1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
b'KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chromosome segregation
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
4FP9A 3G82B 1N6QB 2KJVA 2DNLA 3E8OA 4ETXA 2G9OA 5A8WA 4PYDA 1RWVB 1AUDA 1LWXA 1X0PA 3QT5A 4BCAA 1VK3A 1ZA2B 4LF6F 3MEEA 4MFBA 3KOAA 3AA8A 2MDAA 1VJWA 2C2ZB 3OQ2A 4HACB 4X4OA 3GYGA 5KFTA 2RRAA 1CJUA 3UWTA 3X1LB 5A8KA 1R0BG 2Y8WA 3DRXA 4LF4F 1LXJA 1ZZNA 3H7HB 2N3LA 3NS7B 2N3OA 3RR8A 1HWKA 4K50A 1QSLA 4B17A 4QW8A 3CCQS 3ZTRA 3TARA 3R3TA 2FLPA 3IGNA 2YWFA 4RBVA 3V81A 5KG1A 3FMWA 4A8FA 4Q8FA 1JXLA 3KXDA 1FRIA 4TY8B 1WKKA 3DRPA 4B9NA 2QO3A 4Y34A 3A4TA 3P96A 2BE2B 1R0AB 4YS2A 4Y2CA 2NXNA 4IOAQ 1DY3A 4WFBQ 2R7QA 4I2PA 1TK0A 4MIAA 3GJQB 3QNWB 4JV5J 2DPIA 1JLEA 1UW4A 4I1TA 2N7YA 3M6XA 4KYZA 2VBZA 5KFYA 1HPZA 2B5JA 4YN3B 1SPBP 2XWXA 1SC1B 1NHKL 1C2PA 2PIIA 2MYFA 4U7UD 2AMCB 1M0SA 1GMVA 1RTHA 4ZLLA 4OYAA 3CJTA 2E7VA 4FZVA 2JJ4D 2JRSA 3OTCA 4YQWA 1WHVA 2YKNA 4OJ3A 5D8HB 3GZ7A 2F63A 3MCSA 4JI0J 4U8YA 4Q44A 4K5SA 4Y2AA 2W7AA 3EVWA 4NCBA 5EN1A 2HGLA 4USVA 3CD5A 4M5HA 2YKPA 3A8IA 2GO8A 2KYXA 3GV5B 2BRKA 2X1AA 2QZ8A 2Q3PA 5I3UB 3DOKB 1ZM3A 1UA0A 2HVEA 3W66A 4G3IA 3DLEA 2JEIA 4OX8A 1JLCB 2UZAA 3RB4A 4IOCQ 4LF8J 4YR3A 2C2EA 2MKYA 2F65A 2B9WA 2ZVIA 4FKXA 3ZTQA 1X5SA 2V2VA 2UVRA 2NSBA 2QA4G 2P6TA 3O44A 3CJKB 4Z7CA 2N82B 5I42A 4U96A 2A2DA 3CO0P 3KK1B 2QRRA 4JV2A 3N5BA 4ELUA 3DOMA 3HX9A 1XK8A 3HO1A 4WFAQ 2EFOA 3MTKA 4EZ9A 3UO0A 1Q5VA 4FPIA 1D0EA 1S72S 2XMWA 3L7UA 3B4DA 1BQNA 3KWMA 4O3NA 4NL5A 4RUAA 1VDHA 2IRYA 2R8KA 3UD5A 1RZMA 1U0HB 4CH7A 1HBNB 1RTIB 3GV7B 1M1KT 3RBEA 3AQPA 3JYTA 2I9SA 1UWBB 3RB6A 3OJSA 3TUIC 3CVKA 5EX3A 3MR6A 3UR0A 2AYMA 2XLIA 2CQHA 2C2RA 2DNHA 2MJNA 1R6YA 3VQSA 3VCDA 3KLEB 4TY8A 1PO6A 3QLHA 5BYSA 2G0JA 2FY1A 3QYYA 4EMDA 2BE2A 3MM6A 1KVJA 1L3UA 1NDPA 2IHR1 4PKDB 2GMJA 5A2QY 2B56A 1HNIA 3NNAA 4P75A 4PG8A 2EWHA 4DPOA 2KRBA 2NUHA 3RGIA 2QMXA 1TUWA 5IT4A 3OBIA 3EPIA 1XR5A 2RU3A 2QLJB 3SQGB 5DG8A 2EPIA 3ILJA 3AOCA 5KFPA 5LSLA 3A3OB 1YRUA 4DI6A 1B3TA 2DIVA 4C4WA 1JJ2R 3EGZA 4L72B 2HNYB 2JC1A 4ID8A 4UW2A 5J2NB 2W24A 2M0GB 5B0FA 1VQ5S 4LFCJ 3PYFA 5H9EJ 4M5NA 2VV5A 1EIYB 3I5CA 2YBVA 5J2QA 1RT2B 5HP1B 3FNNA 1RAIB 5HJYA 4CT9A 3H25A 3IP0A 2VA3A 3G8QA 4F4WA 1KSPA 4CO4A 3DRSB 1NH8A 3A3NB 1UEKA 2GNKA 2M52A 5CZVA 1NLKL 1RT5A 1X4HA 3IWXA 4WJBA 2V8PA 6FDRA 1JJ4A 5E3AA 3CJKA 2U2FA 1GMWD 2CDRB 5HMZA 1T05A 3M30B 3RRGA 5HROB 2PE8A 2D41A 3PO5A 1YI2S 5F0WA 4KIAA 2D3OR 4IOBA 2AJQA 2ZH2A 1IQZA 4HDGA 1GMWA 3AY0A 2QGFB 3T5KA 3HULA 1AFJA 2D3ZA 1X4FA 4XPEA 5J2PB 3VV2B 2CRLA 2ZOGA 3MAAA 4ILLA 2FTRA 2H9ZA 4ANEA 2KG1A 3T5JA 3H5SA 3JTOA 2CVEA 1HBNA 1HQUB 3J7ZT 3RAMA 4KKOA 1XR7A 4DFPA 2QN6B 4HTJA 5L38A 3T1YJ 1O51A 1UFWA 1DJ0A 2UUAJ 2Z2ZA 3KLFB 1PKUA 4U9RA 2J6TA 1FKPA 1RK8A 1OSDA 4JYAJ 2CFXA 2IJRA 3M2RA 3QPIA 2RIJA 4I67A 3CCSS 2BX6A 3N4WA 5E3QA 1YGYA 3M8PB 3EDQB 4NLSA 4I69A 4L6V3 2J9CA 2CJAA 2HS0A 4LFCF 1D8ZA 1JK9B 3HVWA 5EHHA 4C3KA 2XMJA 2FJEB 4DSLA 4V19X 2VG5B 1LWCA 1GK8A 4OYXA 2MY7A 1TAQA 1T7PA 2MZ1A 3CDBA 1Q78A 1MW7A 1NDCA 2BQRA 2ACYA 4G1QA 2HNZB 1VRUB 4C3MA 1VBYA 4WBFA 4NA1A 1S10A 4UOCA 2W9AA 3FFIA 1LWFB 4XIUA 1UETA 4NWBA 1RU1A 3BH6B 2GS8A 2CA9A 2VA2A 3D54A 2QL9B 2UU9F 1H7WA 1C1CB 2ROPA 2JC0A 4PCQA 1UPPA 2ZDPA 4K4XA 3JSBA 2YWGA 5E33A 4W92B 1KLNA 2QIFA 1L5UA 2MPUA 2XULA 2A6OA 2ASDA 3Q8SB 1U25A 1FXDA 3LH2S 3D67A 1VQYA 4QPTA 3M6VA 3FGVA 2XLKA 3GG0A 4ZJOA 4WCEQ 2K1RA 1XNQJ 3T19A 5LT5A 4QIGA 5H9EK 5DM7Q 5U47A 5B0BA 3VTIA 2YY3A 1IKXB 4LF5J 4ILMA 1TFYA 1LFPA 1NPRA 5L1IA 1WI8A 4LREA 3MOZA 4G6VB 4P7TA 2R2SA 4ZIWA 3VAMA 4DQRA 2WB1D 4MIWA 3U1NA 4CNYA 2LA4A 1BWEA 4OIXA 4KPYA 3OR2B 3T1YF 5DGAA 2UVUA 1FWPA 3SFUA 5M2UA 4DSIA 1R8AA 4BWJA 3PXGa 2XCPA 2UUAF 1LKZA 2ZBCA 5HJXA 1QAYA 2J7KA 2HFZA 4JYAF 4DXLA 1XR6A 1S9EA 3TA2A 3G6YA 4ZLPA 1D3WA 1TL1A 4CO5A 3OT9A 2RDJA 1VLYA 2FB0A 3OFFA 1Z2ZA 1NB2A 3MD3A 4UTGA 2DR7A 3ZZTA 4OZJA 3OUYA 4PQUB 3QGHA 1JLFB 3FEZA 3PEHA 4IRCA 4NLXA 4M8LA 3DOLB 3EWGA 2I5JA 3CIMA 1OY9A 4K59A 3SIPB 2XCAA 2FJWA 4ZIVA 4ZPWR 2W9CB 4PPDA 3M1VB 1U1OA 2R4FA 4IYQA 1A0OB 4R0JA 3V6HA 4M5LA 1RWWB 1VQKS 2H48B 4O3PA 1WG4A 3K8WA 5LMUJ 3HD1A 4WP8A 2ZOMA 4JB8B 1SC4B 3QJPA 2HW3A 3ILIA 4KHMA 4JP8A 1FDAA 3OJUA 3TZZA 4A8MP 1K0TA 1VIXA 2DNRA 4MT1A 4DV0J 4DN9A 1MN9A 3O8WA 2WMMA 3B6BA 3FUYA 1KQSR 2V50A 4ANCA 2NQPA 4IG0B 2VJUA 1XNQF 3OXFA 3TNVA 5DQIA 4X65F 3QAEA 4CO1A 3TAMB 2DIUA 4O0IA 4F0MA 4ZPCA 4DR2J 1AZSB 5IT0A 7FD1A 2MGZA 1RT3A 4WTYA 3D6HB 2JEFA 2AJ2A 2VQEJ 3H20A 1CSJA 3G87A 4DPUA 5CA5A 4N41A 4DR5J 2OKQA 4FKYA 2DEJA 5KFNA 4I0WA 1S6PA 2V34A 4IDKB 2BW7A 3NGDA 4GKKJ 1RAJA 2VD3A 2P8IA 4LF2A 1XIQA 4X4RA 4LF7J 3M2VA 3CJ5A 1FKOA 3IA0A 2QE5A 5A6PA 3ENQA 2PD1A 1NXIA 3CF5Q 3EGVA 2BOPA 2BYCA 4K8RA 1FT8A 3UCZP 3OR2A 3TJ9A 3DC2A 2LP4A 2ZUGA 2IJFA 4F7VA 5C2CA 1R8BA 2C28A 1T9WA 5F8GA 5HK4A 2AQ4A 4TN2A 2ZWOA 2CG4A 3R5AA 4FF1A 4NXMJ 3MWBA 3PCOB 5HQMA 4C0HA 3PRVA 4KGMA 3D28A 1HI1A 4GVBB 3HP6A 1WF0A 3V6DA 2XTJP 1T3OA 5K5MA 2YPZA 2AKWB 5KG0A 2QSFA 4DZ6A 5F8HA 4AL5A 4KPCA 4YUDA 5ITHA 2CJYB 2XO7A 2C2KB 2W9CA 3M1VA 4OI2A 3PJ9A 1S1WA 4K4VA 1NCLA 4H4KC 2RRNA 2H54B 3K5MA 2Y0BB 3W2WB 4B3TJ 4DR5F 1JNZB 5IC6B 1SVDA 3SSRA 3DDKA 4KO0A 1NJWA 3BB5A 3TUPA 4OYPA 1N5TA 1KP6A 3CMES 2VFVA 4ZHRB 3PW2A 2RE1A 4WKYA 3K5LA 4KHRA 2PEBA 3LPEA 2MLXA 3GONA 2HK3A 3UFCX 1T95A 4P2FA 3LA0A 4F36A 1HMVA 1SV5B 1N33J 1CG2A 3FKBA 2ZH3A 5M2RA 3BBBA 4RLEA 3TAMA 1HARA 1B7YB 4ES2A 4QZVB 1SUQA 1KQFB 1JLBB 4O0NA 4W98A 1R89A 2GW8A 3PFOA 1RT1A 3NXZA 3AD7C 2ZZTA 4KFBA 4YR2A 3I0SB 4LBHA 4YFUA 1Q5YA 3CD7A 4M95A 2KFNA 2GCFA 1T9TA 3R5CA 4FDFA 4G65A 4IDKA 4ER8A 4CH0S 5THWA 4DV7J 2XB2D 3BGRB 3GIJA 3J7YI 3DLJA 3MPYA 3OXGA 4BHQA 4YB1P 4FNHA 5DM6Q 3CIZA 2HQGA 2G13A 2NR0A 5HL7Q 3KUGA 3O2IA 2B4UA 2HK2A 5LJ5Y 3HHLC 1TMMA 2HZAA 4F4AA 1QSSA 3C15B 5CXTA 5HBMA 1EP4A 4DDFA 1N8RT 4Z2XA 3C8YA 3MHYA 1I94J 4A8QA 1RBOB 3P49B 4LT6A 4ZVEA 1VJQA 4RWXA 2KJWA 4USHA 3CCZA 2HHHF 2AYGA 4GVLA 5H9FJ 3AXKA 3QIPA 1WOOA 3EGWB 3BN7A 1HBMB 5L39A 1KBRA 4OJHA 3HJVA 3BM7A 1VMBA 2BDPA 5CHCB 3PW7A 4DL3A 3WDOA 2XEXA 2I8EA 3PV8A 3B54A 3AHPA 2YTCA 4ECQA 1WTBA 4PUOB 2CWKA 4EGLA 1TV6B 2GFFA 4TVAB 4FYDA 1VQLS 4Y3CA 3BYRA 2NXJA 2HS4A 4ZKAA 1AROP 1B0PA 4NLYA 3FEYB 2JEJA 2X3DA 2J0WA 4KHPJ 2FC9A 2QTWA 1T9XA 3P4UB 5L1JA 3D4JA 3BJYA 5KG7A 4USKA 3QT8A 5DGBA 2L41A 1FXRA 2GMHA 3QT7A 5EDWA 1FD2A 1HQEB 2WOMA 2E7WA 2CNKB 4FS1A 3OTBA 2EK1A 4PWDA 1ZOTA 3AB4B 3DM2B 3MCMA 4X62J 4DUYF 3IGVA 3K17A 2IVMA 2HVIA 4NLQA 3IWNC 1RAFB 2KVIA 2OELA 2FLNA 2HZVA 1DRZA 2DNZA 4IG3B 1FVSA 2PMWA 3R6LB 1F1BB 2H1YA 4XAKA 1RAOA 1GNKA 1LFWA 2HFNA 1WKJA 1IBMJ 1FK9B 1GX5A 1X8DA 1F5CA 2DRDA 4F67A 1HHSA 4N77A 3L09A 3FVYA 2HVZA 2LQBA 3CJ2A 4LR7A 3H42A 4NRTA 2GC8A 1VQMS 4ECVA 3QJJA 1V6HA 4RU9A 2UUBJ 1MWYA 2D69A 4YMEA 1FJEB 4PXCA 2HHVA 1REVA 2ZNZA 1EARA 4F26A 3D9BA 3T1AA 2WZ1A 1HNXJ 4HHUA 5KFHA 2ADBA 4RWWA 5FJ4A 2VFSA 2HG4A 5IFMA 1RLDA 1TVRA 2DNMA 1EETA 2QL5B 4LSZB 4OZ0A 3P5TL 3PHEA 1WEZA 4BS2A 3GYNA 1P9YA 5DQGA 2KRRA 2RQCA 4QR0A 3MTJA 2YX7A 2IBOA 3M32B 1KOHA 3M6UA 1WD6A 1S1UA 4CYUA 3PKMA 2XYPB 4NEYA 4GKJJ 4CLLA 1WOPA 4ED2A 3R5JB 1F6TA 2LA6A 2EBEA 2XY5A 2CQ1A 1OY6A 1RUSA 1XN9A 1P1TA 5H9FK 4LBIA 1HWUA 2CPFA 2WBMA 2R7TA 2V4JB 4YB7A 4C98A 2OO4A 3MECB 5K8OA 4QW9A 1T9YA 3R5BA 1TV6A 4ENOA 1FD8A 2XSJA 4WP3A 3DLKA 4J37A 3CCTA 1CS4B 1KRPA 3PYGA 2E5LJ 4C8ZA 2EVZA 2R8JA 1LW0B 2MQMA 3T9NA 1FF2A 2EEYA 3J7YU 2JX2A 1PJ6A 2L3MA 3CCVS 2Y1RI 2VFRA 1NKCA 3MCOA 1QSYA 3M2UA 4IRKA 3ULHA 2OGUA 3OR1A 2VL1A 3UVJB 4LFBF 3TAQA 3I32A 5A76A 4ZP7A 2UUBF 4DV5J 1YJNS 2ZWPA 1LK7A 4CLSA 2F4VJ 3OHAA 1RAGB 3DNCA 1SB6A 2H4WB 3HHNB 2O1PA 2YWWA 1U45A 1LQ9A 2MY8A 3E2EA 3IRXA 5C24A 3HVTB 3VVTA 4PXEA 2RAQA 4WF9Q 4OI4A 1WORA 2BV3A 1FFSB 3PR4A 2ZM6F 1RI7A 1VRTB 1R7IA 3PACA 1AUSL 1M5HA 4F50A 4JI3F 4ELVA 4N5SA 1FK9A 4DN0A 2AX0A 4B08A 5BYRA 4Q2MA 3MOJB 3V4MA 1GEHA 1PJ7A 2WSCC 2HBZB 2R42A 3RB3A 2R7VA 2E5GA 4PEOA 1PAUB 3H2LA 2QC3A 2B8QA 4IQXA 1S7HA 2GJIA 3M9OB 1FWLA 4HHJA 3K7RA 2A3JA 2KTQA 1PYOB 2GA7A 3TEGA 1NO8A 3GFYA 4ZVRB 1S1TA 2DGQA 1UTAA 4EO8A 2OLWA 5A8RA 2ZKUA 3RW6A 2ATCB 1NBEB 1RT4A 4DR1J 4DL4A 5KFLA 1ZYQA 3EVMA 1YLXA 2BJ1A 2ZE2A 3DCAA 4B9MA 4KGKA 3T1HJ 3R2DJ 2CUYA 2P5VA 3UR3C 3LP1A 3UCUP 2O66A 1FO1A 1WG1A 4IH5A 2E5LF 3C16B 1FHTA 1SI9A 1V9OA 1ZM9A 3I5AA 1JKHA 3AQOA 5BXIA 1ITPA 3QBCA 3I87A 3DLGA 3JQJA 4KB7A 3BEGB 4PAAA 1Y00A 2DNNA 3PEJA 3BZQA 2OPQB 2ZUAA 2AZ1A 1QM9A 1H7XA 2F4VF 1HYSA 1Q1KA 1X4EA 1KFDA 5FD1A 3A13A 5KFKA 4JI8J 2H4YB 3Q8QB 2PDAA 2RD5C 4RW7B 5E2QA 4CQ1A 2XM3A 2GAGC 3L95X 2ZZMA 3GR1A 4YB5A 1WDTA 3BPSP 8AT1B 2Y9HA 3L3CA 2K7JA 3SDEB 1N36F 3HSJA 2K3IA 1CVJA 3VF0B 3AB2B 3NGKA 4CLTA 4RW8B 5K8NA 4NZ7A 3ENVA 1ULRA 4G1IA 3MMCB 1R43A 4ZPVR 4OHWA 3OLBA 3M05A 5IZHA 4DS5A 3BGLA 1KNZA 4ZITA 3QQCD 4ECTA 4N8NA 2WB4A 2LXUA 1NK7A 3NGUA 1FESA 2ADCA 3LP2B 3NRBA 1LWEA 1DTTA 2W7PA 3CEDA 1SKWA 2IM3A 3AFGA 3TYTA 3FK4A 1D9FA 2BJ8A 3HPOA 1BUXA 1IJEB 4WE1B 3SEOA 1VRTA 1F5AA 1U1PA 2ZOFA 2QLWA 3K8VA 4RBTA 2B4OA 5LMNJ 3S7RA 4A48A 3G6XA 1H0HB 3D68A 3OXLA 2VG6A 4B3OA 1WKLA 2IAJB 2JLFA 3E3XA 3MEDA 4CP5A 1X9MA 2HQFA 3MMAB 4DLGA 3VQTA 5GAHI 1W26A 1NDKA 4ED6A 3FBBA 1K44A 2VG7A 1AFIA 4CTAB 2NLWA 4GO5X 5E3PA 4OI3A 4NXNF 4A8SA 4ANDA 4ZCLA 1WJ9A 2J9EA 4LSLB 2RHQB 2XMVA 1E6VB 3IXQA 2BW2A 1VHIA 3GCWP 3CMQA 2EG2A 2VIHA 4O3RA 4LVNP 3KLVA 4FNIA 1K1SA 1FVQA 4KSEB 4NLWA 3NNHA 3ISZA 2W9BA 1Y4ZB 1F0XA 2RVJA 2R2TA 5K14A 2J9DA 3PHTA 3TO8A 4ZPAA 1CJVA 3D0GE 1C0UB 4UUWA 2B43A 4LFAJ 2CADA 1KLMB 2HSEB 3R7SB 3OSNA 1FA0A 4D3GA 2NXUA 1KC8T 5DDQC 2N7CA 4DX6A 4DCOB 3KJVB 4KQZA 5F8MA 3OL7A 4ZK7M 2NXEA 5AT1B 1G2EA 4EO6A 5H1SV 1U6BA 3G8SA 4K4UA 1NAQA 4O3OA 1YITS 5DQHA 4PRFA 1FNMA 3CSKA 2LDIA 2SXLA 4OI1A 5AJ3J 3BSAA 2J5AA 5CH7B 3HSDA 4ERDA 1S9FA 4RNMA 2V8VA 4FBTA 5KFAA 1S9GB 2FVSA 4MYTA 5LMNF 4EBEA 2DH9A 3QFHA 3DHXA 5IC4B 1R0CB 2XY6A 2DH7A 2RF2A 4O44B 4C3LA 3AA9A 4M5DB 2QFIA 2AJFE 3DLLQ 3OV7A 4CLUA 3BDPA 2UUTA 1MSWD 3CCLS 1KDNA 3H4BA 3T5LA 2M4MA 2QG9B 3EVOA 4PWWA 3Q8YA 2MKSA 4JOUA 1F3VA 5IOLA 2HWIA 4RW4B 4DV4J 4I6WA 1V3SA 3NCRA 3UCGA 4F3MA 3WQPA 5A0YB 2IPOB 4H54A 2XI2A 2R7SA 4QWAA 4JI2F 4LFAF 2YKMB 1Q16B 2E7XA 4YY3F 3MURP 2KHCA 1Q8IA 4DS4A 1UWAA 3BBCA 1UJ6A 2D3O1 1ZAWA 1LV5A 3RR7A 2KT3A 4DL2A 3I4HX 3MCNA 3JTNA 1Y5IB 2BRLA 4CTAA 3DMJA 1HL6A 1RKIA 1KKHA 5ETLA 3NCPA 1T03B 2BOAA 2GHPA 2CJXB 4LSLA 2UXCJ 4OHXA 3R27A 2E66A 1GTHA 5J1EA 4DL7A 2M88A 1RISA 4YR0A 4BWMA 3PTWA 4RUCA 1HBOA 2HFVA 4H4KA 2HHQA 3IR7B 2RILA 2YWHA 4OYZA 3PYEA 4M5IA 2Z8QA 3UD4P 3QT6A 1GQEA 1NK5A 3Q2SC 1PC4A 2LQ9A 3HVRA 3DYAB 3AOBA 3BREA 4DG1A 3BO4A 3HFKA 4DQPA 4PQAA 1IN0A 2UUWA 4J9LA 2QA2A 2JLGA 2VONA 4M5KA 2JDJA 2C1EB 4F4YA 1Q8BA 4K4TA 3QAUA 3TA1A 5D3GB 1WC1A 4QWBA 3HXMA 3JAMY 2D9PA 4P7VA 1Y11A 2B6AA 4ZN3A 2F7VA 4O4GB 1I51B 1JB0C 1U1QA 1S6QB 4TQSA 3DDIA 2DO4A 1DZ5A 3HZEA 3HMJG 1NZAA 4I56A 5GAHU 2N4DA 4Q8EA 3W2VA 4N7TA 1CULA 3HDSA 5KOXA 1C1BB 4ECRA 5C42A 1TKZA 1PBUA 3KLIB 4J9PA 2WONB 3ZZYA 3I0RA 3GQCA 1NU4A 4NCGA 1IQTA 2IMOA 3HHLA 5KG4A 4HHHA 3FQLA 4M5DA 3C14A 3IM8A 1HNVA 3PM9A 3DXBA 2GJFA 3T6JA 3FZ2A 3O6QA 4O3QA 3HHEA 2YNHA 4L3KA 4I7FA 4LUBA 1LEOA 2DR8A 1NRKA 2AD9A 3JS9A 2YX1A 4FN5A 2HMIA 2GJ2A 4ZLNA 2UXCF 2DCUB 2Y8YA 2UV8A 1M5OC 2MKCA 1VBKA 4NLTA 4ZVSB 3V4IA 4C11A 4ID5B 3ZZZA 1FI4A 1OMSA 3FRYA 3IS9A 1DHMA 4MK8A 2RSQA 4JI7F 1SL2A 3M8QB 2MTLA 4C0BA 2PA8D 2Y1LB 5EWFA 2Y1IA 3C46A 5KFSA 1Y3JA 3MM9B 3S6EA 4P52A 1N88A 1CQMA 2VFUA 1WACA 2ZC3A 2LQ5A 3ZTSA 1NKEA 4UT4A 3THTA 4URQU 4MAKA 4DR7F 1GT8A 2H65B 1PCAA 1U2FA 2R8HA 1S0NA 1RWXB 5J1NA 2L08A 3ITHB 1DTQB 3UPFA 5KFOA 4OZ1A 1JLGA 3GFXA 4OV6A 2OPPA 4DCPB 2BEFA 2C2MB 1MWQA 1RCOB 5HVHA 2DD8S 2DCLA 1FKAF 2KXNB 1H38A 5A8WB 5C7PA 1IBLJ 2JVOA 3AJDA 2POKA 3UN5A 3RYLA 2OTJS 1U8WA 3IG1B 3EZ5A 4MFBB 4RPFA 4PXDA 2G4BA 4K2JA 5G0RA 5ETPA 4B9SA 3OVBA 1W7WA 2HHSA 3VAFA 4TLRA 1VQ4S 1CJUB 3D6FB 5D0GA 3ELHA 5LOQA 5A8KB 1FWKA 1HA1A 4USJC 2HIYA 5L1LA 1Z2LA 1ZPVA 4DMZA 1IJFB 3N6MA 3DLBA 3MUVP 4J9UE 2JOQA 3PVXA 2HBYB 2Q6BA 2IA6A 3IN5A 2OSRA 2XYGB 1FJ7A 5GVQA 3DXSX 1FCAA 1YDLA 4NLVA 1ZETA 2EKYA 2X1BA 2F1FA 2A6MA 3W64A 3DGPA 1Q82T 3EICA 2MB0B 1UVIA 3JQKA 5HLFA 1Y10A 2W1BA 4ZP9A 2IRXA 2MMYA 2W7OA 2QA1A 4NMXA 2DR5A 3MDFA 4V19J 2CJQA 3NCQA 2CZ9A 3DRPB 1YJ9S 1RHKB 2OH2A 3DN9A 2BJ7A 3IBPA 2C2OB 2GO9A 1YVFA 2DNYA 4PG6A 1B64A 3AXMA 4I2PB 2J7WA 1XEZA 3EUNA 2MZTA 4I4BA 4NE9C 1MROA 4UY85 1JLEB 3QGGA 3H40A 2DNKA 2XZTB 4LF1A 2OEJA 1KVKA 2XNQA 2OFGX 2F5GA 4RNFA 4LF4J 4EBCA 2FIUA 1HPZB 2B5JB 6FD1A 3KLIA 2PGCA 2FPHX 4WYLA 2WONA 3VALA 2YKOA 2HVHA 3BO3A 3KLGA 1L3SA 3NY0A 2XHWA 1RTHB 4RNNA 4AQYJ 4QR2A 5IT9Y 3AJ2A 3W9IA 5FDLA 4I2QA 2E1AA 4HDHA 4AYBD 2YKNB 1DAXA 3DDNA 1SIWB 2DPJA 1IBKF 2NZ4A 1JQGA 2CQCA 1FTRA 3AAWB 2E29A 2KM8B 4DQSA 3QIDA 3DLHA 5CD4H 1FFWB 1TAUA 1FRLA 1HWLA 3LWLA 2DGSA 4IFYA 2DHSA 4K7QA 4DJBA 1FNXH 3PYDA 4X66J 4O4RA 4E8UA 3GIKA 5EGYA 3DLEB 1YJTA 4DFJA 4EZ6A 4BBYA 2F9DA 2XMMA 2AJ1A 4EFAC 1WF2A 1S0OA 3ITHA 2EFGA 3Q89A 3G71S 3CULA 1MG7A 5I3PA 2AYEA 5I42B 3C6UA 4FVCA 1AW0A 1OQ6A 2AWZA 1H6KX 3HD2A 3DOMB 2KFYA 5L8RC 2AGOA 3M8SA 1NK8A 1Q81T 5DG9A 5GAEI 3BYPA 3R7BB 3Q24A 2N4CA 1U1NA 4IQMA 5F3TA 2RDIA 4OZLA 1U09A 3IG1A 2HAFA 4GRSA 1LOUA 2FHOB 1BQNB 4FXDA 1YTYA 2OPSA 1KVIA 1KWMA 4ZVOB 3P45B 2XLJA 3KJFB 1SQGA 3W8PA 2J0XA 2AEJA 3OHBA 2G2YA 4OYOA 2CQIA 1RAEB 3JYTB 4MIBA 4RUBA 1YJVA 4K0KJ 2AW0A 2DJWA 4EU0A 2Y3YA 5DLGA 3OD2A 1QUPA 3LALA 4CT8A 3LPYA 3JSYA 2XYHB 4WYWA 3R5GA 2QSWA 2GIRA 2QFJA 4AQYF 3QLHB 2DITA 1WC6A 4RJVA 3TJ8A 5KAKA 1TUGB 2X7IA 3MM6B 3GWCA 2KM8C 2VFTA 3D7SB 3P3DA 2I0XA 3LAMA 3FCVA 1HNIB 2JVRA 2L9WA 4M1KA 4ZOSA 3Q8PB 1T11A 2CAJA 4X66F 5KT2A 2DRBA 5KT7A 3RBDA 2CVIA 2IIHA 4WXWA 4URSA 2HAIA 3PW5A 2LLZA 3TW0A 2WCXA 3MPVA 2MQLA 4USWA 3CJ4A 4QPXA 4U67Q 2IVYA 3RBZA 4AE5A 2IDLA 1N5SA 4LRAA 3PFEA 5MAOA 5IXUA 2MJUA 2K7KA 2MHEA 4U95A 4EWTA 4R25A 5F9NA 5KFFA 4CRJA 3KFWX 3G9CA 3LANA 2BQUA 3MPDA 2FJVA 4L76A 1B0TA 1NH7A 1HWJA 3ETMA 4LF9F 4F8RA 2KL8A 2ZKTA 3MM7B 5B0CA 3D6MB 2C3PA 1FERA 1KD1T 2AV5A 3R1LA 3TX0A 4QR1A 3THVA 2E44A 3D2WA 1AXQA 2I2YA 3ZNJ1 4EI2A 2MSSA 2E9RX 2ZVSA 5J2QB 3HFVA 4OZ2A 4TU8A 1R6VA 2M70A 1ZPWX 2KKHA 4K4ZA 4C8MA 1EB0A 1HI8A 3G8TA 1K1QA 3B82A 1RADB 1RT5B 3E01A 1FX4A 4X4SA 3RU0A 4K0KF 3KDOA 3T3FA 2BZ2A 4F0KA 2OFHX 1JLQA 1B99A 2L48A 3NOCA 1T05B 3SMZA 3GCXP 2I6WA 1K0VA 3KJNB 2VF3A 5EWEA 4WPAA 5KG5A 1FRXA 2DKOB 1L3VA 2WSFC 3GMGA 4NI2A 3PIOQ 2FC8A 3F0NA 2DHHA 3Q8RB 1XNRJ 4RR5A 1P6TA 1LNQA 3QGPA 1SC6A 1HNWJ 3MAAB 1CPZA 2GQQA 4XO0A 7FDRA 1SKSA 4CNZA 1VCTA 3GYXB 2HEKA 1A7GE 1PIEA 4NLRA 1IR2A 2HVDA 5CYQA 3M9NB 3PJWA 2LVWA 5ETMA 4KKOB 2R3VA 4LR8A 4C8OA 1EJ7L 3SFGA 5K9FA 4DR6F 3W8GA 3H2UB 2DHGA 3PKYA 1Q4RA 1IVZA 3IFEA 3O5TB 2AGQA 3MD1A 4H4OA 2RB7A 4Q43A 5MLCV 1FKPB 1AA1B 2HWHA 3BKTA 1SIZA 2HFOA 3M2RB 5IQQA 1IR0A 2OD4A 1NPKA 3O1LA 2BKPA 4ZCMA 2JLEA 1FJGJ 1WC3A 4MK9A 5KG3A 1KTQA 4B9TA 2PO4A 1VRQC 2I1RA 3N6LA 1L3KA 1LWCB 1K9MT 1OYDA 1EQMA 1R8PA 3CJSA 5DDOC 5CQGA 2LECA 2MZRA 4X84A 1V5IB 4F3OA 3VZIA 5B0DA 4QIFA 4G1QB 4USIA 4CIOA 3HI9A 2LQJA 1JJCB 2RNEA 1PC5A 3FFIB 3FZBA 1C0TA 5GAEU 4B9LA 3OL9A 2KXFA 3NBPA 3KK2A 1ELOA 3BSOA 4BDPA 3IM9A 2ZFHA 1Q7LB 1LW2A 5EWGA 2OD6A 4X2BA 2DY9A 2XMAA 2NCKL 2DT9A 2XG8A 3O3LA 5D4PA 1NSAA 3MM7A 2AU0A 4M94A 3FMBA 2CNOB 3GV8B 4PG4A 2E9ZA 1OSCA 2E5IA 2ERRA 3MFHA 4P2SA 1XNRF 1HNZJ 1WEYA 2K1RB 3TZYA 3RG6A 1QJHA 3POTA 1HNWF 4C0OC 3I5BA 3Q8VA 1UMJA 4KRWA 3ZNUA 3U7JA 1RP5A 2VPWB 3KHRA 2GZOA 3ZFVA 3G4SS 2CWXA 4ZCIA 4QIVA 3GJRB 1X5PA 2UU9J 3PX0A 2QYGA 3PNIA 1SKUB 2IYGA 4F4XA 1IUJA 4P10A 1QVFR 4C8YA 4FXWA 1JXEA 2QEXS 1CEZA 4ZVQB 4ED8A 4Y2KA 5DS7A 2KZMA 2GQ2A 3VGSA 2V8GA 3CJRA 2VQFF 3ET6A 1S9EB 5K8PA 2Q1LA 1TL1B 4J5OA 5FLXU 2J6UA 1IKYA 4KH0B 3F41A 1FJGF 5HMXA 3L7OA 2B9EA 3OUYB 4DV3F 4YHHJ 3ONQA 3GSIA 3OL6A 1RTJA 3IAM9 8RUCA 4MN4C 5KT4A 2I5JB 4UUXA 4ED1A 2CZ4A 2MZQA 3M6WA 3VAHA 5KFUA 1N32F 2B7CB 4IO1A 1BLUA 1X4BA 4DPWA 1RQ0A 4WZMA 5KG2A 1D8YA 1XMQF 5JUMA 2Z30B 2BE9B 4U7CA 1QAJA 1NSPA 3AT1B 1HBUA 4ZPDA 4FF4A 1IKWA 4WXOA 1FDDA 5KFCA 1VS3A 4QYZJ 1OWXA 2Z2MA 3W3SA 2CG8A 3FBFA 4FBUA 2HFSA 2MQQA 3LGNA 1VBXA 3A8KA 2CQ3A 2LFVA 1P1LA 1BGXT 1RYSA 2R7XA 2R7UA 1GX6A 1TL5A 3V5RA 2BVZA 3KDNA 2WTFA 1NNDA 2HRUA 1HNZF 3SV4A 3NGRA 4C8NA 2DXEA 2JL9A 4A47A 4MKYA 4ZPTR 2LEPA 5EUHA 1ROFA 4RW9A 4ED3A 1NM2A 1N52B 3C6TA 2MGZB 1RT3B 2JHEA 4WZQA 3X3UA 3K5NA 1JJHA 2R7OA 3L4BC 1NPPA 4Y65A 3DRRA 2PA3A 1YBUA 5D4OA 2VU5A 1QTNB 3E51A 1Z4UA 2DGTA 1U26A 2J0SD 3OFEA 2RH3A 2HLUA 4YB6A 4WK3A 3FQKA 2UVVA 3QMQA 5F8JA 1S6PB 5LXRA 1YK9A 1CC8A 1N0VC 2V2QA 2NZCA 2CQ4A 1HW9A 5LL6d 3GE9A 3LOUA 3B78A 3RJMB 4W4MA 1H74A 5CYMA 3N5FA 1NDLA 2GQCA 3CXCR 4B3SJ 3S1TA 3M2VB 1Z1ZA 3HVAA 1B70B 1TP7A 1FKOB 3WHIA 4OYBA 3RAQA 4X65J 1VLOA 4E98A 1SC3B 3LGHA 3OW2R 4YHHF 1VHFA 4ZVTB 5BJRA 2OPRA 4ZVPB 4E0DA 5ETSA 4F4ZA 1U4BA 3M7VA 3PX6A 2J8SA 1YJUA 4ZLJA 1UZHA 4ICLA 3NL0A 4NYPA 2BANB 1LXNA 2IY5B 2MXYA 1SH3A 1U0SA 3PY8A 1D9DA 2XMTA 3CB4A 3D0IE 1FE4A 4YEAA 3IBFB 4BC7A 2YNFA 3KTQA 4A8XA 4F3QA 4F25A 3A8JA 4LRCA 1S77D 2HHTA 3I56S 3PW4A 2ACMA 1RHRB 4TU9A 2GIQA 4IH6A 2Z2LA 1VI7A 3G2XA 3D1OA 2XZWA 3V6DB 4A8OA 2GVZA 5L1KA 3D3BJ 2PN6A 2E1MC 2KG0A 3TP2A 2CNLB 2AX1A 4USTA 3W62A 1SJ4P 1N0UA 2W2MP 1U49A 4UF4A 3B8HA 4CO3A 1NSQA 3JB9k 2HHPA 3KLHB 1K8AT 2FLOA 2C2DA 1S1WB 2ZH4A 2M9KA 2CQBA 2DXFA 2BACA 1NJYA 2V6AA 3K0JA 1NJXA 4MYUA 4KO0B 5D15A 4HR2A 4KV8A 2F4FA 1S4EA 3CCRS 3RUBL 3G96A 1HKAA 2MZJA 3MAHA 4KR0B 1HMVB 1SXLA 4OZNA 1J5EF 4QYZK 4RW6A 4FYWB 1YSJA 4B3SF 5AXKA 1SQFA 1EZZB 2WAQD 3KG4A 5HAOA 2UXBF 4DR4J 1KONA 3CJ8A 3MR2A 3BQ1A 1SUQB 1DLOA 1U02A 4Y28C 4IFVA 2X51A 4OJGA 1QUVA 5GMEA 1RT1B 1S1VA 4TYBA 2WVCA 3D66A 3NG8A 3VGTA 4JI4J 3CT9A 1F2HA 4KFBB 3SBMA 2NS1B 2ZH7A 1TFWA 1TKXA 3PRBA 1YRTA 3J81U 5AE2A 3M8RA 4OV1A 3HSZA 5CABA 2RMLA 2FVCA 5J2MA 3ZTPA 1IKVA 2A2CA 2V8HA 4Y6IA 2YNGA 3U02A 2WVDA 1S1XA 3IBCB 1ACMB 1RHMB 4DL6A 4H4MB 1YJWS 1RAAB 1OYEA 5SUHA 3RTVA 5KFRA 1DBDA 1O6XA 3ZO7A 1H3DA 5HBMB 1U47A 1EP4B 2CPEA 1SL0A 3ZTOA 4UY8T 3BN4A 1EX8A 1RT6A 2X1GA 1M5PC 2CPIA 4R8UA 2OMLA 3CCES 3QIPB 2BANA 1EKRA 1HR0F 4JI1J 2EC2A 1T9VA 5SZTA 4F02A 3MMBB 2AZ3A 1FDBA 1F9EB 3V6JA 4J9MA 3W5XA 2HURA 3OTDA 3ZZ0A 1VC0A 1TL7A 1X4AA 3OLAA 3DKDA 1K73T 2BJEA 3BS9A 3CC7S 3L7PA 1RYRA 5D4NA 3HSGA 4NA2A 5KT5A 3CDEA 4ZDNA 3MZIA 3S01A 4E2FB 1Y5LB 3BQ2A 1VGYA 4CLKA 1RXOB 3GU0A 1UFLA 3EXCX 2Z58B 2OP5A 2KDOA 1UJ5A 2ZH1A 4OQJA 2B3TB 2EFNA 4ZS6A 1G1XA 4AT1B 5BYQA 3MR5A 1RHUB 4CLYA 2FVQA 2HHHJ 4DR4F 3UDEA 3QRQA 4C7QA 2U1AA 3BR9A 2XS7A 1BY9A 1WTFA 3KLHA 3MM5B 1TUVA 3QRRA 2RS2A 2WOMB 4RL1A 4WKRA 3FDSA 4ZVGA 4JI4F 4YDXA 2M3DA 3W9HA 2CPJA 4PWDB 3D1HA 4NLGA 4JI6J 4J7CA 4Y00A 4RNOA 2YNIA 4L73A 5B08A 3W60A 5B0AA 3R8YA 5F3ZA 3TZXA 3H90A 4B3RF 4AD6A 3DI6A 1Q86T 4LSNA 1C4AA 4D3HA 4DV2J 3I9V9 1NMEB 2B9YA 2IA0A 3BSCA 2H5JB 2W2NP 1MMDA 3N0VA 1F9HA 1N5YA 2DBBA 3C66A 2H51B 1FRJA 4I6YA 2HQCA 2LXIA 4UQTA 1I3OB 3VGVA 1XBWA 3GIIA 3H98A 4P2MA 4V1Ak 2FD2A 1RT7A 3QZ8A 3F56A 1Y7PA 2DYAA 3ICLA 5D0RA 2MKKA 4OFZA 4PWUA 4JI1F 4IRDA 1RWPB 2GX8A 4P74A 5E3CA 1RKJA 4KGZB 2RKIA 2HHUA 5LXYA 4DUYJ 3HHDA 1QE1B 4DX8H 1REVB 1H2VZ 4Q5VA 2YVSA 3Q23A 2JNJA 5HQLA 7AT1B 5ETNA 3BGUA 1GXUA 2OI2A 3OSPA 1TVRB 1EETB 2Z2YB 3TEHB 2VODA 5IM0A 4H4MA 4JI5J 2FJBB 2GGPA 5KFWA 2CPZA 4HEA9 2D74B 4GO7X 3EDRB 1FEEA 3KHHA 1T0TV 5T7LA 3VZHA 1PYTA 1YZ7A 3NP5A 1CJKA 5IQ6A 4CDIA 1S1UB 3K89A 4CM0A 3EE3A 3FSXA 4CYUB 3WC2A 1Y5NB 3M8YA 3EYZA 5AE1A 1RCXB 2A1BA 3MM8B 2RHSB 3W5YA 4MH8A 3MMBA 2VPYB 4DUZJ 1V5VA 1S0VA 4NASA 3QWUA 4YP3A 2PI4A 1JLAA 2PT0A 4JI6F 2VICA 5DZ6A 4WTOB 4ZCKA 4OLOA 4CH1A 3MFIA 2Q6CA 2XSJB 4QIWD 3KJQB 3DRYA 2F8HA 3DLKB 2QT7A 5FLXY 2WK4A 4M5GA 2VZ9A 1NJZA 3PDNA 4ZPBA 1ZM4A 2HQDA 4DV2F 3V6KA 2O3DA 5E0OA 3BPDA 2GVDA 2AGPA 1EKSA 1RTZA 3RAXA 3G82A 2H5IB 5KT3A 1N6QA 5T14A 4L75A 2YWEA 4NLUA 5E3RA 2AHOB 4TKTA 5DDPC 4DOZA 4OX7A 1SQEA 5IS2A 1AT1B 3MM5A 2BE7D 2DK2A 4O3SA 1RWOB 3SCKE 1X31C 3M2UB 2XBPA 3OR1B 3EPGA 2EFPA 2VBYA 4J9NA 1G3OA 1AB8A 3UNYA 2GMLA 2KVQE 4HACA 3OTEA 3US5A 3WBZA 1TK8A 2IM2A 1F60B 2LQ8A 3PJXA 1YHQS 3PO4A 4JV5F 1YZ6A 3KUEA 2DNPA 2YKQA 2JFKA 2BMBA 2FGCA 5IV4A 3IRXB 5C24B 1X9WA 1NK0A 1VQ9S 5AE3A 2UP1A 4CLZA 1OJ4A 2VH7A 3MI7X 3MEGB 5IWAJ 2V8DA 2YQ3A 3CDWA 4JI5F 4ZJLA 3MR3A 1VK8A 4QQBA 2MQPA 3H0PA 4OHVA 2NPIA 3C2PA 2FQQB 2ZHBA 2G2OA 2HS3A 4A8YA 1P9QC 1QLNA 4LFBJ 2HBQB 4JI0F 1R0AA 2UXDJ 4DFMA 1FRHA 1NUEA 2IYIA 1B0VA 1M90T 1QE1A 4DUZF 3PR5B 1S1TB 2ZH9A 2FZCB 2B4PA 4Z7YA 5A8RB 3W9JA 2PSZA 5C5JA 1RT4B 2XS2A 1XMBA 1IXKA 3W5ZA 1P8GA 3VR1A 2ZM6J 2LMIA 3IRWP 1SJ3P 4J9QA 2ZE2B 1VYAA 4LF8F 1QVGR 1TK5A 2YH0A 2M8HA 3GLJA 4NEZA 2ZNYA 4JI3J 1RJJA 3WX4A 3LP1B 2DH8A 1FX2A 4DQIA 1JKHB 2JFDA 5KFBA 5DO2A 4LIRA 2EFVA 3DLGB 1RA6A 1URRA 1V3RA 4WU2A 5AXMA 3MM8A 5KFVA 1QDUB 1YJRA 2P9GA 4DHVA 1UVJA 4ELTA 2D1CA 1FE0A 1HYSB 3JAMU 3P6YC 2EKNA 4OHZA 4FF3A 5I3UA 3DOKA 2DTJA 5DRKA 1GH8A 3Q8UA 3R1HA 5D0EA 1JLCA 2FVPA 2E9TA 2W2PP 3J7AN 2EG1A 2WW8A 4F04B 3K57A 4WFYA 5IWAF 3ZZPA 1R31A 4ECUA 3DHWC 1NB7A 3IC1A 3I4PA 3BKUA 3AODA 3KK1A 2QV6A 1VQNS 3GP9A 1YJ7A 1RACB 3BDEA 1IM6A 1N5QA 3T41A 2DNGA 2X1FA 3GIMA 4K5RA 5AXNA 1IWGA 3OFHA 2UXDF 3TVZA 2V2KA 2CZVC 4NPOA 2LU1A 5GADI 5KFXA 1LWEB 4QWEA 1DTTB 3BBFA 1P27B 1U0HA 4Q45A 1RTIA 1RAHB 3K5PA 3MEGA 1F5BA 2ZD1B 1RHQB 1Q95G 4C8KA 1UWBA 4QWDA 3Q0AA 3IWLA 1N36J 4LVOP 1YQHA 2ZH5A 4IKAA 1QD1A 4DPXA 6AT1B 1PYSB 1R8CA 3N28A 1WF1A 4UZCA 2HBRB 3GILA 1U1MA 1RDRA 1SH0A 2VG6B 4B3OB 3KLEA 2W4DA 4WFXA 3WX8A 3MEDB 2FZGB 2Z0GA 3GPAA 1M1HA 2MQNA 3TI0A 1S4FA 1M5KC 3CNQP 2HGNA 1Y9OA 3J81Y 2VG7B 3CCWA 3DGVA 2ZH6A 2EC0A 3QFWA 1TR0A 4AUKA 2RU9A 3B4MA 4I68A 2FHJD 2V0NA 3SQGA 3T5HA 1UVNA 2W9BB 3Q83A 5K14B 1Y3KA 2AIRB 1F3FA 1I1GA 4LIWA 5HMWA 5ETVA 3HKWA 1GXLA 2HNYA 1CJVB 4MJKA 1V3ZA 2FHJA 1RWKB 2MLZA 5J2NA 1S5ZA 2WVEA 4DU7A 2XY7A 2A10A 1RT2A 5HP1A 4NXNJ 1RBAA 1FFGB 1L3TA 2G1DA 2E1CA 3R6GB 3MGJA 9RUBA 3DRSA 3VWSA 5ETTA 3MUMP 3GJSB 4LBPA 4J90A 1HD1A 4LQ9A 2DNQA 1U6FA 5D6GA 3AD9C 4PXBA 2YH1A 4A8KA 5HSPA 1BE4A 3KHLA 4F2SA 2FDNA 2GHVC 3M30A 4HKQA 3PZPA 5HANA 5HROA 2AYBA 1G4CA 2J76E 1IM4A 4PABA 4L74A 4N56A 4MMOA 4X4QA 3WIUA 4ILRA 5JJBA 1EQ0A 4MK7A 2RF2B 5B09A 3BO2A 3BH7B 2M5YA 2MZSA 2OTLS 2DGUA 2ZHAA 4TNOA 2WBRA 2F9JA 1D9AA 5IT9U 5J2PA 1YX2A 2KH9A 1PSDA 2QLFB 3M8WA 3FSIA 2J9DE 1MMNA 1Q0NA 4ED4A 3FCWA 3ENWA 3H5XA 3CO9A 4KAIA 3NNCA 1TELA 5CCMA 1HQUA 3CWJA 3GIRA 5CAAA 2ZD1A 1RBLA 1GAOA 3PRDA 5KFJA 4K4SA 3L9ZA 2DEIA 1UCNA 1UP1A 3KLFA 5CYJA 2VC1A 5I3QA 4DX7A 2X3GA 1S79A 2BUNA 1M5SA 1R27B 2V67A 1PAEX 1JMTA 3HHKA 3T6BA 4GC7A 4M63A 4LQ3A 2K3KA 4ZP6A 3M8PA 3NAHA 1DQ9A 4RUHA 1X7VA 2VHGA 4X4TA 3VAKA 5K20B 4TYAA 1FXLA 4R5PB 3AOAA 1FJCA 3HT3A 2VKZG 3M8ZA 1SKRA 2VG5A 2XMKA 3G6ES 5F8NA 3BF4A 2ASJA 3DMJB 2ZBQA 5DG7A 2NYIA 3SYZA 4C97A 1WC5A 2JWNA 3VAGA 1CJTB 3N6NA 2XO6A 2BM0A 4C2MA 2CIMA 3QSIA 4U7UK 4IR9A 2GHWA 2HNZA 1PILA 1VRUA 1QAIA 4XPCA 1YBAA 5J1EB 1LWFA 2RS8A 4LF5F 3FCHA 2LEBA 1W25A 5GAGI 5ETRA 2IDEA 1ZZFA 1HBOB 2KB2A 3MMJA 1RWUA 3LQVA 3W63A 1UVKA 1C1CA 4OZ5A 2BQ3A 3CGIA 3TUZC 4QCLA 1RWMB 3WIVA 3GJTB 5GADU 3UN3A 2C3UA 5KTQA 2M2BA 4LJMA 3NGTA 2VOPA 4JI2J 2QMWA 3JQMA 4YY3J 2HQ3A 4B02A 4DG1B 2XSFA 1WHWA 2IC3B 1M1GA 4FVMA 3PIPQ 1SJQA 4GC6A 2WVFA 3RB0A 2FHKA 4XDCA 2ATLA 4EK2A 3HJFA 4ECSA 3EZUA 3CPWR 4KY3A 4USUA 2M8DB 3CW2C 2B6AB 1IKXA 2R9LA 1VQPS 1UA1A 1T3NA 2ASLA 4X64J 2COLA 2JZ5A 3R2CJ 2W2QP 4R0EA 4Q2LA 2YQ0A 3W2VB 1CULB 3H2VE 1BWVA 1TU0B 2VJVA 3EXYA 2IM0A 4K2XA 4KGXB 1UEUA 2FY8A 5LMUF 1S7IA 3SCIE 1UVLA 5C42B 4X4PA 4O23A 1TKZB 2Y0SD 2XGQA 4IUFA 5JVGQ 3I0RB 4NCGB 2MQOA 3HHLB 4DV0F 2ZJQQ 3C14B 3I82A 1HHQA 2R8IA 1HNVB 3D1QA 4ES3A 2QA4S 4PQUA 2YNHB 4CO0A 2CYYA 1JLFA 4I7FB 2F8EX 2VUGA 3KHGA 3DOLA 9ATCB 1Q8KA 4RBUA 1N34J 2HMIB 1VC6A 3TQ1A 1OPIA 4DR2F 1Q8LA 2HQIA 4CLWA 3QJLA 1O5JA 3V4IB 4C11B 1NJIT 2VQEF 3IS9B 2B7BB 3UI3A 2NSCA 2Y1JA 4ECZA 3EGNA 3ZZRA 2XHCA 2GV1A 2XGPA 4GKKF 1ZM2A 4Y0FA 1X60A 1NK6A 4R5PA 1MLAA 2CDQA 3A3PB 1UEVA 2RRBA 4DSEA 2OSQA 2ZHOA 2UVWA 4LF7F 3BV8A 4HTIA 3D0HE 4WK1A 1R3NA 1JLGB 5A6WA 2OPPB 4IG0A 1CJTA 4NZ6A 5HVFA 2J8AA 3H5YA 1AZSA 4UZBA 2ZH8A 2JEGA 4QU6A 4NLDA 3TAPA 1REGX 4DL5A 4X64F 2XC9A 4U6PA 3NAIA 4JI7J 4DSFA 5G0RB 4DSJA 4BLGA 4I6AA 3TVKA 2ZBRA 3JSRA 3ETOA 5E7OB 1WHXA 2CQPA 1QAXA 4AXIA 4HYKA 1U1KA 4DR7J 1WEXA 4NRUA 2IC3A 2Z57B 2EXUA 4NXMF 4MKBA 2V4RA 2V69A 3GSDA 4WU3A 1YBTA 1WOSA 1Q53A 4YDDB 2CQGA 3DGPB 4OYMA 2ROGA 3CE8A 3ZC4A 5HATA 3W61A 5HLFB 1VBZA 3D3CJ 3EM1A 2B8PA 1U1LA 4P71A 2NREA 4J9OA 1N34F 3HCXA 4OYIA 2NYHA 4CLFA 2YXLA 1MWZA 4AXJA 1IWAA 1O0PA 3AD8C 1YG0A 2FJDB 5D4LA 2LU2A 1MROB 3C3LA 3CDAA 3HHLD 1T94A 3FBEA 2KFZA 2L9DA 4B3TF 1RB0A 2HHWA 3LP0B 1U6ZA 3SQOP 1RLCL 2MKIA 4FS2A 1WSVA 1SL1A 3OTOJ 5JVHQ 5GAGU 2FLLA 3ISNC 3KLGB 2R7RA 4GVBA 4LMZA 4CLPA 1E6YB 2O5DA 1B4SA 4NX9A 4IR1A 1N33F 1XWLA 2DISA 2OEMA 1DQAA 3ILOA 4ZN1A 5FDLB 4I2QB 1OPZA 5CCLA 2XWYA 1KOOA 4N47A 4EYIB 5IV3A 3S8SA 1HIYA 1B7FA 3KNAA 3GFHA 2V2ZA 1VQ8S 2CJKA 2F8MA 1UJ4A 4N76A 3UDCA 3W2WA 1OS5A 3RBXA 4JUZA 4IFYB 2IFXA 2BBEA 2ZDOA 1SJFA 3TWZA 2BKNA 2W2OP 3LF0A 2XS5A 1CQNA 5G4DA 4DV7F 2PEHA 3IMQJ 4ZHRA 2HKEA 2HYIB 4OL8A 3N9UC 2HNDB 4PG5A 3MPWA 3T9ZA 2DXDA 2KHDA 1SV5A 4KTQA 4ZJQA 2HFUA 3SSQA 3C6UB 3UDVA 3JXOA 3MPUB 1H73A 3CJ3A 3LTOA 4NYZA 1WNEA 5M2PA 4KC5A 4EYHB 1IBKJ 1I94F 3VAJA 1BD6A 3CD6S 3UQSA 1JLBA 1ZAXA 4LRFA 3J81j 2KT2A 5L46A 2LKZA 3NGSA 3I0SA 1T8EA 2QX0A 1BMQB 2OPSB 1ICEB 2F40A 2B9XA 4UOGA 4EEYA 1RA7A 1WSRA 1YKWA 1WC0A 1HFEL 4ED7A 3LAKA 1U48A 3CCUS 3BGRA 5CD4A 1EHWA 4QBUA 1GTEA 2BJ3A 3RZAA 4EBDA 2EW9A 1RHJB 3OTOF 1ZA1B 4A8WA 3VVUA 4J91A 4FXVA 3MAQA 3R97A 2R2RA 1H2UX 2IMWP 4RZRA 3C15A 2B4VA 1RTDB 1G7CB 2W8LA 2Z4PA 3H5UA 4KHPF 3CTRA 1GFWB 3OL8A 3UE2A 2KXHA 3BGOP 1KFSA 4DUTA 1T9UA 4F2RA 2DHAA 3ZZOA 3N01A 1HBMA 1W2BR 5HO4A 2ALZA 1VFJA 1KN6A 4XTTA 1X4GA 1FTCA 5B0GA 4TQRA 4X62F 3LP0A 4P72A 2DY1A 3CD0A 5FIIA 2XI3A 2DGOA 4DPTA 1PBAA 4PUOA 5HQ8A 2DHXA 5KFQA 4PR6A 3FBCA 3U1LA 1UPMB 2XQCA 3C19A 1E6YA 2FYXA 3AJ1A 1FNOA 4OZ3A 1IBMF 4DF4A 5HMYA 3F44A 4FYYB 2AP6A 2C2NA 4X4VA 4A4JA 1VQSA 2DR6A 5C2GA 4C6AA 3KNGA 2KYZA 1RWNB 2J6SA 3PW0A 4QYRA 2RUGA 3D6TB 1HW8A 1HQEA 4ETZA 2ILYA 4N8OA 3DM2A 5ETOA 2CQ2A 2J0QD 4Z37A 2LXFA 1X4DA 3KK3B 2BJ9A 2DNOA 1C4CA 3E01B 1HNXF 2HNDA 5KFIA 2H3EB 5B0EA 2W01A 4WIIA 3QATA 4IG3A 2D3UA 4ZVHA 2CJ9A 4DSKA 3HFZB 3CUNA 4EUVA 3I31A 1JLQB 2M7SA 1VQ7S 1IBCB 3IR6B 4S0MA 4YOEA 1N4LA 2C3MA 2CQDA 4LF9J 4OI0A 4NZ0A 2QLXA 1KTVA 1GXTA 3LGMA 4C48A 3BQ0A 2VASA 3CC4S 2AF6A 4NI2B 1W2IA 4FYVB 4URGA 3UDLA 4GKJF 3V2UC 3ZXWA 4NCAA 5KFMA 5F8IA 2PC6A 2DGXA 3QWPA 4KJIA 3W65A 1PJ5A 4OLPA 2DO0A 2PFDA 3TR5A 2GAHC 2HWTA 3MXHP 4ZP8A 4QJVA 1CBKA 4PG7A 2K06A 1MU2B 5CYQB 1VOMA 4ITSA 4RU2A 4ED5A 2DRAA 2FJAB 4B9VA 1WHYA 3QSYB 4DPYA 5C25B 3JSMB 4H4OB 4OMFG 1RTDA 4ZA1A 4HVZA 1X9SA 3TA0A 1RU2A 3M32A 1FRMA 1U2RA 3TJAA 1DQ8A 2KT5A 2Q66A 3SCJE 1U1RA 4OI6A 2BR0A 3IR5B 3NMRA 1FDNA 4DX5A 4KGVB 2WSEC 4QOTA 3CC2S 2Q43A 3LO3A 4DCJB 3NWGA 1X5TA 1HI0P 4IO9Q 2V4JA 1S6OA 4BC9A 3KG0A 1D09B 3OVSA 5BR8J 4DV5F 3MECA 2WRMA 3RRHA 3LUYA 1AYEA 2ABYA 3SV3A 2AJ4A 2Q79A 1BQMB 4ZVUB 2VB6A 2C3YA 2MEWA 4DR6J 2NUUG 1C0TB 4WP9A 4U8VA 3NBPB 5JXSA 3KK2B 3NS6A 1CS4A 3H8YA 2MLYA 1NK9A 5F9LA 1HLWA 1UFKA 3G6VA 1LW2B 4CO2A 1TMJA 2O67A 4HH0A 3DU5A 5T41A 2P6SA 4ECWA 1LW0A 4FF2A 3THPA 3HZGA 4TLQA 1WC4A 5I4MA 2I38A 1TKTB 2L9NA 5J1PA 4J9KA 2HPUA 2GIFA 3UVJA 3N79A 3J7A1 3R5DA 1QY7A 3BKFA 3UNGC 2E5JA 3POTB 1O8BA 2AEMA 2C3OA 1BQXA 1S99A 1OIAA 2CQ0A 5ETQA 3HKZD 3J80U 3KK3A 3HLUA 4NA3A 1APSA 3AH6A 4XK8C 2LEAA 2XNRA 4K4WA 3R9LA 3HVTA 1NK4A 4Q7AA 3EX7B 4DWIA 4DR1F 2FVRA 3GR0A 4TU7A 5DLFA 2KU7A 4KBIA 2MHNA 2VPZB 3TX8A 2VBXA 2YKAA 2ZEJA 3TANA 1VR6A 1D1UA 2V4QA 4JBCA 3T1HF 2LDYA 2PMZD 3LW5C 2RT3A 3BSNA 1WI6A 3ET6B 4GMKA 1JNRB 3TVYA 2DB1A 2FUG9 2DGVA 2ZJPQ 4P6QA 4DEZA 3GTYX 1IKYB 4LR9A 1DFDA 1KHVA 1X5OA 1SJ1A 2BJDA 2G0IA 4P73A 2D9OA 8ATCB 5F0UA 4HLBA 4RNHA 3ENAA 2PFFB 5BR8F 1RTJB 2CPHA 4A46A 4QWCA 2FGOA 1ZAVA 2QJ3A 1MU2A 2IVFB 2HGMA 2FZKB 4JI8F 1F9FA 1N48A 2MKJA 3VHQA 1JXVA 2EK6A 4OX9J 2HRYA 3FEXB 4ES1A 1KQGB 2G2ZA 4ED0A 2E1PA 5C25A 3UD3P 3JSMA 3PG9A 1LK5A 1HQ2A 5LSRA 1HBUB 2RQ4A 2K2PA 4UOFA 1S76D 1IKWB 1NHUA 2VQFJ 3U1MA 2Z56B 3C16A 3W1YC 5LM7E 3FRZA 1WWHA 5KG6A 4HT7A 4KT0C 1S57A 1VQOS 1T02A 5K8MA 3KKFA 4USMA 1JX4A 4DZDA 5KT6A 4RKUC 2FJXA 2G1HA 2LYVA 1H98A 1U8SA 1JWWA 4DV3J 2BABA 2A0FB 2MSTA 2OPQA 2V9KA 1XJWB 5KFGA 1BQMA 2AT1B 5HI7A 1RGVA 2CPDA 3KMQA 2OHDA 4MTPA 4RW9B 4RW7A 3C6TB 1N32J 1BC6A 4KH1B 4J9SA 3M9MB 3SXLA 2C22A 3DRRB 3ZZUA 1F2GA 1XMQJ 2RUSA 2MQ8A 3SDEA 3I55S 4HT5A 4CCHA 1A6LA 3KYLA 3FC9A 4RW8A 4Q0BB 1X0FA 5D77A 5JMNA 2R8GA 1EAYC 3K2YA 3MMCA 1WELA 3I96A 1TKTA 1MNEA 2V5HG 4K4YA 1SCJB 5CYMB 3NWRA 4UOHA 5HN0A 2P9CA 2PI5A 3CJQA 1N56A 1HD0A 3H59A 1RSCA 4W90B 1N5VA 3LP2A 4CZCA 2VPXB 1TL4A 5DZ7A 1J5OB 3DFEA 3MEKA 4MKAA 2OPRB 3SSSA 5DDRC 4OX6A 5AXLA 2B0GA 4ICLB 3NMAA 4P9SA 3SI8A 4ZMMA 4OX9F 4WE1A 2QLBB 1Y0HA 3EJMA 4FYXB 2R2UA 2A18A 2V94A 2HHXA 4AL7A 3CCJS 5KFZA 2VKRA 1H2TZ 2AEFA 2ZBPA 2YNFB 4DV6J 2E5HA 4WIQA 2VC0A 3J7Z5 5ETKA 2RDDA 2JH3A 4JV1A 3NOGA 2PMHA 3OPKA 2IAJA 4DF8A 5E41A 2P2CB 1BHNA 3TQEA 4WFNQ 2CXEA 3MMAA 1S0MA 3SCLE 1VC5A 2GVZB 2VBWA 4NLOA 2V9WA 1BXNA 5D78A 5ADZA 3M4XA 3Q2TC 5CZXA 2DVIA 2HRTA 5LJ3Y 4NLPA 3TUJC 3MR7A 4AL6A 1ZTTA 1E6VA 3I6PA 1U7LA 2ZITA 3QO9B 5AJ3F 3GFZA 3CJ0A 4DR3J 3NS5A 4AFFA 3D5MA 5L9NA 5HVGA 2G0CA 3MF5A 2AJ0A 4M5JA 3EMTA 3K58A 4KV8B 4LRBA 1C0UA 5F41A 1KLMA 5DJBA 4ZVFA 1VQ6S 1G6BA 4G1PA 2OAUA 2XZDB 1S6UA 3GB0A 4Y2IA 1CC7A 3WC0A 5EX0A 4RW6B 2VDHA 2D7SA 3KJVA 1ZS6A 1XC9A 2BXJA 4HI2A 3G86A 4CI0B 2APOA 4C9DA 3CDUA 4LRDA 1DLOB 3IBWA 4IFVB 3CMAS 2YX4A 2BKOA 3WZ0A 1S1VB 3IAS9 3KUHA 5L9XA 2ILZA 1RABB 5B7WA 1H72C 1QTMA 5A2QU 2VOOA 1TKXB 1S9GA 3TOQA 4ECXA 1S49A 5KOWA 2W4PA 2ZBIA 4Q0BA 4CWBA 2E1RA 4DFKA 1S97A 4OHYA 5J2MB 4DL0C 4J9VA 1J2VA 4DV6F 1IKVB 3FSYA 4DV4F 1TL3B 4UQGA 1NHVA 2YNGB 2YWKA 1J5EJ 2OJ3A 1OY8A 3LWMA 4O44A 1S1XB 4CM2A 1PGZA 1HWIA 2UXBJ 3HM9A 1U24A 3I9ZA 3ADAC 1J5OA 2IBKA 3SZ2A 3NEKA 4NYOA 4Y2MA 1RT6B 1TQLA 3K59A 1XERA 4R8UB 1ZBTA 4OJ1A 2F3JA 2ZZNA 1VIOA 1XMOJ 4L3NA 4ATNA 1N54B 1S12A 1TTHB 1WG5A 2HZCA 2NXCA 3A12A 5GMKa 1WDDA 4OYWA 3IO1A 4DR3F 4ECYA 2KZZA 3KMSA 2OMOA 3ISND 1TL7B 2CNNB 1NZ8A 2QYCA 2ZC4A 4RW4A 1UKUA 4DBQA 2VDIA 1NKBA 3BGFA 2W8KA 1IR1A 5A0YA 4IH7A 1S59A 1R8HA 3MUTP 2HLTA 1Q79A 2YKMA 1MMLA 4XDDA 4J9RA 3ILLA 3TRGA 4PZVA 3OVAA 4HI1A 1KEKA 2CPXA 2YQ1A 4WWSA 2UUCJ 2OEKA 1KQKA 2HIQA 3Q86A 1UAWA 1T03A 1UZDA 2KO1A 3FJ2A 2V68A 5E5NA 1K47A 4KE5A 3CCMS 1HR0J 1MN7A 4DQQA 1RE1B 2V63A 3RW7A 2OIHA 3NLCA 3P5BP 5GMDA 1NEEA 2K8GA 3QO9A 2ASYA 1S48A 1SJRA 1WUUA 3MEEB 4RX6A 1ZH5A 2IM1A 1Q7YT 1XQIA 1TKDA 1VISA 4C8LA 3W7BA 4B3MJ 2DR9A 2BA9A 2J7UA 2YNIB 2UV8G 3HK2A 2W4CA 3K5OA 3VAIA 4PPZA 4DV1J 2OUGA 3DYAA 2RQMA 3TZWA 3OFGA 3DI6B 4LSNB 2IJNA 3RRKA 3Q22A 2O01C 3HT0A 1YIJS 1TZ0A 4WFZA 1HHTP 2EFQA 2WVBA 1FRKA 2ALYB 2RJZA 2IRUA 2H5EA 1N5YB 5D0HA 1KHWA 5D3GA 3V81B 4DLEA 2EI5A 2ROEA 1RT7B 1OQ3A 4O4GA 4RO0A 3QRPA 2CPYA 4QIEA 4FPRA 1S6QA 1XMOF 4LF6J 2CKWA 2QMUB 2WHOA 4QU7A 1URNA 4HL9A 1UW9A 2WW4A 2RKIB 5RUBA 5KFDA 3HF5A 1CLFA 3UW1A 3U27A 1DURA 5F8LA 4X4UA 1UVMA 1C1BA 4ALZA 1TL3A 3GG1A 3H4DA 1NSKL 4B3RJ 2KN4A 1FEHA 2B51A 2CJBA 1JIHA 1KR4A 4PYAA 1GMUA 1A9NB 1XTZA 3QGIA 1SH2A 4F4KA 4P2XA 2EBGA 4MKVA 2P9EA 5IM0B 2W25A 2RQKA 1OO0B 3KG1A 2GGPB 1YRXA 2JSXA 4HH1A 5DETA 2KI2A 3P8BB 4F0HA 5T7LB 1M5VC 2UUCF 1CJKB 3DU6A 3EZOA 3J80Y 4NOHA 2MKHA 4TY9A 1PG5B 1U2CA 3PX4A 2C42A 2XMUA 4M5MA 3BR8A 1IBLF 4X4NA 1I6JA 1DARA 3JTPA 5KFEA 4ID5A 1YWXA 2YPYA 2ZJRQ 3A1YG 3F73A 1UL3A 1JLAB 3R7NB 1SBRA 4B9UA 3M8QA 2NPFA 1ZTWA 4B3MF 2QL7B 2FHMA 3MM9A 3A8EA 3VGUA 1I5OB 4DU8A 3QZ7A 4DV1F 1J27A 1X4CA 4I64A 5LSOA 3UN2A 2BM1A 4JV0A 2DGWA 1DTQA 2GVDB 4NMLA 4TXSA 3NKYA 2R7WA 1KS2A 2LCWA
chains in the Genus database with same CATH topology
1IKYA 4FP9A 3HVTB 4PXEA 1N6QB 2NSCA 2KJVA 2DNLA 3E8OA 4ETXA 2Y1JA 3F41A 1FJGF 5HMXA 3L7OA 4WF9Q 4OI4A 2G9OA 5A8WA 2BV3A 4ECZA 3EGNA 3PR4A 2ZM6F 3OUYB 4DV3F 1AUDA 1RI7A 3ONQA 1VRTB 3ZZRA 1R7IA 1X0PA 2GV1A 3OL6A 3PACA 1RTJA 1VK3A 4BCAA 4LF6F 1M5HA 3MEEA 3IAM9 4F50A 4JI3F 2XGPA 4MN4C 4ELVA 4N5SA 5KT4A 4GKKF 1FK9A 1ZM2A 3AA8A 4MFBA 2I5JB 4Y0FA 3KOAA 2MDAA 4UUXA 4DN0A 1NK6A 1VJWA 2AX0A 3OQ2A 4ED1A 4R5PA 4X4OA 2CDQA 5KFTA 2CZ4A 2MZQA 4B08A 5BYRA 1UEVA 2RRBA 4DSEA 4Q2MA 2RRAA 3M6WA 3VAHA 3MOJB 3V4MA 2OSQA 5KFUA 1N32F 3UWTA 2WSCC 2ZHOA 3X1LB 2UVWA 3RB3A 2B7CB 4LF7F 2E5GA 2R7VA 5A8KA 4HTIA 3D0HE 4IO1A 4WK1A 1BLUA 1R3NA 1X4BA 1JLGB 5A6WA 3H2LA 1RQ0A 2OPPB 4IG0A 4WZMA 5KG2A 1D8YA 3DRXA 1XMQF 4LF4F 5JUMA 4NZ6A 4U7CA 1QAJA 4IQXA 1LXJA 1HBUA 1S7HA 2J8AA 3H5YA 2GJIA 3M9OB 1ZZNA 4ZPDA 4FF4A 4HHJA 1IKWA 2ZH8A 4WXOA 2JEGA 1FDDA 3K7RA 5KFCA 2A3JA 2KTQA 1VS3A 2GA7A 2N3LA 1NO8A 2N3OA 4QU6A 3RR8A 3GFYA 4NLDA 3TAPA 1HWKA 4K50A 1S1TA 2DGQA 4QYZJ 1OWXA 4DL5A 1QSLA 2Z2MA 3W3SA 4EO8A 4B17A 2OLWA 5A8RA 4X64F 2XC9A 4QW8A 4U6PA 2ZKUA 3CCQS 4FBUA 3NAIA 3TARA 3RW6A 3R3TA 2FLPA 2MQQA 1RT4A 3IGNA 4DSFA 2YWFA 3LGNA 4RBVA 1VBXA 4DL4A 3V81A 2CQ3A 5G0RB 5KG1A 1P1LA 1BGXT 4DSJA 3FMWA 4I6AA 1RYSA 2R7XA 5KFLA 4A8FA 3TVKA 1GX6A 4Q8FA 1TL5A 1JXLA 2R7UA 1ZYQA 3V5RA 1FRIA 2BVZA 3JSRA 4TY8B 3ETOA 5E7OB 1WHXA 2ZE2A 3DRPA 2WTFA 2CQPA 4B9NA 1NNDA 2QO3A 1QAXA 4AXIA 2HRUA 1HNZF 4Y34A 3SV4A 3DCAA 4HYKA 4B9MA 4KGKA 1U1KA 4C8NA 1WEXA 3P96A 4NRUA 2JL9A 2BE2B 4A47A 1R0AB 4Y2CA 4MKYA 2P5VA 4IOAQ 2IC3A 3UR3C 4ZPTR 4WFBQ 3LP1A 3UCUP 2R7QA 2O66A 1FO1A 4NXMF 1WG1A 4IH5A 2LEPA 5EUHA 1ROFA 4I2PA 2E5LF 4RW9A 4MKBA 1TK0A 4ED3A 4MIAA 1FHTA 1N52B 3C6TA 2MGZB 1SI9A 2V4RA 1RT3B 2JHEA 2DPIA 1JLEA 1V9OA 4WZQA 1ZM9A 3GSDA 1JJHA 4WU3A 3X3UA 3I5AA 3K5NA 1UW4A 2R7OA 1Q53A 4YDDB 1JKHA 2CQGA 3AQOA 4Y65A 3DRRA 4I1TA 2N7YA 2PA3A 2ROGA 3M6XA 3CE8A 2VBZA 5KFYA 3I87A 3ZC4A 3DLGA 5D4OA 1HPZA 2B5JA 3E51A 5HLFB 1Z4UA 1VBZA 2DGTA 1U26A 2J0SD 3OFEA 2RH3A 4KB7A 2HLUA 4YB6A 4WK3A 3FQKA 2XWXA 3BEGB 3QMQA 2UVVA 5F8JA 1U1LA 1S6PB 5LXRA 1Y00A 1C2PA 1CC8A 2DNNA 4J9OA 3PEJA 2NREA 1N34F 2PIIA 3BZQA 1N0VC 2OPQB 2CQ4A 1HW9A 1QM9A 1H7XA 5LL6d 2MYFA 3GE9A 3LOUA 2F4VF 1HYSA 1Q1KA 3B78A 1X4EA 1MWZA 1KFDA 5FD1A 4AXJA 1M0SA 5KFKA 3Q8QB 1O0PA 2PDAA 2RD5C 1RTHA 1YG0A 4RW7B 5CYMA 2FJDB 3N5FA 2GQCA 5D4LA 5E2QA 4CQ1A 2LU2A 1MROB 4FZVA 3C3LA 2JRSA 2JJ4D 3CDAA 3HHLD 3L95X 3OTCA 4YQWA 1T94A 3CXCR 1WHVA 2YKNA 3S1TA 2KFZA 2L9DA 3M2VB 4OJ3A 4B3TF 1Z1ZA 5D8HB 2ZZMA 3GZ7A 3HVAA 3MCSA 3GR1A 2HHWA 4YB5A 1TP7A 1FKOB 4Q44A 3LP0B 4K5SA 1U6ZA 3RAQA 4E98A 3OW2R 3L3CA 2K7JA 4YHHF 3SDEB 4Y2AA 4FS2A 1VHFA 2W7AA 2MKIA 4NCBA 1N36F 5EN1A 5BJRA 2HGLA 1SL1A 3CD5A 2OPRA 2K3IA 1CVJA 4E0DA 5JVHQ 3VF0B 3AB2B 4F4ZA 1U4BA 3PX6A 3NGKA 2YKPA 4RW8B 5K8NA 5GAGU 4NZ7A 3ENVA 1ULRA 1YJUA 4G1IA 3ISNC 2FLLA 3KLGB 2GO8A 2KYXA 3GV5B 4ICLA 2R7RA 2BRKA 3NL0A 3MMCB 4NYPA 2X1AA 1R43A 2BANB 4ZPVR 4LMZA 1LXNA 1E6YB 2QZ8A 2Q3PA 4OHWA 3OLBA 3M05A 2O5DA 4NX9A 2MXYA 4IR1A 1SH3A 1N33F 5IZHA 5I3UB 4DS5A 3DOKB 1ZM3A 1XWLA 2DISA 1UA0A 4G3IA 3DLEA 3BGLA 2JEIA 1DQAA 4OX8A 1JLCB 1KNZA 5FDLB 4I2QB 1OPZA 3PY8A 5CCLA 2XWYA 1KOOA 2UZAA 4N47A 4IOCQ 3RB4A 4ECTA 1D9DA 2XMTA 4YR3A 2C2EA 4N8NA 4EYIB 3CB4A 2B9WA 3D0IE 1FE4A 4YEAA 2WB4A 2LXUA 1NK7A 4BC7A 1FESA 1X5SA 2YNFA 3S8SA 2ADCA 2UVRA 3KTQA 3LP2B 4A8XA 4F3QA 1B7FA 2NSBA 4F25A 3KNAA 3GFHA 3NRBA 2QA4G 1LWEA 2P6TA 1VQ8S 1S77D 3O44A 3CJKB 2HHTA 1DTTA 2W7PA 3CEDA 2N82B 5I42A 2F8MA 3I56S 2CJKA 1SKWA 1UJ4A 2IM3A 2A2DA 3TYTA 3PW4A 4N76A 3UDCA 3W2WA 4TU9A 2GIQA 2QRRA 3KK1B 4JV2A 1OS5A 1D9FA 4JUZA 3N5BA 4IFYB 4IH6A 2Z2LA 3HPOA 4ELUA 3DOMA 2IFXA 2BBEA 2ZDOA 1SJFA 1VI7A 3HX9A 1XK8A 3D1OA 1IJEB 2XZWA 3V6DB 4WE1B 3SEOA 4A8OA 3HO1A 3LF0A 4WFAQ 2EFOA 3MTKA 1VRTA 5L1KA 2XS5A 2PN6A 1CQNA 2E1MC 5G4DA 2KG0A 4EZ9A 1F5AA 3TP2A 1U1PA 2ZOFA 2QLWA 4DV7F 2AX1A 2PEHA 4ZHRA 3K8VA 1D0EA 1S72S 2XMWA 2HYIB 4OL8A 3N9UC 1SJ4P 2HNDB 4PG5A 1N0UA 3B4DA 3MPWA 4RBTA 1U49A 1BQNA 2B4OA 3T9ZA 3S7RA 3B8HA 4A48A 2KHDA 3G6XA 1H0HB 1SV5A 4CO3A 3KWMA 3OXLA 2VG6A 3JB9k 4B3OA 4O3NA 4KTQA 2HHPA 4NL5A 3SSQA 4RUAA 3KLHB 1K8AT 2FLOA 2IRYA 2C2DA 3C6UB 2J6UA 2R8KA 1S1WB 2ZH4A 2IAJB 2M9KA 2JLFA 3E3XA 2CQBA 3CJ3A 3MEDA 4CH7A 2BACA 1NJYA 1X9MA 4NYZA 1HBNB 1RTIB 1WNEA 3K0JA 1NJXA 5M2PA 3GV7B 1M1KT 4KC5A 3RBEA 4EYHB 3AQPA 3JYTA 4MYUA 2I9SA 3MMAB 4DLGA 1I94F 4KO0B 3VAJA 1BD6A 3VQTA 5GAHI 3CD6S 1UWBB 3UQSA 1JLBA 1ZAXA 4ED6A 3RB6A 2VG7A 3OJSA 4KV8A 3TUIC 3CVKA 1AFIA 3CCRS 5EX3A 2NLWA 4GO5X 5E3PA 4CTAB 2KT2A 3UR0A 3MR6A 2AYMA 2LKZA 2XLIA 2CQHA 2C2RA 2DNHA 3G96A 4OI3A 4NXNF 2MJNA 4A8SA 2MZJA 3I0SA 1R6YA 3MAHA 1T8EA 4ZCLA 4KR0B 2J9EA 2OPSB 1HMVB 1SXLA 4LSLB 4OZNA 3VQSA 2F40A 1J5EF 3VCDA 2XMVA 1E6VB 2B9XA 4RW6A 1YSJA 3IXQA 4EEYA 2BW2A 3KLEB 1RA7A 4TY8A 1PO6A 2EG2A 3QLHA 4B3SF 5BYSA 5AXKA 4O3RA 2FY1A 4LVNP 3KLVA 1HFEL 4FNIA 4ED7A 1K1SA 3QYYA 2WAQD 1U48A 3KG4A 3BGRA 3LAKA 3CCUS 1FVQA 2BE2A 4KSEB 4NLWA 2UXBF 4QBUA 1KONA 3MM6A 3NNHA 3MR2A 1KVJA 1GTEA 3RZAA 3ISZA 2W9BA 1Y4ZB 1L3UA 3BQ1A 4EBDA 1F0XA 2EW9A 2RVJA 2IHR1 2R2TA 3OTOF 1SUQB 1DLOA 4PKDB 5K14A 2GMJA 4Y28C 2J9DA 4IFVA 5A2QY 2X51A 4OJGA 1QUVA 2B56A 3TO8A 4ZPAA 4A8WA 1RT1B 1HNIA 1S1VA 4TYBA 3NNAA 3D0GE 1C0UB 3NG8A 4FXVA 4UUWA 3MAQA 2B43A 2R2RA 1H2UX 1KLMB 3CT9A 3OSNA 2IMWP 4KFBB 4RZRA 2B4VA 1FA0A 4D3GA 1RTDB 1G7CB 2NS1B 2NXUA 2ZH7A 2W8LA 2Z4PA 4PG8A 1TFWA 3H5UA 2EWHA 4KHPF 4DPOA 1TKXA 2KRBA 3PRBA 1KC8T 1YRTA 2NUHA 5AE2A 3M8RA 5DDQC 2QMXA 4OV1A 3CTRA 2N7CA 2RMLA 5IT4A 3OL8A 3UE2A 3KJVB 3OBIA 3EPIA 2FVCA 1XR5A 2RU3A 2KXHA 5J2MA 4KQZA 5F8MA 1KFSA 3SQGB 3OL7A 1IKVA 2A2CA 5DG8A 2EPIA 4ZK7M 2V8HA 4Y6IA 5KFPA 1G2EA 4F2RA 2DHAA 3ZZOA 5LSLA 4EO6A 2YNGA 1YRUA 3U02A 5H1SV 3N01A 1U6BA 1HBMA 3G8SA 1W2BR 4K4UA 1NAQA 5HO4A 2DIVA 2ALZA 4C4WA 1VFJA 1JJ2R 4O3OA 1YITS 3EGZA 5DQHA 1KN6A 1X4GA 4PRFA 1FNMA 1S1XA 4L72B 3CSKA 2LDIA 2HNYB 2SXLA 4DL6A 2JC1A 4H4MB 1FTCA 5B0GA 4OI1A 1YJWS 4TQRA 3BSAA 2J5AA 5CH7B 5SUHA 4ERDA 4X62F 3RTVA 1S9FA 5KFRA 3LP0A 4RNMA 1DBDA 4ID8A 4UW2A 2V8VA 5J2NB 1H3DA 2W24A 3CD0A 2XI3A 2M0GB 5FIIA 1U47A 5B0FA 5HBMB 1EP4B 2CPEA 2DGOA 1VQ5S 4FBTA 1SL0A 4UY8T 5KFAA 4PUOA 1S9GB 3BN4A 1RT6A 2X1GA 5H9EJ 1M5PC 2FVSA 5HQ8A 2CPIA 4R8UA 2OMLA 2DHXA 2VV5A 5KFQA 4PR6A 3I5CA 4MYTA 5LMNF 4EBEA 5J2QA 1RT2B 2DH9A 3U1LA 3QIPB 3CCES 5HP1B 2BANA 3FNNA 3DHXA 1HR0F 1E6YA 2XY6A 4CT9A 3H25A 2VA3A 3AJ1A 5SZTA 3G8QA 4F4WA 1FNOA 1KSPA 4F02A 3MMBB 2DH7A 4CO4A 2RF2A 4O44B 3DRSB 4C3LA 1FDBA 1NH8A 3V6JA 4J9MA 2GNKA 2M52A 5CZVA 1IBMF 1RT5A 4DF4A 5HMYA 3F44A 2AP6A 3OTDA 3ZZ0A 1X4HA 1VC0A 4X4VA 4A4JA 3AA9A 1VQSA 4M5DB 1X4AA 3KNGA 3OLAA 3IWXA 4WJBA 2KYZA 6FDRA 1K73T 2J6SA 2BJEA 1JJ4A 3BS9A 3CC7S 2AJFE 5E3AA 3PW0A 3CJKA 4QYRA 3OV7A 3DLLQ 3L7PA 2RUGA 2U2FA 1HW8A 1RYRA 5D4NA 4NA2A 1HQEA 5KT5A 3BDPA 2UUTA 3CDEA 4ZDNA 4ETZA 5HMZA 1MSWD 3CCLS 1T05A 3M30B 3MZIA 3S01A 1Y5LB 3BQ2A 1VGYA 3RRGA 3H4BA 5HROB 2PE8A 2ILYA 2D41A 4N8OA 3DM2A 2CQ2A 3T5LA 2M4MA 3PO5A 1YI2S 2J0QD 1UFLA 3EXCX 2OP5A 4Z37A 2KDOA 1UJ5A 5F0WA 4KIAA 2MKSA 2LXFA 2ZH1A 2D3OR 4OQJA 4IOBA 2AJQA 2ZH2A 2B3TB 1X4DA 1IQZA 4HDGA 2EFNA 4JOUA 4ZS6A 3KK3B 1G1XA 5BYQA 3AY0A 2DNOA 3MR5A 3T5KA 1AFJA 1C4CA 2D3ZA 2FVQA 4DR4F 3E01B 1HNXF 1X4FA 2HNDA 4XPEA 4C7QA 2U1AA 5KFIA 5B0EA 3BR9A 4WIIA 2HWIA 4IG3A 4RW4B 2D3UA 4ZVHA 5J2PB 2XS7A 4I6WA 1V3SA 2CRLA 3NCRA 1BY9A 2CJ9A 4DSKA 2ZOGA 1WTFA 4ILLA 3UCGA 2FTRA 4EUVA 3KLHA 3CUNA 4F3MA 5A0YB 3MM5B 4H54A 1TUVA 2H9ZA 3I31A 1JLQB 2RS2A 2XI2A 2M7SA 2WOMB 2R7SA 4QWAA 2KG1A 4WKRA 3FDSA 4JI2F 4ZVGA 3T5JA 1VQ7S 4JI4F 4LFAF 2YKMB 4YDXA 3H5SA 1Q16B 2M3DA 2E7XA 4YY3F 3JTOA 3IR6B 3MURP 2KHCA 2CVEA 2CPJA 4PWDB 1HBNA 1Q8IA 4DS4A 3D1HA 1N4LA 2C3MA 1HQUB 4YOEA 3J7ZT 4NLGA 3RAMA 2CQDA 1UJ6A 4KKOA 1XR7A 4OI0A 4NZ0A 4DFPA 2QLXA 1KTVA 4Y00A 1GXTA 3LGMA 4RNOA 1ZAWA 2YNIA 4HTJA 5B08A 3BQ0A 1LV5A 3RR7A 5L38A 2KT3A 4DL2A 3I4HX 2VASA 3CC4S 3JTNA 1Y5IB 2AF6A 2BRLA 5B0AA 1O51A 4CTAA 5F3ZA 3DMJA 1HL6A 1RKIA 1UFWA 1W2IA 4URGA 3NCPA 3UDLA 4GKJF 3V2UC 1DJ0A 1T03B 4NCAA 3KLFB 5KFMA 5F8IA 2GHPA 2PC6A 2DGXA 4B3RF 1Q86T 3DI6A 4LSNA 1C4AA 4U9RA 4LSLA 2J6TA 4OHXA 1FKPA 3QWPA 4D3HA 4KJIA 1RK8A 1OSDA 2CFXA 3R27A 2E66A 3I9V9 1GTHA 3M2RA 5J1EA 4OLPA 4DL7A 2B9YA 2DO0A 2IA0A 2M88A 2RIJA 3BSCA 1RISA 3QPIA 3TR5A 4YR0A 4I67A 2HWTA 3CCSS 4BWMA 1MMDA 3N0VA 3N4WA 5E3QA 3MXHP 1YGYA 4ZP8A 4RUCA 3M8PB 1N5YA 1HBOA 4QJVA 2DBBA 3C66A 4NLSA 4H4KA 4PG7A 4I69A 1MU2B 2HHQA 5CYQB 4L6V3 1VOMA 2J9CA 2CJAA 2RILA 2HS0A 3IR7B 1FRJA 4LFCF 1D8ZA 1JK9B 4ITSA 3HVWA 4I6YA 2LXIA 4RU2A 4UQTA 5EHHA 4C3KA 2XMJA 1XBWA 2FJEB 2YWHA 3GIIA 3H98A 2Z8QA 4DSLA 4V19X 3UD4P 4ED5A 2VG5B 2FD2A 1RT7A 2DRAA 1LWCA 3QZ8A 2FJAB 4B9VA 3F56A 1GQEA 2MY7A 1NK5A 1Y7PA 3Q2SC 1WHYA 1PC4A 2LQ9A 3ICLA