1GXLA

Smc hinge domain from t. maritima with coiled coil
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
KEKRLREIQFEKEMIERDMREYRGFSRAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFLKQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVVETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGGREERSSNVFERRIKLKHLEQEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Architecture of Smc Proteins and the Yeast Cohesin Complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Chromosome segregation
molecule keywords CHROMOSOME SEGREGATION SMC PROTEIN
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06470 SMC_hinge SMC proteins Flexible Hinge Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.20 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1gxlA01
3.30.70.1620 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gxlA02
1GXLA
chains in the Genus database with same CATH superfamily
2K3KA 1CJKB 1FFWB 3QIPB 4KC5A 2J6SA 2FB0A 3OFFA 3QYYA 2Q66A 1SB6A 3OLBA 2WSCC 2B4VA 1D09B 3E51A 1NJWA 3NGKA 5HATA 2UXBJ 2GO8A 3TA1A 2KYXA 1HWUA 2CPHA 2GGPA 5J2NA 2OMOA 1UPPA 1ZM4A 5KFXA 1T3OA 2DY9A 2E66A 3DRRB 1YZ6A 3H2VE 4ZP9A 2OMLA 5LJ5Y 5B09A 2BE9B 1DLOA 4QWAA 3KMSA 1HHSA 2MLXA 3MM7A 1LXJA 2QIFA 3WQPA 3J81j 3LQVA 1OYDA 2DH7A 2QN6B 1RTDB 3A8KA 4FBUA 4U95A 2KXNB 4B3RJ 2JZ5A 1U1RA 2LKZA 4MK8A 2O01C 3ILIA 3Q8PB 2DHXA 3T1HF 5DS7A 5JMNA 3L7UA 4RW9A 5LMUJ 1TZ0A 4Q2MA 4NWBA 1W2IA 3EPGA 3OHAA 4EFAC 3LOUA 2KL8A 2BJDA 2FZKB 2GW8A 1O5JA 2LCWA 2LMIA 5DQGA 1C2PA 2V6AA 1NXIA 2JJ4D 2PFDA 3W5XA 4B02A 3T5KA 1NB7A 3HFVA 5ETVA 2C2ZB 3VGVA 4PWDA 4NI2A 4URGA 1BLUA 2GVZB 3DLGB 1RYSA 4K5RA 2HW3A 1T9XA 1UAWA 3V6DA 3C16B 1KVIA 3QRRA 5KT7A 3ZZYA 1VRUB 3QFWA 4KRWA 1VJQA 2JH3A 2V67A 2WW4A 3ENWA 1WOOA 4HTJA 3OL6A 3G8TA 2MDAA 4GKKJ 1GMWD 5HBMB 1QUVA 5DDOC 3R7BB 3GILA 1KBRA 5D8HB 2GQ2A 2GJ2A 1QE1A 4HDHA 2COLA 4RW8A 3SCLE 2DR5A 2NPIA 1SC4B 1LWXA 3UVJA 1RAJA 5KFFA 4ED6A 3QQCD 1HNXJ 2KT3A 4LVOP 3KLGA 2RRBA 3VAKA 5KFIA 2L3MA 1ZTTA 2GCFA 1N5QA 2OPPB 3MZIA 3P45B 4ZJOA 1TKXA 4GC7A 1O0PA 2HQFA 4Q7AA 4IR9A 3V4IA 4I69A 2V2ZA 1RWOB 3R5AA 3NMRA 5KT3A 1S6OA 1Z2LA 1NK7A 1RTDA 3GSDA 2CKWA 1RP5A 4WPAA 3RUBL 2AGOA 4USTA 1ACMB 1FF2A 1KTVA 3AA8A 4M5KA 3S01A 1S4FA 4NLGA 3MOJB 3JAMU 2WVBA 4ZVPB 3TW0A 4ES3A 1NDCA 2CQDA 2MJUA 1HNIA 1HW9A 4LSZB 3O8WA 1TL4A 4OYAA 2Z2YB 4CTAA 1I51B 3CCES 2BACA 3M2VB 4C2MA 1JJ2R 4HHHA 3UCGA 3NGSA 4IH6A 4M1KA 2VBYA 4UW2A 1D8YA 2IJRA 1NO8A 3J80Y 3CC7S 4OHWA 3NNHA 2MQPA 3TZYA 3S7RA 1MG7A 1YJUA 3W9HA 1U2CA 2B6AB 2V8HA 4ZPCA 2RD5C 4TLRA 2D7SA 5DG9A 3N6LA 1KSPA 1DFDA 2M9KA 2DNKA 3VALA 2OSRA 3NCQA 1HNZF 5H9FJ 2GHPA 3CDEA 1C4CA 1PKUA 1C0UB 1S57A 1WD6A 4J37A 4MIAA 3SFGA 4XPEA 3EPIA 2BW2A 2BOAA 2VG6B 5D3GA 2B9WA 4IFVA 5KAKA 2R7RA 3IAS9 3BM7A 1SQEA 2W7PA 2E7VA 4C8MA 2DGSA 4PG6A 1SV5B 1TL5A 4E98A 4IH7A 2Y1JA 1C0TB 1AFIA 4XO0A 4TVAB 3H59A 3UDVA 2DYAA 3BDEA 1SC6A 2OTLS 2I6WA 2MMYA 5CCLA 5GAEU 3MM9B 1WI8A 2YPYA 1U47A 2ATCB 2MQLA 3KJNB 1K1QA 1FDAA 3HKWA 4A48A 4HLBA 2Q1LA 4NYOA 3L7OA 1V6HA 4XDDA 1HA1A 4QWEA 1HD0A 2FY8A 3CD7A 2ZOMA 1UA0A 1IR2A 2LU2A 3L9ZA 4YB1P 4K4YA 4ANCA 4ILLA 1N5SA 4C97A 4DN9A 4IG0B 1WC6A 3DOLB 4MFBB 4IOBA 3FBCA 4EZ9A 2CQBA 3K8VA 1ZOTA 4EO6A 4YHHJ 1U8SA 4CO4A 5KG1A 3FSIA 3BR9A 5BJRA 3T1YJ 3NNCA 2D9PA 2AKWB 2DNGA 4KIAA 4UUWA 3CIMA 2HGMA 3PW5A 2LDIA 3FK4A 1ZS6A 4NOHA 4EU0A 4QYZJ 1UTAA 4CCHA 1R43A 2XEXA 3DMJA 3J81Y 1TKTA 2HRTA 4N8NA 4OV6A 2K3IA 3UN2A 1FK9A 3VGUA 1MSWD 2POKA 3M9MB 4PEOA 4F0KA 2GMJA 3QT6A 3NEKA 2ZE2A 3I31A 3G8SA 3WX8A 4GC6A 4NX9A 3TX8A 1OO0B 2PA3A 4WKRA 2LFVA 2VOOA 4UT4A 4KT0C 3F44A 4TY9A 3RU0A 1FD2A 3UR3C 2Z56B 1VRTB 4M5IA 1TAUA 2B6AA 1JLAB 2AYEA 3AA9A 2DVIA 1N54B 2DNZA 2VICA 5J1NA 2CJQA 4NLOA 2W2OP 5J2PB 3ITHB 2XO7A 3C8YA 4MYUA 5I3PA 2ZBCA 3G6YA 4JI1F 3MEDA 1FO1A 1HQEA 1U6ZA 4A46A 2F4FA 3KWMA 3AB2B 3H4BA 1U45A 1FESA 5HP1A 3T41A 1PJ6A 2YVSA 5F8IA 1S76D 1ZAXA 2XS2A 1JXEA 1Y3JA 4KFBA 2MQQA 4CP5A 3PVXA 1N5VA 1HQ2A 1N0UA 5D4PA 4N56A 5DZ6A 5D0EA 2R9LA 1BY9A 1C1BB 1ZM2A 1EETA 4O0NA 4N47A 2VU5A 2R42A 3UWTA 1H3DA 3WZ0A 5KFHA 3KLEA 2ASDA 2GMLA 5E33A 2RQ4A 2CFXA 4DV6F 4DQIA 3CDWA 3LF0A 1FWKA 1GMUA 1FCAA 4DV5J 1RT5B 4OZ2A 3CJTA 5K8PA 2D3OR 1WF1A 5EUHA 4UOGA 4BS2A 1Z2ZA 3TJ9A 1FWPA 2BJ1A 1B7FA 3MUTP 4B3OA 2EKYA 5KFGA 4M8LA 5D15A 3QIDA 4I2PB 1S1VB 3N5BA 1HYSA 1C1CB 2C42A 2I8EA 3BBCA 1XBWA 1KWMA 1EP4B 1WC0A 2FJAB 2V68A 1MLAA 4ZMMA 2C2OB 1LFWA 1S77D 1WI6A 1RKIA 2QMWA 5C42B 1I1GA 4DPUA 1TMMA 5GAGI 1D3WA 2HVDA 4QW9A 1U7LA 3K5MA 4AL7A 3KLFA 4WZMA 4C8KA 2DNMA 3W60A 1U0HA 4B3SF 1S1XB 4NA2A 4ECWA 3M2VA 1JIHA 3IS9B 3OT9A 3GP9A 1JMTA 4M63A 3K5LA 1XR6A 4ECUA 2E5HA 4L3KA 1RWXB 2N3LA 2IRUA 4RBVA 3T5JA 4NLRA 1HHQA 5AXLA 3M8PA 5C25B 2W4PA 2QL7B 5F3TA 3MUVP 2YH1A 4O4GA 4JI7F 1X4EA 2CUYA 2MKYA 3MMJA 3R5JB 2NLWA 5DDRC 2I9SA 3JSMB 4HKQA 4Q5VA 3PYGA 2BM1A 2WTFA 2P6TA 1P6TA 1X31C 3VAHA 2FC9A 1JQGA 1UP1A 4F2SA 3FMBA 4ENOA 4IRDA 4P10A 1R6VA 2YY3A 3MEGA 5HI7A 4DI6A 5HVHA 2IA6A 2AP6A 2XWYA 4PUOA 3HDSA 4GVBB 3I0SB 2IM3A 2W9BB 5F8LA 4F25A 3FFIA 2D41A 1Y0HA 3DRRA 2QLFB 3CCSS 2IVYA 3D66A 5ETTA 3R7NB 3L4BC 4WF9Q 2HNZB 4RNMA 2E44A 1GQEA 1CS4A 2XGQA 4J7CA 3MAAB 3SBMA 4LF6F 2BANA 1NJYA 2CQHA 2QSFA 5LT5A 1Q78A 5GADU 3NGRA 4QR1A 4Q44A 2PFFB 2RDJA 2CJBA 1MN7A 3FJ2A 2DO0A 2K1RA 3KHLA 4C0BA 5LMNJ 3K0JA 2AJ2A 3PACA 4XDCA 2HBRB 3GPAA 2A0FB 3PRVA 4GVLA 4NLSA 2VJVA 4J9QA 2JEGA 4YB6A 3B78A 1DZ5A 5KG2A 4NLTA 5D4LA 4K4ZA 2MY8A 4G1QA 3OXLA 4DFKA 2DXDA 3MF5A 1VK3A 3MMCB 4U7CA 1NK0A 3AAWB 4RR5A 3M8SA 3HVRA 4DR3F 3QNWB 4FYXB 1OSDA 1IM6A 2J9DE 3R27A 1VJWA 1EX8A 3TUIC 3BZQA 4LMZA 2AYBA 3MCNA 1NB2A 1N4LA 4LQ9A 2V2KA 1VQKS 2UUAF 2L41A 3DDNA 2XY6A 4FF3A 5KG6A 3IS9A 1R0AB 2CWKA 2DHGA 1AA1B 5C24A 4J9PA 2V4QA 3WBZA 4DX6A 4P2MA 4YB5A 2L48A 2R7VA 1FKOA 2QMXA 1S6QB 3H2UB 1PYOB 3HD2A 3PYFA 4X62F 3ZTPA 8ATCB 2W9CB 3PO5A 3CF5Q 1L3UA 3CJ3A 3C15B 1RU2A 2L9NA 1IBLF 1LWEA 4CH1A 4ZJQA 2GA7A 3DHWC 2XLJA 1VBZA 4B17A 2VB6A 4TXSA 4YR0A 4TQRA 2M3DA 1UMJA 1WKKA 2YQ1A 4QU7A 1TR0A 5I42A 2UUCJ 4ZPDA 1TVRA 1UWBA 2NXJA 4O4RA 1FRIA 2KM8C 2RF2A 3KG4A 1WC4A 2V94A 4RUBA 3FZBA 4PUOB 2QMUB 3HULA 1IVZA 2XMWA 3KNGA 2PT0A 2NREA 1E6VB 4UUXA 5A8RB 3PKMA 1U1MA 2OPPA 2QLJB 1OMSA 4K59A 1M5PC 1S1UA 1XTZA 1B99A 4F0MA 3DOMB 2BKOA 1QAIA 4ILMA 3MM6A 2FY1A 3E01A 1N0VC 2DIUA 1JX4A 4ZP7A 2ROEA 4QOTA 1NSAA 2OHDA 4Y2KA 1TL3B 1FHTA 1OIAA 3M6XA 2KH9A 1R7IA 4Z7CA 1OPIA 1GXUA 3M9NB 4DUYJ 3J7AN 1S1UB 2WK4A 3SDEB 4DL3A 3AD7C 2RUSA 4QBUA 3HLUA 2KVIA 4DCJB 2XO6A 4IQMA 4BWMA 5EWFA 1ZPVA 3EJMA 4ED2A 4CLYA 3VVTA 4BLGA 5E7OB 4ZK7M 5HN0A 1H7XA 2LQ9A 3KLHB 1CSJA 1PYTA 1Q95G 4DUTA 1QDUB 4JI3F 1DTTB 2GVDB 3E8OA 3R9LA 1PG5B 2KN4A 5ITHA 2ASYA 1N5TA 3WIUA 5H9EJ 1CJTA 3BYPA 4I2PA 1PSDA 4JI5F 2R4FA 3A4TA 3HHKA 3DGPB 4BC9A 2ASJA 4WIQA 4A8WA 2BM0A 1RTHA 2RRAA 1Q5VA 1KOOA 5E3PA 4YS2A 2CJXB 3CJRA 4LRAA 1IKYA 2GIFA 2F4VF 4X64J 2DGOA 4IDKA 2PMHA 4RWWA 1LW0A 4BBYA 3GIRA 3Q8RB 4ELTA 4KSEB 2AJQA 1HARA 3CB4A 1NK6A 3A3NB 3H2LA 4M5LA 1T9WA 2DISA 3K5NA 4V19J 3HHDA 5J1EB 5CYQA 3JTOA 4LJMA 1HR0F 1VMBA 1S6PA 1YSJA 2M88A 2JEFA 5A8WB 1RTHB 2B8QA 2W1BA 1FJGJ 2QLBB 3PX4A 2QLXA 4CLUA 1FNXH 3H5YA 1MWZA 2HVHA 1FI4A 1KQKA 2VC0A 5J2NB 3W2WA 2O5DA 2HNYA 3AJ1A 2BR0A 2Z2LA 2YKQA 1D9FA 3I0SA 2W9BA 4IFYB 3OTBA 1H2TZ 4ZLNA 2AMCB 5I3UA 2YKMA 1X8DA 3LWLA 1U26A 5ETQA 3UD5A 2E5IA 3BREA 2XMMA 3E01B 4CLSA 5IT0A 3NRBA 1BQNB 5LXYA 1NZAA 3VQSA 4KO0A 2LYVA 5GMDA 3MAAA 5F41A 1O8BA 5HK4A 1KLMA 4IH5A 3UO0A 1M1KT 4CO5A 1VRQC 2HG4A 2QA2A 2FUG9 5I4MA 3DYAB 4F4KA 4R0EA 1DQ9A 1VQ8S 1WOSA 2W01A 3DRPA 4HTIA 3BKUA 2W8KA 3EGNA 2D1CA 1TKTB 5M2RA 3ZZRA 5AE2A 4C9DA 5IWAJ 4HEA9 4JI0F 4CTAB 5HMZA 2EVZA 2HFVA 3T1AA 3QLHB 4JI2F 3HPOA 2XSJA 4OJ1A 2RKIB 4KPYA 3MEDB 2QRRA 4CRJA 1ZA2B 2LQBA 4B3SJ 4LRDA 1XC9A 1AUSL 1U2RA 5JXSA 1ZA1B 2H54B 3HZEA 3ELHA 4FNIA 2I38A 3UNGC 4EBDA 2HQIA 3DLKA 4LF6J 4K4WA 2C2RA 1SJ4P 5A2QY 4Q8EA 2V8GA 4K4UA 3K58A 3CJ5A 1XQIA 1KN6A 1TKXB 3KG0A 1HD1A 2P8IA 2MY7A 1IKWB 2RSQA 2LA4A 1AW0A 4QJVA 4LFAJ 5KOWA 1T9TA 3QAUA 3M30A 5ADZA 5IXUA 1LV5A 3WC0A 1PBUA 4ED7A 4OHYA 1FJGF 2GAHC 1SC1B 1S7HA 3AQOA 2HWTA 2HRUA 2IRYA 4EYIB 4NE9C 5IOLA 1FVQA 1UVKA 2FGOA 3BGLA 3IWNC 1FXRA 4OLPA 4KO0B 4LBPA 1HYSB 1S79A 2BE7D 2OELA 3KDOA 1RT1B 3CXCR 1QTNB 4NCBA 5JVHQ 2MQ8A 2HSEB 2NXUA 2Z57B 5I3UB 3MXHP 2FJDB 1TKZB 4AFFA 3K59A 3MD1A 3WX4A 4WIIA 2OIHA 3LGHA 1M1HA 2MZRA 4DS5A 5SZTA 3PYEA 3PX0A 3LAMA 1PJ5A 1T3NA 1S0NA 2DR8A 1CQNA 2UU9F 2EK6A 3GG0A 3KHRA 4DS4A 4OX8A 4OI2A 2AYMA 4YR3A 1R8CA 4X66J 4QR0A 3D3BJ 4DPWA 1UETA 5KFBA 1RBAA 2IM0A 1BC6A 3BBBA 4I64A 3H4DA 1NSPA 4GO7X 3MGJA 3OD2A 3RTVA 5B0AA 3S8SA 4X4VA 2CPDA 1RAHB 2R2SA 1RISA 5D78A 1DRZA 3QLHA 1RWMB 5H9FK 2EEYA 1MNEA 1VYAA 4NLUA 4LF4J 3CW2C 1VIOA 4AT1B 4DU8A 2KFNA 1WEZA 3GYNA 4KAIA 4LFCF 3HX9A 1T7PA 4MH8A 2R7TA 4O3PA 1T05A 3AXKA 2AGPA 2IYIA 2A3JA 2ZWPA 1SJ3P 1DTTA 1L3KA 4Z2XA 2MYFA 3RBZA 2FLOA 1FX4A 2OEMA 4DR2F 2ACMA 2AEJA 3AHPA 1NPPA 3MMAB 2ZKTA 3ET6A 4XK8C 2VHGA 2DPIA 1GX5A 3B8HA 3Q22A 3M32B 1FDDA 1Q4RA 1YVFA 1Y4ZB 2AHOB 4Y3CA 3PZPA 2FVCA 1N36F 2YWEA 1DY3A 4H4MB 1EP4A 3GJTB 2IIHA 2VDIA 2DIVA 5HBMA 5CZXA 1APSA 2G0CA 1HBUA 1D0EA 1URNA 2HHQA 2B4PA 3BQ1A 3U1NA 2GC8A 3O2IA 1S10A 1NH8A 2EXUA 2YTCA 4ERDA 2IM1A 1AZSB 2K8GA 2IFXA 4JV0A 2XCPA 2J6TA 4LFCJ 3MURP 2OPRA 4HI1A 1CBKA 1NHUA 4J9SA 4DL5A 4DL4A 1R8HA 4CQ1A 1N6QA 4FYVB 2VQFF 4J9KA 3P49B 2QO3A 4F0HA 3CDBA 4HHUA 4ZPWR 3CCRS 3G82B 1E6YA 2LXUA 3ENQA 1H2VZ 1MWQA 3GE9A 3N6MA 1VLOA 4I2QA 3LAKA 2N82B 3BF4A 5KFRA 4G3IA 3FMWA 3G8QA 1VQPS 2YNIA 3TI0A 2Q43A 2B0GA 2DT9A 1S4EA 3U7JA 3I9ZA 1REGX 3UN5A 2R8GA 3B6BA 4JP8A 1I94J 1O51A 4GKKF 2FHOB 2M7SA 2HMIA 5AXKA 4I6WA 1F60B 1LWCA 2RDIA 4Y34A 1Y9OA 2BJ9A 3W65A 4I0WA 3IN5A 4GVBA 4J5OA 1S1XA 2XM3A 2KZZA 4M5MA 3KHHA 1REVB 4BHQA 4N41A 2QG9B 1GEHA 3FEZA 1L3TA 1RHKB 1FE0A 2DGXA 4PG7A 5K14A 2QZ8A 4NLWA 5E41A 1RT7A 3GSIA 3IGNA 2HFZA 3P4UB 3HHLC 4WU3A 4X4NA 2NXCA 2C28A 1Y00A 1M0SA 4DF8A 2C2DA 2RDDA 1IJEB 2WONB 3Q8QB 1RAGB 1WEXA 4EMDA 4OZ5A 4ZJLA 3DGVA 3PEHA 4DQRA 3ET6B 2IHR1 1MW7A 2JVOA 3C16A 3MM6B 4ZLLA 2W7OA 1YHQS 4B3MJ 3EVWA 3H20A 1W7WA 3EX7B 3QJLA 3TA2A 5A2QU 2VG5A 2WHOA 3GIMA 4CH0S 2QEXS 1IQTA 5IWAF 2DNHA 1E6VA 5A8RA 4G65A 3OTOJ 1S1TB 4I4BA 3TAMA 3BQ0A 3OHBA 1Q82T 1Y11A 1YRXA 2X51A 4WCEQ 3MM7B 4PAAA 3SEOA 2JLFA 2OPSA 4C8LA 3MR5A 2K7JA 1XR5A 4E8UA 5DQHA 1CVJA 4EBEA 1XK8A 2PC6A 4RO0A 5BYSA 1YITS 4I2QB 1CS4B 2DKOB 2C3YA 5DGBA 3DM2A 2R2UA 2XSFA 4DBQA 4DV2F 1VQ9S 1S0VA 1HQUA 3MPUB 4ED4A 1TK5A 2KRRA 4WP9A 4OMFG 1MWYA 1G4CA 2ZH3A 1VQ7S 3OPKA 3I6PA 5KFEA 5AE3A 3V6DB 3H98A 4ANDA 2YH0A 1XR7A 2VPXB 3LP0A 2G1DA 1WOPA 2W4DA 2WVEA 2XZWA 3PKYA 1G2EA 3TR5A 2BQRA 2OI2A 2XMKA 5DJBA 5E3QA 4KJIA 4PXDA 3F41A 4ALZA 4B9VA 2ADBA 4RU2A 1HWJA 2CVEA 2KRBA 1RT6B 3C19A 4JOUA 4B9TA 4KQZA 4RX6A 4Q43A 1V3SA 2H5IB 4CLPA 2ZH2A 2ZJRQ 5HLFA 4FXDA 1KKHA 1AXQA 3DNCA 3QATA 1HPZB 4PZVA 2V2QA 1SQFA 1WDTA 3KG1A 3UVJB 4DZ6A 4P9SA 3J80U 3HSZA 1WKJA 4ED3A 1KC8T 1VQLS 4I67A 2WZ1A 1UZDA 4DSKA 4ID5B 4IYQA 4PCQA 3K8WA 2H1YA 3H8YA 4O3QA 1HQEB 4QIVA 5T41A 4MN4C 2M8DB 2UXDJ 3BYRA 1SKUB 1HBMB 4F04B 3F56A 2V8PA 5J2QB 1DTQA 2NUUG 4NA1A 2VFVA 4YMEA 1GX6A 2EBEA 1Y5IB 1HPZA 4P73A 4A8FA 9ATCB 4LF9F 1DQ8A 2XBPA 4CM2A 1YBAA 5L46A 4RLEA 2AZ3A 4ZIVA 1QAJA 1J27A 3GQCA 4PQUB 1Y10A 1FEHA 1EKRA 3WHIA 4FP9A 4USIA 3D67A 3W2VA 3OJUA 4DR7F 1A9NB 2Z30B 4CO2A 3CGIA 2DCUB 4DSJA 2YWFA 2F8MA 2LXIA 2HHUA 3D54A 4ILRA 3VF0B 4AQYJ 2B9XA 2HGLA 4M94A 2E9ZA 5D4NA 1M1GA 1XMBA 2AZ1A 3UPFA 1RI7A 2MHEA 1PC4A 3O5TB 4MKBA 2A10A 4DV1J 1EB0A 9RUBA 1JB0C 1MU2A 1D8ZA 2W9AA 4LF5J 4F8RA 5ETNA 2E29A 3MECA 2HHSA 2F63A 3DI6B 5HVGA 1FXDA 4OHVA 3QJJA 3W3SA 1TTHB 2AJFE 1U1OA 1B64A 2RIJA 4AQYF 5T7LB 3QGGA 2KO1A 3LA0A 1V3ZA 2YNHA 3VCDA 4KFBB 2VG7B 1BUXA 1QAXA 1XMQJ 1OY6A 2M4MA 3TANA 1FKPB 4IUFA 1N36J 4EGLA 5M2UA 1HWLA 5BYRA 5SUHA 4P2FA 4GRSA 5KFZA 3UN3A 3LO3A 3PIOQ 4DR5F 1SJFA 2F4VJ 4DFPA 4RJVA 4KH1B 3IBPA 2YQ3A 3QSYB 1CJVA 1X9MA 2MKJA 2N4DA 4YHHF 3CCUS 1Q8BA 3I4HX 3CC4S 3TZZA 3BGFA 3M6UA 3K7RA 1SKSA 3TX0A 5LSLA 1IR0A 1K47A 4DPXA 1YTYA 2V5HG 1YJVA 4FKYA 2CNOB 1HNVB 2DITA 3NOGA 2BXJA 3ZZUA 3D1HA 2XQCA 2V4JA 3M8WA 1MMDA 2MQNA 4I56A 5FLXU 3MAHA 3HSJA 3RW6A 4I7FA 2R8JA 1PO6A 5ETLA 4QW8A 2RT3A 4ZN3A 5CYQB 3POTA 2OH2A 2ILZA 2XNQA 1Q16B 1TV6A 3QT8A 3CTRA 4NMXA 5B0FA 2R2TA 3SSRA 2KHDA 3W63A 4ETZA 1G6BA 3OR2A 1N52B 1SH0A 3DDKA 1YX2A 4M5HA 4YB7A 4DL7A 3KYLA 3FNNA 2NCKL 4EO8A 1BQMA 4WFBQ 3CO0P 2G0IA 4FBTA 2EFGA 3NBPB 5LXRA 3DLJA 4RNHA 1R8BA 4Y2IA 3BBFA 1RU1A 5U47A 2ZD1B 1VQ6S 3DLHA 1A0OB 4LQ3A 2PA8D 1ZTWA 5J2PA 1ZBTA 4S0MA 2CZ4A 3A8EA 4KV8B 3QFHA 5CD4A 1WUUA 4NASA 1B7YB 1VRTA 3GG1A 1LWFA 2G13A 4O0IA 2BEFA 2CNKB 3IR5B 1GT8A 3C6TA 3KJQB 4DV0J 3M1VB 5D6GA 1F9HA 3TEGA 1XWLA 3KLGB 2LLZA 5ETSA 1G3OA 2DHAA 2CRLA 1I3OB 4DG1A 4U8YA 5EX0A 5LMNF 2YNFB 4RW8B 2XC9A 1YZ7A 3S1TA 5C5JA 2MSSA 1NKCA 2FLLA 2Q3PA 3HSDA 3NG8A 2YNGB 2KU7A 1LWFB 3R7SB 5IM0A 4U6PA 3KMQA 4NL5A 4RPFA 1UEVA 2XWXA 3D1QA 1BGXT 1PJ7A 1U02A 3EZOA 4TKTA 3V4MA 3DLKB 1RT2A 1WSVA 1XERA 4NEYA 4RUHA 3KHGA 1IKVB 2UUTA 5C2CA 3J7A1 5HROB 2EFPA 2JFDA 1RK8A 4QIFA 4ZHRB 3LTOA 4KBIA 1RTIA 3AY0A 3DLEA 4WXOA 1KLNA 1VR6A 3OL8A 2DR7A 4C11B 1WHXA 5F8GA 1T94A 1HQUB 2HVIA 4OYZA 2LQ8A 3VQTA 2XULA 4FF2A 3R5DA 2EFQA 1NHVA 2DY1A 3UFCX 2VONA 3G96A 1JLQA 1QY7A 2ZH6A 4DSEA 3UD4P 2F5GA 2MQOA 1N32F 4ZPTR 4ZHRA 2H5JB 3Q8YA 3LP0B 5GMEA 3MEGB 1N33F 4MFBA 1Y3KA 2M2BA 3BO4A 2DRBA 2ZD1A 4LFBF 1Q0NA 1EJ7L 2X3DA 2J9DA 4Y0FA 1SI9A 2GHWA 2C22A 4TLQA 4MIWA 1YI2S 3FSXA 5J2MA 3K5OA 1QD1A 4KGKA 1RSCA 3OXGA 4LSLA 1F9FA 4MJKA 4USWA 1WHWA 2VFSA 3M8PB 1NKEA 3D4JA 1XNQJ 4EBCA 2R3VA 2ROPA 4LF4F 1ICEB 2LVWA 2QA1A 2Q6CA 3M2RA 2B3TB 4QZVB 3FKBA 4IO1A 4TY8A 4RL1A 5HQMA 2OKQA 1TKZA 4Q0BB 3M8YA 4NLQA 3M32A 3HHLB 2HNDA 4ED8A 1VLYA 3UQSA 4DR3J 3TJAA 3DU5A 3HO1A 1K1SA 2CQ3A 5KFDA 1OWXA 1RWVB 2VFUA 4QIWD 5KFSA 5KFKA 1KP6A 2AQ4A 1H38A 1EKSA 4QWBA 2DGQA 2ACYA 4Y2CA 2LEAA 4HR2A 3SSQA 1Q86T 1LW0B 2IDEA 1AYEA 1KR4A 1RT7B 3IA0A 3IRXB 3W7BA 1H73A 3EXCX 4EWTA 4C11A 2VH7A 2D3ZA 5KFMA 1SJ1A 4XIUA 2MLZA 3V2UC 3CCJS 3LPYA 1HW8A 2ZBIA 3LWMA 2FVQA 4MK9A 2HRYA 4HT7A 4P71A 3LANA 4PYDA 4CYUA 5HROA 2VBZA 1S6QA 4NCGB 2HWHA 3GFZA 5GAHI 2KXFA 2FJXA 2D3O1 2KM8B 2XHWA 1KFDA 1QLNA 2H9ZA 5F0WA 1Q79A 4L73A 2ZHBA 2DRAA 1V9OA 3W64A 2F9DA 4X4PA 4IQXA 5B7WA 4IOCQ 3DI6A 3PX6A 4TN2A 2MKKA 4I6YA 3RB6A 4OJGA 2N3OA 4PG4A 5B0EA 3CCVS 2OEKA 3MDFA 4OJ3A 1RT4A 3NL0A 5D0HA 2OEJA 1I5OB 4OX6A 4UOHA 3ZXWA 3NLCA 1A6LA 3TO8A 1T9YA 4ZVQB 1WACA 3M8QB 2MZTA 2XMJA 3W5YA 4F3MA 3IO1A 2HBZB 4CLKA 3BN7A 3SIPB 1U6BA 4O44A 2H4WB 1F2HA 3MUMP 4C3LA 1NSKL 2VIHA 3EXYA 1QJHA 5I3QA 2FJBB 2NXEA 1UVJA 2VG6A 1YLXA 2VZ9A 4PPDA 4DV4J 2WSFC 1VIXA 1HL6A 2DBBA 2OLWA 1TELA 4CNZA 4YR2A 3BO2A 4IRCA 1P1TA 3QGIA 2ROGA 1Z1ZA 5DLGA 2VJUA 2NR0A 2DD8S 3W5ZA 2C3OA 2HFNA 3PW4A 2X3GA 3BPSP 4LSNA 1SIWB 3JSBA 3GCWP 2LDYA 3UCUP 1S48A 3K2YA 2DH9A 1B0VA 3BN4A 1ULRA 3LP1A 1VQOS 4LRCA 4NEZA 4O4GB 5IZHA 2W2PP 2YBVA 1UCNA 3NWRA 1A7GE 4ZCKA 3N0VA 5KG3A 4QPXA 4FVMA 1FX2A 3NBPA 1BWEA 3D1OA 5L39A 3I4PA 4B3OB 4B9SA 3WDOA 5AJ3J 4JI1J 2KJWA 3DLEB 1C4AA 3PM9A 4WP3A 4DSFA 2P2CB 3L95X 1VHFA 3KOAA 2XS7A 3N6NA 3FC9A 3M8ZA 2UP1A 2KFZA 1LW2A 4OI0A 2RKIA 2Y8WA 4JV5J 3A12A 1U8WA 3FBEA 1CJUA 1RE1B 4H54A 3ZZZA 3MPDA 1VGYA 4B9LA 3HM9A 4A8OA 2GHVC 2YKNA 4DL2A 4HVZA 2LEPA 3CEDA 2G9OA 3BGRB 3JTPA 2FHJA 4DWIA 3MWBA 3CWJA 3O6QA 4ZLPA 5KG5A 4IKAA 4DUZF 3BSAA 1XEZA 3ILLA 4WYLA 1FRHA 1OYEA 1CJUB 2B56A 5ETMA 3Q8SB 2VQFJ 4DF4A 2NSCA 4K4VA 5B0GA 6AT1B 1VRUA 4J9RA 2MZQA 4Y6IA 4EZ6A 3EE3A 4LR9A 1RLDA 3VAMA 5GAEI 4OX9J 4KHPF 2HFOA 2RQMA 1X0PA 2CQ4A 2G1HA 3R1HA 3G6ES 3EGVA 1VHIA 1JLBA 4ECXA 2IBKA 4W90B 1RDRA 5DDPC 3MPVA 1HBNA 3PW0A 2BE2A 2CQ0A 1IM4A 2MZSA 3AJDA 4CT8A 1WC5A 4USJC 3IP0A 1NH7A 2GV1A 3MMBB 3CPWR 4ATNA 2ZM6F 4C0OC 2C2KB 1RHJB 4ITSA 2MGZB 1Y5LB 4PXBA 1H7WA 3R5BA 4ICLA 4ZCLA 2F1FA 4RW6B 4USVA 4C0HA 3F0NA 4ECQA 2OPSB 3HK2A 1JLGB 4DSIA 1F1BB 3RRKA 4DR7J 2M5YA 1OJ4A 1B0TA 2XI2A 3PFEA 5KFTA 5HMXA 2MLYA 3QJPA 4ZCIA 4Y2MA 1GK8A 1Q7YT 2R8KA 2ZBRA 5C2GA 4RW6A 5F8NA 3QAEA 3P3DA 4UZCA 2RE1A 1WNEA 3I5CA 3J7Z5 3JB9k 2CWXA 3GR1A 3IRWP 2M70A 2VPYB 3DOKB 3PJXA 1R0AA 2JC0A 2LQ5A 5KFAA 3LGMA 1N34F 1FWLA 1F9EB 2YKAA 3OLAA 1BHNA 5K20B 1PAUB 3EM1A 1EHWA 1RT3A 2XGPA 4KH0B 5IV4A 1WHYA 4KE5A 1YIJS 2E5LF 4FS1A 5HL7Q 2VPZB 1AZSA 2CPYA 2DGWA 1KHWA 1LK7A 3RRHA 2BRLA 2I0XA 4BWJA 4LUBA 3D0IE 1BXNA 2L9DA 5E3RA 5GVQA 4CLTA 4DR5J 1YJWS 3O3LA 1Q5YA 4Y00A 1WG1A 2UXBF 2R7UA 4ID5A 3R2DJ 4FKXA 4DR4J 2IY5B 5AT1B 2HMIB 3TUPA 2UUBJ 5F8HA 3T9NA 2OFGX 5DETA 5KFNA 5F9NA 2MKIA 4M5JA 4DN0A 3M30B 2YNIB 3ZNUA 3IBFB 4PR6A 1CULA 3OFGA 1YJRA 4JV2A 4R5PB 3TJ8A 3SQOP 1GTHA 1VK8A 2DNNA 2E5JA 2OAUA 1H74A 2O67A 3H25A 2UVRA 2UVUA 4DR4F 2RB7A 1S99A 2CDQA 3MPYA 1BE4A 2HQCA 2DXEA 3KUEA 2XMVA 3VGSA 4EUVA 1IBMF 2B4OA 3ITHA 3UDCA 4TQSA 1HNXF 1XIQA 3MI7X 1X7VA 4ID8A 3PR5B 4ICLB 2R7WA 2E1RA 1RWUA 5D4OA 1T03A 3FVYA 1JK9B 3DFEA 2CIMA 4ZKAA 1X5TA 4CLZA 3T1HJ 3TVYA 1G1XA 2PI5A 2R7XA 2U1AA 2DNPA 6FD1A 3P6YC 2XCAA 1NPKA 3LP2B 4G1IA 2IAJB 3VR1A 2P6SA 4CZCA 2JLEA 1NAQA 1SL0A 3O44A 3PHEA 3AT1B 1YJNS 2A2DA 2HHVA 1ROFA 4HACB 3PW7A 1HNWJ 3MMAA 3QBCA 3CJ0A 3PHTA 1X5SA 4IOAQ 1FNMA 4MK7A 1LKZA 3H5SA 2Z2MA 3Q8VA 1JJHA 2J6UA 1RTJB 3R3TA 1R31A 4JI2J 2J0SD 4NI2B 4OL8A 1WF0A 2KT2A 3GV5B 4BC7A 2YNFA 4WKYA 1KOHA 4JB8B 3CT9A 4OX7A 1MROA 5DLFA 1JWWA 5CYMB 1S0OA 2DH8A 1RQ0A 2CPJA 3R97A 3ZZ0A 3MMCA 3EYZA 1HI8A 3H0PA 4FXWA 1Q8LA 3IBWA 2XYHB 3IWXA 4ZS6A 5HQ8A 1QM9A 3M9OB 2ZC3A 2BABA 2HK2A 4PYAA 1CC8A 1YQHA 2ILYA 4UOFA 2MZ1A 4OLOA 1RHMB 1C1BA 4J90A 3LP1B 1V5IB 2BUNA 2F3JA 5KFLA 4WZQA 3K89A 4USMA 5J1EA 4RW7A 3OL9A 4ZVGA 5C24B 1PCAA 5A76A 1NBEB 3GV7B 3EGZA 1UWBB 1TVRB 2GNKA 1NK8A 1TL1A 2JNJA 1TUVA 5K8NA 5DQIA 4R5PA 4ZVSB 4DLGA 1EETB 5IQQA 3VGTA 1JLFB 4GMKA 4B08A 3T5LA 4LF1A 1K73T 3ULHA 1WC3A 4JI3J 4FVCA 4HI2A 3KXDA 3TP2A 3ICLA 1RKJA 1VDHA 2WSEC 5MAOA 1YRTA 3T6BA 1NJIT 2XLKA 2OD6A 4LF9J 3DGPA 3K57A 1SH3A 3SYZA 3TUZC 2D69A 1N34J 4NLPA 2GX8A 4W4MA 3P5BP 3R5GA 4GKJF 1MMNA 3KJVB 1G7CB 2F7VA 1GXLA 3ENVA 4K5SA 2YNGA 4R0JA 2EK1A 1IR1A 4ZVUB 4A4JA 4NXNJ 2C2MB 4OYPA 2W24A 3GWCA 2I5JA 5IC4B 5BR8F 3OSNA 3W9IA 1M5HA 1UJ4A 4X4OA 4N5SA 4LF7F 3FGVA 4DZDA 1YJ7A 4USKA 3SDEA 2NYHA 1JNZB 3PG9A 4DFJA 3FZ2A 2F9JA 4OZ1A 3EICA 2AEMA 4OI1A 1U0HB 2CADA 2BBEA 3DC2A 3VAIA 1J5EF 4WJBA 1OY8A 4XTTA 4K4TA 3DRXA 2ZFHA 3GJQB 1V3RA 1O6XA 3OFHA 2GVZA 2XS5A 1JLQB 2OGUA 1T9VA 4JI5J 3RAXA 1JXLA 1UVMA 4K0KJ 2WW8A 5KT6A 1CEZA 1DJ0A 3KDNA 5DDQC 5GAHU 1YRUA 3DHXA 3VVUA 3DM2B 3HVTB 1N48A 2IYGA 2LU1A 3C3LA 4DSLA 3DLBA 1ZH5A 3C2PA 1VC5A 3H7HB 2BJ7A 4Z7YA 4KPCA 1FTCA 4H4KA 3BH7B 5DM6Q 1NUEA 2O1PA 2P5VA 2V0NA 3NS5A 1X4BA 2FPHX 4EI2A 4ZN1A 4RZRA 1HR0J 2ADCA 2VG5B 2ZEJA 4KYZA 2KKHA 1BMQB 4WP8A 3V6JA 2GIQA 1WORA 1S5ZA 4O23A 1KD1T 5EX3A 4QIEA 4NLXA 3JYTB 5L1JA 1NK5A 2ZOGA 3CDAA 3HHLA 3ZZTA 3TA0A 3LPEA 3B54A 2HZVA 2HLTA 2UU9J 4E0DA 4KTQA 4K0KF 4F2RA 1NDLA 4OX9F 1SV5A 1F5CA 2A2CA 2FTRA 3CC2S 1KRPA 2HHTA 1UEUA 2BKNA 2H65B 1UEKA 2KDOA 2CQ2A 2EWHA 2OSQA 2VPWB 3NCRA 3PRDA 3QGPA 2BDPA 4HHJA 4X84A 5G0RB 3JYTA 4FXVA 3RBDA 3OUYA 1DTQB 2L08A 2YKNB 3CMQA 4DHVA 5AJ3F 4LFAF 5K9FA 4DX5A 2ZH9A 5CHCB 3NGDA 3MEEB 1WWHA 1FKAF 4OYBA 5HMWA 3OV7A 4LF8J 3IR7B 2CG4A 2D3UA 3UI3A 4KY3A 2KB2A 4OZNA 4A8XA 4C7QA 1DQAA 2HQDA 3DOLA 4JI8F 5EDWA 2W8LA 2IMWP 4F50A 3EZUA 4DV3F 8AT1B 2ZZMA 2HHXA 3D6TB 4FNHA 3W62A 4R8UB 1Q53A 3ISNC 1S9EB 1P8GA 2C3UA 4ZVRB 4DPOA 4RW9B 3HT3A 3I56S 1FDBA 3V5RA 3PIPQ 5CYJA 3HHLD 1FJ7A 1QSSA 3GCXP 3QPIA 4UOCA 2RS8A 3G86A 2HAIA 1FJEB 4O44B 4NPOA 4FYWB 3QIPA 5KTQA 4RW4B 4QU6A 2ZDPA 3IXQA 1FJCA 1VCTA 4C48A 2IM2A 2RF2B 3M8QA 3GIIA 4V19X 1KQGB 2QYCA 3FQKA 2CXEA 2E7XA 3IAM9 2HIYA 1SVDA 3C6UB 1RYRA 2PE8A 4DQPA 4LIWA 5KG0A 1N8RT 1WDDA 4H4MA 1X60A 2BJ3A 1K44A 4P7VA 3BDPA 4BDPA 3A3OB 3JS9A 4K2XA 3ZTSA 2DJWA 1FDNA 4DG1B 4MT1A 3RR7A 2W7AA 3EDQB 4USHA 4ELVA 2CNLB 2CQCA 1L3SA 5E5NA 4F3OA 4U96A 1MN9A 2E1AA 2HS4A 4OI6A 1IBLJ 1SKRA 1RAIB 1H2UX 3NWGA 3THPA 2J7WA 4DR2J 2CQGA 4JV1A 2HURA 1KDNA 1RTJA 3BS9A 3DDIA 4RBTA 2X1AA 3MAQA 5K5MA 3CCLS 2UV8G 2DRDA 1T05B 1M5SA 2HHHJ 2DCLA 3VTIA 2FVRA 1XMOJ 2XYPB 5AE1A 3ZC4A 3KK3B 2X7IA 5L9XA 5DGAA 2QYGA 1HFEL 3PXGa 2Y0SD 3SQGB 1M5KC 2H51B 3ZTRA 4WFNQ 4ZVOB 1GFWB 2HNYB 2VFTA 2WB1D 2RJZA 3SXLA 4O3SA 1T11A 2HS3A 3N28A 3ZZPA 4JYAF 4DPYA 4DV1F 1JJ4A 2HBQB 2EFOA 2OPQA 2MXYA 4YFUA 2FIUA 1PC5A 2IJFA 4TU9A 2ZKUA 3J7YU 1SH2A 1IBCB 5M2PA 2XZTB 3OR2B 2BRKA 4U67Q 3D6HB 4ZA1A 2ZM6J 2H48B 5B0CA 3N9UC 3Q8UA 5E3AA 4C8ZA 3GB0A 3OJSA 2AW0A 1NDKA 3AOCA 2OJ3A 3DCAA 1IKYB 4TY8B 2AEFA 1FVSA 2GJFA 1TFYA 2CAJA 2FHKA 4K4SA 2HVEA 5GAGU 4OQJA 2CJAA 4XAKA 5JJBA 4YEAA 5KFPA 2UUBF 2YQ0A 4X65J 1WKLA 2HPUA 4RNFA 1P9QC 3OXFA 2YKPA 1IBMJ 3UR0A 3PCOB 3BKFA 2IC3B 1QSLA 2B9EA 1R89A 3AXMA 1ZM9A 5HVFA 4Y2AA 5A8KA 4C98A 5FDLB 1UJ5A 2JL9A 4QIGA 2I2YA 1X4CA 2ZITA 4JI7J 3LP2A 4QYRA 3DXBA 1Q8KA 4IFYA 2IAJA 2KHCA 3QT5A 2AGQA 3GZ7A 3U1LA 4DV7J 1HNIB 2KZMA 2ALYB 3GFXA 4DLEA 2QTWA 5K14B 2M0GB 7FD1A 2R7SA 3KK1B 3TUJC 3V81B 2KG0A 2PI4A 2XTJP 1QUPA 2HAFA 2HFSA 1AROP 4U9RA 4CNYA 1X4GA 4F4AA 1TFWA 3R8YA 1XN9A 2V50A 2E5LJ 5J1PA 5EWEA 5D0GA 4C8YA 2DHHA 5KG4A 2O66A 4NZ7A 1W25A 4C3KA 2UV8A 3VZIA 3TZXA 2UXCJ 3I5BA 4B3RF 3RB4A 5GADI 2DGUA 1UFKA 2QE5A 1TUGB 4RUCA 1FXLA 2Z2ZA 1ZZFA 3MECB 1N33J 1ZAWA 1S7IA 3CD5A 3OQ2A 1B3TA 1D1UA 1LFPA 2GJIA 5J2QA 3N5FA 1HMVA 1E6YB 1RZMA 2P9GA 3IRXA 4DCOB 2RQCA 4DEZA 1F5AA 1RBOB 2DEJA 2GAGC 2KT5A 2QLWA 4G1QB 2BJEA 2YX4A 4LIRA 2XMAA 2CPFA 1KVKA 4NYZA 2FVSA 1XJWB 1JLEA 1EAYC 1U49A 2EG2A 2FDNA 2W2QP 1M5OC 3MM9A 2H3EB 1R3NA 1NSQA 5L1IA 1J5EJ 5CAAA 5HANA 4AE5A 1JLAA 3PJ9A 1SXLA 1SL1A 2MTLA 4MAKA 4WFAQ 2M8HA 4M5DA 3PDNA 5A0YA 3T9ZA 3W61A 4CM0A 1P9YA 4LBHA 1S49A 4YQWA 3ILJA 4HT5A 2RILA 5CCMA 3HZGA 2RUGA 3I0RB 1CJVB 1Q7LB 3V6HA 4JI6J 5FDLA 3T3FA 2HGNA 3HVAA 3RZAA 1Y7PA 2F40A 3AFGA 1B70B 3PRBA 1EARA 1LK5A 3HSGA 1KS2A 4OI4A 1PILA 5HMYA 5BR8J 5CH7B 1R27B 5F8MA 3BH6B 3I0RA 1I94F 1RACB 3D3CJ 2BANB 4I7FB 3OVAA 2ZJQQ 4AXIA 4K7QA 2YWGA 1RAAB 3DU6A 2VBXA 1T9UA 4E2FB 3Q23A 2KVQE 2QV6A 2BZ2A 3MCOA 3OSPA 4DCPB 4IG3B 4ZVEA 2QL5B 2J0XA 4IO9Q 1GH8A 2HZAA 1DARA 2IPOB 1M5VC 2NQPA 2ZNYA 3E3XA 3ETMA 4UTGA 5RUBA 5H9EK 1MMLA 4MYTA 5DG7A 2MZJA 2FVPA 2D74B 4ES2A 5T14A 1L5UA 2JX2A 3HHNB 3B4DA 4W92B 3R2CJ 3HJVA 3DYAA 3RAMA 1T8EA 4KHMA 3CMAS 1RWKB 2XSJB 1QE1B 3O1LA 3TEHB 4Q0BA 2AJ0A 1HMVB 2KI2A 2DNRA 2ZUAA 2ZUGA 4R25A 4W98A 3UD3P 1Q8IA 1JKHA 5IT9Y 4LRBA 4TU8A 2GS8A 3M6WA 3KLVA 1TU0B 2WVCA 1ZYQA 3RRGA 4X66F 2ZDOA 1WTBA 1JLCA 2CQPA 1GXTA 5B0DA 1C0UA 3H40A 2ZH5A 4KKOA 1HNVA 4DFMA 5HQLA 1X0FA 2YXLA 2WBRA 3SCJE 3DLGA 3R6LB 3U02A 1AFJA 1FTRA 4DX7A 5B08A 1QVFR 2UUCF 4CO0A 4X4TA 5CD4H 2ZVSA 3SCIE 3BGUA 2YKMB 3NY0A 3R6GB 3LALA 5L1KA 3T19A 1TAQA 4KGVB 4NLDA 2F8EX 2V8DA 1UW4A 3VHQA 2BQUA 3BSNA 5EHHA 1C1CA 1RAEB 5DM7Q 1RT4B 3BGOP 2WMMA 2C2NA 3IFEA 2Y0BB 4YDDB 5IT9U 1HLWA 4M95A 2WBMA 4ECZA 2ERRA 3AOAA 1VC6A 5E0OA 1R0BG 1OY9A 3TAQA 3DN9A 3FFIB 1LNQA 1Q81T 5CA5A 1Q1KA 1UFLA 2ZHAA 3U27A 2QJ3A 2R7QA 3BR8A 4ZIWA 4ECRA 4KGXB 3IM8A 3W8PA 1SQGA 2J9EA 1N5YB 4TYBA 3W9JA 2UVWA 2J76E 3RB0A 2BOPA 2DO4A 2VF3A 2DK2A 3JQKA 1WG4A 2F65A 2NUHA 2XHCA 3LH2S 3M4XA 3M7VA 3POTB 3GU0A 4OV1A 3VAGA 2FJWA 4C4WA 5IQ6A 1YGYA 2W4CA 3KTQA 3UE2A 4ZP8A 3OTEA 4HYKA 3RB3A 2IJNA 1HNWF 3V81A 1FK9B 2PDAA 1SL2A 3D7SB 3JXOA 3L7PA 1WHVA 3GYGA 3JQJA 5KFVA 1S0MA 4OYIA 2DR6A 2E5GA 2GVDA 3IBCB 1FNOA 4C3MA 4DMZA 4BCAA 2J0WA 3C14A 4RNNA 1CG2A 5IS2A 4DQSA 4D3HA 3IGVA 2J0QD 3TAPA 2EFVA 3E2EA 4LR8A 1YJ9S 4QCLA 1TK8A 3W1YC 3L09A 1N88A 2OTJS 3SI8A 4IFVB 3CE8A 2ZBQA 1UFWA 3NS7B 2ZBPA 1P27B 2NSBA 4WU2A 2YWWA 3B4MA 5D0RA 2VDHA 5L9NA 1RT1A 2J8SA 5ETRA 2ZC4A 1S6PB 2VL1A 1TK0A 3U1MA 3QWUA 1RT5A 2Y1IA 5J2MB 3ZFVA 4IRKA 4UY85 3D5MA 2AWZA 3ETOA 4Q2LA 2RU3A 1KONA 2QFJA 2PMWA 4NZ6A 4N8OA 3OL7A 3GJSB 1U2FA 3BSOA 2DGVA 1S6UA 4U7UK 1WSRA 3OTCA 1X9WA 1S9EA 2XYGB 1H72C 2XMTA 5MLCV 4CYUB 5CZVA 2MGZA 3HJFA 3FDSA 3UDLA 3THVA 2GGPB 4PQUA 5KOXA 2DNLA 3FCVA 4DX8H 3W66A 5HSPA 1VC0A 1FRXA 3D2WA 3G6XA 2R2RA 3FRYA 3KLIB 2QL9B 1FE4A 2CZ9A 2B43A 4B9MA 5L1LA 1JJCB 1R6YA 3JTNA 4F4WA 3AQPA 4A8YA 1VQYA 2JLGA 1X5OA 3D9BA 1X4FA 2JVRA 2P9EA 4DV0F 2E1CA 2HNDB 1QAYA 1V5VA 4FPIA 4P52A 1HBMA 5LL6d 1NU4A 1ZAVA 2FHMA 4X4RA 3GIKA 3GLJA 1CPZA 1HBOA 3MR6A 3NNAA 4PWDB 4R8UA 4CWBA 2RHQB 3A8IA 1UWAA 3T1YF 2E9RX 1VS3A 1YBTA 4UY8T 3GMGA 4DDFA 3NOCA 3PNIA 4LR7A 4HH0A 1UA1A 2XG8A 5L8RC 4DOZA 1RWPB 1AT1B 3M1VA 2BV3A 3Q89A 4OHXA 4TYAA 4O3NA 3UDEA 3VV2B 1ZZNA 2HHHF 2LA6A 3MOZA 5KT4A 1FEEA 1IQZA 2GQQA 1HWIA 2G2ZA 3QWPA 3DLLQ 3BB5A 1NM2A 3SV4A 5D77A 4WXWA 2OD4A 3NAIA 3EWGA 4F4ZA 5F0UA 3KJFB 3G71S 4ECTA 2GZOA 1GAOA 5LJ3Y 2WOMA 2N4CA 5F8JA 1MU2B 2JSXA 5K8OA 1RAFB 3Q2SC 1CULB 2D9OA 4KB7A 4DR1F 4K50A 3MTJA 4A47A 5DRKA 2HQ3A 2BX6A 3M2UB 2V69A 4ED5A 2HWIA 1VBYA 4B9NA 4NXNF 5CQGA 2ZH1A 2CJ9A 2QC3A 4NLVA 2A1BA 3WIVA 4ANEA 3G4SS 1J5OA 4U7UD 1IWGA 3TAMB 2H5EA 1SIZA 1EQMA 3NKYA 4KGZB 1FRMA 3A8JA 3IG1B 2EFNA 2CA9A 2VV5A 4WTYA 2VODA 3KK2A 3Q0AA 3CJKA 4CLWA 3WC2A 3OR1A 2IBOA 2M52A 4FF4A 1WC1A 3NGTA 3KK3A 1FRKA 1ZPWX 2BVZA 4P74A 3H42A 1UPMB 2JEJA 4RWXA 4LSLB 4OZ3A 1FRJA 1I6JA 3C6UA 1OSCA 3R1LA 2WCXA 5BXIA 4N77A 3BQ2A 3MTKA 1W2BR 2YPZA 4WYWA 3NMAA 1UVNA 4A8QA 1CJKA 3CCTA 2W25A 5A8WA 5EWGA 4JI4J 2K7KA 1QSYA 1L3VA 2OFHX 2E1PA 2Z8QA 3D0HE 3FUYA 1P1LA 3NP5A 4NRTA 4U8VA 3HXMA 3C46A 5THWA 1XNRJ 4AL6A 3NXZA 4ZOSA 3FBFA 4IR1A 1XMQF 2ZHOA 4DU7A 4FPRA 3RR8A 3MFIA 3M8RA 1LWCB 2HHWA 3SCKE 4FYDA 1KTQA 1TL7B 1GTEA 5EGYA 4JV5F 2E7WA 1X9SA 2ZNZA 2DNOA 3HHEA 3ILOA 4L3NA 5DG8A 4N76A 1D9DA 2PEBA 3GR0A 2WVDA 4OZ0A 4QR2A 3SQGA 3DOMA 3TWZA 2XLIA 2B51A 1IKWA 3TOQA 2UXCF 4F4YA 1DURA 5CXTA 1NJXA 1HBNB 1NEEA 2MB0B 1C0TA 2YWKA 3EVOA 1T03B 2AT1B 2H4YB 2HHPA 3G2XA 1VBXA 1HNZJ 2OPRB 1DLOB 3J7YI 3CCZA 1U1KA 3MFHA 4O3RA 4FS2A 4P2XA 2WVFA 5G0RA 3RBEA 3Q86A 4DL6A 3PTWA 4UQTA 2ATLA 3OR1B 3KK1A 2AD9A 1FRLA 2EW9A 1NK4A 1BQXA 2RRNA 2ABYA 2EI5A 3UCZP 1NPRA 3MEEA 3Q83A 3ADAC 4LRFA 5ETOA 2UUAJ 1JNRB 7FDRA 2EC0A 1RTZA 4ZVFA 3KLFB 4PRFA 2OO4A 4AXJA 3OUYB 4KR0B 3L3CA 3OVBA 2FJEB 1S97A 4TNOA 3QMQA 3PV8A 2V9WA 4NXMF 3CJ8A 4D3GA 3BJYA 3VWSA 4B3TJ 2NZCA 4FF1A 4JYAJ 1LW2B 1TL1B 3AJ2A 4X4QA 4CO1A 2IDLA 1TUWA 2FQQB 2RAQA 3IC1A 5T7LA 3MCMA 3THTA 4DJBA 1ITPA 1H98A 3EGWB 1S72S 2WAQD 1RA6A 4Q45A 3FQLA 2RS2A 2J5AA 4J9VA 2XZDB 2CPZA 5K8MA 4PQAA 1HBOB 1GMWA 2DNQA 2JRSA 4FDFA 1J2VA 1NJZA 1WEYA 4DR6F 1D9AA 1UKUA 2KXHA 2LXFA 4B3TF 1GNKA 4DPTA 4JI0J 4WWSA 2E1MC 4CLLA 2QSWA 3OW2R 1U1LA 4ZITA 2VA2A 1F0XA 4NA3A 3GTYX 2N7CA 2JEIA 3PEJA 4OYOA 3NAHA 4ECVA 4OYMA 2UZAA 1RADB 4LSNB 3MR3A 3HT0A 2XY5A 2BKPA 2VFRA 1RT3B 4CIOA 4QYZK 2A6OA 4J9UE 4MKAA 2HVZA 2XB2D 4QPTA 3AD9C 2V63A 2XY7A 1IXKA 1VQ5S 3CULA 4JI8J 1CQMA 3LUYA 2I5JB 1VISA 3I87A 1SBRA 2AX0A 3BO3A 4PG5A 1U25A 4Y28C 1IBKF 4YOEA 3PO4A 2PO4A 4L76A 4M5GA 1K0VA 4NLYA 4OIXA 5HJXA 4H4OA 3AD8C 3EVMA 4P72A 2Y3YA 3CSKA 2UXDF 1KHVA 4QQBA 1PAEX 2QT7A 1FKPA 1DBDA 4URQU 3TVKA 3VZHA 3CUNA 3A13A 2RQKA 5DZ7A 1J5OB 4KKOB 3LW5C 1X4HA 3EMTA 4RBUA 3JSMA 2B5JB 1KQSR 2FJVA 3CD6S 4JI4F 1WF2A 1S59A 4LFBJ 2N7YA 3M2UA 3SZ2A 4KHRA 1ZM3A 4USUA 3ZNJ1 1RLCL 3QZ8A 3F73A 3V6KA 3CJKB 1QVGR 1NKBA 3QRQA 2DGTA 2B7BB 3C6TB 3DXSX 2ZVIA 3GFHA 5E3CA 7AT1B 3CCMS 1TL3A 5KG7A 3PW2A 4DV6J 4X2BA 4EEYA 4ECSA 4WK1A 4CDIA 3NS6A 3ZTQA 3QZ7A 3KLEB 3OTDA 2IVMA 1K0TA 4QWDA 3FSYA 2Y1LB 4ZCMA 1NZ8A 5KFOA 4MTPA 4NZ0A 2X1GA 1OPZA 2KYZA 3PJWA 1SPBP 4WE1A 2NXNA 1SJQA 3RW7A 3BPDA 3GFYA 3UNYA 4J9MA 3AB4B 2RU9A 3OTOF 4NCGA 1HI0P 4J9OA 2X1FA 1F3FA 2R8IA 3QT7A 4OJHA 4ZLJA 2CYYA 1JLBB 3C66A 4ELUA 3I82A 3BSCA 1NLKL 2MKCA 1RA7A 4CH7A 4DV3J 5KFYA 1OQ6A 4DV2J 3CNQP 3AODA 3MR7A 2UVVA 3PFOA 5LM7E 1HWKA 2ALZA 2OPQB 3OVSA 3J7ZT 4ZVTB 4IDKB 1UJ6A 4FZVA 1JLGA 1U09A 4L75A 5F3ZA 4LT6A 3J81U 4OHZA 1UVIA 5IT4A 4X64F 2J7KA 1QTMA 4NCAA 3NGUA 3CJSA 4CLFA 3CJ2A 3H5UA 5EN1A 3FCWA 3GJRB 4CI0B 3KLIA 2WONA 3HVWA 2HKEA 3JSYA 2UUWA 2EC2A 1W26A 3MM5A 1PBAA 1U1NA 2HYIB 2DB1A 1S9FA 2RH3A 1IBKJ 2CNNB 1RCXB 2XMUA 3W2WB 2RHSB 2KTQA 5KT5A 2DR9A 1XNRF 8RUCA 2MEWA 5KFUA 1RGVA 1N5YA 2JWNA 1XNQF 1K9MT 4Q8FA 2HFUA 4RW4A 3P8BB 2PEHA 1M90T 6FDRA 4A8KA 2FZGB 4I6AA 5HAOA 2VQEJ 1T0TV 1TMJA 4OI3A 3TRGA 3HI9A 1LQ9A 2CZVC 2YNHB 4RU9A 1U48A 3Q2TC 2LECA 1AB8A 2DNYA 1VOMA 2HZCA 4WE1B 1IUJA 4NRUA 3BV8A 1SCJB 2CPXA 1YKWA 3P96A 1H0HB 1HIYA 1JLFA 3DRPB 1RT6A 1MROB 4ZDNA 5KFJA 2HNZA 2OUGA 3ONQA 4HDGA 2ZH7A 5LSOA 3I5AA 4J9NA 1VQSA 2AJ1A 1EIYB 1RWNB 1X4AA 3RJMB 2ZZNA 4P2SA 2W9CA 5JVGQ 1IKXB 4JI6F 4RNOA 2G4BA 3MHYA 3CMES 1U0SA 2X1BA 4X4SA 1AUDA 2QGFB 3ENAA 3RYLA 2VKRA 3I32A 4Z37A 3MR2A 3EUNA 4K2JA 4J9LA 3D68A 2G2OA 5FIIA 2Y1RI 4LBIA 4LVNP 5IM0B 2QA4G 5A0YB 3D0GE 2B4UA 1EQ0A 3TYTA 4QWCA 1Z4UA 4ECYA 5LOQA 2KJVA 4ER8A 1K8AT 2ZWOA 4G1PA 3CCWA 2MKHA 1EZZB 1FFSB 2GIRA 4FN5A 4KGMA 1WG5A 2A18A 2YWHA 3GYXB 5A8KB 2I1RA 4EK2A 2FYXA 2Q79A 1R8PA 3US5A 1NDPA 3W8GA 1JLEB 2PMZD 1ZETA 3QRPA 4ZVHA 2IA0A 4L72B 1T95A 4ED0A 1RAOA 4KV8A 1NNDA 4IG3A 2VA3A 1JXVA 2FHJD 4V1Ak 4C8OA 2P9CA 5D3GB 4P75A 1B0PA 2QFIA 3NCPA 2MPUA 1F3VA 5JUMA 3G6VA 5HLFB 2CQ1A 2U2FA 4YDXA 3SSSA 4WTOB 4YN3B 4YUDA 2V34A 5LMUF 4A8SA 4M5DB 1GMVA 4AD6A 3MMBA 3K17A 1U4BA 2MJNA 5H1SV 1CLFA 1FFGB 1X5PA 5FJ4A 2DHSA 2VKZG 2QX0A 4MKVA 5IC6B 2DPJA 3OFEA 2IMOA 3GV8B 4LF7J 2PN6A 4NXMJ 1WTFA 2GMHA 4ZPBA 3OBIA 4OZLA 2AJ4A 3BEGB 1FERA 1YG0A 3QO9A 4OZJA 4CO3A 1VQ4S 3CDUA 3H5XA 1R8AA 3DKDA 2V9KA 3B82A 3EZ5A 3JAMY 1S12A 3N01A 4CT9A 3RBXA 3HCXA 2BJ8A 1CJTB 4MIBA 1U1QA 3CVKA 2JOQA 3FBBA 5HP1B 4DUYF 1KVJA 2ZH4A 3GONA 4G6VB 4XPCA 2K2PA 2ZOFA 5FLXY 4OFZA 3DOKA 4I68A 1JLCB 2LEBA 2ZZTA 2GFFA 1IKVA 4LF8F 1H6KX 1IKXA 1S1TA 1U6FA 1UW9A 3FRZA 3N4WA 4OYXA 3S6EA 5AXMA 1F5BA 2E9TA 3V4IB 1SKWA 3KK2B 3KJVA 4DV7F 4DQQA 1URRA 2NYIA 4B3MF 4L6V3 1B4SA 2XI3A 3X1LB 2ZE2B 3HFZB 2K1RB 3KNAA 4B9UA 2FLPA 5AXNA 4PWUA 2HLUA 3JSRA 1ELOA 1RABB 2G2YA 2CDRB 3DMJB 2J7UA 2DTJA 3IR6B 1JKHB 4ZPAA 1F2GA 2SXLA 2RMLA 4ETXA 2CG8A 1S1VA 2XNRA 2FLNA 2HK3A 1IJFB 4DXLA 1TQLA 2WOMB 1IWAA 2MHNA 2R7OA 1REVA 1R0CB 1LXNA 1YDLA 2B9YA 3DRSB 2F8HA 2EG1A 1RJJA 2VD3A 3D28A 5C42A 5IFMA 3HFKA 2JFKA 2Z58B 4IG0A 1YJTA 1RUSA 3KUGA 4GO5X 3PR4A 1YK9A 2FC8A 3CJ4A 3DRYA 3KUHA 1HHTP 3SV3A 5DO2A 1IN0A 1LEOA 5I42B 1BQMB 3AH6A 3HP6A 3R5CA 2FGCA 3RG6A 3ZZOA 2CQIA 3A1YG 4NYPA 2G0JA 3BKTA 4URSA 3TARA 4KHPJ 1KNZA 3ISZA 5KFQA 4X4UA 1DAXA 4OYWA 5CYMA 2WRMA 3G82A 2W2NP 5C25A 4PWWA 4ZP6A 5LSRA 2AV5A 3K5PA 2IVFB 3HVTA 5KFWA 5KFCA 1XMOF 2AF6A 3HKZD 2MQMA 2PSZA 4ZPVR 4J91A 4AUKA 2FD2A 2V4RA 2C2EA 1TV6B 1UZHA 1NCLA 3SMZA 1UL3A 4K4XA 3FCHA 4F4XA 1X4DA 1NMEB 4UZBA 4UQGA 1RHQB 1YBUA 3M05A 4JBCA 3LGNA 4HACA 5HO4A 3C14B 1BQNA 1VI7A 4DR6J 1VFJA 2VC1A 1PYSB 4RKUC 3W2VB 2OP5A 1RWWB 1Y5NB 2HBYB 4YY3J 3IWLA 1HBUB 3PY8A 1YWXA 3CIZA 3MM8A 4N7TA 5KT2A 3MM5B 2DEIA 4FYYB 2VUGA 3IG1A 3TVZA 2PIIA 1RTIB 1FD8A 3VAFA 3TNVA 2J8AA 4Y65A 3ISND 3G9CA 2O3DA 4O3OA 5A6WA 3BGRA 2C3PA 2V8VA 1RT2B 2JHEA 3KKFA 3QGHA 4K8RA 3TQEA 1F6TA 3GIJA 2Y9HA 1HKAA 1KQFB 2C1EB 4RUAA 3M6VA 4F3QA 1TP7A 1S9GB 3IM9A 3TZWA 4H4OB 1WELA 3PYDA 1KEKA 2ZJPQ 3CD0A 4NMLA 4YY3F 1OQ3A 3HD1A 3KFWX 4LF2A 5ETPA 5F9LA 4X62J 1U24A 1RCOB 4GKJJ 2B5JA 5E2QA 4YP3A 2AU0A 5G4DA 2PD1A 1S1WA 2IRXA 3I9V9 4I1TA 1SJRA 3H90A 3I96A 4AYBD 3G87A 5FD1A 3I55S 2BE2B 4UF4A 4JUZA 2RVJA 1RHRB 3MD3A 1KLMB 4RW7B 2Q6BA 5L38A 4DV4F 4H4KC 4P7TA 1RB0A 1VQMS 1FKOB 1KFSA 5BYQA 1SC3B 2KFYA 1N32J 2HEKA 2KG1A 2BW7A 1CC7A 2V4JB 4PXEA 2Y8YA 1SUQB 1TL7A 2JDJA 4MKYA 3M2RB 2BYCA 3HMJG 1NRKA 3A3PB 2NPFA 5IV3A 2WB4A 4PABA 3MM8B 2K06A 2CVIA 2YKOA 5ETKA 4WFXA 4WBFA 2HQGA 2LP4A 1WJ9A 3AOBA 3IMQJ 4AL5A 5CABA 2LQJA 3SFUA 5HJYA 3T5HA 4M5NA 5A6PA 4DL0C 2APOA 3Q24A 4L74A 3VAJA 2C3MA 3CJQA 1RBLA 1T02A 3FEXB 3JQMA 2B8PA 4LREA 3UW1A 1LOUA 2MSTA 1RHUB 2R8HA 3CCQS 3MCSA 4WFYA 2CPIA 1NHKL 2AX1A 1RXOB 1FA0A 4F26A 3TQ1A 3RAQA 4EYHB 4DV5F 1HI1A 1FT8A 2FZCB 2BA9A 4A8MP 3EDRB 1TKDA 2A6MA 2VBWA 2Z4PA 3RGIA 3D6MB 4MMOA 2YX7A 1S9GA 3ZTOA 2CJKA 1PIEA 1NK9A 2BQ3A 1DHMA 4PXCA 3P5TL 3C15A 3D6FB 2VQEF 2QA4S 2VOPA 1LWEB 4HH1A 2CJYB 1OS5A 2EKNA 5GMKa 3QO9B 2W2MP 4DUZJ 4ED1A 1N56A 4F02A 3T6JA 3X3UA 2V2VA 3KLHA 3MPWA 4C6AA 1PGZA 2Z0GA 1UVLA 4PKDB 4C8NA 2MKSA 3DRSA 1N6QB 2NS1B 1S1WB 2HIQA 2EPIA 2YX1A 2AIRB 2B7CB 2RNEA 3FEYB 4P6QA 2PGCA 4DR1J 4PPZA 1U1PA 2ZH8A 2ASLA 4ES1A 4X65F 2EBGA 3MEKA 3N79A 2GO9A 2HS0A 4F67A 4PG8A 4WK3A 2NZ4A 3CO9A 1BD6A 5C7PA 2AYGA 2CPEA 2BMBA 5B0BA 2GQCA 2VASA 4F36A 3QSIA 2J9CA 4LF5F 1VQNS 4WFZA 2IC3A 1VBKA 2DXFA 1SUQA 3HF5A 1BWVA 2L9WA 3ZO7A 2JC1A 2VG7A 4HL9A 4F7VA 4TU7A
chains in the Genus database with same CATH topology
2K3KA 3QIPB 4KC5A 2J6SA 2FB0A 3OFFA 3QYYA 2Q66A 1SB6A 3OLBA 2WSCC 2B4VA 3E51A 1NJWA 3NGKA 2GO8A 3TA1A 2KYXA 1HWUA 2CPHA 2GGPA 5J2NA 2OMOA 1ZM4A 5KFXA 1T3OA 2E66A 3DRRB 3H2VE 4ZP9A 5LJ5Y 2OMLA 5B09A 1DLOA 4QWAA 3KMSA 1HHSA 3MM7A 1LXJA 2QIFA 3LQVA 2DH7A 1RTDB 4FBUA 2KXNB 2JZ5A 1U1RA 2LKZA 4MK8A 2O01C 3Q8PB 3T1HF 2DHXA 5DS7A 4RW9A 1TZ0A 4Q2MA 4NWBA 1W2IA 3EPGA 3OHAA 4EFAC 3LOUA 2LMIA 2BJDA 2GW8A 1O5JA 2LCWA 5DQGA 1C2PA 4B02A 2JJ4D 3T5KA 1NB7A 4PWDA 4URGA 1BLUA 3DLGB 1RYSA 4K5RA 2HW3A 1UAWA 3V6DA 1KVIA 5KT7A 3ZZYA 1VRUB 4KRWA 2JH3A 3ENWA 3OL6A 4HTJA 3G8TA 2MDAA 5HBMB 5DDOC 1QUVA 3GILA 5D8HB 2GQ2A 2GJ2A 1QE1A 4HDHA 2COLA 4RW8A 3SCLE 2DR5A 2NPIA 1RAJA 5KFFA 4ED6A 2KT3A 4LVOP 3KLGA 2RRBA 3VAKA 5KFIA 2L3MA 1ZTTA 2GCFA 1N5QA 2OPPB 3MZIA 4GC7A 1TKXA 1O0PA 4Q7AA 4IR9A 3V4IA 4I69A 3R5AA 3NMRA 5KT3A 1S6OA 1Z2LA 1NK7A 1RTDA 3GSDA 2CKWA 1RP5A 2AGOA 1FF2A 1KTVA 3AA8A 4NLGA 3S01A 1S4FA 3MOJB 3TW0A 4ES3A 2CQDA 2MJUA 1HNIA 1HW9A 3O8WA 1TL4A 4CTAA 3CCES 2BACA 3M2VB 4C2MA 1JJ2R 3UCGA 4WKRA 4IH6A 4M1KA 2VBYA 4UW2A 1D8YA 3J80Y 1NO8A 3CC7S 3NNHA 4OHWA 2MQPA 3S7RA 1YJUA 2B6AB 2V8HA 4ZPCA 2RD5C 4TLRA 2D7SA 5DG9A 3N6LA 1KSPA 1DFDA 2M9KA 2DNKA 3VALA 2OSRA 3NCQA 1HNZF 5H9FJ 2GHPA 3CDEA 1C4CA 4J37A 1C0UB 4MIAA 1WD6A 3SFGA 4XPEA 3EPIA 2BW2A 2VG6B 5D3GA 2B9WA 4IFVA 5KAKA 2R7RA 3IAS9 3BM7A 1SQEA 2W7PA 4C8MA 2DGSA 4PG6A 1SV5B 1TL5A 4E98A 4IH7A 2Y1JA 1C0TB 4XO0A 3H59A 3BDEA 1SC6A 2OTLS 2MMYA 5CCLA 5GAEU 3MM9B 1WI8A 1U47A 2MQLA 1K1QA 1FDAA 3HKWA 4A48A 4HLBA 2Q1LA 4NYOA 3L7OA 1V6HA 4XDDA 1HA1A 4QWEA 1HD0A 3CD7A 2ZOMA 1UA0A 2LU2A 4K4YA 4YB1P 4ILLA 1N5SA 4C97A 4DN9A 4IG0B 3DOLB 4MFBB 4IOBA 4EZ9A 2CQBA 3K8VA 1ZOTA 4EO6A 3FSIA 1U8SA 4CO4A 5KG1A 3BR9A 5BJRA 3NNCA 2D9PA 2DNGA 4KIAA 4UUWA 3CIMA 2HGMA 3PW5A 2LDIA 4NOHA 4EU0A 4CCHA 1R43A 2XEXA 3DMJA 3J81Y 1TKTA 4N8NA 2K3IA 1MSWD 1FK9A 2POKA 3M9MB 2GMJA 2ZE2A 3I31A 3G8SA 4GC6A 4NX9A 3TX8A 1OO0B 2PA3A 2VOOA 4J9KA 4KT0C 3F44A 4TY9A 3RU0A 1FD2A 3UR3C 4QYZJ 1VRTB 1TAUA 2B6AA 1JLAB 2AYEA 3AA9A 2DVIA 1N54B 2DNZA 5J1NA 2CJQA 4NLOA 5J2PB 3ITHB 2XO7A 3C8YA 4MYUA 5I3PA 2ZBCA 3G6YA 4JI1F 3MEDA 1FO1A 1HQEA 1U6ZA 4A46A 3KWMA 3AB2B 3H4BA 1U45A 1FESA 5HP1A 2YVSA 5F8IA 1S76D 1ZAXA 2XS2A 1JXEA 1Y3JA 4KFBA 2MQQA 3PVXA 1N5VA 1N0UA 5D4PA 4N56A 2R9LA 1BY9A 1C1BB 1ZM2A 1EETA 5KFHA 4N47A 3UWTA 3WZ0A 3KLEA 1H3DA 2ASDA 2GMLA 5E33A 2RQ4A 2CFXA 4DV6F 4DQIA 3CDWA 3LF0A 2D3OR 1FCAA 4BS2A 1RT5B 5K8PA 1WF1A 5EUHA 1Z2ZA 1B7FA 3MUTP 4B3OA 2EKYA 5KFGA 4M8LA 3QIDA 4I2PB 1S1VB 3N5BA 1HYSA 1C1CB 2C42A 2I8EA 1XBWA 1EP4B 2FJAB 4ZMMA 1LFWA 1WI6A 1RKIA 2QMWA 5C42B 1I1GA 5GAGI 4QW9A 1D3WA 4AL7A 1U7LA 3K5MA 4WZMA 3KLFA 4C8KA 2DNMA 4B3SF 1S1XB 4NA2A 4ECWA 3M2VA 1JIHA 3IS9B 1JMTA 4M63A 3K5LA 1XR6A 4ECUA 2E5HA 2N3LA 4RBVA 2IRUA 3T5JA 4NLRA 5AXLA 3M8PA 5C25B 2W4PA 5F3TA 3MUVP 2YH1A 4O4GA 4JI7F 1X4EA 5DDRC 3MMJA 3JSMB 2NLWA 2I9SA 4HKQA 4Q5VA 2BM1A 2WTFA 2P6TA 1P6TA 3VAHA 2FC9A 1UP1A 3FMBA 4F2SA 4IRDA 5HI7A 3MEGA 2YY3A 2OH2A 4PUOA 2IA6A 2AP6A 2XWYA 3HDSA 3I0SB 2IM3A 2W9BB 5F8LA 4F25A 3FFIA 2D41A 1Y0HA 3DRRA 3CCSS 2IVYA 4WF9Q 2HNZB 4RNMA 2E44A 1GQEA 4LF6F 2BANA 1NJYA 2CQHA 2QSFA 5LT5A 1Q78A 5GADU 4QR1A 4Q44A 2RDJA 2CJBA 3FJ2A 2DO0A 2K1RA 3KHLA 4C0BA 3K0JA 4XDCA 3PACA 4J9NA 2JEGA 2OTJS 4NLSA 4J9QA 4YB6A 3B78A 1DZ5A 5KG2A 4NLTA 5D4LA 4K4ZA 2MY8A 4G1QA 3OXLA 4DFKA 3MF5A 1VK3A 3MMCB 4U7CA 1NK0A 3AAWB 3M8SA 3HVRA 4DR3F 1OSDA 2J9DE 3R27A 1VJWA 3TUIC 4LMZA 3BZQA 2AYBA 1N4LA 4LQ9A 2V2KA 1VQKS 2UUAF 2L41A 3DDNA 2XY6A 4FF3A 5KG6A 3IS9A 1R0AB 2DHGA 1K0TA 5C24A 4J9PA 2V4QA 3WBZA 2R7VA 4YB5A 2PFFB 2L48A 1FKOA 2QMXA 1S6QB 3H2UB 4X62F 2W9CB 3CF5Q 3PO5A 1L3UA 3CJ3A 1IBLF 2L9NA 1LWEA 4CH1A 2XLJA 2GA7A 3DHWC 1VBZA 4B17A 2VB6A 4TXSA 4YR0A 4TQRA 2M3DA 1UMJA 4QU7A 1TR0A 5I42A 4ZPDA 1TVRA 1UWBA 4O4RA 1FRIA 2KM8C 2RF2A 3KG4A 2V94A 3FZBA 4PUOB 2XMWA 3KNGA 2PT0A 2NREA 1E6VB 4UUXA 5A8RB 3PKMA 1U1MA 2OPPA 4K59A 1M5PC 1S1UA 1XTZA 1QAIA 3MM6A 2FY1A 3E01A 1N0VC 2DIUA 1JX4A 4ZP7A 2ROEA 4QOTA 4Y2KA 1TL3B 1FHTA 1OIAA 3M6XA 2KH9A 1R7IA 3M9NB 1OPIA 1GXUA 1S1UB 2WK4A 3SDEB 4DL3A 4QBUA 3HLUA 2KVIA 4IQMA 4BWMA 5EWFA 1ZPVA 4ED2A 4ZK7M 5E7OB 5HN0A 3KLHB 1H7XA 2LQ9A 1CSJA 4JI3F 1DTTB 3E8OA 2KN4A 5ITHA 2ASYA 1N5TA 5H9EJ 4I2PA 1PSDA 4JI5F 2R4FA 3HHKA 4BC9A 2ASJA 4A8WA 2BM0A 1RTHA 2RRAA 1KOOA 5E3PA 1IKYA 2F4VF 2DGOA 4IDKA 2PMHA 4RWWA 1LW0A 4BBYA 3Q8RB 4ELTA 4KSEB 2AJQA 1HARA 3CB4A 1NK6A 3H2LA 2DISA 3K5NA 4V19J 3HHDA 5J1EB 5CYQA 3JTOA 4LJMA 1HR0F 1VMBA 1S6PA 1YSJA 2M88A 2JEFA 5A8WB 1RTHB 3PX4A 2QLXA 1FNXH 3H5YA 1MWZA 2HVHA 1KQKA 2VC0A 5J2NB 3W2WA 2O5DA 2HNYA 3AJ1A 2BR0A 2Z2LA 2YKQA 1D9FA 3I0SA 2W9BA 4IFYB 3OTBA 1H2TZ 5I3UA 2YKMA 1X8DA 3LWLA 1U26A 2E5IA 3BREA 2XMMA 3E01B 5IT0A 3NRBA 1BQNB 5LXYA 1NZAA 3VQSA 4KO0A 2LYVA 5F41A 1O8BA 1KLMA 4IH5A 1M1KT 4CO5A 2HG4A 2QA2A 2FUG9 5I4MA 3DYAB 4F4KA 4R0EA 1DQ9A 1VQ8S 3DRPA 4HTIA 2W8KA 3EGNA 2D1CA 1TKTB 5M2RA 3ZZRA 5AE2A 4C9DA 4HEA9 4JI0F 4CTAB 5HMZA 2EVZA 3T1AA 3QLHB 4JI2F 3HPOA 2XSJA 4OJ1A 2RKIB 4KPYA 3MEDB 2QRRA 2LQBA 1XC9A 1U2RA 5JXSA 3HZEA 4FNIA 2I38A 3UNGC 4EBDA 2HQIA 3DLKA 4K4WA 2C2RA 1SJ4P 5A2QY 4Q8EA 2V8GA 1KN6A 3K58A 3CJ5A 1TKXB 3KG0A 1HD1A 2MY7A 1IKWB 2RSQA 2LA4A 1AW0A 4QJVA 5KOWA 3QAUA 3M30A 5ADZA 5IXUA 1LV5A 3WC0A 4ED7A 4OHYA 1FJGF 1S7HA 3AQOA 2HWTA 2HRUA 2IRYA 4EYIB 1FVQA 1UVKA 2FGOA 3BGLA 3IWNC 1FXRA 4OLPA 4KO0B 1HYSB 1S79A 1RT1B 3CXCR 4NCBA 5JVHQ 2NXUA 5I3UB 3MXHP 2FJDB 1TKZB 4AFFA 3K59A 3MD1A 3WX4A 4WIIA 2OIHA 2MZRA 4DS5A 5SZTA 3PX0A 3LAMA 1T3NA 1S0NA 2DR8A 1CQNA 2UU9F 2EK6A 3GG0A 3KHRA 4DS4A 4OX8A 4OI2A 2AYMA 4YR3A 1R8CA 4QR0A 1UETA 5KFBA 2IM0A 1BC6A 4I64A 3H4DA 5B0AA 4GO7X 3MGJA 3S8SA 3RTVA 4X4VA 2CPDA 2R2SA 1RISA 5D78A 1DRZA 3QLHA 1MNEA 4NLUA 1VIOA 2KFNA 1WEZA 3GYNA 4KAIA 4LFCF 3HX9A 1T7PA 4MH8A 2R7TA 4O3PA 1T05A 2AGPA 2IYIA 2A3JA 1SJ3P 1DTTA 1L3KA 4Z2XA 2MYFA 2FLOA 4DR2F 3AHPA 3MMAB 4XK8C 2DPIA 2ZKTA 1GX5A 3B8HA 3Q22A 3M32B 1FDDA 1Q4RA 1YVFA 1Y4ZB 4Y3CA 3PZPA 1N36F 2FVCA 2YWEA 4H4MB 1EP4A 2DIVA 5HBMA 5CZXA 1APSA 2G0CA 1HBUA 1D0EA 1URNA 2HHQA 2B4PA 3BQ1A 3U1NA 2GC8A 3O2IA 1S10A 1NH8A 2YTCA 4ERDA 2IM1A 2K8GA 2IFXA 4JV0A 2XCPA 2J6TA 3MURP 2OPRA 4HI1A 1NHUA 4J9SA 4DL4A 4DL5A 1R8HA 4CQ1A 1N6QA 2VQFF 3P49B 2QO3A 3CDBA 4ZPWR 3CCRS 1E6YA 2LXUA 3ENQA 1H2VZ 3GE9A 3N6MA 4I2QA 3LAKA 2N82B 3BF4A 5KFRA 4G3IA 3FMWA 3G8QA 1VQPS 2YNIA 3TI0A 2Q43A 2B0GA 2DT9A 3U7JA 3I9ZA 1O51A 4GKKF 2FHOB 2M7SA 2HMIA 5AXKA 4I6WA 1F60B 1LWCA 2RDIA 4Y34A 1Y9OA 4I0WA 3IN5A 4J5OA 1S1XA 2KZZA 3KHHA 1REVB 4BHQA 4N41A 3FEZA 1L3TA 2DGXA 1FE0A 4PG7A 5K14A 2QZ8A 4NLWA 5E41A 1RT7A 3IGNA 2HFZA 4X4NA 3HHLC 4WU3A 2C28A 1Y00A 1M0SA 4DF8A 2C2DA 3Q8QB 1IJEB 2WONB 1WEXA 4OZ5A 3PEHA 4DQRA 2IHR1 1MW7A 2JVOA 3MM6B 2W7OA 1YHQS 3H20A 3EX7B 3QJLA 3TA2A 2QEXS 2VG5A 2WHOA 3GIMA 4CH0S 1IQTA 5IWAF 2DNHA 1E6VA 5A8RA 1S1TB 4I4BA 3TAMA 3BQ0A 3OHBA 1Q82T 1YRXA 2X51A 4WCEQ 3MM7B 3SEOA 2JLFA 2OPSA 4C8LA 3MR5A 2K7JA 1XR5A 4E8UA 5DQHA 1CVJA 1XK8A 2PC6A 5BYSA 1YITS 4I2QB 2C3YA 5DGBA 2R2UA 1S0VA 3DM2A 2XSFA 4DBQA 1VQ9S 1HQUA 1TK5A 2KRRA 4OMFG 1MWYA 1VQ7S 2ZH3A 3OPKA 3I6PA 5KFEA 5AE3A 3V6DB 3H98A 2YH0A 1XR7A 2VPXB 3LP0A 2G1DA 3PKYA 2W4DA 2XZWA 1G2EA 3TR5A 2BQRA 5DJBA 2XMKA 5E3QA 4KJIA 4PXDA 3F41A 4ALZA 4B9VA 2ADBA 4RU2A 1HWJA 2CVEA 2KRBA 1RT6B 4JOUA 4RX6A 4B9TA 4KQZA 4Q43A 1V3SA 2ZH2A 2ZJRQ 5HLFA 4FXDA 1AXQA 3DNCA 1HPZB 3KG1A 4ED3A 1KC8T 1VQLS 4I67A 4DSKA 4ID5B 4IYQA 4PCQA 3K8WA 3H8YA 4O3QA 2M8DB 1HQEB 4QIVA 5T41A 4MN4C 1HBMB 3F56A 5J2QB 1DTQA 2NUUG 4NA1A 2VFVA 4YMEA 1GX6A 2EBEA 1Y5IB 1HPZA 4A8FA 4LF9F 1DQ8A 2XBPA 1YBAA 4RLEA 1QAJA 3GQCA 4PQUB 1FEHA 4FP9A 4USIA 3W2VA 3OJUA 4DR7F 1A9NB 4CO2A 3CGIA 2DCUB 4DSJA 2YWFA 2F8MA 2LXIA 2HHUA 3D54A 4ILRA 3VF0B 2B9XA 2HGLA 4M94A 2E9ZA 5D4NA 1XMBA 3UPFA 1RI7A 2MHEA 1PC4A 3O5TB 4MKBA 2A10A 1JB0C 1MU2A 1D8ZA 2W9AA 4F8RA 2E29A 3MECA 2HHSA 3QJJA 3DI6B 3W3SA 1FXDA 4OHVA 1B64A 2AJFE 1U1OA 2RIJA 4AQYF 5T7LB 3QGGA 2KO1A 1V3ZA 2YNHA 3VCDA 4KFBB 2VG7B 1QAXA 2M4MA 3TANA 1FKPB 4IUFA 4EGLA 5M2UA 1HWLA 5BYRA 5SUHA 3PIOQ 4DR5F 5KFZA 1SJFA 3LO3A 4DFPA 3IBPA 2YQ3A 4YHHF 1X9MA 2MKJA 2N4DA 3CCUS 1Q8BA 3I4HX 3CC4S 3BGFA 3M6UA 3K7RA 1SKSA 5LSLA 1IR0A 1YTYA 2V5HG 1YJVA 1HNVB 2DITA 2BXJA 3ZZUA 3D1HA 2V4JA 1MMDA 2MQNA 4I56A 3MAHA 3RW6A 4I7FA 2R8JA 1PO6A 4QW8A 2RT3A 5CYQB 3POTA 2ILZA 2XNQA 1Q16B 1TV6A 3CTRA 5B0FA 2R2TA 3SSRA 2KHDA 4ETZA 1G6BA 3OR2A 1N52B 1SH0A 3DDKA 4YB7A 4DL7A 3KYLA 3FNNA 4EO8A 4WFBQ 1BQMA 4FBTA 2EFGA 3NBPB 5LXRA 3DLJA 4RNHA 1R8BA 4Y2IA 5U47A 2ZD1B 1VQ6S 4LQ3A 2PA8D 1ZTWA 5J2PA 1ZBTA 2CZ4A 3A8EA 4KV8B 1VRTA 3GG1A 1LWFA 2G13A 4O0IA 3IR5B 1GT8A 3C6TA 3M1VB 5D6GA 3KLGB 1XWLA 2LLZA 1G3OA 2DHAA 2CRLA 4DG1A 5EX0A 5LMNF 2YNFB 4RW8B 2XC9A 3S1TA 5C5JA 2MSSA 1NKCA 2FLLA 2Q3PA 3NG8A 2YNGB 2KU7A 1LWFB