1GY0A

Crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2; crystal form c (p3121)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
223
structure length
223
Chain Sequence
PLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL ECTO-ADP-RIBOSYLTRANSFERASE 2
publication title Structure of the Ecto-Adp-Ribosyl Transferase Art2.2 From Rat
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 69
structure length 223
sequence length 223
ec nomenclature ec 2.4.2.31: NAD(+)--protein-arginine ADP-ribosyltransferase.
pdb deposition date 2002-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01129 ART NAD:arginine ADP-ribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 1gy0A00
2C8EE 4H0XA 1R45A 2WN7A 4XM6A 5H03A 1PWVA 1ZXVA 5D1UA 1GY0A 4PKSA 3BUZA 2BOVB 4FXQA 5BWMB 2WN6A 2C8GA 1OG3A 4XM8A 2WN5A 5GTTA 2WN4A 2C8AA 4TR5A 3U0JA 4FK7A 2A78B 2C8CA 1G24A 3BW8A 4H0VA 1QS2A 4PKUA 1PWPA 4ELNA 5DZQA 4XM7A 4GF1A 1UZIA 1OG4A 1OG1A 1GZFA 1YQYA 1GIRA 4H0YA 4H0TA 2J3ZA 4XSGB 1OJQA 4WF6A 4GY2A 1OJZA 4PKTA 5D1TA 4FMLA 1GXYA 4PKQA 2GWLA 2C89A 2J3XA 1R4BA 4PKRA 1GXZA 2WN8A 3NTSA 1PWUA 4PKVA 2C8FE 1GZEA 5H04A 1QS1A 1PWQA 1J7NA 2GWMA 2C8BX 4DV8A 2C8HA 4H03A 1GIQA 1PWWA 2J3VA 1JKYA 2A9KB 4PKWA 5D1SA 4XSHB 2C8DA
chains in the Genus database with same CATH superfamily
2C8EE 4H0XA 1R45A 2WN7A 4XM6A 5H03A 1PWVA 1ZXVA 5D1UA 1GY0A 4PKSA 3BUZA 2BOVB 4FXQA 5BWMB 2WN6A 2C8GA 1OG3A 4XM8A 2WN5A 5GTTA 2WN4A 2C8AA 4TR5A 3U0JA 4FK7A 2A78B 2C8CA 1G24A 3BW8A 4H0VA 1QS2A 4PKUA 1PWPA 4ELNA 5DZQA 4XM7A 4GF1A 1UZIA 1OG4A 1OG1A 1GZFA 1YQYA 1GIRA 4H0YA 4H0TA 2J3ZA 4XSGB 1OJQA 4WF6A 4GY2A 1OJZA 4PKTA 5D1TA 4FMLA 1GXYA 4PKQA 2GWLA 2C89A 2J3XA 1R4BA 4PKRA 1GXZA 2WN8A 3NTSA 1PWUA 4PKVA 2C8FE 1GZEA 5H04A 1QS1A 1PWQA 1J7NA 2GWMA 2C8BX 4DV8A 2C8HA 4H03A 1GIQA 1PWWA 2J3VA 1JKYA 2A9KB 4PKWA 5D1SA 4XSHB 2C8DA
chains in the Genus database with same CATH topology
2C8EE 4H0XA 1R45A 2WN7A 4XM6A 5H03A 1PWVA 1ZXVA 5D1UA 1GY0A 4PKSA 3BUZA 2BOVB 4FXQA 5BWMB 2WN6A 2C8GA 1OG3A 4XM8A 2WN5A 5GTTA 2WN4A 2C8AA 4TR5A 3U0JA 4FK7A 2A78B 2C8CA 1G24A 3BW8A 4H0VA 1QS2A 4PKUA 1PWPA 4ELNA 5DZQA 4XM7A 4GF1A 1UZIA 1OG4A 1OG1A 1GZFA 1YQYA 1GIRA 4H0YA 4H0TA 2J3ZA 4XSGB 1OJQA 4WF6A 4GY2A 1OJZA 4PKTA 5D1TA 4FMLA 1GXYA 4PKQA 2GWLA 2C89A 2J3XA 1R4BA 4PKRA 1GXZA 2WN8A 3NTSA 1PWUA 4PKVA 2C8FE 1GZEA 5H04A 1QS1A 1PWQA 1J7NA 2GWMA 2C8BX 4DV8A 2C8HA 4H03A 1GIQA 1PWWA 2J3VA 1JKYA 2A9KB 4PKWA 5D1SA 4XSHB 2C8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8E E;  4H0X A;  1R45 A;  2WN7 A;  4XM6 A;  5H03 A;  1PWV A;  1ZXV A;  5D1U A;  1GY0 A;  4PKS A;  3BUZ A;  2BOV B;  4FXQ A;  5BWM B;  2WN6 A;  2C8G A;  1OG3 A;  4XM8 A;  2WN5 A;  5GTT A;  2WN4 A;  2C8A A;  4TR5 A;  3U0J A;  4FK7 A;  2A78 B;  2C8C A;  1G24 A;  3BW8 A;  4H0V A;  1QS2 A;  4PKU A;  1PWP A;  4ELN A;  5DZQ A;  4XM7 A;  4GF1 A;  1UZI A;  1OG4 A;  1OG1 A;  1GZF A;  1YQY A;  1GIR A;  4H0Y A;  4H0T A;  2J3Z A;  4XSG B;  1OJQ A;  4WF6 A;  4GY2 A;  1OJZ A;  4PKT A;  5D1T A;  4FML A;  1GXY A;  4PKQ A;  2GWL A;  2C89 A;  2J3X A;  1R4B A;  4PKR A;  1GXZ A;  2WN8 A;  3NTS A;  1PWU A;  4PKV A;  2C8F E;  1GZE A;  5H04 A;  1QS1 A;  1PWQ A;  1J7N A;  2GWM A;  2C8B X;  4DV8 A;  2C8H A;  4H03 A;  1GIQ A;  1PWW A;  2J3V A;  1JKY A;  2A9K B;  4PKW A;  5D1S A;  4XSH B;  2C8D A; 
#chains in the Genus database with same CATH topology
 2C8E E;  4H0X A;  1R45 A;  2WN7 A;  4XM6 A;  5H03 A;  1PWV A;  1ZXV A;  5D1U A;  1GY0 A;  4PKS A;  3BUZ A;  2BOV B;  4FXQ A;  5BWM B;  2WN6 A;  2C8G A;  1OG3 A;  4XM8 A;  2WN5 A;  5GTT A;  2WN4 A;  2C8A A;  4TR5 A;  3U0J A;  4FK7 A;  2A78 B;  2C8C A;  1G24 A;  3BW8 A;  4H0V A;  1QS2 A;  4PKU A;  1PWP A;  4ELN A;  5DZQ A;  4XM7 A;  4GF1 A;  1UZI A;  1OG4 A;  1OG1 A;  1GZF A;  1YQY A;  1GIR A;  4H0Y A;  4H0T A;  2J3Z A;  4XSG B;  1OJQ A;  4WF6 A;  4GY2 A;  1OJZ A;  4PKT A;  5D1T A;  4FML A;  1GXY A;  4PKQ A;  2GWL A;  2C89 A;  2J3X A;  1R4B A;  4PKR A;  1GXZ A;  2WN8 A;  3NTS A;  1PWU A;  4PKV A;  2C8F E;  1GZE A;  5H04 A;  1QS1 A;  1PWQ A;  1J7N A;  2GWM A;  2C8B X;  4DV8 A;  2C8H A;  4H03 A;  1GIQ A;  1PWW A;  2J3V A;  1JKY A;  2A9K B;  4PKW A;  5D1S A;  4XSH B;  2C8D A; 
#chains in the Genus database with same CATH homology
 2C8E E;  4H0X A;  1R45 A;  2WN7 A;  4XM6 A;  5H03 A;  1PWV A;  1ZXV A;  5D1U A;  1GY0 A;  4PKS A;  3BUZ A;  2BOV B;  4FXQ A;  5BWM B;  2WN6 A;  2C8G A;  1OG3 A;  4XM8 A;  2WN5 A;  5GTT A;  2WN4 A;  2C8A A;  4TR5 A;  3U0J A;  4FK7 A;  2A78 B;  2C8C A;  1G24 A;  3BW8 A;  4H0V A;  1QS2 A;  4PKU A;  1PWP A;  4ELN A;  5DZQ A;  4XM7 A;  4GF1 A;  1UZI A;  1OG4 A;  1OG1 A;  1GZF A;  1YQY A;  1GIR A;  4H0Y A;  4H0T A;  2J3Z A;  4XSG B;  1OJQ A;  4WF6 A;  4GY2 A;  1OJZ A;  4PKT A;  5D1T A;  4FML A;  1GXY A;  4PKQ A;  2GWL A;  2C89 A;  2J3X A;  1R4B A;  4PKR A;  1GXZ A;  2WN8 A;  3NTS A;  1PWU A;  4PKV A;  2C8F E;  1GZE A;  5H04 A;  1QS1 A;  1PWQ A;  1J7N A;  2GWM A;  2C8B X;  4DV8 A;  2C8H A;  4H03 A;  1GIQ A;  1PWW A;  2J3V A;  1JKY A;  2A9K B;  4PKW A;  5D1S A;  4XSH B;  2C8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...