1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
b'KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
molecule tags Chromosome segregation
source organism Thermotoga maritima
publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
2D3O1 3I4HX 4QWBA 4HYKA 1JLGB 2OPQA 2HHTA 3DGPA 1SQGA 2EFQA 2HNZB 1HYSB 4TYBA 1E6YB 4RKUC 4PXDA 1HWKA 5LMUF 2W8LA 4RX6A 2I38A 1NHUA 3D1HA 3EXYA 4KFBA 3SCKE 4AL7A 3S6EA 4IOBA 2VOOA 2OSQA 4FN5A 3QRQA 3V6DA 2MQMA 2UXCF 1AA1B 1R3NA 1NM2A 4ZN1A 2A18A 2H4YB 4B9TA 4TVAB 5JMNA 1UL3A 2R4FA 2J7KA 1U2CA 2AIRB 4XPCA 2DRAA 1FKOA 1RXOB 1A9NB 2HVIA 1NKBA 3CJKA 3TAQA 1ZTWA 2LVWA 2DHXA 5E3RA 4CO1A 2Y1LB 2UUCF 3PEHA 3GWCA 1C1BB 4NCGA 4ER8A 3TI0A 1VC5A 4ZVOB 3FEZA 4WFXA 2ZOMA 4I68A 3ITHB 4J9KA 1WHWA 2DCLA 2GHWA 2K06A 2WOMB 2V2VA 4NEYA 2JLFA 5CHCB 3N5BA 1YK9A 5BYQA 5KT4A 2E1PA 1R8HA 4IO1A 2CJ9A 3HI9A 2XM3A 4K7QA 4ETXA 1RT1A 2C3MA 2MTLA 4B3TJ 4RBVA 4K4VA 3CJRA 5A2QY 1V5VA 1FVSA 4YFUA 2HMIB 3BH7B 2JFKA 3PJ9A 4NRUA 5A8RB 1AB8A 4R8UA 2VA3A 1LWXA 5IT9Y 1N0UA 5KAKA 3EDQB 5KFPA 5AJ3J 2ZH6A 2IBKA 3DGVA 1WG5A 3RB3A 1RAOA 3B4MA 2AYEA 4UOCA 5T14A 1WDTA 2H3EB 2V94A 1NUEA 2M88A 3GLJA 2CQ0A 2XTJP 1R7IA 3ILOA 1R6VA 3IWXA 1RWNB 3LPYA 3OFEA 5DZ7A 3DI6A 4DPYA 3IWLA 5EGYA 4ZP8A 3UVJA 2HPUA 4P2SA 4DR4F 3TAPA 1UCNA 1FRHA 1P9QC 4J9VA 4IRDA 3SDEB 1RADB 2CPDA 2L48A 4N8OA 4OZ5A 1FTCA 1NB7A 2HYIB 2JEFA 2EC0A 4GC7A 1FWLA 4G65A 3UD4P 2M8DB 4HT7A 2V4JB 3M8QB 3H4BA 4DCOB 2FVQA 3BSNA 1LQ9A 4FS2A 4N56A 1TP7A 1MU2A 2R8HA 4URQU 5D3GB 4PYAA 2Z4PA 3BN4A 4J9LA 3QO9B 1LWFB 2JNJA 3MUMP 1LWFA 4NX9A 4U6PA 1J27A 1JNRB 3N79A 1HQEA 1UJ6A 3PRVA 5LJ5Y 2DNYA 3SV4A 1EKSA 3Q2SC 2C2EA 2LMIA 5E5NA 2WVEA 1VR6A 4CLPA 2XS5A 1VQ7S 2IMOA 1UEKA 2PDAA 4PEOA 3QIDA 4QU7A 4X65F 1S1VB 2ATLA 2QSFA 4PUOB 3MFIA 3I0RA 1Q78A 5E7OB 4ED2A 3QIPB 1S12A 3VQTA 2FVPA 1Q0NA 3N0VA 4ZLPA 1F9FA 1OWXA 3TA2A 3KWMA 5FDLB 2B6AA 2HIQA 3HT3A 2AJQA 4WU3A 5CCMA 1ZA2B 2W4PA 3AJ2A 3K5MA 1UVJA 4FYVB 2HHWA 2M0GB 4HHJA 3D67A 1IKWB 5HVFA 3BGLA 2N3LA 3MAAA 4ECQA 3FFIB 2R8GA 2MJNA 2GIQA 2O66A 3QMQA 2IVFB 3W8PA 3MR5A 1LEOA 3WX8A 3JS9A 3BO2A 4A8YA 2DITA 2CG4A 4TKTA 5E41A 1CBKA 2KZMA 2W4DA 2XHWA 1LFWA 1S7HA 1SCJB 3HPOA 1BQMA 2QA2A 3KKFA 4L6V3 5LM7E 3K17A 1TFWA 1PIEA 5DLFA 3P49B 3V81A 1AROP 4K2JA 4L74A 1FRIA 5D4NA 1VISA 2E44A 3EDRB 4B3SJ 2DNKA 1RAAB 1R0CB 4ICLA 2DNLA 1D9DA 2BJ7A 1TU0B 3FZ2A 3OBIA 5F8GA 2H48B 1DURA 2CQPA 2LKZA 3GJSB 3MCNA 1UFKA 1HMVB 4YQWA 5H9EJ 3VAKA 5D8HB 2IYGA 4QYZK 3EVMA 2KM8C 4XPEA 1HWJA 1MN7A 2RKIB 1H72C 4U96A 3WIUA 1SV5A 4N47A 3PIOQ 1YSJA 1XQIA 1U02A 4LRCA 1RK8A 5T7LB 3QJJA 1F5AA 3ILIA 4FYYB 5IQ6A 2CPEA 4NLWA 1UFLA 3BS9A 4MKBA 3OVAA 3C3LA 2FYXA 1T0TV 3POTB 3DRSA 1M5HA 3B82A 4U8VA 3T9ZA 4F4ZA 5AE2A 2V50A 2R7RA 1RT2A 4ZVEA 1U0HA 1Y3KA 3HHLC 2HGLA 2V67A 2G9OA 1DQ8A 2LA4A 1JJ4A 4C4WA 2BW2A 4LIWA 3NGRA 3K58A 3Q22A 3GQCA 1GX5A 2UXBF 1LV5A 2CAJA 3M2RB 4KKOA 1F60B 4O3QA 2FQQB 3HD2A 3AH6A 4DV1J 2PT0A 4IG3A 3JSMA 2PA3A 4B08A 2GIFA 1WC6A 3MMCA 2XZWA 1YDLA 4ZIWA 3LP0B 2NZCA 3TUPA 1S6QB 2Z57B 3SSQA 2UUBF 3QT5A 3UCUP 2G1HA 1CJUA 3BF4A 4I2PA 3IM9A 1RP5A 3LTOA 4FKYA 4LBPA 5D4OA 1VBXA 3MD3A 2F9DA 3O1LA 1JXVA 5E33A 1XMQJ 4O4GA 4HTIA 2GMLA 3QWPA 3JSBA 3DM2B 1KC8T 1GT8A 3G6VA 4LF5F 1QDUB 1Q79A 1Y4ZB 2HZAA 3OHAA 1UEVA 2FHJD 2RT3A 3ENWA 1CJVA 1FERA 4J90A 3MZIA 2VQEJ 1H2UX 4DL6A 2RDJA 1S0NA 2APOA 1F9HA 1KHVA 4J9MA 3V4MA 4K4ZA 1RT5B 3AXKA 3GZ7A 2B9YA 3G82A 3L4BC 2ROEA 4NLXA 4TY8B 2BKOA 4GKJJ 3DRPB 5AE3A 3R97A 4C8NA 1I6JA 3QJPA 1VDHA 2LP4A 3QT6A 4LF6F 1HW8A 2RNEA 1X9WA 1H73A 1UZHA 2EBGA 2ZBPA 2ZVSA 5KFIA 3VZHA 1S6PA 4XO0A 3CULA 2OHDA 1YKWA 2MKJA 2E29A 4O4RA 2QA4S 2Z2MA 3GB0A 2ZH1A 1S77D 2BA9A 1JX4A 3QGGA 2Y0BB 2KKHA 1IM6A 1WJ9A 1WKKA 2CQ4A 5KFOA 5HANA 3GG0A 2KXFA 2KI2A 2I1RA 2CQBA 4J7CA 5HATA 2WCXA 4B3SF 3C46A 2VODA 1U24A 1U45A 2R7OA 1YZ7A 1HBOB 2DNQA 5EX0A 4DF4A 1UKUA 2VDHA 2GO8A 2ZITA 4MH8A 4TLQA 1MSWD 2LQ5A 4DR3F 5ETRA 2YNFA 4ZVFA 4A48A 3PG9A 3KG1A 3G6ES 1K0TA 4ELUA 3J81Y 4FDFA 2MHNA 1Q1KA 4DSJA 2HHVA 4HHUA 1TK0A 2HRUA 4F25A 1FDNA 2GGPB 3BQ2A 1G7CB 2QFJA 1HWUA 3UNYA 4C0OC 2X1BA 3RW6A 2LCWA 2WAQD 1KEKA 1CSJA 2NYHA 2VICA 3L7UA 1HBUB 4DUYJ 1BLUA 1I51B 2VG6B 4HDGA 1CLFA 3J81j 4OYZA 1ZM3A 3GILA 4ZPTR 2A6OA 1Y5LB 3HHLB 3BSOA 4OV1A 3H5XA 1GNKA 4KE5A 2H9ZA 3VAMA 5EN1A 3UO0A 1WC0A 2QLWA 1OPZA 5A6PA 2AJ4A 2IAJA 4K5SA 1YJWS 2R8KA 2E5GA 4USUA 5DGAA 3OXFA 1VYAA 1LKZA 3D0IE 3LWLA 2KO1A 2BKNA 3MFHA 1WOOA 2RQMA 1U1KA 2HHQA 1U6BA 2HRTA 4DPOA 2R42A 4LSNB 1RHMB 1PAEX 3FSXA 4CTAB 5B7WA 4Q43A 4OZLA 4S0MA 5DRKA 3N9UC 3OXGA 4RU9A 2VFTA 3MOJB 4LT6A 2AJFE 4RW7B 4ZHRB 4W92B 1BWEA 4NXNJ 4GMKA 4IFVA 2J8AA 1FF2A 3FCVA 3PHEA 2GAGC 2CNLB 3UVJB 3TP2A 1FFGB 2NUHA 2ZBRA 3OTCA 4OZNA 5GMKa 4EBEA 3N28A 2I5JA 2BR0A 1APSA 2ILZA 1VJWA 4YR3A 2IC3A 1RZMA 3UPFA 3FSYA 4LUBA 3QAEA 4OL8A 1XC9A 4F2RA 3OFFA 2KFNA 5I3PA 4BBYA 4J9PA 3ENVA 3KUHA 1G2EA 2DGSA 2NXEA 1U26A 3ENQA 3THPA 2NREA 4K0KF 3IR6B 2WSCC 4RNMA 3T1HJ 3DDNA 2VD3A 3NCPA 3W62A 1U1RA 3BQ1A 2KRRA 1S49A 1YJTA 3TX0A 2AYBA 4JI7F 3CF5Q 4A8WA 1N36F 2DR6A 2R7VA 1XK8A 4FPRA 1HPZB 1SKWA 4U9RA 3GV8B 2QT7A 2NXNA 1ZAXA 3CJ3A 5KFDA 2POKA 1PSDA 4P73A 3MM9B 5ETMA 4K4UA 1X5PA 1WC1A 3BGFA 1RWWB 2JJ4D 2ADBA 4EBCA 1BUXA 1SH2A 2VBXA 3M2UA 3TJ9A 2ZJRQ 4Q0BB 1S10A 1U6ZA 2AZ3A 3OD2A 5KFSA 1FFSB 2FPHX 2HHPA 3A4TA 3MD1A 5C5JA 3KK3B 2ROGA 1NH8A 1S1UA 3EZOA 2KG1A 3LH2S 4OYIA 5H9EK 4ZJQA 4GVLA 3M2VB 1N6QA 2CQ3A 4WXOA 1TKZB 4NPOA 4TYAA 1VJQA 2RKIA 2IJNA 1NHKL 2RJZA 4NEZA 2FDNA 4RWXA 1G6BA 2B7CB 2BANA 2VIHA 2E5IA 1RYRA 2F63A 3U1LA 1CJKA 1U0SA 2QJ3A 3BSCA 3Q86A 3CMAS 2IIHA 3CCLS 4KV8A 4Y28C 2YQ1A 3LQVA 2B5JA 1S9EA 4WFAQ 1OYDA 2EPIA 2P6TA 3D3CJ 4NLPA 5KT7A 2LQJA 2VG7A 2CPIA 2WONB 5BXIA 1WTBA 3HX9A 3UD3P 1HHQA 2N7CA 2BX6A 3KLGA 2ZH9A 4LF8F 4EI2A 3KLIB 3GONA 1C2PA 2VC0A 4C6AA 3MAHA 3D0HE 1DY3A 2R8IA 4DU8A 5DO2A 1SXLA 3Q2TC 2HS4A 2CQHA 3UR0A 1WSRA 2F8EX 2GMJA 4NLTA 1IR2A 4OZ0A 1NDKA 3VF0B 4DQSA 2Q3PA 4DUZF 2DO0A 4CLLA 3KK1A 4I69A 3VR1A 2HBQB 1KVJA 4NLYA 2GV1A 4MTPA 3VGTA 2YKMB 2HK3A 2QO3A 4DL4A 1TTHB 3OXLA 4WFYA 6FD1A 3U7JA 1RSCA 1F2GA 1JLBA 4X66F 2E7XA 4OJHA 4RL1A 4PUOA 1OQ3A 4IDKA 2GO9A 3FK4A 3ZTOA 4K0KJ 4Z37A 4MFBA 4ED0A 3WBZA 1RT6A 9ATCB 2J8SA 2FHKA 1FI4A 4E8UA 1PJ5A 2OPSB 2G0JA 1F1BB 2SXLA 4TXSA 3Q8SB 2LEPA 2GQCA 4AQYF 2AMCB 4OI3A 2B7BB 2LU2A 3IWNC 4NXNF 2E5JA 4KYZA 3DOKB 1RTJB 4DR2J 2HHSA 2AYGA 4CCHA 4TQRA 4PRFA 2GAHC 1IVZA 1CJKB 2X7IA 4DN9A 5M2RA 1CJTB 1LW2A 3FVYA 1V3RA 1HKAA 3DMJB 1RGVA 1L3KA 2OFGX 1Y7PA 2OSRA 3BPSP 1HLWA 2P9CA 5IQQA 1J5OB 1VC0A 2VH7A 5A2QU 3M9MB 1BGXT 1TL3B 2HVDA 3DLKA 3JTOA 2FLLA 4BHQA 4M95A 3LAKA 4FBUA 3M2VA 1N6QB 4DR5J 3MECB 3MM8A 3MEDA 3QJLA 1KSPA 1IKVA 3OR1A 4DU7A 4UZBA 1YIJS 4WXWA 3NBPB 4NL5A 1KDNA 1FDDA 1Q95G 2XMVA 3EVWA 4DQQA 4O44B 3W60A 5H1SV 3P8BB 3KMSA 2HWTA 1WWHA 2DNMA 4WF9Q 2W9CB 3J7YI 4DR3J 3GIIA 2HNYB 3ET6B 1RAJA 1ULRA 2FTRA 1U09A 2J7WA 1ZBTA 5A8RA 3DLHA 2FZGB 2HBYB 2MMYA 2W1BA 4DSFA 3Q24A 1K1SA 1UW9A 2HFSA 1ZH5A 2IPOB 2HLUA 4NE9C 2Y8YA 4FZVA 5F8HA 4K50A 2GIRA 3ILJA 4RW6A 4QZVB 3TQEA 1WC4A 4M5KA 5B0EA 3R1HA 3UDVA 2DPIA 3CC4S 4JI8J 4LFBJ 2E66A 2WZ1A 5HQLA 3R9LA 4ES1A 2HHUA 4ZVSB 5U47A 4YOEA 1REGX 1CS4A 3DRRA 2QEXS 1RTDA 1D8YA 1SKSA 1SH3A 4FYXB 2IDEA 4WBFA 2I5JB 4H4OB 4C8OA 2MQQA 2XO6A 1L5UA 3TVZA 4HKQA 2OTJS 1HQUB 5F8JA 3ZTQA 2XHCA 5L46A 2J6SA 2IHR1 3O2IA 4ZHRA 3NAHA 3R5JB 5CYJA 1JMTA 3SQOP 5B08A 4IO9Q 2AGQA 4DS5A 5GADI 4PPDA 4I1TA 1UA0A 4UQTA 3MM5B 3IBWA 4F4KA 4B9MA 5KFKA 4OHXA 3J7AN 2HVZA 1XMQF 4KHMA 4LBIA 3DU5A 5CH7B 2HLTA 4DDFA 3ICLA 4ES2A 3BB5A 1H38A 4WPAA 4C11A 4OI6A 1TL1B 1KQSR 2E7WA 1JXLA 5CD4A 3D5MA 4YEAA 4ZJLA 3FGVA 1HD0A 3FQLA 4ZVHA 1HI1A 2RDDA 3VVTA 4ZCIA 1YBTA 3I56S 2Y1IA 4F67A 2B9XA 2RRBA 1LWEA 1V3SA 3EJMA 2OD6A 4DX8H 2XCAA 4P75A 1HHSA 2R7TA 2MQ8A 2PI5A 2D69A 4N8NA 1T8EA 3EVOA 3VAIA 4K8RA 1RWOB 4K4WA 3OSNA 4DX7A 3JSYA 3TRGA 1UJ5A 3GJQB 2D74B 1RT4B 2PIIA 2CWXA 2FB0A 2Y1RI 3DLEA 3CIMA 3NNAA 2R7SA 5HJXA 1CQMA 1CQNA 2P9EA 3EE3A 1JJ2R 1T03B 5HMWA 2CWKA 3WDOA 4HACB 3UWTA 3MDFA 3PW4A 2GX8A 3KOAA 3HZGA 3C16B 3HJVA 2LLZA 4OX9F 1JLFA 5K14B 4B3OB 3QSYB 1OY8A 1X0PA 1DAXA 2ZWOA 4L72B 4LF4F 1N56A 5G0RA 3CDUA 4YB6A 1JLAA 1YJVA 2H5EA 1Q82T 2W8KA 4EWTA 2UXDJ 1HBMA 3QLHB 3BGUA 3R6LB 2LXFA 4CNYA 3GFYA 3A8IA 2P6SA 4PYDA 4ANDA 5DGBA 4ZVQB 2BE2A 2NYIA 4EZ9A 1Y9OA 5ITHA 2UUAF 2LA6A 1QAJA 4N77A 5KFRA 1F2HA 2UUAJ 4DBQA 4OI4A 1UVKA 2GA7A 3FEYB 5KFBA 4QW9A 1SJQA 2JEIA 5GAEU 3LAMA 1Z2LA 3IGVA 2PEHA 5CYMA 5DZ6A 2W25A 3HLUA 1YJUA 1H98A 1RAGB 1TL7B 3MEGB 3O6QA 4EO6A 1Q16B 1YWXA 1IWAA 1C0UA 1Y5IB 2CJAA 4RPFA 2D41A 2YNGB 5B0FA 3IBPA 4USVA 2B4PA 3MPVA 4YMEA 4CH1A 3X1LB 4LRAA 2JWNA 3D28A 3GTYX 3HF5A 3MTKA 3KK3A 2ZJQQ 2DHGA 1S5ZA 2YKPA 2ZWPA 5KFAA 4Q8EA 5FLXU 1HA1A 1IR1A 1WOPA 2DGXA 3L7PA 3MM6A 4MFBB 5DJBA 1TV6A 2V2ZA 1XR6A 3VZIA 1GMWD 1PBUA 1R8BA 3NGDA 2OGUA 4DG1A 2YBVA 4DV6J 4R0JA 1DTQA 3MMAA 1Y5NB 4PAAA 3OLBA 2UUBJ 2YPZA 2YKMA 2ZH8A 2K7KA 2VL1A 2XMUA 4X62F 1KD1T 4NCBA 2VFVA 1H74A 2UUTA 2IM0A 2VBZA 3E01A 3C14B 2QL9B 3DLEB 1R43A 1TL4A 1DQ9A 1KLMA 1RT4A 1X4CA 2OUGA 3FMBA 4NWBA 2ZHBA 3V4IB 2MPUA 2YKAA 2C2DA 2HVEA 1D8ZA 2DNZA 1URRA 2BJ8A 1MWZA 4CDIA 4MK8A 2VF3A 1NB2A 4UT4A 2MZ1A 1WF2A 5FD1A 1ACMB 2JC0A 4X62J 3I55S 5THWA 4ED5A 4WKRA 1P9YA 2KDOA 3JQJA 3MCMA 2OEJA 3LP1A 5D15A 3F0NA 2FZCB 1KLMB 2CQCA 3VAHA 1SC6A 5L9XA 4CZCA 4DR6J 1HNIB 4AE5A 4OI2A 4ECRA 4LF7J 4IRKA 3LANA 3G6YA 2GQ2A 2J7UA 4M8LA 1X9SA 4X64F 3KHRA 3EPIA 2ZH5A 2ZH7A 4DN0A 1TKTB 2OFHX 3KJQB 1MW7A 4OHZA 2JX2A 4YB5A 4PQUB 4DLEA 1MROA 2CFXA 4F8RA 1SPBP 2CPYA 3FBEA 4NZ6A 4YS2A 4ZIVA 5HQMA 2JOQA 2Z0GA 3IR7B 3KLVA 2C3UA 2ZEJA 2DCUB 1C0TA 1FDBA 4LFCJ 3PJXA 1EKRA 5C24A 1HNWF 3EPGA 1O0PA 2LQ8A 4RW9B 2YNGA 2D3OR 4NLGA 3HJFA 4M5NA 5A0YA 4C98A 2VQEF 2DGWA 1NCLA 3DRYA 1URNA 4O3SA 2P5VA 3DRRB 2H51B 1NSQA 4C48A 1YJRA 4LRFA 1Q7YT 3TX8A 4W90B 2JVOA 1TZ0A 2YQ3A 4ID5A 1MNEA 2WB4A 3DDKA 4USTA 1YQHA 2VFSA 3GJTB 1LW0A 4DMZA 2DNRA 4LF6J 3CD5A 3NGSA 4RW6B 1NDPA 3K8VA 4OYMA 2WB1D 3LGMA 2XS2A 2QLJB 5F8NA 2MZSA 4UZCA 1HWIA 2IDLA 3TEHB 4WU2A 5L8RC 2XMTA 5H9FJ 4CWBA 1DARA 2OMOA 3A8EA 2K7JA 2RMLA 3EYZA 1U25A 1Y10A 4JI0J 4KH0B 5K14A 3NGTA 4PXEA 5GADU 4DV4F 3AHPA 4MJKA 3RYLA 3TNVA 4OX9J 2UV8A 4FF1A 1Y11A 4OX6A 3ENAA 3PFEA 3MPDA 5KFFA 3PW2A 2HQ3A 4LR9A 5C42A 1IUJA 2CJYB 3BKFA 1OY9A 3PX4A 2HNDB 3QIPA 3L9ZA 3G9CA 2PMHA 2XO7A 3GSIA 5MLCV 3PXGa 1UTAA 3M7VA 4QR2A 4AXJA 2B9EA 2RQKA 1K44A 3AOBA 3LALA 3PFOA 4HDHA 2AYMA 4DPWA 5ETVA 5KG1A 1OS5A 1DFDA 3TOQA 1GK8A 2KJVA 2ZBQA 1HQEB 3W2WA 4CLTA 3CSKA 2D7SA 1Q81T 1QLNA 3DOLA 5KFVA 2CZ4A 2UVWA 4X66J 5B0DA 4NA1A 4KHRA 1WTFA 3SCLE 3SYZA 4YP3A 2GQQA 3NWGA 5D0GA 2IA0A 4JB8B 1IKYB 2E1RA 4ZPDA 3UE2A 2B4OA 1HQ2A 5KFMA 4A8KA 2NSCA 2BM0A 1G4CA 2O5DA 1GAOA 2NSBA 3HHLA 3W66A 4DL7A 2FLPA 3J7YU 1HI0P 2N4DA 2XBPA 3P96A 2HHHF 1N5QA 2BUNA 3DOMA 3J7A1 1JLBB 1G3OA 2KYXA 4JV2A 4ZN3A 1S9FA 2DH8A 2ZFHA 1T94A 3EMTA 4CH7A 4CO5A 4Y2KA 3FUYA 5GAHU 4RWWA 2CQGA 1MMNA 2BZ2A 3W65A 4KT0C 2HRYA 2BOPA 1BWVA 4ALZA 4TU9A 3MR2A 1FO1A 1TUVA 5B0AA 1CJUB 1N8RT 1VQLS 3OL9A 3MCOA 1ZOTA 4G6VB 5CYQB 4NYPA 3VCDA 4KHPF 2DR7A 5KFUA 2GJIA 5GVQA 1YG0A 5KG5A 3NY0A 1SJ1A 1VK8A 2HQDA 2XYGB 1VRTB 4NLDA 5J2NA 1C4AA 2QRRA 3ZZUA 4N76A 2K3IA 3C66A 2F4VJ 3MM7B 3N5FA 1N34J 4ZVGA 2HBZB 4P10A 4DFMA 2ZD1B 4KKOB 4Y2AA 3ZZOA 1NK7A 1EP4A 3G2XA 2FLOA 4R25A 1P6TA 2G0CA 2DNGA 1KKHA 2EXUA 5CQGA 3R7BB 1YTYA 4KV8B 4JV5J 1BD6A 4LVOP 4ZCMA 4NMXA 3R3TA 5SZTA 1V5IB 4KRWA 5CCLA 1S72S 1FK9B 3KUEA 2W7OA 1D0EA 3K5NA 3OTOJ 1FNOA 2E7VA 4H4MB 2Z2YB 3HCXA 4I7FB 4NCGB 2Q6BA 4J91A 2M4MA 4X4TA 1D1UA 4RUAA 2MY8A 1N5YA 3D9BA 2QA4G 2JEGA 5C24B 1IKVB 4NMLA 2DHSA 1C0TB 4ZCLA 1WG1A 3WIVA 2JL9A 2KT2A 4FNIA 4YY3F 3FSIA 1NO8A 3QNWB 1NK4A 2VV5A 5AE1A 2MGZB 3K59A 1K9MT 4LF9J 1SKRA 3BYRA 1TMMA 2H54B 1N0VC 4LIRA 1N36J 1ZZFA 2J6UA 3M2UB 3QYYA 2YKOA 3DMJA 2VBWA 1JKHA 3H5SA 1T11A 3DM2A 1YBAA 1NK6A 3OR2B 4LRDA 1VBZA 3GPAA 1RTJA 3MHYA 4P2MA 4USIA 3RRGA 3KJVB 3RB4A 4F02A 2D3ZA 2J76E 2D3UA 4F3QA 1K1QA 2YNIB 2OTLS 2QSWA 3CCMS 4LRBA 3PZPA 3J80U 2EFVA 1UW4A 2WSFC 3GSDA 1LK7A 1IKWA 1U7LA 2DHHA 2F1FA 2OPPA 4KGVB 2B0GA 5E3CA 2UUWA 4DI6A 5IWAF 1K73T 3K0JA 1FE4A 3JTPA 5F3TA 2W9AA 4OFZA 3TAMA 1FDAA 5KG4A 1NZ8A 3MR6A 5IS2A 4ZDNA 3W9IA 3CUNA 1QSSA 2RRAA 2D9OA 3VGVA 4Z7YA 3QT8A 4MK7A 2K1RB 1HNXJ 4ZP9A 1KOOA 3QQCD 3BKTA 1RA6A 3KJVA 2U2FA 3KG0A 4JUZA 1CULB 1HNXF 4CO2A 2Y9HA 4HHHA 3IN5A 1FA0A 3RR8A 4CH0S 5M2PA 2W2QP 3OR2A 1PGZA 1DTQB 2B43A 2RIJA 2BEFA 3TANA 3IFEA 1TR0A 2DNPA 1SB6A 2QLBB 3I31A 4LR7A 2ZKTA 1NPPA 4C8LA 1ZA1B 1P1TA 1HW9A 1F0XA 1N88A 1YRUA 2MJUA 4ED4A 5HN0A 2BRKA 2BJ3A 3E8OA 3POTA 3DCAA 2C2RA 5A8WA 4C7QA 2BXJA 2ZUGA 3M1VA 1FJ7A 3OFHA 3U02A 3VWSA 1B3TA 2VG7B 4DFKA 2WONA 3BSAA 4I6WA 4QWCA 2ZM6J 5D3GA 4CLZA 1KTQA 4BS2A 1FT8A 1U8SA 1X4BA 2B5JB 2HHXA 2UV8G 1KFSA 1D09B 4KR0B 2DD8S 1TL7A 3C15A 3CVKA 5LL6d 2NR0A 3WQPA 2XY6A 2ROPA 2BE9B 2JLEA 5LOQA 3CCSS 4ATNA 4UW2A 3PV8A 3P6YC 4BWMA 3MMBA 3EZ5A 4RUBA 2ZH4A 3SXLA 5L39A 4XDCA 4X4SA 2GNKA 1RE1B 1TMJA 2BE2B 2CXEA 2Z8QA 4UUWA 4J9UE 3BGOP 2ABYA 1ITPA 3GG1A 5A6WA 3UN2A 3HVAA 4HL9A 4ZOSA 4DV7J 2A1BA 5IC4B 2YWKA 3M6XA 1VQPS 1S6UA 3AB4B 4LF2A 5CZXA 8AT1B 1GXTA 4DL0C 1GMWA 1VCTA 4R8UB 5G0RB 2LEBA 1G1XA 1VRTA 4BWJA 2ZUAA 3PR4A 1DZ5A 1FHTA 3ZZRA 4HACA 2CA9A 1H2VZ 2ZM6F 4AL5A 2HGNA 1N32F 3IO1A 1X60A 5DLGA 5EWEA 1N4LA 4JV5F 3T1HF 2OKQA 2ATCB 1EZZB 4ZJOA 3A3NB 4OJ3A 5LJ3Y 3CB4A 1BE4A 2KFYA 1NJIT 4KO0A 2R7UA 3ZZZA 4A8OA 5KFTA 1D9FA 5CA5A 4DX5A 3L3CA 3PW5A 4K4SA 1OQ6A 3SV3A 1VOMA 2AJ0A 1ZM4A 1M90T 4ZCKA 2PC6A 5EDWA 3NEKA 1EQ0A 4OYWA 2FJWA 1CPZA 1IKXB 1MG7A 2A2DA 1NJXA 1AUSL 2V69A 2DO4A 2OMLA 3B54A 3LF0A 3W63A 5LXRA 1S1WB 3R2DJ 1GEHA 1U47A 1RTZA 2FJVA 3RG6A 4DV2J 2AEJA 2W2MP 4USKA 1Z1ZA 3MR3A 2DJWA 3LO3A 1KS2A 5JXSA 5IWAJ 1JNZB 5LMNJ 1T3NA 2AP6A 4YR2A 3M6VA 3RZAA 2Y3YA 4KTQA 1VGYA 2DIVA 4I56A 2YWWA 1BMQB 3RR7A 3KHHA 3PM9A 3OTBA 4H54A 1X5TA 3ZTPA 4DQIA 1NBEB 4WKYA 1FXLA 3ZO7A 3ETMA 3I6PA 5KG2A 2YH0A 4ZPAA 5E3PA 2NZ4A 1KRPA 1QAYA 1A7GE 4HI1A 5KG0A 3W2VA 1VQKS 1TFYA 4RNNA 3BGRB 2D9PA 4UOGA 4IR9A 2VONA 2EG1A 2HSEB 4WK1A 1N5TA 2OPQB 5HQ8A 2HQFA 3RAMA 3VGSA 1U1MA 4ZMMA 2DGUA 3PY8A 1FKPB 2B4VA 2JSXA 1FD8A 2JFDA 1T02A 4Y65A 4EUVA 4DS4A 3U1MA 1UVMA 2BQRA 1FCAA 5DQIA 3MMCB 4R0EA 3ZTSA 3TZZA 1HD1A 3GU0A 2G1DA 3D66A 3JSRA 3NGKA 1DBDA 2DTJA 3G8QA 4KO0B 4XAKA 1NK0A 3AA8A 2IJRA 2RU3A 3UDLA 2QIFA 5F8LA 1LW0B 2ZD1A 5F9LA 1YVFA 3PVXA 2AT1B 2MEWA 1LWCA 3AODA 2RS2A 3QGPA 4YR0A 4ID5B 2NS1B 1FVQA 3BDEA 4NYOA 3V2UC 2MKHA 3NNCA 4Q7AA 5J2NB 2XMMA 1QUVA 1TKXB 2HFZA 2GHPA 2X51A 3Q8UA 4USMA 2BJ1A 1NMEB 4JYAJ 2MZRA 4RW9A 3T6BA 1U1PA 2L41A 4J9QA 3B8HA 2HG4A 1TL3A 2ZBCA 4L3NA 3W2VB 4EGLA 5LT5A 5DDOC 2AJ2A 3CPWR 4OLOA 4F3MA 4B9UA 3LA0A 4X4NA 3BREA 4TU7A 1SL1A 1P27B 3GYGA 1BY9A 4DV5F 2CPZA 2CQIA 1NXIA 3KUGA 3HVTA 2YX4A 5H9FK 1QY7A 2VKZG 3K89A 2CDQA 3CCTA 1SUQA 2RU9A 3L7OA 1FJGF 1X9MA 2VUGA 4GKJF 1BQMB 4YB7A 5DDPC 1RT5A 3M1VB 3OLAA 3E3XA 1EIYB 8ATCB 3T5HA 3TUZC 3H8YA 1SH0A 1V9OA 1B7FA 1N33J 1KVIA 1GX6A 2MLYA 1CJVB 4FVMA 4UOFA 1IBKF 4KPCA 1RA7A 2ZE2A 2BE7D 1F3FA 1OIAA 1XMOF 1YGYA 2XS7A 1I94J 4M5IA 2DR5A 1PAUB 2YWEA 2CJBA 2J9EA 4AD6A 2IJFA 4HTJA 5FDLA 3I5BA 5BYSA 1QVGR 1UPPA 4MK9A 3MAQA 1O8BA 2UVRA 1N33F 2YX7A 1RAEB 3CD0A 4LSLA 3F73A 3Q0AA 1XR7A 2OELA 2IYIA 2VPYB 3HFVA 2MQLA 2YVSA 4CO3A 4DFJA 1I3OB 3D0GE 3QFHA 4DEZA 3CMQA 1Q8LA 1C4CA 1EETA 1FRLA 2LYVA 1S48A 1S1TA 4FXWA 1F9EB 1Q8IA 4I0WA 4Q8FA 5KT3A 4DV1F 1M5KC 1R8AA 4J5OA 2MHEA 1VQNS 2V34A 4KGZB 4KQZA 1WELA 4EO8A 1RU1A 4K2XA 1X4EA 1Y0HA 4O3NA 3U27A 3QGIA 4MMOA 1X5OA 4J9NA 4I64A 3R1LA 3P4UB 4DR1F 4QIGA 1OY6A 2LDIA 1JLQA 3LOUA 3BEGB 2E5LJ 2VBYA 1SI9A 2W4CA 3H42A 4ZVPB 3BJYA 4NXMJ 2FHOB 4NA2A 3N4WA 4W4MA 5AT1B 1KQFB 4B17A 3F44A 3C15B 1T9YA 2GHVC 1AZSA 2B8PA 5T7LA 5AXNA 3T1AA 2NPFA 5JVHQ 3IRWP 2F8MA 1WG4A 1TKZA 4OYAA 4OZJA 1T9XA 2HAIA 1NLKL 3US5A 4A47A 2MKKA 3H4DA 2UXDF 2QTWA 3BBBA 2DRBA 3S8SA 3G6XA 1GH8A 2KYZA 1FXRA 1FRXA 4A8XA 2CPJA 2LEAA 1TKXA 2ZC3A 3HKZD 1ZM9A 3CTRA 4F0KA 1VBKA 4ED3A 1NPKA 3C6TB 3C16A 2HMIA 4ZPBA 4OHWA 3OSPA 3UFCX 2KN4A 4G1PA 1M1GA 3KFWX 4P7VA 4U95A 2R7WA 1VIXA 1RT1B 4FBTA 3BPDA 1KHWA 2HFUA 1S9GB 3HKWA 2K1RA 2BW7A 1DTTB 4KIAA 1UPMB 5DG8A 1T03A 3G87A 2C2OB 1Y3JA 3M8SA 2GVDB 2FD2A 1XNRF 1IJEB 1S4EA 3R5BA 5HVHA 4F4WA 2KVQE 3PRDA 4QIEA 4QIWD 4RUCA 4LF4J 4JV0A 2JC1A 2ZJPQ 2G4BA 1FKPA 1X4DA 1LWEB 3P5BP 1CG2A 2MKSA 2QYGA 4KGXB 6AT1B 3V4IA 2QGFB 3H2UB 1HNZJ 4DV7F 3GFXA 1HNZF 3KLEB 1VC6A 4ILRA 5KFYA 5CZVA 3M32A 2C28A 1FFWB 3UQSA 2UU9F 4KAIA 3HXMA 1IQZA 3D1QA 4Y3CA 2QA1A 3MPYA 4B3RJ 5K8NA 3CWJA 3PYEA 4KH1B 3HD1A 2F7VA 4NYZA 2CPXA 3MM6B 2DBBA 5HLFA 2XLKA 2BMBA 1PG5B 2AW0A 2BV3A 2ZDPA 1H6KX 1MN9A 1OSCA 4M5LA 1DHMA 5J1NA 3I32A 3GIRA 3IMQJ 1BXNA 4YN3B 1E6YA 1R8PA 3FNNA 1QSLA 1FJGJ 2EEYA 1X0FA 3KMQA 1SC1B 3RBDA 4AT1B 4P6QA 2ZOFA 4CI0B 4TN2A 1IKXA 2ZOGA 3OT9A 4H4MA 4I7FA 4MIWA 2XSFA 3MEGA 4DOZA 1JXEA 5I3UB 3CJ2A 1VQMS 2J0QD 2VG6A 3NL0A 1HBUA 2ZC4A 3K5PA 5DG7A 4ECWA 4WYLA 2XMWA 4Y2IA 1U1OA 4E98A 1I1GA 2W7AA 4F3OA 1FRMA 3RGIA 1PCAA 4DHVA 5ETOA 2RAQA 5L1KA 3FRYA 1M5SA 4XK8C 2J5AA 3TJAA 5C42B 2CQ2A 2FJDB 2J9DE 4DJBA 2VC1A 1EP4B 5AXKA 9RUBA 2J9CA 4CT8A 3OW2R 2DY1A 1JLAB 3KTQA 2WSEC 3NRBA 1SBRA 4DCPB 2D1CA 1ZPVA 3JAMY 3R5CA 2L9WA 2FVCA 3BO3A 4KB7A 3EUNA 3PYFA 2GJ2A 1WNEA 3PO4A 2XY7A 1IN0A 2XI3A 2ZNYA 3LGHA 3OTDA 5BYRA 1W2IA 3MPWA 3AFGA 3NNHA 3T6JA 2MQOA 5C2CA 3UW1A 1WUUA 5CYQA 1RTHA 2HURA 4C97A 1CVJA 4ED6A 4YUDA 3R7NB 2E1MC 5F41A 3PKMA 1IBMF 2MKIA 4PR6A 1PC5A 3E2EA 4IOAQ 1FESA 2VFUA 4PWWA 3K7RA 2X1AA 4OIXA 2C2KB 3W1YC 4QWEA 3P45B 4DQPA 3MR7A 1PBAA 2O01C 4M63A 4A8SA 1UWBB 1CJTA 3LP2B 3PJWA 1E6VB 5T41A 4UQGA 2OPRA 4ECVA 2VB6A 1FX2A 3DOKA 3PIPQ 4EEYA 4EZ6A 3M05A 4MAKA 3PO5A 2OLWA 1M5PC 2Q66A 3ZTRA 2EFPA 4QWAA 2C42A 2G2OA 2UZAA 4GRSA 1AT1B 2MKCA 2OPSA 2MQNA 2C2MB 2GVZB 2LXUA 2VASA 4NOHA 4LFAJ 2FVRA 3D54A 3K8WA 3NMRA 3W2WB 1R27B 3HHDA 5C25A 3CJ0A 1WKLA 4KPYA 3SFGA 2AKWB 2AWZA 3THVA 3ZZTA 3V5RA 4OHYA 3V6DB 3RBEA 4O3OA 3TZWA 3IG1A 4FF3A 3DLGA 4KC5A 3AA9A 3H98A 3VALA 5IZHA 1JJCB 1HNIA 3TZYA 3PYGA 4Q5VA 1KONA 3J7ZT 5BR8J 3BO4A 3Q8YA 3Q8VA 1NKCA 3MURP 3UDCA 3R5DA 3T1YF 5ETNA 1M5OC 4PWDB 1CC7A 5A76A 3W5XA 1RTDB 4R5PB 5IXUA 1YITS 3LP0A 2KVIA 2NXCA 1WSVA 5EX3A 3G96A 2WRMA 5HROA 4DUZJ 4IH5A 1ZTTA 2CVEA 4A46A 2KM8B 3H0PA 1I5OB 5KT2A 3W3SA 2DR9A 1DTTA 4AXIA 3KLHA 3CCES 1MWYA 2LFVA 1VIOA 2AEMA 3BR8A 3FBFA 2MXYA 4ILLA 1RAIB 1TELA 4UY85 1HBNB 1TAQA 1F3VA 1RT3A 3CDBA 4JI5J 2N82B 2JRSA 2V4RA 4PG5A 4P7TA 1RWKB 1RUSA 4DWIA 4UF4A 4QCLA 2J9DA 1T05A 1JKHB 4RUHA 1Q8BA 1YRXA 3CJQA 3CCRS 1R0AB 3AAWB 4JI2F 1KFDA 4O23A 2NQPA 2CZ9A 5B0BA 3FCHA 3Q8RB 4C3LA 3IC1A 3WX4A 5HP1A 2B3TB 5HMZA 4CIOA 3MEDB 1OYEA 2QMWA 4HI2A 1H7XA 1NJYA 4DSEA 1A0OB 4U67Q 4B3MJ 1T9TA 4G3IA 5GAGU 5E2QA 1BQNA 4N7TA 1X4HA 5KT5A 4CYUB 3TARA 5F3ZA 1UA1A 4ELTA 2QMUB 3IA0A 2ASJA 4QIFA 1SL0A 4AQYJ 2ZZTA 1Q86T 1MROB 1FJCA 4ECTA 2Q43A 1A6LA 2B8QA 2V8GA 4ICLB 4DR5F 3HVWA 3J81U 2F4VF 2WBMA 4TY9A 4QYZJ 3OHBA 4O3PA 2DEIA 1NEEA 4ILMA 3RAQA 1Q5YA 3H25A 1RLCL 4N5SA 1DLOA 1HNVB 4Y6IA 4USHA 4IG0B 4EYHB 4LQ3A 2PGCA 4CLKA 5ETKA 3PCOB 4NA3A 3OL7A 1GTEA 2RRNA 1UAWA 2PEBA 2XNQA 4USJC 3Q89A 2Q79A 2XB2D 1WHXA 3ZNUA 2QFIA 3CO9A 1ELOA 3C19A 5DDQC 2H5JB 3MAAB 4M5HA 3CDWA 2AEFA 1T9WA 2F9JA 4FNHA 3VV2B 3W8GA 1F6TA 1GXLA 4BLGA 1T7PA 2A10A 2W24A 2EVZA 4DFPA 3SQGB 3TR5A 3AD7C 4OI0A 4P71A 5BR8F 3FMWA 4HVZA 2WHOA 5HBMB 4JI5F 1H7WA 1RWVB 3DLGB 4X4QA 3I0RB 2IM1A 4J9RA 4B9NA 2IFXA 2EC2A 2QV6A 2XMAA 1S0VA 2CDRB 4B3RF 2BQUA 3V6KA 4AUKA 3OVSA 1RHJB 3BDPA 1VQ8S 4DV0F 4LF8J 1VRQC 5I3UA 2LQBA 1IR0A 3D6MB 4MIAA 1FEHA 1SQEA 4DXLA 1VK3A 3KLIA 2VZ9A 2VJUA 2QG9B 1IQTA 5KFQA 2RUSA 5GMDA 5HMXA 3JYTB 4F36A 1MU2B 3JTNA 4QR0A 3T9NA 3R5GA 1VMBA 2AD9A 1JIHA 4UUXA 5CD4H 1SQFA 1UWAA 3BBFA 5FLXY 3MWBA 1C0UB 3LP2A 4OJ1A 3GIMA 1LXJA 1WACA 2IRXA 3VQSA 2XGPA 4MYTA 3H2VE 3CMES 1QE1A 1ZM2A 2FIUA 1AYEA 1R8CA 3ZZYA 1AFJA 2I8EA 3SDEA 3G8SA 4JV1A 1X31C 3CC2S 2P2CB 5KTQA 4ENOA 3M32B 6FDRA 2IMWP 1KR4A 3AXMA 1WKJA 1HARA 1HQUA 2GGPA 2QZ8A 1S1UB 1RTHB 3SEOA 1WF1A 4C0HA 1M0SA 4EYIB 5J1PA 1WI8A 4I2QA 1HBMB 1FX4A 3MI7X 4CO0A 2C1EB 2W2OP 4YHHJ 2KG0A 1RYSA 3IXQA 1L3TA 1SKUB 1SC3B 2AZ1A 1VQOS 2HQCA 5J2PA 1WF0A 2DISA 3GFZA 1NPRA 1QUPA 2ZNZA 3MM9A 2BM1A 2H5IB 3N6LA 3CGIA 5DDRC 5J2QA 3C2PA 5EHHA 3D4JA 1HPZA 1TKDA 4NI2B 4X4PA 5D0RA 1GXUA 1DLOB 1HNVA 3I5AA 2JDJA 4OJGA 2XSJA 3HVRA 1T9UA 4NZ7A 1IBMJ 3H5UA 1QD1A 3IBFB 3JAMU 5JVGQ 1VI7A 4V1Ak 4URGA 4F4YA 2CQ1A 2WVDA 2NXJA 4M94A 3JQKA 5K8MA 1QSYA 1L3SA 1NSKL 2HIYA 2V8HA 3HT0A 5HSPA 1HWLA 1HFEL 2IA6A 1H0HB 2FY8A 4WCEQ 4CYUA 4B9LA 3CCJS 4P52A 3BN7A 1X4AA 4WFNQ 4KHPJ 3TYTA 3AY0A 3BGRA 2PD1A 3GYNA 4JI6J 3DNCA 2L08A 4TY8A 2C22A 3CJKB 3HHKA 1X4FA 1CC8A 1XERA 5KOWA 3OV7A 1RKJA 5L1JA 1W26A 1J5OA 3GYXB 4ZPVR 2B51A 1JJHA 5DQHA 5HLFB 3NMAA 2XEXA 3B6BA 4DV3F 2RHQB 4IFYB 3R6GB 3A8JA 3W61A 1N5VA 3MM5A 3NP5A 4G1IA 5B0CA 2OI2A 1ZZNA 1ZETA 2EFGA 2EKYA 5DG9A 2FJXA 2MB0B 3A13A 1SIZA 2F8HA 4NLRA 1HBNA 2EWHA 1UP1A 4FXVA 5K20B 4L3KA 3QZ7A 4KJIA 3ZZ0A 2EFNA 4K4TA 4I2PB 1IM4A 1ZAWA 1BQXA 2VU5A 2EFOA 3UR3C 1EETB 2LXIA 2Z58B 4H4OA 4QR1A 4ZPCA 4RZRA 2XLIA 4EBDA 2C3PA 2UU9J 1GQEA 2CVIA 5HROB 3Q8QB 3QBCA 4WIIA 2OD4A 4B9VA 1U1NA 2IRYA 4DPTA 4DL3A 4OYBA 1XNRJ 5G4DA 1PJ6A 5AXMA 4GC6A 3PTWA 3QRPA 4LF1A 5I42A 3J7Z5 3SIPB 4DL5A 3FC9A 3FZBA 3E01B 4RU2A 1FKAF 3I87A 1U4BA 2KZZA 4XDDA 5D6GA 1WEYA 3M9NB 3T5LA 5KFNA 3CD7A 3IG1B 4MN4C 5I4MA 3CJTA 3MMAB 3HHEA 5ETTA 3FRZA 1SVDA 4DUYF 4L76A 2W2NP 2BJEA 3AOCA 2DNNA 2YNFB 1R31A 2R3VA 3D6FB 3O3LA 1K47A 4JI0F 2UXBJ 1TV6B 2FHMA 4F26A 1KQGB 1RBOB 2RUGA 4WJBA 3PHTA 1HBOA 2YWFA 4E2FB 4DR4J 1LXNA 2JLGA 4F4XA 1QAIA 3G8TA 1RTIB 2BDPA 4G1QA 1YI2S 1Z2ZA 4UY8T 1RISA 1EX8A 5D78A 3WZ0A 3DLBA 2ZDOA 1SC4B 4N41A 3H20A 1WC3A 1FD2A 4LR8A 1RHRB 1S1XA 4JI3J 3BYPA 3H90A 1S6PB 3ZXWA 1ICEB 1JQGA 2EBEA 4WE1A 2Q6CA 2F4FA 2J6TA 1LW2B 4TLRA 3OUYB 4ZPWR 1Q53A 2IM3A 2R2TA 3QRRA 3NLCA 3MGJA 5D77A 3V81B 3M8WA 2DK2A 2R8JA 3CNQP 4C8MA 1KTVA 1T3OA 1WI6A 3H7HB 2G2YA 2I0XA 2DXDA 4CLFA 1B99A 5AXLA 3QLHA 2EW9A 2DGQA 3RBXA 1SJ3P 2OAUA 4F50A 4Q0BA 4IKAA 2KU7A 4LSZB 3RTVA 2PMZD 4RNFA 4WZQA 2L3MA 2XI2A 2ZHOA 1NRKA 4IDKB 3ITHA 4M5JA 2AV5A 4ZP7A 2U1AA 1RHUB 2RF2B 4C8YA 1Y00A 1U2FA 3DU6A 2DXFA 3CDAA 3QATA 4P2XA 4RW8A 2JZ5A 5D0EA 3EGWB 2V5HG 1QAXA 4ECYA 3GIJA 5B0GA 3KK1B 3HFKA 5KFEA 3R8YA 3H5YA 1PJ7A 4ANEA 4BDPA 3UNGC 2DH9A 3RUBL 3GV7B 1VQYA 2QYCA 1KBRA 1S1VA 4ELVA 2V2KA 7AT1B 2R2SA 2V2QA 3TVYA 2KL8A 1OSDA 4QWDA 3SMZA 3TVKA 2BQ3A 4HR2A 1IWGA 3SCJE 2V8DA 4CP5A 4F0HA 4PG6A 1NDLA 2YX1A 2BVZA 2YQ0A 3HO1A 3EGNA 1OO0B 1IBKJ 2MY7A 5RUBA 2JEJA 4H4KA 3WC0A 2MLZA 3KLFA 1UJ4A 5FIIA 4Q44A 2UXCJ 3UDEA 4LSNA 3O44A 3DKDA 4BC7A 2IVYA 1L3UA 1Q5VA 3AD8C 4DV5J 2HFVA 3J80Y 2VG5A 5KFLA 3ZC4A 4FPIA 5EWFA 3I4PA 2QC3A 3SSRA 1SIWB 1PC4A 3L09A 2EI5A 4LQ9A 4MKAA 4RW4A 4C2MA 3CCZA 2MGZA 4DR7J 3DHWC 2HGMA 2KJWA 3HSDA 3I5CA 1KLNA 1S1WA 3F56A 1D3WA 4USWA 5GMEA 4X4VA 1U8WA 2MLXA 1S0MA 2XLJA 5EWGA 3SCIE 1NKEA 1H2TZ 3QZ8A 1PYSB 2Z30B 4Y2CA 3VVUA 4U7UD 1FK9A 2RDIA 2A3JA 4MYUA 3RB6A 2KXHA 1W2BR 3FBCA 2MQPA 3M30B 5I3QA 4AL6A 5D4PA 1UFWA 2J0WA 1RI7A 1NK8A 3P3DA 4W98A 3MUVP 4ERDA 4O0IA 3ZZPA 1U48A 2B9WA 2KTQA 3RRKA 4ANCA 4WTOB 2DNHA 2VJVA 3ZNJ1 1R0BG 3MEEA 1WHVA 3KYLA 3M8RA 4KGKA 2AHOB 2FUG9 2G0IA 2HW3A 2XG8A 4WP9A 4FYWB 5J2MB 4FKXA 1TL5A 2HK2A 1F5BA 1KOHA 4WK3A 5DS7A 3QSIA 4LFBF 3R2CJ 3ISND 5K8OA 3ISNC 1QTMA 3A8KA 4OYOA 2CJXB 1MMDA 4DZDA 2W9CA 4OZ3A 3EZUA 4QBUA 3PACA 2DXEA 1NH7A 1FWPA 2F5GA 4FVCA 1YHQS 2B6AB 2K3KA 3HM9A 3UD5A 2MZQA 2ERRA 2MKYA 2PSZA 1B0TA 4ZA1A 1NZAA 1V6HA 3A3OB 4ES3A 2R7QA 3B4DA 3OUYA 2PA8D 3DLKB 2HEKA 3MMBB 3TQ1A 2V68A 3OJUA 2IRUA 1NU4A 3M8ZA 2OEKA 2W7PA 1S1XB 3TEGA 2RQ4A 2M5YA 3GR1A 3W64A 2CKWA 2AJ1A 4NLSA 1GMVA 3MMJA 3ZFVA 5M2UA 4TU8A 4JI4F 1FTRA 4KFBB 2HZVA 3DRPA 4NZ0A 5L1IA 1VQ5S 1MMLA 3HSJA 3DDIA 2YWGA 3Q83A 3NOGA 2UUCJ 1HIYA 3PYDA 1EB0A 1PYOB 4EK2A 2HNZA 4A4JA 4ZLLA 2Q1LA 1GMUA 2CUYA 2CYYA 2VFRA 3PNIA 4RLEA 3WC2A 3D2WA 4ZVUB 2AQ4A 3DXBA 1O51A 2HFOA 5K5MA 3D1OA 1VLOA 5IFMA 2FGOA 5D4LA 4DCJB 2RH3A 1HL6A 3FBBA 2R9LA 1QJHA 3RRHA 3SSSA 1QM9A 1UZDA 4LSLB 4O4GB 3NXZA 1B70B 1P8GA 2EK1A 4AFFA 1Z4UA 1WOSA 3IR5B 5HBMA 3M6UA 3CD6S 5F8MA 2RE1A 5ETQA 1REVA 5L9NA 1FJEB 2VOPA 4OMFG 5KG6A 4DL2A 2HKEA 1JLCB 3N01A 4MIBA 3QGHA 1RWPB 2QMXA 2M7SA 1VLYA 5HO4A 2ZE2B 3N6MA 3B78A 2COLA 3W9HA 2XULA 5BJRA 5CABA 5HVGA 5B09A 3DLLQ 5KG7A 2B4UA 1TK8A 2YKQA 2V63A 4OI1A 4D3HA 4ECSA 3CO0P 1RU2A 2G13A 3GCWP 4PG4A 3T41A 4EU0A 2AGPA 4IQXA 4IRCA 3T1YJ 4GO7X 1TUGB 4Q45A 3TJ8A 1N48A 4RBUA 3H2LA 3W5YA 1HR0F 2VPXB 2Y8WA 1TVRB 2HQGA 4WFZA 3PRBA 1ZYQA 3RU0A 3R27A 4DUTA 4WE1B 1U0HB 3GIKA 1NHVA 1S57A 3AT1B 4IQMA 1S0OA 2AX0A 2BANB 3I9ZA 1LNQA 4B3TF 3DRSB 2DY9A 3HZEA 4IH6A 4OZ1A 3Q8PB 3I0SB 3IS9A 4PWUA 3GV5B 1IXKA 4CLUA 1OMSA 3OL8A 4X84A 5E0OA 1WC5A 4A8MP 1UVNA 2K2PA 1SJRA 2W9BA 3IRXA 1RTIA 2YNHA 3IRXB 3MOZA 4G1QB 1QTNB 4C8KA 2X3GA 4WIQA 1AW0A 8RUCA 4QIVA 3M9OB 1YZ6A 1KQKA 2OIHA 2FC9A 5A8WB 2V4QA 3DRXA 3I0SA 2ACYA 3IS9B 3JB9k 2RVJA 1R0AA 2FLNA 4KY3A 2YH1A 2WBRA 2QLFB 4K5RA 3BV8A 2X3DA 5LMUJ 5DM7Q 3KNAA 1RB0A 2IM2A 3DFEA 2RD5C 3NS7B 3DN9A 5J1EB 4FS1A 4HLBA 4DF8A 4HH1A 3RB0A 4FF2A 1LWCB 1N34F 1HR0J 3EGZA 2BACA 2XSJB 1CULA 2MSTA 4NLVA 5IC6B 3R7SB 1WHYA 4DSIA 4LJMA 4QPXA 4B02A 1XWLA 5I42B 1WEXA 2R2UA 2OH2A 1B4SA 1Q4RA 2ZVIA 5KFJA 1XR5A 2N4CA 3FJ2A 3MM7A 2R2RA 3M4XA 3TAMB 3NGUA 3K57A 1AFIA 3OVBA 2JVRA 2G2ZA 4EMDA 1VQ6S 3HMJG 2ASDA 4I2QB 2GS8A 2LQ9A 2CNOB 4DSLA 2IC3B 2C3OA 2MZTA 3BQ0A 3C8YA 2E5LF 2EKNA 1YLXA 1REVB 2BOAA 4ZVTB 1TAUA 3M2RA 4U7CA 2EK6A 3KXDA 2CPHA 1XIQA 4PKDB 1B0VA 3UN3A 4JI4J 4ZKAA 1X7VA 3JQMA 1SJ4P 4X4RA 1XNQF 3DOMB 3MF5A 4IFYA 2MSSA 1CEZA 1RT7B 3V6HA 1WD6A 2C2ZB 2F40A 3S01A 5DM6Q 4PABA 3KG4A 3A3PB 3BM7A 4C3MA 1C1CB 4ECZA 1K8AT 2UVVA 4YY3J 2BJ9A 2CNNB 4ED7A 5LSRA 4K4XA 2GZOA 2RS8A 3DOLB 3I96A 4CLSA 2OPRB 2OP5A 4DV4J 1U2RA 4RR5A 4LF9F 4P2FA 3OTOF 4E0DA 2M52A 3CCUS 4Y34A 3FCWA 1Q8KA 4K59A 1HI8A 4BCAA 1S6OA 1UVLA 4WWSA 4JP8A 2CIMA 3PEJA 1SL2A 4ZP6A 5SUHA 3NS6A 5GAHI 3E51A 1B0PA 2Z2LA 3EWGA 2CJKA 2FVSA 3ISZA 4OX8A 2AF6A 4CLWA 3DI6B 2OEMA 2XGQA 1NDCA 2O1PA 2RHSB 2CNKB 3PW0A 2WTFA 3SQGA 5LSLA 4C9DA 3NCQA 1T95A 1X4GA 3NWRA 2HBRB 3NKYA 1WDDA 4WP3A 1RJJA 4RJVA 3FFIA 4QJVA 1Q7LB 5KOXA 3VAJA 3SI8A 2B56A 5C2GA 4P74A 5IT9U 3RBZA 5J2MA 4RO0A 4JI1F 5HI7A 5DETA 2WW4A 2FJEB 1RWXB 3W9JA 1O6XA 3MEEB 2CJQA 4Z2XA 5HMYA 3CC7S 2CPFA 2DKOB 2V9KA 1FRKA 5IT0A 4A8QA 2PFDA 1VFJA 1NK5A 5A8KB 2DYAA 4DPXA 1AUDA 2NCKL 1JWWA 4DPUA 2HVHA 2L9DA 3KNGA 4OLPA 1QE1B 3ETOA 4Z7CA 1RBAA 1V3ZA 2HWIA 2W01A 3CJ8A 2VPWB 2ASYA 2Z56B 3GCXP 3JXOA 1RABB 2IBOA 3TUIC 5A0YB 2DPJA 1YJNS 2OJ3A 2LU1A 3FKBA 2PFFB 4U7UK 2GJFA 1IKYA 3EX7B 3TZXA 2VQFJ 4UTGA 5E3QA 4ZITA 1TL1A 3G4SS 4LFCF 1C1CA 3G82B 5IV4A 3H59A 3QO9A 4U8YA 5KFWA 2BKPA 4X2BA 3GP9A 1U49A 3ONQA 5KFXA 1ROFA 3A1YG 4CO4A 2WW8A 1P1LA 4YDDB 1XEZA 1LFPA 2VG5B 5HJYA 5F0UA 1U1LA 3CXCR 2WVCA 2DR8A 4PXBA 2V4JA 4L75A 4ED1A 2R7XA 2E1AA 3VHQA 1RWUA 4DR6F 4FXDA 4HT5A 1KP6A 2DEJA 3FDSA 1GTHA 3MEKA 1KWMA 1NAQA 1TUWA 3KLFB 2X1FA 2CRLA 2HNDA 4LFAF 2XNRA 3KLEA 1WEZA 1F5CA 1D9AA 2I6WA 5ADZA 4Y0FA 2ADCA 3QT7A 1TK5A 4J9SA 2UVUA 3D3BJ 1FE0A 3MPUB 3BH6B 1XBWA 1YX2A 1CS4B 5IT4A 4KSEB 1U6FA 4R5PA 2FY1A 1X8DA 1T9VA 2DGOA 3IP0A 4X4UA 4PWDA 4O3RA 4IG3B 3C14A 4YDXA 3JSMB 1S9GA 4WP8A 4ECUA 3K2YA 4IG0A 2GW8A 2YNIA 2CQDA 2JH3A 3PX6A 2M8HA 2LDYA 1YRTA 3L95X 1VBYA 2MZJA 4JBCA 1UVIA 2Z2ZA 2ACMA 3PDNA 3UCGA 4DV6F 4NXMF 3KHLA 2IY5B 3X3UA 2QN6B 2RF2A 3ADAC 2PMWA 3C6TA 1XMOJ 2FHJA 2JHEA 3QAUA 3PW7A 3CW2C 2F65A 1AXQA 2HNYA 2OO4A 4JI3F 1RHQB 2A0FB 1K0VA 1RT2B 2KB2A 3EXCX 2WOMA 4LBHA 4ZVRB 4ZK7M 3AJ1A 4H4KC 4JI7J 1BQNB 3GR0A 4P72A 2VHGA 4GKKF 5KFZA 2YNHB 4LVNP 3TW0A 4DV3J 1R6YA 1S79A 2ASLA 2ALYB 1R89A 2XYPB 4WTYA 2XC9A 3D6HB 4DR1J 1TQLA 1SV5B 1N5YB 4TNOA 1E6VA 2W9BB 1DQAA 2MYFA 3NG8A 3WHIA 4FF4A 1L3VA 3OJSA 1LOUA 2QL5B 3PKYA 3R5AA 3UCZP 1HMVA 4I4BA 1NSAA 4P9SA 1EARA 5CYMB 2ZZMA 2AX1A 4JI6F 5L38A 4M5GA 5E3AA 1TVRA 3D6TB 2VKRA 1RHKB 4PQUA 4DR7F 3G71S 4X64J 2HS3A 2BRLA 3MCSA 3RJMB 3VGUA 2KFZA 2QLXA 1YJ9S 4OX7A 2WK4A 5F0WA 4F4AA 2Y1JA 2M3DA 2YY3A 4V19J 5JUMA 4FYDA 3MXHP 3KLHB 4NI2A 2MDAA 2HQIA 2NLWA 2FC8A 1HYSA 4Q2MA 1X5SA 1YBUA 2GCFA 1JLGA 4GVBA 3AD9C 3PR5B 2ZH3A 1S99A 2KT3A 5J2PB 4Q2LA 4LF7F 3KDOA 3TWZA 5KT6A 3CCQS 2KH9A 3FQKA 3GJRB 1JB0C 1FWKA 2KHCA 3M8PA 3DYAB 2AU0A 3GE9A 2YXLA 4CM0A 3OFGA 4GO5X 3OL6A 2HFNA 1GFWB 3FEXB 3QPIA 1JLCA 4CRJA 3MUTP 3CJSA 4MT1A 4O0NA 2DNOA 2NXUA 4K4YA 4CQ1A 4IOCQ 2M70A 5GAGI 3P5TL 2E5HA 2V8VA 3DYAA 4NLOA 3SFUA 2KT5A 3O5TB 4DG1B 1N54B 2YTCA 4EFAC 3K5LA 2E9TA 3OQ2A 4I6AA 3CCVS 5C25B 2QX0A 2VDIA 1RKIA 4ZS6A 1PKUA 2RQCA 5F9NA 3M8YA 1FNXH 2M2BA 1VQ9S 4V19X 1QVFR 2ZH2A 1VHFA 1PYTA 2O3DA 3KLGB 2GVZA 5HAOA 3M6WA 3LWMA 2DGTA 2KRBA 4DV2F 4XTTA 4M5DA 2XCPA 3DXSX 4TQSA 4X65J 4QU6A 3HP6A 4C11B 1XMBA 3KJFB 1M1HA 3DC2A 3BKUA 3H40A 1XNQJ 4CLYA 1XJWB 3KHGA 5LSOA 1EQMA 3UN5A 3HVTB 2PE8A 1BC6A 3D68A 3T19A 4NCAA 1KNZA 2V6AA 1UMJA 1LK5A 1UWBA 1YJ7A 1FEEA 3G86A 3M8QA 3CE8A 2N3OA 1S59A 3HSZA 5JJBA 3T5JA 2ZZNA 2F3JA 2A2CA 3KK2B 1KN6A 4DQRA 4GKKJ 3NAIA 5AJ3F 2BJDA 1RLDA 5LMNF 4X4OA 3VAGA 4C8ZA 4DV0J 2XYHB 3T3FA 3IGNA 1WORA 4PCQA 5L1LA 1ZS6A 4MKYA 2RILA 4JI1J 2BBEA 2ZBIA 4QPTA 2XQCA 1W25A 3EICA 1HHTP 1RCXB 2IVMA 2RB7A 4C3KA 4WZMA 3AOAA 3Q23A 2E1CA 3HHLD 2ILYA 2YKNA 1PILA 2GVDA 1S7IA 2RSQA 4CT9A 5KFHA 4B3OA 4LMZA 5FJ4A 2GMHA 3AB2B 2DB1A 5MAOA 1B7YB 3HK2A 1JLEA 5K8PA 2CG8A 3EM1A 3AQOA 3CIZA 1RBLA 2C2NA 2HZCA 3K5OA 2NUUG 2QL7B 2WVBA 5F8IA 1RAFB 4HEA9 3TA1A 4YHHF 4IYQA 4PZVA 1EJ7L 2LECA 5J2QB 3M30A 4QW8A 3CJ4A 3ILLA 1SJFA 3ET6A 4YB1P 2X1GA 3C6UB 3ELHA 3S1TA 3I82A 1M5VC 1RACB 4JI2J 1M1KT 3NBPA 4J37A 4O44A 2H65B 3QWUA 1RWMB 3CEDA 3KDNA 4MKVA 4CM2A 2NPIA 1C1BA 2DVIA 3AJDA 4LREA 4DLGA 3MECA 3MM8B 1H3DA 4IFVB 4PPZA 3PX0A 5HK4A 4Y00A 4AYBD 4RW7A 1MWQA 5HP1B 2A6MA 1IBCB 4HH0A 3BZQA 3HHNB 4JOUA 4CTAA 3VAFA 4B3MF 4RW4B 3KK2A 3D7SB 2Y0SD 1I94F 2EG2A 2YWHA 3KJNB 1JLQB 2GC8A 4OQJA 4QYRA 3RW7A 1FKOB 1XN9A 2VQFF 2E9ZA 1TKTA 2XZTB 3GMGA 2V0NA 3MTJA 1FRJA 1O5JA 2IAJB 2ALZA 2VPZB 4KBIA 3JYTA 2H4WB 3GFHA 1UEUA 1J5EF 3HSGA 1S76D 4I67A 2KXNB 1S4FA 2DHAA 3CCWA 4ID8A 1U1QA 3DLJA 4IR1A 4M5MA 2HAFA 4NASA 3DGPB 3LP1B 3SBMA 3CDEA 3U1NA 3T5KA 1J2VA 1EHWA 3OTEA 3UI3A 3C6UA 4F0MA 2QE5A 3QFWA 7FDRA 4ECXA 2P8IA 2DGVA 4FP9A 2V9WA 4IUFA 4NLUA 1NJWA 5A8KA 5KFGA 3HULA 1N32J 5KG3A 1VRUA 3F41A 4I6YA 5IM0A 3THTA 2HWHA 3LGNA 1N52B 5ETPA 3HDSA 2H1YA 4UOHA 3S7RA 2KHDA 1JLEB 3LUYA 5ETLA 4RNOA 3OPKA 4JYAF 4RW8B 5D0HA 4JI8F 2ZKUA 5J1EA 2DT9A 1FXDA 3M8PB 1EAYC 3EGVA 4KGMA 4ZLJA 1S97A 1NNDA 1B64A 4A8FA 5CAAA 2YKNB 2W2PP 4OV6A 1DRZA 1NJZA 1OJ4A 1JK9B 3LW5C 2N7YA 3CJ5A 2XY5A 1BHNA 1W7WA 2K8GA 3IBCB 4GVBB 1VQSA 4M1KA 5GAEI 4OYPA 4PQAA 4OHVA 5ETSA 2ZHAA 4B9SA 1RDRA 2CADA 2UP1A 5C7PA 3O8WA 4QOTA 4ZLNA 3IAM9 3RAXA 1ZAVA 2DRDA 1SUQB 3OR1B 2XWXA 5IV3A 1RAHB 1S9EB 2XWYA 4OYXA 3A12A 3I9V9 3BR9A 3NCRA 2CZVC 1AZSB 1VHIA 1VS3A 2FZKB 5IOLA 4CNZA 4XIUA 1XTZA 2PO4A 4DSKA 2XMKA 4ED8A 4PG8A 2O67A 3W7BA 2V8PA 2BYCA 4DZ6A 1DJ0A 4NRTA 2E9RX 3IM8A 2HS0A 4URSA 1FNMA 1VQ4S 4RBTA 2I2YA 4DR2F 4WFBQ 1UETA 4F2SA 1N5SA 3BBCA 2I9SA 2DIUA 2WMMA 1KVKA 4LF5J 1IJFB 2BABA 3LPEA 2P9GA 2FJBB 3N6NA 2VA2A 4RNHA 4M5DB 2XMJA 2FJAB 3TUJC 3ULHA 1S1TB 7FD1A 1RT6B 3DHXA 1RT7A 2J0SD 2C3YA 3HFZB 1MLAA 4DX6A 1T05B 1RQ0A 3IAS9 5DQGA 1JLFB 4F7VA 2PI4A 3V6JA 2M9KA 2DH7A 2PN6A 3NOCA 1NK9A 3CT9A 3TO8A 5HL7Q 5CXTA 4PG7A 3NS5A 5K9FA 1RT3B 2XZDB 4PXCA 4ETZA 1OPIA 2AGOA 2GFFA 1IBLJ 5LXYA 3W5ZA 3SZ2A 1ZPWX 2YPYA 4J9OA 1IBLF 5KFCA 1RCOB 1NSPA 1VRUB 2WVFA 5IM0B 4F04B 4IH7A 4L73A 4WYWA 2L9NA 1S6QA 3TA0A 2FGCA 3AQPA 2HHHJ 2J0XA 1J5EJ 4ITSA 4OZ2A 4QQBA 2OPPB 3VTIA 1PO6A 1HNWJ 4Y2MA 4NLQA 5EUHA 4C0BA 4BC9A 4D3GA
chains in the Genus database with same CATH topology
3I4HX 4QWBA 4HYKA 1JLGB 2OPQA 2HHTA 3DGPA 2EFQA 2HNZB 1HYSB 4TYBA 1E6YB 4RKUC 4PXDA 1HWKA 5LMUF 2W8LA 4RX6A 2I38A 1NHUA 3D1HA 3EXYA 4KFBA 3SCKE 4AL7A 3S6EA 4IOBA 2VOOA 2OSQA 4FN5A 3V6DA 2MQMA 2UXCF 1R3NA 2A18A 4B9TA 1UL3A 2R4FA 2J7KA 4XPCA 2DRAA 1FKOA 1A9NB 2HVIA 1NKBA 3CJKA 3TAQA 1ZTWA 2LVWA 2DHXA 5E3RA 4CO1A 2UUCF 3PEHA 3GWCA 1C1BB 4NCGA 3TI0A 1VC5A 3FEZA 4WFXA 2ZOMA 4I68A 4J9KA 1WHWA 2DCLA 2GHWA 2WOMB 2JLFA 5CHCB 3N5BA 5BYQA 5KT4A 1R8HA 4IO1A 2CJ9A 3HI9A 4ETXA 1RT1A 2C3MA 4RBVA 4K4VA 5A2QY 1FVSA 4YFUA 2HMIB 2JFKA 4NRUA 5A8RB 4R8UA 2VA3A 5IT9Y 1N0UA 5KAKA 5KFPA 2ZH6A 2IBKA 1WG5A 3RB3A 3B4MA 2AYEA 4UOCA 5T14A 1UVMA 2V94A 2M88A 3IWXA 2CQ0A 3OFEA 1R7IA 3LPYA 5EGYA 3DI6A 3IWLA 4ZP8A 2HPUA 4P2SA 3TAPA 4IRDA 1FRHA 1P9QC 3SDEB 4N8OA 2CPDA 2L48A 4OZ5A 1NB7A 1FTCA 2HYIB 2JEFA 2EC0A 4GC7A 2M8DB 3UD4P 4HT7A 2V4JB 3M8QB 3H4BA 2FVQA 3BSNA 1LQ9A 4FS2A 4N56A 1TP7A 1MU2A 2R8HA 4URQU 5D3GB 2Z4PA 3BN4A 4J9LA 3QO9B 1LWFB 3MUMP 1LWFA 4NX9A 4U6PA 1JNRB 3N79A 1HQEA 1UJ6A 5LJ5Y 2DNYA 3SV4A 3Q2SC 2C2EA 2XS5A 2LMIA 5E5NA 1VQ7S 2IMOA 2PDAA 3QIDA 4X65F 1S1VB 2ATLA 2QSFA 4PUOB 3MFIA 3I0RA 1Q78A 5E7OB 4ED2A 3QIPB 3VQTA 2FVPA 3N0VA 4ZLPA 1F9FA 1OWXA 3TA2A 3KWMA 5FDLB 2B6AA 2HIQA 3HT3A 2AJQA 4WU3A 5CCMA 2W4PA 3AJ2A 3K5MA 1UVJA 2HHWA 2M0GB 4HHJA 1IKWB 3BGLA 2N3LA 4ECQA 4JYAF 3FFIB 2R8GA 2MJNA 2GIQA 2O66A 3QMQA 2IVFB 3MR5A 3BO2A 4A8YA 2DITA 2CG4A 4TKTA 5E41A 2XHWA 2KZMA 2W4DA 4L6V3 1LFWA 1S7HA 2QA2A 3HPOA 1BQMA 3KKFA 1TFWA 5DLFA 3P49B 3V81A 1AROP 1FRIA 5D4NA 2E44A 2DNKA 4ICLA 3VAHA 3PW4A 2DNLA 1D9DA 1M5OC 3FZ2A 3OBIA 5F8GA 2LKZA 1DURA 2CQPA 5H9EJ 4YQWA 1HMVB 3VAKA 5D8HB 2IYGA 2KM8C 4XPEA 1HWJA 2RKIB 1SV5A 4N47A 3PIOQ 1YSJA 1RK8A 5T7LB 3QJJA 1F5AA 5IQ6A 2CPEA 4NLWA 1UFLA 3BS9A 4MKBA 3OVAA 3C3LA 3POTB 3DRSA 1M5HA 3B82A 3T9ZA 4F4ZA 5AE2A 2R7RA 1RT2A 4ZVEA 1Y3KA 3HHLC 2HGLA 2G9OA 1DQ8A 2LA4A 1JJ4A 4C4WA 2BW2A 4LIWA 3K58A 3Q22A 3GQCA 1GX5A 2UXBF 1LV5A 4KKOA 3M2RB 1F60B 4O3QA 3AH6A 2PT0A 4IG3A 3JSMA 2PA3A 4B08A 3MMCA 2XZWA 3LP0B 1S6QB 3SSQA 2UUBF 3UCUP 3BF4A 4I2PA 1RP5A 5D4OA 1VBXA 3MD3A 2F9DA 3O1LA 5E33A 4O4GA 4HTIA 2GMLA 3QWPA 3JSBA 3DM2B 1KC8T 1GT8A 3G6VA 4LF5F 1Y4ZB 1Q79A 3OHAA 1UEVA 2FHJD 2RT3A 3ENWA 1FERA 3MZIA 1H2UX 4DL6A 2RDJA 1S0NA 2APOA 1KHVA 4J9MA 3V4MA 4K4ZA 1RT5B 3GZ7A 2B9YA 4TY8B 2ROEA 4NLXA 3DRPB 5AE3A 4C8NA 1I6JA 3QJPA 4LF6F 1HW8A 2RNEA 1X9WA 2ZVSA 5KFIA 2EBGA 3VZHA 1S6PA 4XO0A 3CULA 2MKJA 2E29A 4O4RA 2QA4S 2Z2MA 3GB0A 2ZH1A 1S77D 2BA9A 1JX4A 3QGGA 2KKHA 2CQ4A 5KFOA 3GG0A 2KXFA 2KI2A 2I1RA 2CQBA 2VODA 4B3SF 2WCXA 3C46A 1U24A 1U45A 2R7OA 2DNQA 1HBOB 5EX0A 4DF4A 1UKUA 2ZITA 2GO8A 4MH8A 4TLQA 1MSWD 2LQ5A 4DR3F 2YNFA 4ZVFA 4A48A 3G6ES 3KG1A 1K0TA 4ELUA 3J81Y 2MHNA 1Q1KA 4DSJA 2HHVA 1TK0A 2HRUA 4F25A 1FDNA 2GGPB 3BQ2A 1G7CB 2QFJA 1HWUA 4C0OC 2X1BA 3RW6A 2LCWA 2WAQD 1KEKA 1CSJA 1HBUB 1BLUA 1CLFA 2VG6B 4HDGA 3GILA 1ZM3A 4ZPTR 1Y5LB 3HHLB 3BSOA 4OV1A 3H5XA 1GNKA 4KE5A 2H9ZA 3VAMA 5EN1A 2QLWA 1OPZA 5A6PA 2AJ4A 2IAJA 4K5SA 1YJWS 2R8KA 2E5GA 5DGAA 3OXFA 1LKZA 3D0IE 3LWLA 2KO1A 3MFHA 2RQMA 1U1KA 2HHQA 1U6BA 4DPOA 4LSNB 3FSXA 4CTAB 5B7WA 4Q43A 4OZLA 5DRKA 3N9UC 3OXGA 4RU9A 2VFTA 3MOJB 4LT6A 2AJFE 4RW7B 4ZHRB 4W92B 1BWEA 4GMKA 4IFVA 2J8AA 1FF2A 3PHEA 4EBEA 3TP2A 2NUHA 5GMKa 3OTCA 4OZNA 1APSA 2BR0A 3N28A 2I5JA 2ILZA 1VJWA 4YR3A 2IC3A 3UPFA 3FSYA 4LUBA 3QAEA 4OL8A 1XC9A 4F2RA 3OFFA 2KFNA 5I3PA 4BBYA 4J9PA 3ENVA 1G2EA 2DGSA 3ENQA 1U26A 3THPA 2NREA 4K0KF 3IR6B 2WSCC 4RNMA 3DDNA 2VD3A 3NCPA 1U1RA 3BQ1A 2KRRA 1S49A 1YJTA 2AYBA 4JI7F 3CF5Q 4A8WA 1N36F 2R7VA 1XK8A 4FPRA 1HPZB 1SKWA 4U9RA 3GV8B 2QT7A 1ZAXA 3CJ3A 5KFDA 2POKA 1PSDA 4K4UA 3MM9B 1X5PA 3BGFA 2JJ4D 2ADBA 4EBCA 1SH2A 2VBXA 3M2UA 2ZJRQ 4Q0BB 1S10A 1U6ZA 5KFSA 2FPHX 2HHPA 3MD1A 5C5JA 3KK3B 2ROGA 1NH8A 1S1UA 2KG1A 3LH2S 3M2VB 1N6QA 2CQ3A 4WXOA 1TKZB 4NPOA 4TYAA 2RKIA 2IJNA 2RJZA 2FDNA 4RWXA 1G6BA 2B7CB 2BANA 2E5IA 1RYRA 3U1LA 3BSCA 3CCLS 3CMAS 4KV8A 4Y28C 3LQVA 2B5JA 1S9EA 4WFAQ 2EPIA 2P6TA 4NLPA 5KT7A 2LQJA 2VG7A 2CPIA 2WONB 1WTBA 3HX9A 3UD3P 2N7CA 4LF8F 3KLGA 2ZH9A 3KLIB 1C2PA 2VC0A 3MAHA 3D0HE 2R8IA 5DO2A 1SXLA 3Q2TC 2HS4A 2CQHA 3UR0A 2GMJA 2F8EX 4NLTA 4OZ0A 3VF0B 4DUZF 4DQSA 2Q3PA 2DO0A 3KK1A 4I69A 3VR1A 1KVJA 4NLYA 2GV1A 4MTPA 2YKMB 2QO3A 4DL4A 3OXLA 4WFYA 6FD1A 3U7JA 1F2GA 1JLBA 4X66F 2E7XA 4OJHA 4PUOA 1OQ3A 4IDKA 2GO9A 4Z37A 4MFBA 4ED0A 3WBZA 1RT6A 2FHKA 4E8UA 2OPSB 4TXSA 2SXLA 3Q8SB 4AQYF 2LEPA 2GQCA 4OI3A 2B7BB 2LU2A 3IWNC 4NXNF 2E5JA 4PRFA 3DOKB 1RTJB 2AYGA 2HHSA 4CCHA 4TQRA 4DN9A 5M2RA 1LW2A 3FVYA 1V3RA 3DMJB 1RGVA 1L3KA 2OFGX 1Y7PA 2OSRA 5IQQA 2P9CA 1J5OB 1VC0A 2VH7A 3M9MB 4M95A 1BGXT 1TL3B 3JTOA 3DLKA 2FLLA 4BHQA 3LAKA 4FBUA 3M2VA 1N6QB 3MECB 3MM8A 3MEDA 3QJLA 1KSPA 1IKVA 3OR1A 1YIJS 4WXWA 3NBPB 4NL5A 2XMVA 1FDDA 4O44B 5H1SV 4DQQA 3KMSA 2HWTA 1WWHA 2DNMA 4WF9Q 2W9CB 3J7YI 3GIIA 2HNYB 1RAJA 1ULRA 2FTRA 1U09A 2J7WA 1ZBTA 5A8RA 3DLHA 2MMYA 4DSFA 3Q24A 1K1SA 1ZH5A 2HLUA 4FZVA 5F8HA 4K50A 2GIRA 4RW6A 4QZVB 3R1HA 5B0EA 2DPIA 3CC4S 2E66A 4ES1A 2HHUA 5U47A 3DRRA 2QEXS 1RTDA 1D8YA 1SKSA 1SH3A 2I5JB 4H4OB 4C8OA 2MQQA 1L5UA 3TVZA 4HKQA 2OTJS 1HQUB 5F8JA 2J6SA 2IHR1 3O2IA 4ZHRA 3NAHA 5CYJA 1JMTA 5B08A 4IO9Q 2AGQA 4DS5A 5GADI 4PPDA 4I1TA 1UA0A 4UQTA 3MM5B 3IBWA 4F4KA 4B9MA 5KFKA 4OHXA 2HVZA 1XMQF 4KHMA 3DU5A 5CH7B 2HLTA 4DDFA 3ICLA 4ES2A 3BB5A 1H38A 4C11A 4OI6A 1TL1B 1KQSR 2E7WA 1JXLA 3D5MA 4YEAA 3FGVA 1HD0A 3FQLA 4ZVHA 1HI1A 4ZCIA 3I56S 2Y1IA 4F67A 2B9XA 2RRBA 1LWEA 1V3SA 2OD6A 4DX8H 2XCAA 1HHSA 2R7TA 2PI5A 4N8NA 1T8EA 3VAIA 4K4WA 3OSNA 3JSYA 3TRGA 1UJ5A 1T03B 2D74B 1RT4B 2PIIA 2Y1RI 2FB0A 3DLEA 3NNAA 3CIMA 2R7SA 1CQMA 1CQNA 2P9EA 1JJ2R 5HMWA 3WDOA 3UWTA 3MDFA 2GX8A 3HZGA 2LLZA 4OX9F 1JLFA 5K14B 4B3OB 1X0PA 1DAXA 4L72B 4LF4F 1N56A 5G0RA 3CDUA 4YB6A 1JLAA 1YJVA 2H5EA 1Q82T 2W8KA 4EWTA 1HBMA 3QLHB 3BGUA 4CNYA 2LXFA 3GFYA 2P6SA 5DGBA 2BE2A 2NYIA 4EZ9A 1Y9OA 5ITHA 2UUAF 2LA6A 1QAJA 4N77A 5KFRA 4DBQA 4OI4A 1UVKA 2GA7A 3FEYB 5KFBA 4QW9A 1SJQA 2JEIA 5GAEU 3LAMA 1Z2LA 3IGVA 2PEHA 5CYMA 2W25A 3HLUA 1YJUA 1H98A 3O6QA 3MEGB 4EO6A 1Q16B 1YWXA 2CJAA 1C0UA 1Y5IB 2D41A 2YNGB 5B0FA 3IBPA 2B4PA 3MPVA 4YMEA 4CH1A 3X1LB 2JWNA 3D28A 3HF5A 3MTKA 3KK3A 2ZJQQ 4Q8EA 2DHGA 2YKPA 5KFAA 1HA1A 2DGXA 3L7PA 3MM6A 4MFBB 5DJBA 1TV6A 1XR6A 3VZIA 1R8BA 3NGDA 4DG1A 4R0JA 1DTQA 3MMAA 1Y5NB 3OLBA 2YKMA 2ZH8A 2K7KA 2VL1A 2XMUA 4X62F 1KD1T 4NCBA 2VFVA 2UUTA 2IM0A 2VBZA 3E01A 3DLEB 1R43A 1TL4A 1DQ9A 1KLMA 1RT4A 1X4CA 3FMBA 4NWBA 3V4IB 2ZHBA 2MPUA 2YKAA 2C2DA 1D8ZA 2DNZA 1URRA 1MWZA 2MZ1A 4MK8A 1WF2A 5FD1A 2JC0A 3I55S 4WKRA 4ED5A 5THWA 2KDOA 3LP1A 1KLMB 2CQCA 1SC6A 5L9XA 4CZCA 1HNIB 4AE5A 4OI2A 4ECRA 4IRKA 3LANA 3G6YA 2GQ2A 2J7UA 4M8LA 1X9SA 4X64F 3KHRA 3EPIA 2ZH5A 2ZH7A 4DN0A 1TKTB 2OFHX 4OHZA 1MW7A 4PQUB 2JX2A 4YB5A 4DLEA 1MROA 2CFXA 4F8RA 2CPYA 4NZ6A 2JOQA 2Z0GA 3IR7B 3KLVA 2C3UA 2DCUB 1C0TA 1FDBA 3PJXA 5C24A 1HNWF 3EPGA 1O0PA 4RW9B 2YNGA 2D3OR 4NLGA 3HJFA 5A0YA 4C98A 2VQEF 2DGWA 3DRYA 1URNA 4O3SA 2P5VA 3DRRB 1Q7YT 1YJRA 3TX8A 4W90B 2JVOA 1TZ0A 2YQ3A 4ID5A 1MNEA 2WB4A 3DDKA 1YQHA 2VFSA 1LW0A 4DMZA 2DNRA 3CD5A 4RW6B 3K8VA 5F8NA 2WB1D 3LGMA 2MZSA 1HWIA 4WU2A 5L8RC 2XMTA 5H9FJ 1DARA 2OMOA 3A8EA 2K7JA 2RMLA 3EYZA 1U25A 5K14A 4DV4F 4PXEA 5GADU 3AHPA 4MJKA 3RYLA 3TNVA 4FF1A 2UV8A 4OX6A 3PFEA 5KFFA 3PW2A 2HQ3A 5C42A 1IUJA 3PX4A 2HNDB 3QIPA 2PMHA 2XO7A 5MLCV 3PXGa 4QR2A 4AXJA 2RQKA 3LALA 3PFOA 4HDHA 2AYMA 1DFDA 5KG1A 1OS5A 3TOQA 2KJVA 3W2WA 1HQEB 3CSKA 2D7SA 1Q81T 1QLNA 3DOLA 5KFVA 2CZ4A 2UVWA 5B0DA 4NA1A 4KHRA 1WTFA 3SCLE 3SYZA 4YP3A 2GQQA 3NWGA 2IA0A 1IKYB 2E1RA 4ZPDA 3UE2A 2B4OA 5KFMA 4A8KA 2NSCA 2BM0A 2O5DA 1GAOA 2NSBA 3HHLA 4DL7A 2FLPA 3J7YU 1HI0P 2N4DA 2XBPA 3P96A 2HHHF 1N5QA 2BUNA 3DOMA 3J7A1 1G3OA 1JLBB 2KYXA 4JV2A 1S9FA 2DH8A 2ZFHA 1T94A 4CH7A 4CO5A 5GAHU 4Y2KA 4RWWA 2CQGA 1MMNA 2BZ2A 2BOPA 4KT0C 2HRYA 4TU9A 4ALZA 3MR2A 1N8RT 1FO1A 1TUVA 5B0AA 1VQLS 3OL9A 1ZOTA 4G6VB 5CYQB 4NYPA 3VCDA 4KHPF 2DR7A 5KFUA 2GJIA 5GVQA 1YG0A 5KG5A 1SJ1A 1VK8A 4NLDA 1VRTB 5J2NA 4N76A 1C4AA 2QRRA 3ZZUA 2K3IA 3C66A 3MM7B 3N5FA 4ZVGA 4DFMA 2ZD1B 4KKOB 4Y2AA 3ZZOA 1NK7A 1EP4A 2FLOA 4R25A 1P6TA 2G0CA 2DNGA 5CQGA 1YTYA 4KV8B 1BD6A 4LVOP 4ZCMA 3R3TA 5SZTA 4KRWA 5CCLA 1S72S 1FK9B 2W7OA 1D0EA 3K5NA 1FNOA 4H4MB 4I7FB 4NCGB 2Q6BA 4X4TA 2M4MA 1D1UA 2JEGA 4RUAA 2MY8A 1N5YA 2QA4G 5C24B 1IKVB 4NMLA 2DHSA 1C0TB 4ZCLA 1WG1A 2JL9A 2KT2A 4FNIA 4YY3F 3FSIA 1NO8A 5AE1A 1NK4A 2VV5A 2MGZB 3K59A 1K9MT 1SKRA 1N0VC 4LIRA 1ZZFA 2J6UA 3M2UB 3QYYA 2YKOA 3DMJA 2VBWA 1JKHA 3H5SA 3DM2A 1YBAA 1NK6A 3OR2B 1VBZA 1RTJA 3MHYA 4USIA 3RRGA 3KJVB 3RB4A 4F02A 2D3ZA 2J76E 2D3UA 4F3QA 1K1QA 2YNIB 2OTLS 2QSWA 3CCMS 3PZPA 2EFVA 1UW4A 2WSFC 3GSDA 1LK7A 1IKWA 1U7LA 2F1FA 2OPPA 5E3CA 2B0GA 5IWAF 2UUWA 1K73T