1GX1A

Structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
157
structure length
157
Chain Sequence
b'EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title Structure of 2C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase: An Essential Enzyme for Isoprenoid Biosynthesis and Target for Antimicrobial Drug Development
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 44
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1gx1A00
1H47A 3P0ZA 1U3PA 3IKFA 3KE1A 3RE3A 3F6MA 3QHDA 3IKEA 1IV2A 3FBAA 3MBMA 1U40A 3K2XA 4C81A 3F0GA 5B8FA 3K14A 1H48A 1T0AA 1IV4A 1IV1A 3ELCA 1W55A 3ERNA 3F0FA 2GZLA 3B6NA 2PMPA 3FPIA 1W57A 3IEWA 4C8EA 1U3LA 3GHZA 1IV3A 1KNKA 3JVHA 1YQNA 3IEQA 3Q8HA 4C82A 3T80A 3EORA 1GX1A 4C8GA 1JY8A 1KNJA 1U43A 1JN1A 1VH8A 2AMTA 3P10A 1VHAA 2UZHA 4C8IA 3F0EA 3F0DA 3ESJA
chains in the Genus database with same CATH superfamily
3GYQA 5J2TB 1W3EX 1VQKF 3SIVA 3IR9A 2IG8A 1XV2A 3LYBA 4X1KB 3FBAA 3LWRC 5JCOC 1YJWF 5G4VC 1TUBA 3JAKB 1IV1A 4X1IA 1W40A 1Q81H 3RYHB 3C9TA 3ON1A 5IJ0B 4RQOA 3U0OA 3C8LA 4BVRA 5JH7B 3CCVF 3PLAC 5LA6B 4C4WC 4I55A 1W42A 3P0ZA 1RQ7A 2F9ZC 4ZHWA 2VAMA 3F6MA 5B8FA 4O2BB 3GTZA 3E22B 4RHAA 1Q8RA 5ITZA 5J2TA 5HY4A 5LP6B 4TUYB 3RA5A 3NK6A 3JARA 4O2AA 2AMTA 3OW2F 2OHWA 2Z1TA 3M1XA 2CVLA 4EI9A 3LWVC 3VYSC 2VGMA 2HP0B 4X3MA 3JATB 4ZHQB 2HX0A 3I7TA 3CPQA 1JD1A 2QTPA 4YJ3B 1R1MA 3F0GA 1VQOF 3WGNA 2L26A 3K14A 4O4HB 1QVGF 2H8EA 5EZYA 3LMEA 1OAPA 1COMA 2UYPA 1N8RH 3VOAA 4G4ZA 2WALA 5G4UC 3J80M 5GONA 4I50A 4BVSA 1U43A 3ZO8A 4C8GA 1W5FA 1RA4A 2Z01A 1VHAA 2YXZA 1YI2F 3V7EA 3E22A 5IJ9A 3I3FA 5KX5B 5FJ4C 1QD9A 4XCQA 3CCMF 3DC2A 3F0EA 2CHSA 5LP6A 4TUYA 3C9UA 2PHNA 2Z1EA 4I4TB 3CCSF 1W2BF 1U40A 1FNJA 3RYIB 3WGJA 3FD6A 3CC4F 3FPIA 1YJ9F 2HP0A 3JCMM 4ZHQA 4O4IB 2BO1A 1NQ3A 1CLIA 1GZ0A 3R0PA 4BY9D 4F6RA 3C9RA 1ODEA 4ZHVA 1Q82H 4B5CA 4O4HA 1KC8H 2VAPA 5JCOA 1TUBB 4LNUA 1U3PA 2LCAA 3S03A 1VQNF 4U39A 3CB2A 4C81A 3WXMB 1H48A 1Z5WA 5KX5A 1K8AH 1W41A 3BYQA 4C8EA 5JQGB 4I55B 2B33A 5HY2A 4I4TA 3DDNA 4G4VA 1VQVA 3WJQA 1JY8A 2RHJA 2ALEA 1ONIA 3P10A 3TD3A 3RYIA 3J7AR 2OTJF 1X7PA 5EYPA 2JNBA 1YGYA 2NMUA 2FC3A 2H6LA 3M4SA 2LBXA 4O4IA 3VYTC 3JAMM 5ITZB 3ZOPA 2KTUA 3CCQF 3JARB 4O2AB 4TZZA 2R751 3TD4A 5LOVA 3ELCA 2LBWA 3CYQA 4E6EA 4BT4A 5GINC 2RHLA 3IEQA 5EIBD 3KIZA 1VQ4F 3CD6F 2CW4A 2UZHA 2V9YA 3HTNA 3MQWA 3JALB 2DT4A 5JQGA 2Z1FA 1DBFA 5EZYB 2ZODA 3HAXD 4ERHA 5FLXM 1CK2A 3TD5A 5GONB 1CN7A 4I50B 1RLUA 2W8BC 4BT5A 2BTOA 4EI7A 4NWOB 2FGYA 5EO3A 1W5BA 5IJ9B 3V7QA 3P4EA 1KNKA 3WJPA 3G6EF 1KD1H 3Q8HA 2ZVYA 3K12A 4C82A 3T80A 3FFMA 3ZP4A 1VQ5F 4TV9A 1YITF 1VQ8F 3N4ZA 5LXTA 3F0DA 3OBWA 3WGMA 2R6R1 4KWEA 1SDSA 3HKBA 3IKFA 4G88A 5CB4A 2YYEA 4B46A 3VYUC 4F6RB 1KQSF 3QTYA 5LYJA 1NJIH 2N48A 1VQ6F 3JALA 3CCRF 1JFFA 2CHTA 1FSZA 4LNUB 2LBTA 3HJWC 1K73H 1YQNA 2OZBA 1JN1A 3I56F 3L7QA 3K0TA 4IHJB 2BTUA 4C8IA 3HKCB 3N2GA 2I6RA 2UYNB 4HNAB 1YJNF 5GIPC 2GLZA 2HVYD 5JVDA 3MCQA 3MCAB 3VTIC 3CXCF 3RE3A 3RYFB 4ZK7A 3E1YA 2VXYA 3VOBA 4X3LA 3FD5A 3S02A 5C8YB 3RA6A 4DRXB 3ERNA 2QEXF 4FFBA 5EYPB 2HRUA 4BT3A 1ZWZA 2KTVA 1VK3A 1XBIA 3OONA 3CCUF 1RLGA 5HY1A 3M84A 1UFYA 5EB1B 4IIJB 1X7OA 2KGWA 5LOVB 2IAFA 2AIFA 1VQ7F 3JAWA 3LWPC 5CA0B 5MN5A 3IKEA 2VGNA 1Q7YH 3G4SF 2HP3A 3VO8A 3CCLF 3G71F 2I6DA 4U3JA 4IHJA 5EIBC 3HKCA 2UYNA 1TVKA 1NMUB 4HNAA 4DXDA 2OTMA 1SZQA 5GANK 1IV3A 2HS3A 4YJ2A 2CZWA 3RYFA 3VMFB 3D01A 1QU9A 4BVTA 1Q86H 5C8YA 4DRXA 4O4JA 3WPWA 2HS0A 2OTLF 4ZI7A 2ZF8A 4M8IA 2KG4A 3ESJA 2Q1XA 4BT2A 1IV2A 4NUTA 2ZVZA 3N2KB 3J81M 4EI8A 3QUWA 3V3TA 2P6YA 1W59A 4IIJA 3C9SA 5LP6C 3WJRA 3WGLA 4ZHYB 5A2QM 3NMUC 1GO1A 1W55A 3F0FA 4TV9B 1RQ2A 1PXWA 1YIJF 3GHZA 5LXTB 5EWRA 3VI6A 3CC2F 3HKDB 5CA0A 3HKBB 1QVFF 5CB4B 1T0KB 3JASA 5BMVB 4G4YA 3D54A 3KHNA 5LYJB 1K9MH 1JJ2F 1H47A 3E20B 1H7MA 3CPWF 1JFFB 2Z1UA 5GAPK 3KE1A 3LWQC 1QAHA 1UI9A 1E7KA 3K2XA 3SIUA 1W581 2GZLA 3B6NA 2PMPA 4WBNA 2K1SA 2GVIA 2RB9A 3CYPB 3N2GB 4BVQA 5IT9M 5JVDB 3N2KA 1GX1A 3IMPA 2RHHA 4LCKA 5IYZA 3MDOA 4BW0B 4B62A 4ZOLB 5FNVB 3RYCB 4G4WA 3S0HA 3HKDA 1W5EA 4FFBB 4EB6B 4TV8B 2HQSC 3KJJA 5HWEA 4BT6A 5BMVA 5KMGA 5CA1A 4X20A 1IV4A 4O4LB 3CC7F 1W57A 5EB0A 3KJKA 4X1KA 5HY0A 3OBYA 3EORA 3JAWB 3WPXA 3NVKE 3JAKA 1M1KH 2AIZP 3V4DA 1OFUA 4U3JB 3RYHA 2UYJA 2ZOVA 3ZP7A 5IJ0A 1TVKB 2BTQB 2VAWA 5JH7A 5GIOC 4YJ2B 5HXZA 1J7HA 3CCEF 3PAFA 5LA6A 2IQQA 1T0AA 3S0WA 4ZOLA 3UT5B 5FNVA 3RYCA 2H8CA 4O4JB 4PWTA 4ZI7B 4EB6A 5HP7A 2HS4A 4TV8A 1Z5VA 1IPAA 2HRYA 2CSLA 3WGKA 1FNKA 4O2BA 3D00A 4O4LA 2MQEA 1SA0B 1VQLF 5AVMA 3CMAF 1FFXB 3HKEB 4B45A 5EAZA 3VIUA 3AGKA 3S0YA 5J2UB 2ZAUA 1DT9A 3I55F 3JASB 2QI2A 3S06A 3CMEF 3VCZA 4X1YB 1W5AA 3JATA 2CWJA 2EWCA 2UYKA 5HXUA 1VQPF 3JVHA 5HP8A 2QA4F 4YJ3A 3HWUA 3NVIB 1VH8A 2RHOA 3LWOC 1S72F 2Q1YA 3UT5A 4X1IB 1GO0A 4WBNB 1XRGA 3NK7A 2DYYA 4BT7A 3MBMA 3O85A 3CG6A 1VQMF 5MN4A 1SA0A 2G9IA 1X25A 5IYZB 5DCVA 3IEWA 1FFXA 3HKEA 1M90H 1YHQF 1U3LA 3LFOA 1X52A 1XHOA 5MN6A 5J2UA 1KNJA 4NQ3A 3LDTA 3N4YA 4G4XA 5KMGB 1VQ9F 4X1YA 5CA1B 1PF5A 4X20B 3QHDA 4R40B 3CCJF
chains in the Genus database with same CATH topology
1H47A 3P0ZA 1U3PA 3IKFA 3KE1A 3RE3A 3F6MA 3QHDA 3IKEA 1IV2A 3FBAA 3MBMA 1U40A 3K2XA 4C81A 3F0GA 5B8FA 3K14A 1H48A 1T0AA 1IV4A 1IV1A 3ELCA 1W55A 3ERNA 3F0FA 2GZLA 3B6NA 2PMPA 3FPIA 1W57A 3IEWA 4C8EA 1U3LA 3GHZA 1IV3A 1KNKA 3JVHA 1YQNA 3IEQA 3Q8HA 4C82A 3T80A 3EORA 1GX1A 4C8GA 1JY8A 1KNJA 1U43A 1JN1A 1VH8A 2AMTA 3P10A 1VHAA 2UZHA 4C8IA 3F0EA 3F0DA 3ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H47 A;  3P0Z A;  1U3P A;  3IKF A;  3KE1 A;  3RE3 A;  3F6M A;  3QHD A;  3IKE A;  1IV2 A;  3FBA A;  3MBM A;  1U40 A;  3K2X A;  4C81 A;  3F0G A;  5B8F A;  3K14 A;  1H48 A;  1T0A A;  1IV4 A;  1IV1 A;  3ELC A;  1W55 A;  3ERN A;  3F0F A;  2GZL A;  3B6N A;  2PMP A;  3FPI A;  1W57 A;  3IEW A;  4C8E A;  1U3L A;  3GHZ A;  1IV3 A;  1KNK A;  3JVH A;  1YQN A;  3IEQ A;  3Q8H A;  4C82 A;  3T80 A;  3EOR A;  1GX1 A;  4C8G A;  1JY8 A;  1KNJ A;  1U43 A;  1JN1 A;  1VH8 A;  2AMT A;  3P10 A;  1VHA A;  2UZH A;  4C8I A;  3F0E A;  3F0D A;  3ESJ A; 
#chains in the Genus database with same CATH topology
 3GYQ A;  5J2T B;  1W3E X;  1VQK F;  3SIV A;  3IR9 A;  2IG8 A;  1XV2 A;  3LYB A;  4X1K B;  3FBA A;  3LWR C;  5JCO C;  1YJW F;  5G4V C;  1TUB A;  3JAK B;  1IV1 A;  4X1I A;  1W40 A;  1Q81 H;  3RYH B;  3C9T A;  3ON1 A;  5IJ0 B;  4RQO A;  3U0O A;  3C8L A;  4BVR A;  5JH7 B;  3CCV F;  3PLA C;  5LA6 B;  4C4W C;  4I55 A;  1W42 A;  3P0Z A;  1RQ7 A;  2F9Z C;  4ZHW A;  2VAM A;  3F6M A;  5B8F A;  4O2B B;  3GTZ A;  3E22 B;  4RHA A;  1Q8R A;  5ITZ A;  5J2T A;  5HY4 A;  5LP6 B;  4TUY B;  3RA5 A;  3NK6 A;  3JAR A;  4O2A A;  2AMT A;  3OW2 F;  2OHW A;  2Z1T A;  3M1X A;  2CVL A;  4EI9 A;  3LWV C;  3VYS C;  2VGM A;  2HP0 B;  4X3M A;  3JAT B;  4ZHQ B;  2HX0 A;  3I7T A;  3CPQ A;  1JD1 A;  2QTP A;  4YJ3 B;  1R1M A;  3F0G A;  1VQO F;  3WGN A;  2L26 A;  3K14 A;  4O4H B;  1QVG F;  2H8E A;  5EZY A;  3LME A;  1OAP A;  1COM A;  2UYP A;  1N8R H;  3VOA A;  4G4Z A;  2WAL A;  5G4U C;  3J80 M;  5GON A;  4I50 A;  4BVS A;  1U43 A;  3ZO8 A;  4C8G A;  1W5F A;  1RA4 A;  2Z01 A;  1VHA A;  2YXZ A;  1YI2 F;  3V7E A;  3E22 A;  5IJ9 A;  3I3F A;  5KX5 B;  5FJ4 C;  1QD9 A;  4XCQ A;  3CCM F;  3DC2 A;  3F0E A;  2CHS A;  5LP6 A;  4TUY A;  3C9U A;  2PHN A;  2Z1E A;  4I4T B;  3CCS F;  1W2B F;  1U40 A;  1FNJ A;  3RYI B;  3WGJ A;  3FD6 A;  3CC4 F;  3FPI A;  1YJ9 F;  2HP0 A;  3JCM M;  4ZHQ A;  4O4I B;  2BO1 A;  1NQ3 A;  1CLI A;  1GZ0 A;  3R0P A;  4BY9 D;  4F6R A;  3C9R A;  1ODE A;  4ZHV A;  1Q82 H;  4B5C A;  4O4H A;  1KC8 H;  2VAP A;  5JCO A;  1TUB B;  4LNU A;  1U3P A;  2LCA A;  3S03 A;  1VQN F;  4U39 A;  3CB2 A;  4C81 A;  3WXM B;  1H48 A;  1Z5W A;  5KX5 A;  1K8A H;  1W41 A;  3BYQ A;  4C8E A;  5JQG B;  4I55 B;  2B33 A;  5HY2 A;  4I4T A;  3DDN A;  4G4V A;  1VQV A;  3WJQ A;  1JY8 A;  2RHJ A;  2ALE A;  1ONI A;  3P10 A;  3TD3 A;  3RYI A;  3J7A R;  2OTJ F;  1X7P A;  5EYP A;  2JNB A;  1YGY A;  2NMU A;  2FC3 A;  2H6L A;  3M4S A;  2LBX A;  4O4I A;  3VYT C;  3JAM M;  5ITZ B;  3ZOP A;  2KTU A;  3CCQ F;  3JAR B;  4O2A B;  4TZZ A;  2R75 1;  3TD4 A;  5LOV A;  3ELC A;  2LBW A;  3CYQ A;  4E6E A;  4BT4 A;  5GIN C;  2RHL A;  3IEQ A;  5EIB D;  3KIZ A;  1VQ4 F;  3CD6 F;  2CW4 A;  2UZH A;  2V9Y A;  3HTN A;  3MQW A;  3JAL B;  2DT4 A;  5JQG A;  2Z1F A;  1DBF A;  5EZY B;  2ZOD A;  3HAX D;  4ERH A;  5FLX M;  1CK2 A;  3TD5 A;  5GON B;  1CN7 A;  4I50 B;  1RLU A;  2W8B C;  4BT5 A;  2BTO A;  4EI7 A;  4NWO B;  2FGY A;  5EO3 A;  1W5B A;  5IJ9 B;  3V7Q A;  3P4E A;  1KNK A;  3WJP A;  3G6E F;  1KD1 H;  3Q8H A;  2ZVY A;  3K12 A;  4C82 A;  3T80 A;  3FFM A;  3ZP4 A;  1VQ5 F;  4TV9 A;  1YIT F;  1VQ8 F;  3N4Z A;  5LXT A;  3F0D A;  3OBW A;  3WGM A;  2R6R 1;  4KWE A;  1SDS A;  3HKB A;  3IKF A;  4G88 A;  5CB4 A;  2YYE A;  4B46 A;  3VYU C;  4F6R B;  1KQS F;  3QTY A;  5LYJ A;  1NJI H;  2N48 A;  1VQ6 F;  3JAL A;  3CCR F;  1JFF A;  2CHT A;  1FSZ A;  4LNU B;  2LBT A;  3HJW C;  1K73 H;  1YQN A;  2OZB A;  1JN1 A;  3I56 F;  3L7Q A;  3K0T A;  4IHJ B;  2BTU A;  4C8I A;  3HKC B;  3N2G A;  2I6R A;  2UYN B;  4HNA B;  1YJN F;  5GIP C;  2GLZ A;  2HVY D;  5JVD A;  3MCQ A;  3MCA B;  3VTI C;  3CXC F;  3RE3 A;  3RYF B;  4ZK7 A;  3E1Y A;  2VXY A;  3VOB A;  4X3L A;  3FD5 A;  3S02 A;  5C8Y B;  3RA6 A;  4DRX B;  3ERN A;  2QEX F;  4FFB A;  5EYP B;  2HRU A;  4BT3 A;  1ZWZ A;  2KTV A;  1VK3 A;  1XBI A;  3OON A;  3CCU F;  1RLG A;  5HY1 A;  3M84 A;  1UFY A;  5EB1 B;  4IIJ B;  1X7O A;  2KGW A;  5LOV B;  2IAF A;  2AIF A;  1VQ7 F;  3JAW A;  3LWP C;  5CA0 B;  5MN5 A;  3IKE A;  2VGN A;  1Q7Y H;  3G4S F;  2HP3 A;  3VO8 A;  3CCL F;  3G71 F;  2I6D A;  4U3J A;  4IHJ A;  5EIB C;  3HKC A;  2UYN A;  1TVK A;  1NMU B;  4HNA A;  4DXD A;  2OTM A;  1SZQ A;  5GAN K;  1IV3 A;  2HS3 A;  4YJ2 A;  2CZW A;  3RYF A;  3VMF B;  3D01 A;  1QU9 A;  4BVT A;  1Q86 H;  5C8Y A;  4DRX A;  4O4J A;  3WPW A;  2HS0 A;  2OTL F;  4ZI7 A;  2ZF8 A;  4M8I A;  2KG4 A;  3ESJ A;  2Q1X A;  4BT2 A;  1IV2 A;  4NUT A;  2ZVZ A;  3N2K B;  3J81 M;  4EI8 A;  3QUW A;  3V3T A;  2P6Y A;  1W59 A;  4IIJ A;  3C9S A;  5LP6 C;  3WJR A;  3WGL A;  4ZHY B;  5A2Q M;  3NMU C;  1GO1 A;  1W55 A;  3F0F A;  4TV9 B;  1RQ2 A;  1PXW A;  1YIJ F;  3GHZ A;  5LXT B;  5EWR A;  3VI6 A;  3CC2 F;  3HKD B;  5CA0 A;  3HKB B;  1QVF F;  5CB4 B;  1T0K B;  3JAS A;  5BMV B;  4G4Y A;  3D54 A;  3KHN A;  5LYJ B;  1K9M H;  1JJ2 F;  1H47 A;  3E20 B;  1H7M A;  3CPW F;  1JFF B;  2Z1U A;  5GAP K;  3KE1 A;  3LWQ C;  1QAH A;  1UI9 A;  1E7K A;  3K2X A;  3SIU A;  1W58 1;  2GZL A;  3B6N A;  2PMP A;  4WBN A;  2K1S A;  2GVI A;  2RB9 A;  3CYP B;  3N2G B;  4BVQ A;  5IT9 M;  5JVD B;  3N2K A;  1GX1 A;  3IMP A;  2RHH A;  4LCK A;  5IYZ A;  3MDO A;  4BW0 B;  4B62 A;  4ZOL B;  5FNV B;  3RYC B;  4G4W A;  3S0H A;  3HKD A;  1W5E A;  4FFB B;  4EB6 B;  4TV8 B;  2HQS C;  3KJJ A;  5HWE A;  4BT6 A;  5BMV A;  5KMG A;  5CA1 A;  4X20 A;  1IV4 A;  4O4L B;  3CC7 F;  1W57 A;  5EB0 A;  3KJK A;  4X1K A;  5HY0 A;  3OBY A;  3EOR A;  3JAW B;  3WPX A;  3NVK E;  3JAK A;  1M1K H;  2AIZ P;  3V4D A;  1OFU A;  4U3J B;  3RYH A;  2UYJ A;  2ZOV A;  3ZP7 A;  5IJ0 A;  1TVK B;  2BTQ B;  2VAW A;  5JH7 A;  5GIO C;  4YJ2 B;  5HXZ A;  1J7H A;  3CCE F;  3PAF A;  5LA6 A;  2IQQ A;  1T0A A;  3S0W A;  4ZOL A;  3UT5 B;  5FNV A;  3RYC A;  2H8C A;  4O4J B;  4PWT A;  4ZI7 B;  4EB6 A;  5HP7 A;  2HS4 A;  4TV8 A;  1Z5V A;  1IPA A;  2HRY A;  2CSL A;  3WGK A;  1FNK A;  4O2B A;  3D00 A;  4O4L A;  2MQE A;  1SA0 B;  1VQL F;  5AVM A;  3CMA F;  1FFX B;  3HKE B;  4B45 A;  5EAZ A;  3VIU A;  3AGK A;  3S0Y A;  5J2U B;  2ZAU A;  1DT9 A;  3I55 F;  3JAS B;  2QI2 A;  3S06 A;  3CME F;  3VCZ A;  4X1Y B;  1W5A A;  3JAT A;  2CWJ A;  2EWC A;  2UYK A;  5HXU A;  1VQP F;  3JVH A;  5HP8 A;  2QA4 F;  4YJ3 A;  3HWU A;  3NVI B;  1VH8 A;  2RHO A;  3LWO C;  1S72 F;  2Q1Y A;  3UT5 A;  4X1I B;  1GO0 A;  4WBN B;  1XRG A;  3NK7 A;  2DYY A;  4BT7 A;  3MBM A;  3O85 A;  3CG6 A;  1VQM F;  5MN4 A;  1SA0 A;  2G9I A;  1X25 A;  5IYZ B;  5DCV A;  3IEW A;  1FFX A;  3HKE A;  1M90 H;  1YHQ F;  1U3L A;  3LFO A;  1X52 A;  1XHO A;  5MN6 A;  5J2U A;  1KNJ A;  4NQ3 A;  3LDT A;  3N4Y A;  4G4X A;  5KMG B;  1VQ9 F;  4X1Y A;  5CA1 B;  1PF5 A;  4X20 B;  3QHD A;  4R40 B;  3CCJ F; 
#chains in the Genus database with same CATH homology
 1H47 A;  3P0Z A;  1U3P A;  3IKF A;  3KE1 A;  3RE3 A;  3F6M A;  3QHD A;  3IKE A;  1IV2 A;  3FBA A;  3MBM A;  1U40 A;  3K2X A;  4C81 A;  3F0G A;  5B8F A;  3K14 A;  1H48 A;  1T0A A;  1IV4 A;  1IV1 A;  3ELC A;  1W55 A;  3ERN A;  3F0F A;  2GZL A;  3B6N A;  2PMP A;  3FPI A;  1W57 A;  3IEW A;  4C8E A;  1U3L A;  3GHZ A;  1IV3 A;  1KNK A;  3JVH A;  1YQN A;  3IEQ A;  3Q8H A;  4C82 A;  3T80 A;  3EOR A;  1GX1 A;  4C8G A;  1JY8 A;  1KNJ A;  1U43 A;  1JN1 A;  1VH8 A;  2AMT A;  3P10 A;  1VHA A;  2UZH A;  4C8I A;  3F0E A;  3F0D A;  3ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...