1GXZA

Crystal structure of the eukaryotic mono-adp-ribosyltransferase art2.2; crystal form b (p212121)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Structure of the Ecto-Adp-Ribosyl Transferase Art2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 75
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2002-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gxzA00
3BUZA 4H0VA 5D1SA 3U0JA 1GY0A 1R4BA 4FXQA 2A78B 2GWLA 4FK7A 2C8CA 4WF6A 5D1UA 4FMLA 2WN6A 1YQYA 1J7NA 2WN5A 5GTTA 2WN8A 4GY2A 1PWUA 2GWMA 2A9KB 2J3ZA 4PKSA 5DZQA 4XM8A 1OG4A 1GXZA 1OG3A 1GIQA 4XM7A 4XSHB 3BW8A 2C8HA 5H03A 4DV8A 2WN7A 4ELNA 2C8DA 4XM6A 1GIRA 5D1TA 1OJQA 4H0YA 4PKUA 2C8BX 4H0XA 5H04A 1PWQA 1PWPA 4GF1A 3NTSA 4H03A 2C8GA 1G24A 2J3VA 2BOVB 1PWWA 1PWVA 4PKWA 2WN4A 1OG1A 4PKQA 2C8AA 1QS1A 1UZIA 4PKTA 1JKYA 4PKRA 1R45A 1GZEA 4XSGB 1OJZA 2C89A 2C8FE 4PKVA 5BWMB 1GXYA 1QS2A 4TR5A 1ZXVA 2C8EE 2J3XA 4H0TA 1GZFA
chains in the Genus database with same CATH superfamily
3BUZA 4H0VA 5D1SA 3U0JA 1GY0A 1R4BA 4FXQA 2A78B 2GWLA 4FK7A 2C8CA 4WF6A 5D1UA 4FMLA 2WN6A 1YQYA 1J7NA 2WN5A 5GTTA 2WN8A 4GY2A 1PWUA 2GWMA 2A9KB 2J3ZA 4PKSA 5DZQA 4XM8A 1OG4A 1GXZA 1OG3A 1GIQA 4XM7A 4XSHB 3BW8A 2C8HA 5H03A 4DV8A 2WN7A 4ELNA 2C8DA 4XM6A 1GIRA 5D1TA 1OJQA 4H0YA 4PKUA 2C8BX 4H0XA 5H04A 1PWQA 1PWPA 4GF1A 3NTSA 4H03A 2C8GA 1G24A 2J3VA 2BOVB 1PWWA 1PWVA 4PKWA 2WN4A 1OG1A 4PKQA 2C8AA 1QS1A 1UZIA 4PKTA 1JKYA 4PKRA 1R45A 1GZEA 4XSGB 1OJZA 2C89A 2C8FE 4PKVA 5BWMB 1GXYA 1QS2A 4TR5A 1ZXVA 2C8EE 2J3XA 4H0TA 1GZFA
chains in the Genus database with same CATH topology
3BUZA 4H0VA 5D1SA 3U0JA 1GY0A 1R4BA 4FXQA 2A78B 2GWLA 4FK7A 2C8CA 4WF6A 5D1UA 4FMLA 2WN6A 1YQYA 1J7NA 2WN5A 5GTTA 2WN8A 4GY2A 1PWUA 2GWMA 2A9KB 2J3ZA 4PKSA 5DZQA 4XM8A 1OG4A 1GXZA 1OG3A 1GIQA 4XM7A 4XSHB 3BW8A 2C8HA 5H03A 4DV8A 2WN7A 4ELNA 2C8DA 4XM6A 1GIRA 5D1TA 1OJQA 4H0YA 4PKUA 2C8BX 4H0XA 5H04A 1PWQA 1PWPA 4GF1A 3NTSA 4H03A 2C8GA 1G24A 2J3VA 2BOVB 1PWWA 1PWVA 4PKWA 2WN4A 1OG1A 4PKQA 2C8AA 1QS1A 1UZIA 4PKTA 1JKYA 4PKRA 1R45A 1GZEA 4XSGB 1OJZA 2C89A 2C8FE 4PKVA 5BWMB 1GXYA 1QS2A 4TR5A 1ZXVA 2C8EE 2J3XA 4H0TA 1GZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUZ A;  4H0V A;  5D1S A;  3U0J A;  1GY0 A;  1R4B A;  4FXQ A;  2A78 B;  2GWL A;  4FK7 A;  2C8C A;  4WF6 A;  5D1U A;  4FML A;  2WN6 A;  1YQY A;  1J7N A;  2WN5 A;  5GTT A;  2WN8 A;  4GY2 A;  1PWU A;  2GWM A;  2A9K B;  2J3Z A;  4PKS A;  5DZQ A;  4XM8 A;  1OG4 A;  1GXZ A;  1OG3 A;  1GIQ A;  4XM7 A;  4XSH B;  3BW8 A;  2C8H A;  5H03 A;  4DV8 A;  2WN7 A;  4ELN A;  2C8D A;  4XM6 A;  1GIR A;  5D1T A;  1OJQ A;  4H0Y A;  4PKU A;  2C8B X;  4H0X A;  5H04 A;  1PWQ A;  1PWP A;  4GF1 A;  3NTS A;  4H03 A;  2C8G A;  1G24 A;  2J3V A;  2BOV B;  1PWW A;  1PWV A;  4PKW A;  2WN4 A;  1OG1 A;  4PKQ A;  2C8A A;  1QS1 A;  1UZI A;  4PKT A;  1JKY A;  4PKR A;  1R45 A;  1GZE A;  4XSG B;  1OJZ A;  2C89 A;  2C8F E;  4PKV A;  5BWM B;  1GXY A;  1QS2 A;  4TR5 A;  1ZXV A;  2C8E E;  2J3X A;  4H0T A;  1GZF A; 
#chains in the Genus database with same CATH topology
 3BUZ A;  4H0V A;  5D1S A;  3U0J A;  1GY0 A;  1R4B A;  4FXQ A;  2A78 B;  2GWL A;  4FK7 A;  2C8C A;  4WF6 A;  5D1U A;  4FML A;  2WN6 A;  1YQY A;  1J7N A;  2WN5 A;  5GTT A;  2WN8 A;  4GY2 A;  1PWU A;  2GWM A;  2A9K B;  2J3Z A;  4PKS A;  5DZQ A;  4XM8 A;  1OG4 A;  1GXZ A;  1OG3 A;  1GIQ A;  4XM7 A;  4XSH B;  3BW8 A;  2C8H A;  5H03 A;  4DV8 A;  2WN7 A;  4ELN A;  2C8D A;  4XM6 A;  1GIR A;  5D1T A;  1OJQ A;  4H0Y A;  4PKU A;  2C8B X;  4H0X A;  5H04 A;  1PWQ A;  1PWP A;  4GF1 A;  3NTS A;  4H03 A;  2C8G A;  1G24 A;  2J3V A;  2BOV B;  1PWW A;  1PWV A;  4PKW A;  2WN4 A;  1OG1 A;  4PKQ A;  2C8A A;  1QS1 A;  1UZI A;  4PKT A;  1JKY A;  4PKR A;  1R45 A;  1GZE A;  4XSG B;  1OJZ A;  2C89 A;  2C8F E;  4PKV A;  5BWM B;  1GXY A;  1QS2 A;  4TR5 A;  1ZXV A;  2C8E E;  2J3X A;  4H0T A;  1GZF A; 
#chains in the Genus database with same CATH homology
 3BUZ A;  4H0V A;  5D1S A;  3U0J A;  1GY0 A;  1R4B A;  4FXQ A;  2A78 B;  2GWL A;  4FK7 A;  2C8C A;  4WF6 A;  5D1U A;  4FML A;  2WN6 A;  1YQY A;  1J7N A;  2WN5 A;  5GTT A;  2WN8 A;  4GY2 A;  1PWU A;  2GWM A;  2A9K B;  2J3Z A;  4PKS A;  5DZQ A;  4XM8 A;  1OG4 A;  1GXZ A;  1OG3 A;  1GIQ A;  4XM7 A;  4XSH B;  3BW8 A;  2C8H A;  5H03 A;  4DV8 A;  2WN7 A;  4ELN A;  2C8D A;  4XM6 A;  1GIR A;  5D1T A;  1OJQ A;  4H0Y A;  4PKU A;  2C8B X;  4H0X A;  5H04 A;  1PWQ A;  1PWP A;  4GF1 A;  3NTS A;  4H03 A;  2C8G A;  1G24 A;  2J3V A;  2BOV B;  1PWW A;  1PWV A;  4PKW A;  2WN4 A;  1OG1 A;  4PKQ A;  2C8A A;  1QS1 A;  1UZI A;  4PKT A;  1JKY A;  4PKR A;  1R45 A;  1GZE A;  4XSG B;  1OJZ A;  2C89 A;  2C8F E;  4PKV A;  5BWM B;  1GXY A;  1QS2 A;  4TR5 A;  1ZXV A;  2C8E E;  2J3X A;  4H0T A;  1GZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...