1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chromosome segregation
molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
1S1WB 4OI4A 2MXYA 2VU5A 1RLDA 2WRMA 3GG1A 3ICLA 3IR7B 4TXSA 3MR3A 1IJEB 2WONB 3W9JA 3DLEB 3LOUA 3NEKA 4WTYA 3W2VA 4ZHRB 3FUYA 4I6WA 1OY6A 3DCAA 4OZ3A 1N36J 1JXLA 2XMVA 3GYGA 2V8HA 2J5AA 2XG8A 2IAJA 3NNCA 4K2JA 4A8QA 1HQ2A 2FJAB 2Q6BA 3K8WA 3MECB 3IO1A 4DXLA 4CH1A 2AJ0A 2LDYA 2MEWA 2IIHA 2JSXA 3BH6B 1S6UA 3EJMA 4UTGA 3UQSA 1Q81T 3V4IB 1RWPB 5DZ6A 3S1TA 3DLHA 2M9KA 3VAHA 3CC7S 4YB7A 1O0PA 1OMSA 2AF6A 2DEIA 4JI6F 1RTHB 2OLWA 4ANDA 5HAOA 3SEOA 4DZ6A 2MKIA 1Y7PA 1RHQB 1M0SA 1EQMA 2FHOB 3BSAA 3PRVA 3UN2A 1UVJA 4ERDA 1EQ0A 2UUBJ 3H20A 5L1JA 3JAMY 2PI4A 1UVLA 3IM9A 1CG2A 2ZOFA 4F4KA 2B7BB 3G96A 5IT9Y 1IBKF 4U8YA 2YKAA 1SJ3P 1M5KC 2AQ4A 2H5JB 3QZ7A 2P6TA 2YNFA 2XO6A 4ED5A 2I38A 2UZAA 1I94J 1ZH5A 3IAM9 2DNKA 1CS4A 3TARA 4TU8A 2QFJA 1U26A 2VFSA 2AU0A 2B5JA 2F1FA 2XZTB 2IM3A 3W61A 4DBQA 2HHUA 5LXYA 3OL7A 1M1KT 1V6HA 5LSLA 2U1AA 2VC0A 3NWGA 3T9ZA 3CDEA 1EX8A 5L9NA 5FDLB 2DHGA 2PO4A 4F8RA 4J9NA 1DAXA 1IBKJ 4JYAJ 4ECQA 2HFNA 4DV4F 1D1UA 5F41A 3C16A 4PZVA 4BHQA 4L3NA 2E7VA 2B9EA 3U27A 1HI8A 3GB0A 2MQNA 2VFTA 2HZCA 3JSBA 2XLIA 4DV3J 4DSEA 5GAEU 3HDSA 5H1SV 1TMMA 2IRYA 3DRSA 4LBHA 4ZLNA 1HWUA 1NSKL 1YQHA 2LLZA 4HACB 4N77A 3AJ1A 3UR3C 4X62F 1KSPA 4X4OA 4ZIVA 2BKPA 1WKLA 2JX2A 2B5JB 2KHDA 2RILA 4ZPWR 3F73A 1OIAA 2U2FA 4HKQA 4C8NA 1WI8A 1F0XA 3CJSA 4DCPB 2D41A 4E98A 2KFYA 4C4WA 3DDNA 4M5IA 4WU2A 1Z1ZA 2O67A 4DR4J 3ZC4A 3CDUA 3J7YU 4UQGA 1H2UX 4JI5F 4M5GA 2CJBA 1V3SA 2ABYA 3QJJA 1QAXA 2A2DA 4F3OA 1HD1A 1MU2B 3KK2B 3MR2A 2Y1LB 3MZIA 5CYQB 3HHEA 1BLUA 4JI4F 7FDRA 5IXUA 2DHSA 4EZ9A 1TUVA 2CJYB 1T9UA 4GC7A 1C2PA 5F8IA 2HHTA 2LP4A 3S7RA 3MPUB 4C8MA 2FIUA 2YNIA 3MM9A 4UZBA 1PGZA 2BANB 5E5NA 2XMAA 3Q8PB 4IRKA 3KLEA 3MMAA 3OVBA 1R0CB 4QWDA 1CC8A 4DL3A 3CCRS 3JTPA 2XTJP 1UZHA 2ZHOA 2B4VA 4H4KA 5KFQA 1IWGA 2L3MA 3TEGA 2PA3A 3CW2C 4FPRA 1TL5A 4AD6A 3V81B 2FHJD 3PEJA 1OY8A 5LL6d 4LFBF 1UVKA 2E29A 3OR1A 5KFCA 5I3PA 1HNVB 2F7VA 2BQRA 2IDEA 2NS1B 2WB1D 4DPWA 5E3AA 4DJBA 2WBRA 4QU7A 2B56A 1QAYA 1HNIA 4DLEA 2OFHX 3N4WA 3OHBA 1ZM3A 1HMVA 3V6KA 4DR6J 1X4FA 4EBCA 4IOCQ 2CPDA 1DARA 3P96A 4TU9A 4WP8A 4DPYA 3WHIA 1TP7A 2ATLA 4JI1J 1EAYC 7AT1B 1PJ6A 4WXOA 2L9WA 4P73A 2R7WA 2VG5A 3HULA 1S4EA 3RAXA 4OYMA 4DHVA 3AODA 3KFWX 4OZ5A 2BXJA 5ETSA 3J81j 2GJ2A 1KLNA 3DOLB 3UD3P 1AB8A 2JL9A 1RQ0A 2VG6B 1FKPB 3M9OB 5C2CA 4OYWA 4FYWB 4CO2A 4L73A 1GNKA 2DPJA 2VBZA 4KHRA 2OELA 4MH8A 4RNHA 2FJVA 3FFIB 2NSBA 1LWEA 1G4CA 1L3SA 1T05A 4B9SA 3JSYA 4FVCA 3T3FA 3OTEA 1RYSA 3KTQA 4IH7A 1K9MT 4C0BA 3CB4A 3M32A 3OLAA 1UVNA 2VG7A 2YWFA 2OO4A 3L7OA 1GQEA 4JV1A 2QZ8A 1QLNA 4HH1A 4OV1A 4DG1B 4PUOB 4R8UB 5HROB 1S49A 3IWXA 4K0KJ 3SXLA 2IM0A 3J7AN 3T5LA 4ELTA 2FQQB 2H65B 1A6LA 4N5SA 3MTKA 3MUTP 4ID5A 5F3ZA 2CXEA 4P2XA 3W1YC 3NAHA 3UWTA 4USMA 1LXJA 4LJMA 3OFGA 1P1LA 1T02A 4I69A 2CPYA 5KG7A 5C42B 5I3UB 3I32A 3RBXA 3GIMA 2QV6A 1VK3A 2PIIA 2VQEF 4C48A 3VGSA 1EJ7L 4ED3A 4BC7A 3PRBA 2XS7A 4QWBA 4M5LA 2C3YA 1JK9B 4B17A 1URRA 4UF4A 1FXRA 2HFOA 2EG2A 4DV0F 1V3RA 2LQ9A 4PXEA 4DV7F 5ETTA 4FBUA 3DI6A 3K17A 2OUGA 1Q82T 1B99A 4DN0A 1KOOA 2H51B 1DQAA 3A4TA 3IS9B 4HVZA 5K9FA 1SL2A 4ZPAA 5C2GA 4LF7F 5GAGU 1WHWA 3Q8VA 5I3UA 3MCSA 2J9EA 3R6LB 3PW4A 1WSVA 5FIIA 1PYOB 2NZ4A 4X65J 4HL9A 3MCMA 1JIHA 1WKKA 2XWXA 1L3KA 3GFXA 3OBIA 1WHVA 2FHJA 2Q6CA 3HF5A 2RDDA 4OYZA 5BYRA 2CPHA 2NYHA 4MT1A 2B9YA 4LF8F 4CLPA 4KGZB 1HHQA 2W4DA 1FEHA 2VD3A 1T03B 4JI7F 3LGNA 2WBMA 1HMVB 1DQ9A 4KTQA 3UN5A 4XDCA 3PV8A 2FB0A 3Q0AA 4CLKA 2KVQE 3LP1A 2FVPA 4K4VA 1KFSA 5F3TA 1EKSA 2MGZB 3GE9A 4N8NA 3AXMA 1LV5A 4NXNJ 1MROB 2Y0BB 1RLCL 3WZ0A 1RXOB 4JP8A 2ZNZA 4YS2A 1YIJS 1B7YB 2GVZA 3HP6A 3CD7A 4ED7A 1X8DA 1Y3KA 3QJLA 1XMQJ 4O3SA 1HYSA 2MY7A 1OQ3A 4X2BA 1K44A 2ZVIA 1QSSA 1UEVA 2RQKA 1XBWA 3POTB 3MF5A 4P2MA 2IM2A 1T95A 2HK2A 1MN7A 5HVFA 5GAHI 2RQCA 2A3JA 2YKMB 2LEAA 4L6V3 4KHPJ 2IHR1 5L38A 4LR8A 2DEJA 3IRXB 1FDDA 3KK3B 2Z8QA 3MM5A 4B9NA 3JSMA 2ZH8A 4ZCKA 3GCWP 4CNYA 3FJ2A 2RIJA 1M5VC 1HR0F 1GMWA 4ZVSB 5A6PA 2FGOA 1F6TA 3M9NB 1HBOB 2OPPA 3R5JB 4S0MA 4V1Ak 4JI2J 1X5SA 1NKEA 5AXMA 5D78A 2FLPA 2LMIA 5ETMA 2FZGB 3CDWA 2LYVA 1WORA 2CQBA 2OPRA 3BKUA 3GR1A 2YY3A 4IFVA 1KLMA 1IBCB 1C4CA 2VB6A 3SSSA 2K7JA 1LFPA 2AX1A 2DKOB 4K5SA 5KG2A 2Q43A 2KYZA 2RDJA 4LIRA 4OV6A 3S8SA 2CQ0A 2VPYB 3GSIA 1VIXA 2F9JA 2D74B 1NO8A 4PABA 1W26A 3VHQA 9RUBA 4AUKA 3K8VA 1NSQA 4I56A 2HS0A 4PPZA 5KG3A 3TUIC 4F7VA 4M5DA 4QPXA 1QE1A 1NZ8A 4URSA 1P6TA 5HQ8A 2C2DA 2NREA 3GV8B 2DNOA 2CAJA 2XMTA 1D8YA 5ETOA 3DMJB 4QR2A 4X4SA 1N5VA 3LA0A 2OEMA 4DSLA 4Q7AA 1R8AA 3ZZUA 2OJ3A 4Q2MA 3D68A 3MECA 3NGDA 3M9MB 1BMQB 1K0VA 3IS9A 2PMHA 3W2WB 3RTVA 1RADB 2VFRA 3FBCA 3ILLA 2QA2A 2IRUA 2VG5B 1YSJA 1SXLA 4PWDA 1PBAA 2ROEA 2XGPA 5GAEI 3KK1B 1M1GA 1X0FA 3RBDA 3CJ0A 3JSRA 2X1AA 2VODA 1NJIT 3VGUA 3UE2A 5D77A 4NYZA 4B3SF 1FF2A 2HNDB 3NAIA 4CLYA 4DS4A 1GMVA 1F9EB 1I5OB 2OD6A 3CD5A 4RX6A 1FVQA 2J76E 4DR5J 1ZOTA 2OTJS 5HLFB 1LXNA 4Q8FA 1XIQA 2CJ9A 4MK8A 3BB5A 3TVYA 4DR1F 3W2WA 2QMWA 1CSJA 1LWEB 3D3CJ 2IJNA 5A8KA 1U1NA 4WP3A 1XTZA 2QT7A 1CS4B 4YR0A 3M8YA 1B3TA 1KHWA 1DZ5A 3MEKA 2GVZB 3W8PA 3THTA 3MR5A 1KTQA 1R7IA 4Y28C 3SDEB 5HP1B 4ZVOB 4RNOA 5L1IA 2UUTA 4XO0A 1VQ9S 2EI5A 1Q78A 3D3BJ 4NZ0A 5KT2A 4RUAA 2AV5A 1SJFA 2IMOA 1K1SA 4I68A 2ASJA 1Y11A 3LP2B 1NRKA 2FC9A 2W2PP 3MPYA 4KKOB 1R8PA 4ZP6A 1C0TB 3MOZA 2ZD1B 4I1TA 1TL7A 5B7WA 2ASDA 2AYGA 2PEBA 2ZUAA 5D0RA 4CO5A 4Q45A 1NHKL 3G71S 4H4OA 1DQ8A 2ZDPA 2XC9A 4WF9Q 1TKXA 1N5TA 1WC3A 2KJWA 4IYQA 4KE5A 3O1LA 4WCEQ 3AOAA 4KPYA 1HI1A 1F5BA 3DM2B 2YH1A 5F8MA 2WMMA 2Q79A 1N32F 1AFJA 4JI7J 3MM8A 4YB5A 1SJQA 2HWIA 3G8TA 4F3MA 2G0CA 1JLQA 1O51A 4ID8A 3FEYB 4JV5F 1IWAA 1X4CA 2CDRB 1GEHA 2FZCB 2IJFA 3CMQA 4ELVA 4L3KA 4MKBA 5EWFA 1ZETA 2IBKA 4BWMA 1UFKA 2GVDA 3HSJA 2FHMA 2H54B 2RJZA 2YPZA 4ENOA 5IV3A 1PCAA 4M94A 2XMKA 1NKCA 4MKVA 1JLAB 3M6VA 3M2VA 2OI2A 3NMRA 1OYDA 2UUWA 1KQKA 3VALA 3K5LA 2V4RA 3I9V9 1YRTA 2G9OA 5E2QA 3SFUA 4KJIA 3J7A1 2QGFB 3I0RB 3PRDA 2DCLA 4C8KA 2AJ1A 4WE1B 1FWPA 4CLLA 3QSIA 1RA7A 3CMAS 4K50A 3IXQA 1BWEA 3AA8A 1FRHA 1A9NB 4OYOA 3CJKA 3ENVA 4R5PA 2YNIB 6FDRA 1MMDA 1Q95G 3OJSA 1GAOA 1ICEB 3GJTB 1HQEA 4BS2A 2E9RX 4K4UA 1H7WA 3LWMA 2AYMA 2XS5A 4Y2MA 4OX9J 1HR0J 1PYTA 3UVJA 4K8RA 3DRXA 1SQEA 4NRUA 2BRLA 1SUQA 2KXFA 5EX3A 5KFZA 3ILOA 3TAPA 2HAFA 3M2VB 4HDGA 4F25A 1WC6A 1UWAA 2B9XA 4QIGA 3WC0A 2HHWA 2W7OA 1E6VB 2HRTA 3PG9A 2BE7D 2MHNA 3W64A 2HQ3A 3MI7X 4Q8EA 3FSYA 1JLCA 4J9LA 1S1WA 3TRGA 4PG8A 4KY3A 4NLSA 2ZH6A 1UFLA 1XMQF 1VQLS 3L95X 2CNNB 3OQ2A 4EO8A 1FESA 4HHJA 1PAEX 2PT0A 2WTFA 3R2DJ 3HZGA 3CCZA 1QUVA 2QIFA 2KH9A 1Q7YT 2GCFA 1KP6A 2J8AA 3M8ZA 4QIVA 4PQAA 3VZIA 5KFFA 3GIJA 4USTA 1VC0A 1OYEA 3BSOA 1ZTWA 1N8RT 2AW0A 4WU3A 4C8YA 1RT6B 5KOWA 2JEGA 3PW2A 1GXLA 2F40A 3UDCA 1ACMB 4O4GB 5SUHA 2VASA 2D1CA 2DT9A 3QATA 4Y3CA 3R8YA 2UP1A 3Q86A 2DGSA 2RRAA 2OPPB 5H9FK 1UP1A 2GC8A 2RDIA 2ILZA 4G1QB 4PEOA 1S1TA 4A8KA 3KOAA 2LECA 4I4BA 1RCXB 1X7VA 1OSCA 2JZ5A 5AJ3F 2HYIB 1S4FA 2E1RA 4IFVB 3SMZA 4JV5J 2HG4A 4LF7J 3M8QB 2F9DA 5CD4H 3C6TB 1CQNA 2KI2A 1WEYA 1S1XB 2YWKA 2MKJA 1NHUA 3IA0A 2JWNA 4HI1A 1KR4A 5H9FJ 4X4TA 1SIZA 1VQSA 3T1HJ 1Q79A 3GU0A 1UPPA 2VIHA 2HRYA 3MM6B 3VR1A 5HO4A 1FD8A 3CUNA 1BQMB 1WEXA 2NXUA 2PSZA 5DJBA 1S97A 2HS4A 4NZ6A 1F1BB 4ZPVR 5LMUF 7FD1A 2C3MA 3H5YA 5B08A 4JI0J 4IOAQ 2GO8A 1TKTA 3L4BC 4DV2J 3DRPA 2AX0A 2EBGA 1GX5A 2UVVA 1HKAA 3ILJA 4M5NA 4XIUA 4B3MF 4YFUA 2H1YA 3RU0A 2F8MA 4LF4J 1EKRA 1T8EA 1S1VB 2E44A 2GVDB 3FQKA 4KQZA 3NGTA 4IG3B 5KFSA 4X64F 4KBIA 1S57A 5J2NB 2W9BA 1S1XA 2A1BA 2DGTA 3TEHB 2UXCF 3OL6A 4XPEA 2OGUA 2AMCB 4K4SA 3G87A 3I0SA 4GO7X 4WJBA 5D4OA 1SC4B 4FYVB 2B4UA 3GLJA 3MAAB 5ETVA 5DLGA 1RTZA 2JJ4D 3TUPA 4KH0B 5DLFA 4NI2A 1NLKL 3H90A 2HFSA 2C22A 3R9LA 3LUYA 4LIWA 4OJGA 2HVEA 4NLGA 2E5LJ 2LFVA 2AIRB 2HGMA 4J9KA 3IBFB 3OR2A 1S9EA 4M5KA 2RVJA 5B0DA 4QWEA 1CLFA 1XJWB 5HQMA 3FKBA 2FY8A 1RT5B 1Y4ZB 4GO5X 2RRBA 2ROPA 1YWXA 1AXQA 3DGVA 4I2QA 2MJUA 4M8LA 1Z2LA 1TL4A 3PJXA 2AJ4A 3TA0A 3D2WA 3M8WA 4X64J 2ZE2A 2KVIA 2GAGC 4RW4B 3I5CA 4DR4F 2FZKB 4CI0B 3TX8A 1RT1B 2Y3YA 3RZAA 5RUBA 2XO7A 1KFDA 3QSYB 2LXFA 3CCES 3MAAA 2AZ3A 3SSQA 4EFAC 1O5JA 4UOCA 1T03A 4URGA 2DH8A 3A8JA 3ZZ0A 2FC8A 3HLUA 2V68A 4MIAA 4J37A 3AQPA 2DGQA 3FCHA 3I87A 4NA2A 5IV4A 2RMLA 4J9QA 4DV3F 3MUMP 2ACMA 3OTBA 1F3VA 4K59A 4QIWD 1U6ZA 1M5HA 1XMOF 4OZ1A 2V4JB 3GV5B 1C0TA 3G4SS 2H9ZA 4O0NA 3ELHA 2I6WA 3V81A 2EC0A 4DCJB 4DPTA 4DSFA 2XZWA 3BR8A 4RPFA 4WP9A 4K4YA 2KKHA 2YPYA 3OFEA 2HHVA 3Q83A 4ZP9A 2IDLA 4NCGB 4KGVB 4WFYA 2PMWA 3SQGB 4Y2AA 2MMYA 4RUCA 2MQMA 3M8RA 3IFEA 2O5DA 1FJGF 1SH0A 3JS9A 5F8HA 2PEHA 2EVZA 2OFGX 1ZZFA 5CH7B 1GK8A 2B43A 2POKA 1S6PA 3RJMB 2NZCA 3GG0A 2PC6A 3IC1A 2XB2D 2HBZB 4DL0C 1DTTA 1RTIB 1JKHA 1X5PA 2MDAA 2M3DA 4O44B 4ZVGA 4I6YA 2KG0A 5K8OA 5SZTA 1KVKA 2QRRA 2L41A 4GKJF 4B9UA 2KN4A 4DFJA 1OPIA 4J9VA 3AFGA 2V2VA 4K2XA 2YNHB 2CJAA 1M5SA 4Y2CA 2FVSA 4FXWA 4OL8A 1X9SA 1N0VC 5DRKA 3P45B 2JNJA 1K0TA 2RT3A 2WZ1A 1FJCA 1FXDA 1FO1A 4OI1A 4QWCA 2R7VA 2A6OA 1GH8A 4BLGA 4ALZA 4ZKAA 2JHEA 1YJVA 2ZEJA 5DM7Q 2IBOA 1IXKA 1SKRA 1JWWA 4P71A 2PFFB 1VLYA 2D9OA 4YEAA 4X66F 2V9WA 2C28A 4DFPA 3CCWA 1TKZB 2E1AA 2GX8A 3QT8A 4U7UD 4W90B 3KUEA 3CIMA 1Q8LA 3PTWA 1UPMB 2R4FA 5L46A 3V4IA 3MXHP 1U1OA 2GZOA 3ZTQA 2EPIA 2EFNA 2YQ3A 4NEYA 1XEZA 3LP0B 1HIYA 5IQQA 5DETA 5JVGQ 5J2MA 2M4MA 2NLWA 3D66A 3ZTRA 2CKWA 4OYIA 3T1HF 3B82A 1NK5A 3RRHA 1XMOJ 4QIEA 1SL0A 3U1LA 1OSDA 1HQUA 4PRFA 1MWZA 3BGUA 4CDIA 3DKDA 1DLOB 1CULB 1KQFB 3WIVA 3KHHA 4PKDB 3V6DB 3NG8A 3TI0A 1VYAA 2HNZB 4W4MA 1RTJA 2JLGA 4GKKJ 1WOOA 4C3LA 3I96A 4ED4A 3NL0A 2XYGB 3E01B 1YBAA 3PKYA 1YI2S 1H74A 5FJ4A 1X9WA 2FJEB 3PYGA 3GTYX 1WOPA 3EVOA 4DV5F 1UAWA 2XWYA 5DG9A 2OP5A 2OD4A 3SIPB 4X4VA 3K2YA 4NXMJ 2P9CA 2YWEA 1C1CA 3DOMA 5KFPA 2ZOGA 1P9QC 4NLRA 1Q7LB 2XBPA 1PILA 1D9AA 3A12A 2MJNA 4FF1A 2WCXA 3R6GB 4PG4A 5A8WA 4U8VA 1VQ4S 4B3TF 4MTPA 2IPOB 1NK0A 3D6TB 5KAKA 3FBFA 3D9BA 4EZ6A 4Z37A 2KXHA 4Q43A 4FDFA 4CYUA 5ETKA 5U47A 4NL5A 2WK4A 4ZN3A 3A3NB 2IFXA 4ED1A 2DRBA 1NDCA 3A8KA 3G9CA 2MSTA 1TMJA 4ZCLA 3SQOP 1J2VA 3GJRB 2ZHBA 3MR7A 4IDKA 1C0UB 1VBZA 3QFWA 1W25A 2Z2YB 3D67A 4TNOA 2M0GB 2COLA 1KRPA 1B70B 3BPSP 1TR0A 2EK1A 3MMBA 2N82B 4ED8A 4C11B 2ZH2A 4DCOB 4MMOA 4NLQA 4OMFG 1CJKA 2DK2A 2KB2A 2KHCA 1FNMA 1S1VA 1VISA 4L72B 3PW0A 3QRRA 2BEFA 3JYTB 3DRRB 2W7AA 1X4GA 2ZBQA 2ZBPA 1NB2A 2V4QA 4AT1B 2V8GA 3IBCB 2M8DB 4HHUA 2HHPA 2XMMA 4WK1A 4OX9F 1H2VZ 1YX2A 4I7FA 4ZA1A 1WC0A 1RT3A 3UD5A 4CLZA 3M2UB 1W2IA 1EARA 1VMBA 1U09A 1B4SA 1KS2A 2B3TB 2M5YA 2VL1A 3BGOP 5MAOA 3OVAA 1N48A 4DG1A 2RQMA 4ZJQA 2PFDA 3I31A 2AJQA 2BJ1A 1CEZA 3DM2A 3TANA 2XSJA 1NCLA 2DBBA 1Z2ZA 1VBXA 1WC1A 3MM9B 3ISND 1WC4A 2ZOMA 5F8JA 2UVRA 2VBWA 2HHQA 2AT1B 3ZO7A 5JMNA 1TL3B 1D9DA 3DMJA 3OVSA 3AB4B 5DG7A 3AHPA 2C3OA 4MFBA 5CZXA 2V69A 1JLAA 2BW7A 2V50A 3KLIA 2O3DA 3M6WA 3M30A 2HPUA 2CDQA 3OR1B 2HZAA 1YJWS 2QJ3A 2ZJPQ 2R7UA 1YJUA 1GT8A 2EW9A 3VQTA 2W4CA 4LRBA 4QPTA 2J9DA 3AAWB 4ZPBA 2NR0A 2DXEA 3VGTA 5FLXY 2J0WA 1UWBB 4DN9A 1WNEA 1RA6A 3C15B 5DQIA 3EPGA 3SYZA 2G13A 3B54A 2IC3B 1WSRA 1YKWA 4IQXA 1S9GA 3D7SB 4F0HA 3TP2A 5J2QB 2NXCA 3D1QA 1XC9A 5KFNA 1FNXH 4Y2KA 1S0OA 2DR7A 5E3QA 5A2QU 2MZRA 2ZH3A 1FXLA 3I5AA 4OX8A 2Z2LA 2A18A 4ZVQB 4FNHA 4YB1P 5I42A 1ZYQA 1G2EA 5IQ6A 3MPDA 4RW7B 1AW0A 2QMXA 2LEPA 2F4VF 4HHHA 1NPKA 1RWMB 2DJWA 2AEFA 4C97A 3EGVA 2ZZMA 1KVIA 1L3TA 1HBMB 3CJ5A 3LALA 4ZPTR 3LPYA 3CF5Q 3FZBA 2EWHA 2BRKA 2UUCF 3HFZB 3MMJA 3TUJC 1JLCB 3GIRA 1NDKA 2C1EB 3CD6S 4A48A 1FCAA 4AFFA 3EVMA 4WK3A 2CNLB 1VRUB 2ATCB 2EFQA 2J8SA 1RBOB 1R31A 4K5RA 2DR8A 5J2QA 4LVNP 3OHAA 1JX4A 2G0IA 4X4QA 5B0CA 1WOSA 4ED2A 3MD3A 2ALZA 3FQLA 4DU8A 5KT7A 1T7PA 3QWPA 3RB0A 4ED6A 2VG7B 5IT9U 4DFKA 1GTEA 1TUGB 1JMTA 3E3XA 3JXOA 1RT6A 2YKNA 2DH9A 2DXFA 2GAHC 3W60A 1DRZA 2HW3A 5HI7A 3IP0A 1VI7A 1FRLA 2BE2B 3M6XA 3PM9A 4PG7A 4ZJOA 4YHHF 1C0UA 2VBYA 1U47A 3S01A 3EDRB 4QJVA 2EFPA 2YKMA 1UKUA 2ERRA 1QD1A 3B6BA 5IWAJ 4G1QA 1UJ6A 1JB0C 5K8PA 3MFHA 2QX0A 3D1HA 5D0EA 2C2KB 2YKPA 1D9FA 1T9TA 3KG1A 1VCTA 3QRQA 1VFJA 2V63A 2YXLA 4URQU 3IR5B 4G6VB 2PGCA 2HMIB 1KTVA 3OTOJ 2C3PA 1UW9A 3ZZTA 4UOFA 4NA1A 4NLPA 4RBVA 1F9FA 4IH6A 2H4WB 1U4BA 4YUDA 5F9LA 3UR0A 3CD0A 3K5NA 1W7WA 4RW6A 1AUDA 2JRSA 1Q5YA 2JC1A 3PNIA 5EX0A 2GW8A 4LRAA 4DPOA 5K8MA 4A8SA 3ZTPA 4OI6A 4ZP8A 2BBEA 4IOBA 2ZITA 3CC4S 1P8GA 4CH7A 5ETLA 1CC7A 3HO1A 4JI8J 1UEKA 3US5A 1AT1B 3GZ7A 4QZVB 4NI2B 2RH3A 3W2VB 4Q0BB 1TV6B 2QSFA 4AE5A 3DHXA 2VBXA 1R0AA 3QRPA 3EPIA 1N33F 4B9LA 1FRJA 1MU2A 3KK2A 1XR5A 4F3QA 2IMWP 1U2FA 1APSA 1IR1A 1FD2A 3M1VA 4PUOA 3WIUA 1RJJA 3FRZA 4OJHA 5KOXA 4FKYA 2DNHA 3CCLS 2BQUA 1PAUB 2BM0A 4NRTA 1YLXA 2LQBA 2JLFA 4DR5F 5KFUA 1IBMJ 1NZAA 2CZ4A 3KJQB 1JQGA 1NJXA 1LK5A 2ASYA 3L3CA 4ED0A 3C6UA 2PA8D 2CVIA 1VC6A 1FRKA 5T14A 3OW2R 5LMNF 3HHKA 4RW7A 2ZJQQ 1UETA 4NLUA 4O4GA 3IGVA 2O66A 2ZH7A 3M4XA 3VAJA 3EM1A 3UDVA 4G65A 2RKIB 3H4BA 4LF9F 1VQ8S 1RT4A 5ITHA 2CWXA 1XK8A 4RUBA 4EK2A 3Q8UA 4OHWA 1N36F 1IKVA 2DNRA 2DY1A 2B9WA 2I9SA 4ILRA 4YN3B 4XDDA 1BC6A 3UN3A 4NLOA 3N9UC 2GHVC 1TZ0A 2H4YB 4LRCA 4MK7A 1PJ5A 4CRJA 3EYZA 4GRSA 1FFGB 2HKEA 4U7CA 2YNGB 1HA1A 1WG5A 2M70A 1LFWA 3KJFB 1FK9A 3KWMA 4O23A 2XYHB 3SV3A 4CCHA 1IM4A 1NUEA 1U7LA 1ZAXA 5JXSA 3MM7A 3NBPA 4ATNA 1NK6A 3T5KA 4X4NA 1FA0A 4DR3F 3HI9A 1YBUA 3HSGA 1RBAA 1M1HA 3K5PA 2R2UA 1Q8KA 2NYIA 3PVXA 2MYFA 4MK9A 2DGVA 4AXJA 4TY8A 1YTYA 3AB2B 1R6VA 5IT0A 1VRQC 2JFDA 4X66J 2W9AA 3KLIB 3G82B 4QW9A 2Z2MA 1HYSB 3SFGA 4USWA 2F3JA 4KO0B 1R6YA 2XI2A 4FYXB 3RYLA 4M95A 4V19X 3M8QA 4R8UA 1IQZA 5J1EB 2DGOA 2YX1A 4G1PA 2GNKA 1H3DA 4YOEA 3I5BA 1J5OB 3L7PA 3S6EA 4FPIA 1FE4A 3R5AA 3H42A 2GJFA 2XCPA 4M5JA 5A0YA 3TW0A 3OJUA 2L48A 1NAQA 4MJKA 2VJUA 1S1UB 2GGPB 3QAUA 2G1HA 2C2OB 4RO0A 2PD1A 4TY8B 1QSLA 1MN9A 2HHXA 2WOMA 3FBEA 1UMJA 2HVDA 5I3QA 5IFMA 3K58A 4OI0A 1IVZA 3PFEA 1TK5A 1JLFA 4A8XA 1IKWB 2DNYA 2X1GA 4OJ3A 3EE3A 4XTTA 4WTOB 4FF3A 3PKMA 1Y10A 3QNWB 1HNVA 1Y5NB 3HMJG 3EGWB 3Q8RB 2R42A 1KEKA 3ITHB 2HNYA 3M2RB 4TLRA 5HJYA 2IYIA 1X4AA 1FJGJ 5I4MA 2XS2A 1HBUA 1FRXA 1X60A 2HRUA 4OIXA 1Y0HA 2KDOA 2YQ1A 1U2CA 1Y3JA 4KC5A 1J5EF 2OH2A 4ZHRA 3D6MB 4PCQA 4M63A 2KM8B 2F4VJ 1TL1A 3U02A 2J9CA 2YKQA 1T94A 3BM7A 3QWUA 3L9ZA 4PWWA 1QE1B 2VOPA 2Y8YA 5LXRA 2XULA 3B8HA 2FLOA 4J91A 5HBMB 3CXCR 1N33J 1BXNA 4HLBA 3BBBA 1RWUA 4EYHB 2O01C 3SQGA 1TELA 3BGLA 1HNXJ 3QGGA 3W9IA 1RKJA 2ILYA 4F4YA 4JI1F 1DJ0A 3UD4P 1RT4B 3H2UB 4NLWA 3BQ2A 3C46A 4WKRA 3DDIA 1H72C 1MWQA 3QLHA 1R0BG 3HPOA 2VFVA 5KFWA 1VQ5S 1QJHA 2HVIA 3T5JA 1S12A 5KFJA 2BOAA 2RU3A 1PJ7A 3SV4A 2VZ9A 2RHQB 2V34A 3EICA 1OPZA 1CJTB 4LVOP 4OZJA 4KYZA 4K4TA 4LMZA 4EBDA 1R3NA 4I2PB 2D3O1 4ZVTB 4UT4A 3A8EA 2O1PA 2CQIA 5HL7Q 1QSYA 1L5UA 4NYOA 3JTOA 2MSSA 2DO0A 3LWLA 1C1BB 1BQXA 3ZFVA 1NM2A 2YNHA 3TQEA 2CYYA 4ETZA 4DUYJ 2ZFHA 2R7RA 5L1LA 2QG9B 3D28A 2MLZA 3R1LA 3ET6B 1C4AA 2BDPA 4JI6J 2KRBA 1RCOB 1VJWA 1OS5A 2A0FB 3FCVA 3RR8A 3TR5A 3K5MA 1RHKB 4L76A 3TQ1A 2VICA 2HZVA 5KG0A 2ADCA 3UI3A 4DL2A 1UJ4A 2DIUA 1TKTB 2MKYA 3RBZA 4R5PB 4LBIA 3HHLD 4WFNQ 2MZSA 5E33A 4QW8A 2HSEB 2LCWA 4LF2A 2AWZA 3EVWA 4EUVA 3G6VA 1KVJA 4U9RA 5B0GA 2ZZNA 1RB0A 4LF4F 3LP2A 3DRSB 2W9BB 5J2NA 1VIOA 3TYTA 2CWKA 1RT2A 4USVA 2YQ0A 2AHOB 1J5OA 2YWHA 1LW0A 4D3GA 1SJRA 1SPBP 1WHXA 2KL8A 4NASA 1LWFB 5EGYA 2UUAJ 2P8IA 5LMUJ 3I9ZA 4ECRA 4KT0C 3MUVP 2ZHAA 4Z7YA 3F56A 3MM8B 1UZDA 2HHHF 3MAHA 5EWEA 2EFVA 3TAMB 3UCGA 3K0JA 1AROP 1B7FA 2J6SA 1IQTA 1WG1A 4B9VA 1FKPA 2CUYA 4ZDNA 3T9NA 1IBLJ 1EETA 1NPPA 4DV4J 4N7TA 1S99A 4MN4C 4HT7A 4OYAA 3QAEA 5IZHA 3CJ3A 2CFXA 1S0MA 2MY8A 2FGCA 2HK3A 2UVWA 1U6BA 2V0NA 4F0MA 2DR6A 1XERA 2FJWA 2WB4A 3CNQP 3DXSX 1FFSB 1JXEA 3OTDA 1A0OB 4WFAQ 1H98A 1VRTA 2J0SD 2Z58B 3CCMS 1DURA 2LU2A 2DTJA 4UOHA 2HFUA 2YH0A 4PYDA 2KT5A 3TOQA 2R2SA 1M5PC 1XR7A 2I0XA 3ONQA 3KJVB 4N76A 4QU6A 2M7SA 4ICLA 4DQIA 5DDPC 5IWAF 2FLNA 4OLOA 3THPA 1QUPA 2QL7B 2XMWA 3VTIA 4C11A 1L3UA 4NCAA 1S76D 4JI4J 4ZLPA 2V2KA 3M6UA 1TK8A 1WUUA 2EXUA 3FMWA 4RWXA 3WQPA 4Y0FA 4LREA 3JYTA 1RAHB 3BYRA 1PO6A 2E9TA 1ZA2B 2OMOA 4FN5A 1KD1T 1BGXT 3G82A 2R3VA 4LSNB 3WDOA 3KHRA 3DU5A 3MMCA 1XNQF 2HURA 2FVRA 1NNDA 2CADA 3IR6B 3KLHB 1TVRB 4DL6A 1WWHA 3GONA 5G4DA 3GILA 4MIWA 1N34J 1U1RA 5KTQA 3LAKA 2RF2A 3QFHA 2HMIA 2MZQA 3AH6A 1QTNB 4TQSA 3TUZC 5T7LB 3ADAC 4KHPF 4NWBA 1JKHB 4CYUB 5M2PA 2KRRA 1LK7A 3C14A 4PR6A 2DNNA 1MSWD 4JUZA 5KFRA 1TU0B 1U0HA 1K47A 1X4BA 2MQQA 3AT1B 4WBFA 2GQCA 4GKJJ 1RU1A 3NGKA 4UQTA 3BREA 2E5JA 5CAAA 4LF6F 1WEZA 1S9EB 2BJ7A 1PBUA 5G0RA 1VQOS 2V8PA 1IKXA 3ENQA 3M30B 3MMCB 3T1AA 1VQPS 1RU2A 1S6OA 1S72S 2V6AA 3CCJS 1CJKB 4DWIA 3HT0A 1RHUB 1Z4UA 3BBCA 2W2MP 3W63A 2UXDJ 1WF0A 3M8SA 1RZMA 2KFNA 4USHA 3DLLQ 4OYPA 1SJ1A 1UWBA 5T7LA 3RB4A 1RT7A 3FCWA 1RT3B 2EBEA 5DDQC 5C7PA 4GKKF 5DDRC 2CPFA 2XNRA 1BQMA 3N79A 3SCIE 2IA6A 2IVYA 3RGIA 5AE3A 3CJ4A 3ZNJ1 2BKNA 3BKFA 5LJ5Y 3CPWR 1RISA 1SCJB 4NA3A 1EB0A 3KLFB 1I3OB 4EEYA 1AZSA 2WONA 2N3OA 4UUWA 3A8IA 5D6GA 2LEBA 3L7UA 3GSDA 3HX9A 1HBMA 3V2UC 1YVFA 4Y65A 4AYBD 1HNIB 1FRIA 3DI6B 3MAQA 1DLOA 1JJCB 1OO0B 2B8PA 5EWGA 4FF2A 3AD7C 5HSPA 3LW5C 1FX2A 2V94A 2YVSA 2RNEA 1YZ6A 1RABB 1Q86T 4ECUA 3C19A 4KGXB 5GADI 2VPZB 4RZRA 3J7YI 2HBQB 1YG0A 1KNZA 3IM8A 3KLGB 3MOJB 3GFHA 5CQGA 1H7XA 3HVRA 2J9DE 1OJ4A 2MHEA 3IWNC 2XY5A 4BDPA 2HWTA 4LSLB 4ZOSA 3DNCA 2IC3A 3O3LA 2MKKA 3FK4A 2R8GA 2VA2A 2R8KA 1XNQJ 1WHYA 1FWLA 1SQFA 1ZM4A 2AGQA 4H54A 2WAQD 2BX6A 2HQGA 2J7WA 4JI3J 3GCXP 2GIFA 1XR6A 3P4UB 3TZXA 2E5LF 3M8PA 1UA1A 1SC3B 2DY9A 3BEGB 5KFLA 2DB1A 1R8CA 3FC9A 2J7KA 4FVMA 1U1QA 3U1NA 2BR0A 3DHWC 2OTLS 4Z7CA 1SI9A 4C6AA 1LW2B 2W9CA 2YTCA 3HVAA 2YBVA 4M5DB 3SBMA 1RI7A 3O44A 3BGRB 2RS2A 1REGX 1NSPA 1N6QB 4LSLA 3KK3A 4U96A 3FNNA 3NS7B 3PCOB 4J90A 1T9XA 4RW6B 4NYPA 2BA9A 1KWMA 4DR7F 3G86A 4ITSA 4KGKA 1TQLA 4Y6IA 4DFMA 1YITS 3UPFA 2DNGA 1V9OA 5LJ3Y 4KHMA 1CVJA 3BGFA 1Y00A 2HIQA 1ZA1B 3GJQB 3NLCA 4F67A 5K14A 4YR3A 1MW7A 2UV8G 3SCKE 1WDTA 1KQSR 3GYNA 2C2ZB 2VFUA 4C0OC 2BE2A 2P6SA 4DZDA 1SB6A 1UTAA 4HTIA 4MKAA 5IOLA 1IM6A 3SSRA 4DPUA 4MYTA 8RUCA 1LW2A 3NWRA 1N5YA 5KG5A 1FKAF 1HBOA 1VGYA 2ADBA 2WSCC 4DUZJ 4DLGA 3C66A 4PG5A 1VHFA 3TAMA 2NPFA 2BKOA 3FRYA 2QLWA 3R5CA 3TJ8A 3SCLE 1CJUB 2V2QA 5HK4A 3W62A 4DUTA 3D1OA 4PQUA 5ETNA 2EK6A 1RDRA 3V6DA 1JLBB 3DOKA 4N47A 2AD9A 4O0IA 4JI2F 2VA3A 2HHSA 2C2EA 3ENAA 1FE0A 2FJXA 1VJQA 4A47A 4K4ZA 1IJFB 2OEJA 1FNOA 3D5MA 1R89A 1EZZB 4X4PA 2E5GA 2QL5B 1F60B 3K7RA 4WIIA 4ZVRB 5DDOC 4WZQA 4DU7A 4ER8A 2YX7A 1AA1B 4F2RA 1DBDA 1X5OA 3PY8A 3BJYA 1KDNA 5KFBA 1I6JA 4DR7J 2R7TA 5CCMA 1T9WA 1HBUB 1NBEB 4DQRA 2Z0GA 4HH0A 3GQCA 2G2OA 1YJ9S 1FI4A 3BH7B 4C8OA 3CIZA 4TQRA 1JJHA 1TL1B 1W2BR 4Q0BA 3QGHA 4J9OA 1X4HA 2FVQA 5I42B 1Q16B 1U25A 3EXCX 3KMQA 3NCQA 1H73A 3VAFA 2ZNYA 2FJDB 3RRGA 3H5UA 4KV8B 3G6YA 2CVEA 3IG1A 3N5FA 2RRNA 4F0KA 1UL3A 4L74A 4EI2A 1SH3A 1CQMA 3B78A 5DO2A 2I8EA 1RHJB 3FSXA 4LSNA 4CT8A 3BDPA 1PSDA 4B9TA 2CJXB 2N4DA 3X3UA 3ZNUA 5D4LA 8AT1B 5J2PA 2FTRA 4NX9A 4AL6A 5EHHA 5A8KB 3GYXB 3ISNC 3EZUA 1G7CB 2N4CA 5DGBA 3NGUA 4GVBB 1QM9A 2DNMA 3C16B 4F4ZA 2JC0A 2VQEJ 4AQYJ 1PYSB 2QO3A 4X65F 1KKHA 1LWCB 2JLEA 4I2PA 4OI3A 3PHTA 3BQ1A 4GMKA 4FP9A 2CZVC 4ZCIA 4LFAJ 4J9UE 1ZM9A 3H25A 5KFVA 2ZD1A 3HD2A 3PEHA 1VQMS 2CPXA 2RHSB 3BV8A 1LKZA 3QMQA 4PYAA 2VKZG 3Q89A 2VDHA 5E3RA 2Q1LA 4MYUA 1DFDA 4RL1A 1RAIB 1SC6A 3IBPA 1SJ4P 4CLTA 3KUGA 4LF1A 3AXKA 2CNKB 2GQQA 2M88A 1UEUA 3O5TB 5EDWA 1GTHA 3R7NB 3RBEA 3BZQA 4OHVA 1SKUB 5CD4A 4P10A 2W2NP 4IR9A 1R43A 3I0SB 4O44A 1NJZA 3BDEA 1S59A 3Q2SC 3R5GA 4FBTA 4P2FA 2W25A 5CYQA 3RG6A 3TWZA 3HJVA 1OWXA 4CO1A 5D3GB 3V6JA 4LRDA 1VQYA 3KXDA 3HCXA 4KRWA 3DFEA 3PYEA 2E1CA 3KNAA 3MMBB 3MFIA 3LH2S 5C24B 2EG1A 4ID5B 2N7CA 3NGRA 4DEZA 1K73T 2IM1A 4K0KF 3D4JA 3HFKA 4AXIA 2DR9A 2R7XA 4Q2LA 1SL1A 2M2BA 3VGVA 4ZVHA 5A2QY 1U8SA 4PQUB 3QT5A 1ZTTA 5F8NA 2HVZA 3LGMA 3EGNA 3VVTA 4ANCA 2HBYB 2WW8A 1HL6A 2BANA 3KDNA 3KDOA 1TKZA 3MCOA 4OZ2A 3TX0A 3W5ZA 4EO6A 4UY85 3QPIA 4XPCA 3MR6A 5HVGA 3UW1A 2NCKL 3KLGA 5LM7E 2LXUA 3J7ZT 4F50A 2BQ3A 2EC2A 4DX8H 2KM8C 1NB7A 1LQ9A 1I1GA 3KHLA 1AYEA 2K7KA 3QBCA 4F2SA 1QAJA 1VDHA 5GAHU 2K2PA 1LOUA 1RGVA 2FDNA 2WW4A 4CO3A 2CZ9A 3CCQS 5AT1B 2K3IA 3MEDA 4I6AA 2WVEA 2ZUGA 2BABA 3G6ES 3I56S 1CPZA 1VBKA 1RE1B 1GX6A 4P52A 2DO4A 3BSNA 4RNMA 1SUQB 4DV2F 3PO5A 5KFDA 4Y00A 2LQJA 2Y1RI 3QGPA 1RBLA 1NJWA 5KT3A 2MQPA 5AXKA 2EEYA 1TTHB 3F41A 4N8OA 4BCAA 5IT4A 4AL7A 2XLKA 2HFZA 4C8ZA 2LXIA 1ZPWX 2MKSA 2JH3A 3CE8A 3QZ8A 4N41A 1D09B 4D3HA 3K57A 1YHQS 2FY1A 3W7BA 3TVKA 2FPHX 3VWSA 4WYWA 2DGXA 1Q8IA 3PYFA 3ZZOA 3DN9A 3CJRA 2ZBCA 3V4MA 3DGPA 1RAEB 1WKJA 2H3EB 3HVWA 4O4RA 1YGYA 1S0VA 4F02A 1G1XA 1ITPA 3N6MA 4KKOA 2RD5C 2IVMA 1S5ZA 1S6PB 3ETOA 1X4EA 2M8HA 5LOQA 3J80U 1RP5A 3NNHA 3GMGA 4TVAB 2J7UA 2I5JA 2PMZD 4OX6A 1UFWA 4RUHA 3RUBL 3Q8YA 4NMLA 3FEZA 4LF5F 4HEA9 2VDIA 2HLTA 2CQ4A 4IRCA 3MEEA 5ADZA 2MQ8A 4P74A 3EZOA 1SC1B 2HGNA 2RF2B 3OV7A 2E5IA 3MHYA 1R27B 4PPDA 4RJVA 2ZH1A 5KFTA 2AJ2A 3OR2B 4XAKA 3C14B 3R7SB 3PW5A 4PXCA 2I1RA 2XY7A 1T0TV 2B8QA 2QLBB 4GVLA 2Y9HA 5HMXA 4JI3F 2HHHJ 1S10A 3C6TA 4EU0A 3T1YF 4X84A 3HHLA 1U8WA 4B3RF 1HD0A 1LW0B 2I5JB 3DLGA 2BJ3A 2G2YA 2MTLA 4NE9C 5ETQA 3I82A 4ZN1A 5J1EA 2H48B 5DZ7A 3PX4A 3CULA 5CABA 3P3DA 2CG8A 2Z30B 3LP0A 2OPQA 2P9EA 2ZC3A 4YMEA 3H59A 1KQGB 1WF1A 3TNVA 4RU2A 1BQNB 4CTAB 1FTRA 4ZMMA 3CCSS 2RAQA 4RWWA 3ZXWA 5GMKa 2NPIA 3N6LA 3QO9B 5GMEA 2GMLA 1VLOA 3HD1A 4NLTA 5IS2A 3KUHA 3LF0A 3M32B 1M5OC 2XEXA 3UNGC 2W2OP 4EBEA 2XYPB 4DX6A 3BN4A 2WHOA 2HGLA 3DYAB 1JJ4A 1VS3A 1IKYB 2DHHA 2C3UA 3NRBA 3IAS9 2HNYB 3M2RA 1QVFR 4WZMA 4Q5VA 4FYDA 2EKYA 4R0EA 2D7SA 4ZPDA 5B09A 4OYBA 3LGHA 1E6YA 1HWKA 1UJ5A 2KT2A 3H98A 4RBUA 1UVIA 4ILMA 3GR0A 3NKYA 2OMLA 4USKA 1DY3A 5KFEA 4Y34A 5A8WB 1KHVA 1PG5B 2BZ2A 4DSJA 1BE4A 2GQ2A 3MEGB 3R7BB 3Q22A 3CCVS 4K4WA 1O8BA 4ICLB 1HNZF 2EFOA 3HT3A 2F8EX 2CJKA 2XM3A 1X0PA 3UNYA 3CCTA 2DD8S 1RWVB 4DF8A 1T9YA 1WF2A 3W9HA 3BSCA 3P5TL 4LT6A 4DQPA 4PXBA 4AQYF 2CQGA 2Y1IA 3ULHA 3IRXA 3Q8SB 5HLFA 5KG1A 2IVFB 4DI6A 4ZLLA 1H38A 3OXFA 4ECVA 3NP5A 2VC1A 4B08A 3NS6A 2YWWA 3HHDA 3E2EA 2DXDA 4C0HA 3POTA 1IN0A 3C6UB 2GIRA 3HZEA 1XWLA 2IY5B 4RLEA 4P72A 1EP4B 1RWNB 2PN6A 4KFBB 4OYXA 3IGNA 5E3PA 1ZZNA 2KU7A 3NXZA 1H6KX 4WKYA 1U0HB 1QTMA 2CPJA 5D4NA 5HMYA 1PKUA 4NCGA 3AOCA 4YDXA 5B0EA 4ETXA 2Z56B 1GFWB 3HXMA 4HACA 4DR1J 2ZBRA 2UUCJ 2Z4PA 5EN1A 3PW7A 2MLXA 2HQIA 2NUUG 3DRPB 1X5TA 1TUWA 4C98A 3ET6A 4DSKA 5T41A 4H4OB 2DVIA 2DGUA 3IN5A 1M90T 2QC3A 4Y2IA 2OPRB 1DTQA 1TL3A 5BYSA 5F8GA 1NSAA 1T9VA 2OSRA 4CT9A 5KFOA 4IO9Q 3QJPA 3T1YJ 1EHWA 3N0VA 1CULA 3GP9A 3OFHA 1N4LA 2I2YA 3G2XA 5H9EK 3K59A 3BKTA 1YBTA 2F63A 3E01A 3QIPB 2F65A 1X9MA 4H4MA 5C25A 2DNLA 2ZM6J 4KH1B 1IUJA 3RB3A 2L9NA 4A8WA 3T6BA 2J6UA 1HBNA 4CLWA 5IC4B 4JV0A 3KLFA 4IQMA 3BQ0A 4LUBA 4ES3A 4ECTA 2G4BA 3B4DA 3NCRA 2JEIA 2MZJA 1U1MA 3MEDB 4DF4A 1BQNA 4CTAA 5CYMA 1XN9A 2V5HG 3BF4A 1L3VA 1FWKA 4FNIA 4MIBA 3JAMU 4WFXA 4A4JA 3MTJA 5HMZA 5BJRA 2QLFB 1NPRA 2CQHA 4RW8B 3FZ2A 5F0WA 1HQEB 5KFGA 4DR3J 3I4HX 4CWBA 1FRMA 5KT4A 4YB6A 3OSPA 3IMQJ 2WVFA 2GJIA 1HQUB 5HMWA 2H5IB 1IKYA 1D0EA 4OX7A 3CSKA 4ZVPB 4L75A 2V9KA 5F9NA 2DISA 4YY3F 2HNZA 3KNGA 3TZWA 5J2MB 1F5AA 1VRUA 2Q3PA 2UUAF 4KV8A 4G3IA 1Q8BA 4ZCMA 3K89A 3G8SA 5FDLA 5CYMB 5AE2A 2MKHA 3PFOA 2GGPA 1YJTA 2FVCA 2HQCA 1I51B 2KG1A 4IG0B 1JNZB 3CGIA 6FD1A 3M2UA 3HKZD 4P7TA 5DQHA 1NDLA 3EGZA 3AJDA 3OUYB 3A3PB 2LVWA 4RBTA 4KGMA 2VQFJ 1C1BA 4PG6A 3WC2A 4HR2A 2E7WA 2RE1A 1HW9A 3O2IA 2UXBJ 2BJ8A 2V8VA 1RTHA 1LWCA 2KZMA 3OXLA 2CNOB 1N52B 1RUSA 2ZWOA 2OKQA 2X3GA 3P5BP 2Y0SD 3D54A 5EUHA 5LMNJ 1RAFB 2CIMA 5E7OB 4A8YA 1TFWA 2C2NA 2CQDA 3BBFA 1T05B 3CO9A 2UXCJ 2NUHA 1U0SA 3KG4A 3TO8A 1V5IB 1H0HB 3UDLA 2KZZA 1JLQB 1WDDA 3KJNB 4PWDB 3NGSA 2BACA 3H8YA 2GS8A 1SBRA 2AGPA 3PJ9A 2GMJA 2VUGA 4B3MJ 4ILLA 1U48A 2GFFA 2WVCA 3E8OA 2BYCA 2KT3A 4OHXA 1Y5LB 1NU4A 1F5CA 5KFAA 4RU9A 4YP3A 2XLJA 4PXDA 4MAKA 1TAQA 2GHPA 5J1NA 1N5YB 3CC2S 4CLSA 5KFKA 3NBPB 2VHGA 4DV1F 1LWFA 2XHWA 3MM5B 4RW9B 3KLEB 3QLHB 5M2RA 3LO3A 1N5SA 4OZLA 2L08A 3QO9A 1HNXF 2JFKA 4IUFA 2E5HA 2IJRA 1D3WA 1ZAVA 1WJ9A 3SDEA 4DUZF 3J81U 2VONA 2ZC4A 2N3LA 4FKXA 2HFVA 3OXGA 1KLMB 2FJBB 3PIOQ 4IG3A 4H4MB 3HK2A 4ZP7A 2XSFA 4ZVEA 1P9YA 2BE9B 2XSJB 3TJAA 3V6HA 2BUNA 2RUGA 3N01A 4CLFA 1U1KA 2OIHA 1RWOB 4LFAF 3F0NA 1VQNS 3D0HE 4O3QA 4LQ9A 1SQGA 3GFYA 2Y1JA 3CO0P 2XMJA 1HWLA 4QR0A 4CH0S 2XCAA 3PZPA 1U24A 2X1FA 3UVJB 5A8RA 2J6TA 1RAGB 4DMZA 2AEJA 4P2SA 5CYJA 5HVHA 3R5DA 2E7XA 4C9DA 1SKWA 3W5XA 4F04B 4ECWA 1CJVA 2MQOA 2GHWA 1E6VA 4B02A 1JLGA 3AA9A 1N56A 4X4RA 5KFIA 2ZE2B 4LRFA 3OFFA 1F3FA 1VHIA 3FBBA 4IFYB 1JLBA 3DOKB 3H0PA 1F2GA 1SV5B 2E1MC 3PO4A 2JVOA 4RNNA 4LR7A 1C1CB 1WC5A 1S9GB 3DOMB 3MCNA 4C3MA 4YQWA 1HARA 3MMAB 5JVHQ 5D8HB 4CM0A 3MURP 3W65A 5BR8F 2W01A 4BC9A 2R8HA 3HFVA 5K20B 2M52A 4FYYB 3CJKB 2RU9A 2B0GA 2W1BA 1EP4A 3O8WA 2XZDB 1NH8A 2A6MA 4JOUA 2DRDA 2CG4A 5HBMA 3GIKA 2YNFB 2ZH5A 1VQ7S 4J9RA 4I0WA 1RTDB 4WXWA 5AXLA 1FK9B 2QLJB 3J7Z5 4F4XA 1VQKS 3W3SA 2HNDA 4E0DA 1FFWB 4ECYA 1S79A 1Y9OA 4HTJA 5B0AA 5D3GA 1OY9A 2LU1A 4LR9A 5D4PA 3R2CJ 2MLYA 3BO3A 3R27A 4USUA 2BW2A 1R8HA 4J7CA 3DC2A 4QBUA 1FHTA 1ZPVA 2BMBA 4DPXA 1VOMA 2CQ1A 3WX8A 2VKRA 4TY9A 5L9XA 1URNA 1WACA 1S77D 3QT7A 3MGJA 5GADU 3OL8A 4DX7A 4W92B 1VQ6S 1NXIA 3CJ2A 1BY9A 5CCLA 9ATCB 5C5JA 2VG6A 4HT5A 2GIQA 5LT5A 1RTDA 4E2FB 3MEEB 3I55S 1FDNA 1NK7A 2BV3A 5CA5A 2DIVA 4NEZA 3LQVA 4GVBA 5C25B 5IM0A 4V19J 3NOCA 4B3OB 1TL7B 3N6NA 1NK9A 5MLCV 4DV1J 4C8LA 3HVTB 1REVA 2B6AB 1HI0P 3EDQB 4DSIA 2AYEA 2C2MB 2HQDA 3GJSB 3TZYA 2ZJRQ 3X1LB 5KFYA 3TA2A 3H4DA 2UXDF 2ZWPA 1WTBA 3QQCD 4IH5A 5B0FA 3SZ2A 1FT8A 2IA0A 4JB8B 1MMNA 1RWWB 4EWTA 1KBRA 1S48A 3NS5A 2B51A 1AZSB 2OPQB 2VH7A 5KFHA 3CEDA 1RT5A 4I2QB 2OSQA 5B0BA 4ECSA 4OLPA 2JOQA 3BYPA 5CHCB 3WX4A 3KLHA 3T5HA 1HNWJ 2YKOA 3GV7B 2F8HA 1S0NA 2QA4S 1TV6A 4K7QA 1QAIA 4GC6A 1MG7A 1X31C 1RT2B 3PR4A 4OZNA 1Q5VA 1GXTA 2KTQA 2BJDA 5DGAA 2P2CB 2QLXA 1P27B 1U2RA 3SCJE 2AYBA 1HPZB 4OI2A 3JQMA 4ZK7M 3KMSA 3SI8A 2F4FA 1N34F 1ZS6A 3CDBA 2E66A 4WPAA 1IR2A 3N5BA 6AT1B 4UUXA 3N28A 3IRWP 4FXVA 5C42A 2SXLA 2W8LA 5K8NA 4IG0A 4WYLA 1RT1A 4TLQA 4AL5A 4B3RJ 4KR0B 2JVRA 3U7JA 5AXNA 5F8LA 1YRUA 4WFBQ 4M1KA 2KXNB 3RW6A 4CLUA 3OUYA 2ZKUA 2AGOA 2DYAA 2W4PA 3DRYA 2LDIA 4JI0F 2CRLA 2DNZA 1WG4A 2LQ5A 2ZH4A 4HYKA 1EIYB 4IRDA 3PACA 1HW8A 3HJFA 2DCUB 4A46A 1KN6A 5H9EJ 4ES2A 2A10A 3IG1B 3JB9k 1HFEL 2Y8WA 2QFIA 4DUYF 1PC5A 2VPXB 4DL7A 4LF5J 4QOTA 2V4JA 1HNWF 3BGRA 3ETMA 1N6QA 1RK8A 4QYRA 4KO0A 5AJ3J 4JYAF 3MPVA 2DPIA 4NXMF 5J1PA 3P6YC 1TAUA 2IRXA 3R1HA 1CBKA 2CQPA 2FYXA 4ZITA 3VCDA 4DV5J 4F26A 4F4WA 5ETRA 5FD1A 3G8QA 1V3ZA 5CZVA 2UV8A 4PAAA 1MLAA 3GPAA 1T3OA 2RKIA 4P75A 4A8OA 1YJNS 4RKUC 2KFZA 2K06A 5K14B 3BO2A 3RAMA 4DL5A 1AUSL 1F9HA 2K1RA 2YX4A 5K5MA 1JJ2R 1I94F 4QYZJ 1S1UA 2RS8A 4USIA 4ZJLA 1MROA 3MPWA 4C7QA 1IBLF 5L8RC 2FLLA 3GWCA 3H40A 3OSNA 4M5MA 1S7IA 1TK0A 1NKBA 1XQIA 2R7OA 1JLFB 4BWJA 3ENWA 3FSIA 3BO4A 4DV6F 1VK8A 4HI2A 4KFBA 4QYZK 3A3OB 1QY7A 3OPKA 4NOHA 1VR6A 2VF3A 1CJUA 4KIAA 4OHZA 1YK9A 1U6FA 3DRRA 5THWA 5IM0B 3J81Y 2WVBA 4U95A 1T3NA 3DLJA 2JDJA 4UZCA 2HIYA 2CPIA 3MD1A 4EGLA 4ZPCA 1REVB 2B6AA 2HWHA 3HHNB 1NHVA 3M8PB 3H2LA 3UO0A 5L1KA 5FLXU 4TN2A 1NK8A 1LEOA 2B4PA 2K1RB 1DTQB 5HATA 4TU7A 3JSMB 2P5VA 1A7GE 4NMXA 3PXGa 1WD6A 2L9DA 4ZS6A 4UOGA 2DITA 3KLVA 4J9PA 5C24A 2UU9F 3HHLC 4CIOA 3LTOA 3R3TA 2CPZA 1Q4RA 2WSFC 2HVHA 2Z2ZA 1N54B 3DU6A 3M7VA 2HAIA 3NNAA 2WOMB 5GMDA 1U49A 2IAJB 3TA1A 4DV6J 2DGWA 2EKNA 1UVMA 1DTTB 1G6BA 1RTIA 3ILIA 3R97A 1E6YB 4W98A 3D6FB 4ZVFA 2HS3A 3DLEA 2GV1A 1N0UA 5JUMA 5E0OA 1N88A 1WELA 5M2UA 1HNZJ 2RB7A 4U6PA 3C8YA 4U67Q 2X51A 3EWGA 2LA6A 3ZZZA 2MPUA 1UA0A 4CZCA 2BJ9A 4WFZA 1VRTB 3V5RA 4FF4A 2DR5A 3DOLA 2WSEC 4LF8J 3UDEA 4NLYA 2CQ3A 1H2TZ 2PDAA 2AEMA 3NOGA 4DS5A 4RW4A 1MWYA 5A76A 1JLEB 4DDFA 3ZTSA 2XY6A 3LP1B 2LQ8A 3T19A 1NH7A 2HQFA 2OPSB 4F36A 3W66A 1ELOA 2CJQA 2HBRB 4OQJA 2RUSA 4CO0A 2X3DA 1J27A 3CT9A 1VC5A 1RAJA 4ECXA 4P7VA 2PE8A 2IYGA 3CJQA 2D69A 3ZTOA 3GIIA 3HM9A 3QIDA 4ZVUB 2KYXA 3DGPB 1Q1KA 5ETPA 4X4UA 2V8DA 3UCUP 2X1BA 5KT6A 4IDKB 1J5EJ 2XNQA 3MEGA 1XNRF 1MMLA 2VJVA 2QMUB 8ATCB 2R2RA 2B7CB 2R7SA 1B0VA 1LNQA 3MM7B 3BPDA 2J0XA 3MM6A 1YRXA 4O3RA 4LF9J 3PR5B 1YZ7A 5DS7A 2VPWB 4F4AA 2DHXA 1SVDA 4A8FA 4P6QA 3EMTA 2MKCA 3QGIA 2W8KA 3ZZYA 2NQPA 3NCPA 1WTFA 3TZZA 1Q53A 4LSZB 3Q2TC 4NLVA 4P9SA 4FXDA 1S6QB 4NZ7A 5J2PB 1NJYA 1JXVA 3AD8C 3G6XA 1WI6A 3TAQA 5CXTA 5A6WA 1BHNA 3PX0A 1GMUA 4B3TJ 3FEXB 2GO9A 1Q0NA 3HHLB 2UXBF 2G2ZA 1U45A 4ECZA 3BS9A 3F44A 5KT5A 1IBMF 3KKFA 4CNZA 2ZZTA 2VQFF 3OD2A 1O6XA 2QYGA 3FGVA 4OHYA 4QCLA 3FVYA 1UCNA 3DLKB 2ZH9A 5HROA 3ZZPA 1K8AT 1PC4A 2B4OA 3AY0A 2LKZA 3C15A 2ACYA 4O3OA 2H5EA 1FDAA 1IKWA 3ZZRA 4JBCA 5IC6B 1YJ7A 4IO1A 2P9GA 3W5YA 3EUNA 4EYIB 4B9MA 1NMEB 3OT9A 3FDSA 2DRAA 1FJ7A 1ZAWA 4OZ0A 1QDUB 2UVUA 3TVZA 5L39A 5KG4A 2D9PA 4YY3J 3HSZA 2MZTA 2W2QP 4QQBA 1TFYA 4FS2A 5E3CA 2QE5A 2XQCA 2C2RA 2Q66A 2XI3A 3DYAA 2R9LA 1FVSA 3M1VB 2CQ2A 5A8RB 2FUG9 2R2TA 2JEFA 3B4MA 2BOPA 2KO1A 3KK1A 1S1TB 1YJRA 3AJ2A 3CWJA 3EX7B 1KOHA 2FD2A 4JV2A 1FDBA 1RAOA 2W24A 4H4KC 1UW4A 4KPCA 4KAIA 3I4PA 1MNEA 4CO4A 1RKIA 2X7IA 4DQQA 3L09A 5D0GA 4DV0J 4A8MP 2MQLA 4ELUA 4YDDB 3VAIA 3THVA 3OL9A 4LFBJ 1HHTP 1T11A 1NK4A 4IFYA 4DR2J 2R8JA 4TYBA 2J0QD 4RW8A 4ANEA 2G1DA 1RTJB 2ZBIA 1R8BA 4NLDA 1BWVA 5JJBA 4HDHA 2ZM6F 3TJ9A 5BR8J 1PIEA 3U1MA 4DOZA 4LFCF 3PJWA 3H5XA 3KJVA 1AFIA 2ALYB 2XMUA 4YHHJ 2AKWB 5G0RB 3WBZA 5DQGA 3AD9C 2Z57B 5LSOA 3Q8QB 5HP1A 4MKYA 1ULRA 4I67A 2DHAA 3CVKA 3I6PA 3EZ5A 2YKNB 3FFIA 3VVUA 3KHGA 1KC8T 4FZVA 2QSWA 5GVQA 1IKVB 5HJXA 1HWJA 4JI5J 2CQCA 1RYRA 1ZM2A 1JNRB 2UU9J 2VV5A 2AJFE 2GA7A 3M05A 1S7HA 2FHKA 4NXNF 3HSDA 3VQSA 2OEKA 3DLGB 3CDAA 3Q24A 1RWXB 1RHMB 2ZVSA 2RQ4A 3H7HB 4NLXA 4QIFA 3A1YG 3KYLA 4LFCJ 4TKTA 5D15A 2PI5A 3CMES 4X62J 1XNRJ 1FTCA 2NXJA 3LAMA 2HLUA 2ZKTA 1B0TA 1X4DA 4DR2F 2NSCA 2QA1A 4NPOA 4J9MA 5D0HA 2NXEA 2D3ZA 1S6QA 2D3OR 1SKSA 1HLWA 1BUXA 5DM6Q 3D6HB 4DX5A 4UY8T 2AZ1A 3AQOA 3VAGA 2R8IA 3RR7A 2BVZA 1FKOA 2QL9B 3CJ8A 4JI8F 5KFMA 2DH7A 5LSRA 2NXNA 3E51A 4ZIWA 2OHDA 2ZDOA 4YR2A 5HANA 4RR5A 4DQSA 4C3KA 3DLKA 4Z2XA 5HN0A 4K4XA 3NMAA 2EFGA 1HBNB 1GXUA 4R0JA 3AOBA 4DV7J 1RT7B 4ES1A 1YDLA 3RAQA 2ASLA 1R0AB 4DR6F 1G3OA 1K1QA 1IR0A 1HPZA 2R7QA 1SH2A 3PYDA 4M5HA 4TYAA 2BM1A 5BYQA 1SIWB 1S9FA 1JLGB 2YWGA 1EETB 4WWSA 3GFZA 3VZHA 4FS1A 2DNQA 3BR9A 4MFBB 5HQLA 1V5VA 1N32J 1JLEA 3O6QA 2QA4G 3J80Y 1TKDA 1GMWD 1ROFA 2V2ZA 3QYYA 4KB7A 2G0JA 4QR1A 4E8UA 4J9SA 5DG8A 2MB0B 2LA4A 2OPSA 2ROGA 4LBPA 2MZ1A 3DLBA 1P1TA 3IBWA 3QT6A 3A13A 3ITHA 4R25A 4CP5A 1FERA 4Q44A 2BJEA 4RNFA 2K8GA 2MGZA 1RACB 3LPEA 2GMHA 1HHSA 2CA9A 4UW2A 1N5QA 4LQ3A 3OTCA 3FMBA 1Y5IB 2APOA 2C42A 3D0IE 5AE1A 4QWAA 2OAUA 3DDKA 1U1PA 4IR1A 1NEEA 1OQ6A 2QN6B 1U02A 2V67A 1CJVB 5BXIA 1XMBA 3CTRA 1TKXB 3JQKA 2YNGA 2XGQA 3VAMA 1BD6A 2HEKA 5E41A 3OLBA 1QVGR 1B64A 3C3LA 1FX4A 4N56A 3VV2B 2W7PA 2D3UA 4B3SJ 1SV5A 3K5OA 3VAKA 3NY0A 3PX6A 4I64A 1B0PA 5KG6A 2DNPA 3HKWA 5KFXA 1TVRA 4NCBA 1ZBTA 2RSQA 3CJTA 3EXYA 3Q23A 2QEXS 3W8GA 2W9CB 3PHEA 3PIPQ 3BN7A 3VF0B 1CJTA 4I7FB 3HVTA 1D8ZA 5GAGI 4BBYA 2AP6A 3PDNA 3H2VE 2CPEA 3IWLA 2E1PA 3QIPA 3I0RA 4WE1A 4O3NA 3T41A 3T6JA 3UFCX 3RB6A 3LANA 2QYCA 1RHRB 3DXBA 3R5BA 4U7UK 1KONA 3RW7A 2E9ZA 4ZLJA 1U1LA 3MWBA 3P49B 1IKXB 1FEEA 1VBYA 4RW9A 3P8BB 1F2HA 3MDFA 4J5OA 1HWIA 4KSEB 3ISZA 2N7YA 4IKAA 3UCZP 2F5GA 3D0GE 3CCUS 2A2CA 4USJC 3OTOF 2WVDA 4CQ1A 4CM2A 1FKOB 4OFZA 4EMDA 1RAAB 4C2MA 1RWKB 2XHCA 4XK8C 5F0UA 3JTNA 2KJVA 2QTWA 4O3PA 1DHMA 4DL4A 3C2PA 3KG0A 5A0YB 4WIQA 3RRKA 1NDPA 4PWUA 2UUBF 2VOOA 4OJ1A 1FJEB 1RSCA 2K3KA 3H5SA 3JQJA 4LF6J 4G1IA 2JEJA 4B3OA 1LWXA
chains in the Genus database with same CATH topology
1S1WB 4OI4A 2MXYA 2WRMA 3GG1A 3ICLA 3IR7B 4TXSA 3MR3A 1IJEB 2WONB 3DLEB 3LOUA 4WTYA 3W2VA 4ZHRB 4I6WA 3DCAA 1JXLA 2XMVA 2V8HA 2J5AA 2XG8A 2IAJA 3NNCA 2FJAB 2Q6BA 3K8WA 3MECB 3IO1A 4CH1A 2AJ0A 2LDYA 2JSXA 1Q81T 1S6UA 3UQSA 3DLHA 3V4IB 3S1TA 2M9KA 3VAHA 3CC7S 4YB7A 1O0PA 2AF6A 4JI6F 1RTHB 2OLWA 2MKIA 3SEOA 1Y7PA 1M0SA 1UVJA 2FHOB 3BSAA 4ERDA 3H20A 5L1JA 3JAMY 2PI4A 1UVLA 1CG2A 2ZOFA 4F4KA 2B7BB 3G96A 5IT9Y 1IBKF 2YKAA 1SJ3P 1M5KC 2AQ4A 3QZ7A 2P6TA 2YNFA 4ED5A 2I38A 2UZAA 1ZH5A 3IAM9 2DNKA 4TU8A 3TARA 2QFJA 1U26A 2VFSA 2AU0A 2B5JA 2F1FA 5LXYA 2IM3A 3OL7A 1M1KT 2HHUA 1V6HA 5LSLA 2U1AA 2VC0A 3NWGA 3T9ZA 3CDEA 5L9NA 4J9NA 5FDLB 2DHGA 2PO4A 4F8RA 1DAXA 4ECQA 2HFNA 4DV4F 1D1UA 5F41A 4BHQA 4L3NA 3U27A 1HI8A 3GB0A 2MQNA 2VFTA 2HZCA 3JSBA 2XLIA 4DSEA 5GAEU 3HDSA 5H1SV 2IRYA 3DRSA 1HWUA 1YQHA 2LLZA 4N77A 2J6UA 4X62F 3AJ1A 3UR3C 1KSPA 4X4OA 2JX2A 2KHDA 2B5JB 4ZPWR 2RILA 3F73A 1OIAA 2U2FA 4HKQA 4C8NA 1WI8A 1F0XA 2KFYA 2D41A 4E98A 4C4WA 3DDNA 4WU2A 1Z1ZA 2O67A 3ZC4A 3CDUA 3J7YU 4UQGA 1H2UX 4JI5F 2CJBA 1V3SA 2ABYA 3QJJA 1QAXA 2A2DA 4F3OA 1HD1A 1MU2B 3KK2B 3MR2A 5CYQB 3MZIA 3HHEA 1BLUA 4JI4F 7FDRA 5IXUA 2DHSA 4EZ9A 1TUVA 4GC7A 1C2PA 5F8IA 2HHTA 3S7RA 4C8MA 2FIUA 2YNIA 3MM9A 1PGZA 2BANB 5E5NA 3Q8PB 4IRKA 3KLEA 3MMAA 3OVBA 4QWDA 4DL3A 1CC8A 3CCRS 3JTPA 2ZHOA 2B4VA 4H4KA 5KFQA 2L3MA 3V81B 2PA3A 4FPRA 1TL5A 2FHJD 3PEJA 5LL6d 1UVKA 2E29A 3OR1A 5KFCA 5I3PA 1HNVB 2F7VA 2BQRA 2NS1B 2WB1D 4QU7A 5E3AA 4DJBA 2WBRA 1QAYA 2B56A 1HNIA 4DLEA 2OFHX 3N4WA 3OHBA 1ZM3A 1HMVA 3V6KA 1X4FA 4EBCA 4IOCQ 2CPDA 1DARA 3P96A 4TU9A 1TP7A 2ATLA 4WXOA 2L9WA 2R7WA 2VG5A 3RAXA 4DHVA 3KFWX 4OZ5A 2BXJA 2GJ2A 1KLNA 3DOLB 3UD3P 2VG6B 2JL9A 1RQ0A 3M9OB 1FKPB 4CO2A 1GNKA 2VBZA 4KHRA 4MH8A 4RNHA 2FJVA 3FFIB 2NSBA 1LWEA 1L3SA 1T05A 4B9SA 3JSYA 4FVCA 3T3FA 3OTEA 1RYSA 3KTQA 4IH7A 1K9MT 4C0BA 3CB4A 3M32A 3OLAA 1UVNA 2VG7A 2YWFA 2OO4A 3L7OA 1GQEA 4JV1A 2QZ8A 1QLNA 4HH1A 4OV1A 4DG1B 4PUOB 4R8UB 5HROB 1S49A 3IWXA 3SXLA 2IM0A 3T5LA 4ELTA 1A6LA 4N5SA 3MTKA 3MUTP 4ID5A 5F3ZA 3NAHA 3UWTA 1LXJA 4LJMA 3OFGA 1P1LA 1T02A 4I69A 2CPYA 5KG7A 5C42B 5I3UB 3I32A 3GIMA 2QV6A 1VK3A 2PIIA 4ED3A 4BC7A 3PRBA 2XS7A 4QWBA 2C3YA 1JK9B 4B17A 1URRA 4DV0F 1FXRA 2HFOA 2EG2A 1V3RA 2LQ9A 4PXEA 4DV7F 4FBUA 3DI6A 1Q82T 4DN0A 1KOOA 3IS9B 1DQAA 4HVZA 5K9FA 1SL2A 4ZPAA 4LF7F 5GAGU 1WHWA 5I3UA 3MCSA 2J9EA 3PW4A 5FIIA 2NZ4A 4HL9A 1JIHA 2XWXA 3GFXA 1L3KA 2VQEF 3OBIA 1WHVA 2Q6CA 2FHJA 3HF5A 4LF8F 5BYRA 2CPHA 2B9YA 2W4DA 1FEHA 2VD3A 1T03B 4JI7F 3LGNA 2WBMA 1HMVB 1DQ9A 4KTQA 3Q0AA 4XDCA 3PV8A 2FB0A 2FVPA 3LP1A 4K4VA 1KFSA 5F3TA 2MGZB 3GE9A 4N8NA 1LV5A 1MROB 3WZ0A 1YIJS 2ZNZA 3HP6A 3CD7A 4ED7A 1X8DA 1Y3KA 3QJLA 4O3SA 1HYSA 2MY7A 1OQ3A 4X2BA 1QSSA 1UEVA 2RQKA 1XBWA 3POTB 3MF5A 2IM2A 1T95A 5GAHI 2RQCA 2A3JA 2YKMB 2LEAA 4L6V3 2IHR1 5L38A 3IRXB 1FDDA 3KK3B 2Z8QA 3MM5A 4B9NA 3JSMA 2ZH8A 4ZCKA 4CNYA 3FJ2A 2RIJA 1M5VC 1HR0F 5A6PA 2FGOA 3M9NB 1HBOB 2OPPA 1X5SA 1NKEA 5AXMA 5D78A 2FLPA 2LMIA 3CDWA 2LYVA 2OPRA 2CQBA 3GR1A 4IFVA 4A8QA 2YY3A 3SSSA 1KLMA 2VB6A 1C4CA 2K7JA 1LFPA 2AX1A 4K5SA 5KG2A 2Q43A 2KYZA 2RDJA 4LIRA 3S8SA 2CQ0A 2VPYB 1VIXA 2F9JA 2D74B 1NO8A 4AUKA 3K8VA 5K8PA 4I56A 2HS0A 4PPZA 5KG3A 3TUIC 4QPXA 4M5DA 1QE1A 4URSA 1P6TA 5HQ8A 2C2DA 2NREA 3GV8B 2DNOA 2XMTA 1D8YA 3DMJB 4QR2A 4X4SA 1N5VA 4DSLA 4Q7AA 1R8AA 3ZZUA 2OJ3A 4Q2MA 3MECA 3NGDA 3M9MB 1K0VA 3IS9A 2PMHA 3W2WB 3RTVA 2VFRA 2QA2A 2IRUA 2VG5B 1YSJA 1SXLA 4PWDA 2ROEA 3KK1B 2XGPA 5GAEI 1X0FA 3RBDA 3CJ0A 3JSRA 2X1AA 2VODA 1NJIT 3UE2A 5D77A 4NYZA 4B3SF 1FF2A 2HNDB 3NAIA 5D3GB 4DS4A 2OTJS 2OD6A 3CD5A 4RX6A 1FVQA 2J76E 1ZOTA 5HLFB 1LXNA 4Q8FA 2CJ9A 4MK8A 3BB5A 3TVYA 4DR1F 3W2WA 2QMWA 1CSJA 1LWEB 1U1NA 2IJNA 5A8KA 1XTZA 2QT7A 4YR0A 1DZ5A 1KHWA 3MEKA 3THTA 3MR5A 1KTQA 1R7IA 4Y28C 3SDEB 5HP1B 4RNOA 5L1IA 2UUTA 4XO0A 1VQ9S 2EI5A 1Q78A 4NZ0A 5KT2A 4RUAA 2AV5A 1SJFA 2IMOA 1K1SA 4I68A 2ASJA 3LP2B 3MPYA 1NRKA 2FC9A 4KKOB 4ZP6A 3UCGA 1R8PA 5B7WA 1C0TB 3MOZA 2ZD1B 4I1TA 2ASDA 2AYGA 4Q45A 4CO5A 3G71S 4H4OA 1DQ8A 2ZDPA 2XC9A 4WF9Q 1TKXA 1N5TA 2KJWA 4KE5A 4IYQA 4WCEQ 3O1LA 4KPYA 1HI1A 1F5BA 3DM2B 2YH1A 5F8MA 2WMMA 2Q79A 1N32F 1AFJA 3MM8A 4YB5A 1SJQA 2HWIA 3G8TA 4F3MA 1JLQA 2G0CA 1O51A 4ID8A 3FEYB 4JV5F 2IJFA 1X4CA 1ZETA 4MKBA 2IBKA 4ELVA 5EWFA 4BWMA 2FHMA 2RJZA 2XMKA 1NKCA 1JLAB 3M6VA 3M2VA 3NMRA 2UUWA 1KQKA 3VALA 3K5LA 2V4RA 3I9V9 1YRTA 2G9OA 5E2QA 3SFUA 4KJIA 3J7A1 3PRDA 3I0RB 4WE1B 2DCLA 4C8KA 2AJ1A 4K50A 1RA7A 3CMAS 3IXQA 1BWEA 3AA8A 1FRHA 1A9NB 3CJKA 3ENVA 4R5PA 2YNIB 6FDRA 1MMDA 3OJSA 1GAOA 4BS2A 1HQEA 4K4UA 1H7WA 3LWMA 2AYMA 2XS5A 4Y2MA 3DRXA 1SQEA 4NRUA 2BRLA 1SUQA 2KXFA 5EX3A 5KFZA 4HDGA 3TAPA 3M2VB 4F25A 5CXTA 2B9XA 4QIGA 3WC0A 2HHWA 2W7OA 1E6VB 2MHNA 2HQ3A 3MI7X 4Q8EA 3FSYA 1JLCA 4J9LA 1S1WA 3TRGA 4PG8A 4NLSA 2ZH6A 1UFLA 1XMQF 1VQLS 3L95X 3OQ2A 4EO8A 2WTFA 1FESA 4HHJA 2PT0A 3HZGA 3CCZA 1QUVA 2QIFA 2KH9A 1Q7YT 2GCFA 3VZIA 2J8AA 4QIVA 5KFFA 4PQAA 3GIJA 1VC0A 3BSOA 1ZTWA 1N8RT 2AW0A 4WU3A 4C8YA 1RT6B 5KOWA 2JEGA 3PW2A 1GXLA 2F40A 3UDCA 5SUHA 4O4GB 2VASA 2D1CA 2DT9A 4Y3CA 2UP1A 2DGSA 2RRAA 2OPPB 1UP1A 2RDIA 2GC8A 2ILZA 4G1QB 4A8KA 1S1TA 3KOAA 2LECA 4I4BA 1X7VA 1OSCA 2JZ5A 5AJ3F 2HYIB 1S4FA 2E1RA 4IFVB 3SMZA 2HG4A 3M8QB 2F9DA 5CD4H 3C6TB 1CQNA 2KI2A 1WEYA 1S1XB 2YWKA 2MKJA 1NHUA 3IA0A 2JWNA 4HI1A 1KR4A 5H9FJ 4X4TA 1SIZA 1VQSA 1Q79A 2HRYA 3MM6B 3VR1A 5HO4A 1FD8A 3CUNA 1BQMB 1WEXA 2NXUA 2PSZA 5DJBA 1S97A 2HS4A 4NZ6A 4ZPVR 5LMUF 7FD1A 2C3MA 3H5YA 5B08A 4IOAQ 2GO8A 1TKTA 3DRPA 2AX0A 2EBGA 1GX5A 2UVVA 4B3MF 4XIUA 4YFUA 3RU0A 2F8MA 4KQZA 1T8EA 1S1VB 2E44A 3FQKA 5KFSA 2E9RX 4X64F 4IG3B 4KBIA 5J2NB 2W9BA 1S1XA 2A1BA 2DGTA 2UXCF 3OL6A 4XPEA 4K4SA 4GO7X 3I0SA 5D4OA 4WJBA 5DLGA 2B4UA 2JJ4D 5DLFA 2C22A 3LUYA 4LIWA 4OJGA 2HGMA 4J9KA 1CLFA 3OR2A 1S9EA 2RVJA 5B0DA 4QWEA 4DBQA 1RT5B 1Y4ZB 4GO5X 2RRBA 2ROPA 1YWXA 1AXQA 4I2QA 4M8LA 2MJUA 2KM8C 1Z2LA 1TL4A 3PJXA 2AJ4A 3TA0A 3D2WA 2ZE2A 2KVIA 4RW4B 3I5CA 4DR4F 4CI0B 3TX8A 1RT1B 3RZAA 2XO7A 1KFDA 2LXFA 3CCES 3SSQA 4EFAC 1O5JA 4UOCA 1T03A 4URGA 2DH8A 3ZZ0A 2FC8A 3HLUA 4MIAA 4J37A 3AQPA 2DGQA 3FCHA 3I87A 4NA2A 2RMLA 4J9QA 4DV3F 3MUMP 3OTBA 4K59A 4QIWD 1U6ZA 1M5HA 1XMOF 4OZ1A 2V4JB 3GV5B 1C0TA 3G4SS 2H9ZA 3V81A 2EC0A 4K4YA 4DSFA 2XZWA 3BR8A 2KKHA 3OFEA 2HHVA 4ZP9A 4NCGB 4WFYA 3SQGB 4Y2AA 2MMYA 4RUCA 2MQMA 3M8RA 3IFEA 2O5DA 1FJGF 1SH0A 5F8HA 2PEHA 2EVZA 2OFGX 1ZZFA 5CH7B 2B43A 2POKA 1S6PA 3GG0A 2PC6A 3IC1A 2XB2D 4DL0C 1DTTA 1RTIB 1JKHA 1X5PA 2MDAA 2M3DA 4O44B 4ZVGA 4I6YA 2KG0A 5K8OA 5SZTA 2QRRA 2L41A 4GKJF 4B9UA 2KN4A 4DFJA 1OPIA 4K2XA 2YNHB 2CJAA 1M5SA 4Y2CA 2FVSA 4FXWA 4OL8A 1X9SA 1N0VC 5DRKA 1K0TA 2RT3A 1FJCA 1FXDA 1FO1A 4OI1A 4QWCA 2R7VA 1GH8A 4ALZA 4ZKAA 2JHEA 1YJVA 5DM7Q 2IBOA 1IXKA 1SKRA 2PFFB 1VLYA 2D9OA 4YEAA 4X66F 2V9WA 2C28A 4DFPA 3CCWA 1TKZB 2E1AA 2GX8A 4W90B 3CIMA 1Q8LA 3V4IA 2R4FA 3MXHP 1U1OA 2EPIA 2EFNA 2YQ3A 1XEZA 3LP0B 5IQQA 5DETA 5JVGQ 5J2MA 2M4MA 2NLWA 3T1HF 2CKWA 3B82A 1NK5A 3RRHA 4QIEA 1SL0A 3U1LA 1OSDA 1HQUA 4PRFA 1MWZA 3BGUA 1DLOB 1KQFB 3V6DB 3KHHA 4PKDB 3NG8A 3TI0A 2JLGA 2HNZB 1RTJA 4C3LA 3I96A 3NL0A 3E01B 3PKYA 1YBAA 1YI2S 5FJ4A 1X9WA 2FJEB 4DV5F 1UAWA 2XWYA 5DG9A 2OP5A 2OD4A 4X4VA 3K2YA 2P9CA 2YWEA 1C1CA 3DOMA 5KFPA 2ZOGA 1P9QC 4NLRA 1Q7LB 2XBPA 1PILA 1D9AA 4FF1A 2MJNA 2WCXA 5A8WA 4PG4A 1VQ4S 4B3TF 4MTPA 1NK0A 5KAKA 4EZ6A 4Z37A 2KXHA 4Q43A 1QVFR 5U47A 4NL5A 2WK4A 2IFXA 4ED1A 2DRBA 3G9CA 2MSTA 4ZCLA 1J2VA 2ZHBA 4IDKA 1C0UB 1VBZA 1W25A 4TNOA 2M0GB 2COLA 1KRPA 4ED8A 3MMBA 1TR0A 2EK1A 2N82B 4C11B 2ZH2A 4MMOA 4NLQA 4OMFG 2KB2A 2DK2A 2KHCA 3PW0A 1FNMA 1S1VA 4L72B 3JYTB 3DRRB 2W7AA 1X4GA 2V4QA 2V8GA 2M8DB 2HHPA 2XMMA 4WK1A 4OX9F 1H2VZ 4ZA1A 4I7FA 2XCPA 1RT3A 3M2UB 1W2IA 1VMBA 2M5YA 1U09A 2B3TB 1KS2A 3OVAA 2DR5A 2VL1A 5MAOA 1N48A 4M94A 4DG1A 2RQMA 3I31A 2AJQA 1CEZA 3DM2A 3TANA 2XSJA 2DBBA 1Z2ZA 1VBXA 3MM9B 3ISND 2ZOMA 5F8JA 2UVRA 2VBWA 2HHQA 1TL3B 1D9DA 3DMJA 3OVSA 3AB4B 5DG7A 3AHPA 2C3OA 4MFBA 5CZXA 1JLAA 3KLIA 2O3DA 3M6WA 3M30A 2HPUA 2CDQA 3OR1B 1YJWS 2ZJPQ 2R7UA 1YJUA 1GT8A 2EW9A 3VQTA 2W4CA 4QPTA 2J9DA 3AAWB 4ZPBA 2NR0A 5FLXY 2J0WA 1UWBB 4DN9A 1WNEA 1RA6A 5DQIA 3EPGA 3SYZA 2G13A 2IC3B 4IQXA 1S9GA 3TP2A 5J2QB 3D1QA 1XC9A 5KFNA 1FNXH 4Y2KA 1S0OA 2DR7A 5E3QA 2MZRA 2ZH3A 1FXLA 3I5AA 4OX8A 2Z2LA 2A18A 4FNHA 4YB1P 5I42A 1ZYQA 1G2EA 5IQ6A 4RW7B 1AW0A 2QMXA 2LEPA 2F4VF 4C97A 2DJWA 2ZZMA 1KVIA 1L3TA 1HBMB 3CJ5A 3LALA 4ZPTR 3LPYA 3CF5Q 3FZBA 2EWHA 2BRKA 2UUCF 3MMJA 3TUJC 4V19X 1JLCB 3CD6S 4A48A 1FCAA 4AFFA 4WK3A 1VRUB 2EFQA 4K5RA 2DR8A 1R31A 5J2QA 4LVNP 3OHAA 1JX4A 4X4QA 5B0CA 4ED2A 3MD3A 2ALZA 3FQLA 5KT7A 1T7PA 3QWPA 3RB0A 4ED6A 2VG7B 4DFKA 1GTEA 3E3XA 1JMTA 1RT6A 2YKNA 2DH9A 1DRZA 2HW3A 5HI7A 1VI7A 1FRLA 2BE2B 3M6XA 3PM9A 4PG7A 4YHHF 1C0UA