A;  3GHZ A;  1IV2 A;  3KE1 A;  3P10 A;  3FPI A;  1KNK A;  3QHD A;  4C81 A;  3EOR A;  3B6N A;  4C8G A; 
#chains in the Genus database with same CATH topology
 5CA1 B;  2HP3 A;  4BT4 A;  5IJ0 A;  3BYQ A;  1RLU A;  2B33 A;  4B46 A;  1CK2 A;  3LWV C;  3VTI C;  4TUY A;  5IJ0 B;  2Z1E A;  1K9M H;  3RE3 A;  5FLX M;  4IIJ A;  3WGJ A;  4X1I A;  4BT6 A;  4TUY B;  3IEW A;  3VCZ A;  2CVL A;  3R0P A;  4IIJ B;  3WPX A;  1W3E X;  2Z1U A;  3MDO A;  4X1I B;  3FPI A;  3JAW B;  5CB4 A;  1CLI A;  3CB2 A;  2NMU A;  2Q1Y A;  1ONI A;  3IKE A;  4KWE A;  5IYZ A;  3CPQ A;  5CB4 B;  2CHS A;  3F0E A;  5BMV A;  1W5F A;  3V4D A;  5HP7 A;  4HNA A;  5IYZ B;  3ZO8 A;  3J7A R;  3F0D A;  3N4Y A;  4LNU A;  5BMV B;  5GAN K;  2UZH A;  4G88 A;  3OW2 F;  4HNA B;  2OZB A;  3KE1 A;  4EB6 A;  2EWC A;  2Z1F A;  3JAK A;  2BTU A;  4O2A A;  1E7K A;  3CYQ A;  2YXZ A;  1VH8 A;  4XCQ A;  5ITZ A;  3WPW A;  4EB6 B;  3WGL A;  3AGK A;  3JAK B;  4O2A B;  1W58 1;  1W55 A;  3CG6 A;  5LOV A;  4FFB B;  2G9I A;  2OTM A;  5ITZ B;  5EIB D;  2YYE A;  3C9U A;  2P6Y A;  1YIT F;  1VQP F;  2CHT A;  2RHH A;  1KNJ A;  1SA0 A;  2Z1T A;  5GON A;  3IKF A;  3JAS A;  1VQM F;  1ODE A;  2R6R 1;  4IHJ A;  3P10 A;  1N8R H;  1KNK A;  1Q8R A;  2ZOV A;  3B6N A;  4X20 A;  3U0O A;  3P4E A;  1SA0 B;  3S0H A;  3J80 M;  3CCJ F;  4YJ3 A;  5GON B;  3SIU A;  3JAS B;  3FD5 A;  3LWQ C;  4IHJ B;  5G4V C;  3JCM M;  3V3T A;  3G71 F;  2L26 A;  3JAR A;  4C8E A;  5HXZ A;  2QA4 F;  2GLZ A;  4YJ3 B;  4BVQ A;  4O4H A;  2N48 A;  3TD3 A;  3RA6 A;  3C9S A;  3JAM M;  1UFY A;  2VXY A;  1VQ5 F;  3JAR B;  4TZZ A;  2IQQ A;  2KG4 A;  3LFO A;  4BT3 A;  2UYN A;  3VO8 A;  4NQ3 A;  3L7Q A;  1QAH A;  1T0K B;  3NMU C;  4WBN A;  3GHZ A;  5EZY B;  1W5B A;  3NK7 A;  4C81 A;  1JFF A;  1VQK F;  4WBN B;  2I6D A;  5JQG A;  3QTY A;  5IJ9 A;  1JFF B;  3UT5 A;  3MBM A;  3DDN A;  1OAP A;  4EI7 A;  2HS4 A;  5HY0 A;  5EYP A;  1NMU B;  3WGN A;  5JQG B;  5IJ9 B;  3I55 F;  4X3M A;  3UT5 B;  4O2B A;  2LCA A;  3HAX D;  3CC7 F;  1YJW F;  5EYP B;  3CCM F;  1TVK A;  1UI9 A;  2LBX A;  3HJW C;  4O2B B;  1GO1 A;  3RYF A;  2LBW A;  3CC4 F;  3FFM A;  1TVK B;  2AIZ P;  3CYP B;  3G4S F;  3WGM A;  4BY9 D;  2HQS C;  3C9R A;  3RYF B;  2QTP A;  1X7P A;  1Z5W A;  2RB9 A;  1YJ9 F;  5MN5 A;  1VQ7 F;  5GAP K;  5IT9 M;  4PWT A;  1W40 A;  4C8I A;  3RYC A;  1Q7Y H;  1Q86 H;  3ESJ A;  3LME A;  2AIF A;  3S03 A;  3RYC B;  2UYK A;  2ZAU A;  3KIZ A;  4BVR A;  2HX0 A;  4G4Z A;  1VK3 A;  1W5A A;  3LYB A;  5HP8 A;  3FD6 A;  3T80 A;  2R75 1;  3JAT A;  3K2X A;  5MN4 A;  4DXD A;  3V7E A;  3S02 A;  2H6L A;  1IV1 A;  1U3L A;  1VHA A;  1VQ8 F;  4C4W C;  5AVM A;  3JAT B;  2KGW A;  3N4Z A;  2CW4 A;  4G4X A;  4G4Y A;  5JH7 A;  3SIV A;  1IPA A;  4B45 A;  1SZQ A;  4NWO B;  5JH7 B;  2VAP A;  1TUB A;  3IR9 A;  4LNU B;  2HRY A;  3CCL F;  1YIJ F;  2VGN A;  3KJJ A;  3LWP C;  1TUB B;  2I6R A;  3MCQ A;  4O4L A;  1M1K H;  3VI6 A;  3N2G A;  4ZHY B;  2ZF8 A;  1Q82 H;  5JVD A;  3CCR F;  3I7T A;  4O4L B;  5LOV B;  3N2G B;  5JVD B;  1FFX A;  3IEQ A;  1QU9 A;  2FGY A;  3ON1 A;  1YJN F;  1SDS A;  1FNK A;  3RA5 A;  3C9T A;  2CSL A;  1IV4 A;  1JN1 A;  4DRX A;  2Z01 A;  3ELC A;  3OBY A;  4X20 B;  3RYH A;  2QI2 A;  3N2K A;  2CZW A;  3CCS F;  1XBI A;  1W41 A;  2ZVY A;  3CD6 F;  4U39 A;  5EAZ A;  4DRX B;  5J2T A;  3K14 A;  3RYH B;  3N2K B;  3CPW F;  3O85 A;  4I50 A;  1FSZ A;  4O4H B;  3JVH A;  5EIB C;  3E22 A;  4R40 B;  5J2T B;  2UYJ A;  3IMP A;  1VQV A;  4I50 B;  5C8Y A;  3S06 A;  3VOB A;  2UYN B;  3E22 B;  5JCO C;  1U40 A;  5FNV A;  3CCV F;  1S72 F;  1U3P A;  5C8Y B;  3OON A;  3VMF B;  3PLA C;  3P0Z A;  3JAL A;  5EWR A;  5HY4 A;  5FNV B;  4ZHQ A;  4E6E A;  2ZVZ A;  3CCE F;  3VYT C;  4BT7 A;  3HTN A;  5HY2 A;  3JAL B;  4ZHQ B;  1QVG F;  3Q8H A;  4O4J A;  1R1M A;  3GYQ A;  1K73 H;  2WAL A;  1X52 A;  3K0T A;  2K1S A;  4O4J B;  5JCO A;  1VQ4 F;  4RQO A;  3ERN A;  1JD1 A;  3FBA A;  5CA0 A;  4NUT A;  3CCU F;  1H7M A;  4ZHV A;  5KX5 A;  4EI9 A;  1K8A H;  3GTZ A;  3F6M A;  2VAW A;  1RQ7 A;  5MN6 A;  1KQS F;  5LXT A;  1W5E A;  3D00 A;  5CA0 B;  4RHA A;  2ZOD A;  1QVF F;  2CWJ A;  3KJK A;  5KX5 B;  1NJI H;  3D54 A;  1JJ2 F;  1YQN A;  5LXT B;  3CC2 F;  2Q1X A;  1QD9 A;  5HY1 A;  3M1X A;  4BT5 A;  5GIP C;  1DBF A;  3F0F A;  1KC8 H;  2RHJ A;  3HKC A;  4X1Y A;  4ZI7 A;  3LWO C;  1M90 H;  1VQ9 F;  2F9Z C;  4G4W A;  3C8L A;  3HKC B;  2OTJ F;  3NVK E;  1XV2 A;  5EO3 A;  3M84 A;  4X1Y B;  3WJP A;  1XRG A;  4ZI7 B;  2HP0 A;  1DT9 A;  3JAW A;  1J7H A;  3I3F A;  5FJ4 C;  3ZOP A;  2HP0 B;  3S0Y A;  2LBT A;  1IV2 A;  1COM A;  3QHD A;  3K12 A;  1GO0 A;  4TV8 A;  3I56 F;  2IAF A;  2PHN A;  3MQW A;  4TV8 B;  3CCQ F;  1Q81 H;  2BO1 A;  1YI2 F;  2H8E A;  2MQE A;  1FNJ A;  2PMP A;  3CMA F;  3HWU A;  3S0W A;  4BVT A;  5LYJ A;  4BT2 A;  5GIN C;  3WXM B;  4F6R A;  2BTO A;  3G6E F;  4I55 A;  5LYJ B;  4LCK A;  3EOR A;  3WGK A;  4FFB A;  4C8G A;  1W42 A;  3HKB A;  5LA6 A;  1X7O A;  2HS0 A;  1FFX B;  4F6R B;  3CXC F;  2DYY A;  4I55 B;  4YJ2 A;  2HVY D;  4O4I A;  3PAF A;  1U43 A;  3TD4 A;  4C82 A;  2QEX F;  5HWE A;  2IG8 A;  5B8F A;  1NQ3 A;  1W2B F;  3HKB B;  5LA6 B;  5DCV A;  4U3J A;  2OHW A;  1X25 A;  2KTU A;  1PXW A;  1RLG A;  1IV3 A;  4YJ2 B;  5HXU A;  3RYI A;  1RQ2 A;  4O4I B;  1YHQ F;  2KTV A;  4ZHW A;  3D01 A;  1T0A A;  5EB0 A;  4U3J B;  1VQ6 F;  2HRU A;  1JY8 A;  1RA4 A;  5G4U C;  3RYI B;  3TD5 A;  1CN7 A;  1VQN F;  3QUW A;  2JNB A;  1OFU A;  3E1Y A;  5LP6 C;  4I4T A;  2RHL A;  3M4S A;  3WJR A;  3VIU A;  1ZWZ A;  4ZOL A;  5GIO C;  2RHO A;  3CME F;  2AMT A;  3VYU C;  3LWR C;  3NVI B;  4I4T B;  4G4V A;  1VQL F;  1GZ0 A;  4B5C A;  2V9Y A;  3DC2 A;  3OBW A;  4ZOL B;  5J2U A;  3VOA A;  5EZY A;  2VAM A;  1VQO F;  2ALE A;  5J2U B;  3V7Q A;  1H47 A;  1PF5 A;  1KD1 H;  3F0G A;  3KHN A;  1YGY A;  1W57 A;  2UYP A;  2HS3 A;  5EB1 B;  2H8C A;  4ZK7 A;  5LP6 A;  4BW0 B;  2FC3 A;  3HKD A;  1H48 A;  2DT4 A;  2VGM A;  3MCA B;  3ZP7 A;  2GVI A;  3ZP4 A;  3WJQ A;  5LP6 B;  2BTQ B;  4TV9 A;  5KMG A;  3HKD B;  4B62 A;  4X1K A;  4X3L A;  1Z5V A;  1W59 A;  4TV9 B;  2GZL A;  5KMG B;  4ERH A;  1GX1 A;  3NK6 A;  3HKE A;  4M8I A;  4X1K B;  1XHO A;  3LDT A;  3E20 B;  5A2Q M;  5CA1 A;  2OTL F;  3VYS C;  2W8B C;  3J81 M;  4BVS A;  3HKE B;  4EI8 A; 
#chains in the Genus database with same CATH homology
 1VH8 A;  1H48 A;  1U40 A;  3T80 A;  2AMT A;  1IV4 A;  1JN1 A;  1U3P A;  1U43 A;  3ERN A;  3FBA A;  3IKE A;  3MBM A;  4C82 A;  1W55 A;  3ELC A;  4C8E A;  5B8F A;  3K2X A;  3P0Z A;  3RE3 A;  3F0E A;  1IV3 A;  3F6M A;  4C8I A;  1U3L A;  1IV1 A;  1VHA A;  2PMP A;  3K14 A;  3ESJ A;  3F0F A;  1T0A A;  2GZL A;  3F0D A;  1GX1 A;  3IEW A;  1KNJ A;  1JY8 A;  3IEQ A;  3JVH A;  1YQN A;  2UZH A;  1H47 A;  3F0G A;  3IKF A;  3Q8H A;  1W57 A;  3GHZ A;  1IV2 A;  3KE1 A;  3P10 A;  3FPI A;  1KNK A;  3QHD A;  4C81 A;  3EOR A;  3B6N A;  4C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...