1GXAA

Bovine beta-lactoglobulin complexed with retinol and palmitic acid, trigonal lattice z
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
161
structure length
161
Chain Sequence
b'IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTOGLOBULIN
publication title The Ligand-Binding Site of Bovine Beta-Lactoglobulin: Evidence for a Function?
pubmed doi rcsb
molecule tags Lipocalin
total genus 42
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1gxaA00
3MVFA 1IFBA 1ZNLA 1IW2A 5LJHA 1O8VA 4ORSA 3ZUIA 1ZNDA 1E00A 3FELA 4YKMA 5H9NA 4QGXA 1CBRA 4QZUA 3STNA 5HA1A 4BQUA 2HZRA 4ORXA 3TGAA 2R56A 5HWZA 3FA6A 1I06A 2W2BA 3D96A 1G85A 1LIEA 2WEWA 1KT5A 4IBAA 1JJXA 3WJDA 2GJ5A 3FA8A 5LJCA 5HZ6A 1KZXA 1ML7A 5IO7A 4ALOA 3BY0A 5LJBA 2NNEA 2A13A 1KT3A 2WR6A 1JBHA 3UEWA 2FTBA 3JS1A 3VG4A 5IO6A 1GKAA 3KFGA 1O1UA 4I3CA 1TOUA 2Q39A 3WJFA 1Z24A 3DTQA 2AH7X 2R74A 3CWKA 4BOEA 5HTEA 2O62A 1RLBE 5KIDA 1ICMA 4RUUA 2L67A 5JR8A 1MX7A 2AT0X 3FW4A 4YDBA 1SY2A 3FR4A 1D2UA 4M6SA 1ALBA 1RBPA 1T68X 2K62A 1U18A 3FEPA 5D47A 4A8ZA 1EW3A 1KZWA 4IB8A 5L8NA 1U17A 4ES7A 3B2IA 1FEMA 1DZMA 1FTPA 2X45A 4IB6A 3U9PC 1A57A 3ZQ3A 1QG5A 2N93A 1X8OA 5LKFA 1X8NA 4GH7A 3WXQA 3VG2A 3VG7A 1EIOA 1JZUA 5LJEA 4NYQA 1E06A 1HBQA 1U0XA 3B2JA 4YFQA 5F6ZA 2RCQA 3EBWA 2LB6A 3KZAA 1YWBA 5K06A 5LKEA 3PP6A 4R0BA 1OBPA 1SY1A 1IFCA 4XMCA 2QM9A 3ELZA 3P6DA 3APXA 2WEXA 4MVKA 2ACPX 3CBCA 3FLLA 2CM9A 4WBKA 2WQ9A 5FENA 4RUNA 4EFGA 1OEKA 2A2GA 2KTDA 3EBKA 3ELXA 2GTFX 4KIIA 1MUPA 2AT3X 4IMNA 1HMTA 2IFBA 1ZNHA 4HPAA 1IIUA 1GGLA 3KQ0A 3SAOA 1YP6A 2A2UA 1VPRA 1LIBA 3O2YA 5L8OA 3O22A 1BJ7A 3FA7A 2G7BA 4ZH6A 4WFUA 1B0OA 2Q4NA 5D4AA 1SXUA 2LFOA 5B27A 5KHPA 3KFIA 3NX1A 3ZUOA 4AYHA 1AVGI 2AT8X 4XMDA 4NNTA 2FR3A 1TW4A 1DV9A 4ZHHA 5DPQA 1PM1X 2AKQA 2HZQA 2AMMX 4ALBA 4YMYA 1ZRYA 5C0NA 2KT4B 2QO6A 2QOSC 3WVMA 2FLJA 1YWDA 2NP1A 3CMPA 5D8JA 2NNQA 5H9KA 4DQ4A 1R0UA 1DZJA 2L5PA 1SA8A 4IB7A 2AT5X 3BDRA 3NADA 1MX8A 2OFMX 1AQBA 3APWA 3FMZA 4NLIA 2ANSA 3NR3A 4WFVA 1GX9A 3O19A 3CR6A 1OPBA 2W2FA 3P6FA 4GNYA 1JJJA 4XMFA 2AT6X 4ORUA 1QY1A 2L9CA 3BX7A 3P6EA 4NP1A 2JU3A 4YKOA 2CBSA 2LBAA 1XCAA 1ZNKA 1SXWA 2CM4A 3B2HA 2EU7X 2WUTA 4ZFXA 4IAXA 1FE3A 1CBIA 4YGZA 1BRPA 1TVQA 1A2DA 2HYSA 3BLGA 4BVMA 1LIDA 2OFRX 2Q2MA 4O9SA 2R73A 3CQRA 4YFRA 3K3LA 5HZ9A 1QFTA 3OJYC 3PPTA 4IB9A 1AB0A 5AQ6A 3U03A 3DSZA 4GE1A 2NNDA 5BVTA 1N0SA 3HWDA 1ZNEA 1GM6A 4Y0QA 3C77X 3PH5A 4ZCBA 2E4JA 5DG4A 5BVQA 2JN3A 3FIQA 3VG5A 1UREA 3WJBA 3VG6A 1DF3A 2P8GA 4GRJA 4ODDA 4DQ3A 4QAEA 3G7XA 1YWAA 1HN2A 4QGWA 5EEDA 1JYDA 5FFHA 1GKAB 2K23A 4YGHA 1KGLA 2FS6A 3FA9A 2LBVA 1LICA 2XSTA 3WBGA 1OBUA 1B8EA 1BRQA 3APVA 3UEXA 1OPAA 1H91A 4M7MA 2DM5A 1LF7A 1X8QA 3NX2A 4NLJA 4AZQA 4I9SA 1EUOA 5EPQA 1G74A 2MO5A 4QYNA 1KT4A 3FR2A 1GX8A 1TXLA 2OVEA 2CZUA 1KOIA 2AL0X 4YBPA 5IO5A 3APUA 1ERXA 1FENA 4IAWA 4XMEA 4GETA 3PECA 1DFVA 2JU8A 1ERBA 3P6HA 3P6CA 1VYFA 2FT9A 1KT7A 1YIVA 4Y0RA 4EEJA 1S7DA 1MVGA 2FR2A 3JSQA 4ZR2A 3CQNA 1JV4A 5H9AA 1PBOA 1PMPA 1UZ2X 4AZOA 5H8TA 3I0AA 4A1HA 3BRNA 4K19A 4ORWA 1I05A 3FEKA 3HWEA 1I4UA 1X8PA 1BWYA 1KT6A 1KXOA 1DZPA 3TF6A 1YUPA 1TOWA 4LKTA 1ACDA 3WJEA 3WJGA 1GT3A 4QYPA 5HTDA 3FENA 3D95A 3VG3A 1QY0A 4YBUA 3IFBA 1I04A 1DC9A 1AELA 4I3BA 4XMGA 4ORRA 2Q2PA 2WWPA 1JYJA 4ZHCA 1A18A 2JOZA 3U0DA 3KFFA 4YGGA 1SXXA 4ZGUA 2CZTA 2Q9SA 2RD7C 1G5WA 4D6AA 4ZHFA 3L4RA 1NP4A 4UU2A 1BSOA 2HLVA 1GT5A 2XKLA 5B29A 1HQPA 2HNXA 4HPDA 1GXAA 3BS2A 3C78X 1S2PA 1GT1A 3NPOA 3GAQA 4PSQA 4GKCA 3PEDA 2RQ0A 5F58A 4A1YA 2A3FX 3FW5A 1B56A 2MM3A 4AZRA 1KQXA 4N7DA 2OVDA 2MJIA 5HBSA 1SXYA 2CBRA 3B2KA 3FR5A 4ZJ0A 1QQSA 5EEEA 5HCDC 1KQWA 3AKNA 4Y0PA 4YCEA 1CBQA 5H9LA 5EDCA 3CBSA 4AW8A 4TNNA 1XKIA 3MBTA 4TKHA 1BM5A 4HPCA 4CK4A 5F7GA 3NQ9A 2X46A 3NP1A 3B2LA 3EYCA 4N7CA 1LNMA 3T1DA 3TZSA 1MDCA 4OMWA 4MVLA 3STKA 1GT4A 4D6BA 3RZYA 4LZUA 1IKJA 2OZQA 2ACOA 1E5PA 2GC9A 2QO4A 1P6PA 1SY0A 3BU9A 5HZ8A 1QABE 1BSQA 1T0VA 4A60A 3F8AA 2OVAA 5EZ2A 1HBPA 4TKJA 4UU3A 2G79A 1EXSA 1QFVA 3PH6A 4NYRA 4EDEA 1EIIA 4LKPA 1EALA 3D97A 5HA0A 4AZNA 4TLJA 1QY2A 2RCTA 3S26A 1YP7A 4EXZA 5HZ5A 2PY1A 2HMBA 4YDAA 5LJGA 1X8UA 2POAA 4GNWA 5CE4A 2BLGA 2YG2A 4ZHDA 3HWGA 4I9RA 1E02A 4OMXA 1X71A 1LPJA 1QWDA 3RSWA 4MVIA 2ASNX 3KFHA 4ORYA 5F1EA 3STMX 1EQDA 3IA8A 2L68A 4YFPA 2WSJA 3F9DA 4XMHA 4YH0A 2LKKA 1CJ5A 1DZKA 5F6BA 2F73A 1BLRA 1L6MA 3QKGA 2RA6A 4TJZA 4YCHA 3HWFA 5HAEA 4IMOA 1G7NA 5D48A 1O1VA 2FRSA 1FDQA 1T8VA 5LJDA 3EMMA 3TGCA 1FELA 1IKEA 3BSZE 1NGLA 3AKMA 1S44A 4TKBA 3BU1A 2A0AA 4AZPA 4OS0A 3UEUA 1SY3A 4Y0SA 1VYGA 3Q6LA 1NP1A 3TGBA 3HK1A 2W2AA 1BSYA 1CBSA 1X89A 5FAZA 3P6GA 5HCEC 1BBPA 2FS7A 2QO5A 4TQ2A 5D45A 4QGVA 1D3SA 2ALLX 2G78A 1PEEA 3BX8A 3EM0A 4OS8A 1LIFA 1ZNGA 2FWVA 3C76X 4LZVA 4HFOA 5L8IA 1YWCA 1B4MA 3WJCA 1ADLA 3UEVA 1EPBA 2JU7A 5HCCC 1LKEA 5EDBA 5BVSA 3NQ3A 4AZMA 4QZTA 5HZQA 4NNSA 1ICNA 4OS3A 1OBQA 1HMRA 2WQAE 4ZHGA 1OEJA 5KICA 1A3YA 4ZH9A 1EPAA 1LFOA 1HMSA 4HPBA 4I3DA 1OEEA 4ARHA 1CRBA 5LJKA 3I17A 1BEBA
chains in the Genus database with same CATH superfamily
3MVFA 1IFBA 1ZNLA 1IW2A 1RSTB 4ML7B 5LJHA 1O8VA 4ORSA 3ZUIA 1ZNDA 1E00A 3FELA 4GJSA 4YKMA 5H9NA 4QGXA 3WYPA 1CBRA 4QZUA 1NBXA 3STNA 4I95A 5HA1A 1SWUA 4BQUA 2HZRA 2BT9A 4ORXA 3RKGA 2M4LA 4Y59A 2GH7A 2OL7A 3TGAA 4GU8A 2R56A 5HWZA 3FA6A 1I06A 2W2BA 4GUZA 4O4OA 4BJ8A 3D96A 1N7YA 3HTYA 3OBLA 2A5BA 1G85A 4CPFA 1LIEA 2WEWA 1KT5A 4IBAA 1JJXA 3WJDA 2GJ5A 3FA8A 5LJCA 5HZ6A 1KZXA 5IXGA 1ML7A 3Q34A 5IO7A 4ALOA 3BY0A 1MK5A 5LJBA 2IZLB 2NNEA 1N4JA 2A13A 1KT3A 2RN4A 2WR6A 4Z2OA 3T2WA 2FHNX 1JBHA 4Z2PA 4BX5A 2JMBA 2FTBA 3JS1A 4MVEA 2OY7A 3UEWA 3VG4A 5IO6A 1GKAA 1SLGB 1O1UA 2RTQB 1TOUA 2Q39A 3KFGA 3EW2A 1Z24A 2DJFA 2UYWA 1LUQA 3DTQA 2AH7X 5BYPA 2R74A 3CWKA 4BOEA 3P24A 4L3RA 1SLEB 4U8UO 2O62A 1RLBE 5HTEA 5KIDA 1Y9LA 1ICMA 4RUUA 2L67A 5JR8A 4DNEA 1MX7A 2AT0X 3HOEA 3FW4A 4YDBA 1VWNB 1SY2A 2RTMA 3FR4A 3WYQA 1D2UA 4M6SA 3S5XA 1ALBA 1AVDA 1RBPA 1T68X 2GTLN 2RTKA 2K62A 4U3QA 3ZW2A 1U18A 3FEPA 4PJ2A 5D47A 1EW3A 4A8ZA 1STRB 1KZWA 2RTFB 2X8TA 4IB8A 5L8NA 1U17A 2BHVA 4ES7A 3B2IA 1FEMA 1DZMA 1FTPA 2X45A 4IB6A 3U9PC 3D9WA 2IZCB 3WZNA 3ZW1A 1A57A 2RTBB 2RTPB 3ZQ3A 4CSBA 1QG5A 2N93A 3PK2A 4O4XA 1X8OA 5LKFA 1WUBA 1X8NA 2ZAGA 4GH7A 3WXQA 3VG2A 3VG7A 1EIOA 1JZUA 5LJEA 3T2XA 2BC3A 3CKFA 1E06A 4NYQA 1HBQA 1HY2A 1U0XA 2F01A 3B2JA 4YFQA 5F6ZA 2G5LA 2RCQA 3EBWA 3GE2A 2LB6A 3KZAA 1YWBA 5IRWA 5B10O 5K06A 4EKVA 4GGZA 5LKEA 1SWPA 3PP6A 5IRAA 4KT5A 1GX3A 4KCAA 4FBOA 4R0BA 2OY5O 1NQMA 1OBPA 4CDFA 2JGSA 1SY1A 1IFCA 4XMCA 3KVNA 3VU1A 2QM9A 3ELZA 3P6DA 3APXA 1STSB 2WEXA 1SWAA 4MVKA 1SWSA 2ACPX 3CBCA 4L1NA 3FLLA 5AJCA 2CM9A 4WBKA 3ZW1B 3VHHA 2WQ9A 5FENA 4RUNA 4EFGA 1OEKA 2A2GA 2KTDA 3EBKA 3ELXA 3X00A 2KD2A 5B5FA 2GTFX 4KIIA 1MUPA 2RTGB 2AT3X 4IMNA 1VWAB 2MWHA 2LA7A 4BX6A 1HMTA 2IFBA 1ZNHA 4HPAA 1IIUA 4Z6JA 1GGLA 1W5RA 2I5ZO 3KQ0A 1YP6A 2RTEB 3SAOA 2A2UA 1VPRA 5K68A 1LIBA 3O2YA 5L8OA 1LCWA 3O22A 1BJ7A 1SLDB 3FA7A 4O3ZA 2G7BA 4ZH6A 4WFUA 1LELA 3RY2A 1B0OA 4NW4A 2Q4NA 4ZGFA 3D4RA 5D4AA 1SXUA 2LFOA 5B27A 5KHPA 3KFIA 2IZJA 3NX1A 3PQUA 3ZUOA 4AYHA 1AVGI 2AT8X 4XMDA 2OFBA 4NNTA 4CPIA 2FR3A 1TW4A 1DV9A 3SLJA 2IZFB 4QNIA 4ZHHA 5DPQA 1PM1X 2AKQA 2HZQA 2RTLA 1BEBA 2AMMX 3LTWA 4ALBA 4YMYA 1ZRYA 2OFAA 5C0NA 1HQQA 1RSUB 5FQ7E 2KT4B 2QO6A 1KL4A 4I3CA 3VGWA 2QOSC 3WVMA 5FQ8E 2FLJA 4BX6B 1YWDA 2NP1A 3CMPA 5D8JA 2C1SA 3RDQA 2NNQA 5H9KA 2RTCB 4DQ4A 1R0UA 1VYOA 1DZJA 2X32A 2X56A 2L5PA 1SA8A 1SRFA 4IB7A 2IZIA 2AT5X 3T6FA 3BDRA 3NADA 4KH8A 3HPEA 4O3XB 1MX8A 1LDQA 2OFMX 1AQBA 2YMSA 3APWA 3FMZA 2ANSA 3NR3A 4NLIA 4WFVA 1GX9A 3O19A 3CR6A 1OPBA 2W2FA 3WZQA 2I5VO 3P6FA 4U46A 3MG5A 4GNYA 1VWCB 1UYNX 1JJJA 4XMFA 2AT6X 4ORUA 1QY1A 2L9CA 3BX7A 3P6EA 2DJGA 4NP1A 2JU3A 3FDCA 2KTSA 4YKOA 2CBSA 2RTAA 1VWMB 1VWHB 2LBAA 4OEMA 1XCAA 1ZNKA 1SXWA 1HXZA 2CM4A 3B2HA 3OE3A 2EU7X 2WUTA 3P02A 4ZFXA 4IAXA 1FE3A 2ZSCA 2RTOB 1CBIA 3JQOA 4YGZA 3RDOA 4MIRA 4CPHA 1BRPA 1NQNA 3LHNA 4GJVA 2A5CA 1TVQA 1A2DA 3RE5A 1W6FA 2FHLA 1N9YA 2HYSA 3BLGA 4BVMA 1LIDA 2OFRX 2Q2MA 4O9SA 2R73A 3CQRA 3SZHA 3K3LA 4YFRA 5HZ9A 3SLOA 1QFTA 3OJYC 3PPTA 4IB9A 3OD9A 4FBVA 4Z28A 1AB0A 5CSEA 3SLTA 5AQ6A 2RTIB 3U03A 2C1QA 3DSZA 4CDCA 4GE1A 3SZJA 2NNDA 5BVTA 1N0SA 3HWDA 1ZNEA 1GM6A 3PDFA 4Y0QA 3C77X 3PH5A 2Z4HA 3VE2A 4ZCBA 2E4JA 5DG4A 1Y52X 2OVSA 2G8CO 1E2TA 2JN3A 5BVQA 3FIQA 3VG5A 1UREA 1JIWI 3VG6A 2UZ2A 2P8GA 1KL3A 4GRJA 4ODDA 3WJBA 1SWKA 4GDAA 4QAEA 4BX5B 3G7XA 1YWAA 2AF5A 3VHIA 4CDEA 4JGLA 4DQ3A 1HN2A 4QGWA 4QQ1A 1JYDA 5EEDA 1GKAB 2K23A 5FFHA 4C5PA 4CPHB 4COTA 4YGHA 1KGLA 4EQAC 2FS6A 3FA9A 2LBVA 1LICA 2XSTA 3WBGA 1OBUA 1B8EA 1BRQA 3APVA 2OF9A 3UEXA 1OPAA 1H91A 1SWBA 4M7MA 1RXJA 1VWPB 1VWOB 1LF7A 1X8QA 2DM5A 1LCZA 1EI5A 3NX2A 4IABA 4NLJA 4AZQA 4I9SA 3RDXA 1EUOA 4BBOA 5EPQA 1G74A 2MO5A 4QYNA 5JD2A 1KT4A 3FR2A 1Y53X 1GX8A 1TXLA 4QRLA 4FQBB 2OVEA 2CZUA 2FGSA 1KOIA 2AL0X 2QOMA 4YBPA 5IO5A 3QQ2A 1STPA 3APUA 1ERXA 4O3YA 2FKGA 4CDDA 1FENA 4IAWA 4XMEA 4GETA 3PECA 4GGTA 1DFVA 2JU8A 1ERBA 3P6HA 3RE6A 3P6CA 1SWJA 1KFFA 1VYFA 2FT9A 5B11O 1KT7A 1N9MA 1YIVA 4U8UN 4Y0RA 5F2BA 1MM9A 4EEJA 1S7DA 1MVGA 2FR2A 2ZAIA 3JSQA 2VFCA 4ZR2A 3CQNA 1DF3A 1JV4A 5H9AA 1PBOA 1PMPA 1UZ2X 4AZOA 5H8TA 3I0AA 4A1HA 3BRNA 4K19A 4ORWA 1I05A 1Y55X 2OL6O 3FEKA 3HWEA 4YVBA 1I4UA 1X8PA 2OF8A 3RY1A 1BWYA 3HOLA 1KT6A 1KXOA 1JQPA 1DZPA 2MF6A 3TF6A 2VFBA 1SWHA 1TOWA 1YUPA 4GDZA 2OY8A 4LKTA 1ACDA 4GD9A 4O4UA 1JJUA 3WJEA 2C4IA 4HWMA 3WJGA 1VWGB 3LV4A 1GT3A 4QYPA 5IRUA 5HTDA 2F09A 3FENA 2IZGB 1SWEA 3D95A 1SWDA 4CPEA 1SMPI 3MX7A 3VG3A 1SREA 1QY0A 4YBUA 3IFBA 1IJ8A 1I04A 1DC9A 1AELA 4I3BA 2IZDB 5CYBA 4XMGA 4ORRA 2Q2PA 1DF8A 2WWPA 1JYJA 1K3BA 1LDOA 1A18A 3H3IA 2A8GA 2JOZA 2KW1A 4ZHCA 3U0DA 3KFFA 1SWNA 1Y0GA 3VHMA 4MEEA 4I60A 3RBYA 2X34A 1SLFB 4GGRA 4YGGA 3SOTA 1SXXA 1SRHA 4ZGUA 2CZTA 2Q9SA 2RD7C 1G5WA 1SRIA 4D6AA 1VWEB 3L4RA 4ZHFA 1NP4A 4UU2A 1BSOA 2HLVA 1GT5A 2XKLA 4NV7A 4I6SA 5B29A 2BS6A 4CV7A 4MISA 4U9CA 4Y5DA 1W4TA 3WZOA 1HQPA 2HNXA 4HPDA 1GXAA 2VDFA 2IZEB 3BS2A 3C78X 4KC7A 4BGFA 1S2PA 1Y9TA 2Y3FA 1GT1A 3NPOA 2BS5A 2WPUA 3GAQA 4PSQA 4GKCA 3PEDA 2RQ0A 5F58A 4A1YA 2A3FX 3FW5A 1SWCA 1B56A 2MM3A 4AZRA 1KQXA 3EW1A 4N7DA 2OVDA 2MJIA 4JNJA 5HBSA 1SXYA 2MHDA 2IZHB 2CBRA 3B2KA 3FR5A 4ZJ0A 1QQSA 5EEEA 2OYBO 1KL5A 4OELA 1KQWA 2OY1O 3AKNA 3VE1A 4Y0PA 5HCDC 3NBXX 4YCEA 1CBQA 5H9LA 4WHIA 3ZWEA 5EDCA 4ID2A 3CBSA 4AW8A 4TNNA 1XKIA 3MBTA 4LQZA 2Y3EA 4TKHA 1BM5A 4HPCA 1JMZA 1VWIB 4CK4A 3CKGA 5F7GA 3NQ9A 4FBRA 2X46A 3AEHA 1SWTA 3RDUA 5B5GA 3NP1A 1NDJA 3B2LA 3EYCA 3FYFA 4N7CA 1LNMA 3T1DA 3SZIA 3TZSA 1MDCA 4OMWA 4MVLA 3ZI8A 3STKA 1RAVA 1VWBB 1GT4A 4DCBA 4D6BA 1VWDB 3RZYA 4LZUA 1IKJA 1SWGA 2ACOA 1E5PA 2GC9A 2OZQA 2QO4A 1P6PA 2RTHB 3N91A 1SY0A 3BU9A 5HZ8A 1LCVA 1QABE 1BSQA 1T0VA 1UYOX 5CHKA 4A60A 3F8AA 1HXLA 2OVAA 5B2AO 5EZ2A 1HBPA 4TKJA 3EC5A 3MM0A 4UU3A 2G79A 1EXSA 1QFVA 3PH6A 4KC8A 4NYRA 4EDEA 1EIIA 4LKPA 4B55A 1EALA 3D97A 5HA0A 2Z4IA 4AZNA 4TLJA 1QY2A 2RCTA 5AJBA 3S26A 1YP7A 2GTLM 1VWLB 4EXZA 2PY1A 5HZ5A 2RTRB 2HMBA 4YDAA 5LJGA 1X8UA 3AUMO 2POAA 4GNWA 3T6LA 5CE4A 1K24A 2BLGA 2YG2A 2IZAA 1PBYA 3VPJE 3HWGA 4ZHDA 4I9RA 1E02A 4OMXA 1X71A 1LPJA 1QWDA 3RSWA 4MVIA 2ASNX 3E3CA 1SWRA 3KFHA 4OKAA 4ORYA 1SRJA 1EQDA 3IA8A 1RXHA 5F1EA 5K67A 2L68A 3ZW0A 4BX7A 3S60A 4YFPA 3FIDA 1SWQA 2WSJA 1N43A 3WOVA 3F9DA 1WBIA 2RTJA 2OL8O 4XMHA 2QMIA 4O3WA 4YH0A 1FJ1E 2LKKA 1CJ5A 1PTSA 1DZKA 5F6BA 2QCBA 3STMX 2F73A 4BCSA 1BLRA 1L6MA 3QKGA 2RA6A 4TJZA 4YCHA 3HWFA 5HAEA 3S5VA 4IMOA 1G7NA 4INNA 4IRWA 2FKJA 5D48A 1O1VA 2FRSA 1FDQA 1T8VA 5LJDA 3EMMA 3TGCA 1FELA 1IKEA 2IZKA 3BSZE 2X55A 1NGLA 3V8UA 1VWKB 3AKMA 1S44A 1AVEA 4TKBA 2X8SA 1VWRB 2BSZA 3BU1A 2IZBA 4JO6A 1OSPO 2A0AA 3PQSA 4AZPA 4OS0A 5B3MO 3UEUA 1SY3A 4Y0SA 1RXKA 1VYGA 4ON1A 3Q6LA 1NC9A 1NP1A 4Z2VA 3TGBA 3HK1A 2W2AA 1BSYA 1CBSA 1X89A 5FAZA 3P6GA 5HCEC 1BBPA 3ZW0B 3ZZVA 4BX7B 2FS7A 2QO5A 1I78A 4TQ2A 5L3YA 5D45A 4O4SA 4QGVA 4U8UM 1D3SA 2ALLX 2G78A 1PEEA 3BX8A 3EM0A 4OS8A 1LIFA 1ZNGA 2FWVA 3C76X 4LZVA 5AEOA 4GK9A 4HFOA 2RTDB 5L8IA 1YWCA 3WJFA 1SRGA 1B4MA 2HKDA 3WZPA 2JW1A 3WJCA 1ADLA 3UEVA 2PI3O 1SWOA 1EPBA 1VWJB 2JU7A 2X4MA 2RTNB 5HCCC 2Y32A 3RWXA 4NV8A 1LKEA 1SWFA 3NQKA 5EDBA 5BVSA 3RDSA 3NQ3A 4AZMA 4QZTA 5HZQA 1SWLA 1ICNA 4NNSA 4OS3A 1OBQA 1HMRA 2WQAE 4JHQA 4ZHGA 1OEJA 1VWQB 2AVIA 4GZVA 2CAMA 5FQ6E 5KICA 1A3YA 4Z27A 1JMXA 1EPAA 1LFOA 4ZH9A 3RDMA 1I9HA 1HMSA 4FGIB 1VWFB 2X8FA 4HPBA 4O49A 2GTLO 3UAQA 1MOYA 3F6ZB 4I3DA 1OEEA 4ARHA 1CRBA 5LJKA 3I17A 1MEPA
chains in the Genus database with same CATH topology
3MVFA 1IFBA 1ZNLA 1IW2A 4ML7B 5LJHA 1O8VA 4ORSA 3ZUIA 1ZNDA 1E00A 3FELA 4YKMA 5H9NA 4QGXA 1CBRA 4QZUA 3STNA 4I95A 5HA1A 4BQUA 2HZRA 2BT9A 4ORXA 3RKGA 2M4LA 3TGAA 4GU8A 2R56A 5HWZA 3FA6A 1I06A 2W2BA 4O4OA 3D96A 3HTYA 3OBLA 1G85A 1LIEA 2WEWA 1KT5A 4IBAA 1JJXA 3WJDA 2GJ5A 3FA8A 5LJCA 5HZ6A 1KZXA 1ML7A 5IO7A 4ALOA 3BY0A 5LJBA 2NNEA 2A13A 1KT3A 2RN4A 2WR6A 1JBHA 2JMBA 2FTBA 3JS1A 4MVEA 3UEWA 3VG4A 5IO6A 1GKAA 3KFGA 1O1UA 4I3CA 1TOUA 2Q39A 3WJFA 5BYPA 1Z24A 3DTQA 2AH7X 2R74A 3CWKA 4BOEA 3P24A 4L3RA 4U8UO 5HTEA 2O62A 1RLBE 5KIDA 1Y9LA 1ICMA 4RUUA 2L67A 5JR8A 1MX7A 2AT0X 3HOEA 3FW4A 4YDBA 1SY2A 3FR4A 1D2UA 4M6SA 3S5XA 1ALBA 1RBPA 1T68X 2GTLN 2K62A 4U3QA 3ZW2A 1U18A 3FEPA 4PJ2A 5D47A 1EW3A 4A8ZA 1KZWA 2X8TA 4IB8A 5L8NA 1U17A 2BHVA 4ES7A 3B2IA 1FEMA 1DZMA 1FTPA 2X45A 4IB6A 3U9PC 1A57A 3ZW1A 3ZQ3A 4CSBA 1QG5A 2N93A 4O4XA 1X8OA 5LKFA 1X8NA 2ZAGA 4GH7A 3WXQA 3VG2A 3VG7A 1EIOA 1JZUA 5LJEA 4NYQA 1E06A 1HBQA 1U0XA 3B2JA 4YFQA 5F6ZA 2RCQA 3EBWA 3GE2A 2LB6A 3KZAA 1YWBA 5K06A 5LKEA 3PP6A 4KT5A 4KCAA 4FBOA 4R0BA 1OBPA 1SY1A 1IFCA 4XMCA 3VU1A 2QM9A 3ELZA 3P6DA 3APXA 2WEXA 4MVKA 2ACPX 3CBCA 4L1NA 3FLLA 5AJCA 2CM9A 4WBKA 3ZW1B 2WQ9A 5FENA 4RUNA 4EFGA 1OEKA 2A2GA 2KTDA 3EBKA 3ELXA 2KD2A 2GTFX 4KIIA 1MUPA 2AT3X 4IMNA 2MWHA 2LA7A 1HMTA 2IFBA 1ZNHA 4HPAA 1IIUA 1GGLA 3KQ0A 3SAOA 1YP6A 2A2UA 1VPRA 1LIBA 3O2YA 5L8OA 3O22A 1BJ7A 3FA7A 4O3ZA 2G7BA 4ZH6A 4WFUA 4ZGFA 1B0OA 4NW4A 2Q4NA 3D4RA 5D4AA 1SXUA 2LFOA 5B27A 5KHPA 3KFIA 3NX1A 3PQUA 3ZUOA 4AYHA 1AVGI 2AT8X 4XMDA 4NNTA 2FR3A 1TW4A 1DV9A 4QNIA 4ZHHA 5DPQA 1PM1X 2AKQA 2HZQA 2AMMX 4ALBA 4YMYA 1ZRYA 5C0NA 5FQ7E 2KT4B 2QO6A 2QOSC 3WVMA 5FQ8E 2FLJA 1YWDA 2NP1A 3CMPA 5D8JA 2NNQA 5H9KA 4DQ4A 1R0UA 1DZJA 2L5PA 1SA8A 4IB7A 2AT5X 3BDRA 3NADA 4KH8A 4O3XB 1MX8A 2OFMX 1AQBA 2YMSA 3APWA 3FMZA 2ANSA 3NR3A 4NLIA 4WFVA 1GX9A 3O19A 3CR6A 1OPBA 2W2FA 3P6FA 4GNYA 1JJJA 4XMFA 2AT6X 4ORUA 1QY1A 2L9CA 3BX7A 3P6EA 4NP1A 2JU3A 4YKOA 2KTSA 2CBSA 2LBAA 1XCAA 1ZNKA 1SXWA 3P02A 2CM4A 3B2HA 3OE3A 2EU7X 2WUTA 4ZFXA 4IAXA 1FE3A 1CBIA 3JQOA 4YGZA 4MIRA 1BRPA 3LHNA 1TVQA 1A2DA 2HYSA 3BLGA 4BVMA 1LIDA 2OFRX 2Q2MA 4O9SA 2R73A 3CQRA 4YFRA 3K3LA 5HZ9A 1QFTA 3OJYC 3PPTA 4IB9A 3OD9A 4FBVA 1AB0A 5AQ6A 3U03A 3DSZA 4GE1A 2NNDA 5BVTA 1N0SA 3HWDA 1ZNEA 1GM6A 4Y0QA 3C77X 3PH5A 2Z4HA 3VE2A 4ZCBA 2E4JA 5DG4A 2OVSA 5BVQA 2JN3A 3FIQA 3VG5A 1UREA 1JIWI 3VG6A 3WJBA 2P8GA 1DF3A 4GRJA 4ODDA 4DQ3A 4QAEA 3G7XA 1YWAA 4JGLA 1HN2A 4QGWA 4QQ1A 1JYDA 5EEDA 1GKAB 2K23A 5FFHA 4COTA 4YGHA 1KGLA 4EQAC 2FS6A 3FA9A 2LBVA 1LICA 2XSTA 3WBGA 1OBUA 1B8EA 1BRQA 3APVA 3UEXA 1OPAA 1H91A 4M7MA 2DM5A 1LF7A 1X8QA 1EI5A 3NX2A 4IABA 4NLJA 4AZQA 4I9SA 1EUOA 5EPQA 1G74A 2MO5A 4QYNA 1KT4A 3FR2A 1GX8A 1TXLA 4QRLA 4FQBB 2OVEA 2CZUA 1KOIA 2AL0X 4YBPA 5IO5A 3APUA 1ERXA 4O3YA 1FENA 4IAWA 4XMEA 4GETA 3PECA 1DFVA 2JU8A 1ERBA 3P6HA 3P6CA 1VYFA 2FT9A 1KT7A 1YIVA 4U8UN 4Y0RA 4EEJA 1S7DA 1MVGA 2FR2A 2ZAIA 3JSQA 4ZR2A 3CQNA 1JV4A 5H9AA 1PBOA 1PMPA 1UZ2X 4AZOA 5H8TA 3I0AA 4A1HA 3BRNA 4K19A 4ORWA 1I05A 3FEKA 3HWEA 1I4UA 1X8PA 1BWYA 3HOLA 1KT6A 1KXOA 1DZPA 3TF6A 1YUPA 1TOWA 4GDZA 4LKTA 1ACDA 4O4UA 3WJEA 3WJGA 4HWMA 3LV4A 1GT3A 4QYPA 5HTDA 2F09A 3FENA 3D95A 1SMPI 3MX7A 3VG3A 1QY0A 4YBUA 3IFBA 1I04A 1DC9A 1AELA 4I3BA 5CYBA 4XMGA 4ORRA 2Q2PA 2WWPA 1JYJA 3H3IA 1A18A 4ZHCA 2JOZA 2KW1A 3U0DA 3KFFA 3RBYA 4YGGA 3SOTA 1SXXA 4ZGUA 2CZTA 2Q9SA 2RD7C 1G5WA 4D6AA 4ZHFA 3L4RA 1NP4A 4UU2A 1BSOA 2HLVA 1GT5A 2XKLA 4I6SA 5B29A 2BS6A 4CV7A 4MISA 4U9CA 1HQPA 2HNXA 4HPDA 1GXAA 3BS2A 3C78X 4KC7A 1S2PA 1Y9TA 1GT1A 3NPOA 2BS5A 3GAQA 4PSQA 4GKCA 3PEDA 2RQ0A 5F58A 4A1YA 2A3FX 3FW5A 1B56A 2MM3A 4AZRA 1KQXA 4N7DA 2OVDA 2MJIA 5HBSA 1SXYA 2MHDA 2CBRA 3B2KA 3FR5A 4ZJ0A 1QQSA 5EEEA 5HCDC 1KQWA 3VE1A 3AKNA 4Y0PA 3NBXX 4YCEA 1CBQA 5H9LA 4WHIA 3ZWEA 5EDCA 4ID2A 3CBSA 4AW8A 4TNNA 1XKIA 3MBTA 4LQZA 4TKHA 1BM5A 4HPCA 4CK4A 5F7GA 3NQ9A 4FBRA 2X46A 3NP1A 3B2LA 3EYCA 3FYFA 4N7CA 1LNMA 3T1DA 3TZSA 1MDCA 4OMWA 4MVLA 3ZI8A 3STKA 1GT4A 4D6BA 3RZYA 4LZUA 1IKJA 2OZQA 2ACOA 1E5PA 2GC9A 2QO4A 1P6PA 3N91A 1SY0A 3BU9A 5HZ8A 1QABE 1BSQA 1T0VA 4A60A 3F8AA 2OVAA 5EZ2A 1HBPA 4TKJA 4UU3A 2G79A 1EXSA 1QFVA 3PH6A 4KC8A 4NYRA 4EDEA 1EIIA 4LKPA 1EALA 3D97A 5HA0A 2Z4IA 4AZNA 4TLJA 1QY2A 2RCTA 5AJBA 3S26A 1YP7A 2GTLM 4EXZA 5HZ5A 2PY1A 2HMBA 4YDAA 5LJGA 1X8UA 2POAA 4GNWA 5CE4A 2BLGA 2YG2A 3VPJE 4ZHDA 3HWGA 4I9RA 1E02A 4OMXA 1X71A 1LPJA 1QWDA 3RSWA 4MVIA 2ASNX 3E3CA 3KFHA 4ORYA 5F1EA 3STMX 1EQDA 3IA8A 2L68A 3ZW0A 3S60A 4YFPA 2WSJA 3WOVA 3F9DA 4XMHA 4YH0A 2QMIA 4O3WA 2LKKA 1CJ5A 1DZKA 5F6BA 2F73A 1BLRA 1L6MA 3QKGA 2RA6A 4TJZA 4YCHA 3HWFA 5HAEA 3S5VA 4IMOA 1G7NA 4INNA 5D48A 1O1VA 2FRSA 1FDQA 1T8VA 5LJDA 3EMMA 3TGCA 1FELA 1IKEA 3BSZE 1NGLA 3V8UA 3AKMA 1S44A 4TKBA 2X8SA 3BU1A 2A0AA 3PQSA 4AZPA 4OS0A 3UEUA 1SY3A 4Y0SA 1VYGA 4ON1A 3Q6LA 1NP1A 3TGBA 3HK1A 2W2AA 1BSYA 1CBSA 1X89A 5FAZA 3P6GA 5HCEC 1BBPA 3ZW0B 3ZZVA 2FS7A 2QO5A 4TQ2A 5D45A 4O4SA 4QGVA 4U8UM 1D3SA 2ALLX 2G78A 1PEEA 3BX8A 3EM0A 4OS8A 1LIFA 1ZNGA 2FWVA 3C76X 4LZVA 5AEOA 4GK9A 4HFOA 5L8IA 1YWCA 1B4MA 2JW1A 3WJCA 1ADLA 3UEVA 1EPBA 2JU7A 5HCCC 3RWXA 1LKEA 3NQKA 5EDBA 5BVSA 3NQ3A 4AZMA 4QZTA 5HZQA 4NNSA 1ICNA 4OS3A 1OBQA 1HMRA 2WQAE 4ZHGA 1OEJA 5FQ6E 4GZVA 5KICA 1A3YA 4ZH9A 1EPAA 1LFOA 1HMSA 4FGIB 3UAQA 2X8FA 4HPBA 4O49A 2GTLO 3F6ZB 4I3DA 1OEEA 4ARHA 1CRBA 5LJKA 3I17A 1BEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVF A;  1IFB A;  1ZNL A;  1IW2 A;  5LJH A;  1O8V A;  4ORS A;  3ZUI A;  1ZND A;  1E00 A;  3FEL A;  4YKM A;  5H9N A;  4QGX A;  1CBR A;  4QZU A;  3STN A;  5HA1 A;  4BQU A;  2HZR A;  4ORX A;  3TGA A;  2R56 A;  5HWZ A;  3FA6 A;  1I06 A;  2W2B A;  3D96 A;  1G85 A;  1LIE A;  2WEW A;  1KT5 A;  4IBA A;  1JJX A;  3WJD A;  2GJ5 A;  3FA8 A;  5LJC A;  5HZ6 A;  1KZX A;  1ML7 A;  5IO7 A;  4ALO A;  3BY0 A;  5LJB A;  2NNE A;  2A13 A;  1KT3 A;  2WR6 A;  1JBH A;  3UEW A;  2FTB A;  3JS1 A;  3VG4 A;  5IO6 A;  1GKA A;  3KFG A;  1O1U A;  4I3C A;  1TOU A;  2Q39 A;  3WJF A;  1Z24 A;  3DTQ A;  2AH7 X;  2R74 A;  3CWK A;  4BOE A;  5HTE A;  2O62 A;  1RLB E;  5KID A;  1ICM A;  4RUU A;  2L67 A;  5JR8 A;  1MX7 A;  2AT0 X;  3FW4 A;  4YDB A;  1SY2 A;  3FR4 A;  1D2U A;  4M6S A;  1ALB A;  1RBP A;  1T68 X;  2K62 A;  1U18 A;  3FEP A;  5D47 A;  4A8Z A;  1EW3 A;  1KZW A;  4IB8 A;  5L8N A;  1U17 A;  4ES7 A;  3B2I A;  1FEM A;  1DZM A;  1FTP A;  2X45 A;  4IB6 A;  3U9P C;  1A57 A;  3ZQ3 A;  1QG5 A;  2N93 A;  1X8O A;  5LKF A;  1X8N A;  4GH7 A;  3WXQ A;  3VG2 A;  3VG7 A;  1EIO A;  1JZU A;  5LJE A;  4NYQ A;  1E06 A;  1HBQ A;  1U0X A;  3B2J A;  4YFQ A;  5F6Z A;  2RCQ A;  3EBW A;  2LB6 A;  3KZA A;  1YWB A;  5K06 A;  5LKE A;  3PP6 A;  4R0B A;  1OBP A;  1SY1 A;  1IFC A;  4XMC A;  2QM9 A;  3ELZ A;  3P6D A;  3APX A;  2WEX A;  4MVK A;  2ACP X;  3CBC A;  3FLL A;  2CM9 A;  4WBK A;  2WQ9 A;  5FEN A;  4RUN A;  4EFG A;  1OEK A;  2A2G A;  2KTD A;  3EBK A;  3ELX A;  2GTF X;  4KII A;  1MUP A;  2AT3 X;  4IMN A;  1HMT A;  2IFB A;  1ZNH A;  4HPA A;  1IIU A;  1GGL A;  3KQ0 A;  3SAO A;  1YP6 A;  2A2U A;  1VPR A;  1LIB A;  3O2Y A;  5L8O A;  3O22 A;  1BJ7 A;  3FA7 A;  2G7B A;  4ZH6 A;  4WFU A;  1B0O A;  2Q4N A;  5D4A A;  1SXU A;  2LFO A;  5B27 A;  5KHP A;  3KFI A;  3NX1 A;  3ZUO A;  4AYH A;  1AVG I;  2AT8 X;  4XMD A;  4NNT A;  2FR3 A;  1TW4 A;  1DV9 A;  4ZHH A;  5DPQ A;  1PM1 X;  2AKQ A;  2HZQ A;  2AMM X;  4ALB A;  4YMY A;  1ZRY A;  5C0N A;  2KT4 B;  2QO6 A;  2QOS C;  3WVM A;  2FLJ A;  1YWD A;  2NP1 A;  3CMP A;  5D8J A;  2NNQ A;  5H9K A;  4DQ4 A;  1R0U A;  1DZJ A;  2L5P A;  1SA8 A;  4IB7 A;  2AT5 X;  3BDR A;  3NAD A;  1MX8 A;  2OFM X;  1AQB A;  3APW A;  3FMZ A;  4NLI A;  2ANS A;  3NR3 A;  4WFV A;  1GX9 A;  3O19 A;  3CR6 A;  1OPB A;  2W2F A;  3P6F A;  4GNY A;  1JJJ A;  4XMF A;  2AT6 X;  4ORU A;  1QY1 A;  2L9C A;  3BX7 A;  3P6E A;  4NP1 A;  2JU3 A;  4YKO A;  2CBS A;  2LBA A;  1XCA A;  1ZNK A;  1SXW A;  2CM4 A;  3B2H A;  2EU7 X;  2WUT A;  4ZFX A;  4IAX A;  1FE3 A;  1CBI A;  4YGZ A;  1BRP A;  1TVQ A;  1A2D A;  2HYS A;  3BLG A;  4BVM A;  1LID A;  2OFR X;  2Q2M A;  4O9S A;  2R73 A;  3CQR A;  4YFR A;  3K3L A;  5HZ9 A;  1QFT A;  3OJY C;  3PPT A;  4IB9 A;  1AB0 A;  5AQ6 A;  3U03 A;  3DSZ A;  4GE1 A;  2NND A;  5BVT A;  1N0S A;  3HWD A;  1ZNE A;  1GM6 A;  4Y0Q A;  3C77 X;  3PH5 A;  4ZCB A;  2E4J A;  5DG4 A;  5BVQ A;  2JN3 A;  3FIQ A;  3VG5 A;  1URE A;  3WJB A;  3VG6 A;  1DF3 A;  2P8G A;  4GRJ A;  4ODD A;  4DQ3 A;  4QAE A;  3G7X A;  1YWA A;  1HN2 A;  4QGW A;  5EED A;  1JYD A;  5FFH A;  1GKA B;  2K23 A;  4YGH A;  1KGL A;  2FS6 A;  3FA9 A;  2LBV A;  1LIC A;  2XST A;  3WBG A;  1OBU A;  1B8E A;  1BRQ A;  3APV A;  3UEX A;  1OPA A;  1H91 A;  4M7M A;  2DM5 A;  1LF7 A;  1X8Q A;  3NX2 A;  4NLJ A;  4AZQ A;  4I9S A;  1EUO A;  5EPQ A;  1G74 A;  2MO5 A;  4QYN A;  1KT4 A;  3FR2 A;  1GX8 A;  1TXL A;  2OVE A;  2CZU A;  1KOI A;  2AL0 X;  4YBP A;  5IO5 A;  3APU A;  1ERX A;  1FEN A;  4IAW A;  4XME A;  4GET A;  3PEC A;  1DFV A;  2JU8 A;  1ERB A;  3P6H A;  3P6C A;  1VYF A;  2FT9 A;  1KT7 A;  1YIV A;  4Y0R A;  4EEJ A;  1S7D A;  1MVG A;  2FR2 A;  3JSQ A;  4ZR2 A;  3CQN A;  1JV4 A;  5H9A A;  1PBO A;  1PMP A;  1UZ2 X;  4AZO A;  5H8T A;  3I0A A;  4A1H A;  3BRN A;  4K19 A;  4ORW A;  1I05 A;  3FEK A;  3HWE A;  1I4U A;  1X8P A;  1BWY A;  1KT6 A;  1KXO A;  1DZP A;  3TF6 A;  1YUP A;  1TOW A;  4LKT A;  1ACD A;  3WJE A;  3WJG A;  1GT3 A;  4QYP A;  5HTD A;  3FEN A;  3D95 A;  3VG3 A;  1QY0 A;  4YBU A;  3IFB A;  1I04 A;  1DC9 A;  1AEL A;  4I3B A;  4XMG A;  4ORR A;  2Q2P A;  2WWP A;  1JYJ A;  4ZHC A;  1A18 A;  2JOZ A;  3U0D A;  3KFF A;  4YGG A;  1SXX A;  4ZGU A;  2CZT A;  2Q9S A;  2RD7 C;  1G5W A;  4D6A A;  4ZHF A;  3L4R A;  1NP4 A;  4UU2 A;  1BSO A;  2HLV A;  1GT5 A;  2XKL A;  5B29 A;  1HQP A;  2HNX A;  4HPD A;  1GXA A;  3BS2 A;  3C78 X;  1S2P A;  1GT1 A;  3NPO A;  3GAQ A;  4PSQ A;  4GKC A;  3PED A;  2RQ0 A;  5F58 A;  4A1Y A;  2A3F X;  3FW5 A;  1B56 A;  2MM3 A;  4AZR A;  1KQX A;  4N7D A;  2OVD A;  2MJI A;  5HBS A;  1SXY A;  2CBR A;  3B2K A;  3FR5 A;  4ZJ0 A;  1QQS A;  5EEE A;  5HCD C;  1KQW A;  3AKN A;  4Y0P A;  4YCE A;  1CBQ A;  5H9L A;  5EDC A;  3CBS A;  4AW8 A;  4TNN A;  1XKI A;  3MBT A;  4TKH A;  1BM5 A;  4HPC A;  4CK4 A;  5F7G A;  3NQ9 A;  2X46 A;  3NP1 A;  3B2L A;  3EYC A;  4N7C A;  1LNM A;  3T1D A;  3TZS A;  1MDC A;  4OMW A;  4MVL A;  3STK A;  1GT4 A;  4D6B A;  3RZY A;  4LZU A;  1IKJ A;  2OZQ A;  2ACO A;  1E5P A;  2GC9 A;  2QO4 A;  1P6P A;  1SY0 A;  3BU9 A;  5HZ8 A;  1QAB E;  1BSQ A;  1T0V A;  4A60 A;  3F8A A;  2OVA A;  5EZ2 A;  1HBP A;  4TKJ A;  4UU3 A;  2G79 A;  1EXS A;  1QFV A;  3PH6 A;  4NYR A;  4EDE A;  1EII A;  4LKP A;  1EAL A;  3D97 A;  5HA0 A;  4AZN A;  4TLJ A;  1QY2 A;  2RCT A;  3S26 A;  1YP7 A;  4EXZ A;  5HZ5 A;  2PY1 A;  2HMB A;  4YDA A;  5LJG A;  1X8U A;  2POA A;  4GNW A;  5CE4 A;  2BLG A;  2YG2 A;  4ZHD A;  3HWG A;  4I9R A;  1E02 A;  4OMX A;  1X71 A;  1LPJ A;  1QWD A;  3RSW A;  4MVI A;  2ASN X;  3KFH A;  4ORY A;  5F1E A;  3STM X;  1EQD A;  3IA8 A;  2L68 A;  4YFP A;  2WSJ A;  3F9D A;  4XMH A;  4YH0 A;  2LKK A;  1CJ5 A;  1DZK A;  5F6B A;  2F73 A;  1BLR A;  1L6M A;  3QKG A;  2RA6 A;  4TJZ A;  4YCH A;  3HWF A;  5HAE A;  4IMO A;  1G7N A;  5D48 A;  1O1V A;  2FRS A;  1FDQ A;  1T8V A;  5LJD A;  3EMM A;  3TGC A;  1FEL A;  1IKE A;  3BSZ E;  1NGL A;  3AKM A;  1S44 A;  4TKB A;  3BU1 A;  2A0A A;  4AZP A;  4OS0 A;  3UEU A;  1SY3 A;  4Y0S A;  1VYG A;  3Q6L A;  1NP1 A;  3TGB A;  3HK1 A;  2W2A A;  1BSY A;  1CBS A;  1X89 A;  5FAZ A;  3P6G A;  5HCE C;  1BBP A;  2FS7 A;  2QO5 A;  4TQ2 A;  5D45 A;  4QGV A;  1D3S A;  2ALL X;  2G78 A;  1PEE A;  3BX8 A;  3EM0 A;  4OS8 A;  1LIF A;  1ZNG A;  2FWV A;  3C76 X;  4LZV A;  4HFO A;  5L8I A;  1YWC A;  1B4M A;  3WJC A;  1ADL A;  3UEV A;  1EPB A;  2JU7 A;  5HCC C;  1LKE A;  5EDB A;  5BVS A;  3NQ3 A;  4AZM A;  4QZT A;  5HZQ A;  4NNS A;  1ICN A;  4OS3 A;  1OBQ A;  1HMR A;  2WQA E;  4ZHG A;  1OEJ A;  5KIC A;  1A3Y A;  4ZH9 A;  1EPA A;  1LFO A;  1HMS A;  4HPB A;  4I3D A;  1OEE A;  4ARH A;  1CRB A;  5LJK A;  3I17 A;  1BEB A; 
#chains in the Genus database with same CATH topology
 3MVF A;  1IFB A;  1ZNL A;  1IW2 A;  1RST B;  4ML7 B;  5LJH A;  1O8V A;  4ORS A;  3ZUI A;  1ZND A;  1E00 A;  3FEL A;  4GJS A;  4YKM A;  5H9N A;  4QGX A;  3WYP A;  1CBR A;  4QZU A;  1NBX A;  3STN A;  4I95 A;  5HA1 A;  1SWU A;  4BQU A;  2HZR A;  2BT9 A;  4ORX A;  3RKG A;  2M4L A;  4Y59 A;  2GH7 A;  2OL7 A;  3TGA A;  4GU8 A;  2R56 A;  5HWZ A;  3FA6 A;  1I06 A;  2W2B A;  4GUZ A;  4O4O A;  4BJ8 A;  3D96 A;  1N7Y A;  3HTY A;  3OBL A;  2A5B A;  1G85 A;  4CPF A;  1LIE A;  2WEW A;  1KT5 A;  4IBA A;  1JJX A;  3WJD A;  2GJ5 A;  3FA8 A;  5LJC A;  5HZ6 A;  1KZX A;  5IXG A;  1ML7 A;  3Q34 A;  5IO7 A;  4ALO A;  3BY0 A;  1MK5 A;  5LJB A;  2IZL B;  2NNE A;  1N4J A;  2A13 A;  1KT3 A;  2RN4 A;  2WR6 A;  4Z2O A;  3T2W A;  2FHN X;  1JBH A;  4Z2P A;  4BX5 A;  2JMB A;  2FTB A;  3JS1 A;  4MVE A;  2OY7 A;  3UEW A;  3VG4 A;  5IO6 A;  1GKA A;  1SLG B;  1O1U A;  2RTQ B;  1TOU A;  2Q39 A;  3KFG A;  3EW2 A;  1Z24 A;  2DJF A;  2UYW A;  1LUQ A;  3DTQ A;  2AH7 X;  5BYP A;  2R74 A;  3CWK A;  4BOE A;  3P24 A;  4L3R A;  1SLE B;  4U8U O;  2O62 A;  1RLB E;  5HTE A;  5KID A;  1Y9L A;  1ICM A;  4RUU A;  2L67 A;  5JR8 A;  4DNE A;  1MX7 A;  2AT0 X;  3HOE A;  3FW4 A;  4YDB A;  1VWN B;  1SY2 A;  2RTM A;  3FR4 A;  3WYQ A;  1D2U A;  4M6S A;  3S5X A;  1ALB A;  1AVD A;  1RBP A;  1T68 X;  2GTL N;  2RTK A;  2K62 A;  4U3Q A;  3ZW2 A;  1U18 A;  3FEP A;  4PJ2 A;  5D47 A;  1EW3 A;  4A8Z A;  1STR B;  1KZW A;  2RTF B;  2X8T A;  4IB8 A;  5L8N A;  1U17 A;  2BHV A;  4ES7 A;  3B2I A;  1FEM A;  1DZM A;  1FTP A;  2X45 A;  4IB6 A;  3U9P C;  3D9W A;  2IZC B;  3WZN A;  3ZW1 A;  1A57 A;  2RTB B;  2RTP B;  3ZQ3 A;  4CSB A;  1QG5 A;  2N93 A;  3PK2 A;  4O4X A;  1X8O A;  5LKF A;  1WUB A;  1X8N A;  2ZAG A;  4GH7 A;  3WXQ A;  3VG2 A;  3VG7 A;  1EIO A;  1JZU A;  5LJE A;  3T2X A;  2BC3 A;  3CKF A;  1E06 A;  4NYQ A;  1HBQ A;  1HY2 A;  1U0X A;  2F01 A;  3B2J A;  4YFQ A;  5F6Z A;  2G5L A;  2RCQ A;  3EBW A;  3GE2 A;  2LB6 A;  3KZA A;  1YWB A;  5IRW A;  5B10 O;  5K06 A;  4EKV A;  4GGZ A;  5LKE A;  1SWP A;  3PP6 A;  5IRA A;  4KT5 A;  1GX3 A;  4KCA A;  4FBO A;  4R0B A;  2OY5 O;  1NQM A;  1OBP A;  4CDF A;  2JGS A;  1SY1 A;  1IFC A;  4XMC A;  3KVN A;  3VU1 A;  2QM9 A;  3ELZ A;  3P6D A;  3APX A;  1STS B;  2WEX A;  1SWA A;  4MVK A;  1SWS A;  2ACP X;  3CBC A;  4L1N A;  3FLL A;  5AJC A;  2CM9 A;  4WBK A;  3ZW1 B;  3VHH A;  2WQ9 A;  5FEN A;  4RUN A;  4EFG A;  1OEK A;  2A2G A;  2KTD A;  3EBK A;  3ELX A;  3X00 A;  2KD2 A;  5B5F A;  2GTF X;  4KII A;  1MUP A;  2RTG B;  2AT3 X;  4IMN A;  1VWA B;  2MWH A;  2LA7 A;  4BX6 A;  1HMT A;  2IFB A;  1ZNH A;  4HPA A;  1IIU A;  4Z6J A;  1GGL A;  1W5R A;  2I5Z O;  3KQ0 A;  1YP6 A;  2RTE B;  3SAO A;  2A2U A;  1VPR A;  5K68 A;  1LIB A;  3O2Y A;  5L8O A;  1LCW A;  3O22 A;  1BJ7 A;  1SLD B;  3FA7 A;  4O3Z A;  2G7B A;  4ZH6 A;  4WFU A;  1LEL A;  3RY2 A;  1B0O A;  4NW4 A;  2Q4N A;  4ZGF A;  3D4R A;  5D4A A;  1SXU A;  2LFO A;  5B27 A;  5KHP A;  3KFI A;  2IZJ A;  3NX1 A;  3PQU A;  3ZUO A;  4AYH A;  1AVG I;  2AT8 X;  4XMD A;  2OFB A;  4NNT A;  4CPI A;  2FR3 A;  1TW4 A;  1DV9 A;  3SLJ A;  2IZF B;  4QNI A;  4ZHH A;  5DPQ A;  1PM1 X;  2AKQ A;  2HZQ A;  2RTL A;  1BEB A;  2AMM X;  3LTW A;  4ALB A;  4YMY A;  1ZRY A;  2OFA A;  5C0N A;  1HQQ A;  1RSU B;  5FQ7 E;  2KT4 B;  2QO6 A;  1KL4 A;  4I3C A;  3VGW A;  2QOS C;  3WVM A;  5FQ8 E;  2FLJ A;  4BX6 B;  1YWD A;  2NP1 A;  3CMP A;  5D8J A;  2C1S A;  3RDQ A;  2NNQ A;  5H9K A;  2RTC B;  4DQ4 A;  1R0U A;  1VYO A;  1DZJ A;  2X32 A;  2X56 A;  2L5P A;  1SA8 A;  1SRF A;  4IB7 A;  2IZI A;  2AT5 X;  3T6F A;  3BDR A;  3NAD A;  4KH8 A;  3HPE A;  4O3X B;  1MX8 A;  1LDQ A;  2OFM X;  1AQB A;  2YMS A;  3APW A;  3FMZ A;  2ANS A;  3NR3 A;  4NLI A;  4WFV A;  1GX9 A;  3O19 A;  3CR6 A;  1OPB A;  2W2F A;  3WZQ A;  2I5V O;  3P6F A;  4U46 A;  3MG5 A;  4GNY A;  1VWC B;  1UYN X;  1JJJ A;  4XMF A;  2AT6 X;  4ORU A;  1QY1 A;  2L9C A;  3BX7 A;  3P6E A;  2DJG A;  4NP1 A;  2JU3 A;  3FDC A;  2KTS A;  4YKO A;  2CBS A;  2RTA A;  1VWM B;  1VWH B;  2LBA A;  4OEM A;  1XCA A;  1ZNK A;  1SXW A;  1HXZ A;  2CM4 A;  3B2H A;  3OE3 A;  2EU7 X;  2WUT A;  3P02 A;  4ZFX A;  4IAX A;  1FE3 A;  2ZSC A;  2RTO B;  1CBI A;  3JQO A;  4YGZ A;  3RDO A;  4MIR A;  4CPH A;  1BRP A;  1NQN A;  3LHN A;  4GJV A;  2A5C A;  1TVQ A;  1A2D A;  3RE5 A;  1W6F A;  2FHL A;  1N9Y A;  2HYS A;  3BLG A;  4BVM A;  1LID A;  2OFR X;  2Q2M A;  4O9S A;  2R73 A;  3CQR A;  3SZH A;  3K3L A;  4YFR A;  5HZ9 A;  3SLO A;  1QFT A;  3OJY C;  3PPT A;  4IB9 A;  3OD9 A;  4FBV A;  4Z28 A;  1AB0 A;  5CSE A;  3SLT A;  5AQ6 A;  2RTI B;  3U03 A;  2C1Q A;  3DSZ A;  4CDC A;  4GE1 A;  3SZJ A;  2NND A;  5BVT A;  1N0S A;  3HWD A;  1ZNE A;  1GM6 A;  3PDF A;  4Y0Q A;  3C77 X;  3PH5 A;  2Z4H A;  3VE2 A;  4ZCB A;  2E4J A;  5DG4 A;  1Y52 X;  2OVS A;  2G8C O;  1E2T A;  2JN3 A;  5BVQ A;  3FIQ A;  3VG5 A;  1URE A;  1JIW I;  3VG6 A;  2UZ2 A;  2P8G A;  1KL3 A;  4GRJ A;  4ODD A;  3WJB A;  1SWK A;  4GDA A;  4QAE A;  4BX5 B;  3G7X A;  1YWA A;  2AF5 A;  3VHI A;  4CDE A;  4JGL A;  4DQ3 A;  1HN2 A;  4QGW A;  4QQ1 A;  1JYD A;  5EED A;  1GKA B;  2K23 A;  5FFH A;  4C5P A;  4CPH B;  4COT A;  4YGH A;  1KGL A;  4EQA C;  2FS6 A;  3FA9 A;  2LBV A;  1LIC A;  2XST A;  3WBG A;  1OBU A;  1B8E A;  1BRQ A;  3APV A;  2OF9 A;  3UEX A;  1OPA A;  1H91 A;  1SWB A;  4M7M A;  1RXJ A;  1VWP B;  1VWO B;  1LF7 A;  1X8Q A;  2DM5 A;  1LCZ A;  1EI5 A;  3NX2 A;  4IAB A;  4NLJ A;  4AZQ A;  4I9S A;  3RDX A;  1EUO A;  4BBO A;  5EPQ A;  1G74 A;  2MO5 A;  4QYN A;  5JD2 A;  1KT4 A;  3FR2 A;  1Y53 X;  1GX8 A;  1TXL A;  4QRL A;  4FQB B;  2OVE A;  2CZU A;  2FGS A;  1KOI A;  2AL0 X;  2QOM A;  4YBP A;  5IO5 A;  3QQ2 A;  1STP A;  3APU A;  1ERX A;  4O3Y A;  2FKG A;  4CDD A;  1FEN A;  4IAW A;  4XME A;  4GET A;  3PEC A;  4GGT A;  1DFV A;  2JU8 A;  1ERB A;  3P6H A;  3RE6 A;  3P6C A;  1SWJ A;  1KFF A;  1VYF A;  2FT9 A;  5B11 O;  1KT7 A;  1N9M A;  1YIV A;  4U8U N;  4Y0R A;  5F2B A;  1MM9 A;  4EEJ A;  1S7D A;  1MVG A;  2FR2 A;  2ZAI A;  3JSQ A;  2VFC A;  4ZR2 A;  3CQN A;  1DF3 A;  1JV4 A;  5H9A A;  1PBO A;  1PMP A;  1UZ2 X;  4AZO A;  5H8T A;  3I0A A;  4A1H A;  3BRN A;  4K19 A;  4ORW A;  1I05 A;  1Y55 X;  2OL6 O;  3FEK A;  3HWE A;  4YVB A;  1I4U A;  1X8P A;  2OF8 A;  3RY1 A;  1BWY A;  3HOL A;  1KT6 A;  1KXO A;  1JQP A;  1DZP A;  2MF6 A;  3TF6 A;  2VFB A;  1SWH A;  1TOW A;  1YUP A;  4GDZ A;  2OY8 A;  4LKT A;  1ACD A;  4GD9 A;  4O4U A;  1JJU A;  3WJE A;  2C4I A;  4HWM A;  3WJG A;  1VWG B;  3LV4 A;  1GT3 A;  4QYP A;  5IRU A;  5HTD A;  2F09 A;  3FEN A;  2IZG B;  1SWE A;  3D95 A;  1SWD A;  4CPE A;  1SMP I;  3MX7 A;  3VG3 A;  1SRE A;  1QY0 A;  4YBU A;  3IFB A;  1IJ8 A;  1I04 A;  1DC9 A;  1AEL A;  4I3B A;  2IZD B;  5CYB A;  4XMG A;  4ORR A;  2Q2P A;  1DF8 A;  2WWP A;  1JYJ A;  1K3B A;  1LDO A;  1A18 A;  3H3I A;  2A8G A;  2JOZ A;  2KW1 A;  4ZHC A;  3U0D A;  3KFF A;  1SWN A;  1Y0G A;  3VHM A;  4MEE A;  4I60 A;  3RBY A;  2X34 A;  1SLF B;  4GGR A;  4YGG A;  3SOT A;  1SXX A;  1SRH A;  4ZGU A;  2CZT A;  2Q9S A;  2RD7 C;  1G5W A;  1SRI A;  4D6A A;  1VWE B;  3L4R A;  4ZHF A;  1NP4 A;  4UU2 A;  1BSO A;  2HLV A;  1GT5 A;  2XKL A;  4NV7 A;  4I6S A;  5B29 A;  2BS6 A;  4CV7 A;  4MIS A;  4U9C A;  4Y5D A;  1W4T A;  3WZO A;  1HQP A;  2HNX A;  4HPD A;  1GXA A;  2VDF A;  2IZE B;  3BS2 A;  3C78 X;  4KC7 A;  4BGF A;  1S2P A;  1Y9T A;  2Y3F A;  1GT1 A;  3NPO A;  2BS5 A;  2WPU A;  3GAQ A;  4PSQ A;  4GKC A;  3PED A;  2RQ0 A;  5F58 A;  4A1Y A;  2A3F X;  3FW5 A;  1SWC A;  1B56 A;  2MM3 A;  4AZR A;  1KQX A;  3EW1 A;  4N7D A;  2OVD A;  2MJI A;  4JNJ A;  5HBS A;  1SXY A;  2MHD A;  2IZH B;  2CBR A;  3B2K A;  3FR5 A;  4ZJ0 A;  1QQS A;  5EEE A;  2OYB O;  1KL5 A;  4OEL A;  1KQW A;  2OY1 O;  3AKN A;  3VE1 A;  4Y0P A;  5HCD C;  3NBX X;  4YCE A;  1CBQ A;  5H9L A;  4WHI A;  3ZWE A;  5EDC A;  4ID2 A;  3CBS A;  4AW8 A;  4TNN A;  1XKI A;  3MBT A;  4LQZ A;  2Y3E A;  4TKH A;  1BM5 A;  4HPC A;  1JMZ A;  1VWI B;  4CK4 A;  3CKG A;  5F7G A;  3NQ9 A;  4FBR A;  2X46 A;  3AEH A;  1SWT A;  3RDU A;  5B5G A;  3NP1 A;  1NDJ A;  3B2L A;  3EYC A;  3FYF A;  4N7C A;  1LNM A;  3T1D A;  3SZI A;  3TZS A;  1MDC A;  4OMW A;  4MVL A;  3ZI8 A;  3STK A;  1RAV A;  1VWB B;  1GT4 A;  4DCB A;  4D6B A;  1VWD B;  3RZY A;  4LZU A;  1IKJ A;  1SWG A;  2ACO A;  1E5P A;  2GC9 A;  2OZQ A;  2QO4 A;  1P6P A;  2RTH B;  3N91 A;  1SY0 A;  3BU9 A;  5HZ8 A;  1LCV A;  1QAB E;  1BSQ A;  1T0V A;  1UYO X;  5CHK A;  4A60 A;  3F8A A;  1HXL A;  2OVA A;  5B2A O;  5EZ2 A;  1HBP A;  4TKJ A;  3EC5 A;  3MM0 A;  4UU3 A;  2G79 A;  1EXS A;  1QFV A;  3PH6 A;  4KC8 A;  4NYR A;  4EDE A;  1EII A;  4LKP A;  4B55 A;  1EAL A;  3D97 A;  5HA0 A;  2Z4I A;  4AZN A;  4TLJ A;  1QY2 A;  2RCT A;  5AJB A;  3S26 A;  1YP7 A;  2GTL M;  1VWL B;  4EXZ A;  2PY1 A;  5HZ5 A;  2RTR B;  2HMB A;  4YDA A;  5LJG A;  1X8U A;  3AUM O;  2POA A;  4GNW A;  3T6L A;  5CE4 A;  1K24 A;  2BLG A;  2YG2 A;  2IZA A;  1PBY A;  3VPJ E;  3HWG A;  4ZHD A;  4I9R A;  1E02 A;  4OMX A;  1X71 A;  1LPJ A;  1QWD A;  3RSW A;  4MVI A;  2ASN X;  3E3C A;  1SWR A;  3KFH A;  4OKA A;  4ORY A;  1SRJ A;  1EQD A;  3IA8 A;  1RXH A;  5F1E A;  5K67 A;  2L68 A;  3ZW0 A;  4BX7 A;  3S60 A;  4YFP A;  3FID A;  1SWQ A;  2WSJ A;  1N43 A;  3WOV A;  3F9D A;  1WBI A;  2RTJ A;  2OL8 O;  4XMH A;  2QMI A;  4O3W A;  4YH0 A;  1FJ1 E;  2LKK A;  1CJ5 A;  1PTS A;  1DZK A;  5F6B A;  2QCB A;  3STM X;  2F73 A;  4BCS A;  1BLR A;  1L6M A;  3QKG A;  2RA6 A;  4TJZ A;  4YCH A;  3HWF A;  5HAE A;  3S5V A;  4IMO A;  1G7N A;  4INN A;  4IRW A;  2FKJ A;  5D48 A;  1O1V A;  2FRS A;  1FDQ A;  1T8V A;  5LJD A;  3EMM A;  3TGC A;  1FEL A;  1IKE A;  2IZK A;  3BSZ E;  2X55 A;  1NGL A;  3V8U A;  1VWK B;  3AKM A;  1S44 A;  1AVE A;  4TKB A;  2X8S A;  1VWR B;  2BSZ A;  3BU1 A;  2IZB A;  4JO6 A;  1OSP O;  2A0A A;  3PQS A;  4AZP A;  4OS0 A;  5B3M O;  3UEU A;  1SY3 A;  4Y0S A;  1RXK A;  1VYG A;  4ON1 A;  3Q6L A;  1NC9 A;  1NP1 A;  4Z2V A;  3TGB A;  3HK1 A;  2W2A A;  1BSY A;  1CBS A;  1X89 A;  5FAZ A;  3P6G A;  5HCE C;  1BBP A;  3ZW0 B;  3ZZV A;  4BX7 B;  2FS7 A;  2QO5 A;  1I78 A;  4TQ2 A;  5L3Y A;  5D45 A;  4O4S A;  4QGV A;  4U8U M;  1D3S A;  2ALL X;  2G78 A;  1PEE A;  3BX8 A;  3EM0 A;  4OS8 A;  1LIF A;  1ZNG A;  2FWV A;  3C76 X;  4LZV A;  5AEO A;  4GK9 A;  4HFO A;  2RTD B;  5L8I A;  1YWC A;  3WJF A;  1SRG A;  1B4M A;  2HKD A;  3WZP A;  2JW1 A;  3WJC A;  1ADL A;  3UEV A;  2PI3 O;  1SWO A;  1EPB A;  1VWJ B;  2JU7 A;  2X4M A;  2RTN B;  5HCC C;  2Y32 A;  3RWX A;  4NV8 A;  1LKE A;  1SWF A;  3NQK A;  5EDB A;  5BVS A;  3RDS A;  3NQ3 A;  4AZM A;  4QZT A;  5HZQ A;  1SWL A;  1ICN A;  4NNS A;  4OS3 A;  1OBQ A;  1HMR A;  2WQA E;  4JHQ A;  4ZHG A;  1OEJ A;  1VWQ B;  2AVI A;  4GZV A;  2CAM A;  5FQ6 E;  5KIC A;  1A3Y A;  4Z27 A;  1JMX A;  1EPA A;  1LFO A;  4ZH9 A;  3RDM A;  1I9H A;  1HMS A;  4FGI B;  1VWF B;  2X8F A;  4HPB A;  4O49 A;  2GTL O;  3UAQ A;  1MOY A;  3F6Z B;  4I3D A;  1OEE A;  4ARH A;  1CRB A;  5LJK A;  3I17 A;  1MEP A; 
#chains in the Genus database with same CATH homology
 3MVF A;  1IFB A;  1ZNL A;  1IW2 A;  4ML7 B;  5LJH A;  1O8V A;  4ORS A;  3ZUI A;  1ZND A;  1E00 A;  3FEL A;  4YKM A;  5H9N A;  4QGX A;  1CBR A;  4QZU A;  3STN A;  4I95 A;  5HA1 A;  4BQU A;  2HZR A;  2BT9 A;  4ORX A;  3RKG A;  2M4L A;  3TGA A;  4GU8 A;  2R56 A;  5HWZ A;  3FA6 A;  1I06 A;  2W2B A;  4O4O A;  3D96 A;  3HTY A;  3OBL A;  1G85 A;  1LIE A;  2WEW A;  1KT5 A;  4IBA A;  1JJX A;  3WJD A;  2GJ5 A;  3FA8 A;  5LJC A;  5HZ6 A;  1KZX A;  1ML7 A;  5IO7 A;  4ALO A;  3BY0 A;  5LJB A;  2NNE A;  2A13 A;  1KT3 A;  2RN4 A;  2WR6 A;  1JBH A;  2JMB A;  2FTB A;  3JS1 A;  4MVE A;  3UEW A;  3VG4 A;  5IO6 A;  1GKA A;  3KFG A;  1O1U A;  4I3C A;  1TOU A;  2Q39 A;  3WJF A;  5BYP A;  1Z24 A;  3DTQ A;  2AH7 X;  2R74 A;  3CWK A;  4BOE A;  3P24 A;  4L3R A;  4U8U O;  5HTE A;  2O62 A;  1RLB E;  5KID A;  1Y9L A;  1ICM A;  4RUU A;  2L67 A;  5JR8 A;  1MX7 A;  2AT0 X;  3HOE A;  3FW4 A;  4YDB A;  1SY2 A;  3FR4 A;  1D2U A;  4M6S A;  3S5X A;  1ALB A;  1RBP A;  1T68 X;  2GTL N;  2K62 A;  4U3Q A;  3ZW2 A;  1U18 A;  3FEP A;  4PJ2 A;  5D47 A;  1EW3 A;  4A8Z A;  1KZW A;  2X8T A;  4IB8 A;  5L8N A;  1U17 A;  2BHV A;  4ES7 A;  3B2I A;  1FEM A;  1DZM A;  1FTP A;  2X45 A;  4IB6 A;  3U9P C;  1A57 A;  3ZW1 A;  3ZQ3 A;  4CSB A;  1QG5 A;  2N93 A;  4O4X A;  1X8O A;  5LKF A;  1X8N A;  2ZAG A;  4GH7 A;  3WXQ A;  3VG2 A;  3VG7 A;  1EIO A;  1JZU A;  5LJE A;  4NYQ A;  1E06 A;  1HBQ A;  1U0X A;  3B2J A;  4YFQ A;  5F6Z A;  2RCQ A;  3EBW A;  3GE2 A;  2LB6 A;  3KZA A;  1YWB A;  5K06 A;  5LKE A;  3PP6 A;  4KT5 A;  4KCA A;  4FBO A;  4R0B A;  1OBP A;  1SY1 A;  1IFC A;  4XMC A;  3VU1 A;  2QM9 A;  3ELZ A;  3P6D A;  3APX A;  2WEX A;  4MVK A;  2ACP X;  3CBC A;  4L1N A;  3FLL A;  5AJC A;  2CM9 A;  4WBK A;  3ZW1 B;  2WQ9 A;  5FEN A;  4RUN A;  4EFG A;  1OEK A;  2A2G A;  2KTD A;  3EBK A;  3ELX A;  2KD2 A;  2GTF X;  4KII A;  1MUP A;  2AT3 X;  4IMN A;  2MWH A;  2LA7 A;  1HMT A;  2IFB A;  1ZNH A;  4HPA A;  1IIU A;  1GGL A;  3KQ0 A;  3SAO A;  1YP6 A;  2A2U A;  1VPR A;  1LIB A;  3O2Y A;  5L8O A;  3O22 A;  1BJ7 A;  3FA7 A;  4O3Z A;  2G7B A;  4ZH6 A;  4WFU A;  4ZGF A;  1B0O A;  4NW4 A;  2Q4N A;  3D4R A;  5D4A A;  1SXU A;  2LFO A;  5B27 A;  5KHP A;  3KFI A;  3NX1 A;  3PQU A;  3ZUO A;  4AYH A;  1AVG I;  2AT8 X;  4XMD A;  4NNT A;  2FR3 A;  1TW4 A;  1DV9 A;  4QNI A;  4ZHH A;  5DPQ A;  1PM1 X;  2AKQ A;  2HZQ A;  2AMM X;  4ALB A;  4YMY A;  1ZRY A;  5C0N A;  5FQ7 E;  2KT4 B;  2QO6 A;  2QOS C;  3WVM A;  5FQ8 E;  2FLJ A;  1YWD A;  2NP1 A;  3CMP A;  5D8J A;  2NNQ A;  5H9K A;  4DQ4 A;  1R0U A;  1DZJ A;  2L5P A;  1SA8 A;  4IB7 A;  2AT5 X;  3BDR A;  3NAD A;  4KH8 A;  4O3X B;  1MX8 A;  2OFM X;  1AQB A;  2YMS A;  3APW A;  3FMZ A;  2ANS A;  3NR3 A;  4NLI A;  4WFV A;  1GX9 A;  3O19 A;  3CR6 A;  1OPB A;  2W2F A;  3P6F A;  4GNY A;  1JJJ A;  4XMF A;  2AT6 X;  4ORU A;  1QY1 A;  2L9C A;  3BX7 A;  3P6E A;  4NP1 A;  2JU3 A;  4YKO A;  2KTS A;  2CBS A;  2LBA A;  1XCA A;  1ZNK A;  1SXW A;  3P02 A;  2CM4 A;  3B2H A;  3OE3 A;  2EU7 X;  2WUT A;  4ZFX A;  4IAX A;  1FE3 A;  1CBI A;  3JQO A;  4YGZ A;  4MIR A;  1BRP A;  3LHN A;  1TVQ A;  1A2D A;  2HYS A;  3BLG A;  4BVM A;  1LID A;  2OFR X;  2Q2M A;  4O9S A;  2R73 A;  3CQR A;  4YFR A;  3K3L A;  5HZ9 A;  1QFT A;  3OJY C;  3PPT A;  4IB9 A;  3OD9 A;  4FBV A;  1AB0 A;  5AQ6 A;  3U03 A;  3DSZ A;  4GE1 A;  2NND A;  5BVT A;  1N0S A;  3HWD A;  1ZNE A;  1GM6 A;  4Y0Q A;  3C77 X;  3PH5 A;  2Z4H A;  3VE2 A;  4ZCB A;  2E4J A;  5DG4 A;  2OVS A;  5BVQ A;  2JN3 A;  3FIQ A;  3VG5 A;  1URE A;  1JIW I;  3VG6 A;  3WJB A;  2P8G A;  1DF3 A;  4GRJ A;  4ODD A;  4DQ3 A;  4QAE A;  3G7X A;  1YWA A;  4JGL A;  1HN2 A;  4QGW A;  4QQ1 A;  1JYD A;  5EED A;  1GKA B;  2K23 A;  5FFH A;  4COT A;  4YGH A;  1KGL A;  4EQA C;  2FS6 A;  3FA9 A;  2LBV A;  1LIC A;  2XST A;  3WBG A;  1OBU A;  1B8E A;  1BRQ A;  3APV A;  3UEX A;  1OPA A;  1H91 A;  4M7M A;  2DM5 A;  1LF7 A;  1X8Q A;  1EI5 A;  3NX2 A;  4IAB A;  4NLJ A;  4AZQ A;  4I9S A;  1EUO A;  5EPQ A;  1G74 A;  2MO5 A;  4QYN A;  1KT4 A;  3FR2 A;  1GX8 A;  1TXL A;  4QRL A;  4FQB B;  2OVE A;  2CZU A;  1KOI A;  2AL0 X;  4YBP A;  5IO5 A;  3APU A;  1ERX A;  4O3Y A;  1FEN A;  4IAW A;  4XME A;  4GET A;  3PEC A;  1DFV A;  2JU8 A;  1ERB A;  3P6H A;  3P6C A;  1VYF A;  2FT9 A;  1KT7 A;  1YIV A;  4U8U N;  4Y0R A;  4EEJ A;  1S7D A;  1MVG A;  2FR2 A;  2ZAI A;  3JSQ A;  4ZR2 A;  3CQN A;  1JV4 A;  5H9A A;  1PBO A;  1PMP A;  1UZ2 X;  4AZO A;  5H8T A;  3I0A A;  4A1H A;  3BRN A;  4K19 A;  4ORW A;  1I05 A;  3FEK A;  3HWE A;  1I4U A;  1X8P A;  1BWY A;  3HOL A;  1KT6 A;  1KXO A;  1DZP A;  3TF6 A;  1YUP A;  1TOW A;  4GDZ A;  4LKT A;  1ACD A;  4O4U A;  3WJE A;  3WJG A;  4HWM A;  3LV4 A;  1GT3 A;  4QYP A;  5HTD A;  2F09 A;  3FEN A;  3D95 A;  1SMP I;  3MX7 A;  3VG3 A;  1QY0 A;  4YBU A;  3IFB A;  1I04 A;  1DC9 A;  1AEL A;  4I3B A;  5CYB A;  4XMG A;  4ORR A;  2Q2P A;  2WWP A;  1JYJ A;  3H3I A;  1A18 A;  4ZHC A;  2JOZ A;  2KW1 A;  3U0D A;  3KFF A;  3RBY A;  4YGG A;  3SOT A;  1SXX A;  4ZGU A;  2CZT A;  2Q9S A;  2RD7 C;  1G5W A;  4D6A A;  4ZHF A;  3L4R A;  1NP4 A;  4UU2 A;  1BSO A;  2HLV A;  1GT5 A;  2XKL A;  4I6S A;  5B29 A;  2BS6 A;  4CV7 A;  4MIS A;  4U9C A;  1HQP A;  2HNX A;  4HPD A;  1GXA A;  3BS2 A;  3C78 X;  4KC7 A;  1S2P A;  1Y9T A;  1GT1 A;  3NPO A;  2BS5 A;  3GAQ A;  4PSQ A;  4GKC A;  3PED A;  2RQ0 A;  5F58 A;  4A1Y A;  2A3F X;  3FW5 A;  1B56 A;  2MM3 A;  4AZR A;  1KQX A;  4N7D A;  2OVD A;  2MJI A;  5HBS A;  1SXY A;  2MHD A;  2CBR A;  3B2K A;  3FR5 A;  4ZJ0 A;  1QQS A;  5EEE A;  5HCD C;  1KQW A;  3VE1 A;  3AKN A;  4Y0P A;  3NBX X;  4YCE A;  1CBQ A;  5H9L A;  4WHI A;  3ZWE A;  5EDC A;  4ID2 A;  3CBS A;  4AW8 A;  4TNN A;  1XKI A;  3MBT A;  4LQZ A;  4TKH A;  1BM5 A;  4HPC A;  4CK4 A;  5F7G A;  3NQ9 A;  4FBR A;  2X46 A;  3NP1 A;  3B2L A;  3EYC A;  3FYF A;  4N7C A;  1LNM A;  3T1D A;  3TZS A;  1MDC A;  4OMW A;  4MVL A;  3ZI8 A;  3STK A;  1GT4 A;  4D6B A;  3RZY A;  4LZU A;  1IKJ A;  2OZQ A;  2ACO A;  1E5P A;  2GC9 A;  2QO4 A;  1P6P A;  3N91 A;  1SY0 A;  3BU9 A;  5HZ8 A;  1QAB E;  1BSQ A;  1T0V A;  4A60 A;  3F8A A;  2OVA A;  5EZ2 A;  1HBP A;  4TKJ A;  4UU3 A;  2G79 A;  1EXS A;  1QFV A;  3PH6 A;  4KC8 A;  4NYR A;  4EDE A;  1EII A;  4LKP A;  1EAL A;  3D97 A;  5HA0 A;  2Z4I A;  4AZN A;  4TLJ A;  1QY2 A;  2RCT A;  5AJB A;  3S26 A;  1YP7 A;  2GTL M;  4EXZ A;  5HZ5 A;  2PY1 A;  2HMB A;  4YDA A;  5LJG A;  1X8U A;  2POA A;  4GNW A;  5CE4 A;  2BLG A;  2YG2 A;  3VPJ E;  4ZHD A;  3HWG A;  4I9R A;  1E02 A;  4OMX A;  1X71 A;  1LPJ A;  1QWD A;  3RSW A;  4MVI A;  2ASN X;  3E3C A;  3KFH A;  4ORY A;  5F1E A;  3STM X;  1EQD A;  3IA8 A;  2L68 A;  3ZW0 A;  3S60 A;  4YFP A;  2WSJ A;  3WOV A;  3F9D A;  4XMH A;  4YH0 A;  2QMI A;  4O3W A;  2LKK A;  1CJ5 A;  1DZK A;  5F6B A;  2F73 A;  1BLR A;  1L6M A;  3QKG A;  2RA6 A;  4TJZ A;  4YCH A;  3HWF A;  5HAE A;  3S5V A;  4IMO A;  1G7N A;  4INN A;  5D48 A;  1O1V A;  2FRS A;  1FDQ A;  1T8V A;  5LJD A;  3EMM A;  3TGC A;  1FEL A;  1IKE A;  3BSZ E;  1NGL A;  3V8U A;  3AKM A;  1S44 A;  4TKB A;  2X8S A;  3BU1 A;  2A0A A;  3PQS A;  4AZP A;  4OS0 A;  3UEU A;  1SY3 A;  4Y0S A;  1VYG A;  4ON1 A;  3Q6L A;  1NP1 A;  3TGB A;  3HK1 A;  2W2A A;  1BSY A;  1CBS A;  1X89 A;  5FAZ A;  3P6G A;  5HCE C;  1BBP A;  3ZW0 B;  3ZZV A;  2FS7 A;  2QO5 A;  4TQ2 A;  5D45 A;  4O4S A;  4QGV A;  4U8U M;  1D3S A;  2ALL X;  2G78 A;  1PEE A;  3BX8 A;  3EM0 A;  4OS8 A;  1LIF A;  1ZNG A;  2FWV A;  3C76 X;  4LZV A;  5AEO A;  4GK9 A;  4HFO A;  5L8I A;  1YWC A;  1B4M A;  2JW1 A;  3WJC A;  1ADL A;  3UEV A;  1EPB A;  2JU7 A;  5HCC C;  3RWX A;  1LKE A;  3NQK A;  5EDB A;  5BVS A;  3NQ3 A;  4AZM A;  4QZT A;  5HZQ A;  4NNS A;  1ICN A;  4OS3 A;  1OBQ A;  1HMR A;  2WQA E;  4ZHG A;  1OEJ A;  5FQ6 E;  4GZV A;  5KIC A;  1A3Y A;  4ZH9 A;  1EPA A;  1LFO A;  1HMS A;  4FGI B;  3UAQ A;  2X8F A;  4HPB A;  4O49 A;  2GTL O;  3F6Z B;  4I3D A;  1OEE A;  4ARH A;  1CRB A;  5LJK A;  3I17 A;  1BEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...