1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chromosome segregation
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
1VHIA 3M6WA 3MMAB 1RWVB 2HWTA 1Y11A 2W7OA 2M9KA 1C4AA 4LFBJ 1WKLA 1FF2A 2OPSB 2XB2D 2OPPA 1N32F 5H9FJ 4ANCA 2CJXB 2E66A 2J6SA 3I31A 3GILA 4O3RA 3IGVA 3DOMA 5D0GA 1SVDA 1UPPA 4CO1A 5IWAF 3OSPA 2GNKA 4BLGA 1UETA 2C22A 2GVDB 2XWXA 2MKYA 3EMTA 4Y3CA 2HFNA 3DM2A 2YWHA 4TY9A 5E3QA 1IR2A 3KLEB 3TA1A 3CCUS 1YJNS 3LANA 1QUVA 4DL3A 1AUDA 2DCUB 3EXCX 1B0VA 1RACB 2W9BA 2MJUA 4RUCA 1WHXA 1JLAB 2D9PA 2HQGA 3IC1A 4DV1F 4P75A 3VV2B 3MTKA 1JNRB 1Q8IA 4I6YA 4Y2IA 1VR6A 3AA9A 2ASDA 2Z2LA 1UL3A 4PPDA 2KRRA 3PW0A 2YX7A 1S76D 3MUTP 4NYPA 2JL9A 1XERA 1E6YA 4ZCMA 4IFVA 1NPRA 1JJ4A 5LM7E 4UW2A 4QYZJ 1P9YA 3GJRB 3UW1A 2MKKA 2EBEA 3BR9A 4PG5A 3BO3A 3MM5B 3MPYA 1RSCA 3AXKA 3AOAA 3J7YU 3B6BA 1G2EA 1Q7YT 3GLJA 2DY1A 2ZOMA 2X1BA 3VALA 3NEKA 3CMES 3PO5A 4WKRA 2XY5A 2V9KA 3NXZA 4KJIA 2XZWA 3TW0A 3HHDA 2GMLA 1YJUA 1NK9A 2DYAA 2C3OA 4KPCA 1PC4A 1VRQC 4O44B 5CHCB 1DTQA 5B0FA 1M5HA 3JYTB 3O2IA 1TMMA 3TJ9A 3CD7A 1I6JA 1FESA 4DCOB 5KFNA 3NOCA 4DUZF 5F3TA 2E5IA 3M8WA 2FTRA 2VKZG 3IBCB 2VOOA 1Y3JA 2AWZA 4V19X 5C2GA 2NR0A 5ETPA 4YR0A 1M1HA 3EVWA 5B08A 4ER8A 3KHGA 5C24A 2DGXA 2CQBA 4X64F 1ZAVA 2JC0A 3L95X 3ENVA 4FDFA 1M0SA 3G82A 4WYLA 3UNGC 5IT0A 1VQMS 1FFWB 2YWWA 1JK9B 3UDCA 4IOBA 2ZJQQ 2LDYA 3NCQA 1SXLA 2Q6BA 2HGLA 2QV6A 2B6AB 3AQPA 4DSFA 1V5IB 4NPOA 1VQ4S 5A8RA 5IM0B 3PW5A 4JV2A 4U7CA 2BKNA 3L3CA 3MTJA 4HHUA 3LWLA 2EKYA 3QZ8A 4UQTA 1HI8A 2K1RB 3CCQS 4RNHA 1NHVA 1SPBP 1QJHA 2LMIA 1RWKB 5F8HA 2CDRB 1R8AA 2LEBA 1WWHA 3GFYA 5AXMA 1EKRA 4RW4A 3GU0A 4JI2F 2JLEA 5HLFA 3J7AN 4E8UA 2HAFA 2KM8C 3V6HA 1SC4B 3TX8A 3C6UA 4ZJQA 3TAMA 1XNRF 2B9EA 1I5OB 4NLRA 1T94A 3OTDA 1RTJB 1VMBA 3OTOJ 3UD4P 4LF7J 2OPRB 4U95A 2RSQA 5DJBA 2A2CA 4RNMA 3GFXA 1N6QB 1KR4A 2MZ1A 1HNXF 2B51A 1LWXA 2HHUA 4ES2A 3CCRS 1QVGR 2F4VJ 4WU2A 4I0WA 1YRTA 4QR1A 5B0AA 2COLA 2WAQD 2D9OA 4PAAA 5IT4A 4QCLA 1EAYC 3L9ZA 4NLYA 4MKYA 1MLAA 2MZRA 4U7UK 1N36J 3A12A 1S72S 4C3KA 1H6KX 5L1LA 3WX4A 2BE7D 1TAQA 2MQ8A 3OXFA 3EE3A 1RWUA 2FZCB 4DQRA 1BQMA 3CNQP 4NXMF 4YB1P 3BB5A 4N8OA 5J2MB 1BHNA 4WE1B 3ICLA 2QMUB 2APOA 4HACA 3QRPA 1SC1B 3TEGA 4M8LA 3HD1A 2V4JB 5EHHA 1WEZA 5CCLA 2FD2A 1HWKA 3LUYA 4ERDA 4FYYB 2EBGA 4MMOA 2FY1A 1H2UX 2M7SA 4EWTA 3D0IE 3NRBA 4DV2F 3GR1A 3KFWX 4DR3J 3QSYB 2XLIA 5GMKa 2UUAF 2GW8A 3A1YG 3D1OA 2WONA 1JJCB 3OL7A 3ZNJ1 1FX4A 4NWBA 4CYUA 3LALA 3G2XA 1VQ7S 2E5LJ 4NLPA 1NAQA 1X0PA 4X4NA 4UOHA 1DRZA 1QSSA 5IC6B 2W4CA 3G9CA 4K0KF 2ZD1A 3KLIB 4LBIA 5F0UA 3DI6A 3T9ZA 2FHJA 3G6YA 3SZ2A 3JSMB 1KHVA 3H5UA 1UFLA 1WDTA 4NCGA 2R7WA 1T3OA 2YX1A 2DPIA 3DDIA 2E9ZA 1MN7A 3PIPQ 1HFEL 4G3IA 3QT5A 5IQQA 1DJ0A 2KI2A 3JQMA 4F2RA 2IC3B 1KSPA 5KT3A 4YHHJ 3MR3A 3GG0A 4ZJOA 4YUDA 2XMTA 5E0OA 3KK2A 2KZZA 1MROB 4K59A 4QIGA 2NUUG 4P2FA 3T3FA 2X7IA 1JLBA 1MWQA 4N77A 4IQMA 4B3TF 2V2VA 1OO0B 3R6GB 1RKIA 4ZN1A 2RS2A 5FLXU 1NJXA 5HQMA 4DUTA 4A8MP 1JXLA 3RG6A 4DX6A 3EVMA 1WG4A 1KFSA 3CO9A 1FK9A 2GZOA 3V6KA 5KFWA 4CO4A 3HSZA 3K5LA 5KT7A 4TYBA 4PWUA 3GIJA 4ZVEA 3M2RB 3QIPB 2PGCA 3M2VA 1ZZFA 1F5CA 4PQUB 1RADB 1W25A 1T9VA 3M32B 4BS2A 3CXCR 3TUPA 3CCES 4KO0B 2FHKA 2E1CA 5KFHA 5KFKA 1F60B 4PQAA 3TAPA 2LXIA 3FEZA 4JI6F 1I1GA 1YJ9S 3OHAA 3M4XA 2W8LA 2B8QA 3CTRA 3FSXA 5LXYA 5E7OB 2IY5B 3V81A 3ILIA 1GMVA 1QVFR 5HVGA 1OJ4A 3V4IA 3HHLA 1FJGF 4IQXA 4Y2MA 4KHRA 1WI6A 4HH1A 1LWCB 5AXLA 3Q8QB 3PCOB 4OI2A 3ZZ0A 4EYIB 1TL1A 4AYBD 4U96A 1ZPVA 5EWGA 3PDNA 3PY8A 5L39A 3NS6A 3DU5A 1HBMB 3UDEA 1UVNA 4QQBA 2HNYB 1HBOB 4DS5A 5F41A 2LA6A 2E5HA 4XTTA 4OZ1A 5HP1B 4L74A 4PYAA 3VZHA 1LFWA 4EFAC 4DR4F 4IG3B 1XMOF 1RAJA 1V9OA 4DV0J 4URQU 4P2MA 1RTHA 5DETA 1XNQF 3MM6A 2V94A 1HPZB 4Y2KA 1J2VA 1BQXA 2FQQB 3ILJA 4JI1J 1RT6B 1YDLA 4TLQA 2A10A 1VHFA 4GKKJ 2DGOA 3M2UA 2CQHA 3HLUA 2UVUA 3MAQA 2B3TB 1BQNA 4I7FA 4NE9C 1QY7A 1RT5A 4OX9J 2DHHA 3T9NA 2BKPA 3IWLA 4DI6A 3AFGA 3QGPA 2J9DA 5KFVA 5C25B 4ZVTB 4OI1A 2QEXS 3OD2A 4ED0A 3QAUA 5IZHA 4NLDA 2D3UA 5KFSA 2UUBF 2R4FA 3KWMA 5DGAA 4GKJF 2QL5B 4HH0A 2CPDA 1MMLA 3AD8C 3NGSA 2JFKA 2OFGX 4LVNP 3CW2C 4KPYA 2LXUA 1X4FA 1X5SA 4KFBA 2DNHA 3KLVA 2QA4S 4JI0J 2J6TA 4HT7A 2Y1IA 1RA6A 1XN9A 4RUBA 2YKMB 3QSIA 2JHEA 1P27B 3TZYA 3LQVA 2MGZB 1NXIA 3GONA 1RHQB 3O3LA 2MQOA 1IKWA 3CO0P 5GADI 4ECWA 3VF0B 2ALYB 4TQRA 3MEEA 1O8BA 4Q0BA 3CE8A 3D68A 5HBMB 3DCAA 3OUYA 4UUXA 1N5QA 9RUBA 4OFZA 3OJUA 1C1CB 1B3TA 2RVJA 4DPWA 1KLNA 2VA3A 2J9CA 3QO9B 2PI4A 2AU0A 1LKZA 4GRSA 5T41A 4ZP8A 1T95A 4RJVA 3I5CA 1S0MA 2CPXA 2EK1A 3P45B 1R8CA 1FNXH 4OX6A 3DLLQ 1SJRA 5KG4A 4OQJA 2GIQA 4J9SA 3HCXA 1FRLA 2AYGA 5C42B 2CFXA 3IGNA 2XCPA 1VGYA 1QUPA 4RLEA 1FDAA 2ZZMA 8RUCA 4USMA 2HNDB 2DGWA 3NMRA 3GV7B 3HFZB 1PCAA 4DPUA 1U2RA 1IBKJ 4MH8A 1P6TA 2HBQB 3UI3A 4H4OA 4OZNA 1VIOA 3SXLA 3MUVP 2QA4G 1IKYA 4WP3A 1KTQA 1Q5YA 5JVHQ 4OV6A 4FP9A 2F5GA 2I8EA 3BGOP 3CJKB 4USUA 2VDHA 1T11A 3Q24A 3A3OB 3TQEA 2MXYA 3KJVB 1IN0A 1RT3B 3UWTA 3OV7A 4M5MA 3NCPA 1VBYA 4X4UA 1MG7A 4BCAA 3VR1A 2VC0A 5DZ7A 1R0BG 3T5LA 5KFTA 4JI7J 2LFVA 5HMYA 3W2WB 4JYAF 3IBFB 1WACA 1U1LA 1X9MA 2HZVA 4R8UA 1XMBA 4DX7A 3SDEB 2HBZB 4ZHRA 2N4CA 2QX0A 3D3CJ 2YWEA 3W3SA 5D15A 1R6VA 2LXFA 4LSLA 3LP1A 2K2PA 3TUZC 2B4UA 1JLCA 4DQQA 2ZUGA 2PD1A 3GG1A 2IBOA 4K4VA 2FJVA 2C1EB 2OHDA 2VUGA 4TU9A 2SXLA 5D4LA 2ZHAA 1S97A 4IR9A 1SH2A 4RNNA 4DUYJ 2OPPB 4DDFA 4D3HA 1PBUA 3PX6A 4JI8F 3GIMA 4ZCLA 3P5TL 3DOMB 3VZIA 3RAXA 4A8OA 2BRLA 3FKBA 3CB4A 2ZJRQ 3GQCA 1YITS 4ANDA 3RGIA 5IXUA 2CRLA 1FRMA 4YQWA 3DM2B 4PG7A 5LL6d 3NLCA 5KG2A 1H73A 2XLJA 4Z7CA 6AT1B 1H0HB 3WQPA 2R2RA 4USWA 3ZTRA 5D3GA 4X66J 1RK8A 2W2NP 3UDLA 4WXOA 2W9BB 3DN9A 1S7HA 1KN6A 3BBFA 1LK7A 2F8HA 4UOGA 5D78A 1F9HA 3W5XA 3RYLA 3IS9A 1UCNA 4J9PA 3HPOA 2QMWA 5CABA 1NSAA 3AB4B 4C3MA 1AW0A 4V19J 4TU7A 4M5NA 3R5AA 1E6YB 1RB0A 4IFVB 3C6TA 5K14A 3CCLS 2GMJA 3KXDA 3QWUA 3LGMA 2GGPA 3D1HA 3K89A 4WIQA 3SFUA 1DAXA 2YNHA 2XG8A 2HLTA 2K7JA 4AUKA 2CNLB 1WG1A 1RAEB 4LF8F 1TFWA 4WFNQ 1GXLA 1FFSB 1VBKA 3QBCA 3DRYA 4CLZA 3UCGA 2HHWA 1S10A 2UUTA 4DN9A 4CO5A 4ECQA 1SKUB 2G9OA 4A8WA 1WC4A 2MQQA 1L3VA 3SIPB 1DTQB 2RQKA 1FKAF 4CM2A 1OPZA 2RKIA 5DZ6A 2EG1A 1UTAA 5I3PA 4YY3F 4DR7J 2Z0GA 4M95A 3IRWP 3PTWA 5EWFA 2FJAB 4A8YA 5LMUF 2YNGA 1W2IA 1K44A 4RBUA 1SB6A 4NLXA 1U49A 5C24B 1OY9A 2NXUA 2ATCB 2RH3A 2UVRA 2LA4A 3ADAC 2EFGA 1T9XA 3T6BA 1FE0A 3THVA 5ETQA 3G82B 2PFDA 2Z2ZA 3BQ0A 2HZCA 3HJFA 3RB0A 1TKXA 1HI0P 4U8YA 1S12A 2JWNA 2HK3A 3SCLE 2VD3A 4PG6A 1WTFA 1REVA 4LFBF 4I68A 4DU7A 5A8RB 4B08A 4URGA 1HHTP 1RAFB 1BLUA 4C8KA 1TL7A 3MEKA 3FMBA 1N5SA 2MTLA 4DCJB 2DNQA 3P4UB 2J9EA 3TRGA 2HNZA 5HN0A 5KFBA 5KFGA 2PA8D 2HHTA 4WZQA 2ZDPA 4DFJA 3UDVA 1X5OA 2WW8A 4IYQA 4H54A 3PW4A 4HEA9 4DL4A 2NPFA 4O3QA 2QSFA 1BGXT 2GQQA 4OLOA 1Y3KA 1DTTA 2IM0A 3B4DA 1QD1A 5CZVA 4RW4B 3MFHA 1MWZA 2Z2MA 2AGQA 3ZTPA 1X4AA 2BVZA 2XCAA 3G6XA 2DRAA 4WPAA 1H7WA 5HLFB 3NNAA 2N82B 3MPVA 3M8PA 2EPIA 3C6UB 3PW7A 3TAMB 5HK4A 3O44A 1H3DA 1EB0A 4JBCA 4F4WA 3BO4A 2G0CA 3EYZA 4F02A 2B5JA 3HULA 3IAM9 1QDUB 3FRYA 4ZCKA 1TKDA 1YG0A 3KLHA 1SV5A 3NS5A 4NMXA 1JLFA 4PR6A 3A8IA 4KGXB 1RWOB 1LFPA 2DIVA 2RQ4A 2AQ4A 3HSDA 1KWMA 1UJ6A 4MK9A 1XR7A 1BMQB 5K8PA 1RQ0A 2IIHA 1RU1A 1Q53A 4LUBA 2Y9HA 2ABYA 3FBCA 1WSRA 1NEEA 4Q44A 2RRAA 2DNGA 4KSEB 3GFHA 2C2DA 4Y2CA 1S59A 2ROGA 1WF0A 1T7PA 3SV4A 5JUMA 3PXGa 5M2PA 4AT1B 2XS5A 1VRUA 2MKSA 2QJ3A 1U7LA 3BSCA 3PO4A 1BQMB 2GA7A 2W01A 1PG5B 3QT6A 3KDOA 3C46A 2PEHA 4ZA1A 1RXOB 1KVJA 3BEGB 3I4HX 2QFJA 2NYIA 1U8WA 4HACB 2CQ4A 4YR3A 4KBIA 4WFZA 2LQ5A 2XC9A 2VFSA 4NI2A 4CLLA 4YMEA 4CM0A 2VB6A 4UZBA 2VQEJ 1IQZA 5KFMA 4DMZA 1FTRA 5LT5A 1IR0A 4L3NA 5DLFA 2GHPA 3OSNA 2FVQA 2O67A 4ZVQB 2XS7A 2BE2A 1FDBA 4Q8FA 4ZCIA 3R7BB 4M5HA 3VAHA 2WONB 1D9FA 2AIRB 4OZ5A 4CYUB 5BYSA 2XMAA 2Q66A 3MXHP 1AFJA 4DV5J 1N5TA 1HWJA 4DWIA 1RHRB 4ED1A 3I82A 1LV5A 4J90A 4O0NA 2ZD1B 3DI6B 5BJRA 2LP4A 2RAQA 5CD4H 1R43A 5D0RA 4NCGB 1U6ZA 3TZWA 3PHEA 3GFZA 2HHVA 2H5IB 5D4PA 2V8HA 2MPUA 2B4OA 4UF4A 5ETRA 1SJ1A 2HBYB 4ECSA 2OSRA 4MKAA 2H3EB 4DSLA 4ED6A 3QAEA 4KGKA 5J1PA 1IKVA 2PMHA 4I2PA 2BJEA 2M5YA 3CDUA 2GJIA 3M30A 2MY8A 4Q5VA 3FEXB 2WSFC 1BUXA 2QZ8A 1JMTA 4WF9Q 3KK2B 4X4QA 3OTOF 1HLWA 2MEWA 4URSA 2O1PA 4LF7F 4OYXA 1JLBB 3CJRA 5HATA 2WRMA 2QE5A 1DQ8A 4B3OA 3RZAA 5KT5A 4X4SA 3KJQB 4HKQA 1RWWB 3TOQA 1CG2A 3J81Y 3QIDA 2F4VF 4KAIA 3GR0A 5A8KA 3ELHA 1JLEA 1IQTA 1FK9B 4HYKA 1LXNA 2IMOA 3BPDA 2MSTA 4O0IA 1YSJA 3V6JA 4MKBA 3TVYA 2A18A 1TTHB 1N36F 3M2VB 4ED5A 3HMJG 2XYHB 3WHIA 2DXFA 2ADBA 2RJZA 1SI9A 2FPHX 3E51A 5CAAA 1HHQA 1C1BA 2B4VA 2C3PA 2YKOA 3N9UC 4KY3A 2GIFA 2DNMA 4DX8H 5KFCA 2LU1A 5EDWA 4Q2LA 1URRA 5CQGA 1V3SA 2ASLA 1GMUA 3V81B 3LPEA 3TX0A 2B43A 1OPIA 1DQAA 3HHLB 3V4IB 5HJXA 2QRRA 1DARA 1K0VA 2YQ1A 4UY8T 2ADCA 1TL1B 1S1VA 4ED2A 4NYOA 1R8BA 2ILZA 5K5MA 3FNNA 4U7UD 4CLUA 2YPZA 1Y00A 1BXNA 3H98A 2FZKB 3Q8RB 2DNPA 4DR3F 2Q1LA 3SYZA 1F9EB 1X7VA 2I9SA 1AFIA 4ECXA 3P5BP 2EXUA 1HHSA 2WB1D 3U27A 4J7CA 2F65A 2E5LF 3W8GA 1RTHB 3IBWA 1NUEA 2Y1RI 3IN5A 4CWBA 4CNYA 3MM6B 4ILLA 1K9MT 2G1DA 2DGVA 1HARA 5FDLA 4XIUA 2IRYA 3X3UA 5DLGA 1VRTA 5HI7A 2BJ3A 4HDGA 3M2UB 3RRHA 1GMWA 3SCKE 2YY3A 2JLFA 3PRDA 4WYWA 4AL7A 3O1LA 1Q8BA 1BQNB 1F6TA 4BBYA 4I7FB 5CYQA 5ETTA 1RT5B 3J80U 1TP7A 1OWXA 5F3ZA 3N4WA 1Q4RA 2DR7A 2EC0A 2DCLA 2Z56B 3D28A 1TK5A 1WHVA 2J0QD 1F1BB 2X1GA 1TK8A 5E3PA 1IBLJ 4QBUA 2KDOA 2XULA 5BR8J 2QLBB 4CLKA 4YHHF 1VISA 5AXNA 3IM8A 1PYSB 1S5ZA 4QZVB 2P6TA 3UN3A 2C2EA 4C0BA 3AOCA 3MMCA 5D4OA 4ZOSA 3KLGA 1WEXA 2HVEA 4J9QA 5L1KA 1A7GE 4KFBB 5E3AA 1RAHB 4JI5J 5DGBA 2DR9A 2B9XA 4CLFA 4X84A 2J8SA 1RDRA 4AL5A 4CO2A 5SUHA 2CWKA 1UMJA 3MPDA 3GYGA 3ISND 1NKCA 3W1YC 3T1AA 2XQCA 3GIKA 2AV5A 1IWGA 5A8WA 1IKWB 1GQEA 2D3ZA 5LMNJ 4N5SA 2VFUA 1DY3A 3K57A 2UP1A 3DLJA 3I0SA 3MEEB 3FBBA 4Q0BB 1KLMA 3OUYB 2FJBB 1VC5A 2I5JA 2CPZA 1S1WA 3EVOA 3ZTOA 2E1AA 3R5GA 2CG4A 4NCAA 2HURA 4W90B 2MKCA 4ZDNA 2XLKA 1N4LA 4NLGA 1SJ3P 2E7WA 3H2UB 3NGKA 5L8RC 3PVXA 3SQGA 3MMBA 1H98A 4C0HA 3OXLA 3C66A 2CPIA 1R8HA 3A8JA 2FGOA 4I4BA 4Z37A 2VZ9A 2RB7A 2DGQA 1KQGB 3D66A 2I6WA 1NDLA 4DR1J 3AOBA 5KOXA 2V34A 1Z2ZA 2R7QA 3ZZPA 4K5SA 2M8HA 3PG9A 2VBYA 3P8BB 2ZH7A 1X4HA 5LOQA 4ZKAA 4LF4J 2YQ3A 2UV8G 2ZH2A 2GAGC 5J1NA 4DV0F 4H4OB 7FD1A 4EBCA 2DRDA 2H1YA 1IKYB 2JEIA 1JLQA 1FERA 4ICLA 4LFAJ 1RTDA 1O5JA 3UQSA 3MZIA 3HXMA 2DR8A 1FRIA 2W24A 3PIOQ 2PO4A 4WFXA 3EDQB 4K2XA 1CC8A 2V69A 4Q43A 1NLKL 4GKKF 3M6XA 4FNIA 1S0OA 1XR6A 1C0TA 1Q16B 2J7KA 1TVRA 1URNA 3O5TB 2KYXA 2JSXA 3DU6A 2ZH9A 4OX9F 4N41A 2VU5A 4ZN3A 3HVWA 4O4GA 1KVIA 3QFHA 2OEKA 3NBPA 5AT1B 5G0RA 2ACMA 1QM9A 3CMQA 3IFEA 3HHEA 4M5DA 3OBIA 3J81U 1OQ3A 2J7UA 2RDJA 4TKTA 2YWFA 3CDAA 2HHHJ 4R8UB 1HBUA 4ALZA 4QWAA 1NRKA 3M9NB 4B3SJ 4ZHRB 2XHWA 3CDBA 1EJ7L 3RW7A 3HF5A 3LTOA 2NQPA 1KEKA 4LSLB 3LP1B 1QSYA 1JLCB 3U7JA 3LH2S 4DR5F 2RHQB 3DOKA 1ZH5A 3AB2B 3AY0A 3BGRA 3GMGA 6FDRA 1F3FA 2DVIA 1D3WA 2OTLS 4JI0F 2KL8A 4FF1A 2ZBPA 2BW2A 1RU2A 1N5YA 4UQGA 2WW4A 2HHPA 3W66A 5GAEI 5HVFA 2Y1JA 3HM9A 4KKOA 4M5LA 2IJFA 2UVWA 1X5TA 4M94A 1N8RT 2MZSA 3VQTA 3IBPA 5K8MA 1RCOB 3PRVA 3BQ2A 1WTBA 2UXBJ 5L1IA 3MR2A 3HFKA 3HI9A 2DNNA 5HSPA 1LWFA 3UCUP 2C2OB 3FQKA 1GX5A 3LAMA 1P9QC 3QFWA 5AE2A 5D3GB 2CAJA 3Q8PB 4QU6A 3W64A 2RDIA 5KG6A 4J9NA 2CJYB 6FD1A 1S4FA 3K58A 4AFFA 2D7SA 2M8DB 5J1EA 2G2ZA 3LA0A 1X0FA 3IS9B 2HQIA 1YJRA 1U24A 2ALZA 4DFPA 4K4XA 3HZGA 2EKNA 2DNOA 1QAJA 5M2RA 3MAAA 4F3MA 3CCMS 5FJ4A 1I3OB 3GSDA 2DNLA 2W7AA 5KG1A 3C6TB 5K14B 1I94J 2FJWA 3EUNA 1TKTA 2QO3A 2XZTB 3PX4A 2GGPB 4ECUA 2FJDB 1CJTA 2YNHB 3DDKA 2DKOB 2VOPA 4C8OA 1IBKF 2J0WA 1T0TV 1KP6A 2MZTA 4ZVFA 3MECA 1O6XA 1SBRA 3K5MA 1OYDA 2NPIA 1TV6A 1XR5A 2KJVA 5CA5A 3D6HB 5BYRA 2ZC3A 5HO4A 2AKWB 2V8VA 1H72C 3H90A 4WXWA 1KD1T 5E41A 2AW0A 1YJTA 3EZ5A 1UZHA 3PYEA 3RBZA 2ZH5A 1QSLA 4YOEA 4C2MA 2WSEC 4Z2XA 2XY6A 2RKIB 2E7XA 1ZPWX 2IMWP 1KDNA 1U1PA 2WVCA 2JEGA 1JKHA 3NY0A 3LP2A 4USJC 3NCRA 4M5JA 4JI7F 1B0TA 2YNGB 5C5JA 3VAIA 3DLHA 1NB2A 3PW2A 1VS3A 2F9DA 3V6DA 4F0HA 3RR8A 2W2MP 4LIRA 3ET6A 4B9NA 3BDEA 3PJWA 2QMXA 2H9ZA 2IBKA 1TKXB 3ZZRA 3DMJA 3T19A 4DL5A 1R7IA 5LSLA 4A8SA 1REVB 1D9DA 2MY7A 3VAJA 3NGRA 8AT1B 1X5PA 4DUYF 4OHWA 4IH6A 2VASA 5I42A 4Y0FA 4ZPDA 1TL7B 3EZUA 2QLJB 2LCWA 5L1JA 2F8MA 2OH2A 2G2YA 4OJ3A 3VVUA 3A8KA 3Q2SC 3K5NA 3OFHA 2BBEA 2HNZB 4OI3A 3N79A 3LGNA 4Q8EA 1EP4A 3KOAA 4TXSA 2EVZA 3NAHA 4ZIVA 1CVJA 1VQ9S 3IRXA 3DRPA 3Q8SB 2UVVA 3ZTSA 1DTTB 2E1PA 2L9NA 4Y2AA 3OFGA 4X66F 4JV5J 3MDFA 3JXOA 4NASA 3CJ2A 1TL4A 2V8GA 4CLPA 2H5EA 2J6UA 3BREA 4HT5A 3QRRA 2VJUA 1S79A 2K06A 4I2QA 3U1NA 2HVDA 3M8PB 2BUNA 1AROP 2BQUA 4MK8A 3EGZA 1IVZA 2XI3A 3LP0A 1SH0A 2JEJA 2VODA 2B5JB 3FBEA 1FVQA 3BR8A 3MEDA 3ISNC 2ZH4A 2WVBA 1FRKA 4NRTA 2KVIA 1MMNA 1SV5B 3KLHB 2BJ7A 5LXRA 4K4UA 4RW8A 2CQIA 3FDSA 1JLFB 4ECVA 2CWXA 3K5OA 2LU2A 3K8WA 2QSWA 4EZ9A 4P10A 4ZPVR 4J9KA 1RE1B 3QPIA 3BGUA 3CD0A 3Q8UA 2HGMA 1YWXA 2RU3A 2HWHA 4CCHA 5ETKA 2IYGA 1N54B 3HX9A 5I4MA 2OUGA 4IH7A 1YRXA 3THTA 5F8NA 4FS1A 3W62A 3TEHB 2H4WB 2YKQA 3UCZP 1VRUB 1YJWS 1NM2A 2PMWA 2FVPA 3AODA 1DFDA 2W1BA 2R7SA 1N48A 3MOJB 4DR7F 1ZM9A 3R5CA 4NLUA 4AQYJ 4OHVA 3GYNA 5JJBA 3ZZTA 2XM3A 2F1FA 4B17A 3GPAA 3TP2A 3I55S 7AT1B 1DQ9A 2VBZA 1WJ9A 4YDXA 2R7RA 4NI2B 1FJEB 1OYEA 4ILMA 2DNZA 4OYWA 3QT8A 5EX0A 5KAKA 4NA1A 2OEMA 4FPIA 2UXDJ 5KFRA 1RKJA 1WOPA 4CZCA 1XIQA 3CCVS 4IR1A 3DDNA 2AEJA 3WC2A 2BE2B 2WTFA 3N0VA 4P72A 2FLNA 4ETZA 1Y5NB 2YVSA 1H74A 1D9AA 4F04B 4EZ6A 3M8RA 2R42A 1T9UA 4FVMA 5KFEA 5K20B 1OSDA 4NLQA 4JP8A 3M6VA 3RTVA 3R1HA 1GNKA 3HHNB 3KK1B 1OIAA 1S57A 4DL7A 3G71S 2NZ4A 4CNZA 5FD1A 3OL6A 3C3LA 4WU3A 3ZNUA 1BC6A 2BA9A 2DJWA 1UVMA 3TWZA 4XPCA 2LEPA 3R5BA 1LNQA 4TYAA 3LGHA 2KXHA 5HMXA 3THPA 3H5YA 2IJNA 1UWBA 1MN9A 1S9EA 2AX0A 3TUJC 2EWHA 4IRCA 3WIVA 4B3MJ 1IKVB 4I1TA 4I2PB 4OI6A 5KT6A 3LWMA 1WC0A 3M30B 2ZWPA 4DV3J 4L75A 1SIZA 3CCZA 4ELVA 1PO6A 5DO2A 2ERRA 2VPWB 5E5NA 1FO1A 4OYAA 2CQGA 1WOOA 2ZNZA 3H2VE 1NH7A 4LSNA 3OL9A 4XDDA 1KKHA 4B3OB 4EBDA 4OI0A 2AHOB 5KT2A 3AT1B 3OLAA 5D0HA 2EI5A 3A3PB 3KYLA 3G8TA 2XMKA 2KXNB 3GE9A 5A8KB 4C3LA 1JLEB 4WBFA 4J9OA 3HO1A 1YKWA 3AJDA 3Q8YA 3VAKA 1HYSA 3CUNA 1HQEA 4I6AA 3G8QA 4OJHA 1EQMA 1HBNA 2VPXB 1L3KA 2XO7A 4TQSA 4PWDA 2YX4A 5J2PA 4E0DA 2XSFA 4B9TA 4IOCQ 1C1BB 4EMDA 2EC2A 2RILA 2V8DA 2QLXA 2R7TA 4RW9A 1VQKS 1HMVA 2PMZD 4QPXA 3WZ0A 4OZLA 2M70A 1YQHA 1R6YA 1HNWJ 2KXFA 3ZTQA 3W7BA 1SL1A 4ZK7M 1C0UA 3DRRA 2CYYA 2Z30B 4ZVSB 2B7BB 2HFSA 4KTQA 1YZ6A 3VCDA 1QLNA 4HHHA 3NWGA 1S1UA 2VQEF 1ELOA 3SV3A 4W98A 1QE1A 1YVFA 1S1VB 4CO3A 2YBVA 1SKSA 2XBPA 5DDOC 2IJRA 4LVOP 1B4SA 1M1KT 1LXJA 4PUOA 1C2PA 4WWSA 8ATCB 5GADU 5DDRC 5IS2A 1NSQA 4CLSA 2VFTA 4YB5A 4G6VB 5H1SV 3OTEA 2GQ2A 2IHR1 4YS2A 2P6SA 4F0MA 4K8RA 3HJVA 2UUWA 3IA0A 4V1Ak 4DV5F 5JVGQ 1FVSA 1U2FA 1VIXA 5FDLB 1Y0HA 2XTJP 3UO0A 1OMSA 3P6YC 3DLEA 4KRWA 1SJ4P 1UAWA 3W5ZA 2OGUA 2BKOA 1VRTB 4MAKA 2H65B 5ETLA 1FWKA 2BV3A 2R7VA 4WTOB 1CULA 5CYQB 2HVHA 2DR6A 5IC4B 2AMCB 1Q8LA 2KN4A 3CC7S 2ZHOA 3OPKA 3CWJA 5KFPA 2BOAA 1VDHA 1D8ZA 1XEZA 4OJ1A 4M5IA 4RW6A 1CEZA 5IFMA 4NLTA 3Q83A 1FNMA 3W8PA 4C8YA 2FC9A 5AJ3J 3KJFB 3G96A 2C42A 1X31C 3FVYA 3UNYA 2JOQA 2OO4A 3MMCB 4NYZA 1JLGA 2FHOB 2UV8A 3KLGB 2IVMA 3MAHA 2ZOGA 2GX8A 4EO8A 4ZPAA 2F8EX 1TU0B 5T14A 2FVSA 3UR3C 4R5PA 4DF4A 3FZ2A 4C97A 3SSRA 1EETA 2KT2A 4C6AA 2DHGA 4FXVA 2PA3A 3T1HJ 1REGX 4C9DA 1M1GA 2BJDA 3KK3A 1SL0A 2FHMA 4QYRA 2EK6A 5U47A 3NGTA 5A8WB 1Q78A 2L3MA 2Q79A 4LR9A 4ANEA 1T9WA 4ZPBA 3I0SB 3VGVA 4QW8A 3OT9A 1KLMB 2ZE2A 2HFZA 2I5JB 4OYPA 1U47A 1S1WB 3TJAA 4M1KA 1X8DA 3QZ7A 3OJSA 5CYMA 3FUYA 4QIVA 2U1AA 3UN5A 1IR1A 3PR5B 3G6ES 1VQNS 3P49B 3NNCA 1DHMA 4ZITA 2IAJA 3SQGB 3MMBB 2QYGA 1UVJA 1RBLA 2OAUA 2YWGA 5DDQC 4WIIA 2OLWA 2WB4A 4PXEA 1R0AA 3MR7A 1SKRA 3BBBA 4A47A 4ZVUB 1QAIA 1VCTA 1HQ2A 1N5VA 1MWYA 1ZTTA 2CVIA 3HSJA 2FB0A 2LDIA 2WOMA 2V2ZA 2XMVA 2U2FA 2G0IA 2HMIA 5DDPC 2KB2A 1S99A 5B09A 1JLQB 4XPEA 4ICLB 1RTDB 1O51A 2VQFJ 4EBEA 1FRHA 3CMAS 3DHWC 2GFFA 3S7RA 3JSYA 2XI2A 1T05A 2JZ5A 2QA2A 3I56S 1C0TB 3TUIC 1RAOA 5L46A 1TVRB 4B9UA 1YK9A 1S9FA 4DU8A 4C8ZA 5HVHA 4LQ9A 3FGVA 1RT4A 3VGSA 4O4GB 4ECYA 1HNIA 2Q43A 3NBPB 3FMWA 4XK8C 5G0RB 3SEOA 1UKUA 4M5DB 1IBLF 3M8SA 4KV8A 4KYZA 4XDCA 5BR8F 3A3NB 2QTWA 4OX8A 4JOUA 1V3RA 1HBUB 3GB0A 4KGZB 1OY8A 2H48B 3MURP 2A0FB 1S4EA 1PJ5A 4RO0A 4KGVB 3CJ5A 5AXKA 3WIUA 2VF3A 1ACMB 2JJ4D 2AZ1A 3LPYA 1R0CB 1KONA 1Y5IB 4DZ6A 3Q86A 3DOKB 1FJCA 2MQPA 1EIYB 1CS4A 4ED7A 3BGRB 2C2RA 1QTMA 2L9WA 1PKUA 2RUSA 3S8SA 4JI5F 4CLWA 2JVRA 2ZVSA 1J5EJ 1S6UA 1N5YB 3D6FB 4PWWA 4WTYA 2EFVA 2FHJD 3H4DA 4KKOB 4QWDA 3TO8A 2F63A 4QIFA 3C15A 1F2HA 5KFJA 2DRBA 2NXEA 2ZITA 4F3OA 3ONQA 5KFOA 3M8QA 2HHQA 1EQ0A 1VQ6S 5LMNF 1ZM2A 1S7IA 3DXBA 3PFEA 1LWFB 4C8NA 1N34J 3RUBL 1FTCA 4YDDB 4OHZA 2HWIA 2XGQA 2DH8A 4KC5A 2Y8WA 3JS9A 2FJEB 4K50A 1WC3A 2J5AA 1YLXA 3L7UA 1SJFA 2KFNA 1RI7A 2HG4A 1GX6A 5GMEA 4DZDA 2PDAA 4FKYA 5J1EB 5F9LA 2UU9J 4OYIA 2GV1A 5D6GA 2PE8A 3PRBA 3G86A 1KTVA 4Y00A 3RB3A 1J5OA 2ZM6F 4ZPWR 3TYTA 1FKPA 1W2BR 1WKJA 4FVCA 4BC9A 4ZS6A 4DR1F 3CCJS 4TY8A 3MAAB 2WMMA 1B0PA 4CT8A 3ZZYA 1RTIA 3KHRA 3G87A 1UVLA 3PHTA 2X1AA 1TKTB 4W92B 4LF4F 1NDKA 4FXWA 2R7UA 3U1MA 1CJTB 4NZ0A 4AE5A 3MGJA 3BGFA 3KNGA 4CLTA 3KUHA 3MECB 4XAKA 1TUWA 1FJ7A 1I51B 3ULHA 4ATNA 4LFAF 1NK0A 4DFMA 2W9CA 1TV6B 4MTPA 3Q0AA 2KTQA 4DR5J 1Y10A 5DQHA 3H0PA 1VQ5S 3I9ZA 2KHCA 4CH7A 4DR2J 2OELA 1JXVA 3FCWA 2CQ1A 1HW8A 1ZM3A 1FWPA 2VG6A 2WBMA 3ZXWA 4ZVPB 1JNZB 2QL9B 3BQ1A 3O6QA 4DQIA 1KQSR 3DLGA 3BKTA 3HHLD 3F73A 2E7VA 3H42A 3R2CJ 1P1TA 1JKHB 4F8RA 1EZZB 2MYFA 2CDQA 1TQLA 2P9GA 3T5HA 1FXDA 3LP2B 4DBQA 3FK4A 4DR6J 1RZMA 4A4JA 1KBRA 2YKNA 2CPYA 2HHHF 1RUSA 1FEEA 2PI5A 1JWWA 4B3SF 3V6DB 3E2EA 2HPUA 1EX8A 3ZFVA 1K73T 1TL5A 3ET6B 3I96A 2J8AA 4F4XA 2HVZA 3CPWR 1Y4ZB 1TELA 3DMJB 1S6QA 3N6LA 3ETMA 3QGIA 4ID5A 2Z8QA 1ROFA 4FF3A 5I42B 1CC7A 1FD2A 1G7CB 3PYDA 1ULRA 5DG9A 3MCSA 4DLEA 2D3O1 3H4BA 4HTIA 4GVBA 5E3RA 3QLHA 2RIJA 2DH9A 5C2CA 4OZ2A 5KFDA 4FYDA 3C19A 1BWEA 1T02A 1L3SA 1S1XA 2WCXA 3H20A 1EP4B 2UXBF 4EYHB 4J5OA 3VTIA 3HKZD 3IRXB 2R2SA 1PC5A 3DRPB 2AJ2A 3OR2A 2BJ1A 3L4BC 3WDOA 3NL0A 4NX9A 4ED3A 3HVTA 3HZEA 2XMUA 1S49A 3TJ8A 4BWJA 2E1MC 2ATLA 2ILYA 3V4MA 1TFYA 2OSQA 4WJBA 2R3VA 1NKEA 1ZBTA 4AD6A 3MHYA 2RRBA 3ENQA 1UJ4A 1YRUA 5L38A 1HR0J 4I2QB 5F9NA 3BKUA 4CTAA 4KHMA 2VPYB 4Q45A 3LP0B 2IM2A 3CGIA 2M3DA 2FJXA 1ZOTA 3MEDB 4HLBA 1N88A 3MPWA 3T1YJ 2I1RA 1RT2A 4RW8B 2FVRA 1I94F 5BXIA 3BJYA 3H2LA 1HWLA 1NPKA 4AXJA 3BM7A 4ZIWA 2B9YA 3S1TA 2BOPA 2C3MA 2IM1A 4J37A 1S6PA 1TR0A 1NHUA 5H9EK 3OL8A 3CEDA 1VLOA 1WI8A 2JRSA 2CVEA 3P3DA 4ETXA 1VOMA 2L08A 2XMJA 2M2BA 2P9EA 4ZPTR 2W2OP 4GVLA 2MJNA 4WFYA 2AX1A 3CJ4A 3CJTA 4CLYA 3JSRA 2A1BA 5EGYA 3QJPA 4K7QA 3I5BA 3OVSA 2F9JA 4C98A 3OR1A 3D9BA 2HKEA 1XJWB 2FUG9 3K17A 3GJQB 5L9XA 2LQ9A 1UEUA 4CO0A 1U1MA 2LQJA 1R89A 1GAOA 2QG9B 5EWEA 4A8FA 1U1KA 2XO6A 2V6AA 2KYZA 1UW9A 5DM7Q 2VDIA 4Z7YA 1SC6A 2MB0B 3TI0A 4LR8A 1Y5LB 3BH6B 2E5GA 3HT3A 1AZSA 1R31A 1DBDA 3SCJE 3HFVA 3NWRA 3UD3P 1RHJB 4OZ0A 2VONA 1UFKA 4MFBA 1G4CA 4RKUC 4B02A 4DPTA 1AB8A 3AH6A 5FLXY 4ZVGA 1Q95G 2HQDA 2GC8A 3SQOP 4ZJLA 2KT5A 2G2OA 2BM0A 2CADA 2OI2A 4USTA 2IPOB 4EUVA 1D0EA 2G4BA 1X4BA 3MCOA 1TZ0A 3KJNB 3RB4A 3R7SB 4USIA 2IYIA 2RT3A 1U02A 3MMJA 3RW6A 2JLGA 4C0OC 4JV5F 2QL7B 5ETNA 1UWBB 3ZO7A 4WP8A 1S9EB 4LF5J 5EX3A 2VG5A 2RU9A 3UD5A 5A6PA 4C11A 1HIYA 2VV5A 4C48A 3WC0A 3K59A 1L3TA 5KT4A 3SI8A 3VGUA 3M1VA 4OMFG 2YNFA 2UUCJ 2ZHBA 1CQMA 1GT8A 2GO9A 1U26A 4LSNB 4DPYA 5HQLA 5CD4A 2ZJPQ 2FLLA 2CJKA 1NK5A 2OKQA 4MT1A 2C3UA 1MSWD 1U6BA 2OD6A 4DSKA 2YKPA 1WOSA 1RBOB 1PYTA 4GC6A 1U4BA 1HYSB 1IWAA 1HQEB 1WD6A 2D69A 2PIIA 3IR7B 3PJXA 4C8MA 1HBNB 2V67A 3C16A 2B8PA 4DFKA 4PWDB 4BWMA 5J2PB 3D2WA 2ZVIA 2R2UA 4P6QA 1U2CA 1RWPB 5FIIA 1A0OB 1PYOB 4NMLA 4LF1A 2MQLA 2VG7A 4KB7A 1FCAA 2MQMA 2F40A 3GV5B 4H4MA 4RW9B 2QFIA 5E2QA 2E44A 1HMVB 1S1TA 5KG5A 3R9LA 3GCWP 4FNHA 2KRBA 3EICA 1VQ8S 4AQYF 3TNVA 4DCPB 4KIAA 1S0VA 3DLKA 1N0UA 2RRNA 2IVYA 2DGTA 2AYEA 1C0UB 1NBEB 3DRRB 2AJFE 5I3UA 1LW2A 2ZZTA 4P73A 5A6WA 2BR0A 1M5PC 4DEZA 5KFFA 1S1UB 2AD9A 1QE1B 3M9MB 3N01A 1FX2A 4TNOA 3DKDA 2UXDF 1FE4A 1D8YA 2XYGB 2YH0A 2L48A 4YR2A 5IOLA 3JTOA 3LOUA 3CC2S 3EDRB 4K4SA 3B54A 1RLCL 4PUOB 3GP9A 3CIMA 3M6UA 3LAKA 4ENOA 2XNRA 1HA1A 3W9HA 5HAOA 2F7VA 4O23A 1WNEA 4CIOA 3HHLC 4RX6A 2AYMA 1TUGB 2RD5C 3DLEB 3PKMA 4ED4A 3MEGA 2AEMA 1DZ5A 1X9WA 1ZYQA 4IH5A 1VJWA 5KFQA 1FXLA 4MKVA 4G1QA 1V5VA 5GAHU 1Y7PA 3I4PA 5HROA 3P96A 1LEOA 1HKAA 1K1SA 1VQOS 3EGVA 4L73A 3C14A 4E2FB 1B7FA 1CULB 3ENAA 3RU0A 3EJMA 1IKXA 4ZP7A 2DBBA 2CZ9A 2BANA 1JB0C 2Y1LB 2HHXA 3VVTA 1RT7A 3CCSS 2I38A 4QIEA 2RF2A 4MIAA 3UVJA 4NLSA 4B3MF 2MMYA 2XNQA 3GJTB 1NKBA 4AL6A 1F5AA 4RW6B 4IG0A 4DV3F 1YBUA 1UJ5A 1HQUA 4YP3A 4I67A 2W7PA 2DNRA 4HI1A 3EM1A 1IJEB 2R8IA 1JLGB 1ZM4A 5KFXA 4DX5A 4ZP6A 1Z4UA 2BQRA 2H4YB 1LWEA 4LF6J 4KHPJ 3U1LA 2OJ3A 4X2BA 2MQNA 4JV0A 3ILOA 4I69A 2A6MA 1W7WA 4RUHA 1GFWB 4LF9J 1X9SA 4R5PB 3BF4A 1RGVA 5HQ8A 3GCXP 4DL0C 2RDDA 1EETB 3CSKA 1XMQJ 2YPYA 2GVZA 2NUHA 3NNHA 2ZBQA 3KK3B 2D74B 3R1LA 2ZH8A 5JMNA 2QLWA 3CCTA 1TMJA 3TAQA 5M2UA 5KFYA 3G6VA 3D54A 4R25A 4CH1A 4FF2A 1X4EA 3CDWA 3F44A 3RAMA 2DHXA 3FZBA 1PIEA 2XSJA 4FYXB 4JB8B 2ZE2B 4LMZA 4F50A 1FNOA 4X4OA 3UFCX 4RW7A 1IM6A 5A0YA 2IFXA 5CYMB 4P9SA 3D5MA 3DFEA 1EARA 1HNWF 4ED8A 5IT9Y 2K3IA 4NL5A 1NJIT 4ZPCA 2ROEA 1S48A 3BBCA 3KK1A 4ECZA 2NS1B 1U8SA 4I56A 2IAJB 3TARA 4X4RA 1TUVA 2DD8S 5GAEU 3V5RA 3CJ0A 3E3XA 1R0AB 1Y9OA 2QT7A 5DRKA 5KFUA 4O3OA 4NXNJ 4WK3A 5A2QY 3TANA 4F2SA 3OTCA 2BX6A 3F0NA 2XY7A 4IKAA 1U25A 3O8WA 2WOMB 3EGNA 4FBTA 1NZ8A 2HMIB 2VBXA 3US5A 2V9WA 4USHA 2VICA 1YZ7A 5MAOA 4L3KA 1NDCA 3MM9A 3DGPA 4DL6A 5IV3A 5KG7A 3RBDA 4CT9A 2CKWA 4RNOA 4TN2A 1JJ2R 1NK8A 3GIIA 4KE5A 4F4ZA 3GYXB 7FDRA 1UEVA 3PFOA 2KM8B 3CJ3A 4A8KA 1KOHA 2GQCA 1U6FA 4OX7A 2NXCA 4YFUA 2PC6A 1T05B 1PILA 5K9FA 2CNOB 1T9TA 4H4KA 5ETMA 1RAIB 4L72B 2QLFB 1K47A 3M9OB 3AJ1A 1Q82T 5B0EA 2V63A 1NU4A 1RT4B 5J2QA 2MSSA 2KG1A 3BGLA 4LFCJ 3J7YI 1UA1A 1YX2A 3D6TB 1HNIB 4ELTA 3MM8A 1B70B 3CCWA 3W60A 2AJ0A 1NSPA 4KV8B 1NPPA 4I6WA 2ZWOA 2G13A 2ROPA 4HHJA 2OPQA 1Q86T 2YXLA 1KHWA 5AJ3F 5J2NA 4B3RJ 1Q81T 3LF0A 4DLGA 2UXCJ 2H51B 4X4PA 3NMAA 1K8AT 1CS4B 1BWVA 1UWAA 2WZ1A 4BC7A 1BY9A 4QR2A 1PJ7A 3VWSA 4WCEQ 1CJKA 4DV6J 2NZCA 2G0JA 4E98A 4UY85 3BSNA 4M5GA 2ZH1A 3MPUB 3BSOA 3FRZA 4L6V3 1FD8A 1K1QA 2CJ9A 4RU9A 2KZMA 4S0MA 4FPRA 3T1HF 1ITPA 2GS8A 3C15B 5HL7Q 2ZKTA 5HANA 4J9RA 3M8QB 1XK8A 4RBVA 4PKDB 2VC1A 3S6EA 3PZPA 3I9V9 2KFZA 3VAFA 2E9TA 4ILRA 2FLPA 4BHQA 2CQ2A 4LJMA 1Z2LA 2V4QA 3W9IA 3DYAA 2L41A 4WZMA 3AAWB 2N3OA 1SCJB 2VFVA 4HTJA 3R27A 3ITHA 3N28A 2KVQE 2W4PA 2P2CB 3W2VA 4J9LA 3CF5Q 1MU2A 1TL3A 2BZ2A 4D3GA 2BE9B 1UVKA 4ZLJA 4N76A 1J5OB 2HGNA 2P5VA 3MR5A 1FKPB 3CT9A 2YNIA 3MD3A 2W9AA 4A46A 2GHWA 4TY8B 2VFRA 3AQOA 1A6LA 3N6MA 1YJ7A 1VI7A 1RTIB 3BV8A 4B9LA 3EZOA 1RISA 1T03A 4GC7A 1HNVA 4WKYA 3DRXA 1M90T 5IV4A 1VC0A 2ZZNA 4NZ6A 2R8KA 1RYSA 2FGCA 2ZFHA 3GV8B 5G4DA 4UOCA 2W4DA 1VLYA 1FRXA 3ETOA 4GO5X 3TZXA 4LRDA 1RHMB 2XWYA 4B9VA 2W9CB 4P74A 2VQFF 2XGPA 2HIQA 4CDIA 2RE1A 1W26A 2PEBA 2R9LA 2Y3YA 5IQ6A 2OEJA 1R27B 1VQPS 5KFLA 4X4VA 2KKHA 2DR5A 2VG6B 1DLOA 3R97A 4F26A 2HS4A 2DHSA 3KMSA 4KQZA 2XMMA 3B82A 1PAUB 2C2MB 2RS8A 3R5JB 3H8YA 2BABA 3DLGB 2AP6A 2C3YA 2RUGA 1Z1ZA 4X62J 1H38A 3E01A 1XC9A 5ADZA 2BACA 1YHQS 2JVOA 1RWXB 4JI4J 3HVAA 3D7SB 2M52A 2YKNB 2VA2A 5K8OA 2J76E 4OZJA 2MDAA 3NS7B 2DHAA 3MM7A 2FIUA 2PSZA 3SCIE 1RJJA 5H9EJ 4DV7J 2CQ0A 2DGUA 1X4GA 4MYUA 5GAGU 5B0GA 1S6QB 4PXDA 2X51A 2D1CA 2HRUA 1P8GA 3G4SS 3TVZA 1GXTA 3J7Z5 4WP9A 4ID5B 4PXBA 2O01C 5GAHI 1J5EF 4UUWA 2ZM6J 1ZAWA 4Q2MA 4JV1A 1FA0A 4GVBB 3QLHB 3GSIA 4MIBA 1U0HA 3FSYA 5IT9U 1GMWD 2POKA 2DXDA 2MHNA 2KFYA 1XTZA 1S1XB 4DG1A 2WK4A 3DHXA 2QA1A 3MOZA 3JQJA 1VC6A 4P71A 1O0PA 1N34F 3GWCA 4FZVA 2I2YA 1TK0A 3K7RA 4RNFA 2R8JA 1NNDA 3OR2B 2DEJA 1UP1A 5D4NA 1CQNA 1SUQA 2HQCA 3K8VA 2AT1B 5A2QU 3HVTB 2O66A 5GVQA 2VJVA 1N0VC 3CD6S 5T7LA 2P9CA 4U67Q 1GK8A 3OVAA 3CULA 2UU9F 2F4FA 4ECTA 2V5HG 1FKOA 2VPZB 3TQ1A 3DXSX 2DNKA 1RBAA 4NOHA 4CTAB 1U1OA 2R7XA 3RBEA 3I0RA 4ZP9A 1N33J 1MMDA 5MLCV 5CXTA 2DO0A 1G6BA 2OFHX 2IDEA 1IBMJ 4X65J 3OXGA 1RT2B 4QU7A 4RUAA 1K0TA 4AXIA 1D1UA 1CLFA 2V8PA 2IDLA 1HNZJ 3BO2A 4DPXA 1J27A 3IG1A 1S6PB 2FY8A 4LREA 2AEFA 4KH0B 3DGVA 3FCVA 1FEHA 4LT6A 1SC3B 1VK3A 2BMBA 2Y0BB 3D1QA 3H7HB 4HDHA 2CZ4A 3B8HA 4HR2A 4DR2F 4K4TA 5LSOA 4PRFA 1IXKA 2FDNA 5HMZA 2E29A 2MKIA 1U09A 1IM4A 2OMOA 1Q0NA 2Z2YB 4DSEA 3A4TA 1FRJA 1YI2S 3OR1B 3DRSA 4JI3J 2HS0A 1SJQA 2M0GB 3PKYA 4DV4J 4U9RA 3FFIA 3JTPA 2LYVA 3KLFA 3CJQA 4DR6F 2HK2A 3WX8A 3TA0A 3WBZA 2PT0A 4P7TA 2QC3A 4ID8A 2CG8A 1FI4A 3QJLA 4NLVA 4QPTA 3KUGA 2MKJA 4IFYA 2NYHA 2X3GA 2HZAA 2HVIA 4A8XA 2ZH3A 3RAQA 4ITSA 3IP0A 4PG8A 4F36A 3D3BJ 1AZSB 3FJ2A 3JAMY 1ZA1B 3BDPA 2C2ZB 4B9MA 4P7VA 3EPGA 4MFBB 2OD4A 2MZJA 3AD7C 4X4TA 1S6OA 1RP5A 1NB7A 4N7TA 4FBUA 1LOUA 1N32J 3X1LB 1A9NB 3CVKA 4C7QA 1PBAA 5LJ5Y 3MWBA 1X4CA 3DOLA 3NGUA 5DG8A 2BEFA 5A76A 2J7WA 1CJUA 2HFVA 5B0DA 3N5FA 2KG0A 2HYIB 3OW2R 5IWAJ 1LW0A 5KFIA 2NXJA 1B64A 4QIWD 2K3KA 5GMDA 1S77D 2CA9A 1LQ9A 2VBWA 5EUHA 1NHKL 4OZ3A 2KU7A 4IO1A 5AE3A 1TKZA 3F56A 1WKKA 4J9VA 4EEYA 4O3NA 4NCBA 2W2PP 4Q7AA 2VG5B 4C11B 5DQGA 2HBRB 2M4MA 2YWKA 4DJBA 1HR0F 3UN2A 9ATCB 4DV1J 3M1VB 1KC8T 1XBWA 4G1IA 2MLYA 2YNFB 2JX2A 2JEFA 3OVBA 2M88A 4F3QA 3CJ8A 1RA7A 1T9YA 3A13A 4HVZA 2B0GA 3RBXA 4YB7A 2GJ2A 4WFAQ 4DL2A 1QAXA 4WK1A 4IDKA 2N7CA 5KG3A 4FXDA 2KO1A 3MR6A 3M7VA 2EG2A 4TVAB 3T1YF 3N6NA 1FXRA 4OV1A 4R0EA 4ES3A 2WVFA 4USKA 2LQ8A 1MNEA 1AYEA 2YTCA 1NK7A 1T8EA 1U0SA 2OMLA 3IAS9 2CJBA 1RAAB 3GJSB 4U8VA 5ETVA 1BE4A 1UPMB 3BZQA 1CJVA 4P2XA 3C16B 1VQSA 1VYAA 3QQCD 4EU0A 4DXLA 1WHYA 2DO4A 1PGZA 2VG7B 3D67A 3MCNA 4M63A 2YQ0A 1WC6A 4R0JA 3T5JA 3EX7B 4K2JA 3PEJA 2Z57B 3UR0A 4H4MB 3PACA 1S1TB 2CQCA 3T41A 2V68A 2DIUA 4H4KC 3DLKB 3T5KA 2R7OA 3Q89A 1H7XA 3J80Y 1H2TZ 2XHCA 3QNWB 2VIHA 3NAIA 1GTEA 4DUZJ 1E6VA 2GMHA 4XO0A 5I3UB 3B78A 4GMKA 2PN6A 3MF5A 1LW2B 1CBKA 3MUMP 1X60A 5KFAA 4F0KA 1HWUA 3POTA 1SQEA 1NSKL 2CIMA 4OYMA 4NEYA 1G1XA 2RHSB 3HT0A 1MW7A 3ZZUA 2JFDA 3H59A 1RT1A 4X64J 2FZGB 3PR4A 1FWLA 4OL8A 1EKSA 2LECA 1RTZA 1S9GA 2BJ9A 1KQFB 2ZC4A 1U1NA 5D77A 5DQIA 3MMAA 3KG1A 5B0BA 4F67A 3OFFA 1NMEB 3HDSA 3CC4S 4PXCA 1KRPA 1AT1B 2OPSA 3D4JA 2VL1A 2YH1A 4C4WA 3RRGA 2V0NA 3HKWA 1NJZA 2RMLA 3MEGB 2FVCA 5ETSA 2GVDA 2BQ3A 2DNYA 2HW3A 5LJ3Y 2GCFA 2O5DA 1SKWA 4OHXA 4G1QB 1PAEX 4FKXA 2A2DA 2A3JA 5HROB 4DHVA 3BH7B 3V2UC 1EHWA 3KLEA 3C14B 5E3CA 3NOGA 1F0XA 1IKXB 2BANB 4K4ZA 3BPSP 1RT7B 2RF2B 5GAGI 2AJQA 4QW9A 4LF5F 1WSVA 1ZETA 3UVJB 3RJMB 1G3OA 3LO3A 4JI2J 1JLAA 3FC9A 2ZUAA 3BN4A 3N5BA 2IVFB 4IG0B 3W61A 2BW7A 4FN5A 1HQUB 2UUCF 4EK2A 2P8IA 3R3TA 3MI7X 4YN3B 1Q8KA 1XNRJ 4F4AA 4K4WA 2CQPA 3OTBA 1KFDA 4B9SA 3IXQA 1LWEB 2H5JB 1L3UA 4MYTA 4IO9Q 3VHQA 4OYOA 1HNXJ 2NXNA 5DM6Q 5B0CA 1NZAA 2VKRA 2ACYA 2Z4PA 3MM5A 2DTJA 2DK2A 3ZZZA 3L09A 4N47A 2GVZB 3PV8A 2LEAA 3PX0A 2JNJA 3W63A 4F25A 4FF4A 1LK5A 2X1FA 3PJ9A 4LR7A 2DT9A 1XQIA 3I87A 2D41A 2BRKA 3IR6B 4KR0B 2QIFA 3CD5A 2XSJB 1HD0A 1OY6A 2XS2A 3BKFA 2DB1A 2CPEA 3E8OA 5H9FK 4PPZA 4RW7B 1ZAXA 4L76A 5A0YB 2DGSA 4O44A 4NXMJ 3JAMU 2QGFB 3JYTA 4DQSA 2CPFA 4LRFA 1DURA 3W65A 2N3LA 2CZVC 1RLDA 1Q7LB 4F4KA 2A6OA 2B56A 5THWA 3U02A 4PEOA 4ZVOB 4PCQA 1OS5A 1ZZNA 2V2QA 2ZDOA 1UEKA 3PM9A 2HLUA 3R7NB 3H5XA 1T3NA 4QWBA 3TR5A 2AYBA 3H25A 4DQPA 2HHSA 3Q23A 3KNAA 3KTQA 4OI4A 1ZA2B 3KUEA 4DV2J 2AGPA 3J81j 4K5RA 3D0GE 2CNKB 2UUAJ 3FBFA 2HEKA 2B6AA 4Y65A 2XYPB 1WUUA 3MM9B 3DGPB 3BN7A 5IM0A 4MN4C 5JXSA 3VAMA 1ZS6A 1F2GA 2AZ3A 4ZLLA 2CNNB 2V2KA 4K0KJ 2B4PA 3W9JA 2ASYA 2K1RA 3D0HE 5CZXA 3HVRA 4QYZK 1UVIA 1KS2A 1PJ6A 4QR0A 5J2QB 4QOTA 1U1RA 2VHGA 1NJWA 3IR5B 2RQMA 4NA3A 1UA0A 1YBTA 3MM8B 5CCMA 2HRTA 1WDDA 1VFJA 3M8ZA 3SSSA 2K7KA 1WF1A 1M5KC 1M5VC 2OPQB 5J2NB 4IOAQ 1WC1A 2LVWA 4FS2A 2EFNA 4RZRA 5AE1A 5KTQA 1RTJA 3Q8VA 3M8YA 2OPRA 4LRBA 1NO8A 3EWGA 4LF6F 4LQ3A 1AUSL 3Q2TC 4KHPF 4B3TJ 1VBZA 5KG0A 1RABB 1B99A 1CJKB 3M05A 5E33A 1N6QA 3RRKA 1F9FA 2I0XA 5F0WA 4LF9F 2BYCA 1XMQF 4G1PA 1D09B 4CRJA 1OQ6A 1YBAA 1CSJA 2HFOA 1FDNA 3I32A 5HMWA 2E9RX 1NCLA 3NG8A 4NLWA 1R3NA 4USVA 1ZTWA 3KG4A 2KH9A 4IRKA 1S0NA 3DYAB 1KOOA 2OP5A 2KHDA 2LLZA 4JI6J 3JSBA 4I64A 4DOZA 2DITA 3ITHB 2Y8YA 3FEYB 3JTNA 2FLOA 3VGTA 2CPJA 1RYRA 3W2VB 4RL1A 1MU2B 1TL3B 1HD1A 5J2MA 4WE1A 2YKAA 3AJ2A 1NDPA 3CDEA 1PSDA 1HL6A 3PEHA 3QRQA 2EFQA 2B7CB 2V4JA 1FJGJ 3OHBA 4HL9A 5CH7B 1JXEA 2YNIB 3NP5A 4O4RA 5BYQA 5HJYA 4P52A 3C8YA 2CQ3A 4IUFA 3HSGA 4NXNF 2WVDA 3CIZA 4OLPA 4Y34A 2WVEA 2AF6A 3D6MB 3JQKA 2JC1A 3H5SA 3K2YA 1T03B 4ZVRB 4ELUA 1HNVB 4CI0B 4EO6A 1F5BA 4PG4A 1L5UA 3IM9A 1V6HA 5F8GA 4NRUA 3FSIA 2WHOA 4OIXA 4DR4J 5D0EA 4F7VA 1HW9A 1XMOJ 2N7YA 4Y6IA 5EN1A 3HD2A 2BDPA 1IUJA 5B7WA 4TLRA 3KG0A 1XNQJ 1VQYA 1ICEB 2ZBIA 3KLIA 1CPZA 3BSAA 1H2VZ 1NJYA 1DLOB 3J7ZT 4LSZB 3JSMA 1KVKA 4TU8A 4UTGA 2MLZA 2BM1A 4MIWA 3MCMA 4ECRA 3OFEA 3SBMA 4NZ7A 2HFUA 4LFCF 2GHVC 3KMQA 2D3OR 3E01B 2X3DA 4KGMA 1RAGB 4N56A 1UW4A 2WBRA 1RWMB 1F3VA 1FT8A 2MKHA 4A48A 2Z58B 2IC3A 1YIJS 2C2NA 4UZCA 4B3RF 2XMWA 4MJKA 4WFBQ 3MM7B 3K0JA 4Y28C 5L9NA 2UUBJ 2UXCF 2E1RA 3KHLA 2O3DA 5DS7A 3TA2A 1WF2A 4GKJJ 1MROA 1KNZA 4MK7A 5CYJA 3KKFA 3I6PA 2JH3A 4ZLNA 2ASJA 3IWNC 4JI1F 1VJQA 4DV6F 4J9MA 4P2SA 2FYXA 1Q5VA 2GO8A 4QJVA 3R8YA 2GIRA 2G1HA 4ZLPA 1JIHA 2V4RA 3R5DA 1XWLA 2W8KA 3BYRA 3OQ2A 4FYVB 2PFFB 1U0HB 4EGLA 1WG5A 4BDPA 4LBPA 2MZQA 3HK2A 3PNIA 2ZNYA 3M2RA 3SSQA 3MFIA 3QIPA 4DG1B 2J9DE 4PQUA 3ILLA 3R6LB 1BD6A 3M32A 2F3JA 3EXYA 4KO0A 4DSJA 3VQSA 3DLBA 2DPJA 2DY9A 2J0XA 3PYGA 3C2PA 3K5PA 1SUQB 4LRCA 3DNCA 2R8HA 3UE2A 3Q22A 4RWXA 2NREA 3HP6A 1HWIA 3AD9C 5T7LB 1NH8A 1RCXB 1SIWB 4DPOA 1SH3A 3CJSA 2NCKL 1FKOB 2J0SD 2IRXA 5F8MA 3I0RB 1LWCA 3OLBA 2EFOA 4J9UE 2OIHA 3TZZA 2UZAA 3IWXA 3LW5C 3AHPA 1RHKB 1HI1A 1HBMA 2ZEJA 4UOFA 4FYWB 3EPIA 1R8PA 4RPFA 2HNYA 5F8LA 3ZC4A 1HBOA 1VQLS 3BS9A 1X4DA 5HP1A 3IG1B 4K4YA 2ZH6A 2LKZA 1RWNB 3FQLA 3SMZA 4KH1B 3RB6A 4IG3A 3QYYA 1FHTA 1M5SA 2FC8A 3S01A 2ZBCA 5LSRA 4RR5A 4QWCA 1HPZA 2LQBA 4ZMMA 5C7PA 3F41A 4OYBA 2CPHA 1V3ZA 1RT6A 4QWEA 2W25A 2EFPA 4LIWA 2QN6B 1C4CA 4CP5A 2KT3A 3DC2A 5K8NA 3PYFA 3RR7A 1UFWA 1WHWA 1QTNB 3DRSB 3QATA 1U48A 4O3SA 4RU2A 1AA1B 3TVKA 2HQFA 3KHHA 2ZBRA 4X62F 4F4YA 4J91A 3UPFA 3AA8A 4CQ1A 3FFIB 2HRYA 3QJJA 4PYDA 2NSBA 3KLFB 3GTYX 4RWWA 4JI4F 3AXMA 3GIRA 5C25A 4DSIA 4JYAJ 2V50A 2MHEA 4PABA 1FFGB 4NEZA 3R2DJ 4IFYB 2WSCC 3W5YA 3GZ7A 3B4MA 4DV7F 1RHUB 4M5KA 4N8NA 4IRDA 4OHYA 4YB6A 2GJFA 1SQGA 1JX4A 1OSCA 1IJFB 3J7A1 1SQFA 2Q3PA 4NA2A 3FCHA 2B9WA 3JB9k 4OJGA 3NKYA 4DF8A 4LBHA 3DOLB 4JI8J 2YKMA 1QAYA 2Y0SD 1CJUB 2RNEA 2NLWA 1LW0B 2MGZA 1TAUA 1N52B 3ZZOA 4O3PA 2W2QP 4ZVHA 5KFZA 1Q1KA 3I5AA 5ITHA 3QMQA 1N56A 4W4MA 2XEXA 4UT4A 5HBMA 3QT7A 2CJAA 3QGHA 2CQDA 3BYPA 1TKZB 1C1CA 4YEAA 1SL2A 2AJ4A 3HHKA 2IRUA 3L7PA 3QO9A 4HI2A 1FDDA 2OTJS 3EGWB 2CUYA 2GAHC 2IA0A 1GEHA 2N4DA 1YJVA 3ENWA 1M5OC 1B7YB 2ZOFA 2HQ3A 2DXEA 2K8GA 4GO7X 4RBTA 2DEIA 1N33F 1Q79A 3T6JA 4IDKB 5SZTA 2QYCA 2CXEA 5C42A 1IBMF 4X65F 1WC5A 2NSCA 2C28A 4DS4A 5I3QA 1VK8A 4DN0A 1GH8A 4C8LA 2HIYA 1HNZF 1YTYA 2Q6CA 2CJQA 4OYZA 2R2TA 2HNDA 2R8GA 1JJHA 3QWPA 2VH7A 1U1QA 2IM3A 5F8IA 2EEYA 1APSA 1WELA 1CJVB 3MD1A 1GXUA 4CH0S 4EI2A 3IMQJ 2AJ1A 2EW9A 5ETOA 4LF8J 1AXQA 3KDNA 3G8SA 3A8EA 3L7OA 3CJKA 1U45A 1YGYA 3VAGA 1WEYA 3IO1A 4LF2A 1IBCB 4LRAA 2AGOA 2ZKUA 3SFGA 4JUZA 3KJVA 1RT3A 2KJWA 2L9DA 3H40A 4JI3F 3QGGA 1NK6A 2HS3A 2DISA 4ES1A 2RQCA 2JDJA 5DG7A 4G65A 4YY3J 4DV4F 2BJ8A 5KOWA 2HAIA 2XZDB 1JQGA 1E6VB 5LMUJ 2E5JA 1WORA 1P1LA 4U6PA 4PZVA 3W2WA 4A8QA 1NK4A 2HSEB 3POTB 5RUBA 1KQKA 1GTHA 2BXJA 2MLXA 1RT1B 3SDEA 5D8HB 2H54B 5F8JA 2IA6A 2DH7A 1S9GB 3NGDA 1UZDA 2C2KB 4KT0C 4NLOA 3ISZA 1VBXA
chains in the Genus database with same CATH topology
2LQ5A 3M6WA 1KLMB 3MMAB 2ZE2A 2HFZA 2I5JB 2HWTA 1U47A 2POKA 2MHNA 1S1WB 2XC9A 2VFSA 2KFYA 4M1KA 2W7OA 1X8DA 4YMEA 1XTZA 1S1XB 3QZ7A 3OJSA 2M9KA 1C4AA 5CYMA 2VB6A 4DG1A 2WK4A 1IQZA 3DHXA 4QIVA 2U1AA 1FF2A 2QA1A 3MOZA 2OPSB 5KFMA 1VC6A 2XB2D 2OPPA 1N32F 4DMZA 5H9FJ 1O0PA 1FTRA 3PR5B 1N34F 2E66A 3GWCA 4FZVA 2I2YA 1TK0A 3K7RA 5LT5A 4RNFA 3G6ES 3I31A 2J6SA 3GILA 1IR0A 1VQNS 3NNCA 4L3NA 3P49B 2R8JA 1NNDA 1DHMA 4O3RA 5DLFA 2GHPA 3IGVA 3OR2B 3OSNA 3DOMA 2IAJA 1UP1A 3SQGB 3MMBB 5D4NA 2FVQA 2O67A 1CQNA 1SUQA 1UVJA 4CO1A 3K8VA 2XS7A 5IWAF 3OSPA 2OAUA 2BE2A 1FDBA 2GNKA 2YWGA 4Q8FA 3HVTB 1UETA 2O66A 2C22A 5GVQA 4ZCIA 5DDQC 4WIIA 2XWXA 4Y3CA 1N0VC 2OLWA 3VAHA 2WB4A 4PXEA 2WONB 1D9FA 5T7LA 3CD6S 2P9CA 1R0AA 2HFNA 3DM2A 4OZ5A 1SKRA 4U67Q 5BYSA 2YWHA 4A47A 4TY9A 5E3QA 3OVAA 2Q66A 3CULA 1QAIA 2UU9F 3KLEB 3MXHP 3TA1A 4ECTA 3CCUS 1N5VA 1AFJA 2V5HG 1N5TA 1YJNS 1MWYA 1FKOA 2VPZB 3LANA 3TQ1A 1ZTTA 1HWJA 1QUVA 2CVIA 4DWIA 3DXSX 4DL3A 1AUDA 4ED1A 2DCUB 2DNKA 4NOHA 4CTAB 2FB0A 2LDIA 2WOMA 1U1OA 2XMVA 2U2FA 3I82A 1LV5A 3EXCX 2R7XA 1B0VA 3RBEA 2ZD1B 3I0RA 2HMIA 5DDPC 3DI6B 5BJRA 4ZP9A 2W9BA 1MMDA 5MLCV 5CXTA 2MJUA 2DO0A 2KB2A 1G6BA 5CD4H 4RUCA 1R43A 4NCGB 1U6ZA 1WHXA 2OFHX 1JLAB 1S99A 2D9PA 3PHEA 5B09A 3GFZA 3IC1A 1JLQB 3OXGA 4XPEA 2HHVA 1RT2B 4QU7A 4DV1F 4ICLB 1RTDB 1O51A 4RUAA 1K0TA 4AXIA 3MTKA 1JNRB 1Q8IA 1D1UA 4EBEA 4I6YA 4Y2IA 5D4PA 2V8HA 2MPUA 1CLFA 1FRHA 2B4OA 3CMAS 3DHWC 1SJ1A 3AA9A 2GFFA 2ASDA 3S7RA 3JSYA 3BO2A 4ECSA 2OSRA 2XI2A 4MKAA 1T05A 3IG1A 2Z2LA 4DSLA 2JZ5A 1S6PB 1UL3A 4ED6A 4PPDA 2QA2A 3QAEA 3I56S 1C0TB 4KGKA 3TUIC 5J1PA 2KRRA 1FEHA 1TVRB 1IKVA 2YX7A 3PW0A 4B9UA 2PMHA 1S9FA 1S76D 4LT6A 3MUTP 4I2PA 2BJEA 4NYPA 2JL9A 2M5YA 4C8ZA 1VK3A 1XERA 3CDUA 3D1QA 1E6YA 4ZCMA 2GJIA 4HDHA 3M30A 4IFVA 2MY8A 4LQ9A 4Q5VA 2CZ4A 3FEXB 1JJ4A 3FGVA 1RT4A 3B8HA 2WSFC 4UW2A 4O4GB 4ECYA 4QYZJ 4DR2F 3UW1A 2MKKA 4K4TA 2QZ8A 2EBEA 1JMTA 1HNIA 5LSOA 3KK2B 4X4QA 2Q43A 3NBPB 4WF9Q 3BR9A 3OTOF 4PRFA 1IXKA 3FMWA 4XK8C 5G0RB 2FDNA 5HMZA 3SEOA 4PG5A 1UKUA 4URSA 3BO3A 2O1PA 2E29A 2MKIA 4LF7F 1U09A 3MM5B 3MPYA 1JLBB 4M5DB 1IBLF 1IM4A 2OMOA 3M8SA 4KV8A 3J7YU 4DSEA 4XDCA 5BR8F 2WRMA 2QE5A 1DQ8A 1Q7YT 1G2EA 4B3OA 4OX8A 3RZAA 4JOUA 1V3RA 1FRJA 1HBUB 5KT5A 1YI2S 3GB0A 4X4SA 3OR1B 2ZOMA 3DRSA 4HKQA 3MURP 2HS0A 2X1BA 3TOQA 1CG2A 3J81Y 1SJQA 2M0GB 3QIDA 2F4VF 4KAIA 3PKYA 3GR0A 3VALA 3CJ5A 4U9RA 5AXKA 5A8KA 3CMES 2JJ4D 3PO5A 4WKRA 2XY5A 2V9KA 1JLEA 4KJIA 1IQTA 3FFIA 3JTPA 2LYVA 3KLFA 1FK9B 4DR6F 3LPYA 2XZWA 4HYKA 3TA0A 3WBZA 1KONA 2PT0A 1Y5IB 3HHDA 1LXNA 3TW0A 2IMOA 2GMLA 3DOKB 1YJUA 1FJCA 4P7TA 2MSTA 1NK9A 2MQPA 4ID8A 4O0IA 1YSJA 4ED7A 3V6JA 2C3OA 3BGRB 2C2RA 1QTMA 1PC4A 4MKBA 3TVYA 3QJLA 2A18A 2L9WA 1N36F 4NLVA 4O44B 1DTQA 5CHCB 4QPTA 2MKJA 4IFYA 3M2VB 3S8SA 4ED5A 5B0FA 1M5HA 4JI5F 3JYTB 3O2IA 2JVRA 2X3GA 2ZVSA 3HMJG 2HVIA 4A8XA 2ZH3A 3RAQA 3CD7A 1S6UA 1I6JA 4ITSA 1N5YB 1FESA 5KFNA 2ADBA 4PG8A 4DUZF 4WTYA 5F3TA 2EFVA 2RJZA 2FHJD 2E5IA 3H4DA 2FTRA 2VKZG 1SI9A 2FPHX 3E51A 2VOOA 4KKOB 4QWDA 1Y3JA 3FJ2A 2AWZA 1C1BA 4V19X 3TO8A 2B4VA 3JAMY 2C3PA 2YKOA 4QIFA 3BDPA 2NR0A 3N9UC 5KFJA 5B08A 4YR0A 2DRBA 2DNMA 4DX8H 5KFCA 2ZITA 4F3OA 3KHGA 2LU1A 5C24A 5EDWA 4B9MA 2DGXA 3ONQA 4P7VA 4Q2LA 5KFOA 4MFBB 2OD4A 3M8QA 3EPGA 2MZJA 2HHQA 4X4TA 2CQBA 1URRA 4X64F 1ZAVA 2JC0A 5CQGA 1S6OA 1RP5A 1NB7A 5LMNF 3L95X 1VQ6S 4FBUA 3ENVA 1LOUA 1V3SA 2ASLA 3V81B 1M0SA 1ZM2A 3DXBA 3PFEA 3X1LB 1LWFB 1A9NB 3CVKA 4WYLA 4C8NA 4C7QA 5LJ5Y 3MWBA 1X4CA 3DOLA 3UNGC 1FTCA 4YDDB 2B43A 5DG8A 5IT0A 1OPIA 2J7WA 4OHZA 1DQAA 3HHLB 2HWIA 2XGQA 3V4IB 1VQMS 2QRRA 2DH8A 1DARA 4KC5A 5B0DA 3N5FA 1JK9B 2KG0A 2HYIB 3UDCA 4IOBA 2FJEB 2ZJQQ 3OW2R 4K50A 1K0VA 2J5AA 2LDYA 3NCQA 1LW0A 1SXLA 5KFIA 4UY8T 2Q6BA 2HGLA 2QV6A 2ADCA 4QIWD 2B6AB 1B64A 3AQPA 1SJFA 2KFNA 2K3KA 4DSFA 1RI7A 4NPOA 1TL1B 2HG4A 1GX6A 1VQ4S 1S1VA 5A8RA 4ED2A 5IM0B 2PDAA 4NYOA 3PW5A 1R8BA 2ILZA 1S77D 5K5MA 5J1EB 3FNNA 4JV2A 5F9LA 4U7CA 1Y00A 2GV1A 3H98A 5D6GA 3Q8RB 2DNPA 4DR3F 2Q1LA 2PE8A 3PRBA 3G86A 3L3CA 1KTVA 1LQ9A 4Y00A 3SYZA 2VBWA 5EUHA 3RB3A 1J5OA 3MTJA 2ZM6F 2KU7A 4IO1A 3LWLA 4ZPWR 5AE3A 1TKZA 1X7VA 3TYTA 3F56A 2EKYA 3QZ8A 1FKPA 4UQTA 1HI8A 1W2BR 4EEYA 2K1RB 3CCQS 4FVCA 4O3NA 4RNHA 4NCBA 1NHVA 2I9SA 4BC9A 4Q7AA 4ECXA 1AFIA 4ZS6A 2VG5B 1HHSA 4DR1F 2WB1D 1QJHA 3CCJS 4TY8A 2LMIA 2WMMA 1B0PA 3U27A 4C11B 4CT8A 3ZZYA 5DQGA 2E5LF 5F8HA 1RTHB 2M4MA 2YWKA 3IBWA 1R8AA 2LEBA 1RTIA 1WWHA 2Y1RI 4DJBA 3IN5A 1HR0F 3KHRA 4CNYA 3M1VB 1KC8T 3MM6B 3GFYA 4ILLA 1K9MT 1XBWA 4G1IA 1UVLA 2G1DA 2YNFB 2JX2A 2DGVA 2JEFA 3OVBA 1HARA 5FDLA 2M88A 4XIUA 2IRYA 4F3QA 2X1AA 1TKTB 4W92B 5AXMA 4LF4F 1RA7A 3X3UA 4FXWA 2R7UA 3U1MA 5DLGA 4HVZA 2B0GA 4RW4A 4NZ0A 4YB7A 2GJ2A 4WFAQ 1VRTA 4DL2A 1QAXA 5HI7A 4WK1A 4HDGA 4IDKA 2N7CA 5KG3A 4FXDA 2KO1A 3M2UB 4AE5A 3MR6A 3MGJA 3RRHA 2EG2A 3BGFA 3KNGA 4JI2F 3SCKE 2JLEA 2YY3A 3T1YF 2JLFA 3N6NA 1FXRA 3PRDA 3MECB 4OV1A 4R0EA 4WYWA 4XAKA 5HLFA 4AL7A 3O1LA 4ES3A 1FJ7A 1Q8BA 3ULHA 4ATNA 4E8UA 1BQNB 2KM8C 4LFAF 1NK0A 4DFMA 2W9CA 1TV6B 3V6HA 4BBYA 1MNEA 4I7FB 5CYQA 1RT5B 2YTCA 4MTPA 3Q0AA 1NK7A 2KTQA 1TP7A 5DQHA 3TX8A 1OWXA 5F3ZA 1VQ5S 3I9ZA 3N4WA 2KHCA 3C6UA 1T8EA 1Q4RA 2DR7A 2EC0A 3TAMA 2DCLA 4CH7A 1XNRF 3D28A 1TK5A 2OMLA 4NLRA 1T94A 3OTDA 1RTJB 2CQ1A 1HW8A 1VMBA 3UD4P 1WHVA 1ZM3A 2J0QD 2OPRB 2VG6A 3IAS9 2WBMA 2X1GA 2CJBA 1TK8A 2RSQA 5E3PA 4QBUA 2KDOA 5DJBA 2A2CA 4RNMA 1JNZB 3GFXA 2XULA 3BZQA 3BQ1A 3O6QA 4DQIA 4YHHF 1N6QB 1KQSR 5AXNA 3DLGA 3F73A 3HHLD 1VQSA 1KR4A 2MZ1A 1HNXF 2B51A 4EU0A 2HHUA 1P1TA 4ES2A 1JKHB 4F8RA 1WHYA 2DO4A 1PGZA 2MYFA 3CCRS 4QZVB 1QVGR 2P6TA 2CDQA 1TQLA 2P9GA 2VG7B 3T5HA 4WU2A 1FXDA 3LP2B 4DBQA 4I0WA 1YRTA 2C2EA 4M63A 4QR1A 5B0AA 2COLA 2WAQD 4C0BA 2D9OA 3MMCA 5IT4A 4QCLA 4NLYA 4R0JA 5D4OA 4MKYA 3T5JA 3EX7B 4ZOSA 3PEJA 3KLGA 4A4JA 1WEXA 2YKNA 3UR0A 4H4MB 2CPYA 2MZRA 2HHHF 3PACA 1S1TB 2CQCA 4U7UK 4J9QA 5L1KA 1FEEA 1A7GE 2PI5A 1JWWA 4KFBB 4B3SF 5E3AA 2DIUA 4H4KC 5DGBA 3V6DB 3E2EA 2HPUA 3ZFVA 1S72S 3DLKB 2DR9A 2B9XA 3T5KA 1K73T 1TL5A 4C3KA 2R7OA 4X84A 1H7XA 3J80Y 1H6KX 1H2TZ 3I96A 3NAIA 1GTEA 1RDRA 2J8AA 4F4XA 4AL5A 1E6VA 2GMHA 4CO2A 4XO0A 2HVZA 5I3UB 3B78A 4GMKA 3CPWR 2PN6A 1Y4ZB 3MF5A 1LW2B 5SUHA 3DMJB 1S6QA 3N6LA 5L1LA 3MUMP 5KFAA 3WX4A 1TAQA 1HWUA 3POTA 1UMJA 3QGIA 1SQEA 3OXFA 2CIMA 1RWUA 1G1XA 3ISND 4DQRA 1NKCA 1BQMA 4NXMF 3T1AA 1MW7A 4YB1P 3BB5A 3ZZUA 4ID5A 2Z8QA 2JFDA 1ROFA 2AV5A 3H59A 4N8OA 5A8WA 3GIKA 1RT1A 1IKWB 4FF3A 1GQEA 5J2MB 4WE1B 3ICLA 5I42B 1CC7A 2D3ZA 1FD2A 1G7CB 3PR4A 2APOA 1ULRA 5DG9A 3MCSA 4N5SA 4DLEA 2VFUA 3H4BA 4OL8A 4HTIA 4M8LA 2LECA 5E3RA 3QLHA 1S9GA 2RIJA 1KQFB 2ZC4A 3K57A 2DH9A 2UP1A 3DLJA 5KFDA 3I0SA 3MEEB 2V4JB 4Q0BB 5EHHA 1U1NA 5D77A 5DQIA 1KLMA 3MMAA 3OUYB 2FJBB 4FYDA 1VC5A 2I5JA 3KG1A 5B0BA 1BWEA 1WEZA 2CPZA 4F67A 3OFFA 5CCLA 2FD2A 1S1WA 3HDSA 1HWKA 3CC4S 4PXCA 3LUYA 1T02A 1L3SA 2E1AA 4ERDA 1S1XA 2CG4A 2WCXA 3H20A 1KRPA 2EBGA 1EP4B 2UXBF 4NCAA 4EYHB 4W90B 2OPSA 4MMOA 2FY1A 2MKCA 4J5OA 4ZDNA 2XLKA 1N4LA 1H2UX 2VL1A 2M7SA 3HKZD 3VTIA 2YH1A 3IRXB 3D0IE 4EWTA 2R2SA 4NLGA 1SJ3P 2E7WA 1PC5A 3DRPB 3RRGA 3H2UB 3NRBA 4C4WA 2V0NA 4DV2F 3NGKA 3HKWA 5L8RC 3GR1A 1NJZA 3KFWX 3OR2A 3PVXA 3SQGA 2XLIA 3MMBA 1H98A 4C0HA 2RMLA 3WDOA 5GMKa 2UUAF 3NL0A 3MEGB 2GW8A 3OXLA 4NX9A 4ED3A 3C66A 3HVTA 2FVCA 3HZEA 2XMUA 1S49A 2CPIA 1R8HA 3A1YG 4BWJA 2BQ3A 2E1MC 3D1OA 2ATLA 4I4BA 2FGOA 4Z37A 2ILYA 2DNYA 2HW3A 2RB7A 2DGQA 1KQGB 2VZ9A 2OSQA 2WONA 3V4MA 2GCFA 5LJ3Y 2O5DA 1SKWA 4WJBA 3OL7A 4OHXA 4G1QB 1NKEA 2A2DA 2A3JA 4NWBA 3LALA 4DHVA 1ZBTA 5HROB 5KOXA 3V2UC 1VQ7S 3MHYA 2RRBA 1Z2ZA 2R7QA 3ENQA 4NLPA 1UJ4A 3ZZPA 3KLEA 1NAQA 1YRUA 5E3CA 4K5SA 1F0XA 1X0PA 5L38A 1IKXB 4X4NA 4I2QB 1DRZA 1QSSA 2M8HA 2BANB 2VBYA 5F9NA 2W4CA 2ZH7A 3G9CA 4CTAA 1X4HA 4K4ZA 4KHMA 4ZKAA 4K0KF 2YQ3A 2VPYB 4Q45A 3LP0B 2ZD1A 3KLIB 1RT7B 2UV8G 5F0UA 2RF2B 3DI6A 2IM2A 3T9ZA 2AJQA 5GAGI 2FHJA 4QW9A 4LF5F 3G6YA 3CGIA 2ZH2A 2M3DA 1ZETA 2FJXA 5J1NA 1ZOTA 3SZ2A 3MEDB 4HLBA 3JSMB 1N88A 1G3OA 4DV0F 1KHVA 4H4OB 7FD1A 3H5UA 1UFLA 3MPWA 3LO3A 4NCGA 1JLAA 4EBCA 2I1RA 2R7WA 2IVFB 3BN4A 3N5BA 1IKYB 2JEIA 1JLQA 1T3OA 1RT2A 4IG0B 4RW8B 1FERA 4ICLA 2FVRA 1RTDA 1I94F 2YX1A 1O5JA 4FN5A 3UQSA 1HQUB 2DPIA 2UUCF 3MZIA 3HXMA 3R3TA 2DR8A 1FRIA 2W24A 2E9ZA 3PIOQ 3BJYA 2PO4A 3H2LA 1HWLA 3MI7X 4AXJA 3BM7A 4WFXA 4K2XA 4K4WA 2B9YA 3S1TA 1CC8A 4Q43A 2BOPA 2CQPA 2C3MA 2IM1A 4J37A 3PIPQ 1HFEL 4G3IA 4GKKF 1S6PA 3M6XA 4FNIA 1TR0A 1S0OA 3OTBA 1XR6A 1C0TA 1KFDA 4B9SA 3IXQA 1Q16B 2J7KA 1TVRA 1URNA 1LWEB 1NHUA 3O5TB 3OL8A 2KYXA 5IQQA 2JSXA 3CEDA 3DU6A 2KI2A 1L3UA 1DJ0A 2JRSA 4F2RA 1WI8A 1KSPA 2CVEA 2IC3B 3P3DA 4OX9F 5KT3A 4IO9Q 4ETXA 4N41A 1VOMA 2L08A 3MR3A 3HVWA 2XMJA 2M2BA 2P9EA 3GG0A 4O4GA 4ZPTR 4YUDA 1KVIA 5DM6Q