1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
molecule tags Chromosome segregation
source organism Thermotoga maritima
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
4MKVA 1TZ0A 2F9JA 5FLXU 2ZM6F 1EP4B 5CH7B 1S1UA 3AFGA 3CCUS 4IRCA 1RWXB 5EX3A 2JWNA 1KLMA 3PRVA 3GIJA 3DMJA 4CLFA 4UOGA 2EEYA 3OFEA 4OYXA 2F5GA 1MNEA 1VGYA 4WTYA 1S1UB 4M5JA 4DZ6A 2ILYA 3OSPA 4UUXA 4CM2A 4ILRA 1VC6A 1Y9OA 1UP1A 3P4UB 3HF5A 3DMJB 2AYMA 1QUPA 2NS1B 2WVFA 3U1NA 3QRPA 3FJ2A 1WF0A 1X5TA 3ENQA 2XZDB 2IM0A 2ZDPA 1Z2ZA 4OHWA 4DHVA 5E41A 1ZZFA 5J2NA 4J9QA 1T3NA 1VIXA 3BSAA 4HEA9 4WP3A 3RG6A 4W90B 1C0TB 3HXMA 4LF6F 2HNYA 4LVNP 1SQFA 3R7SB 5HJYA 5AJ3F 3N5FA 2IY5B 1TL3B 3EGZA 4ZS6A 2OTLS 2CDQA 2QA1A 2CG8A 1YZ6A 4P74A 2PE8A 4OZNA 1H2UX 5GMEA 4LF5J 3GONA 1PBUA 2PIIA 5AXLA 4OYPA 3D54A 4LRAA 2CJYB 4H4MA 3BH7B 4LJMA 4JI3J 1RLDA 2V8PA 1KQSR 2B5JB 3HHLA 2LYVA 2F8MA 2DTJA 4AXJA 5AXMA 1A7GE 1D9FA 3EVOA 2HVDA 1S9FA 3BSOA 5EWGA 2G1DA 4QWCA 4U7UD 2QA2A 2DNMA 3PY8A 2IYIA 1HD0A 4X66F 5T14A 3RAMA 4B9NA 2FTRA 1T8EA 4JI8J 4ED7A 2HSEB 1VQKS 1TP7A 2V4RA 1U02A 5DDQC 2VASA 1GK8A 1UVNA 4DQIA 2C2OB 3C16A 4DSIA 2D1CA 5E3AA 1GMWD 2LU2A 1VK3A 1MSWD 4QIVA 4N5SA 1NHKL 1VJQA 5E7OB 1YJ9S 4LF8F 3C16B 1RTHB 1TL7A 2R7WA 2EKNA 1URNA 3R5BA 1PJ5A 3LF0A 2VG5A 5GMDA 2RJZA 1TK5A 2HNZB 3DGPA 3MTKA 5KFJA 4MMOA 4OLOA 1TL7B 4GVLA 4WIQA 1SC1B 1VHIA 5KFRA 4DV2F 1VK8A 5DLFA 2DJWA 2O66A 2HW3A 3AOAA 1HQ2A 3MAAA 3DGPB 5D0HA 1KVKA 3AD8C 4GVBA 5BR8J 4DR3J 1X9WA 3GIMA 3U7JA 4Y2MA 5CYQA 2J9DE 5HP1A 5ETOA 2BRLA 2GZOA 1YBAA 3JB9k 1WOOA 1N5VA 5J1NA 4ZKAA 2BACA 4URSA 4O3OA 1ZTWA 3G6YA 2EK1A 5HN0A 1HBOA 2BQUA 4ILLA 2HBQB 2JVRA 4J9SA 2OH2A 2IBOA 3TR5A 1R3NA 5FIIA 3MPDA 4DCOB 4B9SA 1HIYA 2C3YA 4NXNF 1J27A 4ZPDA 1MU2B 1FXDA 3TX0A 4DPUA 3MM7A 1S6OA 1JLAB 4IQXA 2OGUA 2RIJA 2IRXA 1RB0A 4X65F 4AQYJ 3GYGA 4ZITA 1FX4A 3N0VA 3VAKA 2H5EA 2AGPA 5B09A 2E1RA 3THVA 1KBRA 3A1YG 5HBMA 3AXKA 2GO9A 2W01A 1RWVB 4OX7A 1REGX 3MECA 4DG1B 3MM8A 2ATLA 2DT9A 2AZ3A 1JLQA 2IRYA 2DGTA 4GO5X 1QDUB 3GIRA 5KFHA 1S6QA 5HBMB 2UUBJ 3US5A 3Q8SB 1M5HA 4P2FA 2KZZA 2LQ9A 3MECB 1HBNA 2KXHA 1T9YA 1Q5VA 2ZKUA 1JLQB 4WFXA 3OFGA 4HH1A 3MMAA 1LW2A 2MZ1A 2FVSA 4QR2A 3KLEA 1F3VA 1HI0P 1S1TB 3KTQA 4XIUA 1BMQB 1YHQS 4B3MF 1VJWA 2QZ8A 5EUHA 2VDIA 3P3DA 4AFFA 4JI7J 2JJ4D 2IJNA 3MMAB 2P8IA 3M9NB 1U0SA 1R27B 2YKAA 3HVWA 4TU8A 3HKWA 2R3VA 1UW4A 3L3CA 3LW5C 3CCQS 1FJGF 1ITPA 4J9LA 2CNNB 2CZ4A 4QYZJ 4E2FB 3CC7S 1ZS6A 3SQOP 4LVOP 1CBKA 4AL5A 1AROP 2DIUA 3BBFA 4OZ1A 1YJWS 1TMMA 4KYZA 4PUOA 1CS4A 2YKPA 2R8IA 4HR2A 1SC4B 2FVPA 2BJDA 1R8BA 3G6VA 1U1KA 3IM8A 4DV0J 5IOLA 4PPDA 4ECSA 3C8YA 1NJZA 1H7WA 4F2SA 3DRRB 2GV1A 5CHCB 4OYIA 1VISA 3L7PA 3KUHA 3LP0B 3L95X 1SJ1A 3JXOA 4IOAQ 5C42A 3RW7A 3CD5A 1CJUB 1WORA 4B9VA 4D3HA 2X1AA 1TL1B 2HBRB 3PEJA 1VMBA 1WI8A 4WE1A 4IQMA 5C42B 4C7QA 2Q43A 1HI1A 3H4DA 4ZJLA 4ED2A 4CO4A 1TL4A 2GVDB 2ZD1A 5KG5A 3TAMB 3Q2TC 2J0WA 4JV0A 4DPXA 4Z2XA 1WEZA 3SFUA 2PC6A 1XMQJ 3K5LA 4X4NA 1HR0F 2JEIA 3ILIA 2C42A 2FHMA 3NCPA 5ETMA 4RUCA 2A2CA 3QIDA 2RSQA 2CPHA 3VQSA 2ZD1B 1UVJA 1K9MT 2VUGA 2UU9F 1XBWA 1G6BA 5IQQA 1RLCL 2V69A 1YJ7A 4WYWA 3MMCA 5KFUA 1S59A 4KGKA 3GV7B 1T05A 5B7WA 2ROGA 4A8FA 2FJWA 4YS2A 2M3DA 1UZDA 2AEJA 3W65A 5KFQA 3FSIA 3ZZYA 1TFWA 2C22A 4LFCJ 4J7CA 2DEIA 1FTCA 1BQMA 1RISA 2HZCA 1SH3A 2V0NA 4FS1A 3H5XA 1F1BB 1UEUA 2EBEA 3A13A 3IC1A 4F4AA 1CVJA 4C3LA 2LEAA 3VGVA 3TUJC 4TXSA 5I3PA 3SXLA 1BQMB 3OVSA 4CRJA 3W9HA 4DSLA 4NXMJ 4IDKA 5GADI 4Q44A 2H51B 3RB6A 1HWJA 3TW0A 4CYUB 4HYKA 3POTA 1WC5A 1SB6A 3CO0P 1N8RT 1IKVB 3BR9A 5HI7A 3G8SA 4HH0A 3HD2A 3FZBA 1D0EA 1GEHA 1YGYA 2RDIA 3EPIA 5A0YA 3W60A 3Q8YA 1XN9A 1YVFA 4DR2F 4YB7A 3W1YC 4YR3A 2XMWA 3FDSA 4U6PA 2XMTA 3PV8A 3HVTB 5F8HA 3UD5A 3NL0A 3N5BA 3IWNC 1CC8A 2UXDJ 1RA7A 1D8YA 4USJC 3IBPA 1XNRF 1Z1ZA 2W4DA 3KJVA 2PGCA 4KGMA 1RBAA 4YMEA 3LAKA 4RW9B 4WBFA 3DKDA 2YWHA 2RQKA 3KJVB 1RWNB 2MGZB 4FF1A 4WK1A 3MCSA 3UDCA 1D9AA 3GR0A 5D4OA 1J5EJ 1FDAA 5KFPA 3EVMA 2XG8A 3K2YA 2XYPB 4NLXA 5C24A 3BQ0A 1SXLA 3IXQA 5KFBA 1U6FA 3MM9A 1KVIA 1S4EA 5L39A 2CQDA 2W4PA 4ZVEA 1V5IB 1XIQA 3OW2R 2ZZTA 1WHVA 2DXEA 3IFEA 1JLFB 4PWDB 1N54B 5C24B 5B0GA 2VG6A 3MM9B 3GIIA 2XSFA 1IKYA 3BGOP 1ZA2B 4O4GA 3OL8A 5LXRA 4ED3A 4I6AA 5KFKA 1C0UA 2YWGA 3CJKA 4K5SA 3KLGB 3BV8A 4EMDA 3HD1A 1FA0A 3GYXB 1VRTA 2WBMA 4L3KA 1IKYB 4WWSA 5KT4A 3N28A 3DOKA 3K58A 4P52A 3AB4B 2H5IB 2BM0A 2QSFA 5AT1B 2XO7A 4F26A 4TN2A 3RBEA 3DOKB 2CDRB 2I0XA 1SCJB 2V34A 1N48A 3ETOA 1AT1B 2PMHA 3DNCA 4RU9A 2HGNA 3QJPA 4CDIA 1FRHA 3QT7A 1RT1A 3D1OA 2J7KA 2H48B 3A8KA 4K4ZA 4F25A 4JI2J 3IWXA 1XMOJ 3PR5B 4OFZA 1GT8A 2MB0B 1PYTA 4PXCA 3CIZA 3N79A 1RHKB 2MLZA 1RT1B 4DSKA 4RWXA 3E2EA 2RF2A 2V50A 2E7XA 2XLJA 3ICLA 1ZBTA 3W2WB 3T1HF 3OTOJ 2ZHBA 5D4NA 1RACB 2YKMA 1ZOTA 4NZ6A 2ZVIA 2FJVA 2Y8YA 2VFTA 1S99A 1TVRA 2RF2B 1R8CA 1NMEB 4CLLA 3DHXA 1QSYA 1IVZA 2MMYA 4OMFG 1S77D 4MKYA 2YKMB 2ZITA 7FD1A 1TVRB 4QU7A 5GVQA 2HHXA 4EYHB 3FEXB 3CT9A 3ONQA 4QOTA 2LQJA 4D3GA 2FIUA 2XMVA 5F8IA 1RHUB 5KFNA 4DBQA 5J2MA 3FSXA 1XR7A 2A3JA 3GV5B 2XC9A 5LSLA 1A9NB 2VQFJ 3ZZ0A 4IRKA 2ATCB 4YB1P 4J9RA 1WD6A 1EJ7L 4R8UB 2PEBA 2WBRA 3TUIC 1U1QA 2V67A 1S1XB 2HBYB 3PJ9A 4M5MA 3QGGA 1WKJA 3MUMP 5DQIA 1I3OB 3CW2C 4MN4C 3DLKA 4GKJJ 2NPIA 3SQGA 1PYSB 2JDJA 3BH6B 2ZBQA 4UUWA 2C2RA 4KT0C 3CD6S 5J1EA 1RWKB 5JMNA 1MLAA 1VRQC 3ZXWA 1NJWA 4DU7A 5AXNA 2K2PA 2W9CB 1T3OA 3SQGB 2KFYA 5GAEI 2P9CA 3ISZA 2PDAA 4ECVA 1I94J 4WP9A 3JSRA 3HHEA 3JTNA 2R7XA 1X4AA 3B6BA 4F36A 1DHMA 1R8AA 4ENOA 4NEZA 4WZQA 3GCXP 5C25A 5KFIA 1B70B 1T0TV 1L3UA 2B0GA 4IG3B 4ZHRA 1SIZA 3LGHA 3JQKA 4M5DA 1HBMA 2BOPA 2CPFA 3CO9A 3AOCA 3MEEA 3B8HA 2RQMA 3FEYB 2XCAA 3GILA 4ZVPB 4UY85 4WFNQ 5D0EA 4ZHRB 1KEKA 1Z2LA 2RDDA 1LW0B 3G6ES 5T7LA 3TI0A 2EXUA 2HS4A 4LREA 4K4UA 4AD6A 4LF4F 4B02A 5KFOA 1QE1B 1UFWA 4JI5J 3BO2A 4DV1J 3GJSB 1JLGB 2CWXA 4RZRA 3S7RA 5T7LB 3IO1A 1B0TA 1DLOA 3CJRA 3MM5A 4ILMA 4FVCA 1YLXA 1REVA 1Y4ZB 5CCMA 4OI6A 1HNXJ 1QSSA 1GXUA 2ASLA 4P72A 2C3OA 4RKUC 3M6UA 4MIAA 2FD2A 3SV3A 4DQQA 5KFDA 1UMJA 1JXLA 3O6QA 3QAUA 3H2VE 2GNKA 3KK1B 2KFNA 1MWYA 3PHTA 1TTHB 1TUWA 3PEHA 1PIEA 4WU2A 1S97A 4OZ3A 3ITHA 2L08A 1IUJA 4NZ0A 2CYYA 4CLWA 3KLHA 3NKYA 5D4LA 5DQGA 3OTBA 1FCAA 1ZETA 4CQ1A 1IBKF 2W8LA 1U24A 1GMVA 3PM9A 2RB7A 3ITHB 3ENWA 3UFCX 2UVRA 2B8QA 4MYUA 1FWPA 1X4GA 4LF7J 1WC4A 3R27A 1RGVA 3OFHA 4TQRA 1SJ3P 3HCXA 2W9AA 3BN7A 1HI8A 1VQ9S 4IR1A 3OUYA 4M94A 2ZBPA 2IVFB 5A6WA 4Q2MA 3QFWA 1SL2A 4PR6A 1V5VA 4KR0B 1MWQA 2UUTA 5KFWA 4Y2KA 4FF3A 2GJIA 4I69A 2F65A 4NCBA 3QO9A 4YB6A 2HYIB 2ROPA 3R3TA 1M5KC 4DV3F 2W4CA 4IFVA 1SQEA 2XM3A 2BANA 4I0WA 4NLVA 3NNAA 1B7YB 3H8YA 3R1LA 1XJWB 4QYRA 3D67A 4HI2A 5A8RB 2OIHA 3OSNA 4X64F 3A8JA 1B3TA 1YK9A 4ID8A 1RBLA 4IFVB 1EKRA 1EHWA 2XQCA 1S10A 4Y65A 4TNOA 3CMES 4NE9C 4O0IA 3BKFA 3LOUA 1JJCB 3BSNA 1RT2B 3OTCA 2CNOB 1WACA 2DH7A 2AD9A 4NLPA 1IQTA 4FPRA 4P6QA 5B0DA 4FBTA 2FC9A 1JMTA 4ZIWA 2NXEA 1YRXA 2B9WA 2BV3A 3H2UB 4TYBA 3SCIE 3IRXB 2YNFB 4CLKA 3CJ3A 2R7TA 2OSQA 3P6YC 4QWDA 4URGA 4PQAA 2D3OR 1JJ2R 5CYMB 2GO8A 2LU1A 2E1PA 5KT5A 1ICEB 1VQ4S 3D6MB 3EDRB 2HFSA 3SV4A 4DPYA 3THPA 3LP1B 1VI7A 2R2SA 1WSRA 3BGFA 2IYGA 3WX8A 1IJFB 2R7SA 1FEEA 1C4CA 4RU2A 3DCAA 5K5MA 3RBDA 2VPWB 4NX9A 2A0FB 4CO1A 1HBUA 2CQCA 2FQQB 4HT5A 2FJAB 1X4FA 3SZ2A 1NK4A 1OO0B 3FCHA 1IJEB 3ZTRA 1FK9B 3NS7B 4G65A 1C1BB 3IR7B 2JFDA 3V6KA 1VQYA 3PW5A 5DZ7A 2PMWA 1VLYA 5IM0B 1KTQA 4ECWA 4WYLA 4ECZA 4ZOSA 1RHQB 2F4VF 2NZCA 4OYBA 3QNWB 4M5HA 3VVUA 1JLBA 3R1HA 3UN5A 3D0GE 4AL6A 3M2RA 2CVIA 1HNIB 3LWLA 2QFIA 4EWTA 3RAXA 4KH0B 4J5OA 1JLBB 2X3GA 3TVKA 3VZHA 2MQPA 2F40A 4CLPA 3FFIA 1S7IA 3PJWA 4LR8A 1M5OC 2G2YA 3DYAA 2K7KA 3B54A 2IJFA 2YWWA 4DMZA 2MZQA 1LWEB 4ETZA 1K73T 3LPEA 1T7PA 4MK7A 2GVZA 3LWMA 2HVZA 4CCHA 3DYAB 5EDWA 1MN7A 5F8MA 3K7RA 5THWA 4YHHF 2IM3A 4X4SA 3JSMA 1RCOB 1EB0A 3UE2A 1KWMA 2HHQA 1G2EA 1EAYC 2GA7A 4KHPJ 1DQ8A 5HJXA 3NGUA 1CJVA 2VFUA 3PXGa 2MDAA 1NM2A 2HFUA 2IRUA 3JSMB 1TKTA 4EUVA 4DV4J 2CJQA 3QZ7A 2DY9A 1RHRB 3I9ZA 1AFIA 5HSPA 3NG8A 3OPKA 1TKTB 2GIFA 4XK8C 1S7HA 4LR9A 3PW4A 1JNZB 2I8EA 3GE9A 3C6TB 1U09A 1H2VZ 2JNJA 1CPZA 2COLA 1ZPVA 2F8EX 4CTAA 2W1BA 3PTWA 2I38A 3M30B 4PWUA 4EK2A 2CWKA 1X4CA 3MEKA 5E3QA 4KY3A 2GJFA 2IDEA 4TLRA 2JFKA 4CTAB 4ZPVR 4M5GA 3L9ZA 3OL6A 3SSRA 2HQIA 1YKWA 2NYHA 2ZH8A 3SCLE 4TU9A 2AGQA 4I1TA 1SBRA 3M8QB 3LH2S 5IZHA 3TEGA 1U7LA 3CJ0A 2VL1A 1N0UA 1FESA 3CNQP 3Q8PB 1RQ0A 2ZOFA 3IG1A 4Z37A 3T5LA 2R8HA 4DL6A 4JI6J 4ZN3A 4WCEQ 3Q24A 3QLHB 1GTHA 5IT9Y 3D6FB 2R4FA 1RUSA 3G2XA 3M6XA 4WTOB 1FDNA 2MZRA 2ZJRQ 5DDPC 2B6AA 3VQTA 4LF5F 4NPOA 2M4MA 3NBPA 2NUHA 5L9XA 4XDDA 2RQCA 2EC2A 2HFNA 2LVWA 3D9BA 4JI3F 4DCJB 4DX8H 1S49A 4MKAA 1U2CA 2B6AB 3IGNA 4ZA1A 5T41A 3NBPB 3TO8A 1AUDA 1F6TA 5KFZA 4UW2A 4Q7AA 1U1PA 2QYGA 2POKA 4H4KC 2MLXA 3NCRA 2CADA 1FF2A 3C15B 3X3UA 2MQMA 2XI2A 1EKSA 1J5OA 1IWAA 5IFMA 1RADB 4JI8F 5KFXA 4DR6F 5HROB 3OVBA 1NPRA 3FK4A 2DH8A 3CSKA 1KHWA 3DRSA 2CQBA 3B78A 1WF2A 1CJTA 2U2FA 5F8GA 3I0RA 1J5OB 1SV5A 1RAOA 1TAQA 3UDVA 4NWBA 3G6XA 1GAOA 5LJ3Y 2VA2A 2HRYA 2CIMA 1JLEB 1S72S 5F3TA 2Y0BB 1GNKA 3O3LA 2Y1RI 2VB6A 3W61A 2XMMA 1M0SA 1NZ8A 3KHLA 4A8WA 2ZDOA 4NRTA 1YJVA 2EK6A 1C4AA 1H98A 3HZGA 2YXLA 1MWZA 1R0BG 4KE5A 4LRBA 4OHYA 1T9XA 3AJ2A 3G4SS 5E3PA 1KFSA 1B4SA 2H1YA 3UD4P 1KQGB 4KH1B 1OYDA 4M5NA 5KFMA 2FJDB 4DLGA 3BBBA 2RQ4A 5HVHA 4FYWB 2KL8A 4DR3F 1N36J 3TWZA 4OZ0A 5L1JA 2VZ9A 1WKLA 3Q22A 3TA2A 1NH7A 3NGSA 2UVVA 5JVHQ 2Y9HA 1L3TA 4NZ7A 1EIYB 3QT6A 3H5UA 3T6BA 4BS2A 2N7CA 3C66A 1T9WA 3TA0A 1UCNA 3TAQA 4CLUA 4WIIA 5HQ8A 1AZSB 1BD6A 1CEZA 4J9VA 2F8HA 2CJAA 3NWGA 4F3MA 2WK4A 1S0NA 4KAIA 1RI7A 3HT3A 2PFDA 1FJCA 2HHTA 2WSFC 1HWIA 2BKOA 1EZZB 1EQ0A 2DNKA 3D3CJ 3QT8A 4AQYF 2ZNZA 3DOLB 1PC4A 1CULB 3NS5A 3DDKA 1RTIA 4F2RA 2C2NA 1FVSA 2X1GA 3D28A 5KG4A 2B4UA 1ZZNA 4F8RA 4ZVUB 1P9YA 5L9NA 4ED4A 2CNLB 4KO0B 5CAAA 4ECXA 4BBYA 2DNZA 1RTIB 4I56A 1IN0A 3T5JA 1RT3B 1IBMJ 3BDPA 5D0GA 3MR3A 2UUBF 2HZAA 3CCSS 1NO8A 2B7CB 4DV5J 1ZYQA 3GIKA 3FRYA 4RUHA 2IMOA 3KKFA 1TKZA 2V4JA 2YX4A 5F8LA 2QRRA 5HLFA 2OPSA 1DTTB 4K8RA 4RR5A 2FHJD 4U9RA 3DM2A 2FZKB 1IQZA 1VQLS 1TUGB 4C6AA 4HACA 1SJQA 2CZ9A 3LGMA 4DN9A 2C2DA 2FLOA 5HLFB 4MK8A 1IKXA 2MKJA 3TZWA 3TVZA 1ZH5A 2YQ1A 5LL6d 3WIVA 4HHHA 2OEMA 3C6UA 1UJ4A 3G87A 3EUNA 4CP5A 3DDIA 4NLWA 1NU4A 1N33J 3OHBA 3Q2SC 1FD2A 2KYZA 3CCLS 4OZJA 3HFKA 4ERDA 2E5GA 3C6UB 3B4MA 1XERA 3PO5A 2JH3A 2HFZA 3ZZTA 4DSFA 4Q2LA 5C5JA 3Q86A 1NRKA 2CVEA 1JKHA 1RWUA 4JB8B 2KN4A 4KGVB 5EWFA 4NA3A 4DV0F 2CQ4A 3MEDA 2UUCJ 2MYFA 2J6SA 1JLCA 1VC5A 1WHWA 4IO1A 4DFKA 2KJVA 4WP8A 2UV8A 2CKWA 3WBZA 5RUBA 1YG0A 3PDNA 2CRLA 5FD1A 2YWKA 4X62J 2OELA 3DOMA 4YEAA 2YNGA 4C0OC 3BM7A 2XZTB 3VR1A 2DHGA 4FXVA 4HI1A 4Y0FA 3BYRA 3RUBL 2DR6A 2GIRA 4U7UK 1KRPA 1XMQF 3BPDA 2YNGB 2DK2A 1Q79A 5LT5A 1QVGR 1YDLA 4QIFA 2HZVA 3HSGA 3LQVA 5IWAJ 4P73A 4P7TA 3PIPQ 1HHTP 2NPFA 2KM8C 2ZH4A 5IT9U 4QCLA 5D77A 3K8VA 3H40A 1FWKA 4JP8A 3TVYA 2OAUA 4F3QA 2OFHX 3J7Z5 3UN3A 4NL5A 2O1PA 2OHDA 1AXQA 5FDLA 4F0MA 1D9DA 2Z2LA 3U02A 2ZC3A 2DR5A 2CQ0A 3CULA 1A0OB 2DNHA 4TQSA 1BQXA 1X5OA 2RVJA 1HQEB 1TKXA 4DPWA 5B0EA 1X4EA 1D8ZA 1HYSA 4LFCF 2K1RB 3QSIA 4IUFA 4O3QA 5H9FK 1TAUA 2HMIA 3CPWR 1X8DA 1H2TZ 3KK2A 3M32B 3D4JA 3A8IA 2XO6A 2Q79A 2UV8G 3ILJA 1HYSB 2RUGA 1R6VA 3EJMA 1ZAXA 3RR8A 3BGLA 4LQ9A 3F73A 1R89A 3K59A 2W2OP 2HMIB 1O5JA 2H54B 4QWBA 4NXMF 5A2QY 1RWWB 4ED8A 1U1MA 2QMWA 3KLFB 4ZPWR 2BW7A 3CVKA 2QE5A 3TP2A 3MR2A 4ZVSB 3TZYA 3N01A 2C28A 3CD7A 3VAJA 5DETA 1BGXT 2V94A 4HLBA 4IO9Q 1VCTA 3AJ1A 1HNWF 1ACMB 2HEKA 2Q3PA 3TEHB 4LSZB 4OZ2A 1Q1KA 2UXDF 3MF5A 4OJGA 1MMNA 5KFLA 4USUA 3UR0A 4K4YA 4FKYA 1PJ7A 3DHWC 3LAMA 4RW4A 1Q8KA 2VG7A 1YITS 1WELA 2UVWA 1RT7A 4V19J 2QLJB 1X9SA 4QR0A 1NZAA 4WZMA 4RNFA 4X4TA 3I96A 2EPIA 4RW4B 3MR6A 1RT7B 3I31A 2CQ1A 2JL9A 2QLWA 3HKZD 2HK3A 2OMLA 3FNNA 3I32A 1RK8A 1S79A 4DFPA 1NSKL 1F2GA 2HRUA 1S9EA 1J5EF 5L1IA 2GAHC 4RW8B 3WC2A 3D6HB 2JZ5A 4YR0A 4PWWA 2VH7A 5IV4A 3IM9A 3UR3C 4ZVQB 3PFEA 2YNHA 3UNGC 2C3PA 3ZZUA 3D1HA 3IRWP 4ES1A 3BSCA 3PIOQ 3UQSA 2BEFA 1S6UA 4IKAA 3W8PA 2V8HA 2AEMA 4QZVB 3PYDA 4LFBJ 3MUTP 3I4HX 4NCGB 1WG5A 2WB4A 4R0EA 2WSCC 2HK2A 2YNHB 4ZP6A 3U1MA 2ASYA 3A3OB 4TYAA 3V81B 2OLWA 4USHA 1H73A 4ED5A 3V4MA 1X60A 1RT6A 3CCZA 2GCFA 1HNVA 5DGBA 3VGSA 2E44A 1N5QA 2OPPB 1N5TA 4RJVA 2LEBA 4FS2A 4IG0B 1X4DA 5K20B 1WNEA 4I2QA 4ZVRB 4NA1A 5C2GA 4C8MA 1L3VA 3CJ4A 3VALA 4L6V3 3CJ2A 1J2VA 2CNKB 4B3OB 1V6HA 5HQMA 3KJFB 5GADU 2GQQA 3KG1A 4I2QB 3IS9A 1SQGA 5HVGA 4LSNA 2FHKA 4NLTA 5AE3A 3HZEA 3P45B 4JI2F 1XMOF 3FQKA 3FZ2A 4IOBA 3V5RA 1C2PA 4DX6A 4OX9J 4AXIA 4LSNB 1TKDA 2DNLA 5F0WA 3KWMA 3FBFA 1VS3A 3IWLA 3KDOA 2W9BB 3MCMA 1RWOB 2VPYB 2R7RA 3OTOF 4N76A 2H4YB 1SKWA 1HW8A 3QPIA 2I5JA 2O67A 3RRHA 2XY7A 3HHNB 2Q6CA 2LXUA 1UPMB 3MUVP 3MM6A 4QW8A 2O3DA 3OQ2A 3HHKA 4CO2A 3H25A 3M8PB 4ETXA 2XGPA 3O2IA 1XK8A 4X4OA 4RL1A 4DU8A 1PSDA 4HTJA 1T95A 2RRAA 4QPXA 2VODA 2ZE2A 1V3ZA 5A8WA 4ICLA 3QJJA 1SKUB 3SI8A 4DWIA 4O3PA 2HNDB 1JIHA 2VFRA 2G13A 2B4OA 3EICA 2G1HA 2VQFF 3TJ8A 3GR1A 2ZE2B 4YY3J 2G2ZA 3HLUA 3CF5Q 2ACYA 3M6VA 1PCAA 3V6JA 4ZVHA 2K7JA 4ZVGA 1EETA 4A8KA 3V6DB 4DQSA 4XPEA 4PQUA 1OY8A 5IXUA 2VBZA 3LANA 4GKJF 4C9DA 2DGQA 2V2KA 2HGMA 2YKNB 1VBXA 1NXIA 2NQPA 1LWFA 4JV5J 4LRFA 2YNIA 4FVMA 4Q45A 1EETB 1N88A 2OEKA 4JI0J 3TYTA 4Y00A 4WJBA 2LQ8A 4N7TA 2LQBA 5KT3A 2ZWPA 2J7WA 1AFJA 1G3OA 3HULA 2RUSA 2V63A 1LWCA 3UDEA 4H54A 5B0AA 1I94F 1U26A 2Y1JA 3EGNA 1RBOB 4RW7B 2PT0A 4QQBA 2ZH5A 2BMBA 1LWCB 2DKOB 2U1AA 1B64A 4Y34A 5FJ4A 3FBCA 3CCMS 1QD1A 1KHVA 2I1RA 2MEWA 3ZTOA 5LM7E 4OI3A 1O6XA 3WQPA 3O5TB 1KNZA 5D3GA 5A2QU 2L41A 1SL1A 4RUAA 3J7A1 3HSJA 2FJEB 2G2OA 3R7NB 3I56S 5SUHA 4ECUA 1BE4A 2BJEA 1KLMB 1NDKA 4I4BA 2HVIA 2MJUA 2NYIA 1FE0A 2LMIA 5EGYA 2IVYA 1FRMA 3ZFVA 1S0VA 5KFGA 3BB5A 4BHQA 4JI5F 4B08A 4DV1F 4Q43A 1Y3JA 4IH7A 2WCXA 4FF4A 4TY8A 3WDOA 1N0VC 2M5YA 3KLIA 3CDAA 4OLPA 3HP6A 2VC0A 1HNXF 4NMLA 1RTJA 1FI4A 5J2NB 4I67A 3OTEA 3F44A 2HURA 4TY8B 4C8YA 1XEZA 3KLIB 2HNYB 2MKHA 2M88A 1IWGA 3GFYA 3Q8VA 4UZBA 1H72C 3OV7A 5EX0A 1UWBA 1RTJB 4ID5A 3C3LA 4BC7A 4C4WA 1Y7PA 2YH1A 2E7WA 3CCES 5ETQA 3RJMB 1UL3A 4WF9Q 3QAEA 1LV5A 1UJ6A 1DJ0A 1UWBB 3FBEA 4ID5B 2VC1A 1NK6A 4PCQA 2QV6A 2M70A 4H4MB 2N82B 3OT9A 1HHSA 4G1QA 1WHXA 2AYEA 5G4DA 4LF7F 3HHLB 2R2UA 2VJUA 1VQNS 2QMXA 3TX8A 2KO1A 3P5TL 5AXKA 1Q7LB 3LP2A 2AWZA 3WC0A 4ZN1A 1OJ4A 4DR6J 4G1QB 3SBMA 1WTBA 4JV2A 3SCJE 4KFBA 2BUNA 2QGFB 3OJSA 2ZVSA 3IBFB 5I3UA 4CZCA 4A48A 3ELHA 3J81Y 3BZQA 1OY9A 3VV2B 2ZFHA 4JI1J 2XWYA 3JQMA 4MKBA 1I5OB 5GAEU 4KFBB 3BQ1A 5I3UB 4FKXA 3RB0A 3IBWA 3MMBA 2QA4S 2QFJA 4WFZA 5LMNF 2H65B 4X4UA 3AH6A 2DGUA 4CO3A 2E66A 4C8LA 3EDQB 3CWJA 2DNOA 3BO3A 3TUPA 5D78A 2ZOGA 4ZK7M 2GIQA 1B0VA 2YQ3A 4FBUA 2VG5B 2CQ3A 1XR6A 2MQLA 4GO7X 1RP5A 1I51B 3BBCA 2JVOA 4KGZB 4I6YA 1RAGB 4LSLA 4USKA 1M1HA 3PFOA 1N56A 4J9MA 4A8QA 2F63A 5KT6A 3KK3A 1RCXB 2ZEJA 4BC9A 3K5OA 1FJ7A 4RUBA 3MAAB 3PYFA 2YKQA 4N56A 4GVBB 2FLNA 2H5JB 4ELVA 1NK5A 4GMKA 3UVJA 1YTYA 4P71A 5L46A 4QU6A 2W8KA 1S57A 2J0QD 4RBVA 5CYQB 2OMOA 2DD8S 5HP1B 2Z56B 4W4MA 3H90A 2MKCA 1RTZA 1KTVA 4LRDA 2HVHA 4KGXB 3IR6B 1FERA 2ZBRA 4Q5VA 5D15A 2CPZA 1HBOB 2W2NP 4B9MA 1W7WA 1D3WA 3UDLA 3PX0A 2RRBA 6AT1B 4XPCA 3UCGA 3UNYA 1GQEA 2PI4A 1R0AA 2NCKL 5CXTA 4C0BA 4AT1B 4LF1A 3MM7B 2KT3A 1KFDA 2HVEA 1K1QA 5HL7Q 1RTDA 3K17A 1UVMA 1F5CA 3EWGA 3WX4A 3GLJA 4PXEA 3M8SA 2MQOA 3C19A 3ISNC 2J9EA 4PXDA 2OJ3A 2SXLA 4K4VA 4UOHA 3M8WA 3MM8B 2B4PA 1BQNA 4CH1A 3BEGB 3KHHA 3ISND 3AAWB 2MXYA 1S6QB 2JRSA 4DJBA 2E1AA 1FNMA 2ZH1A 3NRBA 2W7PA 1HBNB 3CE8A 3G82A 3DLEA 1BQNB 1VQ7S 4N41A 1KR4A 5AE2A 1C1CA 1LW2B 3VCDA 2PO4A 2VPXB 3KLEB 4OI0A 3A3PB 2N7YA 2NXNA 2MQ8A 3GG1A 5K8OA 1R43A 4DSEA 2ZJQQ 4O3SA 4UOFA 1NNDA 4I6WA 4KHPF 3SMZA 4CT8A 3OLBA 4F02A 4URQU 4NLDA 2M0GB 4C11A 3Q8RB 1FRLA 3WIUA 4HL9A 4DV4F 2J76E 2Q6BA 2ZBIA 3W62A 1T94A 1Q7YT 4LF2A 1VBKA 3GMGA 1VQ5S 3W66A 2DHXA 4PUOB 2A6MA 1CS4B 2ZWOA 4HKQA 2MQNA 2Z57B 3KHGA 1WUUA 4NCAA 4NI2A 4L76A 5J1PA 1FKOA 1PAUB 3M05A 1X4HA 1NK0A 5KFAA 3I5AA 1UWAA 4L75A 4MTPA 2OKQA 4NI2B 1BUXA 3GG0A 4MJKA 2M7SA 2XMUA 2N3LA 1FKOB 2XNQA 2DXFA 2EFNA 3CJQA 3KMQA 2R2TA 2R7QA 2AGOA 2JOQA 4ZPTR 3DXSX 2RHSB 2G9OA 2OD6A 2B9XA 2IA6A 4I2PA 4KPYA 3E51A 5D6GA 3VGUA 4WE1B 4QPTA 2KT2A 1HKAA 4UOCA 3PW0A 1S9GA 1RU1A 5K8NA 3RTVA 5DM6Q 3MDFA 1F9FA 3CXCR 1KQKA 3K5MA 3NP5A 4JI6F 4EO6A 3EZ5A 5JVGQ 1KOOA 2V5HG 3PJXA 4LR7A 1UAWA 2RKIA 5AE1A 2X1BA 1FE4A 1MROA 5KG0A 4DL3A 1LOUA 3VAGA 3MMCB 4NA2A 2N4CA 2RKIB 2D7SA 1T05B 1TL5A 1W2BR 2A6OA 1S0MA 9ATCB 2Z2YB 1Y3KA 1AB8A 2LDYA 1WC3A 4FDFA 2NR0A 4C3MA 3PACA 2WONA 2MZJA 4Z7YA 2UP1A 4ECRA 2FC8A 4K4WA 2W25A 2ALYB 3QJLA 1NSPA 4B3SJ 3J81U 3FSYA 3I0SA 4PEOA 2FB0A 5LSOA 1ZA1B 2WONB 4ZCIA 4O44A 2HQFA 1PAEX 3CCWA 4IDKB 3Q0AA 1SVDA 1UEVA 1S12A 1Q82T 3R2DJ 4DZDA 1HFEL 5KOXA 3AQOA 5L1LA 2E5LJ 4CO5A 3POTB 4O44B 1HNWJ 2FHJA 2FDNA 3H0PA 3R5AA 5A0YB 3Q89A 4TVAB 4DF4A 2WSEC 4M8LA 4F67A 4WFAQ 2VQEF 3QQCD 3I82A 3EGVA 1F0XA 2HBZB 3V4IA 3W7BA 4H4OA 1Q78A 2Y3YA 3W63A 5KAKA 5K9FA 3OXFA 2XHCA 2D74B 4J9UE 1DQAA 5DLGA 3GWCA 4DXLA 5A8KA 4ZVFA 4QIEA 2QLXA 1N36F 3U27A 3OVAA 3P49B 1M5SA 2DGSA 4F4YA 2KJWA 2CAJA 5I42A 2RILA 4IR9A 5G0RA 5A6PA 1VFJA 5A8KB 4PYDA 1NBEB 2CQGA 3DU6A 1RXOB 3G8TA 3LTOA 2AV5A 4OJ1A 3N6MA 2Z4PA 4USMA 4ZLJA 2F1FA 2WVCA 2ABYA 3IA0A 4CLYA 4S0MA 4DPTA 1Q95G 2WAQD 4V19X 3AHPA 3PW7A 2IHR1 4K2XA 4F4WA 4YN3B 3FCWA 2BKNA 1RE1B 2DY1A 2DR7A 2KHDA 5CABA 2D9PA 3BKUA 3S8SA 2B9YA 1LXNA 2DPIA 1OPZA 4K4XA 2QO3A 1WKKA 3R8YA 3AQPA 2QLBB 3CDBA 3ZC4A 2NSBA 3KJNB 3GB0A 2ZHOA 1PJ6A 1RKJA 1RAEB 4NMXA 2VG6B 2BE2A 1IBMF 4UT4A 3RGIA 3CMQA 2VBXA 1KSPA 1U1RA 4B9UA 4O4GB 2IAJA 3GP9A 4DV5F 1ROFA 1C0UB 3CJKB 4DR1J 5J2PA 1N5YA 3S01A 2QT7A 1VRTB 3MTJA 2HAFA 1U1NA 1NJXA 1P1TA 1QAYA 2M9KA 5J2PB 3N6LA 4P9SA 4Y6IA 4IRDA 4C48A 3GTYX 4ELTA 2KH9A 3AT1B 2OPQA 2RAQA 4ZCKA 1KD1T 2X7IA 2C2KB 4C0HA 2CJ9A 1HLWA 2UVUA 1RWMB 3TZZA 4KJIA 1WC1A 2J6TA 1N33F 1TQLA 1MN9A 1U6BA 2APOA 3T1AA 3GZ7A 5KG7A 2HKEA 4JYAJ 1SUQA 5CZVA 1U8WA 2FGCA 2HWIA 3NS6A 4MIWA 3CC4S 1H74A 3VAMA 1DY3A 5IV3A 1SUQB 4NLRA 2FVCA 2EFGA 3GFZA 5KFSA 2UUCF 5ETVA 2AU0A 2ZH3A 4OZ5A 4K7QA 3DLGA 4A8YA 1P27B 1L3KA 4OX8A 2GC8A 2CJBA 1VRUA 2PN6A 5KFTA 2YH0A 1K1SA 3DLGB 1NPKA 1YIJS 1TK8A 2J0XA 4X62F 3HJVA 2HHHJ 3T19A 3O44A 3I6PA 3M9MB 1P1LA 5HAOA 2BDPA 5J2MB 2J7UA 3QGHA 2D3UA 1S76D 1IBLJ 3HFZB 1S1VA 4IYQA 1VR6A 2LFVA 4JUZA 3NNCA 1EP4A 3SYZA 4YDXA 4A8MP 1SPBP 5IWAF 3OXGA 1NCLA 2BVZA 3TJAA 1S1VB 3HVAA 2RDJA 3KOAA 1FEHA 1QAJA 2JX2A 2XMJA 3DLKB 1LK5A 3GYNA 2GQCA 4OYZA 4K50A 2NXCA 5IT0A 1FO1A 2XHWA 5J1EB 4FPIA 4C8NA 1RAJA 2FZCB 3KNGA 3C46A 1S5ZA 5HVFA 2AJFE 2YPYA 4ZPBA 5IQ6A 1H6KX 4WFYA 3MZIA 3QBCA 4DFMA 2X3DA 3Q23A 3D3BJ 1EQMA 4ZCLA 1VQMS 3CUNA 1C0TA 5D8HB 1U1LA 1NKEA 1APSA 1R6YA 5GMKa 1FRXA 1WDTA 2MHEA 2VBYA 3CDUA 1TL3A 2V6AA 5C25B 4FF2A 2Y1LB 4NYPA 3J81j 4M1KA 4PYAA 1SH0A 3MPUB 3HX9A 2Q1LA 3NOCA 1BXNA 4M5DB 2K3IA 2BE7D 1HBMB 3ZTSA 8RUCA 3MEEB 5E5NA 1GX6A 3BKTA 3EE3A 4DLEA 2R7VA 3W5YA 3IR5B 2EBGA 5ETTA 4R5PA 2B5JA 1F2HA 1WJ9A 1R0CB 4AYBD 1VLOA 2CPIA 4DR5J 2AX0A 1NH8A 2BA9A 1ULRA 4OHVA 3F0NA 1JWWA 4UY8T 7AT1B 2AJQA 2MKSA 1UFLA 1LK7A 4R5PB 2R8KA 2ROEA 4ZJQA 3HHDA 4LQ3A 1DLOB 4B9LA 3MM5B 2YTCA 1REVB 4I7FA 4QBUA 4ZLNA 2G0CA 3L4BC 5IC6B 4RWWA 2CQPA 2G4BA 4F7VA 4DL2A 3JTOA 3H4BA 2UXCJ 4I7FB 3BREA 5GAGI 5KG3A 2Y8WA 4F04B 1Y10A 1FJEB 4N47A 5K8MA 1RTHA 2VKRA 3MPYA 1X0FA 3PCOB 5DO2A 4K5RA 3KLHB 2NXJA 5H9EJ 2HNZA 2DNGA 4CLTA 4A8SA 3NGKA 5LJ5Y 3DLBA 4G6VB 2J9DA 4GKKJ 3GSIA 5DG9A 3HMJG 4CO0A 2K8GA 2W7AA 3D2WA 5M2PA 4TY9A 3TAPA 2R7UA 3OUYB 1CJKA 4LFBF 2MTLA 4DUYJ 3RZAA 2G0JA 2JHEA 4WXOA 2ACMA 3LGNA 2FVQA 2OI2A 3DLHA 2BJ3A 3QO9B 5LMNJ 1UW9A 1CJKB 1DFDA 2BJ1A 2BANB 2YY3A 5C7PA 1XNQJ 2GHVC 2YQ0A 2DNPA 3M9OB 3KDNA 1NJYA 1BY9A 4MAKA 1LQ9A 5J2QA 2AMCB 1RAFB 2KXNB 3TARA 4CNYA 2CFXA 5CD4A 1BLUA 2XCPA 1MU2A 1PILA 1RAAB 5ETSA 4PKDB 2CQ2A 4E0DA 1JLAA 1VQ6S 3CIMA 3QATA 5J2QB 2HS0A 5CQGA 3R7BB 5H9EK 4X4QA 1S48A 2E9ZA 2CPYA 3F41A 2V4QA 2IMWP 2C3UA 3EVWA 3IGVA 3CDWA 3ENAA 2RD5C 3VTIA 1PGZA 1U1OA 4CLZA 3SFGA 4DG1A 4B3RJ 3MFIA 4ANCA 2OP5A 1HA1A 5KFFA 1QTNB 2UUAJ 3OFFA 2ALZA 4KHMA 4OX9F 2XMAA 4LFAJ 2JLGA 2KB2A 4FYVB 4ED0A 1FFGB 1VBZA 3KFWX 2VOPA 4C98A 7FDRA 3KXDA 3QWUA 1RT4A 3TANA 3BJYA 3Q83A 1UPPA 1ZAVA 4DR4F 2CJXB 3AODA 1HBUB 1S1TA 3Q8UA 3TRGA 1YJUA 1KLNA 1RT4B 1T11A 3AB2B 4PXBA 3RR7A 2HQGA 2QC3A 2V9KA 2QL9B 4KRWA 5HO4A 3R9LA 2CZVC 4PG8A 2AF6A 2CQIA 1XMBA 3FEZA 1PG5B 4C8ZA 3CJ8A 3K89A 2WTFA 2DHHA 2JC1A 2BR0A 5BXIA 3G96A 2FY8A 2QYCA 1VYAA 1NUEA 3CDEA 2EFPA 3BR8A 3VVTA 3WHIA 1SKRA 3M2RB 3ET6A 1NB2A 4OJ3A 4YY3F 2QIFA 3EZUA 1CLFA 1LNQA 2E9TA 2V2VA 4O0NA 2HIQA 3FFIB 3DI6A 2AQ4A 4KSEB 3ET6B 3GU0A 4LBHA 3DRRA 3CEDA 2V2ZA 3J80Y 2VHGA 4HDGA 2MKKA 3LP0A 2O5DA 4JV5F 4DV6F 5E3RA 4YFUA 3HFVA 3DI6B 2GVZB 1Z4UA 5CD4H 5DG8A 2E5HA 2ADCA 4JI0F 1ZAWA 1CJUA 1QM9A 3QFHA 1QY7A 1PYOB 2BJ7A 1TL1A 1NAQA 4ED1A 4GC6A 2BQRA 1Q8LA 3UN2A 4MH8A 4YOEA 4NLQA 1CJVB 4IFYA 2GVDA 2W2QP 3TAMA 1TUVA 2DRAA 1XQIA 3GFXA 2Z0GA 2UXBJ 3M8ZA 4C2MA 4IFYB 2KRRA 4JI4J 4QYZK 2HHPA 3MCOA 1GMWA 2PEHA 1A6LA 3ZO7A 3CTRA 2BZ2A 2LXFA 3RBXA 1JQGA 3DU5A 2QN6B 3G71S 1XC9A 3KYLA 4WPAA 4DS4A 4ES3A 1HWUA 4BCAA 4XO0A 2JEJA 3PO4A 2VICA 1U4BA 2LA6A 3W64A 4F50A 3CJSA 3VHQA 3CC2S 4DR7J 3PW2A 3O1LA 2Z2MA 4JBCA 1KQFB 2XS2A 2EFQA 4A8OA 2ZJPQ 2MLYA 4EBDA 1M1KT 2D9OA 1WC6A 4LF9J 4OYAA 3R97A 4OL8A 1WTFA 2LCWA 2F9DA 4FZVA 3TQEA 2DGVA 4YDDB 3DLJA 4UZCA 3HJFA 1FDBA 3PYGA 3W5ZA 2DIVA 2LP4A 1HNZJ 2YPZA 5E33A 3IG1B 3D5MA 2B43A 3PHEA 4CYUA 2XS5A 4X4PA 2G0IA 4TU7A 3PG9A 2AYBA 1IKVA 1JB0C 3ZNUA 2AW0A 4CNZA 2MY7A 3T41A 1K44A 4QW9A 4K4TA 3JQJA 2XGQA 5GAHU 1YSJA 2ZNYA 2EFVA 3HVTA 3DLLQ 2MSSA 2V68A 1UVLA 4F4XA 4P2XA 2DHAA 1QAXA 1M90T 1SC6A 1I6JA 1RA6A 3EGWB 4IH6A 3ZZOA 1MMDA 1N34J 5LMUJ 1OMSA 1KDNA 4C97A 3VZIA 2IBKA 2KHCA 2HHSA 2FUG9 2VONA 1VQSA 1DURA 1E6VA 4RW9A 2MKIA 1IR1A 3MD3A 3ZTPA 2KVIA 4JI1F 1TMJA 3OD2A 4K0KJ 3MAHA 3G86A 1R7IA 3M6WA 2O01C 3I4PA 1SJ4P 2MGZA 3BQ2A 2J9CA 3DRSB 1CJTB 2PFFB 1E6VB 3I0RB 2GJ2A 1SV5B 1FKAF 1SJRA 2LDIA 3MPWA 4WXWA 4EGLA 1VQPS 3JYTA 2VQEJ 3U1LA 4DUZJ 2OPRA 3S6EA 4FNHA 1OSCA 3D1QA 3FC9A 3ILOA 1WF1A 2YWEA 1Q53A 2LXIA 3OJUA 4UF4A 3M4XA 3E3XA 4CI0B 5CA5A 4DI6A 4ECQA 1UETA 3JYTB 1ZM4A 1K0VA 4BWJA 2OPRB 4LRCA 3VWSA 2HHUA 3AD7C 3RAQA 2DRDA 4PWDA 1JLFA 2E9RX 3OTDA 3NY0A 2WMMA 1YZ7A 4BWMA 4U7CA 1EX8A 4DOZA 3T9NA 1KONA 2XNRA 1YBUA 2VU5A 3UCZP 3PRBA 3KLGA 3NGDA 4DL0C 3PKYA 4EYIB 1DZ5A 2C1EB 1CSJA 6FD1A 4W92B 4Y28C 2L3MA 1ZM2A 5ETLA 2BX6A 1NKCA 3J7YI 3KHRA 4JV1A 3ZZPA 2D41A 3RW6A 1NB7A 1Y11A 2L9WA 2V9WA 4X2BA 1KKHA 2QMUB 1IR2A 1VBYA 2CPXA 4Q8FA 2F4FA 3HO1A 1U49A 3UPFA 2EW9A 3W8GA 3QIPA 1NLKL 1JK9B 3BF4A 2LEPA 3UW1A 3K57A 4EBEA 2FGOA 2ZHAA 1LFWA 2K3KA 1GTEA 3RRGA 1RAHB 5K8PA 2AJ0A 3QIPB 1AYEA 3J7AN 3MOZA 4OHZA 4J37A 4CIOA 3PZPA 1FD8A 1HARA 1NSQA 1TK0A 1K0TA 1QLNA 3IMQJ 3K5NA 1OYEA 3W2WA 4M5LA 3BGUA 3MPVA 3NXZA 3UI3A 2GAGC 4K59A 2VPZB 3NWRA 2KT5A 3D7SB 1TKZB 2V4JB 1AW0A 2Z2ZA 2JSXA 2DBBA 3J80U 3EYZA 4V1Ak 4F4ZA 2B4VA 2OPSB 1B7FA 3DM2B 5F8NA 4YB5A 1DARA 4RLEA 3T1YJ 3K0JA 2RU3A 2F3JA 4F0HA 2FVRA 4M5KA 1YQHA 1FHTA 4HACB 4X4VA 2VV5A 1H38A 4DX7A 5EN1A 1RHMB 4L74A 1N32J 1IKXB 2BRKA 4EU0A 1UZHA 1U47A 1Q8BA 2IM1A 4DV7J 4B3TJ 3QSYB 1X5SA 4RNOA 3D6TB 4R8UA 5DGAA 1VC0A 2DVIA 3G8QA 3OL7A 4K4SA 1TV6A 2R2RA 1S1XA 1QSLA 3NOGA 3VGTA 4QJVA 2VIHA 2ZH7A 4PG6A 4FYYB 5B0BA 2CUYA 3UO0A 4DL7A 4DUTA 3G9CA 1JKHB 1TV6B 2XYHB 2HFVA 2VF3A 3MEDB 1JLCB 3JSYA 2W9CA 4R0JA 4E98A 2BJ9A 2BQ3A 5H9FJ 1NPPA 3MR7A 2JLEA 2NXUA 2DHSA 4YP3A 2WVEA 1D1UA 3D0IE 3CB4A 3DOMB 1ZPWX 2DCLA 3R6GB 4W98A 5C2CA 3C2PA 2QG9B 2QX0A 4B17A 4IG3A 5HMWA 4DS5A 4KB7A 2DCUB 2B51A 3MEGA 1JX4A 4LBIA 1XR5A 2ZM6J 5KFCA 1WHYA 2EVZA 1KN6A 5CCLA 1FRKA 1K8AT 4F3OA 3W9JA 1AUSL 4NASA 4KHRA 2HWHA 1LW0A 2XULA 4OQJA 5M2RA 3MEGB 4EZ6A 2DXDA 4MK9A 4ZPAA 4P10A 1UA0A 1RHJB 2RNEA 4CM0A 1QE1A 5FDLB 1RSCA 1JLGA 2LQ5A 2D3O1 4LIRA 5F8JA 2RS2A 4Q8EA 4ER8A 5BYQA 3O8WA 5M2UA 3J7ZT 1UKUA 2YKOA 1RABB 2LECA 2FLPA 1TKXB 1SJFA 5F9LA 3R5CA 2KU7A 4ZIVA 1JXEA 3N9UC 4LF6J 3QWPA 3KK2B 4CH0S 3KK1A 5AJ3J 1UEKA 2FPHX 1NJIT 4B3SF 3MMJA 1H3DA 2ZKTA 3ZZRA 1F5AA 4ZMMA 1S0OA 2WW4A 2RE1A 3M1VA 1R31A 1F60B 3ILLA 2XB2D 3M2VA 2WW8A 3QT5A 4AE5A 2XZWA 2AJ2A 2VFSA 1LXJA 2XSJA 2YWFA 5DQHA 5DDOC 2E5LF 4R25A 2J0SD 1HL6A 2CPJA 4KV8A 4NOHA 3M1VB 2I9SA 5JJBA 1WDDA 3R5JB 3M2VB 2XSJB 1OIAA 5U47A 2DPJA 4KV8B 2AJ4A 4B9TA 3E01A 4A8XA 2P9EA 3PYEA 4X66J 2KKHA 4U8YA 2GS8A 2B9EA 4FNIA 2YX7A 4ZLPA 3MR5A 3HVRA 1U48A 3MHYA 3OBIA 2RS8A 2VG7B 3E01B 3IP0A 2KG1A 2IPOB 4RW6A 3AD9C 2FYXA 3SSQA 5A8RA 2XLIA 2X51A 2IDLA 4YR2A 2R8GA 3H5YA 3OR2A 2EKYA 4NYOA 4ZJOA 1RWPB 4RW6B 3BS9A 1EARA 4RX6A 4LF8J 1RT2A 2EWHA 3OR2B 4EBCA 5BYSA 1S9EB 5KG6A 3KLVA 2CXEA 3OHAA 4KIAA 4Y2AA 2PA3A 1W26A 3IRXA 2YNFA 1FFSB 3QGPA 4DV2J 4OJHA 3S1TA 1IBCB 4O23A 3Q8QB 1G1XA 1B99A 4P7VA 2MZSA 1X4BA 5CYMA 1HW9A 2XWXA 1X7VA 4U67Q 5KFEA 1RZMA 3LP1A 3KUGA 3W5XA 1TELA 1DQ9A 3EX7B 2E5IA 4UQTA 1NK8A 4I68A 5E0OA 5ITHA 5DG7A 1SI9A 1Y5IB 1P9QC 3HDSA 2V2QA 1QTMA 2XI3A 3DRPA 3THTA 3HHLC 4YUDA 4FXDA 1FWLA 1YI2S 2ZH9A 1XTZA 1FVQA 4DR1F 4WKYA 4CH7A 1FK9A 1RT6B 1C1BA 3VAIA 3V6HA 1HNVB 2Z8QA 3R5GA 4NXNJ 4KQZA 1HQUA 4RNHA 3DRPB 3SEOA 1YJNS 2J8SA 3HHLD 2HRTA 3B82A 1O0PA 5IM0A 1WSVA 3I55S 5SZTA 3CJ5A 5MAOA 4X65J 2ZH2A 1WI6A 3R5DA 2P5VA 1HQUB 2IJRA 1Y5NB 2XBPA 2KDOA 4DQPA 3GFHA 2CPDA 3IS9B 2GGPA 3BPSP 4DX5A 3W3SA 1HNIA 1WEXA 1NK7A 3MURP 4JYAF 2A18A 1GH8A 2GGPB 2GX8A 4DR4J 3HSZA 2HQCA 2AZ1A 5KT7A 3CJTA 3QRQA 3C14A 2HGLA 4RBUA 1SC3B 1LWEA 4ATNA 2RMLA 1FRJA 3ETMA 2M8HA 1BHNA 1PKUA 2I5JB 3T3FA 3C14B 6FDRA 4B3MJ 4CT9A 1IKWA 3H5SA 2JEGA 5DS7A 2R42A 2AKWB 4QIGA 3MM6B 4XDCA 3PX4A 2DISA 2NZ4A 2GFFA 2FJXA 4PG5A 4TLQA 4QWAA 1IKWB 4O3NA 4ES2A 4NLGA 3D0HE 1FJGJ 3NMRA 2JLFA 4J9NA 3I9V9 1M5VC 2HHHF 5A8WB 4PABA 4ICLB 5GAHI 2AJ1A 3NCQA 4OI4A 4P75A 3ADAC 5KG1A 3NGRA 4DPOA 1T02A 3CCVS 5LSRA 1IBLF 3RU0A 4ZP8A 4DEZA 3W9IA 2OO4A 5JUMA 2AT1B 2EG1A 4P2MA 3F56A 3BGRA 3GV8B 3UD3P 1QAIA 3C6TA 2OTJS 4KTQA 3MOJB 2DR9A 1FFWB 4DV6J 3DGVA 2PA8D 3MXHP 2M8DB 5IC4B 4PQUB 1VIOA 3M30A 3TJ9A 3BGRB 2DNQA 1OQ3A 1LWFB 1LFPA 2YNIB 1DRZA 2XLKA 1TU0B 2OFGX 1N6QA 1YJRA 1NKBA 2DITA 2R8JA 4USIA 5MLCV 1ZM3A 3TOQA 2OUGA 1IR0A 1MW7A 4ED6A 2XS7A 3A4TA 4EO8A 2BYCA 3M8QA 3FUYA 5HK4A 4LBPA 3N4WA 2HQDA 4M95A 3NMAA 1N6QB 3MGJA 3GJQB 3KUEA 1KS2A 3T6JA 1F5BA 3AJDA 5K14A 3V2UC 3ENVA 4TKTA 1L3SA 1HR0J 1WEYA 2VA3A 4Q0BA 2ILZA 4USVA 1VDHA 1W2IA 4KC5A 2Z58B 3QLHA 4OYMA 1X0PA 1DTQA 3L09A 5KFVA 3I5BA 1JJHA 2MY8A 4L3NA 2UU9J 5K14B 4A4JA 5ETKA 2XMKA 1GFWB 4Q0BB 4Y2IA 2WZ1A 2C2ZB 4A47A 5D3GB 1DTQB 1WOPA 5F0UA 1BWVA 4GC7A 1HD1A 4K2JA 2V8VA 1Q81T 3QZ8A 2B3TB 4DR5F 5DZ6A 4UQGA 1RKIA 3RBZA 3TQ1A 4N77A 1VQ8S 2P6TA 1KVJA 2XY6A 2P2CB 3C15A 3LO3A 2FHOB 3EPGA 2CA9A 5B0FA 4LMZA 1CQNA 4USTA 3H20A 1V9OA 2M2BA 4DF8A 1KOHA 5HROA 4ZVOB 5CYJA 3BN4A 4GRSA 1Q86T 2PI5A 4KKOA 2DR8A 1S6PA 2UXCF 1JJ4A 2QEXS 3H98A 1S4FA 1FKPA 1JLEA 3OXLA 2E1CA 4KKOB 1HMVA 1MG7A 4DDFA 4O3RA 1HPZA 1S6PB 3ZNJ1 3DN9A 2J8AA 1FKPB 1H7XA 3JAMY 2BW2A 4DR2J 2ZBCA 3GSDA 1R8HA 2VDHA 4FN5A 1U25A 1FTRA 1HMVB 1ZM9A 4DCPB 1HPZB 4GKKF 2E7VA 2E29A 2QL7B 1PC5A 1U0HA 5LXYA 3MFHA 3E8OA 2EG2A 1G4CA 2GW8A 1D09B 3FMBA 3LP2B 2IM2A 4IH5A 3UWTA 1UVIA 2M52A 2FLLA 5HANA 4DUYF 2DEJA 1XNRJ 4EEYA 3BDEA 3KJQB 1KP6A 3LALA 1U0HB 3IN5A 2KZMA 5HMYA 2H4WB 2BABA 1TFYA 4FXWA 5BR8F 5I3QA 3SCKE 1AZSA 4Z7CA 5D0RA 4U95A 1UFKA 1XNQF 1JXVA 1RYRA 3MMBB 2GHWA 1F3FA 3KG0A 1Y5LB 2CPEA 3OL9A 3DRYA 1SIWB 2HHVA 3M7VA 3JSBA 1Y00A 1X5PA 5CZXA 3AXMA 1LKZA 2KVQE 1QJHA 4KBIA 2LLZA 3FQLA 4DL4A 3DOLA 4USWA 1CULA 2N3OA 1M1GA 3NAHA 4F0KA 3TZXA 3RRKA 4PAAA 5H1SV 1I1GA 4RBTA 4XAKA 4CWBA 3VF0B 1OQ6A 1YBTA 2PSZA 8AT1B 2KYXA 4LSLB 2DH9A 5BJRA 4KO0A 2BKPA 4B3RF 4NRUA 2GMJA 4P2SA 1Q16B 1RT3A 4F4KA 4U8VA 3A3NB 2LA4A 4PPZA 1FNOA 2LKZA 3KK3B 2UUAF 4EFAC 1YRTA 1CQMA 4LFAF 4ALZA 1B0PA 2J5AA 3UVJB 1IM6A 1X31C 4NLSA 2BBEA 2MPUA 3QYYA 2DNNA 2C3MA 3PRDA 1DTTA 2ZUAA 2IC3A 2HLUA 4BDPA 2NREA 1N5SA 1T03A 3GJTB 3M2UA 3DRXA 2K06A 2VD3A 4PG4A 5BYRA 4LIWA 2CG4A 5ADZA 1FX2A 1WG1A 5JXSA 2R9LA 2IC3B 2GMLA 1R0AB 2DRBA 1T03B 3M2UB 3P5BP 3VAFA 3AA8A 3FMWA 4L73A 4OYWA 4WU3A 5GAGU 4DFJA 3SDEA 3KMSA 3D66A 5E3CA 4JI7F 2D69A 1RTDB 2WOMA 1LEOA 3PNIA 3FGVA 4HVZA 2DGXA 5DM7Q 3SDEB 3DDNA 2HLTA 5E2QA 1QUVA 3EMTA 2WOMB 2ZUGA 2QSWA 2DYAA 4DSJA 1N4LA 5B08A 3RYLA 3LA0A 2Q66A 1O8BA 1RAIB 2ZC4A 2PMZD 1GXTA 4L72B 3T1HJ 1W25A 3HK2A 1PBAA 2ERRA 4OV1A 3FRZA 3PKMA 2HPUA 4AUKA 2HS3A 5F3ZA 4XTTA 3G82B 3DLEB 2OEJA 1RU2A 3CMAS 4G1PA 3W2VA 1S1WA 2RHQB 2W24A 1C1CB 1YX2A 3RB3A 1FRIA 3D68A 3VAHA 2L9DA 2AP6A 5A76A 3N6NA 3W2VB 1S1WB 2KI2A 2BM1A 2DNRA 2YBVA 2DO4A 2ZZNA 3EZOA 4PZVA 2H3EB 1VHFA 4C11B 4H4KA 1F9HA 2ASJA 3GJRB 2OD4A 3PR4A 4BLGA 4PRFA 2UXBF 2GHPA 5KT2A 4U96A 3QGIA 4OX6A 4JI4F 2HQ3A 3IBCB 2ZZMA 3AOBA 5HATA 2NLWA 2AEFA 2FJBB 4RPFA 4ZP9A 1YWXA 2AIRB 2XTJP 2W2MP 4QR1A 5L38A 2H9ZA 2HIYA 1SL0A 2YVSA 1RT5A 1HWLA 4ELUA 4ITSA 4WFBQ 5DDRC 3CCTA 2XEXA 1NDCA 1L5UA 1MMLA 1IM4A 1NEEA 1CC7A 3EXCX 2KTQA 2CJKA 3A8EA 4QIWD 4ZPCA 5I4MA 2RU9A 3H59A 1HQEA 2P9GA 1RT5B 4DR7F 4Y2CA 1NDPA 3B4DA 3CCRS 2ZH6A 1P8GA 2K1RA 2UZAA 1T9VA 2KFZA 2AX1A 2A2DA 2GQ2A 1ZTTA 1K47A 3KNAA 4C8OA 3IAS9 2HAIA 1GMUA 3GCWP 2XYGB 3M32A 1Q8IA 1V3RA 4I2PB 2FZGB 4LF9F 2DGOA 4HHJA 1NDLA 3FCVA 4C3KA 2A1BA 3K8WA 1FNXH 4NEYA 4YQWA 1S9GB 1GXLA 3FKBA 3HI9A 2HG4A 1X9MA 5IS2A 2B56A 2RT3A 3A12A 3NGTA 1P6TA 3P8BB 3NEKA 5FLXY 1HNZF 2IA0A 3KLFA 3JS9A 2V8DA 2L48A 2WVDA 2AHOB 2L9NA 2VBWA 4DN0A 3ZTQA 3NAIA 3GPAA 3EXYA 2WB1D 4FYDA 3I5CA 1MROB 2JEFA 1WWHA 4LF4J 3QRRA 1JNRB 1DBDA 1QVFR 4FYXB 3JAMU 1U2RA 1FDDA 1UVKA 3HT0A 4MT1A 1NHVA 2IIHA 3MCNA 5DJBA 1SH2A 1GX5A 3KG4A 1AA1B 4MFBA 5ETPA 1N34F 3ZZZA 5LMUF 4KPCA 2N4DA 3BO4A 1OS5A 3T9ZA 2VFVA 3DC2A 4O4RA 2MSTA 4IOCQ 4M63A 2QTWA 2AYGA 4K0KF 4MFBB 3SIPB 1NSAA 2BE9B 1R8PA 3I0SB 3DFEA 3T5HA 3IAM9 4OV6A 2DNYA 1E6YA 5ETRA 4EI2A 3NLCA 1RJJA 4NLYA 3TNVA 4PG7A 3OLAA 4N8OA 5HMZA 4RW8A 9RUBA 1IBKJ 2MHNA 8ATCB 2RH3A 4DUZF 2P6SA 1E6YB 3H42A 4ANDA 4UTGA 2B7BB 4EZ9A 3M8YA 3H2LA 4HT7A 4X84A 5EWEA 2C2EA 4OZLA 2B8PA 5DRKA 2MZTA 1HWKA 1XWLA 4NCGA 4MYTA 2EI5A 2W2PP 1KC8T 5EHHA 3V4IB 4ECYA 4H4OB 4OIXA 2F7VA 1DAXA 1UTAA 4J9KA 1CG2A 2BXJA 3V81A 2XY5A 4DV3J 4HHUA 2ZOMA 2VOOA 2NSCA 4J9OA 4N8NA 5KG2A 3FVYA 5D4PA 3CGIA 4ZCMA 5I42B 4X64J 1ELOA 2UUWA 5G0RB 1OPIA 2VJVA 2IFXA 2OPPA 4QWEA 2KG0A 1WC0A 2DB1A 2YX1A 3T5KA 2Y0SD 4IG0A 3P96A 5LOQA 3RB4A 2QA4G 3WZ0A 1HHQA 2E5JA 3MWBA 1BC6A 4C8KA 2ADBA 2JC0A 1UA1A 4B3OA 3MD1A 3R6LB 2EFOA 3HPOA 4ZVTB 4J91A 4RO0A 4Y3CA 2EC0A 3I87A 2X1FA 5IT4A 1U2FA 2Z30B 3HM9A 3LPYA 1SKSA 4HTIA 3L7OA 3UCUP 1U45A 1UJ5A 4OYOA 1YJTA 1WG4A 4NYZA 2NUUG 1URRA 2WHOA 2OSRA 3OR1A 4X4RA 3EM1A 4J9PA 2I2YA 5HMXA 1VQOS 2PD1A 2W9BA 2BE2B 3ULHA 3L7UA 2E1MC 3M8RA 4OI2A 2IAJB 1RYSA 3CD0A 3OR1B 3X1LB 2D3ZA 5L1KA 1OWXA 3TA1A 1LWXA 4MIBA 3NNHA 1N5YB 3MI7X 1FXLA 2A10A 3DXBA 4G3IA 4FP9A 4ANEA 4ECTA 2HFOA 3TUZC 3M8PA 3T1YF 1O51A 2C2MB 5L8RC 2QL5B 2MKYA 2WRMA 3PX6A 5KFYA 2Y1IA 2ASDA 2HWTA 5KOWA 3PVXA 5F9NA 2KM8B 2IVMA 2F4VJ 2WVBA 1Q4RA 2OPQB 1OSDA 1N32F 3SSSA 1V3SA 3BYPA 2GMHA 2HNDA 3FBBA 1OY6A 1T9UA 2MJNA 4WK3A 1Q0NA 4DV7F 4B3TF 4NLOA 1TR0A 4RNNA 1U8SA 3GQCA 2FY1A 4AL7A 1VOMA 2W7OA 1NK9A 4I64A 4WKRA 2HHWA 1U6ZA 2DGWA 3V6DA 4ZDNA 2KXFA 2CQHA 2VKZG 4E8UA 2J6UA 1T9TA 4LUBA 2MQQA 4LT6A 4ZP7A 2YKNA 3JTPA 3AA9A 1Y0HA 4G1IA 3CCJS 1RDRA 4NLUA 4J90A 2QLFB 5B0CA 5HQLA 1IXKA 2BOAA 4YHHJ 4DQRA 4OHXA 2BJ8A 3LUYA 2QJ3A 1H0HB 3AY0A 5KTQA 1N52B 4DL5A 1M5PC 2RRNA 2R7OA 3QMQA 1VRUB 1FXRA 2V8GA 4RNMA 3HSDA 4RW7A 1PO6A 3J7YU 3R2CJ 4JOUA 1YRUA 1G7CB 3K5PA 1F9EB 4HDHA 1WOSA 5ETNA 4CLSA 4A46A 2KRBA 5F41A 3MAQA 3H7HB 1Q5YA 2DO0A 4M5IA 1NHUA 1BWEA 2I6WA 4ZLLA 4OI1A 1FT8A
chains in the Genus database with same CATH topology
1TZ0A 2F9JA 1X4CA 3MEKA 4ZPTR 2ZM6F 3DXSX 5E3QA 1EP4B 4IG3A 5CH7B 5HMWA 1S1UA 2G9OA 4DS5A 4KB7A 2OD6A 2B9XA 3CCUS 2IA6A 4IRCA 4I2PA 4TLRA 5EX3A 2JWNA 4KPYA 1KLMA 3E51A 2DCUB 2JFKA 5D6GA 4CTAB 3GIJA 4WE1B 2B51A 4QPTA 3MEGA 2KT2A 3DMJA 4UOCA 4ZPVR 3PW0A 1JX4A 1XR5A 3OL6A 3OFEA 5KFCA 1WHYA 1MNEA 3SSRA 2EVZA 1S9GA 1VGYA 1KN6A 4WTYA 1S1UB 2HQIA 5K8NA 5CCLA 3RTVA 1FRKA 5DM6Q 1K8AT 2ZH8A 3MDFA 4F3OA 2ILYA 1F9FA 3SCLE 3OSPA 3CXCR 4TU9A 2AGQA 4I1TA 4UUXA 1SBRA 4KHRA 1KQKA 2HWHA 1LW0A 4ILRA 1VC6A 1Y9OA 2XULA 1UP1A 3M8QB 4OQJA 5M2RA 3HF5A 3MEGB 3DMJB 3K5MA 4EZ6A 2AYMA 3LH2S 3NP5A 5IZHA 1QUPA 4JI6F 2NS1B 4MK9A 4ZPAA 1U7LA 3U1NA 4EO6A 3FJ2A 3CJ0A 1WF0A 2VL1A 1UA0A 1X5TA 1N0UA 1FESA 2RNEA 3EZ5A 3ENQA 5JVGQ 1KOOA 1QE1A 2V5HG 2IM0A 5FDLB 2ZDPA 3PJXA 3Q8PB 1UAWA 1RQ0A 2RKIA 1Z2ZA 4OHWA 4DHVA 5AE1A 5E41A 2X1BA 2ZOFA 1ZZFA 3IG1A 1JLGA 5J2NA 2LQ5A 4J9QA 1FE4A 4LIRA 4Z37A 3T5LA 2R8HA 1T3NA 4DL6A 5F8JA 1VIXA 2RS2A 4Q8EA 4WCEQ 3BSAA 5BYQA 1MROA 3O8WA 4HEA9 3Q24A 4W90B 1C0TB 3HXMA 3QLHB 5M2UA 3J7ZT 1GTHA 1UKUA 2HNYA 5KG0A 2YKOA 4LF6F 5IT9Y 4LVNP 4DL3A 1LOUA 3VAGA 3MMCB 4NA2A 2LECA 2N4CA 2R4FA 2FLPA 1TKXB 1SJFA 5AJ3F 3N5FA 3M6XA 2RKIB 5F9LA 1TL3B 2D7SA 3R5CA 3EGZA 1FDNA 4ZS6A 2MZRA 2ZJRQ 1T05B 1TL5A 2KU7A 1W2BR 5DDPC 1S0MA 2OTLS 2B6AA 3VQTA 2CDQA 4LF5F 4NPOA 2M4MA 3NBPA 2QA1A 2NUHA 1JXEA 5L9XA 3N9UC 4XDDA 2RQCA 1Y3KA 2HFNA 2PE8A 3QWPA 2LVWA 3KK2B 4CH0S 3KK1A 4JI3F 2LDYA 4OZNA 2FPHX 1NJIT 4B3SF 1H2UX 3MMJA 2NR0A 4DX8H 1H3DA 2ZKTA 1S49A 4MKAA 4C3MA 3PACA 2B6AB 4ZA1A 3IGNA 5T41A 2PIIA 3NBPB 3TO8A 1AUDA 2WONA 5AXLA 3ZZRA 3D54A 2MZJA 5KFZA 2UP1A 4UW2A 4H4MA 4Q7AA 1F5AA 4ECRA 4ZMMA 2FC8A 1U1PA 2POKA 4LJMA 4K4WA 2W25A 4H4KC 1S0OA 2RE1A 3M1VA 1R31A 3QJLA 3NCRA 1KQSR 2B5JB 3HHLA 1F60B 2LYVA 3FSYA 3M2VA 2XB2D 2F8MA 2WW8A 3I0SA 4AE5A 2FB0A 2DTJA 2XZWA 4AXJA 5AXMA 1FF2A 1A7GE 1D9FA 1LXJA 2VFSA 2XSJA 2YWFA 5DQHA 5DDOC 1S9FA 5LSOA 2WONB 3X3UA 4ZCIA 3BSOA 2MQMA 2XI2A 5EWGA 4R25A 2E5LF 2J0SD 1J5OA 5IFMA 1HL6A 4O44A 2G1DA 4QWCA 2CPJA 4KV8A 4JI8F 4NOHA 5KFXA 3M1VB 4DR6F 2I9SA 2QA2A 3CCWA 2DNMA 4IDKB 5HROB 5JJBA 3Q0AA 1UEVA 3M2VB 3OVBA 3PY8A 1Q82T 2IYIA 2DH8A 1HD0A 3CSKA 1KHWA 4X66F 1HFEL 2XSJB 3DRSA 3AQOA 1OIAA 5KOXA 5T14A 2CQBA 3B78A 1WF2A 5L1LA 2U2FA 5F8GA 4CO5A 3I0RA 3RAMA 3POTB 4B9NA 1J5OB 2FTRA 1T8EA 5U47A 2DPJA 4O44B 1SV5A 2FHJA 4KV8B 2AJ4A 1TAQA 4ED7A 4B9TA 4NWBA 2FDNA 1VQKS 3E01A 3G6XA 4A8XA 3R5AA 1GAOA 5LJ3Y 2VA2A 1TP7A 2HRYA 2V4RA 2CIMA 5A0YB 2P9EA 1JLEB 4DF4A 2KKHA 5DDQC 2VASA 1S72S 2WSEC 4M8LA 4F67A 5F3TA 4WFAQ 1UVNA 2VQEF 1GNKA 4DQIA 3O3LA 4FNIA 4DSIA 2YX7A 4ZLPA 2D1CA 2Y1RI 5E3AA 2VB6A 3I82A 2XMMA 1F0XA 3MR5A 1M0SA 4A8WA 3KHLA 3HVRA 1U48A 2ZDOA 3MHYA 4NRTA 3OBIA 1YJVA 2EK6A 2LU2A 1C4AA 2RS8A 2VG7B 1H98A 1VK3A 1Q78A 3E01B 4H4OA 4QIVA 3W7BA 2KG1A 1MSWD 3HZGA 4RW6A 5KAKA 1MWZA 4N5SA 5K9FA 3OXFA 4KE5A 3SSQA 5A8RA 5E7OB 2XLIA 4OHYA 2X51A 2D74B 1YJ9S 4LF8F 1DQAA 3AJ2A 5DLGA 1RTHB 4YR2A 3G4SS 3GWCA 2R8GA 5E3PA 1KFSA 3H5YA 2R7WA 5A8KA 1URNA 4ZVFA 3OR2A 4QIEA 2QLXA 3UD4P 1N36F 3U27A 1KQGB 3R5BA 3OVAA 2EKYA 3LF0A 3P49B 1M5SA 2DGSA 2VG5A 4NYOA 2RJZA 4RW6B 3BS9A 1TK5A 2HNZB 5KFMA 2KJWA 4F4YA 2FJDB 4RX6A 4DLGA 5I42A 3DGPA 1RT2A 3MTKA 2RILA 2RQ4A 4IR9A 5G0RA 2EWHA 5KFJA 4MMOA 4OLOA 5A6PA 1VFJA 4DR3F 5A8KB 5KFRA 4DV2F 3OR2B 5L1JA 4OZ0A 4EBCA 1VK8A 2CQGA 1S9EB 3DU6A 2VZ9A 5KG6A 5BYSA 5DLFA 2DJWA 3G8TA 2O66A 3KLVA 2HW3A 3Q22A 2AV5A 3OHAA 3TA2A 1NH7A 4KIAA 4OJ1A 4Y2AA 3N6MA 5JVHQ 2PA3A 2UVVA 2Z4PA 3IRXA 2YNFA 1L3TA 4NZ7A 3T6BA 3H5UA 4BS2A 2F1FA 2N7CA 2ABYA 3IA0A 3C66A 3TA0A 3QGPA 4OJHA 3S1TA 3TAQA 4WIIA 5HQ8A 1BD6A 2WAQD 1X9WA 4O23A 3Q8QB 4V19X 1CEZA 1G1XA 3GIMA 3U7JA 2F8HA 4P7VA 2CJAA 2MZSA 3AHPA 1X4BA 3NWGA 4Y2MA 5CYMA 4F3MA 3PW7A 5CYQA 2J9DE 2IHR1 4K2XA 1HW9A 5HP1A 2XWXA 4F4WA 2WK4A 2BRLA 1S0NA 1YBAA 3JB9k 4KAIA 2DR7A 1N5VA 1RI7A 1X7VA 2KHDA 3HT3A 5J1NA 4ZKAA 2BACA 2D9PA 4U67Q 1FJCA 3S8SA 4URSA 2HHTA 2WSFC 5KFEA 4O3OA 1HWIA 2B9YA 1ZTWA 1LXNA 3LP1A 3G6YA 1DQ9A 3EX7B 2EK1A 5HN0A 1HBOA 2BQUA 2DPIA 1OPZA 4K4XA 2E5IA 4UQTA 4ILLA 1NK8A 2JVRA 4I68A 2QO3A 5E0OA 4J9SA 2OH2A 5ITHA 2DNKA 2IBOA 3TR5A 1R3NA 5DG7A 5FIIA 1SI9A 1Y5IB 4B9SA 3AQPA 1P9QC 3HDSA 2C3YA 3CDBA 4AQYF 1QTMA 4NXNF 3ZC4A 2ZNZA 2NSBA 2XI3A 3DRPA 3THTA 3HHLC 3DOLB 4YUDA 4FXDA 1PC4A 3GB0A 4ZPDA 1YI2S 3NS5A 3DDKA 1MU2B 2ZH9A 2ZHOA 1FXDA 1RTIA 1XTZA 4F2RA 1RKJA 1FVQA 3MM7A 4DR1F 1S6OA 2VG6B 1JLAB 2BE2A 4WKYA 1FVSA 1IBMF 4IQXA 4CH7A 2X1GA 1FK9A 2RIJA 1RT6B 1C1BA 2IRXA 2VBXA 3D28A 5KG4A 3VAIA 1KSPA 1U1RA 4B9UA 2B4UA 1HNVB 3V6HA 1ZZNA 2Z8QA 4F8RA 4X65F 4O4GB 2IAJA 4DV5F 4KQZA 5L9NA 3N0VA 1HQUA 4RNHA 3DRPB 1ROFA 3VAKA 4KO0B 3SEOA 1YJNS 2H5EA 1C0UB 3HHLD 3CJKB 4ECXA 4BBYA 2DNZA 1RTIB 3B82A 4I56A 1IN0A 3T5JA 1O0PA 1RT3B 5J2PA 1N5YA 3S01A 2AGPA 2QT7A 5IM0A 3BDPA 5B09A 2E1RA 3I55S 3MR3A 3THVA 5HBMA 3A1YG 5SZTA 1VRTB 3CJ5A 5MAOA 2UUBF 2GO9A 2ZH2A 3CCSS 1NO8A 2B7CB 3MTJA 4OX7A 1WI6A 3R5DA 1ZYQA 2P5VA 3MECA 1U1NA 3GIKA 3FRYA 1NJXA 1HQUB 4DG1B 3MM8A 2ATLA 1P1TA 1Y5NB 4RUHA 2DT9A 2IMOA 3KKFA 2XBPA 1TKZA 1QAYA 1JLQA 2IRYA 2DGTA 2KDOA 2V4JA 2M9KA 4GO5X 4DQPA 5J2PB 3GFHA 5KFHA 3N6LA 2CPDA 2YX4A 1S6QA 3IS9B 5F8LA 4Y6IA 2GGPA 5HBMB 2QRRA 3US5A 4IRDA 3Q8SB 3W3SA 5HLFA 4ELTA 1HNIA 2OPSA 1DTTB 2KH9A 1M5HA 2FHJD 2KZZA 2OPQA 4U9RA 2LQ9A 3DM2A 3MECB 1IQZA 1WEXA 4ZCKA 1HBNA 1KD1T 1VQLS 1NK7A 2KXHA 2ZKUA 1JLQB 4C0HA 4WFXA 2CJ9A 3OFGA 3MURP 1SJQA 4JYAF 2UVUA 2A18A 4HH1A 1GH8A 2GGPB 2GX8A 3MMAA 1LW2A 2MZ1A 4KJIA 3LGMA 4DN9A 2C2DA 2FLOA 5HLFB 2FVSA 4QR2A 3KLEA 4MK8A 5KT7A 1IKXA 2J6TA 1N33F 1TQLA 2MKJA 1HI0P 1S1TB 3TVZA 3KTQA 2HGLA 4RBUA 1U6BA 1ZH5A 4XIUA 1YHQS 1LWEA 5LL6d 4B3MF 1VJWA 2QZ8A 3C6UA 2APOA 5EUHA 3T1AA 1UJ4A 3GZ7A 3EUNA 3P3DA 5KG7A 4AFFA 1SUQA 5CZVA 4ATNA 2JJ4D 2RMLA 2IJNA 1FRJA 2FGCA 3MMAB 1NU4A 4NLWA 2HWIA 3NS6A 3M9NB 2M8HA 4MIWA 1R27B 3CC4S 3OHBA 2YKAA 2I5JB 3HVWA 4TU8A 3T3FA 3HKWA 6FDRA 3Q2SC 1FD2A 4CT9A 3VAMA 1IKWA 2KYZA 3H5SA 3CCLS 4OZJA 3HFKA 2JEGA 4ERDA 2E5GA 3C6UB 5DS7A 1UW4A 3L3CA 3LW5C 4QIGA 3B4MA 3CCQS 1XERA 1SUQB 4NLRA 2FVCA 3PO5A 1FJGF 2JH3A 4J9LA 2EFGA 2HFZA 3MM6B 3GFZA 4XDCA 3PX4A 5KFSA 3ZZTA 2CZ4A 2UUCF 2DISA 4QYZJ 2AU0A 2NZ4A 3CC7S 2GFFA 2ZH3A 2FJXA 4DSFA 4PG5A 4Q2LA 5C5JA 4TLQA 4LVOP 4OZ5A 4QWAA 4AL5A 1IKWB 1NRKA 1AROP 3DLGA 2CVEA 2DIUA 4A8YA 4O3NA 4ES2A 1P27B 1JKHA 1L3KA 4OZ1A 4NLGA 3D0HE 1RWUA 1YJWS 4OX8A 2KN4A 5EWFA 4PUOA 3NMRA 2JLFA 4NA3A 4DV0F 4J9NA 3I9V9 2GC8A 2YKPA 2R8IA 1M5VC 2CQ4A 3MEDA 2HHHF 2CJBA 2MYFA 1VRUA 2J6SA 2FVPA 5A8WB 4ICLB 5GAHI 2PN6A 1JLCA 2AJ1A 3NCQA 5KFTA 4OI4A 1VC5A 2YH0A 1WHWA 4IO1A 1K1SA 4DFKA 2BJDA 1R8BA 3DLGB 2KJVA 3G6VA 5KG1A 1U1KA 2UV8A 1YIJS 4DPOA 2CKWA 3WBZA 1TK8A 1T02A 2J0XA 5LSRA 4X62F 3CCVS 1IBLF 3RU0A 4ZP8A 4DEZA 3T19A 2OO4A 4PPDA 5JUMA 3O44A 4ECSA 3C8YA 1NJZA 1H7WA 3I6PA 3M9MB 1P1LA 2BDPA 2EG1A 4F2SA 1YG0A 3DRRB 2CRLA 3PDNA 5J2MB 2J7UA 2GV1A 3F56A 5FD1A 3QGHA 5CHCB 3BGRA 3GV8B 3UD3P 3L7PA 1QAIA 3C6TA 2OTJS 4KTQA 2YWKA 3MOJB 2DR9A 3LP0B 2PA8D 2D3UA 1S76D 3DOMA 1S1VA 3L95X 1SJ1A 4IYQA 4YEAA 3MXHP 2YNGA 2M8DB 4IOAQ 4PQUB 1VIOA 3M30A 5C42A 3RW7A 4C0OC 3CD5A 3BM7A 4JUZA 3VR1A 3NNCA 3BGRB 2DHGA 1EP4A 4FXVA 4B9VA 2DNQA 3SYZA 4YDXA 1OQ3A 4D3HA 2X1AA 4A8MP 1LWFB 4HI1A 1LFPA 5IWAF 2YNIB 4Y0FA 1DRZA 3OXGA 2BVZA 2GIRA 4U7UK 1TL1B 1KRPA 1S1VB 3HVAA 2XLKA 2RDJA 3KOAA 3PEJA 1XMQF 1VMBA 1WI8A 4WE1A 1FEHA 2YNGB 1QAJA 2JX2A 2DK2A 1Q79A 4IQMA 4C7QA 5C42B 5LT5A 2OFGX 1QVGR 2Q43A 1HI1A 2XMJA 3H4DA 1N6QA 1YJRA 1NKBA 2DITA 2R8JA 4ED2A 3DLKB 1LK5A 4QIFA 3GYNA 4CO4A 4USIA 5MLCV 1TL4A 1ZM3A 2GQCA 3TOQA 4K50A 2ZD1A 5KG5A 5IT0A 3LQVA 3TAMB 3Q2TC 2J0WA 4JV0A 1FO1A 4P7TA 1IR0A 1MW7A 4Z2XA 3PIPQ 4ED6A 2XHWA 5J1EB 1HHTP 1WEZA 3SFUA 2NPFA 2KM8C 2ZH4A 2XS7A 2PC6A 3K5LA 4X4NA 4EO8A 4QCLA 4C8NA 2BYCA 3M8QA 1HR0F 5D77A 3K8VA 1RAJA 3N4WA 2JEIA 3KNGA 3H40A 3TVYA 3C46A 4M95A 2OAUA 3NMAA 4F3QA 2C42A 2OFHX 2FHMA 3NCPA 3MGJA 3J7Z5 1N6QB 1KS2A 3T6JA 4RUCA 2A2CA 2AJFE 1F5BA 3QIDA 4NL5A 2RSQA 2CPHA 2O1PA 4ZPBA 3VQSA 2ZD1B 5IQ6A 1H6KX 4WFYA 1AXQA 3MZIA 5FDLA 1UVJA 4DFMA 5K14A 3V2UC 1K9MT 3Q23A 2VUGA 2UU9F 3ENVA 4TKTA 1XBWA 1L3SA 1G6BA 1D9DA 4ZCLA 5IQQA 1WEYA 2VA3A 4Q0BA 1VQMS 2ILZA 2Z2LA 3CUNA 1W2IA 4KC5A 3U02A 1C0TA 5D8HB 2ZC3A 2DR5A 2CQ0A 3QLHA 1U1LA 3CULA 1NKEA 1APSA 1X0PA 4WYWA 1DTQA 1R6YA 2DNHA 3L09A 5GMKa 3MMCA 4TQSA 1BQXA 1X5OA 5KFUA 2RVJA 5KFVA 3I5BA 1FRXA 1HQEB 1TKXA 1JJHA 2MY8A 2MHEA 2VBYA 4L3NA 5B0EA 3CDUA 5K14B 1TL3A 4KGKA 4A4JA 1X4EA 3GV7B 1D8ZA 1T05A 1HYSA 4LFCF 2K1RB 2ROGA 5B7WA 5C25B 4FF2A 4NYPA 4A8FA 4IUFA 2FJWA 2XMKA 4O3QA 4Q0BB 2M3DA 4Y2IA 4A47A 1TAUA 5KFQA 2HMIA 3CPWR 4M1KA 1X8DA 5D3GB 1H2TZ 1DTQB 3FSIA 1SH0A 5F0UA 3KK2A 3ZZYA 3M32B 3HX9A 2Q1LA 4GC7A 4M5DB 1TFWA 2Q79A 2UV8G 1HD1A 2K3IA 2C22A 1HYSB